4KIOA

Kinase domain mutant of human itk in complex with a covalently-binding inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
265
structure length
240
Chain Sequence
GSVIDPSELTFVQEIGSGLVHLGYWLNKDKVAIKTIEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery of novel irreversible inhibitors of interleukin (IL)-2-inducible tyrosine kinase (Itk) by targeting cysteine 442 in the ATP pocket.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 240
sequence length 265
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kioA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kioA01
5ANOA 3B2TA 4CCUA 3ZO3A 2G2HA 2UW0A 3LZBA 4FIHA 4C37A 3LE6A 5A4CA 2BIKB 5DWRA 3RCJA 5LWMA 1UV5A 4NTSA 4QMZA 2UW8A 4L46A 3WYYA 5E8SA 1TVOA 4M84A 4WNKA 4EI4A 2QOKA 4KABA 4IJPA 3R7UA 1ND4A 3UZRA 1YOLA 3TDVA 1AD5A 4CTCA 5ETCA 5IEVA 2VTIA 4YZMA 3DGKA 2JDRA 4GK3A 4X2GA 2IWIA 4HPUE 5J8IA 4GYIA 3UVQA 5DVRA 4XOZA 3TZ7A 3BLRA 1ZY5A 5L2IA 4YUQA 5IA4A 4JI9A 4PTCA 3NYNA 2J0LA 3VUMA 5LVLA 5M07A 4OBPA 5M55A 1YWNA 3COHA 3CJFA 3NAXA 4HVGA 3OVVA 3EL8A 4ZTNA 3UNKA 4NSTA 4O38A 5AR8A 4ZY6A 4B8LA 4DEAA 3DCVA 5M09A 3LHJA 3E8EA 2FSMX 5JEBA 5AP7A 3AMBA 4TXCA 3ZOSA 3AC8A 3AOXA 3MFTA 5EOLA 4WNPA 2O63A 3MFUA 4KS7A 3VUTA 4DGMA 4IVDA 2GNJA 3DA6A 5EI6A 3ZSHA 4AT4A 1M7QA 2ZV9A 3DNEA 3LFFA 4TYGA 4GIHA 5IU2A 4ZSEA 4RJ4A 3PPZA 5EYCA 5C4LA 2VTJA 4JQ7A 1Z9XA 4MNFA 3UP2A 4J8NA 2YLEA 4PQNA 1NY3A 1VYWA 4U44A 1OPJA 2BHHA 3TUBA 4IQ6A 5GIPE 4JAIA 2O8YA 1H07A 5BQ0A 1KSWA 2WMAA 4IIRA 4AG8A 4BFMA 3R1QA 2YIYA 4LQMA 5HX8A 2VGOA 4C59A 5K0KA 3KF4A 1OBGA 3V6SA 5I5ZA 5M4IA 3KEXA 3PJ3A 2W9FB 4CV8A 2HIWA 1QPCA 1G5SA 3NUAA 3LMHA 3MIYA 5T3QA 3KA0A 2J5FA 3FKOA 3MI9A 4HVSA 4YZBA 2OZOA 4Y95A 3O7LB 2GTNA 2Y6MA 3QGWA 4LUEA 4CTBA 4UMTA 3ERKA 3U6JA 2FSTX 4RIWA 4BCNA 3E8NA 4ZK5A 4YJSA 2JAVA 3CTQA 4NUSA 4RZVA 4EHGA 3VUKA 3R28A 2BRGA 1CKIA 4DH7A 1M2RA 3FMMA 1P4FA 4GT4A 3CKWA 4AWIA 5D11A 4EK6A 3MH1A 4G6OA 3DKFA 2PVNA 4FSMA 5TO8A 4F9CA 2PYWA 5HIBA 3W10A 2C1BA 1A48A 4WBOA 3F5UA 2C3KA 2XZSA 3ALOA 3F2NA 4CG8A 1MQ4A 2GFCA 2CNUA 2W05A 4FSQA 4ANBA 5A4TA 3CPBA 3P0MA 3QQFA 3QYZA 5DI1A 4QMYA 4USDA 3UQGA 5JZJA 1YWRA 5IQEA 2UZVA 3N4TA 3MPMA 3FQSA 4G34A 3DJ5A 5DIAA 4MXCA 3DBCA 3HRCA 2J0KA 4YJVA 4EK4A 4MTAA 1NT2A 1XH7A 5BUEA 3MN3A 5EM6A 2W5AA 4Y72A 2ZMCA 4PL4A 5KMOA 2YDIA 4GK2A 3AC4A 2AYPA 2WMVA 4H1MA 4QNYA 3HMIA 1XJDA 4H3BA 3EKKA 4E5WA 2R3FA 3SDJA 4E1ZA 3LFDA 3IGGA 4J95A 3FY0A 2HAKA 4LGHA 1QPDA 3PVUA 3R01A 4YLJA 4YJOA 1J1BA 1OL2A 3A60A 1FBNA 5DYJA 4YO6A 4U6RA 1PMVA 2PSQA 3QTZA 3ULIA 2EXMA 4BBMA 2XIYA 2VNWA 4U79A 2GNGA 3TZMA 4JQ8A 3QQGA 5KMIA 4FYNA 3BYOA 4UYNA 1FPUA 4CLJA 3R7IA 2X2LA 1QMZA 2XEZA 4O27B 1U5QA 1V0BA 3EN7A 3IGOA 4JT3A 2QQ7A 5I9WA 4D0XA 4G17A 1V1KA 4C3RA 3F7WA 4QTAA 4DG0E 4F0IA 5L6PA 3OCGA 5FEQA 1JOWB 5DR9A 2WPAA 4C3FA 1OMWA 3NDMA 4HPTE 3D7TA 1OBDA 2OJ9A 3IDPA 4A9SA 4ANLA 3S3IA 4GT5A 4BVUA 5D9HA 2Q83A 4DG2E 4UXQA 1OI9A 2EVAA 4R6VA 4TPTA 2C5NA 3Q6UA 4UZDA 4FTMA 2C5VA 4IB3A 1TQMA 5AUTA 1CKJA 4FR4A 4QTEA 4N57A 3A4PA 2VTAA 2X4ZA 2YZAA 5IZFA 5CU6A 1JKSA 3G0FA 1JKTA 4IM0A 5EFQA 4AX8A 3NVKI 3KCKA 4Z9LA 5C8NA 2XKEA 2I1MA 3NR9A 4ZP5A 5JRSA 4B8MA 5EKOA 2IVSA 3H0YA 4QMSA 1VJYA 1RDQE 3RM6A 2JBOA 4G6LA 4YLLA 3ZO4A 2ONLC 3FZ1A 4YGAA 3F3TA 1P5EA 1FQ1B 4KIPA 3AT2A 5HCZA 5LQFA 3HLLA 3QLFA 2J0JA 2X7FA 2PU8A 4FKUA 2GHGA 3RTPA 3SGCA 3BU5A 4FVQA 4OTRA 4LRJA 2NRYA 3FY2A 4FMQA 5F94A 5C26A 3AC3A 3MSSA 4AF3A 3V8WA 3TTIA 5CF5A 4O7TA 4U42A 4ZLZA 3C13A 2YA9A 4EJ7A 1OKZA 5HG5A 4FGBA 5CU3A 5HVYA 1Q41A 2QHNA 3BYSA 4E6QA 3ZC6A 3ACKA 5HOAA 4JQEA 5J7BA 3CQUA 4KKEA 3BEGA 4GG5A 5CU4A 3HMMA 4QMPA 4WD5A 3R9HA 3QZHA 4GRBA 4L8MA 4FZDB 5IEYA 3KL8A 2EXCX 4HGSA 3MA6A 4KS8A 3VULA 3W2QA 4UY9A 5LMKA 2R3KA 3IW6A 4F64A 4K18A 2ZOQA 3KVXA 3TV4A 1IAJA 1FOTA 3QRIA 3JY0A 5L8KA 3FE3A 4QP3A 4E5BA 5HO7A 3NUUA 4ENYA 2PVMA 2FH9A 2I0HA 4MBLA 4EK8A 4DT9A 4JDJA 4IC8A 3C0GA 4NWMA 4BDBA 3OS3A 4M12A 3LPBA 2UZEA 4DFXE 4HZRA 4DTBA 3TI1A 3E7VA 3VIDA 5IQAA 3N51A 2UV2A 4V01A 2J50A 2CNVA 5AAFA 2BZIB 3DAKA 4QP9A 3DNDA 1XKKA 3QX4A 5E8TA 2CKQA 2OIQA 4XCUA 3W1FA 1M52A 3UO6A 4W4YA 1FMKA 3ENMA 4O96A 5IA5A 3NZ0A 2V7OA 4A9YA 3FL4A 4LL0A 4BC6A 3OEFX 4BIBA 3QYWA 4K0YA 4FV5A 3P7BA 4O0YA 3FMEA 4NFMA 4AT3A 1KE7A 4EUUA 3EWHA 3RPYA 3BELA 4GT3A 4R3PA 4DFNA 5JQ5A 4EOPA 3R7GA 1ZYSA 4R7HA 3BQCA 2VN9A 2FA2A 4C8BA 4KIOA 1YDSE 2ETMA 3FC1X 4O0XA 4S33A 4H36A 5AUZA 3BV2A 5CAUA 3MESA 5IKWA 5HO8A 1ZOEA 4PPCA 1URWA 2RFNA 4JX7A 3ZH8A 1STCE 4IXPA 2OXXA 3I79A 3ZSIA 4F63A 3SC1A 4YMJA 4FT9A 2BRBA 3O96A 4AN9A 3PRIA 2C6OA 3PE2A 4OTFA 1UNGA 2ITQA 4FEXA 3QKKA 4LV5A 5AX3A 4DFBA 1U46A 3AMAA 5IDPA 3EQIA 2YIQA 4I5HA 1QL6A 5H8BA 5M57A 2J0MB 2Q0NA 5M4FA 3LOKA 5HIDA 3SG8A 2UZWE 3DKCA 1I09A 3Q4ZA 5HU3A 4FV4A 4N4SA 1DI8A 1OUKA 4YURA 3K54A 3QD2B 5GJFA 5I9VA 2HENA 2J51A 3W33A 5AP1A 3VF8A 1H08A 1PXPA 2E9PA 2F2UA 2W5BA 2WFYA 3VF9A 4BB4A 4F65A 3NMUF 5M4CA 5I9XA 3KXNA 4PL3A 3NVMB 4RVMA 3T3VA 3ZFMA 3N4VA 3RHXA 3ZTXA 2QLQA 2BDFA 4BICA 5G1XA 4GKHA 2RIOA 3ANRA 3QC4A 4FV7A 4ASDA 2X8EA 4TWNA 3ACJA 3ULZA 4BY9E 3FLWA 3EYGA 3V5QA 2XF0A 2YWVA 3KU2A 4QP7A 2QOOA 4BDEA 1F5QA 4YNOA 3KN5A 4OTGA 2XNBA 3D9VA 4HGTA 3OG7A 3PLSA 3UIUA 5EW9A 4AW0A 5BPYA 5KMJA 1UKIA 3SQQA 4QP1A 4TYHB 2Y7JA 5CS6A 3D0EA 1M2QA 2PVHA 2PK9A 3UE4A 3DV3A 2BAJA 3D7ZA 4RWKA 3UIXA 4ZLOA 5A6OA 4S31A 1O9UA 2O0UA 4AS0A 4E26A 3FUPA 3F9NA 4IVAA 3AMYA 5CX9A 2E9NA 5HI2A 3UG1A 2GNFA 2PZRA 3E92A 4FZFB 2FSLX 4I0SA 3UYSA 1IA8A 2HXLA 2GQRA 3BPRA 5D41A 5CAPA 5IEXA 4NM3A 5KMKA 4DA5A 3EN4A 3PY0A 5I9UA 4QP2A 2XKDA 3HVCA 1WVXA 1H01A 2VWZA 2I0EA 1GJOA 3ETAA 3LFCA 2P55A 2JDOA 4BTJA 4YHFA 4EH3A 1OKYA 4ARKA 4KSQA 3FHIA 4PDPA 5ETFA 2OWBA 4N6ZA 4YP8A 4XV2A 3BX5A 3ITZA 4LRMA 3VQUA 2YITA 1WAKA 4CQGA 4DF3A 2UZNA 3PWYA 2WTKB 3H30A 3HMPA 5E92A 5AWMA 4TWOA 3P1AA 3QWKA 4F9YA 3NNWA 3LFNA 5HBEA 4GUBA 4G5PA 5A14A 1SYKA 3MS9A 1ZLTA 2ITNA 2UZTA 3OROA 3QCSA 4FYOA 4Z7HA 3UC4A 5CAOA 3V8TA 3NW6A 4FV0A 3RAKA 3G9NA 4BGHA 4V05A 4TYJA 5HIEA 4Y5HA 4FV8A 4L01A 5JN2A 1KE5A 3ORZA 5HEZA 3UOLA 4IAIA 4PDYA 1XQZA 3G6HA 3CPCA 4ACDA 1U4DA 2OU7A 3FJQE 3AGLA 4ACHA 1H1WA 2VX1A 1NXKA 2OZAA 3MB6A 3ZM4A 3KRRA 4CMTA 4D2WA 3ID6C 2W1HA 4AP7A 3TNHA 3HDNA 4UMRA 1IAHA 3E93A 2PMOX 4PMPA 3NS9A 1BX6A 3R1SA 4RA4A 4CFFA 3RAIA 5IQHA 4DLJA 5A46A 3FI4A 5AUXA 3OWKA 4FC0A 4U43A 3VAPA 4OUCA 2OKRA 4H3PA 2W1EA 4YZNA 4J99A 3ORXA 5HKMA 3GC0A 2ZV8A 2R3QA 4ASXA 1RQQA 2YM5A 4RJ5A 3RPVA 5HORA 5J9YA 3JVRA 2X9EA 5KMMA 4ENXA 1XH5A 5GHVA 4J71A 5KKRB 5LJJA 4FNZA 4MWIA 5KZ0A 4FSZA 1Q62A 4L67A 2H96A 3F5PA 2JIVA 5LCKA 2YIXA 2IJMA 1SVHA 4KBAA 3HV5A 1WZYA 3DAEA 3CD3A 4IWDA 4ANOA 4MCVA 4XUFA 2O65A 2GHMA 4WG3A 5EQPA 4DCEA 3DB6A 4NZWB 4CKJA 4UX9A 1JVPP 4RT7A 2W17A 4XV3A 3ZU7A 4OTQA 2ACXA 3BHHA 5DR2A 3LMIA 4GH2A 4KWPA 4EQMA 2F7EE 2UZLA 4F6WA 4ZY4A 2F7ZE 4X2JA 3E62A 5DFPA 3W2CA 4BTKA 5KUPA 1PY5A 3FAAA 4G3GA 4RIXA 5E4HA 3C0IA 2VWYA 3AC1A 4M0YA 1I44A 5KE0A 1ZMVA 4YJQA 2BR1A 3ORLA 4HVIA 5H8GA 1YQJA 3PJ2A 1ZY4A 4I4FA 4R1VA 5E90A 1ZXEA 5HCYA 5BVEA 3OCSA 4O82A 2BUJA 3CXWA 3EYHA 3EL7A 2IO6A 3PA3A 3ORKA 5D1JA 5IQCA 2VTTA 1XBAA 4FIIA 4LOOA 3E8CA 4I4EA 4A4OA 2HZIA 2CN8A 4K2RA 3RMFA 4ORKA 3SV0A 3BZ3A 5F9EA 3QKMA 3D4QA 1PW2A 3MVHA 3LW0A 4RBLA 4A4XA 2JFLA 4GJ2A 3OEZA 3L9NA 3KULA 1XH4A 3BQRA 3IW4A 4YC6A 1DM2A 2Y4PA 2J7TA 4O1OA 3CJGA 2F49A 4IZYA 2ZMDA 4JIKA 4O0WA 1IG1A 4QQJA 3SG9A 4XG7A 5DNRA 2OXDA 3CGFA 3OBJA 3PJ8A 4K9YA 4JL9A 4XLVA 5TE0A 2C5XA 4I3ZA 3SVVA 1WBTA 3NUPA 4CT1A 1URCA 5KMNA 3P7CA 4HYSA 5J5SA 4CQEA 4X6QC 4TWPA 5LMAA 5I0BA 4M8TA 1H4LA 2VTNA 2XNEA 3TXOA 3RKBA 4XH6A 2BALA 2OLCA 4C2VA 4AA5A 3VN9A 1KE6A 2XP2A 3OWLA 2WO6A 3P4KA 4PX6A 4CFUA 3BI6A 2B55A 4RIWB 5E1EA 4C36A 4C4FA 2XH5A 4F7SA 5CF6A 4KKGA 3CLYA 4AOIA 4A9RA 4BCOA 2GMXA 4QMTA 3DBEA 2QKWB 4I6BA 4IAZA 4D2VA 3UJGA 4E7WA 3OZ6A 1BMKA 1UWJA 5AM7A 5ANIA 4L7FA 5C8KA 2QO9A 2XKFA 2GNHA 5IQFA 3PG1A 1Q24A 3MW1A 4ALVA 3M1SA 3NIZA 4EH6A 4MXYA 4M13A 3HX4A 3QRUA 5E8VA 1GAGA 3ZHPC 3FSKA 4DGOA 3SKCA 4RFZA 2CDZA 4OTHA 4E93A 5J1WA 2VWVA 1W7HA 1GZKA 3HYHA 4EHZA 3LXNA 3CIKA 4NKAA 3CKXA 1PMNA 4QMWA 1ZMWA 4EZ5A 4G31A 2XM8A 4QMNA 1UU7A 3VBXA 3WF5A 4EKLA 3QRKA 4Y73A 3RK5A 3G15A 1JKLA 4FIFA 1PHKA 3CE3A 3UMWA 1OM1A 4KB8A 1B6CB 5FDXA 5FBOA 3DOGA 4D58A 2QNJA 1KOBA 5EHLA 2UVYA 5HO6A 1LEWA 3A8WA 2RL5A 2V22A 4CRLA 3H9OA 2GFSA 2PL0A 2GCDA 5FQDC 2WQNA 3CD8A 5CU0A 3HAVA 4R78A 5L3AA 2ITXA 3HNGA 2PVKA 1OL7A 4FTQA 3GCPA 4JXFA 3PIYA 3SOAA 4RSSA 4MH7A 4G9RA 5HD4A 2ZV2A 1YHSA 3K5UA 3WF9A 1JAMA 3G9LX 4UWCA 3Q9WA 4JS8A 3PIZA 1OIRA 5DE2A 2XJ2A 4MWHA 4XNEA 4UEUA 4BDJA 3POOA 5E1SA 5CEQA 2CCHA 3LJ0A 5B7VA 3FEGA 4JAJA 4IWQA 3QTUA 4C2WA 3KRLA 3L1SA 1PXKA 4AAAA 2R9SA 3SD0A 3PXKA 2G15A 2JEDA 3EKNA 3QQKA 4FZ7A 5J7HA 1M14A 4OTPA 5HNIX 2OO8X 3Q96A 4W8DA 3I5ZA 4JBQA 5E8WA 5ETAA 3FI8A 4BI1A 5AP2A 3F2RA 1OVEA 4BI2A 3U6HA 3FC2A 2OGVA 2W4KA 1REKA 3MY5A 2R3IA 4RFMA 1PMEA 2J4ZA 3OBGA 5AR4A 3T8OA 1FGKA 3PY1A 3OUNB 5H3QA 4IFCA 3V3VA 3V01A 3F69A 1PXLA 4Y46A 2BFXA 5AA9A 2Z02A 4UV0A 4X3FA 4XG4A 5DBXA 2FGIA 5E7RA 5IUGA 5AV3A 4XG8A 4QYEA 3NUSA 4FV9A 4IM2A 4FV3A 4JBVA 5IA0A 1B38A 4U40A 2RF9A 3T9TA 4IVCA 2XEYA 2F2CB 4LV8A 4F08A 1YHWA 2XA4A 2XNGA 4V0GA 5HVJA 3R7YA 3MFSA 4PP7A 4EJNA 3OT8A 4KSPA 1UKHA 4MQ1A 5EW3A 4S2ZA 3DXQA 4BBFA 1Q97A 2VV9A 4F7NA 4O7LA 1XH6A 2FUMA 2PZ5A 4YSMA 3ZUTA 2EB2A 3NYXA 5BX0A 1W82A 1ZARA 2WQMA 3U4UA 4RX7A 5EW8A 5JFVA 5DRDA 4O2PA 5F20A 2IW8A 3RP9A 5A9UA 1BYGA 3FXWA 5CENA 1PMUA 4GG7A 4LI5A 5AV2A 4FTCA 4ZSJA 2WEIA 1DAWA 4YTIA 3TIYA 3OUKA 4JBPA 3OW4A 2J0IA 3HV6A 5HNGA 2I40A 4IEBA 1J91A 4FTTA 4ZTSA 3O23A 3C5IA 4DCAA 3MWUA 2RGPA 3EQHA 3CY3A 3C4FA 4TYIA 4YJTA 3BWFA 3GOKA 3ZONA 3ZZWA 4UWYA 5JQ8A 3PWDA 5DR6A 1T46A 4I0RA 3DZOA 1KUTA 1TQIA 2FVDA 3Q52A 4K8AA 4KAOA 4KRCA 4A7CA 4C33A 4CCBA 4E5AX 3FLQA 3S1HA 3B8RA 1YKRA 1ZYLA 3QCYA 1EH4A 2CLQA 4AGCA 1VYZA 3JVSA 4ACMA 2B7AA 2YCQA 4OR5A 3P23A 1YHVA 2NPQA 4AZTA 2X7OA 2Y4IB 2XK9A 4HW7A 5CWZA 4FKSA 4NU1A 1NW1A 4TNDA 5BYZA 2XRWA 4AZVA 3ROCA 4DT8A 2F4JA 2WMWA 4EEVA 2A0CX 1PJKA 1KOAA 3WF6A 2KTYA 5EYMA 1HCLA 1J3HA 2UZDA 3U55A 2WTWA 4IVBA 3E3BX 5HCXA 3I6WA 4RC2A 4KUJA 3QUEA 2WTKC 4HGEA 5C27A 3OWJA 3LCSA 4P5ZA 1H27A 3QKLA 3CQEA 3RWPA 1CSNA 4BRXA 4MXOA 4LOPA 5HG8A 3IW5A 4FK3A 5F95A 3RAWA 2P0CA 2W1ZA 4D9UA 5EM7A 2WOTA 4QYHA 1OPKA 2IVTA 3PZHA 3TJCA 4X2KA 2W99B 3CEKA 3D5VA 4OLIA 4RX9A 4AT5A 3F6XA 1G8SA 3PFQA 4YTCA 4MD9E 3T3UA 4FSUA 4G16A 2QU6A 2PZPA 1GIJA 4D4VA 2WU6A 5AV4A 3NCGA 4W9WA 4WUNA 2W5HA 4IM3A 2AUHA 4IX4A 3MFRA 4BCPA 2A1AB 3UQCA 1X8BA 3EQGA 4MQ2A 5FM3A 2JGZA 2Z8CA 1WBOA 5K0XA 3BLQA 2PUUA 5K4JA 2VTRA 3MDYA 5A4QA 3GQLA 1G3NA 5BMSA 2ITOA 4NJDA 3N9XA 4YU2A 4F9BA 3NYOA 4WKQA 4XP0A 5T6KA 3UTOA 2YM8A 4V04A 3OY3A 3ZUVA 4X3FC 2P3GX 3DTWA 3QF9A 4HYUA 4R5YA 4M97A 2JFMA 2UW7A 3AQVA 1QPJA 3KGAA 1APME 4O7VA 2JD5A 3PSBA 4X21A 1Q4LA 3KCFA 4EWHA 5IQGA 3EB0A 3MA3A 4CV9A 4C57A 2VNYA 4AGUA 4CXAA 3KRJA 3ZMMA 4AFEA 2BPMA 4I93A 2P4IA 2Z2WA 3F5XA 4IFGA 5DT3A 4AGDA 4DFZE 3UOKA 5KKRC 4L6QA 4O6EA 3P78A 3A7HA 3QLGA 5G6VA 3HEGA 2GHLA 3QTXA 5FDPA 5K5XA 4CNHA 2QURA 5CALA 4XV9A 4YSJA 1JQHA 2WKMA 3ORPA 5J5TA 3F3VA 1VZOA 4X7QA 4O7NA 4CGAA 2R3MA 3QALE 3OF0A 1YXXA 4MXXA 3ELJA 3NX8A 3E63A 5BVDA 2QG7A 3C0HA 4FKPA 4BI0A 4B6LA 3DBFA 5ANKA 4BCMA 3VS0A 5JGDA 5JMSA 5E8YA 4ZJJA 3R8VA 4EKKA 1R78A 3OY1A 1O6LA 3D5XA 3MVLA 2QKRA 1XR1A 2X39A 1YI4A 3E8DA 3OT3A 4FSWA 4PDOA 3C4ZA 4U81A 4BKYA 4AU8A 2H34A 1H1SA 4EBWA 5I3RA 1PF8A 3UQFA 2C6LA 4BTFA 2HW6A 3R73A 4F70A 4BCJA 3R7EA 2O64A 5BUIA 1MRUA 3BHVA 4JRVA 3PXZA 4LRKA 1K3AA 4MX9A 5CY3A 3GC8A 4GIIA 4EHEA 3FLNC 2YAKA 4S32A 2G1TA 4MVFA 3R9DA 4TZRA 1ATPE 3FZRA 1F3MC 4ZSLA 3VUGA 2QHMA 4EBVA 5JGAA 3K5VA 4RVLA 3EFLA 4NW5A 2YHVA 3RHKA 3UYTA 5K5NA 4IMYA 4TYEA 2NNWB 4RRVA 4AACA 3FPQA 4QMUA 2CGXA 4RC4A 4QTDA 3PUPA 2WMXA 3C50A 4L53A 3LXPA 3QCXA 4LL5A 4MK0A 2XNMA 5ANJA 4E6CA 2UZBA 4IZ5A 4F99A 3WE4A 5CXHA 5IDNA 4C4GA 3DXPA 3VS2A 4TL0A 1UNLA 5EHOA 4EYJA 1BL6A 4XMOA 2IZUA 4R7BA 5AADA 3PP1A 4ZS0A 4FL1A 4ALWA 5C03A 3GCSA 2WQBA 4J1RA 2A27A 4ANQA 5LCJA 1Q8UA 3K2LA 4RX5A 5IUIA 4IE9A 1ZYCA 2WU7A 3GENA 4OTWA 5TF9A 3VBYA 5BVNA 4A9UA 5HE0A 4J96A 4FKGA 2BAQA 4M69A 4ZTHA 4ASEA 3HV4A 5CF4A 1UU9A 5A4EA 4EOOA 4FSYA 1ZOGA 4LFIA 4ACCA 4CSVA 4KNBA 4CVAA 4C4EA 2IW6A 2OZAB 2VZ6A 1WFCA 3DY7A 4PDSA 4E73A 3QWJA 1OIUA 4C7TA 3FKNA 3JPVA 2HW7A 3G51A 5KBQA 4CZUA 2R3RA 2W1GA 4ID7A 3H10A 4QT1A 4D2TA 3ZCLA 4EYMA 3R1YA 4BGQA 5BYLA 3O0GA 3W18A 4WSYA 3R2BA 3SRVB 4PNIA 2C1AA 4Z7GA 2WTJA 3EN5A 5L6WL 4DGLC 3SHEA 3TL8A 4U97A 2VWWA 3NGAA 5J9LA 4EH4A 3QL8A 1GY3A 1S9JA 3TM0A 2R3LA 4QYGA 3LM0A 3TG1A 3DQXA 2VX3A 3UNJA 4GEOA 5HICA 5BVOA 4MD8E 4USEA 5AEPA 3FV8A 4JDIA 3LJ2A 4FODA 4JOAA 4MF0A 5HE1A 5CEIA 4EH7A 1OKWA 2XKCA 4HCTA 3PPKA 4GFGA 4FTNA 4O0SA 4YJNA 5FXQA 2IZTA 2WMRA 4GFMA 4R7IA 1OL5A 3MPTA 5CZHA 4BZNA 4CG9A 5FTGA 3TZ8A 1J7IA 4IAAA 4KIKA 5CEKA 2RKUA 4RIXB 2YDJA 4DC2A 1S9IA 1W83A 2BAKA 2OJJA 3PVBA 1PRYA 4MYGA 4EOJA 4BWPA 4GFOA 4YTFA 3W2RA 4ZTMA 4BCHA 3QRTA 1DI9A 4AGWA 4I22A 4RIOA 3COKA 4ANSA 4DFUA 3VHEA 2ZJWA 2BRHA 2OF2A 3QZGA 4L9IA 3HGKA 4D1SA 4RJ8A 4XRJA 4YR8A 1OIQA 4DH3A 4C3PA 4OT5A 4FEUA 3FYJX 4FK6A 5EI2A 2O3PA 3SOCA 3UBDA 4C34A 3UOJA 3NW7A 4GVJA 5D12A 4CZYB 2PHKA 4I94A 3BHYA 4BTMA 4DFYA 2W4OA 5ICPA 5ITAA 3KULB 3RGFA 2ZB1A 4PF4A 3N4UA 4FKWA 2G2FA 5ACKA 5KBRA 3MY1A 4FKJA 2XK8A 4LG4A 2JDTA 4TNBA 4FSTA 4GJ3A 4RJ3A 1OECA 1K9AA 2CKEA 3A7JA 4A06A 4O7WA 2C3JA 4F0FA 5CT7A 5AJQA 4GVAA 4JVGA 3KMWA 1CDKA 4FTJA 3ZYAA 2W4JA 4UMQA 5BNJA 5AUYA 3NNXA 3PVGA 5FG8A 2DWBA 1VR2A 3TJDA 2JC6A 3O7LD 2OJFE 5BVFA 3L9PA 2IZRA 2WAJA 3EH9A 4ASZA 2R3GA 3WILA 2PUIA 3FZTA 4FF8A 3EFWA 3R8MA 4G2FA 4IX6A 3DJ6A 4D2PA 4BZDA 3ZO2A 4O84A 2WMUA 2BMCA 2ITZA 2HCKA 2R3PA 3IDBA 3VJOA 2Z7QA 5HE2A 2YM3A 4ZOGA 2YACA 3QA0A 3I5NA 5GJDA 2UVZA 4IJ9A 4MHAA 4S34A 1H24A 4TY1A 4RLKA 4DAWA 5AAEA 3PRFA 2EB3A 1OGUA 2DUVA 4MNEA 5FBNC 3F88A 3FXXA 3HV7A 3W16A 3POZA 3NPCA 3THBA 1XBCA 3PSDA 3OFMA 3ZRKA 5E8ZA 2PVRA 3HP2A 4E6DA 4E4XA 3VW6A 1WCCA 4BL1A 2RG5A 3EFKA 4QMMA 1Q5KA 2WNTA 5A3XA 2BFYA 3HDMA 3EN9A 4TKSA 3VS1A 3UPZA 4RWIA 5IH5A 4D5KA 2QOIA 5DOSA 5E8UA 5LMKC 4FG9A 1Y57A 3MB7A 3RK7A 4DH5A 3Q9XA 4FTRA 5F1ZA 5FWKK 3BU3A 3DZQA 5B0XA 2V7AA 4YZ9A 1OL6A 5C1QB 4FG8A 3PLAE 2RFEA 4ANMA 1FVVA 1UWHA 4XG6A 2C68A 4PWNA 2BZHB 3JYAA 1WBVA 3P5KA 3V6RA 3ZZEA 2R7BA 3AC5A 2E9OA 4KD1A 5IG1A 4WHZA 3V5PA 2GSFA 4IX3A 4DEGA 3QXPA 2OG8A 2VTSA 4FKQA 2Y4IC 4UMPA 3GU7A 3H9RA 4D5HA 5IQIA 3R7VA 1BL7A 3V5TA 4J97A 5IMEA 3FYKX 1NA7A 2XRUA 2QLUA 2CCIA 4TRLA 2JDVA 4HYHA 3PTGA 4OAVB 4BGGA 4IH8A 4F9AA 4LM5A 4RMZA 4NT4A 4BKJA 1ZZ2A 2B9IA 2PTKA 4U41A 3VS7A 4QPSA 4BF2A 2J5EA 3A7FA 4W4XA 4FX3A 3JY9A 4R5SA 5HD7A 3A62A 4QMXA 4N0SA 4OTIA 3E7OA 4U9AA 5BYYA 3GQIA 2XNOA 3F3UA 1HOWA 2VTQA 3GCVA 5DG5A 4ZZMA 4C4HA 3DBQA 3S2PA 1MUOA 5FGKA 5HTCA 1H0WA 4CEGA 3FI3A 5CXZA 4W8EA 3MTLA 4X0MA 1QPEA 2HZ0A 4GL9A 1Q3WA 3O71A 1UVRA 4QP8A 5FXSA 3I7BA 4FV1A 1P14A 4FVRA 5H8EA 1OPLA 1Q8WA 3QX2A 4H39A 5FM2A 4ZTLA 2NP8A 1M17A 2X81A 3GOPA 3BU6A 3QZFA 5M51A 4B99A 2BKZA 4NCTA 4O22A 4JBOA 2YLFA 3IQ7A 5DT4A 4BCQA 5FUTA 4NM7A 3PP0A 3CP9A 4I0TA 4O0UA 4AZEA 4O0TA 2OJIA 5C4KA 3F3ZA 4L3PA 4X3FB 1UA2A 4UYAA 1V0OA 3L8PA 3LCKA 2CHLA 4C62A 2BRMA 4YLKA 1KWPA 3SRVA 2WQEA 2DYLA 2GS2A 3HECA 3LXKA 2R3NA 5L8JA 4EZ3A 5CASA 4FNXA 4O7RA 3U6IA 4V0GB 3RZBA 2HZ4A 5FTQA 4QOXA 4OT6A 3U9CA 3NAYA 3VO3A 4I6FA 4RJ6A 4Q2AA 3VRZA 3L9LA 5CVFA 5EH0A 3RPSA 4O2ZA 3W8QA 4L3LA 1P4OA 4FT3A 3RK9A 4JNWA 2C3LA 1BUHA 2OH4A 3MY0A 4XP3A 3IPHA 2PZIA 3E87A 3GFEA 3BE9A 3WI6A 4ZLYA 3QGYA 5HNBA 4QO9A 5AA8A 4ACGA 3AT4A 1H26A 5CQUA 3KN6A 1KV1A 3ZRMA 3PG3A 3W8LA 3VBTA 1H28A 2C30A 4K77A 4Q9SA 5LVOA 5HG9A 5CQWA 1TQPA 4GW8A 4BDGA 4D1ZA 2EXEA 2VO0A 2ITWA 2XCHA 3F66A 4NYEA 2YDKA 3DPKA 3GBZA 3A4OX 1U59A 3CY2A 3A7GA 1OL1A 2RFDA 3CR0A 3OTVA 4I5PA 4RZWA 5KX8A 3V5JA 2PMNX 4EHVA 1IA9A 2QODA 2QR8A 4EH8A 1CKPA 2ZV7A 3EN6A 3ANQA 5CNOA 2YWPA 4II5A 2ZM3A 4UZHA 5EOBA 4QD6A 1LP4A 2JIIA 2OICA 3UPXA 3RAHA 4E4LA 4BN1A 4ZZNA 4APPA 4FEQA 3R63A 1YXVA 4FEVA 2W1CA 3IS5A 1XHAA 3D2KA 4NW6A 3CTHA 4G3DA 3T9IA 2CSNA 4C02A 4DTKA 4M68A 3C5UA 5CVHA 2OF4A 3QQUA 3ZLSA 4C35A 1O6KA 4E6AA 3MBLA 4FSRA 1V0PA 1U5RA 1ZWSA 3KXZA 3AT3A 2OH0E 4DGGA 5DLSA 3LM5A 4FKVA 3VS4A 3BEAA 1CM8A 4ITHA 1Q8YA 2V5QA 2XMYA 3RPOA 3CSVA 1TKIA 2XK3A 4Q9ZA 4Q5EA 4AE9A 3EQPA 1W0XC 4RLLA 2VWBA 5CEPA 5KCVA 3R8PA 4MF1A 5IPJA 4FVPA 4EH5A 3NSZA 4WIHA 2G2IA 1YWVA 2RFSA 4XBRA 3RALA 5AFVA 4DEHA 3ODZX 5I9ZA 3QTSA 4EOLA 3ORIA 3JR1A 5AM6A 4OW8A 4GCJA 4JRNA 3QTRA 2W1DA 4AN2A 2CKPA 4CRSA 3O8UA 2QR7A 1WBPA 4NTTA 3SXFA 5D7AA 4C38A 2PUPA 5A4LA 1K2PA 4FKIA 3R8LA 4ALUA 4JG8A 2VRXA 4N70A 3KXGA 5J79A 4UMUA 3GGFA 5M06A 4NCTC 3NYVA 2YCFA 3TWJA 3ORTA 5K4IA 2X6DA 1PXJA 4U5JA 4DGNA 5FP6A 2HWPA 5CYIA 2UW4A 4O7YA 5F4NA 5KZIA 2EUFB 3D83A 1PXMA 2P2HA 1MRVA 3LFBA 3GT8A 4P5QA 4QNAA 4ZSAA 5KO1A 4EZ7A 4ZMEA 2OBJA 2WTCA 5CU2A 1H8FA 1DAYA 3GEQA 1YW2A 4O0VA 1KV2A 4RIYA 5H2UA 2PPQA 5GINE 3RINA 3ATSA 4XEYA 1SNUA 5C8MA 4K33A 4EONA 2PVFA 2ZB0A 4P90A 2C6MA 3A2CA 4QYYA 3QHWA 2H9VA 2REIA 3R04A 4EQCA 3HL7A 1WVYA 3HA6A 1Q3DA 4FIGA 1YOMA 1ZYDA 2UW9A 2VTHA 3HV3A 3Q4CA 1GZNA 3IDCA 1YXTA 5C9CA 2IN6A 4B7TA 3NRMA 4P2KA 3GC7A 3VVHA 5EM5A 5H9BA 3W2OA 2E9VA 2H8HA 4XG9A 3TKUA 3TDWA 3QUPA 4XP2A 2WMSA 2XK7A 3EMGA 3U9NA 2ZYBA 1LR4A 1ZMUA 3PE1A 3QUDA 2R0IA 4D4RA 2YZLA 5LARA 3BGQA 3JS2A 1XWSA 4D55A 2XK4A 4PTEA 1L3RE 2B53A 3ODYX 3LCDA 2FYSA 4HJOA 4E20A 5AIKA 3UDBA 3II5A 4R8QA 2ITTA 3QTIA 4NL0A 3R22A 2IW9A 2OIDA 4G9CA 1GIIA 4D4SA 3QZIA 3EQCA 5GJGA 4BCIA 3KRWA 3FMJA 4JG7A 4M3QA 3KXXA 5AP4A 3FI2A 4WBBB 3O17A 2I0YA 3PIXA 3D14A 4CMOA 2BZKB 3BRBA 3RVGA 4DE4A 2GU8A 4PP9A 4Y85A 4I5CA 1FVRA 3QC9A 4E4NA 1FGIA 2GS6A 2C0IA 5IF1A 2BDWA 4BZOA 4CYIA 4EC8A 3CCNA 3S00A 4Y8DA 3WF8A 4Y83A 1XBBA 3DXNA 1SMHA 4H3QA 5AUVA 3VS6A 4IW0A 2W96B 2SRCA 5C01A 5GZ8A 3TUCA 2BZJA 3O50A 3KKVA 4QTBA 2PVYA 3I6UA 3G33A 2DQ7X 2ITPA 4NM5A 4M14A 2VWIA 1SM2A 3R9NA 4D9TA 2AC5A 4WG4A 1A9UA 3COMA 1U54A 3OC1A 5L2QA 4QMOA 1LUFA 4DYMA 4O1PA 4R3RA 4DBNA 2I7QA 2QOLA 2G9XA 4M69B 5CI7A 4BDFA 1PYEA 2CJMA 3WZUA 3MTFA 4J98A 4X2NA 3NLBA 3G2FA 1R39A 4IAKA 1OUYA 1REJA 3UGCA 4FI1A 4GU6A 5CSXA 3VBQA 5IH4A 2YEXA 1E1VA 1YRPA 2OI4X 2VWUA 3FL5A 3LFEA 4Q5HA 3WF7A 4HZSA 2PMLX 2YJSA 3RI1A 3W55A 3AD4A 2ITUA 4ZAUA 5L2TA 3ZC5A 2XJ1A 2GS7A 2J2IB 5EK7A 5L8LA 1SVGA 3VUIA 1JKKA 2C69A 1HCKA 4E3CA 5AIRA 4MBJA 4QP4A 3VNTA 1OIYA 2C5OA 2R64A 1AGWA 4RVKA 2JKMA 4DEIA 3TEIA 5M08A 2V55A 4FKLA 1GNGA 4ZSGA 5T68A 3LAUA 3Q9YA 3NWWA 3TNPC 3C4XA 4XHKB 5JK3A 3WZKA 1ZAOA 5LOHA 2Z60A 3ZDUA 5CF8A 4IBMA 5FTOA 5AMNA 5ACBC 3MJ2A 3PY3A 3MH3A 4WT6A 1PKGA 1E1XA 1SNXA 2LGCA 3BHTA 4I6QA 4KIKB 2C5YA 3UP7A 3WBLA 1RW8A 3C4EA 4RWJA 1L8TA 1R1WA 2J9MA 4BDIA 4IWOA 4IHPA 3M42A 3DJ7A 4FOCA 4BCKA 3PJ1A 1ZRZA 5LVMA 1IRKA 2WZJA 3DS6A 2OXYA 4HYIA 2XIRA 3KMMA 1F0QA 4JJRA 2X8IA 3ZFXA 3KK9A 3DDQA 4WNOA 4YPDA 4C4IA 4O83A 3D94A 4OTDA 4XX9A 4FSNA 4FTAA 4TN6A 4LOQA 3R30A 4G3FA 3AGMA 4NIFA 2HELA 4UBAA 3ZLWA 3PXYA 4I5MA 4RX8A 4IACA 3REPA 5LWNA 3PZEA 4F7LA 5I3OA 3KXHA 3LQ3A 4EQUA 5EQEA 3VUHA 3V04A 4HNFA 4WOVA 4DEEA 1CTPE 1Y6AA 4CD0A 3SLSA 2UW6A 4EORA 4EK5A 4BYIA 2PMIA 3A61A 3R83A 5HVKA 2V62A 3FHRA 4O7SA 5IQBA 2X2MA 3OMVA 4JG6A 2VO7A 4CFVA 3HZTA 3GFWA 2WMBA 1JBPE 4U7ZA 4BIDA 3ZDIA 4ZXTA 5AR5A 4I6HA 2P33A 5HLPA 4OGRA 2QONA 4NM0A 4AXAA 3IECA 3GC9A 3KXMA 4FTLA 4GYGA 4YNEA 1A06A 3C4CA 4MBIA 3I81A 4FT0A 3GCQA 4PL5A 4PNKA 4KBCA 2OFUA 3FQEA 1H0VA 4F1OA 4U0IA 3SXSA 1GIHA 5DEYA 3LCOA 2H6DA 2QOFA 3PPJA 3G0EA 3PXQA 3IONA 4O21A 4ZEGA 3RCDA 3WE8A 5DN3A 3OP5A 5EKNA 4EH9A 3Q4TA 2XS0A 4NK9A 5CSVA 3R0TA 4TTHB 2IPXA 3V51A 4BYJA 4FE2A 3Q2MA 3AD5A 3ZLXA 2B9JA 3VJNA 1BLXA 5CEOA 1XH9A 5KHWA 4K11A 4O86A 2Z7RA 2ONLA 4HOKA 5DHJA 3I7CA 4GV1A 4ZY5A 4O81A 3UO4A 3QRJA 4MNEB 3IG7A 4CFWA 3OD6X 1ZYJA 4RFYA 4QYFA 1BI8A 1Y8YA 3HP5A 1Z5MA 2ZDTA 2XIKA 4YC8A 5EYKA 3WIKA 2BROA 4XLIA 3FDNA 2G01A 4CMUA 3GU5A 2QCSA 4U3ZA 4ZS4A 2JAMA 2UZOA 3TNQB 2F7XE 1YOJA 3PYYA 3R1NA 1WVWA 2IZSA 3QQHA 5HG7A 1M7NA 4BDKA 4E4MA 3K3IA 3OOMA 3DAJA 2WQOA 3M11A 3QAME 4NH1A 4MKCA 2VD5A 4FL2A 4DEDA 4Z55A 2CNQA 3ROYA 4ZJIA 3EFJA 4IX5A 3ZLYA 4F9WA 3ATTA 5LMBA 4F09A 4NKSA 3BYVA 4F7JA 1DS5A 3I60A 4K1BA 4AA0A 2ITVA 3KY2A 3OTUA 3U8WA 3KK8A 3VS5A 4F1TA 5EI8A 2GNLA 3I4BA 2LAVA 3FMDA 4EH2A 4QQCA 4M7IA 2RG6A 2VO6A 4ITJA 4Y5QA 5KNJA 2KULA 5TT7A 3LXLA 4XG2A 5FXRA 2GPHA 4GS6A 4IB5A 4L7SA 5TR6A 3W2SA 4BDHA 3DTCA 3SW4A 4E8AA 5JH6A 1NVSA 3PXRA 3DFCB 4XJ0A 3QQJA 1GOLA 3HAMA 5E9EA 1W98A 2PE2A 4XS2A 3CTJA 3KVWA 2A19B 3OXTA 3TKIA 3FZSA 3QQLA 4EC9A 4MD7E 5I4NA 2ZAZA 5KMLA 3ZUUA 3JUHA 5L4QA 2CLXA 2PVLA 2VTMA 1IEPA 4FTIA 2W0JA 3E3PA 3O8TA 3R00A 4N6YA 5FRIA 3BBWA 3WZDA 3OOGA 4G1WA 3P86A 4G3CA 1JWHA 2B9FA 4L42A 3AC2A 5LXMA 4F4PA 2YCRA 2QOHA 4AW2A 4ERKA 4HVDA 2WTVA 4AW5A 1MQBA 2WTDA 2QC6A 2UW5A 5HBJA 2RSVA 2CGVA 2DS1A 4RC3A 4JIAA 5DEWA 5L6OA 3HA8A 2HY81 3ZBXA 3AG9A 5HX6A 3NW5A 2R3OA 4XRLA 3UZTA 1H25A 1BKXA 3PVWA 3TIZA 4WSQA 4BDAA 5CSWA 2WHBA 4FT7A 2PY3A 3HMNA 4PRJA 5IMXA 3DLSA 2OJGA 3DDPA 3GXLA 4FNYA 3DK7A 3SW7A 5GIOE 2XYNA 2JKKA 4FTUA 3GCUA 3A99A 3F82A 3LFAA 3ORNA 3WZJA 2YISA 4JDKA 4YZDA 5GZ9A 2OK1A 5IUHA 3E88A 3ORMA 4QP6A 4DH8A 5IA1A 4IC7A 4W4WA 3GP0A 4FUYA 3R6XA 4EWQA 5HTIA 3F61A 3BLHA 3GU4A 4EUTA 1FMOE 4LMUA 5DH3A 3ENHA 5ANGA 4JR3A 1KE9A 3A8XA 3KREA 2B9HA 2QI8A 5M56A 3QXOA 5J9ZA 3PXFA 4QQ5A 5AX9A 2PVJA 2O5KA 2B54A 5LVPA 3ZXTA 2I6LA 3VUDA 2XBAA 1E9HA 3FXZA 2ITYA 4PTGA 4W9XA 4A4LA 2ERKA 2XUUA 3VBWA 5HESA 5LVNA 1YI3A 3ZEWA 5K9IA 4B9DA 1JSTA 4QMLA 2PE1A 4IB0A 5AV1A 3VWAA 3BBTB 4F6SA 5JFWA 3ZO1A 2YFXA 4U3YA 4M0ZA 3HRFA 3RNIA 1QCFA 3O51A 2BIYA 1YVJA 4KRDA 3L9MA 4CKRA 1J7LA 5CANA 3UVRA 2PWLA 4YHTA 4XOYA 4Z16A 3RJCA 5IQDA 3AD6A 2XCKA 2FB8A 3NEWA 3U51A 3VW8A 3EZVA 1H1PA 2XK6A 3FLZA 4APCA 3BKBA 3HKOA 5B2LA 1Q8TA 3GB2A 2HWOA 3COIA 3TKHA 3F2AA 2EU9A 3C9WA 3EOCA 5DT0A 4ZTRA 5BVWA 2YIWA 3DKGA 2VO3A 3O8PA 3JXWA 3DB8A 1WMKA 3U54A 1UNHA 3Q6WA 4UB7A 3BYMA 3QFVA 4CKIA 4PPAA 4ZIMA 5M53A 4PY1A 4EOIA 2Y9QA 2BVAA 3B2WA 5EDRA 1JPAA 1BI7A 1Q8ZA 3I0OA 3LFSA 3QBNA 4IAYA 5EDQA 4FUXA 1ZOHA 3FZPA 4RQKA 3TCPA 3CGOA 2JITA 4U80A 3LQ8A 2F57A 4NFNA 5ANEA 1WBWA 1VEBA 4MXAA 4DH1A 3Q60A 4LGGA 3OCTA 3LLAA 3ET7A 4LYNA 2XJ0A 3TV7A 4FIEA 3H3CA 3R8ZA 3WIGA 4OAUC 3HUCA 3ZFYA 4X3JA 3MIAA 4GKIA 2BHEA 5J87A 1Y6BA 4L43A 1J1CA 5DGZA 3FMNA 3FBVA 4FT5A 3NIEA 3QD4A 4C4JA 5B2MA 4GK4A 5AP5A 2ERZE 1PXIA 4G3EA 3UG2A 3OXZA 1G8AA 2WD1A 2R3JA 2JKOA 4QMQA 1UU3A 3BWJA 3UC3A 1H00A 1O6YA 3AXWA 3RWQA 4AN3A 3NNVA 1P2AA 4EOMA 4DBXA 4NEUA 2QOBA 4DEBA 5A54A 1LPUA 4JR7A 4O7ZA 4F0GA 2HOGA 2Y6OA 2WEVA 2X9FA 2WGJA 3OHTA 4TWCA 4U45A 4IZ7A 5AR7A 5JZNA 4H58A 3GNIB 4RGJA 4M66A 1R0PA 3WZEA 3SX9A 3MPAA 4I23A 1Q99A 3FLSA 3TN8A 1XH8A 2PUNA 3R2YA 4RIYB 2HYYA 3BV3A 3IOKA 4WA9A 4QPMA 4FA2A 2QO7A 4AW1A 4UN0C 4Z3VA 2GNIA 1H1RA 1ZZLA 2IVVA 2E9UA 4YTHA 5KHXA 3MVJA 2YAAA 3G5DA 5GZAA 4GMYA 4EL9A 4J8MA 3QU0A 4MAOA 4L52A 3UO5A 3IOPA 4FV2A 5IA3A 1OZ1A 2PZYA 3PDTA 5HQ0A 2C6EA 2WB8A 4AQCA 2R3HA 4AZSA 4M67A 1WBNA 2XIZA 3DK6A 3R21A 3R7OA 3RZFA 5CVGA 4L3JA 2X1NA 3DKOA 2GTMA 3HMOA 4FNWA 3FSFA 1PYXA 4C0TA 4WO5A 5TOZA 3MVMA 2PE0A 2ZM4A 2B52A 3C1XA 3Q5IA 4FKOA 4QRCA 4RG0A 3BIZA 3EIDA 2XNPA 3Q04A 5CI6A 4A9TA 4AOTA 5IA2A 4FKTA 4WUAA 5EM8A 4P4CA 3RBWA 2VU3A 2CGWA 3LCTA 4CFNA 3R02A 3ZEPA 3MV5A 3FLYA 3OWPA 3ZRLA 2I0VA 2CKOA 4IDTA 3MH2A 4ZMFA 3UOHA 4KINA 2GDOA 5L2SA 4BR3A 3Q2JA 3O2MA 1JSVA 4IAFA 5CZIA 3C7QA 5K3YA 2BTSA 3BYUA 3OCBA 1XO2B 3V5WA 3LLTA 1OKVA 4BHNA 1M2PA 1SVEA 3B8QA 3KMUA 4BHZA 3Q5ZA 4LMNA 5CEMA 4O6LA 3U87A 4XG3A 4C58A 4EOKA 3W32A 3ZBFA 4PPBA 4BDCA 3P79A 3F3WA 3M2WA 2ZVAA 4YHJA 2QU5A 5E8XA 5HBHA 5JRQA 2IG7A 3FMKA 3SAYA 4LUDA 5E91A 3OXIA 4CFXA 4WNMA 4QPAA 3LQ5A 3MH0A 1Q61A 4FGRA 2C6DA 5DPVA 5M4UA 3TV6A 4IADA 3S0OA 2VUWA 5AUWA 2JLDA 4IANA 4D28A 5HLWA 1U54B 5JFSA 4I20A 4HCVA 4ZZOA 1Y8GA 1PXOA 2R4BA 2Z7LA 4DHFA 2BRNA 4G5JA 3LMGA 4EOSA 4D2RA 2WOUA 1NVRA 3DK3A 2X4FA 3I1AA 2AC3A 4R77A 4A07A 3FQHA 2BILB 4UXLA 4YJUA 2OW3A 1KE8A 4P7EA 5AR2A 2X2KA 3UNZA 3P08A 4RVTA 5JKGA 3RNYA 3KB7A 2XNNA 4FTOA 4IB1A 3NUXA 4L68A 3BGPA 5TKDA 2FSOX 3VBVA 4HCUA 5BUJA 2B0QA 3TUDA 4PMTA 2O2UA 2YN8A 4R3CA 5AV0A 3QD3A 3EQRA 3GI3A 1LEZA 5I9YA 2XYUA 2R5TA 1RE8A 5FEEA 5M44A 5CSPA 5JGBA 4M15A 3WARA 1R0EA 4J53A 4AFJA 3BCEA 3EQFA 4IWPA 1ERKA 3Q4UA 2VTPA 3V5LA 3DLZA 4FKRA 1IASA 4WRSA 2C6TA 4KIQA 3D5UA 2VAGA 2CGUA 4ANNA 5J1VA 3WYXA 2WIPA 4AUAA 4PMSA 4DITA 2ZDUA 3CQWA 4AZFA 1UU8A 2C6IA 1MP8A 1Z57A 2OFVA 5JFXA 4FEWA 5CNNA 4CLIA 4L44A 2HY0A 3CBLA 3BHUA 3H9FA 3E5AA 5ANDA 2J6MA 5ETIA 1AQ1A 4I92A 3TACA 1T45A 4KA3A 4DTAA 3Q9ZA 4FIJA 2C47A 1SZMA 2FO0A 4XBUA 3MYGA 4YBKA 5HLNA 2PULA 2B1PA 3F5GA 3F7ZA 1YXSA 3D2IA 4FTKA 4W4VA 2XM9A 1OITA 2J90A 3IW7A 3NUYA 5EQYA 2JKQA 3DQWA 3VRYA 2E2BA 1W84A 3LJ1A 4B4LA 4HVHA 4BWXA 3PA5A 5JSMA 1PKDA 2ETKA 4TT7A 5CT0A 3UVPA 4DFLA 3EZRA 2UVXA 4NIFB 1RJBA 2WTIA 3K3JA 2W7XA 4XV1A 4RJ7A 4EK3A 5HU9A 5HTBA 3I0QA 2VTOA 5DRBA 3U4WA 4HGLA 3G90X 5HE3A 4BCGA 1JNKA 4RQVA 5AUUA 2YM7A 3A7IA 3EJ1A 4WRGA 1H1QA 3H4JA 2BKKA 3QA8A 4AOJA 4AZWA 2YM6A 4FICA 1R3CA 3P7AA 5DMZA 3TNWA 2VX0A 1GZ8A 5AP3A 2CN5A 3FKLA 4BKZA 2NRUA 2QVSE 2WXVA 3GU6A 3HUBA 4JX3A 4MXZA 4YZCA 5GNKA 3SXRA 3R9RA 2WMTA 4D1XA 3KQ7A 4GUEA 4UWBA 4BDDA 2QO2A 2VTLA 2JIUA 2Q0BA 3PA4A 2OSCA 3MJ1A 3R71A 4X6RA 4PMMA 5DA3A 4FOBA 5FP5A 3FMHA 3D5WA 4UALA 4J52A 3NCZA 5CSHA 3S95A 5EHYA 3GUBA 2ZM1A 2UZUE 2BDJA 2QOCA 3E64A 3EQDA 3R8UA 3FPMA 4CFMA 4YC3A 2Y0AA 4FZ6A 4FG7A 3G6GA 3GU8A 5EDPA 2IVUA 2W9ZB 3Q32A 4IZAA 5HGIA 2WMQA 1W8CA 4S30A 4C61A 2B4SB 1IR3A 2V0DA 3FWQA 2X6EA 1J7UA 2OIBA 3VHKA 2BTRA 4QQTA 3HRBA 2A2AA 5BVKA 3EHAA 3KRXA 4OBOA 4YJRA 2Y8OA 3NNUA 3TNIA 2CMWA 2W06A 4EOQA 4ZJVA 4H1JA 4BCFA 1CMKE 3TTJA 4L00A 5AR3A 5EYDA 4AE6A 2ESMA 2C0TA 3QD0A 3VC4A 4WG5A 2VGPA 3QTWA 1JLUE 1Y91A 5CLPA 2F9GA 4RA5A 2XVDA 5EG3A 2XBJA 4I24A 4I21A 4JDHA 5CAVA 1NVQA 4RPVA 2W1IA 5CTPA 5HHWA 4G6NA 3RPRA 4YPSA 3UMXA 2C3IB 3UZPA 4YO4A 3QHRA 2BCJA 2X8DA 3GVUA 1YI6A 3FZOA 4D2SA 3L8SA 2YERA 3QTQA 4BBEA 5AAGA 2EWAA 4FV6A 4NJ3A 4DN5A 3CS9A 2ETRA 3TT0A 4H05A 3UIBA 5FD2A 3ZM9A 3VQHA 4GSBA 1WBSA 4ERWA 1MRYA 4TYHA 4L45A 2R2PA 3IW8A 4KKHA 4R1YA 4K6ZA 2UUEA 1YDRE 3LIJA 3W2PA 4F6UA 4TW9A 3SA0A 4CT2A 2XB7A 3L8VA 4DINA 2GQGA 4FL3A 2JDSA 3OW3A 4IDVA 3CC6A 3BE2A 3FMLA 4I41A 4ONAA 2NO3A 2X7GA 3EQBA 3KFAA 3UODA 4RWLA 4B0GA 5J95A 3LVPA 3ALNA 2QOQA 5FLFA 4HNIA 3D15A 3PSCA 3Q53A 4BWKA 5HZNA 3ZXZA 1OB3A 5FEDA 2R0UA 3LFQA 2HZNA 2YM4A 4MEDA 3WOWA 3DBDA 4I1ZA 4YJPA 3P9JA 2YCSA 4FZAB 3RM7A 5L2WA 2UW3A 5JT2A 5A6NA 2XIXA 5B2KA 3DT1A 3BGZA 2C4GA 5CAQA 2X0GA 5IISA 4O0RA 2WELA 3C4WA 5D10A 5AP0A 5AP6A 2WIHA 2YJRA 4AA4A 4PUZA 3V8SA 3ZSGA 3ZS5A 4DLIA 4LGDA 4GU9A 3MGYA 2C6KA 3IK3A 3NUNA 5D7VA 3TZ9A 2VWXA 4F1MA 3IKAA 4ITIA 2JBPA 3H0ZA 4PV0A 3D7TB 2Z7SA 3DFAA 2A4LA 4X2FA 3R9OA 4FBXA 4YBJA 4J7BA 1JSUA 1YXUA 2CPKE 4BIEA 3DU8A 3L8XA 4O91A 5IH6A 1FVTA 2C0OA 2YABA 3IO7A 2GQSA 4JLCA 4DG3E 4QMVA 2W1FA 3C51A 3Q3BA 2YIRA 2QD9A 3S4QA 5BMMA 3PJCA 1PXNA 4ZTQA 4QTCA 1FINA 4D0WA 2HXQA 3VS3A 1GZOA 4U8ZA 3UIMA 1YDTE 4OBQA 4CYJA 4KBKA 1B39A 4XYFA 2QG5A 3LKMA 3QCQA 3KC3A 4D4YA 2R7IA 3KF7A 2P2IA 4CZTA 4USFA 2HK5A
chains in the Genus database with same CATH superfamily
5ANOA 3B2TA 3AKKA 4CCUA 3ZO3A 2G2HA 2UW0A 3LZBA 4FIHA 4C37A 3LE6A 5A4CA 2BIKB 5DWRA 3RCJA 5LWMA 1UV5A 4NTSA 4QMZA 2UW8A 4L46A 3WYYA 5E8SA 1TVOA 4M84A 4WNKA 4EI4A 2QOKA 4KABA 4IJPA 3R7UA 1ND4A 3UZRA 1YOLA 3TDVA 1AD5A 4CTCA 5ETCA 5IEVA 2VTIA 4YZMA 3DGKA 2JDRA 4GK3A 4X2GA 2IWIA 4HPUE 5J8IA 4GYIA 3UVQA 5DVRA 4XOZA 3TZ7A 4AXFA 3BLRA 1ZY5A 5L2IA 4YUQA 5IA4A 4JI9A 4PTCA 3NYNA 2J0LA 4O4BB 3VUMA 5LVLA 5M07A 4OBPA 5M55A 1YWNA 3COHA 3CJFA 3NAXA 4HVGA 3O5AA 3OVVA 3EL8A 4ZTNA 3UNKA 4NSTA 4O38A 5AR8A 4ZY6A 4B8LA 4DEAA 3DCVA 5M09A 3LHJA 3E8EA 2FSMX 5JEBA 5AP7A 3AMBA 4TXCA 3ZOSA 3AC8A 3AOXA 3MFTA 5EOLA 4WNPA 2O63A 3MFUA 4KS7A 3VUTA 4DGMA 4IVDA 2GNJA 3DA6A 5EI6A 3ZSHA 4AT4A 1M7QA 2ZV9A 3DNEA 3LFFA 4TYGA 4GIHA 5IU2A 4ZSEA 4RJ4A 3PPZA 5EYCA 5C4LA 2VTJA 4JQ7A 1Z9XA 4MNFA 3UP2A 4J8NA 2YLEA 4PQNA 1NY3A 1VYWA 4U44A 1OPJA 2BHHA 3TUBA 4IQ6A 5GIPE 4JAIA 2O8YA 1H07A 5BQ0A 1KSWA 2WMAA 4IIRA 4AG8A 4BFMA 3R1QA 2YIYA 4LQMA 5HX8A 2VGOA 4C59A 5K0KA 3KF4A 1OBGA 3V6SA 5I5ZA 5M4IA 3KEXA 3PJ3A 2W9FB 4CV8A 2HIWA 1QPCA 1G5SA 3NUAA 3LMHA 3MIYA 5T3QA 3KA0A 2J5FA 3FKOA 3MI9A 4HVSA 4YZBA 2OZOA 4Y95A 3O7LB 2GTNA 2Y6MA 3QGWA 4LUEA 4CTBA 4UMTA 3ERKA 3U6JA 2FSTX 4RIWA 4BCNA 3E8NA 4ZK5A 4YJSA 2JAVA 3CTQA 4NUSA 4RZVA 4EHGA 3VUKA 3R28A 2BRGA 1CKIA 4DH7A 1M2RA 3FMMA 1P4FA 4GT4A 3CKWA 4AWIA 5D11A 4EK6A 3MH1A 4G6OA 3DKFA 2PVNA 4FSMA 5TO8A 4F9CA 2PYWA 5HIBA 3W10A 2C1BA 1A48A 4WBOA 3F5UA 2C3KA 2XZSA 3ALOA 3F2NA 4CG8A 1MQ4A 2GFCA 2CNUA 2W05A 4FSQA 4ANBA 5A4TA 3CPBA 3P0MA 3QQFA 3QYZA 5DI1A 4QMYA 4USDA 3UQGA 5JZJA 1YWRA 5IQEA 2UZVA 3N4TA 3MPMA 3FQSA 4G34A 3DJ5A 5DIAA 4MXCA 3DBCA 3HRCA 2J0KA 4YJVA 4EK4A 4MTAA 1NT2A 1XH7A 5BUEA 3MN3A 5EM6A 2W5AA 4Y72A 2ZMCA 4PL4A 5KMOA 2YDIA 4GK2A 3AC4A 2AYPA 2WMVA 4H1MA 4QNYA 3HMIA 1XJDA 4H3BA 3EKKA 4E5WA 2R3FA 3SDJA 4E1ZA 3LFDA 3IGGA 4J95A 3FY0A 2HAKA 4LGHA 1QPDA 3PVUA 3R01A 4YLJA 4YJOA 1J1BA 1OL2A 3A60A 1FBNA 5DYJA 4YO6A 4U6RA 1PMVA 2PSQA 3QTZA 3ULIA 2EXMA 4BBMA 2XIYA 2VNWA 4U79A 2GNGA 3TZMA 4JQ8A 3QQGA 5KMIA 4FYNA 3BYOA 4UYNA 1FPUA 4CLJA 3R7IA 2X2LA 1QMZA 2XEZA 4O27B 1U5QA 1V0BA 3EN7A 3IGOA 4JT3A 2QQ7A 5I9WA 4D0XA 4G17A 1V1KA 4C3RA 3F7WA 4QTAA 4DG0E 4F0IA 5L6PA 3OCGA 5FEQA 1JOWB 5DR9A 2WPAA 4C3FA 1OMWA 3NDMA 4HPTE 3D7TA 1OBDA 2OJ9A 3IDPA 4A9SA 4ANLA 3S3IA 4GT5A 4BVUA 5D9HA 2Q83A 4DG2E 4UXQA 1OI9A 2EVAA 4R6VA 4TPTA 2C5NA 3Q6UA 4UZDA 4FTMA 2C5VA 4IB3A 1TQMA 5AUTA 1CKJA 4FR4A 4QTEA 4N57A 3A4PA 2VTAA 2X4ZA 2YZAA 5IZFA 5CU6A 1JKSA 3G0FA 1JKTA 4IM0A 5EFQA 4AX8A 3NVKI 3KCKA 4Z9LA 5C8NA 2XKEA 2I1MA 3NR9A 4ZP5A 5JRSA 4B8MA 5EKOA 2IVSA 3H0YA 4QMSA 1VJYA 1RDQE 3RM6A 2JBOA 4G6LA 4YLLA 3ZO4A 2ONLC 3FZ1A 4YGAA 3F3TA 1P5EA 1FQ1B 4KIPA 3AT2A 5HCZA 5LQFA 3HLLA 3QLFA 2J0JA 2X7FA 2PU8A 4FKUA 2GHGA 3RTPA 3SGCA 3BU5A 4FVQA 4OTRA 4LRJA 2NRYA 3FY2A 4FMQA 1W2DA 5F94A 5C26A 3AC3A 3MSSA 4AF3A 3V8WA 3TTIA 5CF5A 4O7TA 4U42A 4ZLZA 3C13A 2YA9A 4EJ7A 1ST4A 1OKZA 5HG5A 4FGBA 5CU3A 5HVYA 1Q41A 2QHNA 3BYSA 4E6QA 3ZC6A 3ACKA 5HOAA 4JQEA 5J7BA 3CQUA 4KKEA 3BEGA 4GG5A 5CU4A 3HMMA 4QMPA 4WD5A 3R9HA 3QZHA 4GRBA 4L8MA 4FZDB 5IEYA 3KL8A 2EXCX 4HGSA 3MA6A 4KS8A 3VULA 3W2QA 4UY9A 5LMKA 2R3KA 3IW6A 4F64A 4K18A 2ZOQA 3KVXA 3TV4A 1IAJA 1FOTA 3QRIA 3JY0A 5L8KA 3FE3A 4QP3A 4E5BA 5HO7A 3NUUA 4ENYA 2PVMA 2FH9A 2I0HA 4MBLA 4EK8A 4DT9A 4JDJA 3UDSA 4IC8A 3C0GA 4NWMA 4BDBA 3OS3A 4M12A 3LPBA 2UZEA 4DFXE 4HZRA 4DTBA 3TI1A 3E7VA 1TZDA 3VIDA 5IQAA 3N51A 2UV2A 4V01A 2J50A 2CNVA 5AAFA 2BZIB 3DAKA 4QP9A 3DNDA 1XKKA 3QX4A 5E8TA 1VLRA 2OIQA 4XCUA 2CKQA 3W1FA 1M52A 3UO6A 4W4YA 1FMKA 3ENMA 4O96A 5IA5A 3W0OA 3NZ0A 2V7OA 4A9YA 3FL4A 4LL0A 4BC6A 3OEFX 4BIBA 3QYWA 4K0YA 4FV5A 3P7BA 4O0YA 3FMEA 4NFMA 4AT3A 1KE7A 4EUUA 3EWHA 3RPYA 3BELA 4GT3A 4R3PA 4DFNA 5JQ5A 4EOPA 3R7GA 1ZYSA 4R7HA 3BQCA 2VN9A 2FA2A 4C8BA 4KIOA 1YDSE 2ETMA 3FC1X 4O0XA 4S33A 4H36A 5AUZA 3BV2A 5CAUA 4AAYA 3MESA 5IKWA 5HO8A 1ZOEA 4PPCA 1URWA 2RFNA 4JX7A 3ZH8A 1STCE 4IXPA 2OXXA 3I79A 3ZSIA 4F63A 3SC1A 4YMJA 4FT9A 2BRBA 3O96A 4AN9A 3PRIA 2C6OA 3PE2A 4OTFA 1UNGA 2ITQA 4FEXA 3QKKA 4LV5A 5AX3A 4DFBA 1U46A 3AMAA 5IDPA 3EQIA 2YIQA 4I5HA 1QL6A 5H8BA 5M57A 2J0MB 2Q0NA 5M4FA 3LOKA 5HIDA 3SG8A 2UZWE 3DKCA 1I09A 3Q4ZA 5HU3A 4FV4A 4N4SA 1DI8A 1OUKA 4YURA 3K54A 3QD2B 5GJFA 5I9VA 2HENA 2J51A 3W33A 5AP1A 3VF8A 1H08A 1PXPA 2E9PA 2F2UA 2W5BA 2WFYA 3VF9A 4BB4A 4F65A 3NMUF 5M4CA 5I9XA 3KXNA 4PL3A 3NVMB 4RVMA 3T3VA 3ZFMA 3N4VA 3RHXA 3ZTXA 2QLQA 2BDFA 4BICA 5G1XA 4GKHA 2RIOA 3ANRA 3QC4A 4FV7A 4ASDA 2X8EA 4TWNA 4BJJB 3ACJA 3ULZA 4BY9E 3FLWA 3EYGA 3V5QA 2XF0A 2YWVA 3KU2A 4QP7A 2QOOA 4BDEA 1F5QA 4YNOA 3KN5A 4OTGA 2XNBA 3D9VA 4HGTA 3OG7A 3PLSA 3UIUA 5EW9A 4AW0A 5BPYA 5KMJA 1UKIA 3SQQA 4QP1A 4TYHB 2Y7JA 5CS6A 3D0EA 1M2QA 2PVHA 1W2CA 2PK9A 3DV3A 2BAJA 3D7ZA 4RWKA 3UE4A 3UIXA 4ZLOA 5A6OA 4S31A 1O9UA 2O0UA 4AS0A 4E26A 3FUPA 3F9NA 4IVAA 3AMYA 5CX9A 2E9NA 5HI2A 3UG1A 2GNFA 2PZRA 3E92A 4FZFB 2FSLX 4I0SA 3UYSA 1IA8A 2HXLA 2GQRA 3BPRA 5D41A 5CAPA 5IEXA 4NM3A 5KMKA 4DA5A 3EN4A 3PY0A 5I9UA 4QP2A 2XKDA 3HVCA 1WVXA 1H01A 2VWZA 2I0EA 1GJOA 3ETAA 3LFCA 2P55A 2JDOA 4BTJA 4YHFA 4EH3A 1OKYA 4ARKA 4KSQA 3FHIA 4PDPA 5ETFA 2OWBA 4N6ZA 4YP8A 4XV2A 3BX5A 3ITZA 4LRMA 3VQUA 2YITA 1WAKA 4CQGA 4DF3A 2UZNA 3PWYA 2WTKB 3H30A 3HMPA 5E92A 5AWMA 4TWOA 3P1AA 3QWKA 4F9YA 3NNWA 3LFNA 5HBEA 4GUBA 4G5PA 5A14A 1SYKA 3MS9A 1ZLTA 2ITNA 2UZTA 3OROA 3QCSA 4AXDA 4FYOA 4Z7HA 3UC4A 5CAOA 3V8TA 3NW6A 4FV0A 3RAKA 3G9NA 4BGHA 4V05A 4TYJA 5HIEA 4Y5HA 4FV8A 4L01A 4JMQA 5JN2A 1KE5A 3ORZA 5HEZA 3UOLA 4IAIA 4PDYA 1XQZA 3G6HA 3CPCA 4ACDA 1U4DA 2OU7A 3FJQE 3AGLA 4ACHA 1H1WA 2VX1A 1NXKA 2OZAA 3MB6A 3ZM4A 3KRRA 4CMTA 4D2WA 3ID6C 2W1HA 4AP7A 3TNHA 3HDNA 4UMRA 1IAHA 3E93A 2PMOX 4PMPA 3NS9A 1BX6A 3R1SA 4RA4A 4CFFA 3RAIA 5IQHA 4DLJA 5A46A 3FI4A 5AUXA 3OWKA 4FC0A 4U43A 3VAPA 4OUCA 2OKRA 4H3PA 2W1EA 4YZNA 4J99A 3ORXA 5HKMA 3GC0A 2ZV8A 2R3QA 4ASXA 1RQQA 2YM5A 4RJ5A 3RPVA 5HORA 5J9YA 3JVRA 2X9EA 5KMMA 4ENXA 1XH5A 5GHVA 4J71A 5KKRB 5LJJA 4FNZA 4MWIA 5KZ0A 4FSZA 1Q62A 4L67A 2H96A 3F5PA 2JIVA 5LCKA 2YIXA 2IJMA 1SVHA 4KBAA 3HV5A 1WZYA 3DAEA 3CD3A 4IWDA 4ANOA 4MCVA 4XUFA 2O65A 2GHMA 4WG3A 5EQPA 4DCEA 3DB6A 4NZWB 4CKJA 4UX9A 1JVPP 4RT7A 2W17A 4XV3A 3ZU7A 4OTQA 2ACXA 3BHHA 5DR2A 3LMIA 4GH2A 4KWPA 4EQMA 2F7EE 2UZLA 4F6WA 4ZY4A 2F7ZE 4X2JA 3E62A 5DFPA 3W2CA 4BTKA 5KUPA 1PY5A 3NFGB 3FAAA 4G3GA 4RIXA 5E4HA 3C0IA 2VWYA 3AC1A 4M0YA 1I44A 5KE0A 1ZMVA 4YJQA 2BR1A 3ORLA 4HVIA 5H8GA 3PFYA 1YQJA 3PJ2A 1ZY4A 4I4FA 4R1VA 5E90A 1ZXEA 5HCYA 5BVEA 3OCSA 4O82A 2BUJA 3CXWA 3EYHA 3EL7A 2IO6A 3PA3A 3ORKA 5D1JA 5IQCA 2VTTA 1XBAA 4FIIA 4LOOA 3E8CA 4I4EA 4A4OA 2HZIA 2CN8A 4K2RA 3RMFA 4ORKA 3SV0A 3BZ3A 5F9EA 3QKMA 3D4QA 1PW2A 3MVHA 3LW0A 4RBLA 4A4XA 2JFLA 4GJ2A 3OEZA 3L9NA 3KULA 1XH4A 3BQRA 3IW4A 4YC6A 1DM2A 2Y4PA 2J7TA 4AQKA 4O1OA 3CJGA 2F49A 4IZYA 2ZMDA 4JIKA 4O0WA 1IG1A 4QQJA 3SG9A 4XG7A 5DNRA 2OXDA 3CGFA 3OBJA 3PJ8A 4K9YA 4JL9A 4XLVA 5TE0A 2C5XA 4I3ZA 3SVVA 1WBTA 3NUPA 4CT1A 1URCA 5KMNA 3P7CA 4HYSA 5J5SA 3W0MA 4CQEA 4X6QC 4TWPA 5LMAA 5I0BA 4M8TA 1H4LA 2VTNA 2XNEA 3TXOA 3RKBA 4XH6A 2BALA 2OLCA 4C2VA 4AA5A 3VN9A 1KE6A 2XP2A 3OWLA 2WO6A 3P4KA 4PX6A 4CFUA 3BI6A 2B55A 4RIWB 5E1EA 4C36A 4C4FA 2XH5A 4F7SA 5CF6A 4KKGA 3CLYA 4AOIA 4A9RA 4BCOA 2GMXA 4QMTA 3DBEA 2QKWB 4I6BA 4IAZA 4D2VA 3UJGA 4E7WA 3OZ6A 1BMKA 1UWJA 5AM7A 5ANIA 4L7FA 5C8KA 2QO9A 2XKFA 2GNHA 5IQFA 3PG1A 1Q24A 3MW1A 4ALVA 3M1SA 3NIZA 4EH6A 4MXYA 4M13A 3HX4A 3QRUA 5E8VA 1GAGA 3ZHPC 3FSKA 4DGOA 3SKCA 4RFZA 2CDZA 4OTHA 4E93A 5J1WA 2VWVA 1W7HA 1GZKA 3HYHA 4EHZA 3LXNA 3CIKA 4NKAA 3CKXA 1PMNA 4QMWA 1ZMWA 4EZ5A 4G31A 2XM8A 4QMNA 1UU7A 3VBXA 3WF5A 4EKLA 3QRKA 4Y73A 3RK5A 3G15A 1JKLA 4FIFA 1PHKA 3CE3A 3UMWA 1OM1A 4KB8A 1B6CB 5FDXA 5FBOA 3DOGA 4D58A 2QNJA 1KOBA 5EHLA 2UVYA 5HO6A 1LEWA 3A8WA 2RL5A 2V22A 4CRLA 3H9OA 2GFSA 2PL0A 2GCDA 5FQDC 2WQNA 3CD8A 5CU0A 3HAVA 4R78A 5L3AA 2ITXA 3HNGA 2PVKA 1OL7A 4FTQA 3GCPA 4JXFA 3PIYA 3SOAA 4RSSA 4MH7A 3W0NA 4G9RA 5HD4A 2ZV2A 1YHSA 3K5UA 3WF9A 3W0SA 1JAMA 3G9LX 4UWCA 3Q9WA 4JS8A 3PIZA 1OIRA 5DE2A 2XJ2A 4MWHA 4XNEA 4UEUA 4BDJA 3POOA 5E1SA 5CEQA 2CCHA 3LJ0A 5B7VA 3FEGA 4JAJA 4IWQA 3QTUA 4C2WA 3KRLA 3L1SA 1PXKA 4AAAA 2R9SA 3SD0A 3PXKA 2G15A 2JEDA 3EKNA 3QQKA 4FZ7A 5J7HA 1M14A 4OTPA 5HNIX 2OO8X 3Q96A 4W8DA 3I5ZA 4JBQA 5E8WA 5ETAA 3FI8A 4BI1A 5AP2A 3F2RA 1OVEA 4BI2A 3U6HA 3FC2A 2OGVA 2W4KA 1REKA 3MY5A 2R3IA 4RFMA 1PMEA 2J4ZA 3OBGA 5AR4A 3T8OA 1FGKA 3PY1A 3OUNB 5H3QA 4IFCA 3V3VA 3V01A 3F69A 1PXLA 4Y46A 2BFXA 5AA9A 2Z02A 4UV0A 4X3FA 4XG4A 5DBXA 2FGIA 5E7RA 5IUGA 5AV3A 4XG8A 4QYEA 3NUSA 4FV9A 4IM2A 4FV3A 4JBVA 5IA0A 1B38A 4U40A 2RF9A 3T9TA 4IVCA 2XEYA 2F2CB 4LV8A 4F08A 1YHWA 2XA4A 2XNGA 4V0GA 5HVJA 3R7YA 3MFSA 3NFFB 4PP7A 4EJNA 3OT8A 4KSPA 1UKHA 4MQ1A 5EW3A 4S2ZA 3DXQA 4BBFA 1Q97A 2VV9A 4F7NA 4O7LA 1XH6A 2FUMA 2PZ5A 4YSMA 3ZUTA 2EB2A 3NYXA 5BX0A 1W82A 1ZARA 2WQMA 3U4UA 4RX7A 5EW8A 5JFVA 5DRDA 4O2PA 5F20A 2IW8A 3RP9A 5A9UA 1BYGA 3FXWA 4AXCA 5CENA 1PMUA 4GG7A 4LI5A 5AV2A 4FTCA 4ZSJA 2WEIA 1DAWA 4YTIA 3TIYA 3OUKA 4JBPA 3OW4A 2J0IA 3HV6A 5HNGA 2I40A 4IEBA 1J91A 4FTTA 4ZTSA 3O23A 3C5IA 4DCAA 3MWUA 2RGPA 3EQHA 3CY3A 3C4FA 4TYIA 4YJTA 3BWFA 3GOKA 3ZONA 3ZZWA 4UWYA 5JQ8A 3UDTA 3W0QA 3PWDA 5DR6A 1T46A 4I0RA 3DZOA 1KUTA 1OGYA 4QEBA 1TQIA 2FVDA 3Q52A 4K8AA 4KAOA 4KRCA 4A7CA 4C33A 4CCBA 4E5AX 3FLQA 3S1HA 3B8RA 1YKRA 1ZYLA 3QCYA 1EH4A 2CLQA 4AGCA 1VYZA 3JVSA 4ACMA 2B7AA 2YCQA 4OR5A 3P23A 1YHVA 2NPQA 4AZTA 2X7OA 2Y4IB 2XK9A 4HW7A 5CWZA 4FKSA 4NU1A 1NW1A 4TNDA 5BYZA 2XRWA 4AZVA 3ROCA 4DT8A 2F4JA 2WMWA 4EEVA 2A0CX 1PJKA 4FJVA 1KOAA 3WF6A 2KTYA 5EYMA 1HCLA 1J3HA 2UZDA 3U55A 2WTWA 4IVBA 3E3BX 5HCXA 3I6WA 4RC2A 4KUJA 3QUEA 2WTKC 4HGEA 5C27A 3OWJA 3LCSA 4P5ZA 1H27A 3QKLA 3CQEA 3RWPA 1CSNA 4BRXA 4MXOA 4LOPA 5HG8A 3IW5A 4FK3A 5F95A 3RAWA 2P0CA 2W1ZA 4D9UA 5EM7A 2WOTA 4QYHA 1OPKA 2IVTA 3PZHA 3TJCA 4X2KA 2W99B 3CEKA 3D5VA 4OLIA 4RX9A 4AT5A 3F6XA 1G8SA 3PFQA 4YTCA 4MD9E 3T3UA 4FSUA 4G16A 2QU6A 2PZPA 4DDIA 1GIJA 4D4VA 2WU6A 5AV4A 3NCGA 4W9WA 4WUNA 2W5HA 4IM3A 2AUHA 4IX4A 3MFRA 4BCPA 2A1AB 3UQCA 1X8BA 3EQGA 4MQ2A 5FM3A 2JGZA 2Z8CA 1WBOA 5K0XA 3BLQA 2PUUA 5K4JA 2VTRA 3MDYA 5A4QA 3GQLA 1G3NA 5BMSA 2ITOA 4NJDA 3N9XA 4YU2A 4F9BA 3NYOA 4WKQA 4XP0A 5T6KA 3UTOA 2YM8A 4V04A 3OY3A 3ZUVA 4X3FC 2P3GX 3DTWA 3QF9A 4HYUA 4R5YA 4M97A 2JFMA 2UW7A 3AQVA 1QPJA 3KGAA 1APME 4O7VA 2JD5A 3PSBA 4X21A 1Q4LA 3PUFC 3KCFA 4EWHA 5IQGA 3EB0A 3MA3A 4CV9A 4C57A 2VNYA 4AGUA 4CXAA 3KRJA 3ZMMA 4AFEA 2BPMA 4I93A 2P4IA 2Z2WA 3F5XA 4IFGA 5DT3A 4AGDA 4DFZE 3UOKA 5KKRC 4L6QA 4O6EA 3P78A 3A7HA 3QLGA 5G6VA 3HEGA 2GHLA 3QTXA 5FDPA 5K5XA 2XARA 4CNHA 2QURA 5CALA 4I6LA 4XV9A 4YSJA 1JQHA 2WKMA 3ORPA 5J5TA 3F3VA 1VZOA 4X7QA 4O7NA 4CGAA 2R3MA 3QALE 3OF0A 1YXXA 4MXXA 3ELJA 3NX8A 3E63A 5BVDA 2QG7A 3C0HA 4FKPA 4BI0A 4B6LA 3DBFA 5ANKA 4BCMA 3VS0A 5JGDA 5JMSA 5E8YA 4ZJJA 3R8VA 4EKKA 1R78A 3OY1A 1O6LA 3D5XA 3MVLA 2QKRA 1XR1A 2X39A 1YI4A 3E8DA 3OT3A 4FSWA 4PDOA 3C4ZA 4U81A 4BKYA 4AU8A 2H34A 1H1SA 4EBWA 5I3RA 1PF8A 3UQFA 2C6LA 4BTFA 2HW6A 3R73A 4F70A 4BCJA 3R7EA 2O64A 5BUIA 1MRUA 3BHVA 4JRVA 3PXZA 4LRKA 1K3AA 4MX9A 5CY3A 3GC8A 4GIIA 4EHEA 3FLNC 2YAKA 4S32A 2G1TA 4MVFA 3R9DA 4TZRA 1ATPE 3FZRA 1F3MC 4ZSLA 3VUGA 2QHMA 4EBVA 5JGAA 3K5VA 4RVLA 3EFLA 4NW5A 2YHVA 3RHKA 3UYTA 5K5NA 4IMYA 4TYEA 2NNWB 4RRVA 4AACA 3FPQA 4QMUA 2CGXA 4RC4A 4QTDA 3PUPA 2WMXA 3C50A 4L53A 3LXPA 3QCXA 4LL5A 4MK0A 2XNMA 5ANJA 4E6CA 2UZBA 4IZ5A 4F99A 3WE4A 5CXHA 5IDNA 4C4GA 3DXPA 3VS2A 4TL0A 1UNLA 5EHOA 4EYJA 1BL6A 4XMOA 2IZUA 4R7BA 5AADA 3PP1A 4ZS0A 4FL1A 4ALWA 5C03A 3GCSA 2WQBA 4J1RA 2A27A 4ANQA 5LCJA 1Q8UA 3K2LA 4QDEA 4RX5A 5IUIA 4IE9A 1ZYCA 2WU7A 3GENA 4OTWA 5TF9A 3VBYA 5BVNA 4A9UA 3BL7A 5HE0A 4J96A 4FKGA 2BAQA 4M69A 4ZTHA 4ASEA 3TMOA 3HV4A 5CF4A 1UU9A 5A4EA 4EOOA 4FSYA 1ZOGA 4LFIA 4ACCA 4CSVA 4KNBA 4CVAA 4C4EA 2IW6A 2OZAB 2VZ6A 1WFCA 3DY7A 4PDSA 4E73A 3QWJA 1OIUA 4C7TA 3FKNA 3JPVA 2HW7A 3G51A 5KBQA 4CZUA 2R3RA 2W1GA 4ID7A 3H10A 4QT1A 4D2TA 3ZCLA 4EYMA 3R1YA 4BGQA 5BYLA 3O0GA 3W18A 4WSYA 3R2BA 3SRVB 4PNIA 2C1AA 4Z7GA 2WTJA 3EN5A 5L6WL 4DGLC 3SHEA 3TL8A 4U97A 2VWWA 3NGAA 5J9LA 4EH4A 3QL8A 1GY3A 1S9JA 3TM0A 2R3LA 4QYGA 3LM0A 3TG1A 3DQXA 2VX3A 3UNJA 4GEOA 5HICA 5BVOA 4MD8E 4USEA 5AEPA 3FV8A 4JDIA 3LJ2A 4FODA 4JOAA 4MF0A 5HE1A 5CEIA 4EH7A 1OKWA 2XKCA 4HCTA 3PPKA 4GFGA 4FTNA 4O0SA 4YJNA 5FXQA 1XMMA 2IZTA 2WMRA 4GFMA 4R7IA 1OL5A 3MPTA 5CZHA 4BZNA 4CG9A 5FTGA 3TZ8A 1J7IA 4IAAA 4KIKA 5CEKA 2RKUA 4RIXB 2YDJA 4DC2A 1S9IA 1W83A 2BAKA 2OJJA 3PVBA 1PRYA 4MYGA 4EOJA 4BWPA 4GFOA 4YTFA 3W2RA 4ZTMA 4BCHA 3QRTA 1DI9A 3VONA 4AGWA 4I22A 4RIOA 3COKA 4ANSA 4DFUA 3VHEA 2ZJWA 2BRHA 2OF2A 3QZGA 4L9IA 3HGKA 4D1SA 4RJ8A 4XRJA 4YR8A 1OIQA 4DH3A 4C3PA 4OT5A 4FEUA 3FYJX 4FK6A 5EI2A 2O3PA 3SOCA 3UBDA 4C34A 3UOJA 3NW7A 4GVJA 5D12A 4CZYB 2PHKA 4I94A 3BHYA 4BTMA 4DFYA 2W4OA 5ICPA 5ITAA 3KULB 3RGFA 2ZB1A 4PF4A 3N4UA 4FKWA 2G2FA 5ACKA 5KBRA 3MY1A 4FKJA 2XK8A 4LG4A 2JDTA 4TNBA 4FSTA 4GJ3A 4RJ3A 1OECA 1K9AA 2CKEA 3A7JA 4A06A 4O7WA 2C3JA 4F0FA 5CT7A 5AJQA 4GVAA 4JVGA 4DHIB 3KMWA 1CDKA 4FTJA 3ZYAA 2W4JA 4FRFA 4UMQA 5BNJA 5AUYA 3NNXA 3PVGA 5FG8A 2DWBA 1VR2A 3TJDA 2JC6A 3O7LD 2OJFE 5BVFA 3L9PA 2IZRA 2WAJA 3EH9A 4ASZA 2R3GA 3WILA 2PUIA 3FZTA 4FF8A 3EFWA 3R8MA 4G2FA 4IX6A 3DJ6A 4D2PA 4BZDA 3ZO2A 4O84A 2WMUA 2BMCA 2ITZA 2HCKA 2R3PA 3IDBA 3VJOA 2Z7QA 5HE2A 2YM3A 4ZOGA 2YACA 3QA0A 3I5NA 5GJDA 2UVZA 4IJ9A 4MHAA 4S34A 1H24A 4TY1A 4RLKA 4DAWA 5AAEA 3PRFA 2EB3A 1OGUA 2DUVA 4MNEA 5FBNC 3F88A 3FXXA 3HV7A 3W16A 3POZA 3NPCA 3THBA 1XBCA 3PSDA 3OFMA 3ZRKA 5E8ZA 2PVRA 3HP2A 4E6DA 4E4XA 3VW6A 1WCCA 4BL1A 2RG5A 3EFKA 4QMMA 1Q5KA 2WNTA 5A3XA 2BFYA 3HDMA 3EN9A 4TKSA 3VS1A 3UPZA 4RWIA 5IH5A 4D5KA 2AEGA 2QOIA 5DOSA 5E8UA 5LMKC 4FG9A 1Y57A 3MB7A 3RK7A 4DH5A 3Q9XA 4FTRA 5F1ZA 5FWKK 3BU3A 3DZQA 5B0XA 2V7AA 4YZ9A 1OL6A