4KIOA

Kinase domain mutant of human itk in complex with a covalently-binding inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
265
structure length
240
Chain Sequence
GSVIDPSELTFVQEIGSGLVHLGYWLNKDKVAIKTIEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery of novel irreversible inhibitors of interleukin (IL)-2-inducible tyrosine kinase (Itk) by targeting cysteine 442 in the ATP pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 240
sequence length 265
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kioA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kioA01
2JGZA 3D14A 1KE5A 4R7HA 2PE1A 4FNZA 1E1XA 3JPVA 3PE1A 2J5FA 3ZOSA 5HIEA 3QQLA 4AT4A 1TQPA 3WIKA 4L7FA 3F5UA 3K54A 3PJ2A 4J53A 3PG1A 4NK9A 4ENYA 2O2UA 4BVUA 4BBFA 5GIPE 1M14A 2XK9A 3F66A 5GNKA 2XNEA 3HUBA 1VYWA 4UV0A 3EYGA 3K3JA 1JSTA 2A1AB 2B9IA 4QO9A 4RRVA 3FWQA 3UYSA 4H05A 2GDOA 1Q3DA 2XIRA 3MVJA 4O2ZA 4EH4A 1JKLA 4CZUA 2VTHA 2QR7A 4RFMA 5CEOA 3BIZA 4G3EA 2JDOA 2XP2A 2UW6A 3PA5A 2VX1A 3MYGA 4R77A 2X8EA 5J95A 2VWZA 3F3VA 3Q60A 3BHUA 3ZZEA 3D83A 4DT9A 3F5GA 3HMPA 5CSXA 1Y8GA 4XJ0A 5M53A 5KMOA 3GU4A 2FSLX 4AW5A 1PMUA 3BGQA 3G33A 4RIWA 2ITQA 5DLSA 4IDTA 3U4WA 3LQ3A 4E4LA 3HMNA 4I5PA 5DIAA 2W9FB 2RFSA 4D1XA 3QKLA 3SDJA 4R3PA 2WTKB 4K77A 4W8DA 2YDJA 4QPMA 4Y5QA 4RLKA 2GTNA 2WB8A 3WF9A 2VTNA 2BILB 3ENMA 2OG8A 4O7NA 3F6XA 4JX7A 4O7ZA 3KRXA 3HRFA 2E9OA 4JQ7A 1FMOE 3H30A 2I40A 4TYJA 2WTDA 4Z16A 4FIEA 3V8TA 4TZRA 5CSHA 2CJMA 2E9PA 2X81A 4FV2A 4WKQA 1Q8WA 4RPVA 2OO8X 2W1FA 4CTBA 3CBLA 4RIWB 4FZ7A 1H24A 4AT3A 3F69A 3MA6A 3DQXA 2QODA 3TI1A 2QCSA 3AT4A 2UZBA 1H1QA 5IEXA 2OH0E 2ITPA 4PRJA 4BHNA 2PUIA 2XK8A 1JKTA 2W1HA 3ZXZA 1B6CB 2HXQA 5LVOA 4D28A 4DGLC 5AP3A 1KOBA 3POOA 4EUTA 1K9AA 4WD5A 2J0KA 2JLDA 3GFEA 4QP6A 3PWDA 1R39A 2WQEA 2EB2A 4CMTA 2UZOA 2CLQA 3KVXA 4GH2A 4RWKA 4ACCA 3IKAA 5AAEA 4XG4A 3R9RA 1PXPA 5KBRA 2XM9A 5KUPA 2RIOA 2YLFA 4RT7A 4UBAA 5D1JA 5DT3A 1OBDA 4WSQA 2WEVA 1OVEA 4XG9A 5E1EA 3QRKA 4YSJA 4NSTA 3NYOA 4I21A 2ZM4A 4HCVA 5IUIA 4CD0A 1GZ8A 3CY2A 3U55A 4AN3A 1Q62A 5HE0A 4ZEGA 3TDVA 2FSMX 2HAKA 4FIFA 4EBWA 3ZFMA 4EWHA 4FOBA 1W82A 4RGJA 2V7OA 3CGOA 3DB8A 4H39A 5M4FA 3D2IA 2R3FA 2J51A 2Y8OA 3VRYA 4FYOA 2ITVA 3ORTA 4X3FA 4OUCA 4KIQA 4K0YA 2C0OA 3RPOA 3HL7A 4W4VA 5D12A 2PVLA 3OD6X 3QKKA 3VO3A 1GY3A 4BIDA 4DGOA 1EH4A 4JIKA 4JT3A 3ULZA 4G3GA 4PQNA 3OG7A 2GNGA 4E6DA 1YI3A 5JT2A 3KU2A 3UP2A 4F0GA 5CVHA 4EK5A 4BTMA 3FE3A 1XH7A 4NT4A 4YNEA 3U9NA 4YZDA 1DI8A 1GAGA 4IZ7A 2JFMA 5FEDA 1YWRA 3R8ZA 5JSMA 5AR7A 4QTAA 4S31A 3S00A 2ERZE 3EQGA 1ZXEA 3LAUA 2XEZA 2J0MB 2HW6A 3KRLA 4RA5A 5A4TA 4ZJVA 2WPAA 3LW0A 2YAKA 1YXVA 5JN2A 3A4PA 4Y85A 4ZTSA 5AR8A 4DTKA 5EW9A 2XJ1A 3PXZA 2RG5A 4QMLA 5IKWA 3FI2A 3QD2B 4WIHA 3C0HA 4G2FA 2IZUA 4F0IA 2VX3A 2BRNA 4BDFA 4O7LA 1SM2A 3C7QA 1CM8A 4HCTA 5HNBA 2FB8A 5A3XA 3ZLWA 4GUBA 2V0DA 4M14A 3IONA 5IQCA 1XH6A 3E7OA 3QTXA 4PDYA 2EU9A 2PVKA 4FTAA 1KE9A 2FA2A 3TJDA 3LCOA 4E26A 1Q8ZA 1OM1A 2W1EA 2JKKA 4K18A 1H07A 1K3AA 3ATSA 2G15A 3BE2A 4NJDA 4FZ6A 4V05A 4BDDA 4FKWA 3SRVA 3UZTA 5EQPA 5AUYA 2XBAA 4G6OA 5FM3A 2G01A 4PUZA 3MB6A 1OKYA 4BDEA 3IW7A 4JG6A 3R9NA 2QOIA 5F20A 3R8PA 2H34A 4D4SA 4Z7GA 5KBQA 2QG7A 4FT3A 5KX8A 3VS6A 2BHHA 1U54A 1BLXA 4AW2A 4ZLOA 1FVRA 4FEXA 3V5TA 4DFNA 1VEBA 5FXSA 2J50A 4RC3A 3WOWA 4DH7A 3I4BA 2O5KA 2WTJA 3BV3A 3EL7A 3FC2A 3O7LD 1HCLA 4O38A 2ESMA 2R3QA 3AC2A 2C6IA 4LUDA 4CCUA 4I20A 3LFQA 5CT7A 3F2NA 3SC1A 3PE2A 2R3MA 3WYYA 3NW5A 1QCFA 2VWVA 3NNVA 5J1WA 2C3JA 3ELJA 4YZMA 3KB7A 4I24A 5IPJA 2I6LA 1KE8A 4D2RA 4HNIA 3VUHA 1W83A 4K6ZA 2XS0A 5AUXA 4PTCA 2HCKA 4GK2A 4HYSA 3G6GA 1WBTA 2O0UA 3DBEA 3DT1A 5EM7A 2R3IA 2V7AA 5ANGA 5HCZA 4FMQA 2ZMCA 3SOCA 4D55A 4DLIA 2QLQA 3RVGA 4IADA 2XK3A 4PV0A 5CAPA 5IQFA 4FL1A 4TWPA 3O96A 5EW3A 3BBTB 4HZRA 4OTQA 3QTWA 4X21A 4FI1A 1QL6A 4N0SA 3GU6A 3U8WA 4QMQA 3MTFA 4NFNA 5A46A 3EN9A 3BZ3A 4IB1A 3BGZA 1PXMA 4UALA 3OUKA 5HKMA 4JAIA 4O27B 2OJGA 4P7EA 3TZ8A 3BQCA 3KXZA 2VD5A 4D2VA 4I93A 4E3CA 1YOMA 2GFSA 2Z7LA 3BELA 4AOTA 5KO1A 5H8EA 2ITUA 2WMTA 2BR1A 3TUBA 5EHLA 3SKCA 4HVIA 3Q4TA 4YC6A 2VWUA 3FL5A 3AGLA 4F65A 3ODYX 2O65A 3E8NA 3P5KA 4IACA 5M55A 2A0CX 3KXNA 4RX8A 3GB2A 1BI7A 1H00A 3WARA 2REIA 5E8VA 4OGRA 5TE0A 3FI4A 3MFTA 3R28A 3V04A 4EH7A 3EQPA 4F09A 1JKKA 4YZCA 4IM3A 4QMNA 1QMZA 3QRTA 4EYMA 4AN2A 4HYUA 1ZYCA 3HECA 4CV9A 3VUDA 3SGCA 2RFDA 3EFLA 5EM6A 5LWNA 4XMOA 3E7VA 4X3FC 3F5XA 2OW3A 5LXMA 4FEVA 3DB6A 4CYJA 1WBPA 3ANQA 3KL8A 3FC1X 4M0ZA 4NM5A 5JK3A 3R21A 4G3DA 2YIXA 5HICA 2R7IA 4BKZA 5IA4A 3F82A 4ONAA 4PL4A 2A4LA 4LMNA 4CFNA 3UIXA 5IH4A 2CNUA 1J1BA 2XIKA 4J7BA 2I1MA 3NAXA 5AP4A 5CSPA 3KMMA 3NR9A 2XK7A 3LPBA 3QC4A 5I3OA 5IISA 1I44A 4QMTA 1PW2A 4J8NA 2Y4IB 2PU8A 2OFUA 2Y7JA 3CQWA 2XBJA 2UZEA 3R02A 3RBWA 3CPBA 3RM7A 5CQUA 5CF4A 2UW9A 3A62A 3P1AA 1UWJA 4M84A 5TO8A 5KE0A 2FGIA 4ZY4A 3ATTA 3C4CA 4RBLA 1PYXA 4C4JA 5K5XA 4D0XA 5KMIA 2GS2A 2R3JA 4ZSGA 4IB5A 2W1CA 2WZJA 3ZONA 2JIIA 4WNKA 5EI8A 3AD6A 3OF0A 4UWYA 4YMJA 2CKOA 2R7BA 1JAMA 3A2CA 3LFBA 4NCTA 3KRJA 5AA9A 4Q5EA 3TIZA 4MEDA 4YHFA 3P0MA 4I6BA 5IA2A 3PY0A 3KKVA 4PX6A 1OL6A 3K5VA 4OR5A 5I9XA 2X2MA 1AQ1A 4KSQA 1A06A 3AC4A 3DXNA 2Y6MA 4YBKA 1G5SA 3EKNA 5LVMA 1M7QA 4EJ7A 3QRIA 3NUPA 3R63A 3VW6A 3HEGA 1BUHA 4PTEA 2BFYA 2JBOA 3E8DA 3OUNB 4RZVA 4FTCA 4E5WA 3AG9A 1ZOEA 2BAJA 2NRUA 3UVPA 5CALA 4TYHA 2HWPA 3BWFA 4U80A 4ANLA 3BV2A 2W1DA 3OVVA 4D58A 2C6OA 2C3LA 3Q04A 2QHNA 3ZM4A 2VWIA 1UNHA 4JQEA 5AIRA 4L01A 3NGAA 4KRDA 4F9AA 5DNRA 3KK9A 2VTOA 4GFGA 1W98A 4F6SA 2GS7A 2ITYA 3FYKX 5DRBA 3U54A 4C8BA 1UU7A 3LZBA 4AZTA 4L7SA 3IGGA 3VN9A 3LVPA 4FIGA 1XQZA 4UXQA 3FMEA 2W1IA 5CY3A 4UB7A 5J1VA 4C4EA 1PXKA 3DZQA 3OCTA 2BROA 1QPCA 2F7EE 4QMXA 4GS6A 2UW7A 4C58A 3S4QA 3N4TA 4MKCA 2XCKA 4AN9A 3GNIB 1UU9A 5D9HA 3UODA 2BZKB 2OWBA 2GQRA 5AV3A 5JFVA 4E7WA 5L2IA 1T46A 4XUFA 2OFVA 5FBNC 5ETAA 4QMMA 4RQKA 2PZIA 2KULA 3R7YA 4ARKA 3AGMA 1WMKA 2BALA 4PTGA 3VUKA 3R7UA 2QOQA 1WBVA 5HVYA 4O0XA 3HMMA 3OY3A 3W1FA 3G9NA 4BZDA 1VZOA 4PF4A 5HE1A 2R3HA 4LQMA 4M0YA 4MD7E 4O21A 3ORPA 3RJCA 4WBOA 3SOAA 4FUXA 2JDRA 4ZAUA 3PY1A 5C8KA 4D4YA 2R3NA 2YCRA 2J2IB 4QOXA 3ZZWA 2R3RA 3FL4A 3EYHA 3G5DA 1REKA 4DHFA 4QMSA 4JQ8A 4O0RA 4RJ5A 3VAPA 3AMYA 2I0YA 3FMHA 3GI3A 4TXCA 3ZCLA 2Y4IC 4H1MA 5IDPA 4Z55A 4UMQA 3BYVA 4F9YA 2EVAA 5KMKA 1S9JA 2ZB0A 3DAJA 4ERWA 5GINE 4BCKA 2FSOX 2VWXA 4JIAA 4HVDA 4RVKA 5HG7A 3KF7A 5I9UA 2RG6A 4EOSA 3LKMA 5CZHA 1Q8UA 3CC6A 4BKJA 2C0TA 2QO7A 4DG3E 3EFWA 4RJ3A 2VO7A 3TG1A 4E5AX 4EH5A 1URWA 2O64A 3NX8A 3TIYA 2BZJA 3WILA 4LOOA 3EQRA 3CJFA 4A07A 1XHAA 4BZNA 3HMIA 4AFJA 1YW2A 2DS1A 2YZAA 2QONA 3IDBA 3SLSA 4I0RA 3HA6A 3KULA 4IAAA 5AFVA 4FK6A 2CHLA 4FV5A 2XRWA 3FLNC 4G34A 1OBGA 1QPEA 2DYLA 3ENHA 3I7CA 3KY2A 3O8TA 3OXZA 4KS8A 3HAMA 3TZMA 3PZHA 3DCVA 4IMYA 3OFMA 1JSUA 4Y83A 4FTOA 3FQHA 2VZ6A 4KAOA 4ALUA 2W96B 1E9HA 4WHZA 1VYZA 2YERA 4AOIA 4NCTC 4XG6A 4NU1A 2C4GA 4FSYA 5M51A 5DRDA 4JG8A 1H28A 3LCTA 3A99A 4HYHA 2F7ZE 4ACGA 2GNJA 5HU9A 4MHAA 3KULB 4ANBA 4GK3A 2YM3A 3QBNA 4RWLA 4DG2E 2W4KA 3C0GA 3LLTA 4X7QA 4ZK5A 3AOXA 4EK8A 2QG5A 3D4QA 1JWHA 3H10A 4EH8A 3MY0A 2VTTA 2XCHA 4UXLA 4GU6A 1XH5A 4I92A 3OWKA 1FPUA 3DJ5A 3DLSA 4BZOA 3GOPA 4NIFB 3BQRA 4DEGA 1O9UA 4EOPA 1IG1A 4EZ5A 2C47A 4O0SA 4BRXA 3JS2A 5HVJA 1JNKA 4G16A 3VUGA 2Q0BA 4NZWB 4BTFA 4TYEA 2JEDA 4QTBA 4P5QA 3FY2A 1RDQE 1YVJA 4KS7A 5ETIA 3TNWA 3ZDUA 4ACDA 2HIWA 2R64A 4E6AA 5K4IA 4UZDA 5BNJA 3BE9A 3O71A 4J52A 4G9CA 1U5RA 4GVAA 2C1BA 5L4QA 2J0JA 3HYHA 5J87A 3VBXA 1SZMA 1RW8A 4Z9LA 1OIYA 2HXLA 3VS3A 5T3QA 1S9IA 3EJ1A 2RL5A 3RGFA 3NRMA 1OKZA 2HZIA 3AMBA 2YCSA 3A4OX 4GVJA 4IWQA 4ZTMA 4ENXA 1KE7A 5L3AA 3HNGA 3COKA 3CLYA 4DG0E 2KTYA 4FE2A 4MH7A 3PLAE 2EXCX 3D5VA 3W10A 3VQHA 5CU2A 2P55A 3NS9A 1W84A 3DXQA 5M06A 3VNTA 5HNIX 2YACA 3RHXA 5D11A 4ANQA 3PVBA 5M4CA 4DGGA 2IVUA 3R2YA 4V04A 2WU7A 3GCPA 5L2SA 4APPA 3AMAA 2C6LA 3O2MA 3R7OA 3F9NA 3ACKA 2WAJA 3DKGA 3W2PA 3ZBFA 4GFMA 2E9UA 4QQ5A 3IK3A 4YO6A 3T9IA 2PSQA 2WU6A 3BX5A 3Q9YA 3RZFA 3ERKA 3K3IA 2ITTA 4D1SA 4FKLA 3GC8A 2I0EA 1Q8YA 3GCVA 3O7LB 5EM5A 2PMIA 5C8MA 3R73A 3TWJA 4ANSA 4EKLA 4D2PA 3UG1A 3PSBA 4JDJA 5FLFA 3PZEA 4MQ2A 3GEQA 3QX4A 4FT5A 3FBVA 5AV0A 4FV8A 1MRVA 1OGUA 5CU4A 1IRKA 2CMWA 4GYIA 3A60A 5T6KA 1ZZLA 3BU6A 3QX2A 4U0IA 4JLCA 4O6EA 4AA0A 2NPQA 2Z8CA 3L9MA 4XLVA 3ZMMA 2OK1A 5HLWA 4MXCA 4F6WA 2YIYA 3C1XA 3MIAA 5C27A 3PYYA 1Q24A 3L9LA 1GJOA 3EZRA 3DTWA 3P23A 4IANA 4N57A 5L2WA 2QR8A 4FEWA 5FD2A 3WZKA 4F7SA 4C38A 1XJDA 4C61A 4FKSA 3SW7A 4C59A 2WMRA 3HDMA 2WEIA 3DOGA 3FPMA 3G6HA 4NKAA 4BGGA 2PVRA 4F63A 5IU2A 3E64A 4NJ3A 3C5IA 4DEEA 1G3NA 3L8SA 1PHKA 2HY81 4EH9A 3AD5A 4M68A 4DN5A 5IH5A 4QMZA 2BIKB 1FGKA 1Q61A 2PZPA 1ZY4A 3KCKA 3OWJA 4GG5A 4R1VA 5AMNA 5HG8A 4D0WA 3EH9A 3D0EA 4YP8A 4DH1A 4FSZA 2J5EA 5HTCA 3D7ZA 4IZAA 3HGKA 3RAHA 4F7JA 1RQQA 2YISA 4EEVA 4IXPA 3C5UA 3UDBA 4RFZA 4ZY5A 1CMKE 3H9RA 5EW8A 4UX9A 3C4ZA 1PMVA 2R3GA 2VTJA 4GEOA 4M66A 4BYIA 4FZDB 4I41A 4MBLA 5K3YA 4F1OA 3KK8A 3NCZA 4OTPA 2R3LA 1J7LA 2GSFA 2OF2A 2VX0A 4AA5A 4ASZA 5GZAA 4BFMA 4EBVA 5L2QA 3KMUA 3MVLA 1MRYA 3ORLA 3LCSA 4F64A 2R2PA 4DT8A 4GW8A 2ZV9A 1ZYSA 4O6LA 3QD4A 4IZYA 5H8BA 3UYTA 2V5QA 3W18A 5CEMA 3UJGA 2DQ7X 3V5QA 2FH9A 3TNQB 1P4OA 2YM5A 2RGPA 2VUWA 3GCSA 3W55A 3JY0A 3MFRA 4AGUA 2BHEA 4EOMA 4IAZA 2ITXA 2XNMA 3G9LX 3NSZA 4XOYA 3TNHA 4D9UA 2BDWA 3BHVA 3Q53A 4JL9A 4TWOA 4C4HA 2UW8A 3S95A 3SG8A 3VIDA 4C35A 1GIIA 3GU5A 3QZHA 4YR8A 4IB0A 1OITA 5ICPA 1VJYA 3V8WA 4O0TA 1UVRA 4JAJA 3PRIA 3TM0A 4PP9A 4X3JA 5DPVA 3H9OA 3PXKA 3A7FA 3VW8A 1ZWSA 3IW8A 2IZSA 3Q9WA 4FZFB 3QWJA 3ORKA 3EQDA 4JX3A 1OUYA 2BRHA 4K2RA 3I81A 4EC9A 2YDKA 4OAVB 3BI6A 2Z7RA 3WBLA 1UNLA 2BPMA 3NW6A 3R22A 4QYEA 5I0BA 5EFQA 3COMA 3ZUTA 4E93A 4MX9A 4R7BA 3MH1A 3V51A 1XBCA 5HX8A 2GNIA 3ZO3A 1PY5A 4YLLA 4LOPA 4U42A 1YWVA 5J5TA 1WBSA 5M44A 4WNOA 5HCYA 4RZWA 3W2CA 3ORXA 5CAOA 3LIJA 5E8TA 1YXUA 4EK3A 4O7TA 2AC5A 3DU8A 4GJ2A 4XP2A 1K2PA 3PVGA 4O91A 3RHKA 4UN0C 4FGBA 4BTKA 4C4FA 3L9PA 5TOZA 4BCIA 4XCUA 1O6KA 4AAAA 5CTPA 3P86A 4UY9A 2XZSA 4FF8A 3RAIA 4FSRA 3IW5A 2ZV7A 4ZSEA 4AGWA 5AP2A 4DEAA 2GHMA 4AACA 3E8EA 4B4LA 4ANMA 2O63A 1PXJA 3D15A 1CTPE 1M17A 1OKWA 2JD5A 5DR2A 3QHWA 1XWSA 2OSCA 3CIKA 3EQHA 2QOBA 1Y6BA 3O50A 4B8LA 3TDWA 2WXVA 4BF2A 5DR9A 2HW7A 1JSVA 3A7GA 3C13A 4L42A 3TV7A 2OIDA 3H0ZA 4YU2A 5A4QA 3G90X 4J97A 4KBAA 4U45A 4BCHA 2OZOA 2CCHA 3LCKA 4WT6A 2B9FA 3EHAA 4B0GA 2XKDA 4IX6A 1UKIA 3IOPA 4DEIA 4YTCA 3W33A 3LXPA 5F9EA 3U6HA 4WA9A 5AWMA 5BVDA 3TV6A 4FOCA 4CG8A 4GU9A 4RG0A 4BDJA 5CS6A 2JDSA 3WZUA 4DITA 2UVZA 1GIJA 1P5EA 2IWIA 2QOKA 3R2BA 5HE3A 2WHBA 3IDPA 3T9TA 3QAME 5CZIA 1IAJA 2UZWE 1NA7A 1OIRA 1WCCA 4CTCA 5BMSA 5AX9A 3CQUA 4KRCA 4OTWA 2XMYA 3QQGA 4RVTA 4BCOA 3G15A 3PUPA 4QMOA 5C8NA 3TTIA 4CV8A 2WMUA 4USEA 5HNGA 4LL5A 5CXHA 4F6UA 5IDNA 4FSTA 3DBQA 4L9IA 4GFOA 3KRWA 1KE6A 4X2JA 4N70A 4YZ9A 3LCDA 3QGWA 2EUFB 3VS4A 4CYIA 3KXHA 5C1QB 5HX6A 2HOGA 1OPLA 3SVVA 2CNQA 4CRLA 5KZIA 4KB8A 1SNXA 2J0IA 3QRUA 5HBEA 5HCXA 3LXKA 5LCJA 4I6HA 5LMKA 4DE4A 1ZAOA 3R9HA 4BBEA 4CZYB 3E5AA 3MGYA 5BYZA 3QQHA 4GL9A 1SYKA 4L45A 3S2PA 4YJQA 3ZS5A 5LVNA 1L8TA 4EC8A 4R7IA 1JLUE 3ET7A 5FUTA 3BEAA 4TW9A 3MH3A 4L3LA 3QA8A 4LRMA 2HY0A 3TKHA 4FKQA 1DI9A 2P33A 3AD4A 2OI4X 4RX7A 3T3UA 4NTTA 3UVQA 3WE4A 5CLPA 3NUAA 3GQIA 3DFAA 3QKMA 4FVPA 4I6QA 4FV0A 5AA8A 1R0PA 4W4YA 3EMGA 5EYMA 1ZY5A 3B8QA 5J9LA 4GIIA 3F2RA 1TKIA 4V01A 2UZNA 5DH3A 5IQGA 4BL1A 5AJQA 5HBHA 3GBZA 3D2KA 5CU3A 3RK9A 4S2ZA 2W17A 4QTEA 2J6MA 2X7GA 3QQKA 3LMHA 1FVTA 3DK6A 4CQGA 2JIVA 4QMVA 1Z5MA 3HV3A 2PVYA 1UWHA 2VNYA 2WTKC 3FZRA 3PP1A 3R1NA 4FKUA 4FG8A 2OZAB 4L67A 4O0UA 4OLIA 4GYGA 2X9EA 4O22A 1OPJA 3FV8A 5EKOA 2J4ZA 3ETAA 3QTUA 5HHWA 5F4NA 4ZJJA 4Z7HA 4CSVA 1NT2A 2QO2A 3V01A 3LFEA 2W5BA 5HIBA 5K0KA 5I5ZA 3L1SA 2C5OA 3IG7A 3ORMA 5E1SA 3N4UA 5HTBA 3Q2JA 3JXWA 4JVGA 2XK6A 2YIWA 3DBFA 3QCQA 3TN8A 5KCVA 2OH4A 3IPHA 3OT8A 4XLIA 3VF9A 3VULA 3IECA 1F3MC 3PXYA 4BI0A 3GFWA 4LMUA 4O2PA 2PVFA 3FZOA 2OJJA 1H01A 2XUUA 4G6LA 3PPJA 4ZXTA 1ZARA 3A61A 4MCVA 5FXRA 1YHSA 3UP7A 3QLFA 1U46A 3TACA 4YTHA 5AUUA 2V62A 4KKEA 3WI6A 2UZUE 4W9XA 4AX8A 2W06A 3FLWA 4JDHA 3BHTA 4CRSA 1Q5KA 2WQNA 5LARA 5AR4A 5LMBA 1H25A 2ZDTA 2G2IA 4OTRA 4RIYA 4CZTA 3NUUA 3NUYA 3PPKA 5DGZA 5E92A 4AS0A 4EJNA 3R0TA 4LL0A 4QTDA 2X8DA 5E8UA 4Y95A 4OAUC 3K2LA 4WG5A 3VHKA 2YA9A 1YI4A 3CE3A 1OZ1A 3CPCA 4WUAA 5CVGA 5FXQA 5AIKA 2WMAA 2C6MA 2JDVA 4NH1A 4YNOA 3TNPC 3UQCA 2XEYA 1V1KA 4EI4A 3C9WA 3FKLA 4EOLA 1KV2A 4IIRA 3EN6A 4GT5A 3QTZA 2H6DA 5EM8A 3DK3A 4K11A 4QP1A 5I3RA 4KBKA 5LVLA 5DWRA 5TF9A 3NVMB 3FMNA 3MI9A 2CKEA 4CMOA 2JBPA 3BLQA 4A9YA 2BAKA 3CTJA 4FKGA 5L6OA 4QP2A 4RIYB 3T3VA 3MY5A 3ZO2A 3QTIA 5EQEA 4XG3A 4S30A 4XH6A 3ZFYA 3G0EA 4O7VA 5KMJA 4ZSJA 1JKSA 2QOHA 5AP0A 2RSVA 4BDHA 3VBWA 5A14A 4B6LA 5J9YA 4LM5A 4AUAA 4KSPA 4TY1A 1ERKA 4BKYA 2XYUA 1YRPA 5EDQA 5FTGA 1R3CA 2XNOA 4AZFA 5IMXA 2ZM1A 4L3JA 4YTIA 4E6QA 5M07A 2RFEA 4DBNA 3NWWA 1R78A 3KFAA 3QTRA 2X4ZA 4WG3A 2WMBA 4IJPA 4IM0A 4YPDA 3TTJA 5M09A 4KKGA 3UC4A 5IA5A 2WTCA 4GCJA 4LOQA 4WRGA 5AUWA 2RKUA 3ZDIA 3OBGA 4MXYA 5CSVA 4BBMA 4M12A 5ACBC 5A9UA 5LMKC 2YHVA 4ZY6A 3V3VA 3VWAA 3QCYA 3LFSA 2YZLA 5C4LA 3FMMA 2W5HA 4IQ6A 4KIOA 5E7RA 4TKSA 5HD4A 4QMPA 3UO6A 4G9RA 4MVFA 4TWCA 4LFIA 2JKOA 3DXPA 4QNYA 4I0TA 3QQFA 1PJKA 1UU8A 3BHHA 4HVGA 1DAYA 1MP8A 1G8AA 4OTIA 3I60A 3VUMA 3EQFA 3N51A 5B2KA 4AQCA 2AC3A 4QYHA 4QTCA 5HIDA 4XRJA 1HOWA 4ALVA 2JITA 2SRCA 3R71A 1Z9XA 2GS6A 3P78A 4FC0A 1YHVA 4JNWA 4JBOA 4NW6A 5JQ5A 1LPUA 3PSDA 4HGTA 2IG7A 2PE0A 5AUZA 4F08A 1Q99A 1LR4A 4EHVA 4CG9A 5D7VA 3RKBA 3Q32A 4FODA 4E4XA 3Q96A 1NVSA 3DS6A 3LMGA 4FG7A 5E8ZA 3Q4UA 5LVPA 4DFZE 4OT6A 4ACMA 1KSWA 2W4OA 3MTLA 1STCE 1APME 1IR3A 2NRYA 1URCA 3FZTA 1YDTE 3OY1A 3VS1A 4QQJA 4FSMA 4ZOGA 4D9TA 3EQBA 2R0UA 1YXTA 5JEBA 3NUXA 4OW8A 5ANDA 1OIUA 4QRCA 5CVFA 3QTSA 4LRKA 3R8VA 4BYJA 4D2WA 4XP0A 3MFUA 4ASDA 2YAAA 3Q5IA 3U6IA 3DNEA 3Q9XA 5FQDC 5BVKA 4NM7A 3UNJA 3MBLA 3T8OA 5B2LA 4IAYA 2VV9A 3OHTA 2GU8A 5HO6A 1NVQA 4C2VA 4EOKA 1B38A 4YLKA 4FIJA 4KABA 3WE8A 1CKPA 3TXOA 3ZC5A 3TV4A 4DH8A 5JKGA 2UZVA 4R5SA 4UMRA 3CJGA 3PWYA 3RALA 3LLAA 2XIZA 3OC1A 4EOIA 4EK4A 3FLYA 2GTMA 4QPSA 2JKQA 5BX0A 3M1SA 1FINA 1WVWA 1A9UA 2F57A 3ZU7A 2BTSA 3O8PA 4C3RA 4ASEA 4MTAA 3MH0A 3TKIA 2GQSA 2CNVA 3A8XA 2IO6A 5HU3A 5JFSA 3Q5ZA 2YIQA 3F3UA 3UNZA 4O0VA 2LGCA 3PXRA 3V5LA 5D7AA 5ETCA 2VTPA 3AC3A 3KGAA 3G2FA 4O0YA 5EYCA 4U81A 1YXXA 2QU5A 3CCNA 3II5A 2WIHA 4QYYA 4A4LA 4I22A 5I9YA 4FA2A 2QI8A 5E8WA 4KINA 3U87A 3GU8A 2YITA 2QKWB 1V0PA 2EWAA 4O7RA 4RA4A 1FBNA 4BDCA 4LGGA 3RPYA 4MWIA 3ZRMA 2PY3A 2CCIA 4I5MA 5IUHA 3QGYA 2QLUA 3PJ8A 3KC3A 3FUPA 3LFFA 5JZJA 2QOFA 2PMLX 4L68A 1DM2A 3E93A 4AW0A 5J7HA 4DEHA 2HZ4A 3Q2MA 1JBPE 1XKKA 1ZLTA 3QALE 1OPKA 4E5BA 4EYJA 5ETFA 5M4IA 2OF4A 1ZYDA 4QP4A 4J71A 1KOAA 1OB3A 2VTRA 4FVQA 2H9VA 4F0FA 5HD7A 3PIXA 3CSVA 4DEBA 4FSUA 4J98A 3OOMA 4L3PA 4C4IA 5L2TA 4K9YA 1T45A 3ULIA 4RMZA 4DGMA 3OBJA 4NW5A 1UU3A 4L46A 4L6QA 3R9OA 1H08A 4FTTA 4EHGA 2CN5A 3QU0A 2FUMA 4BCMA 3KF4A 4KD1A 1JVPP 3W16A 2IZTA 5DEYA 3MDYA 4BB4A 3I1AA 4NM0A 3KREA 3CD8A 3L8PA 4QMUA 4R6VA 4AWIA 4KKHA 2XRUA 4PPAA 4D5KA 5HTIA 3MN3A 3RCDA 4FV7A 4F9BA 5DFPA 4MD8E 4RJ4A 2EB3A 3PFQA 4MD9E 4PPBA 5C01A 1ZYJA 1H0WA 1SVGA 4EK6A 4S34A 1OMWA 2ETRA 3LJ2A 4W4WA 3TJCA 2WFYA 4E1ZA 3UMXA 3U6JA 3D5WA 5ANOA 4I6FA 3ZSHA 4FR4A 4G3FA 4IAIA 4BDBA 4I4EA 2XH5A 3RI1A 2BAQA 2P4IA 3AC1A 4FX3A 2GNLA 3I7BA 1XH9A 2OJIA 2F4JA 3HP5A 4MF1A 4DF3A 2CGXA 2C5NA 4C37A 5CT0A 4O7YA 2O3PA 3OWLA 3PIYA 3VQUA 2PVNA 2B54A 3E62A 3E92A 3VBTA 2ZDUA 3ZBXA 4QYGA 3RPSA 4YUQA 2X39A 4N4SA 5FTQA 4BCFA 4BTJA 5IA3A 4NIFA 4XHKB 1MUOA 5FDPA 2BRMA 4P4CA 3SQQA 2OIQA 3UE4A 1BL6A 3BCEA 4FTQA 3VHEA 4PNIA 1UA2A 5ACKA 5IG1A 5JQ8A 3UO5A 2V55A 2OXDA 2BRBA 1YDSE 1BKXA 4IE9A 3GOKA 4ALWA 2VTIA 3CXWA 3PIZA 3BLRA 5M08A 2F9GA 3R00A 3TKUA 3TL8A 2BZIB 3LM0A 2XKFA 5FP6A 3ZYAA 4ERKA 5AV4A 3D9VA 3M11A 4AZSA 4HVSA 4H3PA 4I3ZA 1J1CA 2ZAZA 2QO9A 3DA6A 4MF0A 2GCDA 3VJNA 5CSWA 4GIHA 5EDPA 1YI6A 4LG4A 3TNIA 4Q9ZA 5BUJA 2AYPA 4CKJA 5JH6A 1YQJA 4FTUA 3R04A 3REPA 3RNIA 4G3CA 2ZVAA 5TR6A 4AE6A 5J79A 4EONA 2X0GA 4C57A 1WBNA 4L44A 3P4KA 2UV2A 2P0CA 4D1ZA 3OROA 3FXWA 4F7LA 4NFMA 3FAAA 5DVRA 5A6OA 3B2TA 3P7AA 4J1RA 4RX9A 3W2SA 5CASA 4YHJA 4BDIA 2Y9QA 4FV9A 1BMKA 2ERKA 4AT5A 3ZHPC 2WMSA 4FIIA 1UNGA 2ETMA 2J7TA 2QKRA 3UOLA 3M42A 5EYKA 2W5AA 3MFSA 4ZLYA 2UZDA 5IA1A 4QP3A 2QOCA 3GCUA 4LI5A 2F7XE 3NCGA 3OCBA 3BYMA 4ZZNA 5IQIA 4C34A 5EG3A 3QTQA 4FG9A 3ALNA 2R3KA 2XNNA 4LGHA 4M7IA 3QUDA 4X2NA 5JGBA 4U5JA 3ZRKA 5E4HA 3FSFA 3PJCA 4YJPA 3ORZA 2X9FA 5LMAA 4K1BA 4C02A 4TT7A 2UUEA 5J9ZA 2OLCA 5CAVA 4FGRA 2Y0AA 3FQEA 3D94A 5GIOE 5CENA 1GZOA 3OZ6A 5JFXA 3FZSA 3N4VA 3EN5A 5BVFA 4WG4A 3KQ7A 3PJ1A 5EK7A 5K0XA 5G1XA 3TZ7A 2YWVA 4PPCA 4R5YA 4IHPA 4QQTA 4FNXA 4AA4A 3LOKA 1JPAA 3TZ9A 3FY0A 4LRJA 5T68A 3ANRA 2UZTA 3IW6A 2WMWA 3LXLA 3ORIA 4NM3A 3BLHA 4A9SA 3ID6C 4V0GA 4JJRA 5BUIA 4CGAA 2E9NA 4DA5A 4EHZA 2PMOX 3GUBA 4J96A 2GPHA 4ITHA 4U41A 3PXQA 4RC4A 3CGFA 4AP7A 5HE2A 5FTOA 4BWXA 1LEWA 3O17A 3R8MA 4BWKA 3LJ1A 3QUEA 4HW7A 1UV5A 3LHJA 4E20A 3VC4A 1TQIA 4YGAA 3I6WA 5DE2A 2XJ2A 3ZEPA 4YC8A 3Q4CA 3E88A 2YFXA 1DAWA 2PTKA 4IM2A 4JS8A 3FI8A 4XEYA 3ZSGA 5HBJA 5DYJA 1MRUA 4B7TA 4AW1A 4O7WA 1ZMWA 3SXFA 2FO0A 2VTLA 2Z2WA 3FZ1A 3UOJA 1LP4A 3FLSA 5EDRA 1P4FA 4V0GB 4R8QA 4YHTA 3V5WA 5LCKA 4QMYA 4G6NA 2UVXA 4CVAA 2ZM3A 3O0GA 3RK5A 4O81A 3V5JA 4IWPA 4LUEA 5FEQA 3OTVA 3WZEA 5HLPA 4CFXA 4Y46A 4DYMA 2OBJA 4PY1A 3QZGA 2JAVA 3DKCA 3NAYA 2XNPA 4YC3A 4W8EA 5KMNA 4MAOA 2WTIA 3DFCB 3CD3A 4BDAA 3RK7A 2HZNA 4JDKA 4RQVA 5A4EA 3HA8A 1IASA 4IFGA 5EYDA 5CNNA 1GZNA 3QC9A 3HLLA 3RNYA 1IEPA 2CGVA 3LE6A 1WBOA 3UZRA 4X2GA 4E4NA 2WOUA 3LFCA 3O51A 5D41A 3QHRA 4RWIA 4OTGA 3OCGA 4I4FA 2YEXA 4KIPA 4FV1A 5AAFA 3NNUA 2WGJA 3QCXA 3R83A 1OIQA 2GFCA 4NKSA 3RZBA 3CP9A 4XP3A 3ZO4A 1P14A 4EKKA 5HVKA 3ZSIA 4QT1A 5AP5A 3CEKA 2PZRA 4L53A 2WIPA 3R6XA 3UVRA 1R1WA 2QD9A 3C4XA 4L00A 2UW0A 3WZJA 4FZAB 3RP9A 1ZYLA 1W0XC 3CKXA 3UG2A 1DS5A 3GXLA 4G5PA 3HV7A 5TKDA 3W2OA 4CT2A 1Y6AA 4FBXA 1YHWA 5L8KA 2OIBA 3LM5A 2WO6A 4JRVA 2PL0A 4MBJA 5M57A 2B9JA 4ZIMA 3GVUA 5AV2A 4IX5A 4Q5HA 5GZ9A 3VS0A 2QNJA 3SXRA 5AX3A 3OEZA 4FV6A 5CEPA 4FKTA 5FM2A 3F2AA 3FEGA 3ZM9A 4M69B 1ZZ2A 4MNFA 5AAGA 5FGKA 3UPZA 1A48A 3I0QA 5FRIA 3QCSA 4OTFA 2WELA 4X0MA 1HCKA 2GMXA 5FWKK 4NTSA 3RPRA 3MESA 5J8IA 3NLBA 4QD6A 5KZ0A 1ZMUA 4HVHA 2X8IA 3GP0A 5E8SA 4UWCA 5F95A 5AP6A 2G1TA 2VTSA 2ZMDA 2C6EA 4M3QA 4QQCA 4R3RA 1M7NA 1PXLA 5BUEA 2ITWA 1OI9A 3MVMA 5AR5A 2BZHB 4X6RA 4CLIA 3PPZA 2G2FA 3FHIA 4UMTA 4YPSA 3LFAA 2XKEA 5IA0A 5CQWA 4IWOA 2OU7A 3C4WA 3Q6UA 4B8MA 2FVDA 3F61A 3U51A 4IAKA 5A54A 2JFLA 2OJ9A 4TNBA 3EWHA 3AT2A 3ZUVA 1M52A 5CU6A 3OEFX 4F9CA 4DINA 4RVMA 5FBOA 4BCPA 4TYIA 5CI6A 4JI9A 3PP0A 4MWHA 2CN8A 3DKFA 4H36A 1Q97A 4CMUA 2WMXA 2WQOA 5LOHA 2XNBA 3BYSA 4ZTLA 3MV5A 2Q0NA 4ID7A 4MQ1A 5DA3A 1G8SA 4EL9A 2C30A 4AOJA 2E2BA 5IQBA 1O6LA 2CGWA 1QPDA 2BFXA 2X4FA 3MA3A 1OL1A 2BKZA 1FQ1B 4FTJA 4MNEA 3R7GA 4XBRA 3IGOA 5I9VA 1CKJA 2GHLA 4BGQA 4CFVA 5A6NA 4BC6A 3PA4A 3Q4ZA 3FI3A 5CAUA 3Q52A 4IAFA 4BY9E 4FT7A 2AUHA 1FVVA 3EFKA 3DBCA 2A27A 3B8RA 4G17A 3QZIA 3TUDA 2PULA 3HRBA 4G1WA 4TRLA 4GK4A 3ZEWA 4GUEA 5EKNA 4A4XA 3UIBA 2YABA 5C9CA 4USDA 3L8VA 2XIXA 3BYUA 3HVCA 5IF1A 2R3PA 2ZJWA 1BX6A 3A7IA 3CY3A 4AZEA 4BICA 4ZLZA 2R4BA 3EIDA 3P7BA 4RSSA 4FKOA 5DEWA 4HZSA 5ANIA 4CNHA 5ANKA 3F7ZA 1OL2A 3KRRA 3MWUA 3NPCA 4X2KA 3HDNA 3KEXA 3OXIA 4IVDA 3IS5A 3QFVA 3QD3A 1V0OA 3K5UA 3KMWA 4JRNA 4MNEB 4YJNA 2IN6A 4O1OA 4EZ7A 2XM8A 5FDXA 3WZDA 5CAQA 3KVWA 3GT8A 4DTBA 3NVKI 2QQ7A 2C5YA 3QA0A 5E9EA 1PYEA 5IQAA 4Q9SA 4GV1A 3F3WA 4BI1A 3OCSA 5F1ZA 4KIKA 3FMKA 2EXMA 3E8CA 4XOZA 5BYYA 3QQUA 4FEQA 5AR2A 4HGLA 3NYVA 4MXOA 5DT0A 2WKMA 3EB0A 4I0SA 4RX5A 2PK9A 3W2QA 3V8SA 4PNKA 4MK0A 3PLSA 5EOBA 4CT1A 2CGUA 3JYAA 4IFCA 3R7EA 1I09A 3ZC6A 4AE9A 4BN1A 2IPXA 2NO3A 5EOLA 4IVAA 2RFNA 3DLZA 1SNUA 1U5QA 3FZPA 4TL0A 4MYGA 4P2KA 5CNOA 5D10A 3KA0A 2FYSA 3ALOA 4FSNA 4FTIA 3VJOA 5HO8A 2C6KA 3ODZX 5EQYA 1SVEA 4FYNA 4N6YA 4XX9A 4YBJA 3SG9A 1Q3WA 3VRZA 5CI7A 4YJOA 4KIKB 3MH2A 3Q6WA 4Y5HA 2OZAA 4ZS0A 5GZ8A 5KMMA 1O6YA 4CFWA 4UMPA 3QUPA 5L6WL 4GT4A 3W2RA 3MPMA 4IWDA 3ZTXA 5DBXA 2X7OA 2ZYBA 4QYFA 3OW4A 2BMCA 4YLJA 5AP7A 4DAWA 1KWPA 2VO6A 2X2LA 4UYNA 3DTCA 1MQ4A 4MXXA 3ZUUA 2QU6A 4L8MA 3E87A 5CANA 1WVXA 2PPQA 2E9VA 2I0HA 5DHJA 4XNEA 4EH6A 2VU3A 3R8UA 4F1MA 3ZH8A 2Z7QA 1WVYA 2IJMA 3VUTA 4ZMEA 4FSQA 5L6PA 4J8MA 4O83A 1FMKA 1GNGA 4DEDA 4BIBA 4ACHA 3UQFA 3I5ZA 2A19B 4X3FB 1PKDA 3HX4A 4DFBA 2IVVA 2C5XA 3C51A 5L8JA 5CU0A 5K4JA 4HPUE 4YZBA 2IW8A 4U43A 3RAKA 4DH3A 4U79A 4HPTE 4EH3A 3COIA 4A9RA 4CEGA 2WOTA 2YWPA 4EZ3A 3PY3A 3OXTA 4TYGA 3QF9A 5FP5A 4CQEA 2YN8A 3UTOA 4ZP5A 3QZFA 4IDVA 3PJ3A 2J9MA 4BCQA 3A7HA 4XBUA 2ITNA 5ANJA 4BWPA 3TCPA 2CKQA 4BDKA 5J5SA 3DAEA 3F3ZA 5EHYA 4RLLA 2V22A 3DZOA 4HGSA 1J7IA 3CR0A 3CS9A 4MXAA 5JGDA 3CTHA 3Q3BA 4M67A 3OW3A 4WRSA 4D4RA 5H9BA 4JDIA 3W8QA 4YJVA 2C5VA 4S32A 1H8FA 5AM6A 3W8LA 4YTFA 2UW4A 1PRYA 2DWBA 2VWWA 3GC0A 1OL7A 3POZA 5HGIA 5GJGA 2C69A 2YDIA 4HGEA 3DJ7A 4TNDA 4CKRA 4EORA 3IW4A 4I23A 1PMNA 1LEZA 3LMIA 3C50A 2H96A 3SA0A 1Q4LA 3RINA 2VTQA 2P2HA 4AGCA 3HMOA 4EOJA 4R1YA 3HZTA 1JOWB 3DY7A 4F4PA 3BU3A 3Q9ZA 1WZYA 3RMFA 2Z7SA 4FL2A 3QYZA 1CSNA 2YM4A 4YJRA 5HLNA 1XO2B 3FMDA 3GENA 3FLZA 4FEUA 3SRVB 1WBWA 5IMEA 5JZNA 5DT4A 3AC8A 3MS9A 4BDGA 3C4FA 3UIUA 3D5UA 4RFYA 1Y8YA 5KHWA 5IQHA 2VAGA 2X6EA 1F5QA 1U54B 3FMJA 5A4CA 3UQGA 1KV1A 4O86A 5B2MA 3MVHA 5B0XA 5IQEA 1XBBA 2YCQA 1P2AA 1H4LA 4A7CA 4FTRA 3DKOA 3MY1A 3OS3A 4EHEA 1VR2A 4QP8A 2BCJA 2UW5A 3UNKA 3FXXA 2G9XA 2PUUA 4OTDA 4ZTHA 1YWNA 2C3IB 4GG7A 4DH5A 2DUVA 3FPQA 4WNMA 1CKIA 5JRQA 3E3BX 4ZZMA 4XV9A 1H26A 4U6RA 2OXYA 3QYWA 2JC6A 3OTUA 2VN9A 5CF6A 3A8WA 1YDRE 1IA9A 1IA8A 4ITIA 4U7ZA 2JIUA 2QHMA 4QPAA 2JAMA 1WAKA 2PHKA 3E3PA 3NIZA 4U97A 3I5NA 4RIXA 4XV3A 1YOJA 5JRSA 3BEGA 1Q41A 3FSKA 2PVMA 4ZZOA 4UMUA 5J7BA 2BTRA 3IO7A 3U4UA 3GU7A 4C33A 1SVHA 3I79A 3QLGA 4NEUA 4UWBA 5DN3A 1Q8TA 1ND4A 4PL5A 4H3BA 4M8TA 5HI2A 5I9ZA 4XRLA 3RM6A 5KHXA 5HOAA 3VF8A 4ORKA 4IEBA 2OJFE 5H3QA 3SV0A 2W1ZA 1XBAA 1NW1A 4XG2A 4FV4A 3BBWA 4IX3A 3H3CA 4E6CA 3BU5A 4M97A 3AC5A 2QC6A 1PXNA 4U40A 5DMZA 3RWQA 4ANOA 5CF5A 1XR1A 3HP2A 3NYNA 4JBPA 3LQ8A 4I5CA 4RIXB 4IJ9A 4EOQA 3B2WA 4C62A 2VGOA 1QPJA 5HQ0A 3R1YA 2XA4A 4I5HA 2YM7A 3UMWA 4BI2A 2C6DA 2WQBA 4B99A 3IOKA 4DTAA 4GT3A 4UEUA 4O84A 3VBYA 3MIYA 1OL5A 3NIEA 3BWJA 3SD0A 3PVWA 4JG7A 4AU8A 4ZSAA 4O7SA 2OGVA 4RC2A 4FT9A 4IBMA 4LGDA 4PDOA 2X2KA 3RTPA 5CF8A 3SHEA 1MQBA 5K5NA 2IW6A 2ZOQA 2EXEA 4FSWA 2VWBA 2JKMA 4D2SA 1ZOGA 1GOLA 3ZLXA 2PWLA 2QOLA 2WMVA 4FT0A 3LJ0A 3HV6A 2Y6OA 4HNFA 2R0IA 3SW4A 4BCGA 3EOCA 3NW7A 4K33A 2PVHA 4U8ZA 5C4KA 1BYGA 3P7CA 2HK5A 3KXMA 5AUTA 2C1AA 3HV5A 4C3PA 1YKRA 2NP8A 3FYJX 5C03A 4FL3A 1REJA 3MW1A 4ASXA 1AD5A 4LV8A 5CX9A 1FOTA 1H27A 4HYIA 4RJ6A 4AZVA 1ATPE 4DCEA 4DFLA 3NDMA 5FEEA 3FKNA 4DFXE 2BKKA 4II5A 2VTAA 1PXIA 2BDFA 2GHGA 2ITOA 3DQWA 2B7AA 4NUSA 5DR6A 2GNHA 4I94A 3H4JA 1J91A 4PDSA 5LQFA 3JUHA 1UKHA 2R3OA 2WNTA 3HAVA 1OECA 4J95A 1H1RA 4U3YA 5BVWA 4A9TA 5DI1A 3FXZA 4AZWA 2F49A 5C26A 2WD1A 2PMNX 5E8YA 3OOGA 4XV1A 3FKOA 4CKIA 4XG7A 2W0JA 3FDNA 4YO4A 2O8YA 4FV3A 4CFMA 5F94A 2HENA 3EQIA 3R9DA 2NNWB 2IVSA 2WTVA 3PDTA 4IX4A 2LAVA 2X7FA 3PXFA 4ZTNA 1BL7A 4X2FA 2XKCA 3WF7A 3JY9A 4AG8A 2W05A 4IVBA 2HELA 4IW0A 1JQHA 1YOLA 3BPRA 4O96A 4TYHB 4AXAA 3H0YA 3CQEA 4IC7A 5BQ0A 4QP9A 5CEKA 4FTMA 3PRFA 3COHA 3MPTA 3QRJA 1SMHA 3S1HA 2Z60A 2VWYA 3KXXA 3LFNA 4E8AA 2IZRA 2YIRA 2XJ0A 3UO4A 2P3GX 4RJ8A 2CLXA 3R1QA 3BGPA 4EQMA 3JVSA 5HZNA 4Z3VA 5G6VA 4F7NA 4O82A 1PMEA 3ZO1A 1L3RE 1ZMVA 2QVSE 4TPTA 4QMWA 5EI6A 2VNWA 1PKGA 4P90A 1F0QA 4O1PA 4WOVA 4DGNA 1RJBA 3MPAA 4CCBA 3CKWA 2PYWA 1H0VA 3EFJA 2WQMA 2XIYA 5IEVA 1NY3A 3ROYA 4YZNA 4D2TA 2GNFA 4FIHA 3KXGA 4HOKA 5KKRB 4OBPA 2I0VA 3D5XA 4U44A 4EUUA 3G51A 2R9SA 2XNGA 1M2QA 3WF5A 4TWNA 5IH6A 2Q83A 3QXPA 3BHYA 3KN5A 4IVCA 4ZTRA 5IZFA 2ACXA 4TTHB 4W4XA 4JXFA 3ORNA 3FHRA 2UZLA 4UYAA 4WNPA 4FTKA 5HORA 3FQSA 2G2HA 4H3QA 4IH8A 1ZRZA 2J90A 2YLEA 4MXZA 2CSNA 3O8UA 2B4SB 3ZXTA 3MJ2A 1WFCA 3JR1A 4A9UA 4QNAA 1BI8A 2QURA 1M2RA 3NUSA 3OT3A 3THBA 4E73A 2YCFA 5I4NA 1R0EA 4ANNA 3DK7A 4JBQA 5HESA 2B9HA 3RAWA 2ONLA 3VS2A 1V0BA 4CXAA 4ZMFA 4FK3A 1YXSA 2OICA 4R3CA 2OKRA 5DG5A 5I9WA 5AUVA 4G31A 3E63A 4NWMA 2IW9A 2R5TA 4Y73A 4F70A 1J7UA 3V5PA 1W8CA 3MB7A 4FKPA 2ETKA 4KA3A 2F2UA 2UVYA 1OUKA 2XF0A 3NNXA 4M15A 4S33A 4YJTA 4HCUA 4YSMA 4CLJA 4CFFA 2XB7A 1NVRA 4UZHA 2OXXA 2ZV8A 3OP5A 2B53A 3ROCA 2C68A 4PMMA 4PP7A 2YJSA 3N9XA 3VVHA 3D7TA 1TQMA 2W1GA 4ITJA 4TN6A 5CXZA 4OT5A 1IAHA 4JBVA 4IZ5A 3UGCA 5CEQA 2WMQA 4M13A 3QQJA 4C4GA 1Y91A 2BIYA 5E91A 3VUIA 3WF6A 2PZYA 4DCAA 3ACJA 3NUNA 3OMVA 4FVRA 4LV5A 3DJ6A 4J99A 2C0IA 2F2CB 2YJRA 4D5HA 2B1PA 3PVUA 4WSYA 5GJDA 5CWZA 3G0FA 5JFWA 4NL0A 4C3FA 3R8LA 4OBOA 3NYXA 4NYEA 2XVDA 4FICA 1B39A 2X6DA 3EQCA 3UBDA 1X8BA 3UC3A 1E1VA 4OTHA 2J0LA 5ITAA 4AFEA 3W32A 3D7TB 1GIHA 4ZJIA 5M56A 5BYLA 3IQ7A 3RCJA 3QL8A 3P9JA 5HG5A 3H9FA 3WIGA 4DC2A 1KUTA 3ZFXA 4XV2A 3LXNA 3SX9A 2GQGA 4L43A 3KCFA 2HZ0A 4PMTA 3TT0A 3ZLYA 1H1PA 2W4JA 2YM8A 3V6RA 3BKBA 3ZRLA 3EKKA 2W99B 4JOAA 3QXOA 5LWMA 3NEWA 2HYYA 4FKVA 1OKVA 3ITZA 2ZB1A 4WUNA 3F88A 5GJFA 3L9NA 5JMSA 3AXWA 4KUJA 4F9WA 3NNWA 4GSBA 5AP1A 4IB3A 4FKJA 2UW3A 3TEIA 3IDCA 3EZVA 4U3ZA 4KBCA 5HO7A 3GCQA 2HWOA 4C36A 2PZ5A 4DFYA 3EN7A 2VRXA 3GQLA 4O0WA 1U59A 3V6SA 3UOKA 1H1SA 4PDPA 4XG8A 4I1ZA 3QD0A 3P08A 5K9IA 5KKRC 4XS2A 3VS5A 2Y4PA 3F5PA 4PMSA 3DGKA 3LQ5A 4WBBB 4JR3A 1U4DA 2B0QA 3NMUF 5LJJA 5CYIA 4BHZA 5H2UA 1NXKA 5JGAA 4Q2AA 4E4MA 1M2PA 5EH0A 2JDTA 4H58A 4B9DA 4EQCA 1GZKA 4LYNA 4Y72A 5L8LA 4G5JA 3NZ0A 5AR3A 1PXOA 2PVJA 4W9WA 4ZTQA 4RJ7A 4RVLA 5FG8A 2VO3A 1ZOHA 2PE2A 2XK4A 3C4EA 4L52A 2ZV2A 4EH2A 3R30A 1CDKA 5IEYA 2P2IA 5HG9A 4BCNA 5M4UA 4PWNA 3UIMA 4C7TA 4PMPA 3MJ1A 1Y57A 4BGHA 3DNDA 5AV1A 4FNYA 4GMYA 5EI2A 5IQDA 3HRCA 2X1NA 1FGIA 1RE8A 5BPYA 5DOSA 2PUPA 3DBDA 4FTNA 4C0TA 5E90A 5TT7A 3R7VA 3WYXA 4GRBA 4GKIA 2XYNA 4P5ZA 3R01A 2BRGA 5CEIA 2ITZA 5BMMA 3RPVA 3O23A 4F99A 2CKPA 4R78A 2YM6A 4DFUA 3DV3A 2VTMA 3GGFA 4K8AA 3S3IA 3F7WA 1XH8A 4RWJA 4YJSA 3VS7A 1LUFA 4FKIA 1TVOA 4U9AA 2BVAA 4A06A 3DDQA 3PG3A 5BVOA 2PUNA 4GKHA 3P79A 1PF8A 4FTLA 5KMLA 2H8HA 4BCJA 4XYFA 5IUGA 4FUYA 3L8XA 3SAYA 3HUCA 4H1JA 2RF9A 2B55A 2ONLC 5BVNA 4WO5A 3EN4A 2A2AA 3DDPA 2Z02A 2IVTA 5EHOA 4AF3A 1W7HA 3VBQA 1Z57A 4Y8DA 3AQVA 1XH4A 2C6TA 3BRBA 4OBQA 3KN6A 2I7QA 3PSCA 2C3KA 3R1SA 5GHVA 3LFDA 3MSSA 2W7XA 3HV4A 3M2WA 4CFUA 3I0OA 4M69A 4ZS4A 4APCA 1H1WA 2VGPA 4ZSLA 3FLQA 3PA3A 2WTWA 3FJQE 4FKRA 5ANEA 4USFA 5H8GA 3TUCA 4HJOA 3BYOA 3CTQA 3SXSA 2CDZA 3DAKA 4EOOA 4YURA 3QWKA 4EQUA 5AEPA 3RWPA 4GJ3A 3FMLA 4KWPA 4AGDA 4X6QC 3ZLSA 3UPXA 3DPKA 2BUJA 4F1TA 1AGWA 5E8XA 3UOHA 3HKOA 2W9ZB 4A4OA 5AADA 3S0OA 5BVEA 3C0IA 3JVRA 4EWQA 3AT3A 3I6UA 3R7IA 5B7VA 5AM7A 4IC8A 4BR3A 2BDJA 3A7JA 5KNJA 3UZPA 2FSTX 4YJUA 4QP7A 3VBVA 3PTGA 4FNWA 2VO0A 4JR7A 3EL8A 4DLJA 4MBIA 4D4VA 4C2WA 5A4LA 5HEZA 4PL3A 2QOOA 2CPKE 2B52A 3U9CA 3GC9A 4KNBA 4N6ZA 3GC7A 3WF8A 4BIEA 4DBXA 1J3HA 3F3TA 4RIOA 3OWPA
chains in the Genus database with same CATH superfamily
2JGZA 3D14A 1KE5A 4R7HA 2PE1A 4FNZA 1E1XA 3JPVA 3PE1A 2J5FA 3ZOSA 5HIEA 3QQLA 4AT4A 1TQPA 3WIKA 4L7FA 3F5UA 3K54A 3PJ2A 4J53A 3PG1A 4NK9A 4ENYA 2O2UA 4BVUA 4BBFA 5GIPE 1M14A 2XK9A 3F66A 5GNKA 2XNEA 3HUBA 1VYWA 4UV0A 3EYGA 3K3JA 1JSTA 2A1AB 2B9IA 4QO9A 4RRVA 3FWQA 3UYSA 4H05A 2GDOA 1Q3DA 2XIRA 3MVJA 4O2ZA 4EH4A 1JKLA 4CZUA 2VTHA 2QR7A 4RFMA 5CEOA 3BIZA 4G3EA 2JDOA 2XP2A 2UW6A 3PA5A 2VX1A 3MYGA 4O4FA 2X8EA 5J95A 2VWZA 4R77A 3F3VA 3Q60A 3BHUA 3ZZEA 3D83A 4DT9A 3F5GA 3HMPA 5CSXA 1Y8GA 4XJ0A 5M53A 1TZDA 5KMOA 3GU4A 2FSLX 4AW5A 1PMUA 3BGQA 3G33A 4RIWA 2ITQA 5DLSA 4IDTA 3U4WA 3LQ3A 4E4LA 3HMNA 4I5PA 5DIAA 2W9FB 2RFSA 4D1XA 3QKLA 3SDJA 4R3PA 2WTKB 4K77A 4W8DA 2YDJA 4QPMA 4Y5QA 4RLKA 2GTNA 2WB8A 3WF9A 2VTNA 2BILB 3ENMA 2OG8A 4O7NA 3F6XA 4JX7A 4O7ZA 3KRXA 3HRFA 2E9OA 4JQ7A 1FMOE 4MUQA 3H30A 2I40A 4TYJA 2WTDA 4Z16A 4FIEA 3V8TA 4TZRA 5CSHA 2CJMA 2E9PA 2X81A 4FV2A 4WKQA 1Q8WA 4RPVA 2OO8X 2W1FA 4CTBA 3CBLA 4RIWB 4FZ7A 1H24A 4AT3A 3F69A 3MA6A 3DQXA 2QODA 3TI1A 2QCSA 3AT4A 2UZBA 1H1QA 5IEXA 2OH0E 2ITPA 4PRJA 4BHNA 2PUIA 2XK8A 1JKTA 2W1HA 3ZXZA 1B6CB 2HXQA 5LVOA 4D28A 4DGLC 5AP3A 1KOBA 3POOA 4EUTA 1K9AA 4WD5A 2J0KA 2JLDA 3GFEA 4QP6A 3PWDA 1R39A 2WQEA 4AXEA 2EB2A 4CMTA 2UZOA 2CLQA 3KVXA 4GH2A 4RWKA 4ACCA 3IKAA 5AAEA 4XG4A 3R9RA 1PXPA 5KBRA 2XM9A 4AQKA 5KUPA 2RIOA 2YLFA 4RT7A 4UBAA 5D1JA 5DT3A 1OBDA 4WSQA 2WEVA 1OVEA 4XG9A 5E1EA 3QRKA 4YSJA 4NSTA 3NYOA 4I21A 2ZM4A 4HCVA 5IUIA 4CD0A 1GZ8A 3CY2A 3U55A 4AN3A 1Q62A 5HE0A 4ZEGA 3TDVA 2FSMX 2HAKA 4FIFA 4EBWA 3ZFMA 4EWHA 4FOBA 1W82A 4RGJA 2V7OA 3CGOA 3DB8A 4H39A 5M4FA 3D2IA 2R3FA 2J51A 2Y8OA 3VRYA 4FYOA 2ITVA 3ORTA 4X3FA 4OUCA 4KIQA 4K0YA 2C0OA 3RPOA 3HL7A 4W4VA 5D12A 2PVLA 3OD6X 3QKKA 3VO3A 1GY3A 4BIDA 4DGOA 1EH4A 4JIKA 4JT3A 3ULZA 4G3GA 4PQNA 3OG7A 2GNGA 4E6DA 1YI3A 5JT2A 3KU2A 3UP2A 4F0GA 5CVHA 4EK5A 4BTMA 3TYKA 3FE3A 1XH7A 4NT4A 4YNEA 3U9NA 4YZDA 1DI8A 1GAGA 4IZ7A 2JFMA 5FEDA 1YWRA 3R8ZA 5JSMA 5AR7A 4QTAA 4S31A 3S00A 2ERZE 3EQGA 1ZXEA 3LAUA 2XEZA 2J0MB 2HW6A 3KRLA 4RA5A 5A4TA 4ZJVA 2WPAA 3LW0A 2YAKA 1YXVA 5JN2A 3A4PA 4Y85A 4ZTSA 5AR8A 4DTKA 5EW9A 2XJ1A 3PXZA 2RG5A 4QMLA 5IKWA 3FI2A 3QD2B 4WIHA 3C0HA 4G2FA 2IZUA 4F0IA 2VX3A 2BRNA 2X0OA 4BDFA 4O7LA 1SM2A 3C7QA 1CM8A 4HCTA 5HNBA 2FB8A 5A3XA 3ZLWA 4GUBA 2V0DA 4M14A 3IONA 5IQCA 1XH6A 3E7OA 3QTXA 4PDYA 2EU9A 2PVKA 4FTAA 1KE9A 2FA2A 3TJDA 3LCOA 4E26A 1Q8ZA 1OM1A 2W1EA 2JKKA 4K18A 1H07A 1K3AA 3ATSA 2G15A 3BE2A 4NJDA 4FZ6A 4V05A 4BDDA 4FKWA 3SRVA 3UZTA 5EQPA 5AUYA 2XBAA 4G6OA 5FM3A 2G01A 4PUZA 3MB6A 1OKYA 4BDEA 3IW7A 4JG6A 3R9NA 2QOIA 5F20A 3R8PA 2H34A 4D4SA 4Z7GA 5KBQA 2QG7A 4FT3A 5KX8A 3VS6A 2BHHA 1U54A 1BLXA 4AW2A 4ZLOA 1FVRA 4FEXA 4AAYA 3V5TA 4DFNA 1VEBA 5FXSA 2J50A 4RC3A 3WOWA 4DH7A 3I4BA 2O5KA 2WTJA 3BV3A 3EL7A 3FC2A 3O7LD 1HCLA 4O38A 4DHJA 2ESMA 2R3QA 3AC2A 2C6IA 4LUDA 4CCUA 4I20A 3LFQA 5CT7A 3F2NA 3SC1A 3PE2A 2R3MA 3WYYA 3NW5A 1QCFA 2VWVA 3NNVA 5J1WA 2C3JA 3ELJA 4YZMA 3KB7A 4I24A 5IPJA 2I6LA 1KE8A 4D2RA 4HNIA 3VUHA 1W83A 4K6ZA 2XS0A 5AUXA 4PTCA 2HCKA 4GK2A 4HYSA 4QDEA 3G6GA 1WBTA 2O0UA 3DBEA 3DT1A 5EM7A 2R3IA 2V7AA 5ANGA 5HCZA 4FMQA 2ZMCA 3SOCA 4D55A 4DLIA 2QLQA 3RVGA 4IADA 2XK3A 4PV0A 5CAPA 5IQFA 4FL1A 4TWPA 3O96A 5EW3A 3BBTB 4HZRA 4OTQA 3QTWA 4X21A 4FI1A 1QL6A 4N0SA 3GU6A 3W0RA 3U8WA 4QMQA 3MTFA 4NFNA 5A46A 3EN9A 3BZ3A 4IB1A 3BGZA 1PXMA 4UALA 3OUKA 5HKMA 4JAIA 4O27B 2OJGA 4P7EA 3TZ8A 4BJJB 3BQCA 1W2CA 1W2DA 2VD5A 3KXZA 4I93A 4D2VA 1YOMA 2GFSA 2Z7LA 3BELA 4E3CA 4AOTA 5KO1A 5H8EA 2ITUA 2WMTA 2BR1A 3TUBA 5EHLA 3SKCA 4HVIA 3Q4TA 4YC6A 2VWUA 3FL5A 3AGLA 4F65A 3ODYX 2O65A 3E8NA 3P5KA 4IACA 5M55A 2A0CX 3KXNA 4RX8A 3GB2A 1BI7A 1H00A 3WARA 2REIA 5E8VA 4OGRA 5TE0A 3FI4A 3MFTA 3R28A 3V04A 4EH7A 3EQPA 4F09A 1JKKA 4YZCA 4IM3A 4QMNA 1QMZA 3QRTA 4EYMA 4AN2A 4HYUA 1ZYCA 3HECA 4CV9A 3VUDA 3SGCA 2RFDA 3EFLA 5EM6A 5LWNA 4XMOA 3E7VA 4X3FC 3F5XA 2OW3A 5LXMA 4FEVA 3DB6A 4CYJA 1WBPA 3ANQA 3KL8A 3FC1X 4M0ZA 4NM5A 5JK3A 3R21A 4G3DA 2YIXA 5HICA 2R7IA 4BKZA 5IA4A 3F82A 3NFFB 4ONAA 4PL4A 2A4LA 4LMNA 4CFNA 3UIXA 5IH4A 2CNUA 1J1BA 2XIKA 4J7BA 2I1MA 3NAXA 5AP4A 5CSPA 3KMMA 3NR9A 2XK7A 3LPBA 3QC4A 5I3OA 5IISA 1I44A 4QMTA 1PW2A 4J8NA 2Y4IB 2PU8A 2OFUA 2Y7JA 3CQWA 2XBJA 2UZEA 3R02A 3RBWA 3CPBA 3RM7A 5CQUA 5CF4A 2UW9A 3A62A 3P1AA 1UWJA 4M84A 5TO8A 5KE0A 2FGIA 4ZY4A 3ATTA 3C4CA 4RBLA 1PYXA 4C4JA 5K5XA 4D0XA 5KMIA 4AXFA 2GS2A 2R3JA 4ZSGA 4IB5A 2W1CA 2WZJA 3ZONA 2JIIA 4WNKA 5EI8A 3AD6A 3OF0A 4UWYA 4YMJA 2CKOA 2R7BA 1JAMA 3A2CA 3LFBA 4NCTA 3KRJA 5AA9A 4Q5EA 3TIZA 4MEDA 4YHFA 3P0MA 4I6BA 5IA2A 3PY0A 3KKVA 4PX6A 1OL6A 3K5VA 4OR5A 5I9XA 2X2MA 1AQ1A 4KSQA 1A06A 3AC4A 3DXNA 2Y6MA 4YBKA 1G5SA 3EKNA 5LVMA 1M7QA 4EJ7A 3QRIA 3NUPA 3R63A 3VW6A 3HEGA 1BUHA 4PTEA 2BFYA 2JBOA 3E8DA 3OUNB 4RZVA 4FTCA 4E5WA 3AG9A 4JMQA 1ZOEA 2BAJA 2NRUA 3UVPA 5CALA 4TYHA 2HWPA 3BWFA 4U80A 4ANLA 3BV2A 2W1DA 3OVVA 4D58A 2C6OA 2C3LA 3Q04A 2QHNA 3ZM4A 2VWIA 1UNHA 4JQEA 5AIRA 4L01A 3NGAA 4KRDA 4F9AA 5DNRA 3KK9A 2VTOA 4GFGA 3O5AA 1W98A 4F6SA 2GS7A 2ITYA 3FYKX 5DRBA 3U54A 4C8BA 1UU7A 3LZBA 4AZTA 4L7SA 3IGGA 3VN9A 3LVPA 4FIGA 1XQZA 4UXQA 3FMEA 2W1IA 5CY3A 4UB7A 5J1VA 4C4EA 1PXKA 3DZQA 3OCTA 2BROA 1QPCA 2F7EE 4QMXA 4GS6A 2UW7A 4C58A 3S4QA 3N4TA 4MKCA 2XCKA 4AN9A 3GNIB 1UU9A 5D9HA 3UODA 2BZKB 2OWBA 2GQRA 5AV3A 5JFVA 4E7WA 5L2IA 1T46A 3W0OA 4XUFA 2OFVA 5FBNC 5ETAA 4QMMA 4RQKA 2PZIA 2KULA 3R7YA 4ARKA 3AGMA 1WMKA 2BALA 4PTGA 3VUKA 3R7UA 2QOQA 1WBVA 5HVYA 4O0XA 3HMMA 3OY3A 3W1FA 3G9NA 4BZDA 1VZOA 4PF4A 5HE1A 2R3HA 4LQMA 4M0YA 4MD7E 4O21A 3ORPA 3RJCA 4WBOA 3SOAA 4FUXA 2JDRA 4ZAUA 3PY1A 5C8KA 4D4YA 2R3NA 2YCRA 2J2IB 4QOXA 3ZZWA 2R3RA 3FL4A 3EYHA 3G5DA 1REKA 4DHFA 4QMSA 4JQ8A 4O0RA 4RJ5A 3VAPA 3AMYA 2I0YA 3FMHA 3GI3A 4TXCA 3ZCLA 2Y4IC 4H1MA 5IDPA 4Z55A 4UMQA 3BYVA 4F9YA 2EVAA 5KMKA 1S9JA 2ZB0A 3DAJA 4ERWA 5GINE 4BCKA 2FSOX 2VWXA 4JIAA 4HVDA 4RVKA 5HG7A 3KF7A 5I9UA 2RG6A 4EOSA 3LKMA 5CZHA 1Q8UA 3CC6A 4BKJA 2C0TA 2QO7A 4DG3E 3EFWA 4RJ3A 2VO7A 3TG1A 4E5AX 4EH5A 1URWA 2O64A 3NX8A 3TIYA 2ZFYA 2BZJA 3WILA 4LOOA 3EQRA 3CJFA 4A07A 1XHAA 4BZNA 3HMIA 4AFJA 1YW2A 2DS1A 2YZAA 2QONA 3IDBA 3SLSA 4I0RA 3HA6A 3KULA 4IAAA 5AFVA 4FK6A 2CHLA 4FV5A 2XRWA 3FLNC 4G34A 1OBGA 1QPEA 2DYLA 3ENHA 3I7CA 3KY2A 3O8TA 3OXZA 4KS8A 3HAMA 3TZMA 3PZHA 3DCVA 4IMYA 3OFMA 1JSUA 4Y83A 4FTOA 3FQHA 2VZ6A 4KAOA 4ALUA 2W96B 1E9HA 4WHZA 1VYZA 2YERA 4AOIA 4NCTC 4XG6A 4NU1A 2C4GA 4FSYA 5M51A 5DRDA 4JG8A 1H28A 3LCTA 3A99A 4HYHA 2F7ZE 4ACGA 2GNJA 5HU9A 4MHAA 3KULB 4ANBA 4GK3A 2YM3A 3QBNA 4RWLA 4DG2E 2W4KA 3C0GA 3LLTA 4X7QA 4ZK5A 3AOXA 4EK8A 2QG5A 3D4QA 1JWHA 3H10A 4EH8A 3MY0A 2VTTA 2XCHA 1ST4A 4UXLA 4GU6A 1XH5A 4I92A 3OWKA 1FPUA 3DJ5A 3DLSA 4BZOA 3GOPA 4NIFB 3BQRA 4DEGA 1O9UA 4EOPA 1IG1A 4EZ5A 2C47A 4O0SA 4BRXA 3JS2A 5HVJA 1JNKA 4G16A 3VUGA 2Q0BA 4NZWB 4BTFA 4TYEA 2JEDA 4QTBA 4P5QA 3FY2A 1RDQE 1YVJA 4KS7A 5ETIA 3TNWA 3ZDUA 4ACDA 2HIWA 2R64A 4E6AA 5K4IA 4UZDA 5BNJA 3BE9A 3O71A 4J52A 4G9CA 1U5RA 4GVAA 2C1BA 5L4QA 2J0JA 3HYHA 5J87A 3VBXA 1SZMA 1RW8A 4Z9LA 1OIYA 2HXLA 3VS3A 5T3QA 1S9IA 3EJ1A 2RL5A 3RGFA 3NRMA 1OKZA 2HZIA 3AMBA 2YCSA 3A4OX 4GVJA 4IWQA 4ZTMA 5BV3A 4ENXA 1KE7A 5L3AA 3HNGA 3COKA 3CLYA 4DG0E 2KTYA 4FE2A 4MH7A 3PLAE 2EXCX 3D5VA 3W10A 3VQHA 5CU2A 2P55A 3NS9A 1W84A 3DXQA 5M06A 3VNTA 5HNIX 2YACA 3RHXA 5D11A 4ANQA 3PVBA 5M4CA 4DGGA 2IVUA 3R2YA 4V04A 2WU7A 3GCPA 5L2SA 4APPA 3AMAA 2C6LA 3O2MA 3R7OA 3F9NA 3ACKA 2WAJA 3DKGA 3W2PA 3ZBFA 4GFMA 2E9UA 4QQ5A 3IK3A 4YO6A 3T9IA 2PSQA 2WU6A 3BX5A 3Q9YA 3RZFA 3ERKA 3K3IA 2ITTA 4D1SA 4FKLA 3GC8A 2I0EA 1Q8YA 3GCVA 3O7LB 5EM5A 2PMIA 5C8MA 3R73A 3TWJA 4ANSA 4EKLA 4D2PA 3UG1A 3PSBA 4JDJA 5FLFA 3PZEA 4MQ2A 3GEQA 3QX4A 4FT5A 3FBVA 5AV0A 4FV8A 1MRVA 1OGUA 5CU4A 1IRKA 2CMWA 4GYIA 3A60A 5T6KA 1ZZLA 3BU6A 3QX2A 4U0IA 4JLCA 4O6EA 4AA0A 2NPQA 2Z8CA 3L9MA 4XLVA 3ZMMA 2OK1A 5HLWA 4MXCA 4F6WA 2YIYA 3C1XA 3MIAA 5C27A 3PYYA 1Q24A 3L9LA 1GJOA 3EZRA 3DTWA 3P23A 4IANA 2XAMA 4N57A 5L2WA 2QR8A 4FEWA 5FD2A 3WZKA 4F7SA 4C38A 1XJDA 4C61A 4FKSA 3SW7A 4C59A 2WMRA 3HDMA 2WEIA 3DOGA 3FPMA 3G6HA 4NKAA 4BGGA 2PVRA 4F63A 5IU2A 3E64A 4NJ3A 3C5IA 4FJVA 4DEEA 1G3NA 3L8SA 1PHKA 2HY81 4EH9A 3AD5A 4M68A 4DN5A 5IH5A 4QMZA 2BIKB 1FGKA 1Q61A 2PZPA 1ZY4A 3KCKA 3OWJA 4GG5A 4R1VA 5AMNA 5HG8A 4D0WA 3EH9A 3D0EA 4YP8A 4DH1A 4FSZA 2J5EA 5HTCA 3D7ZA 4IZAA 3HGKA 2AEGA 3RAHA 4F7JA 1RQQA 2YISA 4EEVA 4IXPA 3C5UA 3UDBA 4RFZA 4ZY5A 1CMKE 3H9RA 5EW8A 4UX9A 3C4ZA 1PMVA 2R3GA 2VTJA 4GEOA 4M66A 4BYIA 4FZDB 4I41A 4MBLA 5K3YA 4F1OA 3KK8A 3NCZA 4OTPA 2R3LA 1J7LA 2GSFA 2OF2A 2VX0A 4AA5A 4ASZA 5GZAA 4BFMA 4EBVA 5L2QA 3KMUA 3MVLA 1MRYA 3ORLA 3LCSA 4F64A 2R2PA 4DT8A 4GW8A 2ZV9A 1ZYSA 4O6LA 3QD4A 4IZYA 5H8BA 3UYTA 2V5QA 3W18A 5CEMA 3W0SA 3UJGA 2DQ7X 3V5QA 2FH9A 3TNQB 1P4OA 2YM5A 2RGPA 2VUWA 3GCSA 3W55A 3JY0A 3MFRA 4AGUA 2BHEA 4EOMA 4IAZA 2ITXA 2XNMA 3G9LX 3NSZA 4XOYA 3TNHA 4D9UA 2BDWA 3BHVA 3Q53A 4JL9A 4TWOA 4C4HA 2UW8A 3S95A 3SG8A 3VIDA 4C35A 1GIIA 3GU5A 3QZHA 4YR8A 4IB0A 1OITA 5ICPA 1VJYA 3V8WA 4O0TA 1UVRA 4JAJA 3PRIA 3TM0A 4PP9A 4X3JA 5DPVA 3H9OA 3PXKA 3A7FA 3VW8A 1ZWSA 3IW8A 2IZSA 3Q9WA 4FZFB 3QWJA 3ORKA 3EQDA 4JX3A 1OUYA 2BRHA 4K2RA 3I81A 4EC9A 2YDKA 4OAVB 3BI6A 2Z7RA 3W0QA 3WBLA 1UNLA 2BPMA 3NW6A 3R22A 4QYEA 5I0BA 5EFQA 3COMA 3ZUTA 4E93A 4MX9A 4R7BA 3MH1A 3V51A 1XBCA 5HX8A 2GNIA 3ZO3A 1PY5A 4YLLA 4LOPA 4U42A 1YWVA 5J5TA 1WBSA 5M44A 4WNOA 5HCYA 4RZWA 3W2CA 3ORXA 5CAOA 3LIJA 5E8TA 1YXUA 4EK3A 4O7TA 2AC5A 3DU8A 4GJ2A 4XP2A 1K2PA 3PVGA 4O91A 3RHKA 4UN0C 4FGBA 4BTKA 4C4FA 3L9PA 5TOZA 4BCIA 4XCUA 1O6KA 4AAAA 5CTPA 3P86A 4UY9A 2XZSA 4FF8A 3RAIA 4FSRA 3IW5A 2ZV7A 4ZSEA 4AGWA 5AP2A 4DEAA 2XANA 2GHMA 4AACA 3E8EA 4B4LA 1TFFA 4ANMA 2O63A 1PXJA 3D15A 1CTPE 1M17A 1OKWA 2JD5A 5DR2A 3QHWA 1XWSA 2OSCA 3CIKA 3EQHA 2QOBA 1Y6BA 3O50A 4FRFA 4B8LA 3TDWA 4DDGA 2WXVA 4BF2A 5DR9A 2HW7A 1JSVA 3A7GA 3C13A 4L42A 3TV7A 2OIDA 3H0ZA 4O4EA 4YU2A 3G90X 4J97A 4KBAA 4U45A 4BCHA 5A4QA 2OZOA 2CCHA 3LCKA 4WT6A 2B9FA 3EHAA 4B0GA 2XKDA 4IX6A 1UKIA 3IOPA 4DEIA 4YTCA 3W33A 3LXPA 5F9EA 3U6HA 4WA9A 5AWMA 5BVDA 3TV6A 4FOCA 4CG8A 4GU9A 4RG0A 4BDJA 5CS6A 2JDSA 3WZUA 4DITA 2UVZA 1GIJA 1P5EA 2IWIA 2QOKA 3R2BA 5HE3A 2WHBA 3IDPA 3T9TA 3QAME 5CZIA 1IAJA 2UZWE 1NA7A 1OIRA 1G8JA 1WCCA 4CTCA 5BMSA 5AX9A 3CQUA 4KRCA 4OTWA 2XMYA 3QQGA 4RVTA 4BCOA 3G15A 3PUPA 4QMOA 5C8NA 3TTIA 4CV8A 2WMUA 4USEA 5HNGA 4LL5A 5CXHA 4F6UA 5IDNA 4FSTA 3DBQA 4L9IA 4GFOA 3KRWA 1KE6A 4X2JA 4N70A 4O4BB 4YZ9A 3LCDA 3QGWA 2EUFB 3VS4A 4CYIA 3KXHA 5C1QB 5HX6A 2HOGA 1OPLA 3SVVA 2CNQA 4CRLA 5KZIA 4KB8A 1SNXA 2J0IA 3QRUA 5HBEA 5HCXA 3LXKA 5LCJA 4I6HA 5LMKA 4DE4A 1ZAOA 3R9HA 4BBEA 4CZYB 3E5AA 3MGYA 5BYZA 3QQHA 4GL9A 1SYKA 4L45A 3S2PA 4YJQA 3ZS5A 5LVNA 1L8TA 4EC8A 4R7IA 4AXCA 1JLUE 3ET7A 5FUTA 3BEAA 4TW9A 3MH3A 4L3LA 3QA8A 4LRMA 2HY0A 3TKHA 4FKQA 1DI9A 2P33A 3AD4A 2OI4X 4RX7A 3T3UA 4NTTA 3UVQA 3WE4A 5CLPA 3NUAA 3GQIA 3DFAA 3QKMA 4FVPA 4I6QA 4FV0A 5AA8A 1XMLA 3VONA 1R0PA 4W4YA 3EMGA 5EYMA 1ZY5A 3B8QA 5J9LA 4GIIA 3F2RA 1TKIA 4V01A 2UZNA 5DH3A 5IQGA 4BL1A 5AJQA 5HBHA 3GBZA 3D2KA 5CU3A 3RK9A 4S2ZA 2W17A 4QTEA 2J6MA 2X7GA 3QQKA 3LMHA 1FVTA 3DK6A 4CQGA 2JIVA 4QMVA 1Z5MA 3HV3A 2PVYA 1UWHA 2VNYA 2WTKC 3FZRA 3PP1A 3R1NA 4FKUA 4FG8A 2OZAB 4L67A 4O0UA 4OLIA 4GYGA 2X9EA 4O22A 1OPJA 3FV8A 5EKOA 3TMOA 2J4ZA 3ETAA 3QTUA 5HHWA 5F4NA 4ZJJA 4Z7HA 4CSVA 1NT2A 2QO2A 3V01A 3LFEA 2W5BA 5HIBA 5K0KA 5I5ZA 3L1SA 2C5OA 3IG7A 3ORMA 5E1SA 3N4UA 5HTBA 3Q2JA 3JXWA 4JVGA 2XK6A 2YIWA 3DBFA 3QCQA 3TN8A 5KCVA 2OH4A 3IPHA 3OT8A 4XLIA 3VF9A 3VULA 3IECA 1F3MC 3PXYA 4BI0A 3GFWA 4LMUA 4O2PA 2PVFA 3FZOA 2OJJA 1H01A 2XUUA 4G6LA 4BJJA 3PPJA 4ZXTA 1ZARA 3A61A 4MCVA 5FXRA 1YHSA 3UP7A 3QLFA 1U46A 3TACA 4YTHA 5AUUA 2V62A 4KKEA 3WI6A 2UZUE 4W9XA 4AX8A 2W06A 3FLWA 4JDHA 3BHTA 4CRSA 1Q5KA 2WQNA 5LARA 5AR4A 5LMBA 1H25A 2ZDTA 2G2IA 4OTRA 4RIYA 4CZTA 3P5JC 3NUUA 3NUYA 3PPKA 5DGZA 5E92A 4AS0A 4EJNA 3R0TA 4LL0A 4QTDA 2X8DA 5E8UA 4Y95A 4OAUC 3K2LA 4WG5A 3VHKA 2YA9A 1YI4A 3CE3A 1OZ1A 3CPCA 4WUAA 4LDTA 5CVGA 5FXQA 5AIKA 2WMAA 2C6MA 2JDVA 4NH1A 4YNOA 3TNPC 3UQCA 2XEYA 1V1KA 4EI4A 3C9WA 3FKLA 4EOLA 1KV2A 4IIRA 3EN6A 4GT5A 3QTZA 2H6DA 5EM8A 3DK3A 4K11A 4QP1A 5I3RA 4KBKA 5LVLA 5DWRA 5TF9A 3NVMB 3FMNA 3MI9A 2CKEA 4CMOA 2JBPA 3BLQA 4A9YA 2BAKA 3CTJA 4FKGA 5L6OA 4QP2A 4RIYB 3T3VA 3MY5A 3ZO2A 3QTIA 5EQEA 2A98A 4S30A 4XG3A 4XH6A 3ZFYA 3G0EA 4O7VA 5KMJA 4ZSJA 4O4DA 1JKSA 2QOHA 5AP0A 2RSVA 4BDHA 3VBWA 5A14A 4B6LA 5J9YA 4LM5A 4AUAA 4KSPA 4TY1A 1ERKA 4BKYA 2XYUA 1YRPA 5EDQA 5FTGA 1R3CA 2XNOA 4AZFA 5IMXA 2ZM1A 4L3JA 4YTIA 4E6QA 5M07A 2RFEA 4DBNA 3NWWA 1R78A 3KFAA 3QTRA 2X4ZA 4WG3A 2WMBA 4IJPA 4IM0A 4YPDA 3TTJA 5M09A 4KKGA 3UC4A 5IA5A 2WTCA 4GCJA 4LOQA 4WRGA 5AUWA 2RKUA 3ZDIA 3OBGA 4MXYA 5CSVA 4BBMA 4M12A 5ACBC 5A9UA 5LMKC 2YHVA 4ZY6A 3V3VA 3VWAA 3QCYA 3LFSA 2YZLA 5C4LA 3FMMA 2W5HA 4IQ6A 4KIOA 5E7RA 4TKSA 5HD4A 4QMPA 3UO6A 4G9RA 4MVFA 4TWCA 4LFIA 2JKOA 3DXPA 4QNYA 4I0TA 3QQFA 1PJKA 1UU8A 3BHHA 4HVGA 1DAYA 1MP8A 1G8AA 4LV7A 4OTIA 3I60A 3VUMA 3EQFA 3N51A 5B2KA 4AQCA 2AC3A 4QYHA 4QTCA 5HIDA 4XRJA 1HOWA 4ALVA 1ST0A 2JITA 2SRCA 3R71A 1Z9XA 2GS6A 3P78A 4FC0A 1YHVA 4JNWA 4JBOA 4NW6A 5JQ5A 1LPUA 3PSDA 4HGTA 2IG7A 2PE0A 5AUZA 4F08A 1Q99A 1LR4A 4EHVA 4CG9A 5D7VA 3RKBA 3Q32A 4FODA 4E4XA 3Q96A 1NVSA 3DS6A 3LMGA 4FG7A 5E8ZA 3Q4UA 5LVPA 4DFZE 4OT6A 4ACMA 1KSWA 2W4OA 3MTLA 1STCE 1APME 1IR3A 2NRYA 1URCA 3FZTA 1YDTE 3OY1A 3VS1A 4QQJA 4FSMA 4ZOGA 4DHIB 4D9TA 3EQBA 2R0UA 1YXTA 5JEBA 3NUXA 4OW8A 5ANDA 1OIUA 4QRCA 5CVFA 3QTSA 4LRKA 3R8VA 4BYJA 4D2WA 4XP0A 3MFUA 4ASDA 2YAAA 3Q5IA 3U6IA 3DNEA 3Q9XA 5FQDC 5BVKA 4NM7A 3UNJA 3MBLA 2X0PA 3T8OA 5B2LA 4IAYA 2VV9A 3OHTA 2GU8A 5HO6A 1NVQA 4C2VA 4EOKA 1B38A 4YLKA 4FIJA 4KABA 3WE8A 1CKPA 3TXOA 3ZC5A 3TV4A 4DH8A 5JKGA 2UZVA 4R5SA 4UMRA 3CJGA 3PWYA 3RALA 3LLAA 2XIZA 3OC1A 4EOIA 1G8KA 4EK4A