2G2FA

A src-like inactive conformation in the abl tyrosine kinase domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
275
structure length
275
Chain Sequence
YDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAPAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Abl Kinase
publication title A SRC-like inactive conformation in the abl tyrosine kinase domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2g2fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2g2fA01
5BVWA 2A2AA 3RZBA 1H28A 2RG5A 4JBVA 4K11A 4FKPA 5JGAA 3DBDA 3ENHA 1YDTE 4JDKA 3OHTA 3WF5A 1APME 4F9WA 3FMEA 5HNBA 2BALA 4U42A 2ACXA 3BQCA 2BDJA 4QTAA 3D7ZA 4PL3A 2WQMA 4FVRA 4K1BA 1URCA 5HCZA 1X8BA 4B0GA 2KTYA 4NU1A 4U97A 4GS6A 3LIJA 1QL6A 3L9MA 4M0ZA 4ACCA 2WTKC 4WNMA 5EM6A 4D1SA 3UOHA 3CCNA 3JXWA 3QALE 4PNIA 4R8QA 5F94A 4BTFA 4D2WA 4B8LA 1W8CA 2OBJA 1M52A 3PVBA 5FEEA 1UNLA 3EB0A 1DAYA 4FSZA 3VNTA 3QHWA 3ZBXA 4Z55A 1YOLA 5J9ZA 2VRXA 1DI9A 5LARA 2X81A 4NW6A 5CAQA 4QD6A 3Q5IA 5L8KA 5ICPA 2Y4PA 4O0YA 4IX4A 4YNEA 5ACBC 4ZAUA 5L2TA 4GU6A 2ZMDA 4R5YA 3UPXA 4KRDA 2YIWA 4BDDA 2ETMA 2HOGA 3LMHA 3VBWA 3KN5A 4ZZMA 5M06A 3R8ZA 4A9SA 4PDSA 1YXTA 3DXNA 5CEIA 3R8LA 4WUNA 4FTLA 2PWLA 3OC1A 1MRUA 4JT3A 2XIZA 2YZAA 3DNDA 5BVEA 1ZMVA 1F3MC 3R2BA 3PJ2A 4YSMA 5HE2A 3EN6A 1P4FA 1TQIA 3PA4A 3QBNA 5JRQA 4X6RA 3IKAA 4H36A 5ACKA 2OICA 3EN4A 1Q3WA 4D2VA 5KX8A 4GJ2A 2HENA 3VS7A 5J9LA 4L44A 2VU3A 1WBNA 2QU6A 2Y6MA 2GFCA 3M2WA 4FV5A 4JQ7A 5HBHA 4USFA 3QKKA 3BV3A 4FT7A 4LV5A 4BCFA 3PE2A 4AA4A 4IFGA 1OL5A 3CY2A 1U46A 4NK9A 4XHKB 5A14A 5CAVA 5JFXA 1B38A 4TPTA 4OBPA 4L45A 3ANQA 2WU6A 4KINA 4H3PA 5DG5A 3LCSA 1ZZ2A 1ZOGA 3KEXA 1CTPE 2UVYA 3R04A 4RZWA 4CXAA 2JIUA 2BZJA 4RPVA 4P2KA 2XK3A 3VW8A 3MBLA 3VQUA 4IM3A 5DRDA 3LE6A 1ZARA 2YFXA 4PX6A 4R5SA 3WZUA 1LPUA 5K5XA 2WGJA 2J51A 3M11A 5DPVA 3GOKA 1PXLA 4E1ZA 2X9EA 2HZ4A 2IG7A 1Q97A 2PMIA 3MTFA 3TKHA 3VAPA 1FVRA 4CMOA 1WBVA 4DFBA 3W2PA 3UQGA 4O1PA 2C6TA 3FC2A 3OCGA 3WI6A 3LFQA 3ORTA 3FI4A 3PY3A 4LOQA 4PTEA 3KVWA 2FSOX 3E87A 4QQ5A 3WBLA 3EFJA 4EYJA 4DFUA 3U9CA 1Q24A 3O50A 3CLYA 3VQHA 2QI8A 2ZVAA 5HQ0A 2WTWA 2HYYA 5DT4A 1OIRA 4M15A 1JKKA 4ACMA 1OL2A 4TYGA 5J5SA 1V0PA 2FYSA 2BFYA 4IB5A 5FM2A 4I6QA 2QOFA 4G9CA 5CSXA 2XM8A 4L9IA 4YO6A 4GW8A 3TKIA 4FGRA 3QRTA 3Q5ZA 3R2YA 2JAMA 5JZJA 3MPAA 3MA6A 5AR7A 3C7QA 4I21A 4JQ8A 4DITA 4IVCA 1J1CA 3TZ8A 4CZUA 5IQHA 4QTEA 3UJGA 3DLZA 4JRNA 4U9AA 4EHEA 4AA5A 4FUXA 4DCEA 4QYEA 4GG5A 3KN6A 3WIGA 2IVSA 2OJ9A 4W8EA 4FSNA 3R8MA 4EWHA 2VTSA 2ERZE 4O7TA 4CG9A 2GMXA 3CKWA 3ET7A 2QU5A 4Z9LA 2CKOA 4KUJA 4X6QC 2O5KA 3FXXA 4G17A 4WOVA 3ZMMA 4CT1A 3PY0A 5M4IA 1BL7A 2W06A 2BIYA 2W9FB 5CASA 4BICA 4P5ZA 1FGKA 3DB6A 2F9GA 4LYNA 3UPZA 1GAGA 1PKDA 4DH7A 4O96A 5TO8A 2XNPA 4BF2A 4TYEA 3HAVA 3FLZA 3CGFA 4AZFA 3U4WA 2G2FA 2X6EA 3K2LA 4C59A 4F9CA 4YMJA 3H10A 4F1TA 4H1MA 2IN6A 4BHNA 3TNPC 3CJFA 5LVNA 4E4LA 2YM7A 3VBVA 3BGZA 5HNGA 1Y8GA 2UZVA 4Q9ZA 4BGGA 1T46A 4IM2A 2CKQA 4A9TA 3TNWA 3C13A 4RWKA 5AR4A 4BYIA 2ITZA 4V05A 2YCFA 3IDPA 4XLVA 2YZLA 4O0UA 1PRYA 3EQGA 3G90X 2QC6A 2UZLA 4U8ZA 3IDCA 3UOKA 4DEGA 2W4KA 3VRYA 3CXWA 4X3FC 3BBTB 3A7JA 3CR0A 5EKOA 4EOPA 3BHVA 1GIIA 4NKSA 4UWYA 5AV4A 1O6LA 4WA9A 4BR3A 1RW8A 3DK3A 5KKRB 1YWVA 1Q4LA 2I0EA 4FIHA 4OR5A 5DIAA 2J5EA 2QODA 4AACA 1UNHA 4JR7A 5AUXA 4C33A 3RM7A 3BYSA 1ZYJA 1ZZLA 2QURA 3V6RA 3A4PA 4MXOA 1K2PA 3K3JA 3M1SA 4O22A 5EOBA 3BHHA 1WBOA 2G2HA 3W2RA 4DH5A 4GKHA 5LMKC 1H27A 3GQIA 3C5UA 3LXPA 5CXHA 4HNFA 4EZ7A 4N6ZA 3W33A 5EYMA 3CJGA 4PDPA 4EJNA 3RZFA 5K5NA 3LKMA 4QP4A 2A1AB 4Z7GA 3IGOA 4D2PA 3V01A 2GTNA 4RIOA 4UZDA 1W98A 4X3FB 5CF5A 4QTCA 4A4XA 3VBXA 2B54A 3ZC5A 5EM7A 2W17A 3Q6WA 3FHIA 2X8DA 3UIXA 3GC8A 3KY2A 5AUUA 2CLXA 5BYLA 3AC1A 3R28A 5KMLA 2OZAB 4ENXA 2C0TA 3BU6A 5CEMA 5M4CA 3UC3A 4ANQA 1WVWA 3U51A 2CKEA 4GU9A 4OAUC 3OWKA 2UW0A 3FL5A 3DKFA 4HYSA 1ATPE 2OJIA 4M68A 4ZSAA 5CU3A 2WO6A 4PPBA 5IQIA 1R1WA 5EYCA 4QT1A 3D94A 1YXVA 3DY7A 3E62A 3CPCA 4J1RA 4JAIA 4L68A 4AUAA 1R0PA 3F7ZA 5FEDA 4XG9A 4FEXA 4J98A 3TV4A 2Y6OA 5IA0A 2W1EA 4ONAA 4NZWB 2PUPA 4MD9E 1HCKA 3ZO4A 2BPMA 2PVFA 4F1OA 1YI4A 3QA8A 4JIAA 3BRBA 4S2ZA 2NO3A 5E8ZA 3NYOA 5AR2A 2ITOA 1LUFA 4DC2A 4OUCA 2C68A 2V7AA 4DT9A 5ETFA 3REPA 4EONA 3ORMA 4O7VA 3F9NA 3HDMA 2XBAA 3OY3A 3OCSA 4C58A 1SVGA 2G1TA 4U40A 5AEPA 4XNEA 5LMBA 3CTJA 4ZEGA 4IAFA 3BQRA 4WNKA 4DGNA 5CQWA 3K54A 5IH5A 4LRMA 3EQFA 4IZ5A 4QTBA 3RJCA 3V51A 1ZYCA 3FY0A 3EQBA 4MXAA 2QHNA 3C4ZA 4C4HA 3HV4A 2YDIA 2OXXA 1VEBA 2C47A 4AT4A 4C3FA 3DCVA 1WMKA 3T9IA 4DEHA 4EH9A 5KBQA 3V04A 2C6OA 2GSFA 3PUPA 3VJOA 2ETRA 5C4LA 4QNAA 5TT7A 3LPBA 3Q04A 3RAWA 5BVDA 3FKNA 5B2KA 4RIWB 1V0BA 4MWHA 4OBQA 3WE4A 1SVHA 4B9DA 1W84A 2WXVA 3MVHA 5BYYA 4BDJA 3DTCA 4EK4A 3I1AA 5ETAA 3EOCA 3POZA 3VUMA 1JSVA 3FZTA 2C6LA 1WCCA 4G6NA 3ATTA 1YHVA 4AT3A 4FK6A 3KK9A 1OBDA 3BE2A 1FBNA 1Q5KA 3C0IA 3R1NA 4TZRA 3ZFXA 1IA9A 5IH4A 5AIKA 4DFLA 4ZY4A 4QP1A 2NP8A 4WG5A 3QUDA 4AS0A 4TYHB 3RMFA 1U54A 4I5HA 4UMQA 4P90A 4EL9A 1SMHA 2XB7A 3UYSA 2YWVA 4BDCA 3FI8A 4J8MA 2VWBA 4OT5A 3ORLA 3FLNC 5CF8A 2B55A 3Q4ZA 2PZ5A 3JPVA 3NRMA 4FX3A 5EW8A 3UYTA 3R21A 4OGRA 4EC8A 3QCSA 2XIKA 4DGMA 4DG2E 3H9RA 3GCQA 3HEGA 5IEXA 3NUNA 2PU8A 4IAAA 5I3RA 5BUJA 3GQLA 5F9EA 2EWAA 1PXOA 2BAJA 3FWQA 3BLHA 3G9LX 4YC3A 4JBOA 5CSPA 3CBLA 4RFZA 5HG9A 2V7OA 4YPSA 5KHXA 5LCKA 2B9JA 4R7BA 3ZH8A 3RP9A 1YKRA 3BI6A 1YHSA 4OW8A 4H39A 4BCGA 2HXQA 4TWNA 2E2BA 4YHFA 5HKMA 2R3GA 3AC3A 1J7LA 1A9UA 4I94A 3VO3A 4BCPA 5C27A 1J3HA 3TKUA 3ZRLA 4MNFA 4EYMA 2VTMA 3F5PA 3EQHA 4WKQA 4EZ3A 1JKSA 4M84A 2UZTA 3Q9ZA 5D11A 3ZTXA 2C0OA 2V62A 4X0MA 5M09A 3UP7A 5IG1A 4H05A 5AAGA 3B8RA 1Q8TA 3ERKA 3D83A 3AD6A 1L3RE 4FTRA 3BIZA 3GB2A 5J95A 3O96A 4U80A 5CLPA 4K6ZA 5I9VA 3UIUA 5E9EA 4FA2A 4GRBA 4QMOA 4YJUA 3K3IA 5EHYA 5KMJA 4FF8A 3ZFMA 3B2WA 3A7HA 5E8YA 4BCNA 1KOBA 1QPCA 1PKGA 2NPQA 3ZONA 1UU3A 3KMMA 1DI8A 3LZBA 4JQEA 1MUOA 3DAJA 4I6HA 3QUEA 1H0VA 3D2IA 3F2AA 1KV1A 1P14A 3VS2A 4A7CA 2JFMA 3KVXA 3OTVA 1R0EA 2OH0E 4AE6A 5CU4A 3OBJA 4FSYA 5HD7A 3PSDA 3TZ7A 1OPJA 4ZLZA 2J7TA 2GHLA 4O0VA 1H1PA 4RWIA 4O83A 3DBCA 3MPTA 3NDMA 4F7SA 4FV6A 4PMMA 2QLUA 5FUTA 4HYUA 2EB3A 1WAKA 3BCEA 4RC3A 5L3AA 2W1ZA 4G5PA 2WKMA 5FXQA 5I9UA 3H9FA 3QQKA 2W1CA 4GFGA 3QTQA 3BGPA 5EI6A 2YISA 2GHGA 3Q4TA 3Q96A 2GNJA 5CALA 2NRYA 5A4TA 5ANIA 5LVPA 5DT0A 2ITPA 1YXSA 4QMMA 2OIDA 1S9IA 2HW6A 4WG3A 3T3UA 3GT8A 4IZ7A 5AA9A 2HY0A 4LGHA 3FQHA 3P7CA 3KF4A 4AOTA 4CMUA 2JD5A 3FMKA 2R3MA 3QC4A 4F6SA 3F3ZA 3DGKA 4FEQA 3EN5A 2PMNX 3O7LB 2BR1A 4X21A 4E4XA 3V8WA 4LGGA 1YHWA 4W4VA 4XV1A 1NA7A 4U79A 3W55A 3VIDA 4AZSA 2Z7RA 5IDPA 4LUEA 4MH7A 3C4FA 4FKWA 2QOBA 4N57A 4WHZA 3LQ8A 1SM2A 3G2FA 3KRRA 2QOLA 3ZLXA 5JFVA 3ODYX 4XG3A 5CYIA 5C9CA 2GQGA 4XG6A 2OWBA 4R3RA 4WG4A 1T45A 3W2SA 1H1QA 2R5TA 3UOJA 1JBPE 3NNUA 4J8NA 4C36A 5B2LA 2QNJA 4FGBA 5CI6A 4YLJA 5E8SA 4AW5A 3BELA 3HDNA 1O6YA 2QHMA 2DS1A 4GFOA 2JDSA 2C6MA 1ZLTA 3SQQA 4O7LA 4NUSA 3HZTA 5DE2A 4YR8A 5LWMA 3GU5A 2ITNA 5ANDA 4KIOA 3KU2A 3AT4A 4BCQA 5IEVA 4QMPA 4QMQA 5LMKA 1L8TA 5CXZA 5HE1A 4NFNA 3BV2A 1YVJA 4GCJA 5CSWA 3GC9A 2ZAZA 2OF2A 1UVRA 3HKOA 3QRUA 3N9XA 1JNKA 4RVKA 4YC6A 4ZY6A 3ZO3A 4EUUA 3MVJA 3UIBA 1XO2B 3QAME 1EH4A 3T3VA 4DAWA 4EHGA 2C6IA 2JGZA 3ATSA 3FYKX 3OXIA 5I5ZA 5EDPA 4FYOA 2ZV8A 2EXCX 1WVYA 2WZJA 1UNGA 2XNGA 1SVEA 2PVNA 3CC6A 3QLGA 3ULZA 3NMUF 3P08A 3GI3A 4IM0A 5FQDC 4ALWA 2J6MA 3R71A 1MQ4A 4BY9E 2WHBA 2ONLA 2W1FA 3BKBA 4BCIA 4RLKA 3A8XA 1JVPP 3F82A 4KIKA 2VO3A 3WZKA 2FA2A 3AC4A 4G6OA 3FMJA 3NNVA 3MS9A 3PXKA 1H24A 2B52A 3A62A 3AMBA 4O0WA 5JEBA 4AZEA 1XH8A 2CGVA 3WF7A 1OMWA 5HG5A 3WILA 3IW7A 4Y8DA 2XRUA 2R3OA 3ANRA 3LFBA 4JJRA 2VWIA 2BTSA 5D7AA 5ANOA 1GZ8A 5HBEA 4C4FA 3FEGA 5K3YA 4K2RA 2GS6A 2YCRA 2ZOQA 3KMUA 5F1ZA 5CNOA 3UO6A 4AP7A 2WD1A 3SHEA 3A7IA 3O2MA 3FHRA 4R77A 2WMUA 2XEZA 3MH0A 2CKPA 2QO2A 3IDBA 5FXRA 3RM6A 3G0FA 3EQPA 4L01A 4HVHA 5LOHA 4C35A 4UYAA 1V1KA 2F7EE 4KS7A 3LXKA 3VS6A 4O6LA 4EH6A 4ANSA 2OF4A 3NUYA 3MB7A 4M14A 3DFCB 3JVSA 5DA3A 3MV5A 1V0OA 5TF9A 2OKRA 4DLIA 2BZKB 3DXPA 3BZ3A 2OGVA 5K0XA 3D7TB 2VTIA 3DV3A 3FQSA 5F20A 3ZO2A 1CMKE 2XNEA 3P9JA 2Y8OA 3QX2A 3QTZA 4HNIA 2BRNA 2CN5A 2PVRA 5I9WA 3ZYAA 2X2KA 3LJ0A 3QFVA 2WMWA 4RVMA 4DH1A 4I5CA 5A6OA 2CHLA 2WMSA 5KHWA 4RJ4A 5EQYA 3JY9A 2UZOA 1XH4A 4U43A 2P33A 4F64A 3EL8A 4KNBA 4TL0A 3AGMA 3CSVA 4BDKA 4U0IA 2X8IA 5E8WA 3DBQA 4PL4A 2Z7SA 2VV9A 5M07A 3PWYA 4OLIA 2ZM3A 1PYEA 1YOMA 4RRVA 4YJPA 5IKWA 4AFJA 4NTSA 4FZDB 4NSTA 2WIPA 4C3PA 1E9HA 1MRYA 4M67A 4LI5A 4S32A 2Z60A 1HOWA 4FV3A 4XRLA 3B8QA 3I7CA 4F08A 4BCJA 3V6SA 3Q2MA 3LM5A 5KMIA 4JIKA 4QP6A 2WTVA 5DT3A 5IQEA 3L8PA 3O0GA 4AX8A 4FTQA 4J53A 3IG7A 4AT5A 5J79A 2F7XE 3FZRA 4GK2A 1UWJA 3A7FA 4BRXA 1U5QA 3NW6A 3O71A 3OMVA 4J96A 4WRSA 1AQ1A 4DA5A 3KCKA 4TKSA 2WMTA 3NYNA 3E5AA 3OF0A 3PIYA 4BDGA 4FEVA 4K33A 4PY1A 3W18A 3PTGA 3NX8A 3D14A 3MH3A 2ESMA 4QYGA 2C5YA 4JG7A 2QG7A 5BUIA 4G6LA 3GU8A 5H8BA 4EBVA 4ZTSA 5KBRA 5DHJA 4Q2AA 1RJBA 1W83A 4EK5A 3COIA 3F6XA 4NYEA 3Q6UA 4P4CA 5DFPA 2GU8A 4XG8A 2VTOA 1QCFA 3DT1A 3PVUA 4G3CA 4B7TA 4E7WA 2PUUA 1YW2A 4D4RA 3A60A 3V5PA 4RZVA 4FG7A 3CY3A 5IQAA 2C3IB 4Y5HA 4AG8A 3TV7A 4O0XA 4OTPA 2P2HA 3LQ5A 5CI7A 3E93A 5CSVA 4BI1A 1PMUA 3GU6A 1K3AA 4IAIA 1STCE 4BTJA 4ZTNA 3SOAA 3FUPA 4W9XA 2QR8A 1M14A 3HP5A 3I6UA 1BI8A 4D4VA 3HMMA 5A4QA 3FYJX 4C61A 5BVNA 4H58A 3E92A 1REJA 1JQHA 2BHEA 3CD8A 4ZLOA 5I9XA 5DOSA 1PF8A 4IC7A 4RX7A 4ZXTA 4EKKA 3QTSA 3ELJA 2CCHA 3HLLA 4JS8A 1H08A 4YU2A 2F57A 3A99A 4ZTQA 4Z3VA 4A9RA 2P0CA 5IU2A 5JN2A 2VTAA 2XKEA 3LFEA 3TZMA 3IONA 3TCPA 3VUTA 4ID7A 2REIA 3QD4A 4WSQA 4PDYA 3CKXA 5HIDA 5C4KA 1OL6A 5L8JA 4APCA 5IF1A 2JDTA 1OGUA 3KULA 2X4FA 4RQVA 1GZOA 4RWLA 2BRMA 4Y85A 4DGGA 4DFZE 4EH5A 4E4MA 2PUNA 4U45A 4QMWA 2FGIA 4FODA 4BI2A 4YHJA 5K0KA 2EB2A 4DTAA 4JVGA 2OG8A 1PW2A 4CKJA 2GFSA 5HNIX 3WIKA 3BHYA 3ZU7A 3DFAA 4RC4A 5AR5A 2QKRA 4OTQA 3FI3A 4L3LA 2CGUA 1CKJA 4QP3A 3C4CA 3OZ6A 3QTIA 5F4NA 4C4IA 2XNBA 2WPAA 3R7UA 1GNGA 3AG9A 4D0XA 3NAXA 4AU8A 4DEDA 5J5TA 4MQ1A 1H26A 4QMLA 4DH3A 3VBQA 2X8EA 1ZRZA 3BGQA 3ZOSA 4IW0A 3ZLSA 4BGHA 2QOCA 5HD4A 3WZEA 5HLNA 2UZNA 2RFNA 2OJGA 2FSMX 3A4OX 3MFTA 3PSCA 4M69B 4U3YA 4FUYA 2BTRA 5L2QA 1UU9A 3QWJA 4J99A 4K9YA 4QNYA 4UMRA 4XYFA 5CEPA 4LL0A 2QOHA 5BX0A 5FWKK 3AD5A 4F4PA 4OAVB 5HG7A 4KWPA 1NW1A 3ID6C 5L6PA 3VUIA 3SG9A 3BEGA 3PFQA 5T68A 4B6LA 2I1MA 4ANLA 3P1AA 4FC0A 3FMLA 3EQCA 2VX0A 5E1SA 4O7YA 2XCKA 3HMOA 3V5TA 3K5UA 3IOKA 3NNWA 3GXLA 5HOAA 1Y91A 4GYGA 3ZBFA 3ACKA 5HU9A 4NTTA 4QMSA 1WBTA 4FL2A 3GFWA 3L1SA 4II5A 4C2VA 4O7WA 3LCDA 3PVWA 3OXZA 4I6BA 4YTHA 2C1BA 4WD5A 5HO6A 4BFMA 4IACA 5DEYA 3QD0A 5K4JA 4UX9A 2JAVA 4NM7A 3L8VA 3NEWA 2XK6A 3LMIA 4XOZA 2KULA 3P5KA 5HORA 3QQLA 4YGAA 5C01A 4BTMA 3G51A 3PG1A 3PXRA 4IVAA 5AUYA 4KKHA 3LFCA 1OITA 1F5QA 3QF9A 3HAMA 2VWZA 2NRUA 4XP2A 4FTNA 2Y4IB 3KQ7A 4TN6A 4IVDA 3TM0A 3SG8A 5DBXA 2XNOA 3PZEA 2QCSA 3PPJA 3V5JA 4BZDA 3IQ7A 4AN9A 3OW4A 1PXPA 2OXYA 2XM9A 4GUEA 3F5UA 1GY3A 2YHVA 4QRCA 5EKNA 4RLLA 5AP5A 3P78A 5CEOA 5GZAA 5FP5A 3ITZA 2RSVA 2R3PA 2J0IA 4ZMFA 3DZQA 4Q9SA 5KZ0A 1ZY4A 4RA4A 2R3NA 1F0QA 2HY81 5IQFA 1OKYA 5IMEA 3AC2A 4IWQA 3JY0A 4K18A 1YXXA 2JKKA 1RE8A 5D12A 5D41A 3OWPA 3W2OA 3O17A 1URWA 2VX3A 1OUYA 2OJFE 4D1ZA 3E3PA 5AV0A 3HUCA 2WNTA 4L8MA 4RJ7A 5I3OA 4QP9A 3R8VA 4JX3A 4AF3A 4L42A 4YJOA 5JK3A 4O81A 4A4OA 4YTCA 5D1JA 2HIWA 4AZTA 2A19B 2VO7A 4ZOGA 3R9HA 4YP8A 3THBA 4XJ0A 4JDHA 5L2IA 4M97A 5AADA 3DTWA 4FIGA 3SA0A 3U6HA 1JSUA 1M2RA 2J5FA 3W8LA 2HW7A 2C6KA 3D2KA 2O2UA 2UZDA 3NAYA 4NCTC 2OI4X 2VD5A 3AD4A 2XEYA 3UODA 3AMAA 4QPSA 3FBVA 1J91A 4MD8E 2VWXA 4MBJA 4KS8A 4CFXA 2C5NA 5AR8A 4ASEA 3NPCA 5KKRC 4FTUA 2YWPA 4F7LA 1QPDA 4ZSEA 3I81A 3EFKA 2QR7A 4LRJA 1M2QA 3RGFA 1ZY5A 3RKBA 4C57A 3UZTA 2IW9A 2SRCA 2YABA 2NNWB 3SXRA 1OIUA 1VZOA 5FG8A 3TNIA 2WTCA 4IBMA 3F3TA 4HCUA 1SNXA 3QTRA 4DHFA 4FE2A 3QU0A 2XIYA 5EW3A 5EW9A 3PXYA 4TYJA 4MBIA 4XEYA 3ORKA 3S00A 3HV3A 2EXMA 2J90A 4QMYA 2VTJA 2WOUA 4YZBA 1Z9XA 3KXHA 2BUJA 2CLQA 4RC2A 4CFMA 4UMPA 5AFVA 2J2IB 3TV6A 3Q53A 3RK7A 4AW0A 4BDFA 3NVKI 4OTDA 3GC0A 4GSBA 5FXSA 3FZPA 2CNVA 2H96A 5HHWA 5CT0A 4L43A 4BYJA 3NUAA 4JNWA 4I1ZA 3ZDIA 2YERA 5L4QA 4YURA 5CSHA 4F1MA 4FIIA 5TE0A 2JEDA 1G8SA 3RWQA 2C69A 3RCDA 3NR9A 3ENMA 3QWKA 4IJPA 4YTIA 4JOAA 4V01A 3I5NA 3PWDA 5JZNA 3VS4A 3QKMA 2OZOA 2B9FA 4L52A 4XBUA 5EOLA 4GYIA 3NUUA 3QKLA 3AT2A 4UWCA 1IA8A 4FTMA 3KCFA 4M13A 2W7XA 3HRFA 2J0JA 4BCOA 2HCKA 5FGKA 4QQTA 3SRVB 2BHHA 4JG8A 4XLIA 4EOKA 3HA6A 2R3QA 4WIHA 4EKLA 3UBDA 1OBGA 3AOXA 4O2PA 4GL9A 3MN3A 4BIEA 2UW3A 5LJJA 4DF3A 3KA0A 2ITQA 4CFWA 2JBOA 5HLWA 2JIIA 2GHMA 4IAZA 3POOA 4XG7A 3MJ1A 1Z5MA 2F49A 4EQUA 5T3QA 1FPUA 1OKZA 2H6DA 4FYNA 2XKDA 2WFYA 3HGKA 3KXGA 2HXLA 4NT4A 4PUZA 3R83A 4EH4A 2W1GA 3EQRA 5IH6A 4GUBA 1Z57A 5A46A 4V0GB 5HX8A 2WTDA 3NSZA 3TTIA 3ORXA 1KE6A 2BAKA 4MXXA 3OTUA 4HOKA 4KKGA 4AGDA 4AW1A 4QPAA 2CGWA 3AMYA 4FTTA 3UZPA 5DMZA 4FL1A 3BYUA 4ANNA 2BFXA 3FY2A 3PLAE 4XV2A 5CEQA 1OI9A 2JKOA 4FZFB 4MXYA 1CDKA 3TUCA 3KRXA 4J97A 4ZJVA 1PXKA 2GDOA 4IADA 4D9UA 4FTAA 5JQ5A 2P3GX 5M57A 1YI6A 5ANGA 3TIZA 4YHTA 2BKKA 1TVOA 3SXSA 1IRKA 4PTCA 2WTIA 3HMNA 3VUHA 5BMSA 3CQUA 5ETCA 4C37A 1TQPA 1DAWA 2PVMA 3QCQA 4XCUA 4I5MA 4ZZNA 3FSFA 3V3VA 2R3JA 4YJVA 4YO4A 5L8LA 3D5UA 4C7TA 3PRIA 3UE4A 2X0GA 4FVPA 1ZYLA 3Q9WA 3S2PA 3ZHPC 5HE0A 3SW7A 1OVEA 3BEAA 4KIKB 5DWRA 4TWCA 5FLFA 4QMNA 5AUTA 5HVJA 3KRWA 5IMXA 4NIFA 4E4NA 2I7QA 2UW8A 5E8XA 4DH8A 2VWWA 3DJ6A 2W1IA 3EN7A 4CFUA 3CIKA 3GBZA 1H8FA 3EIDA 1GZKA 3EN9A 3QZIA 4PMTA 3GCVA 4NJ3A 2G9XA 5TR6A 2FSTX 3RAKA 4DE4A 2DUVA 2XVDA 3HMIA 4DTBA 1E1VA 3TIYA 2X2MA 3BX5A 5CF6A 4XV3A 4QMZA 4RIYA 3H0YA 1FGIA 3MSSA 3NS9A 3U4UA 3EZVA 3NIZA 5KNJA 2ZV7A 4FV7A 3WOWA 2PPQA 3P4KA 3D15A 3N4TA 4PNKA 3C0GA 5C26A 3GC7A 3OOGA 4K8AA 2HAKA 4MXCA 3MTLA 4A06A 3PJ8A 4JLCA 4UXQA 5GJDA 4GG7A 3UG2A 3RPVA 1M7NA 2GNIA 4IB1A 2RF9A 5M4UA 4ERWA 4KBKA 2IPXA 4PTGA 2CCIA 2VTHA 2VWVA 3O7LD 4XS2A 3SAYA 3TEIA 2JLDA 5I9YA 2F2CB 2UVZA 3FAAA 4GMYA 5I0BA 3MH1A 5IA1A 3R9RA 3QQJA 3LCKA 2ITXA 3GU7A 2X9FA 2ITTA 3NVMB 1NVRA 4I0SA 4KD1A 3UNKA 4FNXA 4JG6A 4MHAA 1UV5A 3ZUUA 3WYYA 4F9YA 4HVIA 5A54A 1W7HA 3PE1A 2WOTA 2O0UA 2JKQA 4F0GA 4ZIMA 2UZUE 4YSJA 3PRFA 3KXMA 4LGDA 4ANMA 3P79A 4OTGA 5DGZA 4UY9A 5EH0A 4X2NA 2X7OA 4HVGA 2ERKA 2P2IA 4TWPA 2BAQA 2QONA 3MB6A 4FG8A 4DINA 4FTKA 2XNMA 1J1BA 2PVHA 2WU7A 3C50A 3G9NA 4PF4A 3GENA 3ODZX 3PY1A 2GNLA 3W16A 4YC8A 3JR1A 4IANA 5HICA 2R0UA 3FMDA 3VF8A 4HZRA 4L67A 3PIXA 2PMLX 1OUKA 3NZ0A 4J95A 3HV7A 4MF1A 3VVHA 4DBNA 3QQFA 2I40A 3L9PA 3QZGA 2WQOA 1OKVA 2PULA 1Q99A 2RIOA 2JC6A 3D4QA 5FTOA 4AW2A 4C4JA 5CS6A 3VC4A 2A0CX 4KBAA 5CU6A 5D9HA 3C4XA 2G15A 5A4LA 2JITA 5LWNA 2B1PA 2OJJA 3MH2A 1H25A 4I93A 4Y95A 3OVVA 3COKA 4BC6A 3R6XA 4HVDA 5HCXA 2Z2WA 4G1WA 5A3XA 3UVPA 3U6IA 4I22A 2PE2A 1Y6BA 1J7UA 5IQBA 4ITHA 4EC9A 4O1OA 1PMEA 3PPZA 2DWBA 3VULA 3F88A 2UZBA 4RJ8A 5E1EA 5EK7A 4FSTA 5B7VA 4FV2A 2VUWA 4BI0A 3RTPA 4X7QA 4FKJA 4HGEA 1E1XA 1ZMWA 4F0IA 5IQDA 3I7BA 4LOOA 5DN3A 1PHKA 4YZNA 3LFNA 3ZSHA 4E5AX 3EJ1A 4ZTHA 3ZRKA 1NXKA 3F7WA 3FPMA 4ACHA 4X2JA 3P7BA 4R78A 3GCUA 2LAVA 4C0TA 3VW6A 1JWHA 3F5GA 5L2WA 4RIXA 3LFSA 4OTHA 4AN3A 4F99A 1H01A 2YCSA 3FDNA 4MWIA 4CMTA 3HVCA 1K9AA 4O84A 3H0ZA 3LJ1A 3QA0A 4FVQA 4IX6A 5C8MA 4KA3A 4NJDA 4E93A 2OFVA 3QGWA 2ZDTA 2V5QA 3HRBA 4QP7A 4RFYA 2OO8X 3GP0A 3KULB 3L9NA 3V5WA 1CKIA 2UZWE 3E8CA 4CKIA 4X3FA 2W4JA 2A4LA 4HGLA 2Z7LA 4LOPA 4DFXE 2RKUA 4U3ZA 2VGOA 5DVRA 3ZZWA 3MY1A 3TI1A 4ACGA 4E5WA 5BQ0A 4CLJA 4PL5A 5CENA 4C4GA 2OH4A 5LCJA 4WO5A 4YJSA 3AT3A 2OZAA 4UB7A 1CKPA 4FV4A 4Y46A 2J0KA 1ZYSA 4F09A 2YEXA 1XBBA 3ZDUA 3DZOA 3ZLWA 2VTRA 4U44A 4FT3A 5AV3A 3TJDA 3VS3A 3WF9A 3VHKA 4EOIA 4ZS4A 5CVGA 4FTJA 5IA3A 3A61A 4BIDA 3FZOA 4CFFA 3RHXA 4C3RA 4RVTA 5J8IA 2BZHB 3W1FA 5BUEA 4GKIA 4I3ZA 3C9WA 4MEDA 2R9SA 3NUSA 5H3QA 4MVFA 2GNFA 3R22A 3GGFA 1OIYA 1OECA 4RJ6A 4S33A 4ZP5A 4RGJA 2WTJA 3IK3A 3QTXA 2O63A 3WE8A 3ZZEA 3FE3A 4QP8A 3F3UA 2PVLA 2UVXA 3Q52A 1WZYA 3SV0A 4GIIA 2XH5A 3Q32A 3UO4A 4N0SA 3KL8A 4WNOA 5C1QB 2XJ2A 3BYOA 2P55A 3OWLA 4I4FA 3ZM4A 4A4LA 4EUTA 2DYLA 2PZRA 4YZCA 4F7NA 5IQGA 3RPRA 3QHRA 5EI2A 4TWOA 4RMZA 3MI9A 4BDEA 5LVOA 3FQEA 3UQFA 2YAKA 3IO7A 3ZO1A 4XOYA 4ACDA 1MP8A 2VN9A 4MXZA 4O0SA 4H3BA 3QXOA 2O64A 4I5PA 4K77A 4TRLA 2VTLA 1NT2A 5HTIA 1XQZA 5J7BA 3QZHA 5DR6A 4F63A 5L6OA 4S34A 3TT0A 5DH3A 4XG2A 2PHKA 3FLQA 3E64A 3PA5A 1Q8ZA 3LVPA 4BDHA 3CTQA 3QQUA 4MNEA 4BVUA 4AN2A 1FVTA 3UVQA 1MRVA 3HRCA 4FSMA 5ANKA 1ZAOA 4BKJA 2B7AA 3KREA 2R64A 4NM5A 4RIWA 5HVYA 4E8AA 4EOJA 3UQCA 2XYUA 2QG5A 3G5DA 4HZSA 4DN5A 1Y57A 4U5JA 1BMKA 3V5QA 4C62A 3I0QA 4FBXA 1UWHA 3D9VA 5D7VA 2J9MA 4FV0A 5JSMA 4DG0E 4S30A 5AUWA 3DDQA 3ZLYA 4NFMA 4ZSLA 4XP3A 4I41A 4FTIA 3RALA 4BDAA 4CRLA 3BWJA 3C0HA 5CWZA 5H2UA 1XH6A 4DEIA 2IZRA 3FZSA 5FBNC 1FOTA 4PPCA 5HESA 3UDBA 3IECA 4EEVA 5JGDA 4YLKA 3OW3A 4TYHA 3W8QA 1YDRE 2UW4A 2XKCA 3MIAA 4EOOA 1NVSA 4I6FA 4LM5A 3PJ3A 4TW9A 3W32A 2C5VA 4A9UA 4EORA 3LMGA 4KSPA 3SXFA 3DAKA 1UA2A 2VTPA 4UMUA 2CMWA 5AP0A 3BHTA 2IVVA 3OT8A 1W0XC 1QPEA 4EI4A 5IISA 5AX9A 1ND4A 3FI2A 4N6YA 4UN0C 4ALUA 5HTCA 4UALA 1DM2A 3OY1A 1YI3A 2VAGA 2YM6A 4LUDA 3RK9A 1KE8A 4JBPA 3MPMA 4BKZA 2OSCA 5FRIA 3BYMA 4WNPA 3W10A 4EJ7A 4GT4A 4RWJA 2X1NA 3VS1A 3EMGA 5M08A 4IIRA 4HW7A 4WBBB 5H9BA 2W5AA 4PV0A 2VO0A 4F0FA 4M7IA 4WBOA 4CTBA 4UYNA 3QLFA 2ZM4A 2DQ7X 5I9ZA 3TWJA 1PMVA 3Q60A 4Q5HA 5HIBA 4UXLA 3WZJA 4U7ZA 2R3HA 3V5LA 2C5OA 2AC5A 4AXAA 3T9TA 4EQMA 3HA8A 2PUIA 2CDZA 2UW7A 2JDRA 4FR4A 1HCLA 2Z7QA 3GU4A 5BPYA 3TXOA 4C38A 1KE7A 2E9VA 4BDBA 2W05A 5M55A 4FK3A 2EVAA 2LGCA 3GVUA 4F9AA 1OPLA 1TKIA 3DU8A 4L7SA 3LXNA 3QL8A 2Q0NA 1AGWA 3LW0A 2C3LA 3U87A 3PJ1A 4OTWA 3EFLA 4BIBA 1U59A 2UW5A 3R30A 4D2TA 5AP3A 5HE3A 2J0MB 4G2FA 3R7EA 4HYIA 4OTRA 3H9OA 2YCQA 3C5IA 3PA3A 3RPOA 4UEUA 3CE3A 3WARA 4BN1A 5EDRA 2QLQA 1UU8A 3I4BA 4FG9A 2GS2A 3PG3A 3BLRA 4FKIA 3UTOA 4S31A 2BCJA 1R3CA 4G3DA 4IDTA 3SDJA 1G3NA 1IASA 3EWHA 4IH8A 4ITIA 3QC9A 4O86A 4U41A 2G2IA 2GQRA 3RNIA 1VR2A 2BVAA 4ZTRA 4NEUA 2PY3A 3D5XA 5GIPE 3GCSA 5HEZA 2E9NA 3TACA 1FMOE 4RX9A 4DEEA 1LEZA 4EHZA 4F65A 1I44A 3NUXA 3OOMA 4CV8A 5KUPA 2X2LA 3EZRA 1ZXEA 1Q41A 1KE9A 2OFUA 5AWMA 2YLEA 4GVJA 3DDPA 2I0HA 1P5EA 1YQJA 1WBPA 3UVRA 1BYGA 1XBCA 2XA4A 5AP6A 2V22A 3ZEPA 3G33A 1I09A 3HMPA 3R1SA 1B6CB 4FT9A 2VNYA 3ZFYA 4E26A 4DGOA 3VBYA 5EQEA 4YUQA 3O23A 4G31A 3EKNA 3N4UA 3SD0A 5M51A 1RQQA 5E91A 1VJYA 2YACA 4AE9A 3QQGA 3QYWA 3R7GA 5C8NA 3TG1A 5J1WA 4FMQA 4CVAA 4FKSA 5GJFA 4FTOA 4TNBA 2R7IA 2XK9A 4R3PA 5A9UA 4CD0A 5KMMA 3SGCA 5CVHA 2C4GA 1YXUA 3P86A 2E9OA 1H1RA 3BU5A 4R6VA 2YIQA 1WBSA 4E73A 1BX6A 3FC1X 4KB8A 4ZK5A 1H1SA 4J7BA 4I4EA 3ROCA 2YITA 1ZOEA 3E8DA 3EKKA 4QQJA 3G6GA 3ETAA 1AD5A 3IS5A 4ITJA 4L3JA 3SLSA 3GOPA 1ZWSA 4CEGA 2VZ6A 2W1DA 5DYJA 3I79A 4E3CA 2PE0A 4ZS0A 3W2QA 3S1HA 5AA8A 3VS0A 3LLAA 2BROA 4I23A 4YBJA 2WTKB 2FUMA 3M42A 5FEQA 1PYXA 1OZ1A 4E20A 3KFAA 4F6WA 4W4YA 3TZ9A 4RFMA 2HK5A 4F70A 5JFSA 2IVTA 3PXFA 2C1AA 3PP1A 1JLUE 3R0TA 1IAJA 3AXWA 3U54A 3DJ5A 4PQNA 2W99B 2W9ZB 3N51A 4GJ3A 2Y4IC 4I20A 3OEFX 1SYKA 3O8UA 4UWBA 2XS0A 4JL9A 2BRHA 3OEZA 4BB4A 2BIKB 5H8GA 3D0EA 3RK5A 4X2KA 1REKA 3R02A 4Z16A 3SOCA 3ZS5A 3E8NA 2J50A 3PYYA 2WEIA 3E7VA 4ZJIA 3UNZA 5BVFA 5GNKA 4L3PA 4CSVA 5KCVA 1P2AA 3FMMA 4RG0A 4CZTA 3ZXZA 2UV2A 2XRWA 4QYYA 3RPSA 5IUGA 3GEQA 3SVVA 2X4ZA 2YDJA 3H3CA 4NIFB 3VN9A 4PPAA 5J87A 4RSSA 3L8SA 2E9PA 3IW4A 4R1VA 2GCDA 3W2CA 4AGCA 1RDQE 1WBWA 5DR9A 5JRSA 4D5HA 5H8EA 2YM3A 4ZY5A 1XJDA 3JS2A 3LFDA 4PWNA 2QQ7A 3OG7A 4M66A 4JDIA 4RIYB 3TJCA 5L6WL 4FKOA 4BCHA 1U54B 3OCTA 4UBAA 4GIHA 4J52A 3OS3A 3EQIA 2WQNA 4I0RA 5CT7A 3GFEA 4EH7A 4U6RA 2Q0BA 5HCYA 4PP9A 4QYFA 4DT8A 3R7VA 4W4XA 3ZRMA 4EH3A 4CTCA 5ANJA 4AZVA 4RT7A 4F7JA 2YAAA 4KRCA 4U81A 3QD2B 2HZ0A 3AC5A 3MFRA 5E8TA 2PK9A 2ITWA 3RINA 2BMCA 4WSYA 1XR1A 4FEUA 3QXPA 3D7TA 3F3VA 4EBWA 2WELA 5KMOA 3HL7A 1H0WA 3B2TA 3IW8A 2VGPA 4G34A 3UP2A 4AWIA 3DXQA 3ORIA 2E9UA 4R1YA 3WZDA 3MESA 3PP0A 1KV2A 2B0QA 5LVLA 2HZNA 1VYZA 4CNHA 1B39A 2VTTA 3ZM9A 3ZSGA 4HGSA 5AR3A 4N4SA 4QO9A 2HWPA 5CU2A 4IAKA 2JKMA 4MAOA 4DCAA 4Q5EA 3DA6A 4D58A 5AP2A 3VUGA 5AM7A 2WMRA 3FMNA 1YRPA 2YIYA 3COHA 3QCXA 4FL3A 5T6KA 1ZOHA 3ULIA 3ORNA 1FINA 4GVAA 5AP4A 5A4EA 3UO5A 2H34A 4RBLA 4FTCA 2XIRA 5AV2A 2GS7A 3Q9XA 5IUIA 1CSNA 4QYHA 1MQBA 2ITVA 3KC3A 4D9TA 1CM8A 3LQ3A 2ZB1A 4ALVA 3UOLA 4EH2A 4HVSA 4FNYA 4BBEA 5HIEA 5I4NA 3QCYA 5AMNA 4CQGA 5CZHA 3N4VA 4NM3A 1KE5A 4PP7A 3JUHA 2CN8A 2XCHA 1GIHA 4N70A 3D5VA 3R7YA 3OP5A 2Q83A 4D28A 3OXTA 2QD9A 1BL6A 4BCMA 3BPRA 2QO7A 1XH7A 4CKRA 4ARKA 2WMBA 1FVVA 1QMZA 3EYHA 4FKUA 2PZIA 4YJRA 4FOBA 3R7IA 1Y6AA 4GK4A 3U9NA 4CYIA 4USEA 4DBXA 2UW9A 3UNJA 1LR4A 4NH1A 3PVGA 2GNHA 1NY3A 4B99A 3HP2A 4DFNA 1W82A 2I0YA 3KXXA 2B9HA 5EYDA 4D0WA 4C4EA 1OIQA 3HV6A 4E6CA 3NLBA 4ZSJA 3IW5A 2QKWB 2R7BA 1PXMA 3NYXA 2PVYA 3F2NA 5ETIA 1BKXA 2IWIA 4KABA 3KK8A 4BTKA 5KMKA 3TDVA 4TXCA 5HU3A 2QOKA 3V8TA 4NW5A 4DFYA 3BBWA 3FLWA 3TNQB 5LMAA 4KSQA 3ACJA 4Z7HA 4RJ3A 3KRJA 3G15A 3NWWA 2OXDA 2C30A 3LXLA 2F4JA 4RIXB 2ZV2A 3MWUA 1OL7A 2XKFA 2B4SB 4IDVA 5JGBA 3G0EA 4QMVA 3ALNA 4XMOA 4MTAA 2BILB 3UMWA 4EOMA 4USDA 3S3IA 3MDYA 4W8DA 4FKLA 2PVJA 2YIXA 4WT6A 1Q8WA 3MY0A 5CAUA 3PSBA 3GNIB 3MY5A 4YNOA 3PJCA 5FTQA 2H8HA 3DBFA 5AM6A 4P5QA 4J71A 4E6DA 3L8XA 4AGUA 4NL0A 1PXJA 2RGPA 4HYHA 2W1HA 2YA9A 3LOKA 1GJOA 2GTMA 5EM5A 4CG8A 3DPKA 3AGLA 3DQWA 3DNEA 2XYNA 3F3WA 3NCGA 5DRBA 5CEKA 5HZNA 4BWKA 3QRKA 1DS5A 4QQCA 4QMTA 4O2ZA 5HO8A 2EXEA 2HELA 2PMOX 2ZM1A 1H1WA 3NW7A 4G5JA 2OIBA 4TYIA 3UC4A 5CF4A 4YTFA 2WMVA 2YLFA 4L53A 3I60A 3R00A 5D10A 5AV1A 4AGWA 4TTHB 2ONLC 4LL5A 4R7IA 3TN8A 3LJ2A 3COMA 4IFCA 2C6DA 5AIRA 2IZSA 1ERKA 4CT2A 5E8UA 4PMPA 2C0IA 3ROYA 3MVMA 4BGQA 2Y9QA 4BZNA 4RX8A 4IE9A 2WQEA 3LHJA 4BCKA 1PXIA 4MKCA 3QD3A 4EQCA 3Q4CA 2OU7A 4BBMA 4EH8A 1JSTA 4ZTLA 3Q3BA 4KBCA 1M2PA 4IWPA 4IB0A 5HGIA 4DEBA 2EUFB 4MF0A 3R9NA 4CV9A 3H30A 3IPHA 4M69A 1XH5A 4ZZOA 1OKWA 2FVDA 4G9RA 4D55A 4CZYB 1LP4A 4DGLC 1UKIA 4HJOA 2ITUA 4JI9A 2BRGA 4W4WA 4L6QA 1H00A 4NWMA 3VS5A 2XIXA 4FZ6A 2ETKA 2IVUA 5EDQA 5CVFA 4YBKA 2YJRA 3KMWA 5GIOE 3PPKA 1Q8UA 3ZEWA 3SX9A 4QMXA 3LCTA 5TOZA 3TUDA 5G6VA 5G1XA 2W96B 5DEWA 4BKYA 4BDIA 4QOXA 5KE0A 2YN8A 3GCPA 4KAOA 3P23A 4EK8A 3R1QA 3MJ2A 4EK3A 3ZC6A 5E92A 4MNEB 2YM4A 4M3QA 4EHVA 4D2SA 2Z02A 4BZOA 4XV9A 4GT3A 3R01A 4FIJA 1IG1A 3ALOA 2BDFA 2C5XA 4G3EA 2PE1A 5IUHA 4ZLYA 5K4IA 2JDOA 2XK7A 4QP2A 3SW4A 1BLXA 5JKGA 1VYWA 1IAHA 4ZTMA 4FOCA 5BVKA 4UMTA 5AJQA 3VUDA 2OLCA 5BYZA 3OUKA 4YJQA 4PRJA 1O6KA 3O8TA 4FZ7A 4R7HA 5KMNA 5C03A 1JKLA 3FJQE 4RA5A 1LEWA 2R2PA 3FL4A 4TY1A 2QVSE 4X2FA 4X3JA 2YDKA 3P7AA 3R63A 4O38A 1JOWB 3MGYA 5M44A 1XBAA 1H07A 2JFLA 4CLIA 3ORZA 5M56A 4FNZA 4LQMA 3HV5A 5CQUA 4O21A 3RHKA 2QOIA 2XZSA 4O0RA 2BKZA 3OROA 4A9YA 4EOQA 2YJSA 1Q62A 2RL5A 4LG4A 4FSQA 2BDWA 4D5KA 1SZMA 3FSKA 3DK6A 5BVOA 4ASDA 5AP7A 4IWOA 4JRVA 1OB3A 1PJKA 3DOGA 4MQ2A 2XUUA 3H4JA 5EHLA 3Q2JA 5CX9A 3FLSA 4YZMA 4Y72A 3O51A 4XBRA 2R0IA 2IZTA 3I6WA 3OCBA 3JYAA 4ANBA 3PIZA 3VJNA 4D4YA 2R3FA 2VTQA 4H1JA 2XMYA 1IR3A 1TQMA 5HG8A 4KKEA 1H4LA 5IEYA 2FB8A 4IB3A 2CNUA 2O3PA 3R7OA 2O8YA 1G5SA 4QTDA 4JBQA 4UZHA 3I5ZA 3GUBA 5GZ9A 4D1XA 3HECA 3KKVA 4K0YA 5IZFA 3DKOA 2IZUA 4LFIA 4IZAA 2O65A 5HX6A 2R3LA 2H9VA 3PLSA 5FTGA 2EU9A 4CCBA 2A27A 1A06A 2VO6A 2QOQA 3DAEA 1ZYDA 4RQKA 3QTUA 4AA0A 3U55A 4DLJA 3KF7A 4CGAA 3QUPA 3VHEA 5IA2A 5AX3A 4BHZA 2VNWA 2X6DA 4TT7A 2FSLX 3DKCA 3RBWA 2G01A 3R73A 2PSQA 4L46A 4D2RA 1KUTA 3OT3A 5B2MA 2QOOA 5IA4A 3RPYA 5M4FA 4AOJA 5KZIA 4DEAA 3Q4UA 1PXNA 4GH2A 4I0TA 2B9IA 3NYVA 3MA3A 3R8UA 3F5XA 4WUAA 2W0JA 4JR3A 3ZUVA 3ZSIA 3BWFA 4L7FA 3ZXTA 5FDPA 3JVRA 1G8AA 4CRSA 3UG1A 3DKGA 3E3BX 3E88A 1JKTA 4FSWA 4GK3A 2CNQA 4FV8A 3QTWA 4GEOA 4QMUA 4F6UA 2PL0A 1XHAA 3TUBA 1KSWA 2RFSA 2ZYBA 3EFWA 4P7EA 3A8WA 4CFVA 4OT6A 2IO6A 1SNUA 2F7ZE 2XP2A 2XK8A 4NCTA 2RFEA 4JDJA 4YZDA 3VWAA 3DJ7A 4C02A 1A48A 3C4WA 4MK0A 4Y73A 4KIQA 5AUVA 2I0VA 4M8TA 4YPDA 3U8WA 3RCJA 3T8OA 4FEWA 5HTBA 3E63A 4FV1A 3TTJA 3PXZA 4RJ5A 5CTPA 4G3GA 4FI1A 3NNXA 4F9BA 4W9WA 2XJ1A 4GV1A 3NGAA 4H3QA 4MCVA 4DYMA 2C3JA 2XJ0A 3CGOA 5CZIA 5IA5A 4O7NA 5EM8A 5FDXA 2XBJA 3CP9A 2WMXA 1GZNA 3QGYA 3WYXA 4OTFA 1O9UA 1JPAA 3WF6A 3RAIA 2JBPA 5JT2A 2X7GA 2XNNA 2WEVA 3HUBA 4ANOA 5L2SA 3UGCA 4X2GA 1OPKA 2R3IA 4MX9A 2PYWA 1FMKA 3IW6A 4OTIA 2CJMA 3BHUA 4JXFA 4NKAA 4V04A 4EOSA 5F95A 4XP0A 1YWRA 2AC3A 4O7SA 5FP6A 3FZ1A 3CTHA 4E6QA 5ANEA 3IGGA 5C8KA 1XH9A 3LAUA 4MD7E 5IQCA 1XWSA 3DS6A 2YM8A 3RI1A 4ENYA 5CU0A 4G3FA 3MIYA 4FKRA 3SRVA 4BWXA 4FT0A 5EI8A 4O0TA 3C51A 3RNYA 3VBTA 1OM1A 3PZHA 5EHOA 4IC8A 4IXPA 2ITYA 4IVBA 3TNHA 4BBFA 5IDNA 3MYGA 4HGTA 4QPMA 5TKDA 5BNJA 4AFEA 1Y8YA 5EFQA 1UU7A 2WMQA 3S95A 5GHVA 5E4HA 3LFFA 2GQSA 3LM0A 5A6NA 4M12A 3BE9A 5CAPA 2Y7JA 4ASZA 5B0XA 3KRLA 2UW6A 4GT5A 3VRZA 4B4LA 3NUPA 2BRBA 5K9IA 2PZYA 4JAJA 4RX5A 4O82A 3DB8A 3FXZA 2OIQA 2VTNA 3FMHA 4FSRA 3HYHA 2J0LA 2AUHA 1XKKA 2C3KA 3OUNB 4RVLA 4AAAA 4C34A 4IQ6A 4O7ZA 3OBGA 4EZ5A 2I6LA 4UV0A 4V0GA 4IX3A 4E5BA 3ZCLA 3S0OA 2WB8A 5DLSA 3VUKA 2WIHA 4PDOA 1GOLA 1WFCA 4Y5QA 4A07A 3NIEA 2FO0A 5DNRA 4LRKA 3F2RA 4D4SA 3PDTA 2CGXA 2R3RA 3II5A 3RWPA 3E8EA 4FIEA 5CY3A 3EL7A 3QYZA 1J7IA 1Q61A 4C2WA 2GPHA 4PMSA 4TNDA 3QRJA 4I92A 4LMNA 3VF9A 4O7RA 5AP1A 5EG3A 3R9OA 4LMUA 3CD3A 3FPQA 4LV8A 4YJNA 3CQEA 2Y0AA 2ZV9A 1BI7A 2VWYA 2XK4A 2V0DA 3U6JA 2C6EA 1YWNA 2HZIA 4FIFA 5LQFA 3WF8A 2YIRA 3AC8A 4BL1A 4HPTE 5JQ8A 2CPKE 3BYVA 3Q9YA 3EYGA 3DBEA 1P4OA 2P4IA 4FKQA 1KOAA 4KIPA 4ZSGA 5BMMA 5J7HA 5E8VA 4FSUA 4FZAB 3FKOA 1QPJA 2UUEA 1NVQA 1Q8YA 4IAYA 4XH6A 5AAFA 4ZMEA 3NCZA 4FICA 4IZYA 2RFDA 4IEBA 3SC1A 3V8SA 4ASXA 4EK6A 5GZ8A 4L00A 1WVXA 2F2UA 4JX7A 3C1XA 3CQWA 3MFUA 3PXQA 2PTKA 5DR2A 4ZJJA 3FKLA 4Y83A 3I0OA 4G16A 3ORPA 4IMYA 1R78A 3KXZA 5HI2A 3TDWA 2Z8CA 3UMXA 2FH9A 4MYGA 3BLQA 4M0YA 1OL1A 4ERKA 2V55A 3G6HA 4O27B 3O8PA 5A4CA 3EQDA 3MVLA 3R1YA 1U5RA 3DQXA 1UKHA 3K5VA 4XG4A 4B8MA 2W5BA 5GINE 3EHAA 3IOPA 4C8BA 4FNWA 3LLTA 2ZB0A 4EOLA 4FKTA 2HWOA 4FKVA 4APPA 4XUFA 5HLPA 3R9DA 2RG6A 3OWJA 2QO9A 3KGAA 2OK1A 2ZMCA 3E7OA 5ITAA 3DK7A 2B53A 2X39A 4AQCA 5KO1A 2J4ZA 2ZDUA 3LCOA 5HO7A 4WRGA 1PY5A 3EH9A 4HPUE 5JH6A 4R3CA 3CEKA 2R4BA 3SKCA 1FQ1B 2VWUA 2IW6A 4O6EA 5AUZA 3ZUTA 3L9LA 3HX4A 4DG3E 3FLYA 2IJMA 4FKGA 3LFAA 1M7QA 5FBOA 5AAEA 1R39A 3QRIA 1JAMA 1S9JA 4IJ9A 4I24A 5EQPA 3KB7A 2ZJWA 5HBJA 5HVKA 1GIJA 3FXWA 5LVMA 4BWPA 4FV9A 3CS9A 3D5WA 4FT5A 4GFMA 3RAHA 1PMNA 3QZFA 2WMAA 5FD2A 3OFMA 4OBOA 4IHPA 4CCUA 2OW3A 3QQHA 5GJGA 3BU3A 4IWDA 4EWQA 2JIVA 3A7GA 3QX4A 2W5HA 3F69A 2JDVA 3F66A 5JMSA 2PVKA 2WAJA 3S4QA 2CSNA 1ZMUA 2W4OA 4YZ9A 5CAOA 1YOJA 5M53A 5E90A 5J1VA 4AOIA 5LXMA 3F61A 4HCTA 5DI1A 1M17A 1KWPA 3HNGA 4DTKA 3A2CA 2IW8A 2X7FA 3OD6X 4NM0A 2BZIB 4ORKA 3UZRA 3UIMA 5FM3A 1YDSE 1Q3DA 2VX1A 3CPBA 3MW1A 1BUHA 2UZEA 3RVGA 4O91A 3AQVA 2PZPA 5EYKA 4CQEA 4AZWA 4IX5A 2XF0A 5E7RA 3C4EA 4CYJA 4XX9A 4YJTA 3TL8A 4XRJA 3DLSA 2R3KA 3KXNA 2WQBA 4YLLA 5CNNA 4CFNA 4HCVA 1U4DA 5JFWA 3MFSA 5CANA 4MBLA 3P0MA 2AYPA 3FV8A 5IPJA 3NW5A 2YM5A 5J9YA 4E6AA 1IEPA 3R8PA 2GNGA
chains in the Genus database with same CATH superfamily
5BVWA 2A2AA 3RZBA 1H28A 2RG5A 4JBVA 4K11A 4FKPA 5JGAA 3DBDA 3ENHA 1YDTE 4JDKA 3OHTA 3WF5A 1APME 4F9WA 3FMEA 5HNBA 2BALA 4U42A 2ACXA 3BQCA 2BDJA 4QTAA 3D7ZA 4PL3A 2WQMA 4FVRA 4K1BA 1URCA 5HCZA 1X8BA 4B0GA 2KTYA 4NU1A 4U97A 4GS6A 3LIJA 1QL6A 3L9MA 4M0ZA 4ACCA 1XMMA 2WTKC 4WNMA 5EM6A 4D1SA 3UOHA 2XANA 3CCNA 3JXWA 3QALE 4PNIA 4R8QA 5F94A 4BTFA 4D2WA 4B8LA 4BJJA 1W8CA 2OBJA 1M52A 3PVBA 5FEEA 1UNLA 3EB0A 1DAYA 4FSZA 3VNTA 3QHWA 3ZBXA 4Z55A 1YOLA 5J9ZA 2VRXA 1DI9A 5LARA 2X81A 4NW6A 5CAQA 4LV7A 4QD6A 3Q5IA 5L8KA 5ICPA 2Y4PA 4O0YA 4IX4A 4YNEA 5ACBC 4ZAUA 4JMQA 5L2TA 4GU6A 2ZMDA 4R5YA 3UPXA 4KRDA 2YIWA 4BDDA 2ETMA 2HOGA 3LMHA 3VBWA 3KN5A 4ZZMA 5M06A 3R8ZA 4A9SA 4PDSA 1YXTA 3DXNA 5CEIA 3R8LA 4WUNA 4FTLA 2PWLA 3OC1A 1MRUA 4JT3A 2XIZA 2YZAA 3DNDA 5BVEA 1ZMVA 1F3MC 3R2BA 3PJ2A 4YSMA 5HE2A 3EN6A 1P4FA 1TQIA 3PA4A 3QBNA 5JRQA 4X6RA 3IKAA 4H36A 5ACKA 2OICA 3EN4A 1Q3WA 4D2VA 5KX8A 4GJ2A 2HENA 3VS7A 5J9LA 4L44A 2VU3A 1WBNA 2QU6A 2Y6MA 2GFCA 3M2WA 4FV5A 4JQ7A 5HBHA 4USFA 3QKKA 3BV3A 4FT7A 4LV5A 4BCFA 3PE2A 4AA4A 4IFGA 1OL5A 3CY2A 1U46A 4NK9A 4XHKB 1TZDA 5A14A 5CAVA 5JFXA 1B38A 4TPTA 4OBPA 4L45A 3ANQA 2WU6A 4KINA 4H3PA 5DG5A 3LCSA 1ZZ2A 1ZOGA 3KEXA 1CTPE 2UVYA 3R04A 4RZWA 4CXAA 2JIUA 2BZJA 4RPVA 4P2KA 2XK3A 3VW8A 3MBLA 3VQUA 4IM3A 5DRDA 3LE6A 1ZARA 2YFXA 4PX6A 4R5SA 3WZUA 1LPUA 5K5XA 2WGJA 2J51A 3M11A 5DPVA 3GOKA 1PXLA 4E1ZA 2X9EA 2HZ4A 2IG7A 1Q97A 2PMIA 3MTFA 3TKHA 3VAPA 1FVRA 4CMOA 1WBVA 4DFBA 3W2PA 3UQGA 4O1PA 2C6TA 3FC2A 3OCGA 3WI6A 3LFQA 3ORTA 3FI4A 3PY3A 4LOQA 4PTEA 3KVWA 2FSOX 3E87A 4AAYA 4QQ5A 3WBLA 3EFJA 4EYJA 4DFUA 3U9CA 1Q24A 3O50A 3CLYA 3VQHA 2QI8A 2ZVAA 5HQ0A 2WTWA 2HYYA 5DT4A 1OIRA 4M15A 1JKKA 4ACMA 1OL2A 4TYGA 5J5SA 1V0PA 2FYSA 2BFYA 4IB5A 5FM2A 4I6QA 2QOFA 4G9CA 5CSXA 2XM8A 4L9IA 4YO6A 4GW8A 3TKIA 4FGRA 3QRTA 3Q5ZA 3R2YA 2JAMA 5JZJA 3MPAA 3MA6A 5AR7A 3C7QA 4I21A 4JQ8A 4DITA 4IVCA 1J1CA 3TZ8A 4CZUA 5IQHA 4QTEA 3UJGA 3DLZA 4JRNA 4U9AA 4EHEA 4AA5A 4FUXA 4DCEA 4QYEA 4GG5A 3KN6A 3WIGA 2IVSA 2OJ9A 4W8EA 4FSNA 3R8MA 4EWHA 2VTSA 2ERZE 4O7TA 4CG9A 2GMXA 3CKWA 3ET7A 2QU5A 4Z9LA 2CKOA 4KUJA 4X6QC 2O5KA 3FXXA 4G17A 4WOVA 3ZMMA 4CT1A 3PY0A 5M4IA 1BL7A 2W06A 2BIYA 2W9FB 5CASA 4BICA 4P5ZA 1FGKA 3DB6A 2F9GA 4LYNA 3UPZA 1GAGA 1PKDA 4DH7A 4O96A 5TO8A 2XNPA 4BF2A 4TYEA 3HAVA 3FLZA 3CGFA 4QEBA 4AZFA 3U4WA 2G2FA 2X6EA 3K2LA 4C59A 4F9CA 4YMJA 3H10A 4F1TA 4H1MA 2IN6A 4BHNA 3TNPC 3CJFA 5LVNA 4E4LA 2YM7A 3VBVA 3BGZA 5HNGA 1Y8GA 2UZVA 4Q9ZA 4BGGA 1T46A 4IM2A 2CKQA 4A9TA 3TNWA 3C13A 4RWKA 5AR4A 4BYIA 2ITZA 4V05A 2YCFA 3IDPA 4XLVA 2YZLA 4O0UA 1PRYA 3EQGA 3G90X 2QC6A 2UZLA 4U8ZA 3IDCA 3UOKA 4DEGA 2W4KA 3VRYA 3CXWA 4X3FC 3BBTB 3A7JA 3CR0A 5EKOA 4EOPA 3BHVA 1GIIA 4NKSA 4UWYA 5AV4A 1O6LA 4WA9A 4BR3A 1RW8A 3DK3A 5KKRB 1YWVA 1Q4LA 2I0EA 4FIHA 4OR5A 5DIAA 2J5EA 2QODA 4AACA 1UNHA 4JR7A 5AUXA 4C33A 3RM7A 3BYSA 1ZYJA 1ZZLA 2QURA 3V6RA 3A4PA 4MXOA 1K2PA 3K3JA 3M1SA 4O22A 5EOBA 3BHHA 1WBOA 2G2HA 3W2RA 4DH5A 4GKHA 5LMKC 3W0OA 1H27A 3GQIA 3C5UA 3LXPA 5CXHA 4HNFA 4EZ7A 4N6ZA 3W33A 5EYMA 3CJGA 4PDPA 4EJNA 2IF8A 3RZFA 5K5NA 3LKMA 4QP4A 2A1AB 4Z7GA 3IGOA 4D2PA 3V01A 2GTNA 4RIOA 4UZDA 1W98A 4X3FB 5CF5A 4QTCA 4A4XA 3VBXA 2B54A 3ZC5A 5EM7A 2W17A 3Q6WA 3FHIA 2X8DA 3UIXA 3GC8A 3KY2A 5AUUA 2CLXA 5BYLA 3AC1A 3R28A 5KMLA 2OZAB 4ENXA 2C0TA 3BU6A 5CEMA 5M4CA 3UC3A 4ANQA 1WVWA 3U51A 2CKEA 4GU9A 4OAUC 3OWKA 2UW0A 3FL5A 3DKFA 4HYSA 1ATPE 2OJIA 4M68A 4ZSAA 5CU3A 2WO6A 4PPBA 5IQIA 1R1WA 5EYCA 4QT1A 3D94A 1YXVA 3DY7A 3E62A 3CPCA 4J1RA 4JAIA 4L68A 4AUAA 1R0PA 3F7ZA 5FEDA 4XG9A 4FEXA 4J98A 3TV4A 2Y6OA 5IA0A 2W1EA 4ONAA 4NZWB 2PUPA 4MD9E 1HCKA 3ZO4A 2BPMA 2PVFA 4F1OA 1YI4A 3QA8A 3BL7A 4JIAA 3BRBA 4S2ZA 2NO3A 5E8ZA 3NYOA 5AR2A 2ITOA 1LUFA 4DC2A 4OUCA 2A98A 2C68A 2V7AA 4DT9A 5ETFA 3REPA 4EONA 3ORMA 4O7VA 3F9NA 3HDMA 2XBAA 3OY3A 3OCSA 4C58A 1SVGA 2G1TA 4U40A 5AEPA 4XNEA 5LMBA 3CTJA 4ZEGA 4IAFA 3BQRA 4WNKA 4DGNA 5CQWA 3K54A 5IH5A 4LRMA 3EQFA 4IZ5A 4QTBA 3RJCA 3V51A 1ZYCA 3FY0A 3EQBA 4MXAA 2QHNA 3C4ZA 4C4HA 3HV4A 2YDIA 2OXXA 1VEBA 2C47A 4AT4A 4F78A 4C3FA 3DCVA 1WMKA 3T9IA 4DEHA 4EH9A 5KBQA 3V04A 2C6OA 2GSFA 3PUPA 3VJOA 2ETRA 5C4LA 4QNAA 5TT7A 3LPBA 3Q04A 3RAWA 5BVDA 3FKNA 5B2KA 4RIWB 1V0BA 4MWHA 4OBQA 3WE4A 1SVHA 4B9DA 1W84A 2WXVA 3MVHA 5BYYA 4BDJA 3DTCA 4EK4A 3I1AA 5ETAA 3AKJA 3EOCA 3POZA 3VUMA 1JSVA 3FZTA 2C6LA 1WCCA 4G6NA 3ATTA 1YHVA 4AT3A 4FK6A 3KK9A 1OBDA 3BE2A 1FBNA 1Q5KA 3C0IA 3R1NA 4TZRA 3ZFXA 1IA9A 5IH4A 5AIKA 4DFLA 4ZY4A 4QP1A 2NP8A 4WG5A 3QUDA 4AS0A 4TYHB 3RMFA 1U54A 4I5HA 4UMQA 4P90A 4EL9A 1SMHA 2XB7A 3UYSA 2YWVA 4BDCA 3FI8A 4J8MA 2VWBA 4OT5A 3ORLA 3FLNC 5CF8A 2B55A 3Q4ZA 2PZ5A 3JPVA 3NRMA 4FX3A 5EW8A 3UYTA 3R21A 4OGRA 2XARA 4EC8A 3QCSA 2XIKA 4DGMA 4DG2E 3H9RA 3GCQA 3HEGA 5IEXA 3NUNA 2PU8A 4IAAA 5I3RA 4FRFA 5BUJA 3GQLA 5F9EA 2EWAA 1PXOA 2BAJA 3FWQA 3BLHA 3G9LX 4YC3A 4JBOA 5CSPA 3CBLA 4RFZA 5HG9A 2V7OA 4YPSA 5KHXA 5LCKA 2B9JA 4R7BA 3ZH8A 3RP9A 1YKRA 3BI6A 1YHSA 4OW8A 4H39A 4BCGA 2HXQA 4TWNA 2E2BA 4YHFA 5HKMA 2R3GA 3AC3A 1J7LA 1A9UA 4I94A 3VO3A 4BCPA 5C27A 1J3HA 3TKUA 3ZRLA 1TFFA 4MNFA 4EYMA 2VTMA 3F5PA 3EQHA 4WKQA 4EZ3A 1JKSA 4M84A 2UZTA 3Q9ZA 5D11A 3ZTXA 2C0OA 2V62A 4X0MA 5M09A 3UP7A 5IG1A 4H05A 5AAGA 3B8RA 1Q8TA 3ERKA 3D83A 3AD6A 1L3RE 4FTRA 3BIZA 3GB2A 5J95A 3O96A 4U80A 5CLPA 4K6ZA 5I9VA 3UIUA 5E9EA 4FA2A 4GRBA 4QMOA 4YJUA 3K3IA 5EHYA 5KMJA 4FF8A 3ZFMA 3B2WA 3A7HA 5E8YA 4BCNA 1KOBA 1QPCA 1PKGA 2NPQA 3ZONA 1UU3A 3KMMA 1DI8A 3LZBA 4JQEA 1MUOA 3DAJA 4I6HA 3QUEA 1H0VA 3D2IA 3F2AA 1KV1A 1P14A 3VS2A 4A7CA 2JFMA 3KVXA 3OTVA 1R0EA 2OH0E 4AE6A 5CU4A 3OBJA 4FSYA 5HD7A 3PSDA 3TZ7A 1OPJA 3O5AA 4ZLZA 2J7TA 2GHLA 4O0VA 1H1PA 4RWIA 4O83A 1XMLA 3DBCA 3MPTA 3NDMA 4F7SA 4FV6A 4PMMA 2QLUA 2XAOA 4HYUA 2EB3A 1WAKA 3BCEA 4RC3A 5L3AA 5FUTA 2W1ZA 4G5PA 2WKMA 5FXQA 5I9UA 3H9FA 3QQKA 2W1CA 4GFGA 3QTQA 3BGPA 5EI6A 2YISA 2GHGA 3Q4TA 3Q96A 2GNJA 5CALA 2NRYA 5A4TA 5ANIA 5LVPA 5DT0A 2ITPA 1YXSA 4QMMA 2OIDA 1S9IA 2HW6A 4WG3A 3T3UA 3GT8A 4IZ7A 5AA9A 2HY0A 4LGHA 3FQHA 3P7CA 3KF4A 4AOTA 4CMUA 2JD5A 3FMKA 2R3MA 3QC4A 4F6SA 3F3ZA 3DGKA 4FEQA 3EN5A 2PMNX 3O7LB 2BR1A 4X21A 4E4XA 3V8WA 4LGGA 1YHWA 4W4VA 4XV1A 1NA7A 4U79A 3W55A 3VIDA 4AZSA 2Z7RA 5IDPA 4LUEA 4MH7A 3C4FA 4FKWA 2QOBA 4N57A 4WHZA 3LQ8A 1SM2A 3G2FA 3KRRA 2QOLA 3ZLXA 4BJJB 5JFVA 3ODYX 4XG3A 5CYIA 5C9CA 2GQGA 4XG6A 2OWBA 4R3RA 4WG4A 1T45A 3W2SA 1H1QA 3TMOA 2R5TA 3UOJA 1JBPE 3NNUA 4J8NA 4C36A 3W0NA 5B2LA 2QNJA 4FGBA 5CI6A 4YLJA 5E8SA 4AW5A 3BELA 3HDNA 1O6YA 2QHMA 2DS1A 4GFOA 2JDSA 2C6MA 1ZLTA 3SQQA 4O7LA 4NUSA 3HZTA 5DE2A 4YR8A 5LWMA 3GU5A 2ITNA 5ANDA 4KIOA 3KU2A 3AT4A 4BCQA 5IEVA 4QMPA 4QMQA 5LMKA 1L8TA 5CXZA 5HE1A 4NFNA 3BV2A 1YVJA 4GCJA 5CSWA 3GC9A 2ZAZA 2OF2A 1UVRA 3HKOA 3QRUA 3N9XA 1JNKA 4RVKA 4YC6A 4ZY6A 3ZO3A 4EUUA 3MVJA 3UIBA 1XO2B 3QAME 1EH4A 3T3VA 4DAWA 4EHGA 2C6IA 2JGZA 3ATSA 3FYKX 3OXIA 5I5ZA 5EDPA 4FYOA 2ZV8A 2EXCX 1WVYA 2WZJA 1UNGA 2XNGA 1SVEA 2PVNA 3CC6A 3QLGA 3ULZA 1VLRA 3P08A 3GI3A 4IM0A 5FQDC 3NMUF 4ALWA 2J6MA 3R71A 1MQ4A 4BY9E 2WHBA 2ONLA 2W1FA 3BKBA 4BCIA 4RLKA 3A8XA 1JVPP 3F82A 4KIKA 2VO3A 3WZKA 2FA2A 3AC4A 4G6OA 3FMJA 3NNVA 3MS9A 3PXKA 1H24A 2B52A 3A62A 3AMBA 4O0WA 5JEBA 4AZEA 1XH8A 2CGVA 3WF7A 1OMWA 5HG5A 3WILA 3IW7A 4Y8DA 2XRUA 2R3OA 3ANRA 3LFBA 4JJRA 2VWIA 2BTSA 5D7AA 5ANOA 1GZ8A 5HBEA 4C4FA 3FEGA 5K3YA 4K2RA 2GS6A 2YCRA 2ZOQA 3KMUA 5F1ZA 5CNOA 3UO6A 4AP7A 2WD1A 3SHEA 3A7IA 3O2MA 3FHRA 4R77A 2WMUA 2XEZA 3MH0A 2CKPA 2QO2A 3IDBA 5FXRA 3RM6A 3G0FA 3EQPA 4L01A 4HVHA 5LOHA 4C35A 4UYAA 1V1KA 2F7EE 4KS7A 3LXKA 3VS6A 4O6LA 4EH6A 4ANSA 2OF4A 3NUYA 3MB7A 4M14A 3DFCB 3JVSA 5DA3A 3MV5A 1V0OA 5TF9A 2OKRA 4DLIA 2BZKB 3DXPA 3BZ3A 2OGVA 5K0XA 3D7TB 2VTIA 3DV3A 3FQSA 5F20A 3ZO2A 1CMKE 2XNEA 3P9JA 2Y8OA 3QX2A 3QTZA 4HNIA 2BRNA 2CN5A 2PVRA 5I9WA 3ZYAA 2X2KA 3LJ0A 3QFVA 2WMWA 4RVMA 4DH1A 4I5CA 5A6OA 2CHLA 2WMSA 5KHWA 4RJ4A 5EQYA 3JY9A 2UZOA 1XH4A 4U43A 1ST0A 2P33A 4F64A 3W0MA 3EL8A 4KNBA 4AXCA 4TL0A 3AGMA 3CSVA 4BDKA 4U0IA 2X8IA 5E8WA 3DBQA 4PL4A 2Z7SA 2VV9A 5M07A 3PWYA 4OLIA 2ZM3A 1PYEA 1YOMA 4RRVA 4DHIB 4YJPA 5IKWA 4AFJA 4NTSA 4FZDB 4NSTA 2WIPA 4C3PA 1E9HA 1MRYA 4M67A 4LI5A 4S32A 2Z60A 1HOWA 4FV3A 4XRLA 3B8QA 3I7CA 4F08A 4BCJA 3V6SA 3Q2MA 3LM5A 5KMIA 4AXFA 4JIKA 4QP6A 2WTVA 5DT3A 5IQEA 3L8PA 3O0GA 4AX8A 4FTQA 4J53A 3IG7A 4AT5A 5J79A 2F7XE 3FZRA 4GK2A 1UWJA 3A7FA 4BRXA 1U5QA 3NW6A 3O71A 3OMVA 4J96A 4WRSA 1AQ1A 4DA5A 3KCKA 4TKSA 2WMTA 3NYNA 3E5AA 3OF0A 3PIYA 4BDGA 4FEVA 4K33A 4PY1A 3W18A 3PTGA 3NX8A 3D14A 3MH3A 2ESMA 4QYGA 2C5YA 4JG7A 2QG7A 5BUIA 4G6LA 3GU8A 5H8BA 4EBVA 4ZTSA 5KBRA 5DHJA 4Q2AA 1RJBA 1W83A 4EK5A 3COIA 3F6XA 4NYEA 3Q6UA 4P4CA 5DFPA 2GU8A 4XG8A 2VTOA 1QCFA 3DT1A 3PVUA 4G3CA 4B7TA 3VONA 4E7WA 2PUUA 1YW2A 4D4RA 3A60A 3V5PA 4RZVA 4FG7A 3CY3A 5IQAA 2C3IB 4Y5HA 4AG8A 3UDZA 3TV7A 4O0XA 4OTPA 2P2HA 3LQ5A 5CI7A 3E93A 5CSVA 4BI1A 1PMUA 3GU6A 1K3AA 4IAIA 3W0SA 1STCE 4BTJA 4ZTNA 3SOAA 3FUPA 4W9XA 2QR8A 1M14A 3HP5A 3I6UA 1BI8A 4D4VA 3HMMA 5A4QA 3FYJX 4C61A 5BVNA 4H58A 3E92A 1REJA 1JQHA 2BHEA 3CD8A 4ZLOA 5I9XA 5DOSA 1PF8A 4AXDA 4IC7A 4RX7A 4ZXTA 4EKKA 3QTSA 3ELJA 2CCHA 3HLLA 4JS8A 1H08A 4YU2A 2F57A 3A99A 4ZTQA 4Z3VA 4A9RA 2P0CA 5IU2A 5JN2A 2VTAA 2XKEA 3LFEA 3TZMA 3IONA 3TCPA 3VUTA 4ID7A 2REIA 3QD4A 4WSQA 4PDYA 3CKXA 5HIDA 5C4KA 1OL6A 5L8JA 4APCA 5IF1A 2JDTA 1OGUA 3KULA 2X4FA 4RQVA 1GZOA 4RWLA 2BRMA 4Y85A 4DGGA 4DFZE 4EH5A 4E4MA 2PUNA 4U45A 4QMWA 2FGIA 4FODA 4BI2A 4YHJA 5K0KA 2EB2A 4DTAA 4JVGA 2OG8A 2AQXA 1PW2A 4CKJA 2GFSA 5HNIX 3WIKA 3BHYA 3ZU7A 3DFAA 4RC4A 5AR5A 2QKRA 4OTQA 3FI3A 4L3LA 2CGUA 1CKJA 4QP3A 3C4CA 3OZ6A 3QTIA 5F4NA 4C4IA 2XNBA 2WPAA 3R7UA 1GNGA 3AG9A 4D0XA 3NAXA 2ZFYA 4AU8A 4DEDA 5J5TA 4MQ1A 1H26A 4QMLA 4DH3A 3VBQA 2X8EA 1ZRZA 3BGQA 3ZOSA 4IW0A 3ZLSA 4BGHA 2QOCA 5HD4A 3WZEA 5HLNA 2UZNA 2RFNA 2OJGA 2FSMX 3A4OX 3MFTA 3PSCA 4M69B 4U3YA 4FUYA 2BTRA 5L2QA 1UU9A 3QWJA 4J99A 4K9YA 4QNYA 4UMRA 4XYFA 5CEPA 4LL0A 2QOHA 5BX0A 5FWKK 3AD5A 4F4PA 4OAVB 5HG7A 4KWPA 1NW1A 3ID6C 5L6PA 3VUIA 3SG9A 3BEGA 3PFQA 5T68A 4B6LA 2I1MA 4ANLA 3P1AA 4FC0A 4O4FA 3FMLA 3EQCA 2VX0A 5E1SA 4O7YA 2XCKA 3HMOA 3V5TA 3K5UA 3IOKA 3NNWA 3GXLA 5HOAA 1Y91A 4GYGA 3ZBFA 3ACKA 5HU9A 4NTTA 4QMSA 1WBTA 4FL2A 3GFWA 3L1SA 4II5A 4C2VA 4O7WA 2XALA 3LCDA 3PVWA 3OXZA 4I6BA 4YTHA 2C1BA 4WD5A 5HO6A 4BFMA 4IACA 5DEYA 3QD0A 5K4JA 4UX9A 2JAVA 4NM7A 3L8VA 3NEWA 2XK6A 3LMIA 4XOZA 2KULA 3P5KA 5HORA 3QQLA 4YGAA 5C01A 4BTMA 3G51A 3PG1A 3PXRA 4IVAA 5AUYA 4KKHA 3LFCA 1OITA 1F5QA 3QF9A 3HAMA 2VWZA 2NRUA 4XP2A 4FTNA 2Y4IB 3KQ7A 4TN6A 4IVDA 4O4DA 3TM0A 3SG8A 5DBXA 2XNOA 3PZEA 2QCSA 3PPJA 3V5JA 4BZDA 3IQ7A 4AN9A 3OW4A 1PXPA 2OXYA 2XM9A 4GUEA 3F5UA 1GY3A 2YHVA 4QRCA 5EKNA 4RLLA 5AP5A 3P78A 5CEOA 5GZAA 5FP5A 3ITZA 2RSVA 2R3PA 1W2DA 2J0IA 4ZMFA 3DZQA 4Q9SA 5KZ0A 1ZY4A 4RA4A 2R3NA 1F0QA 2HY81 5IQFA 1OKYA 5IMEA 3AC2A 4IWQA 3JY0A 4K18A 1YXXA 2JKKA 1RE8A 5D12A 5D41A 3OWPA 3W2OA 3O17A 1URWA 2VX3A 1OUYA 2OJFE 4D1ZA 3E3PA 5AV0A 3HUCA 4FJVA 2WNTA 4L8MA 4RJ7A 5I3OA 4QP9A 3R8VA 4JX3A 4AF3A 4L42A 4YJOA 5JK3A 4O81A 4A4OA 4YTCA 5D1JA 2HIWA 4AZTA 2A19B 2VO7A 4ZOGA 3R9HA 4YP8A 3THBA 4XJ0A 4JDHA 5L2IA 4M97A 5AADA 3DTWA 4FIGA 3SA0A 3U6HA 1JSUA 1M2RA 2J5FA 4O4EA 3W8LA 2HW7A 2C6KA 3D2KA 2O2UA 2UZDA 3NAYA 4NCTC 2OI4X 2VD5A 3AD4A 2XEYA 3UODA 3AMAA 4QPSA 3FBVA 1J91A 4MD8E 2VWXA 4MBJA 4KS8A 4CFXA 2C5NA 5AR8A 4ASEA 3NPCA 5KKRC 4FTUA 2YWPA 4F7LA 1QPDA 4ZSEA 3I81A 3EFKA 2QR7A 4LRJA 1M2QA 3RGFA 1ZY5A 3RKBA 4C57A 3UZTA 2IW9A 1W2CA 2SRCA 2YABA 2NNWB 3SXRA 1OIUA 1VZOA 5FG8A 3TNIA 2WTCA 4IBMA 3F3TA 4HCUA 1SNXA 3QTRA 4DHFA 4FE2A 3QU0A 2XIYA 5EW3A 5EW9A 3PXYA 4TYJA 4MBIA 4XEYA 3ORKA 3S00A 3HV3A 2EXMA 2J90A 4QMYA 2VTJA 2WOUA 4YZBA 1Z9XA 3KXHA 2BUJA 2CLQA 4RC2A 4CFMA 4UMPA 5AFVA 2J2IB 3TV6A 3Q53A 3RK7A 4AW0A 4BDFA 3NVKI 4OTDA 3GC0A 4GSBA 5FXSA 3FZPA 2CNVA 2H96A 5HHWA 5CT0A 4L43A 4BYJA 3NUAA 4JNWA 4I1ZA 3ZDIA 2YERA 5L4QA 4YURA 5CSHA 4F1MA 4FIIA 5TE0A 2JEDA 1G8SA 3RWQA 2C69A 3RCDA 3NR9A 3ENMA 3QWKA 4IJPA 4YTIA 4JOAA 4V01A 3I5NA 3PWDA 5JZNA 3VS4A 3QKMA 2OZOA 2B9FA 4L52A 4XBUA 5EOLA 4GYIA 3NUUA 3QKLA 3AT2A 4UWCA 1IA8A 4FTMA 3KCFA 4M13A 3PFYA 2W7XA 3HRFA 2J0JA 4BCOA 2HCKA 5FGKA 4QQTA 3SRVB 2BHHA 4JG8A 4XLIA 4EOKA 3HA6A 2R3QA 4WIHA 4EKLA 3UBDA 1OBGA 3AOXA 4O2PA 4GL9A 2IEWA 3MN3A 4BIEA 2UW3A 5LJJA 4DF3A 3KA0A 2ITQA 4CFWA 2JBOA 5HLWA 2JIIA 2GHMA 4IAZA 1W2FA 3POOA 4XG7A 3MJ1A 1Z5MA 2F49A 4EQUA 5T3QA 1FPUA 1OKZA 2H6DA 4FYNA 2XKDA 2WFYA 3HGKA 3KXGA 2HXLA 4NT4A 4PUZA 3R83A 4EH4A 2W1GA 3EQRA 5IH6A 4GUBA 1Z57A 5A46A 4V0GB 5HX8A 2WTDA 3NSZA 3TTIA 3ORXA 1KE6A 2BAKA 4MXXA 3OTUA 4HOKA 4KKGA 4AGDA 4AW1A 4QPAA 2CGWA 3AMYA 4FTTA 3UZPA 5DMZA 4FL1A 3BYUA 4ANNA 2BFXA 3FY2A 4AXEA 3PLAE 4XV2A 5CEQA 1OI9A 2JKOA 2XAMA 4FZFB 4MXYA 1CDKA 3TUCA 3KRXA 4J97A 4ZJVA 1PXKA 2GDOA 4IADA 4D9UA 3W0PA 4FTAA 5JQ5A 2P3GX 5M57A 1YI6A 5ANGA 3TIZA 4YHTA 2BKKA 1TVOA 3SXSA 1IRKA 4PTCA 2WTIA 3HMNA 3VUHA 5BMSA 3CQUA 5ETCA 4C37A 1TQPA 1DAWA 2PVMA 3QCQA 4XCUA 4I5MA 4ZZNA 3FSFA 3V3VA 2R3JA 4YJVA 4YO4A 5L8LA 3D5UA 4C7TA 3PRIA 3UE4A 2X0GA 4FVPA 1ZYLA 3Q9WA 3S2PA 3ZHPC 5HE0A 3SW7A 1OVEA 3BEAA 4KIKB 5DWRA 4TWCA 5FLFA 4QMNA 5AUTA 5HVJA 3KRWA 5IMXA 4NIFA 4E4NA 2I7QA 2UW8A 5E8XA 4DH8A 2VWWA 3DJ6A 2W1IA 3EN7A 4CFUA 3CIKA 3GBZA 1H8FA 3EIDA 1GZKA 3EN9A 3QZIA 4PMTA 3GCVA 4NJ3A 2G9XA 5TR6A 2FSTX 3RAKA 4DE4A 2DUVA 2XVDA 3HMIA 4DTBA 1E1VA 3TIYA 2X2MA 3BX5A 5CF6A 4XV3A 4QMZA 4RIYA 3H0YA 1FGIA 3MSSA 3NS9A 3U4UA 3EZVA 3NIZA 5KNJA 2ZV7A 4FV7A 3WOWA 2PPQA 3P4KA 3D15A 3N4TA 4PNKA 3C0GA 5C26A 3GC7A 3OOGA 4K8AA 2HAKA 4MXCA 3MTLA 4QDVA 4A06A 3PJ8A 4JLCA 4UXQA 5GJDA 4GG7A 3UG2A 3RPVA 1M7NA 2GNIA 4IB1A 2RF9A 5M4UA 4ERWA 4KBKA 2IPXA 4PTGA 2CCIA 2VTHA 2VWVA 3O7LD 4XS2A 3SAYA 3TEIA 2JLDA 5I9YA 2F2CB