2G2FA

A src-like inactive conformation in the abl tyrosine kinase domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
275
structure length
275
Chain Sequence
YDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAPAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abl Kinase
publication title A SRC-like inactive conformation in the abl tyrosine kinase domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2g2fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2g2fA01
1NA7A 2CPKE 4NCTA 5T68A 5DOSA 4KIKB 1WBNA 3AMAA 4FSNA 4D1XA 3ZYAA 1DI9A 1YOMA 2XBAA 1GZOA 2YCSA 4KSPA 4RLLA 2JDOA 4CT1A 3Q6UA 3QTUA 5J9YA 2BKKA 3VF9A 4BI0A 4ERKA 3D15A 5I9UA 4DFBA 4ENYA 3RMFA 1JSUA 3DPKA 5JRSA 3FLQA 1ZY4A 2XK8A 2A1AB 3AC8A 3W2SA 2GS6A 5AX3A 5K4IA 4H58A 3BEGA 5DR9A 5L8JA 3SXFA 4CQGA 5FEQA 4QQTA 1O9UA 1U54A 3W1FA 2BPMA 2X4FA 3W33A 3EB0A 4PNKA 4G9CA 4ZTSA 1P14A 4H3BA 1Z9XA 2ITZA 4RIXB 5CEOA 5LWMA 2GSFA 3ORMA 3CTJA 4NM3A 1DAYA 2QG5A 1LUFA 1J7LA 1P4FA 5I9XA 4E73A 2WMQA 5KMNA 3NUNA 3OOMA 2YWPA 3PG1A 2CDZA 3MA3A 2JC6A 4HVGA 3GU5A 1WBSA 2C1BA 5J1VA 3CTQA 1GZNA 5FTOA 4DN5A 4AW5A 1L8TA 4O1PA 4ZTMA 2O63A 4DC2A 3KK8A 4PL4A 4IC8A 4O38A 3TEIA 3UOKA 3ZM9A 4FUXA 3H0ZA 3R9HA 5IMEA 3W2RA 3DK6A 4DGNA 3HMIA 1S9IA 3O71A 4MXAA 4PQNA 4G3DA 1PXNA 5CEIA 4ACHA 2NNWB 2JFLA 2SRCA 4QTEA 3F88A 3TV4A 5E92A 3UC3A 4KIQA 2UZWE 4U42A 3D14A 5AUTA 5FUTA 4LI5A 4Y73A 3FZRA 3QTSA 3M1SA 4RJ6A 4ACCA 1V0PA 3WIKA 1AQ1A 3Q96A 1T45A 2YM3A 2R3OA 1PY5A 3F3UA 3FV8A 2R4BA 5IU2A 2OIQA 2PVKA 3DA6A 3ZBXA 2Y6OA 1YW2A 1M52A 3MVLA 3OC1A 4YTIA 3R8VA 5IPJA 5E1SA 5EK7A 5A3XA 3GT8A 2VWYA 3W2OA 3TNPC 2BROA 2QOKA 4EOPA 4IWQA 4E1ZA 5AAEA 5FDPA 4BC6A 4FT7A 3ZONA 5AUVA 4A9SA 3ZRLA 4QP7A 3BU3A 3IPHA 3PXQA 4WSQA 4QD6A 3TACA 4C36A 4X3FC 5BYLA 4EQCA 1PJKA 4FVPA 5HIBA 4KRCA 2WTDA 5JFWA 4UMRA 4RC3A 3OUNB 3F3ZA 2HY81 3ALNA 4YJSA 1Q5KA 2XEZA 4TXCA 5LCKA 4L52A 3VJOA 2X8EA 4IDVA 3TCPA 3EQBA 3KK9A 1Y6BA 4Z9LA 4HNFA 2NRUA 1YDTE 3NW5A 1ZYLA 4E3CA 5IQHA 4NZWB 3F69A 3MJ1A 1P2AA 4YC6A 5FEDA 5CEKA 2GHGA 2J50A 2C0IA 3OS3A 4C7TA 2J51A 1TQPA 2X81A 3GOPA 1X8BA 4TNBA 5KMIA 1V1KA 1XH6A 4CLIA 2UZDA 3TJCA 2OKRA 3HLLA 4YNEA 5C9CA 3OZ6A 4R7HA 4BKYA 3TZMA 2ITWA 3H3CA 2QONA 2H8HA 3JYAA 3EJ1A 3QXOA 4I6HA 4FYOA 5K9IA 5J9LA 1WVWA 3A7IA 2CCHA 4YTCA 4MQ2A 4PNIA 4QPSA 4WSYA 4MH7A 3NUSA 2W1HA 2R2PA 3JPVA 4WO5A 1GJOA 3VVHA 5J1WA 5BX0A 4DLJA 5A6OA 4RC4A 2XA4A 1EH4A 4O21A 1FPUA 1FVVA 4I6FA 4ZOGA 3QLGA 2C6EA 3A7JA 3FMKA 4BKZA 4BFMA 3TUCA 3LKMA 4CTCA 4GVJA 4KKEA 4R3CA 3QD0A 3IW8A 3CJFA 2J0MB 4JG8A 1F5QA 3FMEA 3MI9A 3FMLA 4IVCA 2O65A 4MX9A 3ZU7A 4QMOA 3F66A 1WBWA 4LQMA 2P4IA 4R1VA 4EWHA 2UW4A 2GNIA 4UBAA 3PJ3A 3QCQA 4JXFA 1JLUE 5B2KA 2OH0E 1YDRE 1V0OA 3PP1A 2KTYA 4FG8A 4RQKA 5EG3A 4TWOA 5FLFA 5LMKA 4B8LA 2CJMA 2R0UA 3N4VA 4DFYA 4UMTA 4BCPA 3TNHA 3PE2A 3MJ2A 4FIJA 4N70A 3TKUA 4EOKA 2Y8OA 3HV5A 3U6JA 4I93A 3E64A 3LMHA 2R3MA 4ZZMA 2XVDA 2W9ZB 3CS9A 4EZ3A 4CRSA 4RA5A 2PYWA 3FMHA 2JIIA 3DQWA 1LR4A 1OPJA 2WTWA 3FMMA 4FODA 3TL8A 4BCMA 3ZLXA 3ET7A 1E1VA 1JQHA 2IZTA 3DU8A 4AN3A 3S1HA 4IB5A 4LV5A 1WMKA 2R3GA 3G90X 3QQKA 4ZJVA 1OECA 5CVGA 4RLKA 4G5PA 4UALA 2PE2A 3RCJA 2J7TA 3DDPA 5DRDA 5GNKA 3QA0A 3UIUA 1YI3A 5DRBA 2C3IB 4OTGA 5CEQA 4DEHA 4YZ9A 3R7OA 3HDMA 5B0XA 2OH4A 2W5BA 3KFAA 4FBXA 2JD5A 5HU3A 5AV2A 3HV6A 1DI8A 4QMNA 2F9GA 2PVFA 3ERKA 5BVEA 2R3IA 5EYKA 3NUXA 3KB7A 3Q9WA 3C4XA 2XKCA 3NW7A 1ZMUA 4FL1A 2J0IA 3AD4A 2B9IA 3EN4A 3ORKA 3BHHA 4FKGA 4RVTA 3UVRA 5CASA 2J2IB 2CSNA 4H3PA 5A4EA 4Q2AA 4TRLA 3ANQA 4R3PA 4APPA 3LFCA 4XG4A 5C03A 4PDOA 2BVAA 3UG2A 3CEKA 5DR6A 5CXZA 5JRQA 3D5WA 3FI4A 3KGAA 4JI9A 3G5DA 1NT2A 4CEGA 4DH1A 3HECA 2UVXA 2PHKA 3KF4A 4U7ZA 5HX6A 5ETIA 3PWDA 4NH1A 2IW8A 3R21A 3PLSA 3QD2B 3U55A 4CQEA 3GP0A 3CP9A 2B7AA 3PUPA 5BVWA 4DEIA 5BVFA 1E9HA 1KWPA 2XK7A 1ZOEA 2I6LA 4L44A 4O0SA 4I6QA 3ZCLA 4BHZA 3C5IA 4L43A 4N4SA 2CN8A 3C4WA 4IB3A 4FV7A 3PPJA 3SVVA 5HESA 2ZM4A 3FZPA 3QL8A 4LUDA 1IAJA 2HK5A 3PWYA 1VR2A 1IRKA 4QMZA 4QQ5A 5LCJA 4E6DA 3B2TA 3AT2A 2BRMA 3I1AA 4U3YA 5K5XA 5KMMA 5FP6A 2KULA 4WD5A 4QP6A 1WFCA 3OWKA 1VYZA 3OCGA 4NW5A 2C6TA 4FNYA 2VTIA 2GMXA 4MTAA 4NWMA 3FHIA 1KOBA 4ZXTA 1PMVA 5HCYA 3V6SA 3DBQA 3LQ5A 3HRBA 1NW1A 1YXVA 2Q0BA 3TIZA 4CZTA 3G15A 3Q9ZA 3ZO3A 4U41A 1BLXA 2C6DA 4CYJA 5L2SA 4DF3A 2VZ6A 4MNEB 4D9TA 4W4WA 3D5XA 5EHYA 2VGPA 3TKIA 5HORA 3C9WA 4L42A 2XB7A 3R1SA 3TDWA 2QR8A 3NPCA 4KIKA 1SM2A 5C27A 2UVYA 3IQ7A 1K3AA 4FF8A 4RIWB 2OXDA 4ZY4A 3FYKX 2JFMA 5EDPA 4B8MA 3VS5A 3WF5A 1ZYDA 3O8PA 4JQ7A 5M07A 4RWLA 3UP7A 5D9HA 1GOLA 2CGVA 4I3ZA 4X6QC 4O7RA 2YIXA 2QU6A 1OBGA 4AUAA 3FY2A 4QYYA 3BRBA 5AADA 2YEXA 2X2KA 2A27A 2X7OA 1RW8A 3FXXA 4P5ZA 3JUHA 3WE4A 3V01A 1ZY5A 3OTVA 3F9NA 4RIXA 4C8BA 4HCUA 3QHWA 4LMUA 4FX3A 3MVMA 3HZTA 2C30A 3E8CA 4WNMA 2W9FB 1ZWSA 5BVKA 5HQ0A 4EH4A 3A7HA 2XM8A 2YIWA 2YIQA 3LFDA 3G6GA 4U5JA 2P0CA 3FXZA 4QP2A 2O2UA 4IZ5A 2GNLA 3IS5A 4DTBA 3R1QA 4BCGA 2JKMA 3BV3A 4EJNA 4IAKA 1H27A 3FUPA 2VWUA 1OPLA 2HOGA 5CSXA 5KMOA 3UIMA 4DCAA 2VWIA 3QUEA 4XP0A 5EM6A 4AW0A 3KU2A 4NKAA 4G6OA 5EW3A 4J8NA 5BMMA 4ZIMA 4GG5A 3A60A 4JT3A 2AC5A 4KA3A 4M97A 5F20A 5HKMA 1HCLA 3FPMA 3QGWA 3QTXA 3UNKA 3JVRA 5CSWA 4KS7A 3CIKA 2YDIA 4O0RA 1PXKA 1G5SA 4F0GA 5JN2A 5EQPA 3W8LA 4XOZA 4MKCA 4HYUA 4FV0A 5FBNC 4FK3A 5G6VA 2C68A 3ZDUA 3L9MA 1GY3A 3SDJA 2VO7A 4QMUA 4PL5A 3QRTA 1IEPA 5BMSA 4L9IA 3VQUA 1JKTA 2ZV7A 3G33A 3GVUA 4QMMA 2XNGA 4WOVA 5HE3A 5CVHA 4IW0A 3Q2MA 2RFDA 4BCQA 2OJJA 4HGLA 5EQYA 5E1EA 2ERZE 3UBDA 3BHUA 3V6RA 4DEGA 3AMYA 4I5PA 2FSTX 4AFEA 3BZ3A 3LXPA 2CN5A 1NVRA 4FMQA 5TT7A 3S0OA 4HZRA 3R22A 3KULB 5BYYA 4TTHB 4WUNA 4W4YA 5L4QA 3DAKA 4O7LA 3CBLA 4FTAA 3PPKA 3PXFA 4GVAA 3MS9A 5CAOA 4XMOA 3ZFMA 2EXMA 3OTUA 3Q4TA 2W1GA 4E26A 4PTEA 2VO6A 4D55A 3G6HA 5HX8A 3BV2A 5IQCA 2CGWA 2R3HA 4PP7A 3EQPA 4E93A 3NVMB 5KUPA 4M68A 5EOBA 4CZYB 3NLBA 3EH9A 2YZLA 2VTQA 4GW8A 4QMYA 2YIRA 2LAVA 3QZFA 2VN9A 2OLCA 5CZIA 2RG6A 2ONLA 3I7CA 3AGMA 3PIXA 2UZOA 4AX8A 5AR5A 3V5TA 5EKOA 4LOQA 1W84A 4UV0A 3EWHA 4IZ7A 4QPMA 3SRVB 3I79A 5C1QB 3Q52A 4FVRA 4FG7A 1Q8TA 1L3RE 2PTKA 2YAAA 1WAKA 3LJ0A 4U79A 3BYMA 4FIGA 4GFMA 4YSMA 3LXLA 2WMWA 4BDDA 3L9LA 2JAVA 3GU4A 3KQ7A 3OT3A 4I0TA 4C58A 3RHXA 4UX9A 1R78A 3D9VA 3TM0A 2X1NA 1M2QA 5HHWA 2ITOA 3KRRA 4RIYB 4GFGA 4ZMEA 3PFQA 2WMAA 4PMTA 3GQIA 4LMNA 3UQGA 2YACA 5AUYA 3PG3A 2W4KA 4X21A 4ZK5A 5JQ5A 3U4UA 1G8SA 3KVXA 3OBGA 3ZM4A 3AQVA 3NNXA 5IH5A 3DNDA 3QALE 4RWKA 5J7HA 1ZOGA 1KUTA 4M8TA 4ZTHA 3PJ1A 2PVYA 3A7FA 4QO9A 5LARA 4K0YA 1CM8A 4IMYA 2XIRA 4U97A 3BE2A 3GGFA 4G17A 5CVFA 3OCSA 2JIVA 4OUCA 2JDRA 2W4OA 4C2WA 3TNWA 3VW8A 2BRHA 4I1ZA 1SMHA 3HYHA 3BGQA 3OW3A 4TNDA 4AE6A 3C0HA 3KL8A 4ANNA 2B54A 4FKQA 3C5UA 2VTRA 3ITZA 4ORKA 4F6UA 4NUSA 2JBOA 4O83A 1KV2A 1TVOA 2WOUA 2WTVA 1Q97A 3R6XA 1OL6A 2PE1A 4IFGA 4ANQA 2Y9QA 3I60A 1BL6A 4KBAA 2PVMA 3NW6A 4S2ZA 3ZC6A 4EKLA 1YOJA 3W10A 5HZNA 2H96A 1KE5A 4AF3A 4YUQA 2OF2A 3MN3A 3P7BA 2VX1A 3T8OA 4A4OA 5IDPA 3SX9A 3F7ZA 3PZEA 3QRUA 5K0XA 3GFEA 2BR1A 1H00A 5IISA 3EQDA 4MD8E 3TI1A 4WRSA 2PUUA 2HZIA 3QTZA 5FBOA 2UUEA 2Z8CA 5K3YA 4EORA 2WEVA 4AOTA 4FKPA 4KWPA 3CSVA 1Q24A 2REIA 2X6DA 1TQIA 4NJDA 5FM3A 1FOTA 5H9BA 2JBPA 3R9DA 3UVPA 4OAVB 3NS9A 4EQMA 3BCEA 1PRYA 3QQGA 2XIZA 4QMWA 1Q8YA 4GJ3A 1OM1A 5AP2A 3C13A 4MVFA 4XG2A 3BLRA 3PLAE 3R30A 3SLSA 4ACMA 3DK3A 5CLPA 3DBEA 4C3RA 3TV7A 2YCQA 3BU6A 3R2BA 4E6CA 1B38A 2J90A 3PTGA 3VBXA 5E8XA 5HG5A 4TY1A 5DN3A 5LXMA 4O7SA 2RSVA 2OSCA 3A4PA 3G0FA 3QRIA 4JL9A 4O0YA 2C3LA 4EH6A 4I5MA 4K1BA 3ZRMA 5AV1A 4QTBA 5BVNA 4ZJJA 2QOCA 3LCTA 4IEBA 3B8QA 4RJ5A 2IJMA 3OCBA 2ZV9A 4RX9A 1KSWA 5JQ8A 4A9RA 4FV9A 3TZ8A 4GUBA 5T6KA 4RX5A 3AC5A 3MVHA 1HCKA 3OG7A 5HCZA 5I4NA 1B6CB 3MH2A 3D2KA 2YERA 3E87A 2C6MA 3NAYA 3FI2A 3QZHA 1P4OA 2W05A 4PPBA 2C69A 3ZC5A 5M06A 2DQ7X 2P2HA 4I0RA 4YPDA 1REKA 1FGKA 2P55A 3CXWA 2OJFE 2WQMA 4G3CA 1A06A 2PZIA 1GIIA 2UZBA 2RGPA 2YM8A 3HMMA 3G9LX 2WMRA 4GIIA 4JNWA 4RVMA 5AM6A 5IMXA 1H8FA 1OMWA 3F5UA 4NM7A 4KNBA 2HY0A 1PW2A 3D7ZA 4X2JA 3NYXA 2ZM3A 2JKOA 3DZQA 4GYGA 5HG9A 3E3BX 4EBWA 2B55A 2OJ9A 3P86A 4AS0A 3R7IA 4RMZA 3IECA 4D28A 1OPKA 1XBAA 2WNTA 4YJVA 3UTOA 3ZRKA 1BYGA 4TYIA 5DHJA 1IASA 4YBJA 3R9OA 3QGYA 3UNZA 5KNJA 3HP2A 4FT5A 2QLQA 4FTQA 4I21A 3FPQA 2AC3A 4O0VA 4YTHA 2FVDA 1H08A 4S33A 5IKWA 3DAEA 2XKDA 4D2VA 4V04A 1JSVA 4LOOA 4Z3VA 4GU6A 2EXEA 2QOLA 3S95A 4XBRA 3ODYX 3WZKA 4H05A 3R8ZA 1O6LA 4OLIA 2GNHA 4UWCA 3RZBA 2Z7QA 3FXWA 3VN9A 4FYNA 3D83A 2ITTA 3ROYA 3EFWA 4FK6A 2W06A 4IX6A 5CT7A 4CTBA 2P33A 5HO7A 3CJGA 2E9UA 2F2CB 3DJ6A 3VS7A 4Y72A 4CG8A 4MNEA 3FHRA 3R63A 4R7BA 3E88A 2ZOQA 2X8DA 4KSQA 4YBKA 3PVUA 2VTLA 3UNJA 2P2IA 4D58A 3RAIA 4QYGA 3V5PA 4KUJA 4FV8A 1ZYSA 3MPTA 5CF6A 2OF4A 1JKKA 3DZOA 3O7LB 4W9WA 2VTJA 4BGGA 4CFFA 2PUIA 2GDOA 3BU5A 4RIWA 2WGJA 5CU6A 5HI2A 2F4JA 5CENA 5E4HA 5DVRA 4HCVA 3R2YA 4YGAA 4FG9A 3OWLA 4GT3A 4U3ZA 4USFA 3TDVA 2YM5A 3R73A 3LJ2A 5D7AA 3C50A 3NYNA 4G3FA 5CQWA 4EOIA 1OZ1A 5AMNA 2OXYA 5AIRA 2YLEA 3DOGA 1ATPE 2I0EA 2I40A 4IAFA 4OTQA 2WU6A 3FJQE 4NM5A 2YLFA 2VTHA 3WYXA 3NDMA 4FEWA 3CY3A 1K2PA 4GIHA 2QOBA 3RAHA 2W1EA 4FKLA 4D0WA 5EM8A 3SKCA 3RWPA 2J0KA 5J87A 3ZZWA 4C38A 4HVDA 4EH9A 3UOJA 2HW6A 4BDGA 1FVTA 1OB3A 2BILB 2VD5A 5CS6A 4R77A 4L45A 4DCEA 4FNXA 3HMOA 4QMQA 2DS1A 4FSTA 3IDPA 4RFZA 3HV7A 4S34A 3ZLSA 4U81A 3R7YA 4O0TA 2ITYA 4F7SA 3W16A 2W1CA 3ZH8A 4FGRA 4CZUA 4OT5A 4B4LA 2XMYA 4OGRA 4DG0E 3EQIA 3PA5A 3EFKA 3FY0A 3L8VA 3QHRA 4FL2A 4L3PA 5AUXA 3BWFA 5LMAA 1G8AA 5C01A 4O7YA 5J9ZA 3GXLA 5CZHA 4TL0A 3NIZA 3SOAA 4EK6A 4C57A 2C0TA 4GSBA 5JKGA 2H9VA 3GC8A 3GENA 3QUPA 4MXCA 3QRJA 4W8EA 5HTBA 2BHHA 2NPQA 1XO2B 2WTCA 3QXPA 3A62A 1UU3A 4FA2A 4XG7A 1ZZ2A 1O6YA 5CXHA 2QURA 3UOHA 2YA9A 3LM5A 4AGCA 2EB3A 3NCGA 3ZUTA 3UQCA 1RDQE 4DITA 4ANLA 3PDTA 2C5NA 1CKPA 3KKVA 5HLPA 1KV1A 3RCDA 2ONLC 1XH8A 2OW3A 2FSOX 2QI8A 1H1WA 3GU8A 3ORPA 3LLAA 2PMNX 3DKOA 5E8ZA 4U43A 4AW1A 4PDPA 4OBPA 4DBNA 1H07A 4TWCA 4D0XA 5I9VA 2W17A 3KULA 4XH6A 2XYUA 2XRWA 3EKNA 3LQ8A 4P90A 3SQQA 3ZFXA 1GIHA 4ZJIA 4S32A 1MRYA 3DJ5A 3PZHA 3COKA 1OL2A 4LFIA 2ETKA 4RX8A 4XBUA 4BHNA 3KXGA 4E6QA 5IDNA 3G51A 1PYXA 4K9YA 5HE2A 2VTSA 4ID7A 4E7WA 4YLLA 1FMOE 3W8QA 4F63A 5CI7A 1J1BA 3PXRA 2R3KA 5DG5A 5AUWA 3Q9XA 4F65A 2PZPA 3P78A 2YDJA 4FT9A 2CGUA 3VNTA 4JRNA 3WF7A 4CKJA 1ERKA 4RFMA 5IEVA 4NL0A 2QNJA 4M0ZA 4JG7A 3UO4A 3V5WA 2B0QA 5IQIA 2Q0NA 3S00A 5LWNA 3KCFA 3Q9YA 3MIAA 2G2FA 4DBXA 4ASEA 3SRVA 1FBNA 3GFWA 1XJDA 4F0FA 3C0GA 5KMLA 2ZMDA 5EDRA 2AUHA 5C8KA 3G2FA 1MUOA 1XQZA 1WCCA 4K33A 4IWDA 4C4JA 5I0BA 5L2WA 1OUKA 4IANA 4IM3A 3QQHA 2PZ5A 2Q83A 2XJ0A 4X2GA 3VS2A 4FL3A 4EOSA 5CF8A 3COIA 4RIYA 2J4ZA 1Y8YA 1ZZLA 4C3PA 4TYJA 1URWA 4J98A 3R8MA 4KBKA 4MXZA 4NIFB 3VRYA 4FKIA 5CSPA 5LVNA 3D4QA 3OF0A 1R0PA 1YXXA 5DE2A 1JWHA 4BDBA 5KHXA 4B6LA 3D0EA 3ZZEA 3V8WA 4F9WA 4O7WA 3D7TB 4GT5A 3EKKA 3D5UA 4JDHA 4FKSA 4MYGA 4YJUA 3DTCA 4YNOA 4F6SA 4G3EA 3ULIA 4PPCA 4ZZNA 4GJ2A 3P7AA 3C1XA 2UZUE 3F7WA 3LFEA 4L3LA 5JGDA 5BVOA 3M2WA 4EUTA 2W0JA 5CAVA 1H1RA 3PJCA 2YISA 4BCFA 2C3JA 3E8DA 3EQHA 4KIOA 3QAME 2ITPA 3UZPA 5K0KA 1U59A 3H9RA 1YHSA 5FQDC 3AC2A 5AAFA 4C3FA 5F1ZA 2ITXA 4Y83A 1LP4A 1OIQA 2HIWA 4C4FA 4RVLA 4ASDA 3SW7A 1RQQA 4EK3A 4USEA 4BY9E 3UZRA 4IVBA 2WB8A 4GU9A 3EQFA 2GQSA 4BCNA 2ZAZA 1PMEA 3BGZA 5DWRA 4BDEA 4FOBA 4DAWA 4F7JA 2GQGA 3H9OA 3HA8A 4AZVA 3HRCA 3FEGA 3ZXZA 4IIRA 5ICPA 3PXYA 3CQEA 5DT3A 5IQFA 4OW8A 4PX6A 2ESMA 1Q99A 4QTDA 5M57A 5C4KA 3IOKA 1YWVA 3N4TA 4HJOA 3AMBA 1ZMVA 4IJPA 4L6QA 4XG9A 5CTPA 2IPXA 2PPQA 5LVOA 4QYFA 4HW7A 5M4CA 5EDQA 5L6PA 3JY9A 4RJ4A 4E20A 3ATTA 2R9SA 4RIOA 1R3CA 3KVWA 3QU0A 2OICA 3BYOA 5HTIA 2PMIA 3OY3A 1FINA 3IK3A 1H25A 3R83A 5E9EA 3RBWA 3AD6A 5I3OA 5IUGA 3UMWA 1UWHA 2WO6A 3HKOA 3ORIA 3VHEA 3VUHA 4DGMA 5B2MA 2WPAA 4IZYA 2Y4IB 4LRMA 3IOPA 3LLTA 4FVQA 1FVRA 1ZOHA 5IQAA 5IA1A 4J95A 5KBQA 5AUZA 4OTIA 1PHKA 2WMXA 2G2IA 4D2WA 4RFYA 4NJ3A 3QRKA 5DIAA 5HVJA 2IVUA 4ZEGA 1GIJA 1CSNA 4JOAA 3T3VA 2HWOA 4GK3A 4CV8A 3KXMA 3I0QA 2IW9A 1OIUA 3V8TA 2PY3A 2XM9A 1NVQA 2OZOA 5HLNA 3DBDA 4APCA 2O8YA 4KIPA 4G2FA 3FC2A 4AT3A 1Z5MA 5ITAA 4AA4A 3F6XA 2V0DA 3NNUA 3R7UA 4WBOA 4EL9A 2OBJA 4YHTA 3BBWA 5BYZA 3VUDA 1OI9A 3KY2A 4KAOA 5FRIA 3CQWA 4FSRA 4I94A 2CKPA 1VEBA 4J8MA 4I6BA 1CDKA 2CKQA 3KMMA 1YWNA 5LVMA 5ANGA 4J99A 4DINA 5J95A 3IGOA 5FDXA 4EYMA 5A4QA 3LAUA 2HXQA 4JJRA 2V62A 3GC0A 2Z7RA 3IKAA 3EN9A 2VTPA 2OU7A 4BKJA 2PK9A 2WXVA 5FP5A 4IM0A 1YHWA 4E5AX 4FTUA 2VTMA 3Q6WA 2F57A 2PU8A 4QP1A 1ZMWA 2R3FA 4L53A 3AXWA 3KEXA 4AT4A 4C61A 4D1SA 1R39A 4QP4A 3GQLA 2IO6A 5IH6A 5HVKA 4XLIA 4DEBA 1VYWA 3O51A 4EHEA 1YOLA 3OP5A 3BGPA 4PWNA 5GHVA 3UC4A 4C62A 4ASXA 5CAPA 4H1JA 3QQFA 2BRNA 5IQDA 5JT2A 4XLVA 1YVJA 1YXSA 4JX7A 4YZCA 5CX9A 3DGKA 3FSFA 4HVIA 5IG1A 1Q8WA 4F9YA 2Y0AA 2ITNA 3E7OA 3BHYA 4JBQA 5EM7A 5DGZA 5EOLA 4QP9A 1OITA 5EYDA 3HL7A 5JMSA 3WZDA 5HTCA 1JKLA 2R3QA 1BX6A 4R7IA 4BRXA 2XH5A 1J7UA 5ETFA 1Y6AA 2XJ1A 5H8GA 5HGIA 1TQMA 5DT0A 1OL7A 3ANRA 3QWJA 3ZFYA 4BIEA 5FGKA 4ZY5A 4O0UA 3EHAA 4CXAA 4FSWA 3RINA 3L9NA 4XJ0A 4AQCA 4EUUA 4FTTA 3RTPA 3U9CA 5LMBA 4AWIA 3NX8A 4FICA 4DA5A 3L1SA 3NAXA 3QUDA 4WRGA 5EW8A 4CMUA 2YN8A 4D2RA 4L01A 4WG5A 1NVSA 1YI6A 4BTJA 5AR8A 2ZMCA 5FXSA 3SOCA 1T46A 2GS2A 2XNPA 3OBJA 1M2RA 1CKJA 5AP7A 3NMUF 4DEEA 4JX3A 4EJ7A 4JS8A 1JNKA 3ORZA 2FUMA 2R3JA 1Q8UA 3L8XA 4XV2A 4DEDA 2YDKA 3VQHA 4CRLA 3HDNA 3KRLA 4NU1A 3SA0A 4J52A 1TKIA 1Q62A 4OAUC 1H01A 3CKXA 3QCYA 5BPYA 3VWAA 4BR3A 4M0YA 4DE4A 4E4MA 2BIYA 3KXZA 1ZXEA 3VUMA 4D4YA 1OKZA 3COMA 3GBZA 2XP2A 5IH4A 4GL9A 5L8LA 4AGWA 5JFSA 3QYZA 2XCHA 1UNHA 3LXKA 4C4EA 4M14A 5D10A 3LOKA 4EHVA 5HEZA 3PVBA 4YJRA 1U46A 3FL5A 3QZGA 3R8UA 3N51A 4YR8A 3I5ZA 3TTJA 2W4JA 4C35A 4Z16A 3ZO1A 4WUAA 1YWRA 4IM2A 1VJYA 4DH5A 1H0WA 1ZAOA 3MBLA 4UZDA 2WAJA 2CCIA 3HUCA 3SG8A 3MPMA 4Q9SA 1Q3DA 5L6OA 1URCA 4MAOA 3EFLA 1A9UA 3L8PA 4M12A 1VZOA 2PVHA 3GI3A 3BYUA 4WNPA 4K77A 5E8UA 1PMUA 1QPJA 3TN8A 5GJGA 1NY3A 2XNNA 4GK4A 3V51A 4D4SA 4QNYA 2VWZA 5FTQA 2O0UA 2UZVA 3NWWA 2CHLA 3A2CA 3HV3A 2VWVA 4P2KA 2UZTA 2XK6A 3QX2A 4JR7A 3FKOA 3E8EA 3I5NA 2HZ0A 4J71A 5TKDA 1QPEA 4GEOA 4NEUA 3QLFA 1M14A 5AP5A 4ALVA 3ZLYA 4Y5QA 3MFUA 5F95A 3ZS5A 3RAKA 2JIUA 2QU5A 3FLYA 4H3QA 4O7TA 4DHFA 4CMTA 3DXQA 4FUYA 2LGCA 4ASZA 4PUZA 4V01A 3AT4A 1XKKA 3HX4A 4M3QA 5EI6A 2WTJA 4IH8A 2OFUA 2IVTA 2YM7A 4NT4A 4UMUA 3TKHA 4CFUA 4FE2A 3MYGA 4LOPA 3PPZA 4F70A 2J0LA 5IUHA 5L8KA 4XS2A 3R7VA 3DXPA 4C59A 4EH5A 2QOFA 1YRPA 3B8RA 5A46A 3DBFA 4U0IA 3E93A 4O6LA 3BHVA 3C4EA 4NIFA 2RF9A 3MW1A 4ZSGA 4X2KA 5DEWA 4FOCA 4CFXA 3UIBA 4CLJA 3UDBA 3D7TA 4BYIA 3BI6A 5HOAA 5HG8A 3GCSA 4Z55A 1SVEA 3A7GA 1U54B 5I5ZA 4FTNA 4J53A 3RKBA 1IR3A 2XIYA 4NSTA 2OZAB 2QOQA 3LCSA 4FV4A 4PP9A 3NEWA 3U4WA 4BDCA 4GRBA 4BI2A 3EZVA 3DLSA 2HCKA 4WIHA 4G5JA 3DV3A 3ID6C 4PY1A 5BUEA 4CKRA 3FLZA 3AGLA 2E9NA 4O96A 4B99A 3P4KA 4YZDA 3K2LA 1YI4A 3RNYA 4ZS4A 3FLSA 4GFOA 4O7VA 4EOOA 2E9PA 4F1MA 4O0XA 5LQFA 4YHJA 3OXZA 4DGOA 3QBNA 4G34A 4H39A 2WMVA 1OUYA 3HP5A 5F9EA 4L7FA 3HAVA 1IAHA 2VWWA 4NTSA 4S31A 1M7QA 5JSMA 4JAIA 5CNOA 4BYJA 1JSTA 3WARA 2ITUA 4ONAA 2HYYA 3UYSA 4IB0A 3P23A 1UNLA 3DT1A 1W83A 3ACKA 4RZVA 1KE6A 5HU9A 3V5QA 4II5A 3POZA 2NP8A 3QYWA 3IDBA 3POOA 2V22A 5E8VA 4YC8A 1ND4A 4LL5A 4MBJA 5IA4A 2BALA 3U51A 4BBMA 4JDIA 3OXTA 5JZJA 5FG8A 1BUHA 1ZRZA 2X6EA 3EOCA 4IC7A 1RJBA 3R7GA 2G1TA 1F0QA 1UVRA 2PMOX 2GQRA 4CGAA 2W5AA 4IWOA 3RPRA 2RFSA 5TE0A 4DEAA 2QO2A 4QQCA 5DA3A 4QQJA 4USDA 1WVXA 4ZTRA 3RK7A 4EH3A 2CNQA 3PJ8A 5J79A 2GNFA 3BX5A 2BZHB 1GNGA 3DKCA 2GHMA 4QMTA 4A7CA 2GNJA 3FDNA 2PWLA 4W4XA 4AZTA 4EONA 3QTWA 3KC3A 3MSSA 4MBLA 3R7EA 5L2IA 1JBPE 4YJNA 4AN9A 3RI1A 3PSDA 4ANMA 5CYIA 5A6NA 3NNVA 2OIBA 2ZDUA 5AP3A 2O5KA 2R5TA 4QTCA 5CWZA 2IVVA 4GT4A 3P9JA 4I24A 3OMVA 1PXPA 5KZIA 5M51A 4L67A 2C47A 3MFSA 3N9XA 4AZEA 4F7LA 5IQGA 3KN5A 4DFLA 2XNMA 3P79A 2JAMA 3VS4A 3Q4ZA 3BBTB 5HNGA 4B9DA 5CSHA 3WZUA 1H28A 4D4RA 3CTHA 3ACJA 3K5VA 3Q3BA 1G3NA 3LPBA 4PRJA 4F99A 1E1XA 5GIPE 2X39A 5HVYA 3A61A 3FC1X 3FMNA 3VF8A 3EIDA 4FI1A 5CEPA 4MF1A 3CD8A 4LM5A 5FXQA 1SZMA 3DLZA 4FNZA 4FT0A 3LE6A 2QD9A 3MY0A 2UW3A 3FQEA 4UZHA 4D4VA 2E9OA 4J1RA 3Q53A 4PTCA 3LFFA 5G1XA 4PV0A 4O27B 4ANOA 4R5SA 4EHZA 3WILA 2R3NA 4AT5A 3FZSA 3TT0A 4DTAA 3C0IA 3R28A 3V8SA 4L00A 3QTRA 4LV8A 5TOZA 4FTKA 3ZEWA 4C4HA 4DFZE 4FIFA 4FEUA 1SNXA 5A4TA 1SVHA 5HBHA 3WOWA 2XNBA 1J1CA 3FMDA 3LXNA 3MB7A 3PXZA 3R00A 4EYJA 2OO8X 4DT8A 2WMUA 2YAKA 4QRCA 1SYKA 3RPVA 1PKDA 3M11A 4CVAA 4IZAA 4YJQA 5EYCA 2V7AA 2Z02A 3LZBA 2R7IA 1AD5A 2BDWA 2B9JA 1OL1A 4IACA 3CD3A 4OTFA 2PZYA 4F6WA 2F2UA 5D12A 3VS1A 3AC3A 2WEIA 3R0TA 3VBTA 4OTDA 5E8TA 4AU8A 3NGAA 2W1ZA 4FIIA 3VC4A 5C8MA 4XCUA 3ZSIA 2CNUA 2XUUA 3DKGA 3UE4A 2XYNA 2HW7A 1OL5A 2BTSA 4C02A 4O84A 4Z7GA 3CY2A 3QA8A 1YQJA 5GINE 4MNFA 1OGUA 4QMSA 2WTKB 5C4LA 2WQBA 1WBTA 3MFRA 4U40A 4MWHA 3MESA 2J5EA 3ENHA 5L2TA 4EH2A 3BPRA 3LCDA 4I5CA 4ZP5A 5DNRA 3WE8A 4CFWA 2OJIA 3HMPA 4RJ7A 5I9WA 3K54A 3I81A 3DBCA 3LCOA 4A9UA 4TT7A 2ZV8A 4CV9A 3FZ1A 4C2VA 1BL7A 1H1PA 1QL6A 5EHOA 1Q4LA 2JEDA 4A06A 3NUYA 4ENXA 2IW6A 3F3VA 2B53A 2Z2WA 3FL4A 3PA4A 4JR3A 3RVGA 3UMXA 3VRZA 5IA0A 3UPXA 4RRVA 1M2PA 4FSQA 2BRGA 3ORXA 4HCTA 3NZ0A 4O2ZA 4Y46A 4R1YA 5HE0A 5L3AA 1O6KA 3A99A 2P3GX 1Q61A 4OTWA 4EOQA 5DR2A 3SD0A 3AOXA 3Q5IA 3R1NA 1XH7A 4G6NA 5GZ9A 3BWJA 1JKSA 1W8CA 4CFNA 4YURA 3MDYA 5HNBA 3S3IA 2XK9A 1M17A 2OI4X 5L6WL 3CGOA 2B4SB 2XZSA 3JY0A 4JAJA 5CI6A 3LW0A 1UA2A 5AA8A 2OGVA 4OBQA 3WZEA 2RG5A 1A48A 1BI7A 4I5HA 4YLKA 5FM2A 3W2PA 4QYHA 4ITIA 4XP2A 4CNHA 3FQSA 3PIYA 4NM0A 5KKRB 5AWMA 3LMIA 1PF8A 2BHEA 2W5HA 3NYOA 4YP8A 2PSQA 4J97A 4CG9A 4MK0A 4X3JA 5D7VA 4F0IA 2HENA 3QCXA 4E4NA 1JVPP 3QQLA 2BZKB 4P4CA 5ACKA 4ANBA 2JDSA 3FI8A 4O82A 3WZJA 3UQFA 3P5KA 4YZMA 3VO3A 1UU9A 2ETMA 5B2LA 2IVSA 4W9XA 5FEEA 1AGWA 4FSZA 4PMSA 3LJ1A 3IW7A 4AN2A 3A8WA 2BDFA 4KABA 5C8NA 3RWQA 3QD3A 5CAUA 4D5HA 3DTWA 3T9IA 4WBBB 3Q4UA 2UW5A 4BCJA 2EU9A 2QC6A 2X9EA 3F3WA 3LCKA 4NTTA 5AFVA 1H1QA 3BHTA 3CQUA 3P7CA 5AV3A 1OKYA 2UW7A 3WI6A 4RQVA 4A9YA 4R5YA 2IZSA 2W7XA 2PMLX 2GPHA 5CNNA 3ZLWA 4RZWA 5ACBC 1DM2A 3GU6A 3EQRA 4CD0A 1MQ4A 4CCUA 3FQHA 2IWIA 2QHNA 3QFVA 4WG4A 2BKZA 2GS7A 3SHEA 4TPTA 2VX3A 3CGFA 2WMTA 4TYHB 3ZSGA 4AE9A 3B2WA 5TR6A 3OXIA 4EQUA 4ZLZA 2JKKA 5DI1A 4AOIA 4EOJA 3GEQA 3CPBA 1Q41A 2BFYA 4MXXA 2FSLX 5ANIA 5HE1A 5D11A 3F2RA 1BKXA 1APME 4GV1A 1UKIA 3PYYA 3O8TA 4UYNA 5JZNA 2EXCX 4ZZOA 4IFCA 5BNJA 4YO4A 5HNIX 3VBWA 3MY1A 2E9VA 4I41A 4MCVA 4O2PA 4TWPA 3ZDIA 5AAGA 1Y8GA 4FTRA 4K2RA 3PY1A 4L46A 2CLQA 4BVUA 3R8PA 5M4UA 2VV9A 2DUVA 4ZSJA 1R1WA 2BMCA 2BZIB 4RA4A 5EW9A 4FTCA 2W1IA 3HRFA 4ZSEA 5LVLA 5K4JA 3ZXTA 3W18A 4BZOA 2BIKB 2OZAA 4UYAA 4C4GA 3QTQA 2B9HA 5K5NA 3A4OX 3QQJA 4XRJA 5BUJA 4G6LA 4UWBA 3JR1A 3R04A 3W32A 1YHVA 4FNWA 4L68A 5IF1A 3GNIB 3TNQB 2VTAA 4BDAA 2YM6A 1H0VA 3C4ZA 1B39A 4L8MA 3I7BA 2F7XE 4RBLA 5CQUA 4BGQA 1FMKA 3U6HA 2C5OA 4UXLA 4EC8A 4U8ZA 1XR1A 4UMQA 4M84A 3S2PA 4D2SA 2A19B 5KO1A 3MB6A 2XIXA 3KREA 4OR5A 4CT2A 4C34A 4BCHA 2VTNA 1UU7A 5I3RA 2PUPA 4EK5A 2QVSE 2VO0A 4XV9A 4DFXE 4ACGA 3GCVA 4R6VA 3MV5A 3ZUVA 1UKHA 4FKJA 4FV2A 5M56A 3R71A 4BCKA 4QYEA 2Y4IC 3KRWA 5H8EA 4JBVA 4BCOA 4HVSA 3PVWA 2UZEA 3FWQA 4FTIA 3O50A 2X2LA 4HGTA 3OD6X 4UWYA 4LGHA 1IA9A 3KMWA 3ZO2A 3UGCA 2VU3A 3QC4A 4ANSA 2ITVA 3O8UA 4RPVA 4IE9A 2GTNA 5HD4A 2OFVA 3PY3A 3MWUA 3HVCA 5LJJA 5IA2A 4N57A 2HELA 5LVPA 4FIHA 1XH9A 4IVAA 2XS0A 2JDVA 3BYVA 4EHGA 3Q2JA 5IQEA 3LVPA 4P5QA 5KZ0A 4OTHA 3DXNA 4KB8A 4KRDA 2WQEA 2RKUA 3QCSA 4I22A 4AFJA 4F9AA 4NW6A 5I9ZA 5KHWA 4N6ZA 3VHKA 2QODA 3WF6A 1V0BA 3IGGA 5DYJA 1IG1A 3A8XA 3BQRA 4RGJA 4F64A 3Q5ZA 3E62A 2WQNA 5JK3A 3HAMA 3K3JA 3UYTA 2QOOA 4F9CA 2W96B 4ITHA 4UN0C 1I44A 5DBXA 3H4JA 1CTPE 5D41A 3VUKA 3ZEPA 3R9NA 1RE8A 5CF5A 1MP8A 3ELJA 3PA3A 4O6EA 5E91A 4BWPA 4Q5HA 2C0OA 3AG9A 3OWJA 3VUGA 4IAIA 3REPA 3FAAA 2F49A 4EKKA 2X7GA 5I9YA 2VAGA 5FTGA 4C33A 3U9NA 4DYMA 2H34A 3AC4A 4AGDA 4A9TA 2J5FA 5JFVA 4PDYA 3KRJA 5AR4A 2E2BA 4IAAA 3RK9A 4XUFA 1I09A 3K3IA 4FKTA 3TUDA 4FSMA 2XJ2A 3VW6A 3UPZA 4G16A 4JVGA 4KS8A 4W4VA 1DS5A 4M69B 5ANJA 3EMGA 5E90A 2XNOA 3RPYA 3DB6A 3W2QA 4AZWA 3MVJA 3P08A 3IONA 1OBDA 2VRXA 3ULZA 2XKFA 4DH7A 2V5QA 3O96A 2YZAA 4AP7A 2O3PA 4ALUA 3C4CA 3QD4A 3VUIA 3EN5A 4IHPA 4ZS0A 4JDJA 5H2UA 2C3KA 3TG1A 4BL1A 4NFMA 3VBVA 1UV5A 1ZLTA 2EB2A 2JLDA 3P1AA 1K9AA 3OW4A 4O86A 1XHAA 4JBPA 5ANKA 3QF9A 5FXRA 4I4FA 4IVDA 4HPUE 3BKBA 4ALWA 4F1TA 2I1MA 3FYJX 4Y8DA 2WELA 3DFCB 1S9JA 2WQOA 1P5EA 4DLIA 3VS6A 4QMXA 3Q4CA 3RJCA 3I4BA 3W55A 4C0TA 3R02A 1XBBA 5HIDA 4G1WA 5GJDA 4DGLC 2QOHA 3OT8A 4M15A 3FZTA 5HBJA 3QKKA 3PVGA 5DT4A 3CE3A 1IA8A 4O1OA 2RL5A 3RPOA 4OTRA 4BDIA 4YSJA 3T9TA 3NR9A 4L7SA 3R9RA 3EL7A 4BWXA 2X9FA 2CKEA 2J0JA 3RPSA 3VS0A 3VJNA 1YDSE 3EZRA 4D5KA 4O22A 2QO7A 3JVSA 3LMGA 4YZNA 5L2QA 3V3VA 4FGBA 4PMMA 3MGYA 4X3FB 4XV1A 4F09A 2YHVA 3PSCA 5CU0A 4ACDA 5H8BA 1XH5A 4LGGA 4NFNA 4U45A 2ITQA 2EUFB 2ERKA 2UVZA 4E5WA 4E4XA 3II5A 2OJGA 3D2IA 2C6IA 2VTOA 4UEUA 3VUTA 4A07A 3SV0A 2HZ4A 5A4CA 3EN7A 3LHJA 4PTGA 4C37A 3EN6A 5JH6A 3QQUA 2VUWA 1QPDA 3DFAA 2PUNA 3TJDA 2C6OA 3DK7A 1OIYA 2BAJA 3OCTA 4NYEA 4LYNA 2XEYA 4K18A 4I20A 3LFBA 4WNKA 3SAYA 3DNEA 3IW4A 4ZLOA 4YMJA 4AXAA 3CCNA 4LRJA 3VAPA 3I6UA 4WKQA 1WBVA 1KE9A 3AT3A 3D94A 3MPAA 3TZ9A 3RHKA 4BIBA 5M4IA 4E5BA 3LFNA 4FEXA 3E7VA 5EM5A 3TZ7A 4O7ZA 3SC1A 3G0EA 3GC9A 1QCFA 3L9PA 3NRMA 4V05A 4BDFA 4F7NA 3I6WA 4RJ8A 3EL8A 4IWPA 3PE1A 3AC1A 4Q5EA 4GKIA 1GZKA 3EQCA 2QKRA 5HICA 5J8IA 5EQEA 2QLUA 2ZVAA 4HYSA 4BI1A 4LG4A 4YLJA 4AACA 3RGFA 3PSBA 2CGXA 2X0GA 2OG8A 3D5VA 4WHZA 2EWAA 3VBYA 4CKIA 3BELA 3K5UA 3SXSA 1BMKA 2OWBA 2BTRA 4AA0A 4XG8A 5CT0A 4BZNA 2QKWB 5IEYA 4DFNA 4DH8A 4YPSA 2WFYA 4L3JA 5TO8A 2A4LA 4ZTLA 2V55A 4XG3A 2Z7LA 4FR4A 3FSKA 3ZOSA 2VNWA 3PRFA 3FLNC 4XNEA 3C7QA 5GZAA 5AM7A 1LEWA 3DKFA 5HLWA 1PXLA 4FV3A 3VBQA 2NO3A 4UMPA 4ZSAA 3OUKA 4I4EA 4IXPA 5AP1A 4FZAB 4MQ1A 3Q32A 4MF0A 4X0MA 2B52A 2GFSA 3NYVA 4PF4A 2QG7A 5CY3A 3ORNA 4DG3E 5AP6A 4NCTC 3PIZA 2XK3A 5J7BA 1J7IA 3FKNA 3KCKA 5DMZA 3E8NA 5A9UA 4B7TA 1WBOA 2GU8A 3DAJA 4HYIA 3NSZA 3OEFX 2ZYBA 4RWJA 5AUUA 5KE0A 3SG9A 3GOKA 4AOJA 4FZ7A 4XX9A 4KKHA 4OT6A 4XV3A 1JAMA 1YXTA 4FKUA 4QMVA 4GKHA 3UG1A 2OIDA 5E8SA 2CKOA 4F1OA 2PVRA 5EFQA 4F4PA 1REJA 2XK4A 2R3LA 2XCKA 1XBCA 5CSVA 3ZHPC 2WTIA 5AV4A 4EK8A 4GMYA 4KD1A 3W2CA 1W82A 4UXQA 3P0MA 4HGEA 4ITJA 4B0GA 5CAQA 5ANDA 3O17A 5DPVA 5FD2A 4HZSA 1KE7A 3OY1A 4D2PA 4XG6A 3LFAA 5ETCA 2C5YA 4TYHA 4AZSA 2YITA 2UV2A 1UNGA 5DH3A 4I23A 2ZB0A 2WMSA 4BTMA 4DT9A 4JQ8A 4TYGA 4BGHA 3HV4A 4YJOA 4GUEA 5IZFA 3UVQA 3WF8A 1OKVA 4YU2A 4YJTA 3V04A 4F9BA 1U5QA 3AD5A 4MWIA 3FBVA 3BQCA 2UZLA 3H10A 3BLQA 5A54A 2XIKA 4UY9A 3ZSHA 3I0OA 4FSYA 5H3QA 3RZFA 2C4GA 4ZMFA 1Q8ZA 3MH3A 3MTLA 3GU7A 1H26A 3M42A 2FH9A 4FKRA 3BLHA 4FZFB 4FTMA 4FT3A 4JRVA 4RWIA 3RAWA 4BZDA 3COHA 3NVKI 3QTIA 4RJ3A 5AP0A 4ERWA 5J5SA 4O7NA 2AYPA 3F3TA 3CR0A 3U8WA 2QO9A 3OVVA 4N0SA 5HCXA 2G9XA 3MIYA 3R8LA 2G01A 3HMNA 4FTJA 4AA5A 2WHBA 3DQXA 2VWXA 2X4ZA 4H1MA 4YJPA 4TZRA 4R78A 3HA6A 3LQ3A 2R0IA 4J96A 4YTFA 3IG7A 3SW4A 2GHLA 4FKOA 5HG7A 4G9RA 2X7FA 4GS6A 3SXRA 4IX4A 3PP0A 2UW8A 4EWQA 4FTOA 4TWNA 1YKRA 4ZAUA 4E8AA 1M7NA 3C51A 3ODZX 4EEVA 5JFXA 3OEZA 2YABA 3LFSA 4KKGA 4OBOA 4O0WA 3FLWA 1LPUA 2YCFA 4FKVA 4FV5A 5F94A 2GFCA 3QKMA 1PYEA 1Z57A 4YO6A 4BTKA 5CANA 4N6YA 5M44A 3MH0A 1R0EA 3ORTA 1PMNA 1GZ8A 3EYHA 2XRUA 4HPTE 5AA9A 3NNWA 2YIYA 4KINA 1BI8A 3OROA 4WA9A 4EK4A 3U6IA 2Z60A 3BYSA 4FV1A 4A4LA 2J9MA 2RFEA 1SNUA 2QHMA 3F2AA 2GNGA 4RSSA 2VWBA 3DDQA 3T3UA 3TUBA 2ETRA 5DEYA 5AJQA 3UZTA 2UZNA 2CNVA 1JOWB 3F2NA 5HBEA 3GUBA 4EOLA 4QNAA 1XWSA 5ANOA 4FTLA 2VTTA 3KA0A 4GH2A 1QPCA 4CSVA 4BB4A 3ZUUA 3QZIA 2A2AA 3DY7A 3O23A 3NUPA 1DAWA 2CMWA 4XP3A 4ZSLA 3O2MA 2C1AA 3WBLA 4LRKA 4CMOA 5B7VA 4XEYA 3U54A 4IB1A 2EVAA 3VIDA 3E3PA 4MEDA 4BIDA 2PL0A 4RVKA 4AGUA 4FZDB 3GCUA 3NCZA 2C5VA 4G31A 4M13A 2B9FA 4QMPA 4HGSA 4Y5HA 2R7BA 2UW9A 4HVHA 2C6KA 2UW6A 3KN6A 1MRVA 2JKQA 4XHKB 2YM4A 4JG6A 1HOWA 3RNIA 1NXKA 3V5JA 3ORLA 3CKWA 4K11A 2W1DA 2BZJA 4RX7A 4W8DA 1H24A 3KXXA 4V0GB 2I0VA 4FZ6A 4JLCA 2A0CX 3N4UA 4IBMA 4QMLA 2R64A 5LMKC 4ZLYA 2IG7A 4M69A 4FEQA 1PXMA 4CYIA 3RM6A 2YFXA 3FKLA 3RM7A 3U87A 2IN6A 4U44A 4EOMA 5AP4A 4IJ9A 3UODA 5IA3A 2WKMA 2YJRA 5HO8A 2XNEA 2FYSA 2YJSA 1QMZA 5CU4A 3R1YA 4EH7A 2FA2A 3BEAA 3JS2A 1UWJA 4XRLA 1F3MC 2W1FA 5KX8A 2G15A 5M09A 3EFJA 4BWKA 2QQ7A 1SVGA 4FSUA 5EH0A 4H36A 2VNYA 4TW9A 1WVYA 4BF2A 5EYMA 5EI8A 2YCRA 4ZY6A 2WTKC 4DFUA 4PMPA 4MXYA 2PE0A 2IZUA 3DS6A 4AAAA 4EI4A 2OK1A 2WU7A 4EBVA 3WF9A 3GB2A 3R01A 4AG8A 1UU8A 3ENMA 3VULA 3PRIA 2F7EE 1CMKE 3FI3A 4C4IA 2F7ZE 4FKWA 5T3QA 4R3RA 4G3GA 1YXUA 3LM0A 4QPAA 2XF0A 4QP3A 2HZNA 3MA6A 5E7RA 5E8WA 5JEBA 5EHLA 4MD9E 1J3HA 1W98A 3QX4A 4RT7A 4HYHA 5IEXA 5IUIA 2X8IA 3NUUA 4ZTNA 3F5XA 4QTAA 5M53A 4TKSA 1W0XC 2G2HA 5CU2A 3TWJA 2WIPA 4BICA 2FO0A 4UB7A 4WT6A 5JGAA 5IA5A 4AW2A 5C26A 1FQ1B 2BUJA 3BIZA 1MRUA 3GCPA 4DTKA 3C4FA 1Y91A 4X3FA 5BQ0A 3QC9A 4RC2A 4M7IA 4RG0A 3RALA 2Z7SA 5CU3A 2BDJA 5AR2A 3RP9A 4GG7A 2Y6MA 4IX3A 2WIHA 3IO7A 4I92A 4BDHA 1CKIA 4U9AA 5HD7A 3ATSA 5AEPA 1XH4A 1Q3WA 2FSMX 1J91A 5DLSA 4TYEA 4MBIA 3MY5A 3F5PA 4D2TA 4Y95A 1WBPA 1GAGA 3Q60A 2OXXA 4M66A 2BFXA 3E5AA 4D9UA 4Q9ZA 4K8AA 5AIKA 1STCE 3MH1A 5GZ8A 5KKRC 2RIOA 2VGOA 2HWPA 2Y4PA 4U6RA 5LOHA 5AX9A 3RK5A 5IQBA 3UO5A 3VS3A 5M4FA 2X2MA 3BE9A 4EC9A 2ZDTA 2YWVA 1OKWA 3H30A 1WZYA 3CPCA 5GJFA 2WOTA 4HOKA 4TN6A 2C5XA 3ZTXA 2PVLA 1PXIA 3OWPA 2V7OA 3PJ2A 2WMBA 4FC0A 4MHAA 3G9NA 2I0YA 3UP2A 2PULA 2J6MA 1OVEA 3IW6A 2JGZA 1JPAA 3F61A 5TF9A 4Z7HA 5J5TA 2I0HA 4YZBA 3MTFA 3OOGA 2XBJA 4DH3A 3FE3A 5D1JA 4KBCA 2PZRA 2ZJWA 3WYYA 4EZ5A 3LFQA 1H1SA 3E63A 4ZTQA 2ZV2A 3MFTA 3ZBFA 3TXOA 4LL0A 4GCJA 5M08A 1W7HA 3H9FA 1PKGA 3S4QA 1PXJA 4EH8A 3HNGA 5BVDA 4QOXA 4GYIA 5DFPA 4D1ZA 5M55A 4X7QA 3ALOA 3PY0A 3NIEA 4K6ZA 3H0YA 2FGIA 4OTPA 5A4LA 3KMUA 1LEZA 3EYGA 3O7LD 4P7EA 5AR7A 4HNIA 4BCIA 4BTFA 2GTMA 2R3PA 3V5LA 4MXOA 3CC6A 4PL3A 3KF7A 4DGGA 2PVNA 2VX0A 4IDTA 3EQGA 2C6LA 3LIJA 3F5GA 5GIOE 1Y57A 2QCSA 3WIGA 4ARKA 4BDJA 3FZOA 4XYFA 2CLXA 4CCBA 1H4LA 3TTIA 5A14A 4S30A 4LUEA 2W99B 4JIKA 2I7QA 2WZJA 4I0SA 2JITA 1PXOA 3IW5A 3KXNA 4IADA 4YC3A 3E92A 3THBA 4BDKA 3DCVA 4DG2E 4NK9A 4F08A 1ZYJA 2PVJA 4WNOA 2NRYA 5HO6A 2R3RA 4X2FA 5AR3A 3TIYA 3UOLA 4O81A 3TV6A 4X6RA 1ZARA 5EI2A 2HXLA 4JQEA 1U4DA 2BRBA 2GCDA 3QKLA 4X2NA 3GC7A 3UJGA 4E6AA 2IZRA 2DYLA 4YHFA 4O91A 2Y7JA 4MD7E 2H6DA 5AV0A 3ZO4A 1KE8A 5CALA 2UW0A 5KMJA 3HUBA 5CEMA 4NKSA 3GCQA 3KRXA 5F4NA 4BN1A 2XKEA 4BBEA 3OFMA 1OIRA 2BCJA 5ETAA 4PPAA 4JDKA 2HAKA 3SGCA 2BAKA 2VO3A 3Q04A 5CF4A 3NUAA 2RFNA 3F82A 2ZB1A 5ANEA 4U80A 5JGBA 4M67A 3QWKA 4LGDA 4Y85A 4AZFA 5KCVA 3OHTA 4GK2A 1ZYCA 2QR7A 4CFMA 4BBFA 4V0GA 3KXHA 2WD1A 2QOIA 4JIAA 4IX5A 3ZMMA 3ROCA 1FGIA 3CLYA 5BUIA 3TNIA 3O0GA 2ZM1A 4IQ6A 2BAQA 5KMKA 1KOAA 4WG3A 4E4LA 3HEGA 3IDCA 4CFVA 4FIEA 2O64A 3DJ7A 5EKNA 3FMJA 2ACXA 4J7BA 5FWKK 4IAYA 3ETAA 2B1PA 1MQBA 4FEVA 3HGKA 5KBRA 3PXKA 2FB8A 4JBOA 4PDSA 4XOYA 5HIEA 4QP8A 4EZ7A 1U5RA 4R8QA 5E8YA 3JXWA 4FV6A 3UO6A 4A4XA 2JDTA 4QT1A 2DWBA 3DB8A 4IAZA 3L8SA 3UIXA
chains in the Genus database with same CATH superfamily
1NA7A 2CPKE 4NCTA 3P5JC 5T68A 5DOSA 4KIKB 1WBNA 3AMAA 4FSNA 4D1XA 3ZYAA 1DI9A 1YOMA 2XBAA 1GZOA 2YCSA 4KSPA 2ZFYA 4RLLA 2JDOA 4CT1A 3Q6UA 3QTUA 5J9YA 2BKKA 3VF9A 4BI0A 4ERKA 3D15A 5I9UA 4DFBA 4ENYA 3RMFA 1JSUA 3DPKA 5JRSA 3FLQA 1ZY4A 2XK8A 2A1AB 3AC8A 3W2SA 2GS6A 5AX3A 5K4IA 4H58A 3BEGA 5DR9A 5L8JA 3SXFA 4CQGA 5FEQA 4QQTA 1O9UA 1U54A 3W1FA 2BPMA 2X4FA 3W33A 3EB0A 4PNKA 4G9CA 4ZTSA 1P14A 4H3BA 1Z9XA 2ITZA 4RIXB 5CEOA 5LWMA 2GSFA 3ORMA 3CTJA 4NM3A 1DAYA 2QG5A 1LUFA 1J7LA 1P4FA 5I9XA 4E73A 2WMQA 5KMNA 3NUNA 3OOMA 2YWPA 3PG1A 2CDZA 3MA3A 2JC6A 4HVGA 3GU5A 1WBSA 2C1BA 5J1VA 3CTQA 1GZNA 5FTOA 4DN5A 4AW5A 1L8TA 4O1PA 4ZTMA 2O63A 4DC2A 3KK8A 4PL4A 4IC8A 4O38A 3TEIA 4AXFA 3UOKA 3ZM9A 4FUXA 3H0ZA 3R9HA 5IMEA 3W2RA 3DK6A 4DGNA 3HMIA 1S9IA 3O71A 4MXAA 4PQNA 3W0NA 4G3DA 1PXNA 5CEIA 4ACHA 2NNWB 2JFLA 2SRCA 4QTEA 3F88A 3TV4A 5E92A 3UC3A 4KIQA 2UZWE 4U42A 3D14A 5AUTA 3NFGB 5FUTA 4LI5A 4Y73A 3FZRA 3QTSA 3M1SA 4RJ6A 4ACCA 1V0PA 3WIKA 1AQ1A 3Q96A 1T45A 2YM3A 2R3OA 1PY5A 3F3UA 3FV8A 2R4BA 5IU2A 2OIQA 2PVKA 3DA6A 3ZBXA 2Y6OA 1YW2A 1M52A 3MVLA 3OC1A 4YTIA 3R8VA 5IPJA 5E1SA 5EK7A 5A3XA 3GT8A 2VWYA 3W2OA 3TNPC 2BROA 2QOKA 4EOPA 4IWQA 4E1ZA 5AAEA 5FDPA 4BC6A 4FT7A 3ZONA 5AUVA 4A9SA 3ZRLA 4QP7A 3BU3A 3IPHA 3PXQA 4WSQA 4QD6A 3TACA 4C36A 4X3FC 5BYLA 4EQCA 1PJKA 4FVPA 5HIBA 4KRCA 2WTDA 5JFWA 4UMRA 4RC3A 3OUNB 3F3ZA 2HY81 3ALNA 4YJSA 1Q5KA 2XEZA 4TXCA 5LCKA 4L52A 3VJOA 2X8EA 4IDVA 3TCPA 3EQBA 3KK9A 1Y6BA 4Z9LA 4HNFA 2NRUA 1YDTE 3NW5A 1ZYLA 4E3CA 5IQHA 4NZWB 3F69A 3MJ1A 1P2AA 4YC6A 5FEDA 5CEKA 2GHGA 2J50A 2C0IA 3OS3A 4C7TA 2J51A 1TQPA 2X81A 4AAYA 3GOPA 1X8BA 4TNBA 5KMIA 1V1KA 1XH6A 4CLIA 2UZDA 3TJCA 2OKRA 3HLLA 4YNEA 5C9CA 3OZ6A 4R7HA 4BKYA 3TZMA 2ITWA 3H3CA 2QONA 2H8HA 3JYAA 3EJ1A 3QXOA 4I6HA 4FYOA 5K9IA 5J9LA 1WVWA 3A7IA 2CCHA 4YTCA 4MQ2A 4PNIA 4QPSA 4WSYA 4MH7A 3NUSA 2W1HA 2R2PA 3JPVA 4WO5A 1GJOA 3VVHA 5J1WA 5BX0A 4DLJA 5A6OA 3UDZA 4RC4A 2XA4A 1EH4A 4O21A 1FPUA 1FVVA 4I6FA 4ZOGA 3QLGA 2C6EA 3A7JA 3FMKA 4BKZA 4BFMA 3TUCA 3LKMA 4CTCA 4GVJA 4KKEA 4R3CA 3QD0A 3IW8A 3CJFA 2J0MB 4JG8A 1F5QA 3FMEA 3MI9A 3FMLA 4IVCA 2O65A 4MX9A 3ZU7A 4QMOA 3F66A 1WBWA 4LQMA 2P4IA 4R1VA 4EWHA 2UW4A 2GNIA 4UBAA 3PJ3A 3QCQA 4JXFA 1JLUE 5B2KA 2OH0E 1YDRE 1V0OA 3PP1A 2KTYA 4FG8A 4RQKA 5EG3A 4TWOA 5FLFA 5LMKA 4B8LA 2CJMA 2R0UA 3N4VA 4DFYA 4UMTA 4BCPA 3TNHA 3PE2A 3MJ2A 4FIJA 4N70A 3TKUA 4EOKA 2Y8OA 3HV5A 3U6JA 4I93A 3E64A 3LMHA 2R3MA 4ZZMA 2XVDA 2W9ZB 3CS9A 4EZ3A 4CRSA 4RA5A 2PYWA 3FMHA 2JIIA 3DQWA 1LR4A 1OPJA 2IEWA 2WTWA 3FMMA 4FODA 3TL8A 4BCMA 3ZLXA 3ET7A 1E1VA 1JQHA 2IZTA 3DU8A 4AN3A 3S1HA 4IB5A 4LV5A 1WMKA 2R3GA 3G90X 3QQKA 4ZJVA 1OECA 5CVGA 4RLKA 4G5PA 4UALA 2PE2A 3RCJA 2J7TA 3DDPA 5DRDA 5GNKA 3QA0A 3UIUA 1YI3A 5DRBA 2C3IB 4OTGA 5CEQA 4DEHA 4YZ9A 3R7OA 3HDMA 5B0XA 2OH4A 2W5BA 3KFAA 4FBXA 2JD5A 5HU3A 5AV2A 3HV6A 1DI8A 4QMNA 2F9GA 2PVFA 3ERKA 5BVEA 2R3IA 5EYKA 3NUXA 3KB7A 3Q9WA 3C4XA 2XKCA 3NW7A 1ZMUA 4FL1A 2J0IA 3AD4A 2B9IA 3EN4A 3ORKA 3BHHA 4FKGA 4RVTA 3UVRA 5CASA 2J2IB 2CSNA 4H3PA 5A4EA 4Q2AA 4TRLA 3ANQA 4R3PA 4APPA 3LFCA 4XG4A 5C03A 4PDOA 2BVAA 3UG2A 3CEKA 4LDTA 5DR6A 5CXZA 5JRQA 3D5WA 3FI4A 3KGAA 4JI9A 3G5DA 1NT2A 4CEGA 4DH1A 3HECA 2UVXA 2PHKA 3KF4A 4U7ZA 5HX6A 5ETIA 3PWDA 4NH1A 2IW8A 3R21A 3PLSA 3QD2B 3U55A 4CQEA 3GP0A 3CP9A 2B7AA 3PUPA 5BVWA 4DEIA 5BVFA 1E9HA 1KWPA 2XK7A 1ZOEA 2I6LA 4L44A 4O0SA 4I6QA 3ZCLA 4BHZA 3C5IA 4L43A 4N4SA 2CN8A 3C4WA 4IB3A 4FV7A 3PPJA 3SVVA 5HESA 2ZM4A 3FZPA 3QL8A 4LUDA 1IAJA 2HK5A 3PWYA 1VR2A 1IRKA 4QMZA 4QQ5A 5LCJA 4E6DA 3B2TA 3AT2A 2BRMA 3I1AA 4U3YA 5K5XA 5KMMA 5FP6A 2KULA 4WD5A 4QP6A 1WFCA 3OWKA 1VYZA 3OCGA 4NW5A 2C6TA 4FNYA 2VTIA 2GMXA 4MTAA 4NWMA 3FHIA 1KOBA 4ZXTA 1PMVA 5HCYA 3V6SA 3DBQA 3LQ5A 3HRBA 1NW1A 1YXVA 2Q0BA 3TIZA 4CZTA 3G15A 3Q9ZA 3ZO3A 4U41A 1BLXA 2C6DA 4CYJA 5L2SA 4DF3A 4O4CA 2VZ6A 4MNEB 4D9TA 4W4WA 3D5XA 5EHYA 2VGPA 3TKIA 5HORA 3C9WA 4L42A 2XB7A 3R1SA 3TDWA 2QR8A 3NPCA 4KIKA 1SM2A 5C27A 2UVYA 3IQ7A 1K3AA 4FF8A 4RIWB 2OXDA 4ZY4A 3FYKX 2JFMA 5EDPA 4B8MA 3VS5A 3WF5A 1ZYDA 3O8PA 4JQ7A 5M07A 4RWLA 3UP7A 5D9HA 1GOLA 2CGVA 4I3ZA 4X6QC 4O7RA 3TMOA 2YIXA 2QU6A 1OBGA 4AUAA 3FY2A 4QYYA 3BRBA 5AADA 2YEXA 2X2KA 2A27A 2X7OA 1RW8A 3FXXA 4P5ZA 3JUHA 3WE4A 3V01A 1ZY5A 3OTVA 3F9NA 4DHJA 4RIXA 4C8BA 4HCUA 3QHWA 4LMUA 4AXDA 4FX3A 3MVMA 3HZTA 2C30A 3E8CA 4WNMA 2W9FB 1ZWSA 5BVKA 5HQ0A 4EH4A 3A7HA 2XM8A 2YIWA 2YIQA 3LFDA 3G6GA 4U5JA 2P0CA 3FXZA 4QP2A 2O2UA 4IZ5A 2GNLA 3IS5A 4DTBA 3R1QA 4BCGA 2JKMA 3BV3A 4EJNA 4IAKA 1H27A 3FUPA 2VWUA 1OPLA 2HOGA 5CSXA 5KMOA 3UIMA 4DCAA 2VWIA 3QUEA 4XP0A 1W2CA 5EM6A 4AW0A 3KU2A 4NKAA 4G6OA 5EW3A 4J8NA 5BMMA 4ZIMA 4GG5A 3A60A 4JT3A 2AC5A 4KA3A 4M97A 5F20A 5HKMA 1HCLA 3FPMA 3QGWA 3QTXA 3UNKA 3JVRA 5CSWA 4KS7A 3CIKA 2YDIA 4O0RA 1PXKA 1G5SA 4F0GA 5JN2A 5EQPA 3W8LA 4XOZA 4MKCA 4HYUA 4FV0A 5FBNC 4FK3A 5G6VA 2C68A 3ZDUA 3L9MA 1GY3A 3SDJA 2VO7A 4QMUA 4PL5A 3QRTA 1IEPA 5BMSA 4L9IA 3VQUA 1JKTA 2ZV7A 3G33A 3GVUA 4QMMA 2XNGA 4WOVA 5HE3A 5CVHA 4IW0A 3Q2MA 2RFDA 4BCQA 2OJJA 4HGLA 4AQKA 5EQYA 5E1EA 2ERZE 3UBDA 3BHUA 3V6RA 4DEGA 3AMYA 4I5PA 2FSTX 4AFEA 3BZ3A 3LXPA 1VLRA 2CN5A 1NVRA 4FMQA 5TT7A 3S0OA 1XMMA 4HZRA 3R22A 3KULB 5BYYA 4TTHB 4WUNA 4W4YA 5L4QA 3DAKA 4O7LA 3CBLA 4FTAA 3PPKA 3PXFA 4GVAA 3MS9A 5CAOA 4XMOA 3ZFMA 2EXMA 3OTUA 2A98A 2W1GA 3Q4TA 4E26A 4PTEA 2VO6A 4D55A 3G6HA 5HX8A 3BV2A 5IQCA 2CGWA 2R3HA 4PP7A 3EQPA 4E93A 3NVMB 5KUPA 4M68A 5EOBA 4CZYB 3NLBA 3EH9A 2YZLA 2VTQA 4GW8A 4QMYA 2YIRA 2LAVA 3QZFA 2VN9A 2OLCA 5CZIA 2RG6A 2ONLA 3I7CA 3AGMA 3PIXA 2UZOA 4AX8A 5AR5A 3V5TA 5EKOA 4LOQA 1W84A 4UV0A 3EWHA 4IZ7A 4QPMA 3SRVB 3I79A 5C1QB 3Q52A 4FVRA 4FG7A 1Q8TA 1L3RE 2PTKA 2YAAA 1WAKA 3LJ0A 4U79A 3BYMA 4FIGA 4GFMA 4YSMA 3LXLA 2WMWA 4BDDA 3L9LA 2JAVA 3GU4A 3KQ7A 3OT3A 4I0TA 4C58A 3RHXA 4UX9A 1R78A 3D9VA 3TM0A 2IF8A 2X1NA 1M2QA 5HHWA 2ITOA 3KRRA 4RIYB 4GFGA 4ZMEA 3PFQA 2WMAA 4PMTA 3GQIA 4LMNA 3UQGA 2YACA 5AUYA 3PG3A 2W4KA 4X21A 4ZK5A 5JQ5A 3U4UA 1G8SA 3KVXA 3OBGA 3ZM4A 3AQVA 3NNXA 5IH5A 3DNDA 3QALE 4RWKA 5J7HA 1ZOGA 1KUTA 4M8TA 4ZTHA 3PJ1A 2PVYA 3A7FA 4QO9A 5LARA 4K0YA 1CM8A 4IMYA 2XIRA 4U97A 3BE2A 3GGFA 4G17A 5CVFA 3OCSA 2JIVA 4OUCA 2JDRA 2W4OA 4C2WA 3TNWA 3VW8A 2BRHA 4I1ZA 1SMHA 3HYHA 3BGQA 3OW3A 4TNDA 4AE6A 3C0HA 3KL8A 4ANNA 2B54A 4FKQA 3C5UA 2VTRA 3ITZA 4ORKA 4F6UA 4NUSA 2JBOA 4O83A 1KV2A 1TVOA 2WOUA 2WTVA 1Q97A 3R6XA 1OL6A 2PE1A 4IFGA 4ANQA 2Y9QA 3I60A 1BL6A 4KBAA 2PVMA 3NW6A 4S2ZA 3ZC6A 4EKLA 1YOJA 3W10A 5HZNA 2H96A 1KE5A 4AF3A 4YUQA 2OF2A 3MN3A 3P7BA 2VX1A 3T8OA 4A4OA 5IDPA 3SX9A 3F7ZA 3PZEA 3QRUA 5K0XA 3GFEA 2BR1A 1H00A 5IISA 3EQDA 4MD8E 3TI1A 4WRSA 2PUUA 2HZIA 3QTZA 5FBOA 2UUEA 2Z8CA 5K3YA 4EORA 2WEVA 4AOTA 4FKPA 4KWPA 3CSVA 1Q24A 2REIA 2X6DA 1TQIA 4NJDA 2AQXA 1FOTA 5FM3A 2JBPA 5H9BA 3R9DA 3UVPA 3NS9A 4EQMA 3BCEA 4OAVB 1PRYA 3QQGA 2XIZA 4QMWA 1Q8YA 4GJ3A 1OM1A 5AP2A 3C13A 4MVFA 4XG2A 3BLRA 3PLAE 3R30A 3SLSA 4ACMA 3DK3A 5CLPA 3DBEA 4C3RA 3TV7A 2YCQA 3BU6A 3R2BA 4E6CA 1B38A 2J90A 3PTGA 3VBXA 5E8XA 5HG5A 4TY1A 5DN3A 5LXMA 4O7SA 2RSVA 2OSCA 3A4PA 3G0FA 3QRIA 4JL9A 4O0YA 2C3LA 4EH6A 4I5MA 4K1BA 3ZRMA 5AV1A 4QTBA 5BVNA 4ZJJA 2QOCA 3LCTA 4IEBA 3B8QA 4RJ5A 2IJMA 3OCBA 2ZV9A 4RX9A 1KSWA 5JQ8A 4A9RA 4FV9A 3TZ8A 4GUBA 5T6KA 4RX5A 3AC5A 3MVHA 1HCKA 3OG7A 5HCZA 5I4NA 1B6CB 3MH2A 3D2KA 2YERA 2X0PA 2C6MA 3E87A 3FI2A 3NAYA 3QZHA 1P4OA 2W05A 4PPBA 2C69A 3ZC5A 5M06A 2DQ7X 2P2HA 4I0RA 4YPDA 4I6LA 1REKA 1FGKA 2P55A 3CXWA 2OJFE 2WQMA 4G3CA 1A06A 2PZIA 1GIIA 2UZBA 2RGPA 2YM8A 3HMMA 3G9LX 2WMRA 4GIIA 4JNWA 4RVMA 5AM6A 4O4FA 5IMXA 1H8FA 1OMWA 3F5UA 4NM7A 4KNBA 2HY0A 1PW2A 3D7ZA 4X2JA 3NYXA 2ZM3A 2JKOA 3DZQA 4GYGA 5HG9A 3E3BX 4EBWA 2B55A 2OJ9A 3PUFC 3P86A 4AS0A 3R7IA 4RMZA 3IECA 4D28A 1OPKA 1XBAA 2WNTA 4YJVA 3UTOA 3ZRKA 4QDVA 1BYGA 4TYIA 5DHJA 1IASA 4YBJA 3W0PA 3R9OA 3QGYA 3UNZA 5KNJA 3HP2A 4FT5A 2QLQA 4FTQA 4I21A 3FPQA 2AC3A 4O0VA 4YTHA 2FVDA 1H08A 4S33A 5IKWA 3DAEA 2XKDA 4D2VA 4V04A 1JSVA 4LOOA 4Z3VA 4GU6A 3W0MA 2EXEA 2QOLA 3S95A 4XBRA 3ODYX 3WZKA 4H05A 3R8ZA 1O6LA 4OLIA 2GNHA 4UWCA 3RZBA 2Z7QA 3FXWA 3VN9A 4FYNA 3D83A 2ITTA 3ROYA 3EFWA 4FK6A 2W06A 4IX6A 5CT7A 4CTBA 2P33A 5HO7A 3CJGA 2E9UA 2F2CB 3DJ6A 3VS7A 4Y72A 4CG8A 4MNEA 3FHRA 3R63A 4R7BA 3E88A 2ZOQA 2X8DA 4KSQA 4YBKA 3PVUA 2VTLA 3UNJA 2P2IA 4D58A 3RAIA 4QYGA 3V5PA 4KUJA 4FV8A 1ZYSA 3MPTA 5CF6A 2OF4A 1JKKA 3DZOA 3O7LB 4W9WA 2VTJA 4BGGA 4CFFA 2PUIA 2GDOA 3BU5A 4RIWA 2WGJA 5CU6A 5HI2A 2F4JA 5CENA 5E4HA 5DVRA 4HCVA 3R2YA 4YGAA 4FG9A 3OWLA 4AXEA 4GT3A 4U3ZA 4USFA 3TDVA 2YM5A 3R73A 3LJ2A 5D7AA 3C50A 3NYNA 4G3FA 5CQWA 4EOIA 1OZ1A 5AMNA 2OXYA 5AIRA 2YLEA 3DOGA 1ATPE 2I0EA 2I40A 4IAFA 4OTQA 2WU6A 3FJQE 4NM5A 2YLFA 2VTHA 3WYXA 3NDMA 4FEWA 3CY3A 1K2PA 4GIHA 2QOBA 3RAHA 2W1EA 4FKLA 4D0WA 5EM8A 3SKCA 3RWPA 2J0KA 5J87A 3ZZWA 4C38A 4HVDA 4EH9A 3UOJA 2HW6A 4BDGA 1FVTA 1OB3A 2BILB 2VD5A 5CS6A 4R77A 4L45A 4DCEA 4FNXA 3HMOA 4QMQA 2DS1A 4FSTA 3IDPA 4RFZA 3HV7A 4S34A 3ZLSA 4U81A 3R7YA 4O0TA 2ITYA 4F7SA 4BJJB 3W16A 3ML1A 2W1CA 3ZH8A 4FGRA 5FTGA 3BL9A 4CZUA 4OT5A 4B4LA 2XMYA 4OGRA 4DG0E 3EQIA 2X0OA 3PA5A 3EFKA 3FY0A 3L8VA 3QHRA 4FL2A 4L3PA 5AUXA 3BWFA 5LMAA 1G8AA 5C01A 4O7YA 5J9ZA 3GXLA 5CZHA 4TL0A 3NIZA 3SOAA 4EK6A 4C57A 2C0TA 4GSBA 5JKGA 2H9VA 3GC8A 3GENA 3QUPA 4MXCA 3QRJA 4W8EA 5HTBA 2XARA 2BHHA 2NPQA 1XO2B 2WTCA 3QXPA 3A62A 1UU3A 4FA2A 4XG7A 1ZZ2A 1O6YA 5CXHA 2QURA 3UOHA 2YA9A 3LM5A 4AGCA 2EB3A 3NCGA 3ZUTA 3UQCA 1RDQE 4DITA 4ANLA 3PDTA 2C5NA 1CKPA 3KKVA 5HLPA 1KV1A 3RCDA 2ONLC 1XH8A 2OW3A 2FSOX 2QI8A 1H1WA 3GU8A 1TFFA 3ORPA 3LLAA 2PMNX 3DKOA 5E8ZA 4U43A 4AW1A 4PDPA 4OBPA 4DBNA 1H07A 4TWCA 4D0XA 2XANA 5I9VA 2W17A 3KULA 4XH6A 2XYUA 2XRWA 3EKNA 3LQ8A 4P90A 3SQQA 3ZFXA 1GIHA 4ZJIA 4S32A 1MRYA 3DJ5A 3PZHA 3COKA 1OL2A 4LFIA 2ETKA 4RX8A 4XBUA 4BHNA 3KXGA 4E6QA 5IDNA 3G51A 1PYXA 4K9YA 5HE2A 2VTSA 4ID7A 4E7WA 4YLLA 3AKLA 1FMOE 3W8QA 4F63A 5CI7A 1J1BA 3PXRA 2R3KA 5DG5A 5AUWA 3Q9XA 4F65A 2PZPA 3P78A 2YDJA 4FT9A 2CGUA 3VNTA 4JRNA 3WF7A 4CKJA 1ERKA 4RFMA 5IEVA 4NL0A 2QNJA 4M0ZA 4JG7A 3UO4A 3V5WA 2B0QA 5IQIA 2Q0NA 3S00A 5LWNA 3KCFA 3Q9YA 3MIAA 2G2FA 4DBXA 4ASEA 3SRVA 1FBNA 3GFWA 1XJDA 4F0FA 3C0GA 5KMLA 2ZMDA 5EDRA 2AUHA 5C8KA 3G2FA 1MUOA 1XQZA 1WCCA 4K33A 4IWDA 4C4JA 5I0BA 5L2WA 4DDIA 1OUKA 4IANA 4IM3A 3QQHA 2PZ5A 2Q83A 2XJ0A 4O4DA 4X2GA 4FL3A 3VS2A 4EOSA 5CF8A 3COIA 4RIYA 2J4ZA 1Y8YA 1ZZLA 4C3PA 4TYJA 1URWA 4J98A 3R8MA 4KBKA 4MXZA 4NIFB 3VRYA 4FKIA 5CSPA 5LVNA 3D4QA 3OF0A 1R0PA 1YXXA 5DE2A 1JWHA 4BDBA 5KHXA 4B6LA 3D0EA 3ZZEA 3V8WA 4F9WA 4O7WA 3D7TB 4GT5A 3EKKA 3D5UA 4JDHA 4FKSA 4MYGA 4YJUA 3DTCA 4YNOA 4F6SA 4G3EA 3ULIA 4PPCA 4ZZNA 4GJ2A 3P7AA 3C1XA 2UZUE 3F7WA 3LFEA 4L3LA 5JGDA 5BVOA 3M2WA 4EUTA 2W0JA 5CAVA 1H1RA 3PJCA 2YISA 4BCFA 2C3JA 3E8DA 3EQHA 4KIOA 3QAME 2ITPA 3UZPA 5K0KA 1U59A 3H9RA 1YHSA 5FQDC 3AC2A 5AAFA 4C3FA 5F1ZA 2ITXA 4Y83A 1LP4A 1OIQA 2HIWA 4C4FA 4RVLA 4ASDA 3SW7A 1RQQA 4EK3A 4USEA 4BY9E 3UZRA 4IVBA 2WB8A 4GU9A 3EQFA 2GQSA 4BCNA 2ZAZA 1PMEA 3BGZA 5DWRA 4BDEA 4FOBA 4DAWA 4F7JA 2GQGA 3H9OA 3HA8A 4AZVA 3HRCA 3FEGA 3ZXZA 4IIRA 5ICPA 3PXYA 3CQEA 5DT3A 5IQFA 4OW8A 4PX6A 2ESMA 1Q99A 4QTDA 5M57A 5C4KA 3IOKA 1YWVA 3N4TA 4HJOA 3AMBA 1ZMVA 4IJPA 4L6QA 4XG9A 5CTPA 2IPXA 2PPQA 5LVOA 4QYFA 4HW7A 5M4CA 5EDQA 5L6PA 3JY9A 4RJ4A 4E20A 3ATTA 2R9SA 4RIOA 1R3CA 3KVWA 3QU0A 2OICA 3BYOA 5HTIA 2PMIA 3OY3A 1FINA 3IK3A 1H25A 3R83A 5E9EA 3W0QA 3RBWA 3AD6A 5I3OA 5IUGA 3UMWA 1UWHA 2WO6A 3HKOA 3ORIA 3VHEA 3VUHA 4DGMA 5B2MA 2WPAA 4IZYA 2Y4IB 4LRMA 3IOPA 3LLTA 2XALA 4FVQA 1FVRA 1ZOHA 5IQAA 5IA1A 4J95A 5KBQA 5AUZA 4OTIA 1PHKA 2WMXA 2G2IA 4D2WA 4RFYA 4NJ3A 3QRKA 5DIAA 5HVJA 2IVUA 4ZEGA 1GIJA 1CSNA 4JOAA 3T3VA 2HWOA 4GK3A 4CV8A 3KXMA 3I0QA 2IW9A 1OIUA 3V8TA 2PY3A 2XM9A 1NVQA 2OZOA 5HLNA 3DBDA 4APCA 2O8YA 4KIPA 4G2FA 3FC2A 4AT3A 1Z5MA 5ITAA 4AA4A 3F6XA 2V0DA 3NNUA 3R7UA 4WBOA 4EL9A 2OBJA 4YHTA 3BBWA 5BYZA 3VUDA 1OI9A 3KY2A 4KAOA 5FRIA 3CQWA 4FSRA 4I94A 2CKPA 1VEBA 4J8MA 4I6BA 1CDKA 2CKQA 3KMMA 1YWNA 5LVMA 5ANGA 4J99A 4DINA 5J95A 3IGOA 5FDXA 4EYMA 5A4QA 3LAUA 2HXQA 4JJRA 2V62A 3GC0A 2Z7RA 3IKAA 3EN9A 2VTPA 2OU7A 4BKJA 2PK9A 2WXVA 5FP5A 4IM0A 1YHWA 4E5AX 4FTUA 2VTMA 3Q6WA 2F57A 2PU8A 4QP1A 1ZMWA 2R3FA 4L53A 3AXWA 3KEXA 4AT4A 4C61A 4D1SA 1R39A 4QP4A 3GQLA 2IO6A 5IH6A 5HVKA 4XLIA 4DEBA 1VYWA 3O51A 4EHEA 1YOLA 3OP5A 3BGPA 4PWNA 5GHVA 3UC4A 4C62A 4ASXA 5CAPA 4H1JA 3QQFA 3O5AA 2BRNA 5IQDA 5JT2A 4XLVA 1YVJA 1YXSA 4JX7A 4YZCA 5CX9A 4O4EA 3DGKA 3FSFA 4HVIA 5IG1A 1Q8WA 4F9YA 2Y0AA 2ITNA 3E7OA 3BHYA 4JBQA 5EM7A 5DGZA 5EOLA 4QP9A 1OITA 5EYDA 3HL7A 5JMSA 3WZDA 5HTCA 1JKLA 2R3QA 1BX6A 4R7IA 4BRXA 2XH5A 1J7UA 5ETFA 1Y6AA 2XJ1A 5H8GA 5HGIA 1TQMA 5DT0A 3W0OA 1OL7A 3ANRA 3QWJA 3ZFYA 4BIEA 5FGKA 4ZY5A 4O0UA 3EHAA 4CXAA 3AKJA 4FSWA 3RINA 3L9NA 4XJ0A 4AQCA 4EUUA 4FTTA 3RTPA 3U9CA 5LMBA 4AWIA 3NX8A 4FICA 4DA5A 3L1SA 3NAXA 3QUDA 4WRGA 5EW8A 4CMUA 2YN8A 4D2RA 4L01A 4WG5A 1NVSA 1YI6A 4BTJA 5AR8A 2ZMCA 4BJJA 5FXSA 3SOCA 1T46A 2GS2A 2XNPA 3OBJA 1M2RA 1CKJA 5AP7A 3NMUF 4DEEA 4JX3A 4EJ7A 4JS8A 1JNKA 3ORZA 2FUMA 2R3JA 1Q8UA 3L8XA 4XV2A 4DEDA 2YDKA 3VQHA 4CRLA 3HDNA 3KRLA 4NU1A 3SA0A 4J52A 1TKIA 1Q62A 4OAUC 1H01A 3CKXA 3QCYA 5BPYA 3VWAA 4BR3A 4M0YA 4DE4A 4E4MA 2BIYA 3KXZA 1ZXEA 3VUMA 4D4YA 1OKZA 3COMA 3GBZA 2XP2A 5IH4A 4GL9A 5L8LA 4AGWA 5JFSA 3QYZA 2XCHA 1UNHA 3LXKA 4C4EA 4M14A 5D10A 3LOKA 4EHVA 5HEZA 3PVBA 4YJRA 1U46A 3FL5A 3QZGA 3R8UA 3N51A 4YR8A 3I5ZA 3TTJA 2W4JA 4C35A 4Z16A 3ZO1A 4DDGA 4WUAA 1YWRA 4IM2A 1VJYA 4DH5A 1H0WA 1TZDA 1ZAOA 3MBLA 4UZDA 2WAJA 2CCIA 3HUCA 3SG8A 3MPMA 4Q9SA 1Q3DA 5L6OA 1URCA 4MAOA 3EFLA 1A9UA 3L8PA 4M12A 1VZOA 2PVHA 3GI3A 3BYUA 4WNPA 4K77A 5E8UA 1PMUA 1QPJA 3TN8A 5GJGA 1NY3A 2XNNA 4GK4A 3V51A 4D4SA 4QNYA 2VWZA 5FTQA 2O0UA 2UZVA