4KIOA

Kinase domain mutant of human itk in complex with a covalently-binding inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
265
structure length
240
Chain Sequence
GSVIDPSELTFVQEIGSGLVHLGYWLNKDKVAIKTIEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery of novel irreversible inhibitors of interleukin (IL)-2-inducible tyrosine kinase (Itk) by targeting cysteine 442 in the ATP pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 240
sequence length 265
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kioA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kioA01
2X1NA 4O0WA 3OEFX 4C4IA 4E7WA 4HW7A 3R00A 3HUCA 3TXOA 4MNEB 2REIA 4TYEA 3QLGA 5GJGA 4DEIA 4H3PA 3TDWA 3C4ZA 5CI6A 3VS1A 2VWXA 2YCRA 1XHAA 4MXXA 5DGZA 2EB2A 2OWBA 2QQ7A 4YO6A 4PWNA 4L68A 4CMOA 3LFBA 3B2WA 3F61A 3GOPA 3MPMA 4G34A 2H96A 3TTJA 3C4FA 1RDQE 2E9UA 3RWQA 1IAJA 3RCJA 4QMPA 3NPCA 4ZSJA 5KZIA 4EH2A 5HU9A 4M69B 2IWIA 2A0CX 2O2UA 4BCJA 5JFVA 4YSMA 2PE0A 5LWMA 1SVGA 3PY3A 1KV1A 2OJIA 1G3NA 4GIIA 3CC6A 4RC2A 2R3JA 4HNIA 2OJJA 4OBPA 5CX9A 5ANKA 1OL2A 3UOKA 4QQTA 5LMBA 3I7CA 2PMIA 3QRUA 4GT4A 4KS8A 5B2KA 5KBRA 4BCGA 1WFCA 3R8PA 3P08A 4UXQA 4AZTA 5L8LA 3SV0A 1FBNA 3LXKA 2XK7A 2IW8A 1PMEA 4ZSGA 2QOOA 4IFGA 4MCVA 4G17A 5FBOA 4KAOA 3UIXA 2YCSA 5JZJA 1Q4LA 3DDQA 3ZO4A 3ZTXA 3ELJA 3AOXA 5D12A 4KIPA 2ETRA 3F3VA 2W06A 4IADA 3ROYA 4EZ7A 4D4VA 5JT2A 3QX4A 2XEZA 4QD6A 4AGDA 2C5OA 3CPBA 4H3BA 2PE2A 4PTEA 3D5XA 4TNDA 3QA8A 2PK9A 3FZ1A 1JKSA 1CDKA 2RG6A 3RZBA 2YM7A 1FPUA 3FXWA 3RJCA 3PPKA 4FNZA 4WUAA 3NVKI 4KD1A 2C6EA 3E7OA 4MH7A 2VO7A 1Q62A 3H9RA 4OTDA 4XLIA 3LQ5A 5FUTA 2BDWA 4UMUA 1V1KA 1OKZA 1UKHA 4LG4A 4JDKA 4F63A 4DT9A 4JX3A 3NW7A 4R77A 2W4OA 3WARA 1O9UA 1OL5A 2C69A 2BIKB 2GFCA 2C0OA 2XCKA 3HP5A 3I5ZA 5ETCA 3PPJA 1BL6A 5TT7A 2CNUA 2IVVA 4USEA 5IEVA 2YM4A 4YJPA 4FT5A 3UYTA 4IAFA 3BBWA 4O7YA 5B0XA 3Q9YA 3VUKA 4BIDA 5KKRC 5E91A 2R4BA 3SVVA 5C27A 1M7NA 4XV9A 1K9AA 5JMSA 4C4EA 4EYJA 1QPEA 4GFOA 1XBCA 2V7AA 1DS5A 4GU9A 4ITHA 3EYGA 2QOLA 3EFLA 4L42A 4E3CA 5CVHA 5EG3A 2GCDA 2W96B 4EK4A 2YN8A 3GOKA 2YZAA 4PY1A 4X21A 4GYIA 2C6OA 2G15A 3W8LA 4ASEA 3BRBA 5T68A 2FSTX 1ATPE 2EXEA 2Q0NA 3OW3A 5L4QA 2WNTA 3DBFA 4B7TA 3SW7A 1OZ1A 3MSSA 4AZVA 2A1AB 4U79A 1NVRA 3ORIA 2Z8CA 3V5WA 5C4LA 5EFQA 5IF1A 3DNDA 5AUUA 5IQBA 4NM3A 5ANGA 4CV8A 3CTHA 3SG9A 1ZXEA 2GPHA 4L44A 4HVDA 4KSQA 4FA2A 3MTLA 5DFPA 2B53A 2W1HA 3TNHA 3KRXA 2PUPA 4N0SA 3DQXA 5F95A 5AMNA 3R7IA 2HXLA 2Z2WA 4L8MA 5EI6A 3EFKA 1PMVA 2XP2A 5T3QA 1U54B 5BVOA 1UNLA 3C1XA 1OL7A 3PRIA 2XIXA 4MTAA 4MNFA 1SZMA 3OZ6A 4MX9A 4TZRA 2CHLA 4WSYA 2VO0A 4JIKA 5L2IA 4G6NA 1LP4A 3FSKA 2VZ6A 3R9HA 3DK6A 3ORTA 3SD0A 3ZLSA 4D4SA 2ZYBA 5JRQA 1JBPE 4NSTA 4FZ6A 2WTKB 2GNJA 2WQEA 3EFJA 3ANQA 4HGTA 4QYFA 2PVKA 2B9JA 2QR8A 3DJ7A 2HYYA 4QMNA 2JITA 4MNEA 1M2QA 5LARA 4D0XA 3RPVA 2EXMA 5CENA 1YOLA 4NW6A 3RAWA 1G5SA 5EH0A 3QRIA 4WNKA 4LOQA 5D41A 5KMOA 4YBKA 4ZZNA 3DTCA 4MBLA 5M4UA 4UYAA 3AC2A 5C01A 2W1ZA 3BYSA 4C59A 4C57A 4EQUA 3NYXA 4DE4A 2BVAA 3R6XA 5E8VA 4AZWA 2WTDA 4O22A 4C4FA 4YBJA 5CLPA 3TCPA 2XIRA 5FM2A 4M69A 4C34A 2WTCA 3GCSA 5AV2A 3LCSA 1W84A 5L6OA 2W9ZB 1VYWA 4TTHB 3LAUA 4AAAA 4C2WA 3BYMA 2YLFA 4TWOA 4AS0A 3AMBA 3POOA 3CY2A 4DCEA 4ANQA 5AP5A 3TZ7A 3IS5A 2E9PA 2W05A 2JAMA 2QODA 3DT1A 2RFEA 3EL7A 4FGRA 4IM0A 2CCHA 3HV6A 4YURA 2CCIA 1R3CA 3P7CA 4BGHA 4EQCA 4U97A 3DGKA 5AAGA 3QFVA 5GZ9A 2WQBA 4RQKA 4C35A 2BTRA 3W2CA 3TUDA 1U46A 3KF7A 4ACMA 1TQIA 4JR7A 2JEDA 3Q96A 4RVKA 2C3LA 1NXKA 3K2LA 5FEEA 2CGUA 2XM9A 4BKYA 4HYHA 4FEVA 3PE2A 1FVRA 3TKHA 4O21A 3BEGA 2Z7RA 5HO8A 3PRFA 2J90A 3BHTA 2WKMA 5BMSA 4OLIA 3A4OX 4HVIA 2OFUA 4PPBA 4Y5QA 3PIXA 3VF8A 3OC1A 5EDQA 5CF5A 3PG3A 1ZMWA 3COMA 4G1WA 4IWDA 1CSNA 3ITZA 3COIA 4F6WA 3PE1A 3SLSA 3LCTA 2W5BA 4JIAA 5BVEA 3GUBA 4OTWA 5JGAA 2GNGA 5AP6A 2C30A 4ALUA 3PJ3A 3R2YA 4EOIA 4MXZA 3H30A 4FUXA 4J98A 1H28A 4PX6A 5FDXA 4JDHA 4DFBA 4F6SA 5CAVA 1DAWA 3E87A 4GK4A 3R73A 4YNOA 3GC7A 4N6YA 4ZS0A 4YJNA 1TVOA 3TG1A 3DBCA 4M12A 3CR0A 4QP3A 5EM7A 2ZB0A 4BDGA 2QO2A 4O0SA 1XH8A 2QVSE 4PUZA 3EQHA 2FGIA 4MXAA 3VWAA 3KXGA 4FEXA 2JIIA 4XOYA 4ITJA 5L8JA 3WILA 2HELA 3MH3A 3BLHA 3NUSA 3MVHA 3NW6A 1ZAOA 4AA4A 1UWJA 2KTYA 3QCYA 3U8WA 3R1QA 4FBXA 5HEZA 3IO7A 2IG7A 4BDAA 3ZSGA 5J8IA 5E90A 1PXPA 4YNEA 3OEZA 4YMJA 2ZDUA 1VR2A 4FTKA 2BDFA 4DFLA 1STCE 3C13A 4HZRA 4JDJA 4S33A 4IEBA 4BWXA 3OW4A 2W17A 1VJYA 2OFVA 3A99A 3QTXA 3BQRA 4Y85A 5HOAA 3WF9A 5E8XA 2C6TA 4YTCA 3HA8A 2R3IA 3KMMA 5A4EA 3FQEA 2PVMA 4PNKA 4YZMA 3TZ9A 2VWUA 2CKEA 4TN6A 3EN7A 2X2MA 1GY3A 4EK5A 1U54A 4EOKA 4ANLA 3BKBA 3CQEA 3LJ1A 4FTCA 4X2JA 1B38A 4O7ZA 3QU0A 5CZIA 4IBMA 4RSSA 4FSNA 3TACA 4BHZA 4R7HA 4FTOA 4KS7A 4FIEA 1Y6BA 2WEVA 3LFDA 3N4TA 2OBJA 3E5AA 4C8BA 4RMZA 4P2KA 3F3ZA 4IX3A 4G3GA 1UV5A 5AX9A 1FOTA 4JDIA 3TV4A 2X4FA 4RA5A 1JAMA 3QHRA 4RJ3A 4FG7A 4FT0A 4D1XA 3VUGA 3ZONA 2YJRA 1WVWA 4B4LA 3AD4A 4OTGA 3R9DA 3PIYA 3WF7A 2ZAZA 5IQGA 2IO6A 2BCJA 4C33A 3AMYA 2OU7A 4ZIMA 4ZY4A 2VO6A 3ZLYA 2QOHA 3Q04A 3L8PA 3UMWA 4CG8A 2QU5A 3GEQA 4L7SA 5CTPA 3V8SA 4CZTA 4BI2A 1JOWB 4EOMA 3VS6A 5M57A 3QTZA 2BAJA 3MA6A 2VTHA 4RIOA 4WNMA 1SVEA 4FTNA 2VWYA 1R0EA 2XKDA 5CI7A 2RSVA 2FYSA 3WF5A 4F1MA 4U5JA 3DXNA 1SNUA 2PPQA 1V0OA 4FKOA 4HVGA 2ITUA 1OGUA 1REKA 1FMKA 5AAFA 4KA3A 2R9SA 3A8XA 4YJRA 5AV0A 3R7OA 3R9OA 3K5VA 5AUWA 4ARKA 3G15A 1H0VA 4LFIA 5TOZA 2F2UA 2RGPA 3W1FA 1OECA 2YCFA 3UBDA 5HLNA 1IASA 2WMQA 4FZ7A 5IPJA 3TNQB 4FG8A 3VO3A 4XUFA 4DGGA 3KXMA 3ANRA 2P33A 2AC3A 5HICA 1BX6A 2UVZA 5HKMA 3O51A 4UZDA 4CMTA 3PDTA 3NSZA 3QYZA 4CFUA 4X3FB 3MDYA 2BALA 4A06A 3ZSHA 4IVDA 4BDCA 2X4ZA 4F0IA 4FV8A 4NUSA 4G2FA 3GC8A 4PV0A 4Q5EA 5BNJA 5IUHA 5H2UA 4EOSA 4YSJA 3DK3A 4IE9A 3PXQA 4ZTSA 1KSWA 2PZ5A 2VWBA 3R8LA 3GXLA 3WZDA 3E7VA 4UX9A 4GIHA 5IMEA 3QA0A 1JKKA 4QMYA 2ZMCA 1W98A 3RALA 4GKHA 2J0LA 1O6LA 5ICPA 5E4HA 4KBCA 3THBA 4IHPA 3MFUA 4IDVA 4H3QA 4FEWA 3EIDA 2WU6A 2HWOA 4G3DA 3KXXA 2C5XA 2HZNA 2QONA 3D7ZA 3NIEA 3EQCA 3QQKA 5DR9A 4USFA 5H8EA 4FSWA 4OTRA 3SXFA 3JUHA 4UYNA 4WO5A 3FL5A 4MXYA 3Q53A 4IJ9A 4XP2A 3MVLA 3QX2A 4YJQA 3SKCA 3RNIA 3ULIA 3A7HA 4YJSA 3QF9A 3WIKA 4LUDA 4GVAA 2C3IB 2RFDA 5DIAA 3FPQA 1Z57A 2R3PA 3RVGA 3UIUA 2OLCA 3JR1A 3TI1A 4OTHA 5E8YA 1LEWA 3DCVA 3QTWA 5KMMA 5FLFA 4FZFB 3VUTA 2XJ2A 2B7AA 4J97A 4X2GA 4GG7A 2HZ0A 3COKA 2XF0A 2UW5A 5HCYA 3ZLWA 2ITQA 5CSHA 3ZUUA 4CLIA 4OAUC 4ZS4A 3Q4TA 3V6SA 3QQHA 4AOJA 5CU3A 4RX9A 2XBJA 3OBGA 5K4IA 5EOBA 5AUXA 4AGCA 4GVJA 4GS6A 3VS5A 2WQMA 4JXFA 4PMSA 5M4CA 2HCKA 2YM8A 4J8MA 3I7BA 3G33A 4DFXE 4E6QA 1NW1A 2ITWA 3MIAA 5D7AA 3D4QA 4G9CA 5HG7A 5HVYA 3DFCB 5ANEA 5J79A 4FV1A 3P79A 3CBLA 4JBQA 1ZYCA 4XG4A 3ZRKA 4FTMA 5C8MA 4UMTA 1UNHA 2VTSA 4FYOA 4BZNA 1K3AA 3W8QA 1OBDA 2JKOA 3KEXA 2GHMA 1ZOHA 3HNGA 4HGLA 3RPSA 1F0QA 1PXNA 2BIYA 5HE3A 4A4LA 3IDBA 5C8KA 4XBUA 3DLZA 2CSNA 3NEWA 4GU6A 4DAWA 2ITNA 3BHYA 4BDDA 4RLLA 4LYNA 4O7VA 3Q52A 4F4PA 3OOMA 3QZFA 3E88A 2UW9A 4FV0A 3I0OA 1NVQA 4DH1A 4FODA 4KIKB 3ETAA 4FC0A 5ANOA 4BY9E 3F3TA 5DR6A 3VBQA 1YI6A 4H39A 4NCTC 2X8IA 4YLJA 1WBTA 4A9YA 3ACJA 5KX8A 3CIKA 3P4KA 2QG5A 3O8TA 4M0YA 3V8WA 5IDNA 4TWPA 5AA9A 2ZVAA 2OF4A 3OT8A 1B39A 4NZWB 4U0IA 4I3ZA 1XR1A 4FICA 4TYIA 3A62A 4FV7A 4PL5A 5EHYA 1ZYSA 4A9TA 4JG7A 4A07A 3I79A 2W1FA 3UZTA 3GB2A 3VS3A 2FH9A 3HZTA 1MUOA 2JLDA 3QWKA 4IAAA 2QHNA 5JSMA 2VTMA 2XH5A 3BU3A 4MEDA 5A4CA 1M2PA 4F6UA 2B52A 4P90A 5FWKK 2CKQA 2RKUA 4ANSA 4DT8A 2QOFA 5IA5A 5EYKA 4BCOA 5ANDA 2WELA 4F9AA 3Q9ZA 4Y83A 3TNWA 2GQRA 4U3ZA 4U44A 2WMUA 4ITIA 1JLUE 4FNWA 3PVGA 5D9HA 4F1OA 3ROCA 3WE8A 3TWJA 1FMOE 3O17A 5BUEA 3LQ8A 4LGHA 4GW8A 1QMZA 1YRPA 2NP8A 2G01A 4PL3A 4MF1A 1WBOA 1E1VA 1Y91A 3QTUA 1KE5A 1UU3A 2GMXA 4X3FA 4UWCA 5HCXA 2PU8A 4USDA 1BI7A 4KKHA 2OO8X 3ALOA 3FV8A 3BLQA 3IGGA 5L2WA 1OUYA 4AE9A 3KC3A 5HBJA 2I0VA 1PY5A 4FV3A 3E8EA 3PJ1A 3VS0A 4BF2A 5H3QA 2UW6A 4XH6A 3FHIA 2GNHA 1YXUA 3A7GA 3WZEA 3ODYX 2W99B 3H4JA 5EHLA 3RPYA 4BBMA 4H58A 4DYMA 3EKKA 4DEAA 1KV2A 2UW8A 4IVAA 5A9UA 1PXJA 4RA4A 5FD2A 5LJJA 4RIXB 2PUNA 3DS6A 2BTSA 2JBPA 4E20A 2QD9A 1JSVA 3NNWA 3WYYA 5JQ8A 4AOIA 4FR4A 2AC5A 4AN3A 3KK9A 3R22A 2OJGA 4QMOA 2XKFA 4TYJA 5IKWA 5IUIA 3HECA 2WTVA 3P1AA 4G3CA 4D2SA 4WIHA 3IK3A 3CJGA 5E8SA 5BMMA 3WZUA 3FHRA 2OXXA 4IXPA 2C0IA 4EWQA 2ETKA 2R3KA 5CEPA 2OJFE 5EI8A 5EW8A 5IISA 5AJQA 4QMTA 3UVRA 5HTIA 4WD5A 3EQBA 3SHEA 3CPCA 3II5A 2IW9A 2YZLA 4O82A 3I5NA 4DG0E 4DG3E 1V0PA 5HNBA 3OS3A 4J99A 2E9OA 2OI4X 3KXZA 4A7CA 4DFUA 3MY5A 3VUMA 3TV6A 3PTGA 4IFCA 3EN5A 2R0IA 5M51A 4D9TA 2HXQA 5IA0A 5HIDA 3DPKA 2R7BA 3LCDA 1JQHA 1MRUA 4IAYA 5A3XA 2R3GA 3MBLA 5KCVA 3ZEPA 4DEEA 1QL6A 4BC6A 3OP5A 1Q8WA 1YI4A 4DN5A 4NT4A 3FDNA 4BTFA 4E5AX 3QD2B 2VO3A 3R63A 4RWJA 4O27B 1PXMA 1WBWA 2PMLX 3D5VA 3LPBA 3QCSA 4C7TA 3DB8A 3HMNA 3NCGA 3R83A 5IEYA 2XNMA 3AC8A 5CF8A 3R7GA 5G1XA 4O7SA 2HZIA 3E8CA 4HYIA 5CYIA 3MH2A 2W9FB 3AQVA 3OCSA 3QZGA 5FTGA 1URWA 5CEKA 4KIKA 2RFNA 3PP1A 1SM2A 3Q6WA 3F6XA 3LFSA 3LM0A 4YJUA 3FJQE 3PYYA 1SYKA 3QKMA 4GUBA 3VS2A 2VNYA 5CALA 3ZFXA 3G9NA 5AP3A 4CFVA 1A48A 4BVUA 2QCSA 4FKSA 5E9EA 1GIIA 3QBNA 4EK6A 3O7LD 1PYEA 4FSRA 4RC3A 4I92A 3BQCA 3OT3A 3Q9XA 4BHNA 2WQNA 4YU2A 3E62A 3FSFA 4PMTA 4R1VA 2HK5A 3NYOA 4K0YA 3S4QA 3W2QA 3BZ3A 4DH3A 4C37A 3SRVB 3G90X 3NS9A 1YHSA 2B0QA 3SGCA 2ONLC 2QOCA 3ZFMA 5IEXA 2ITPA 3HX4A 5HO7A 5EHOA 5C8NA 5CU4A 4II5A 3DB6A 2YJSA 2BZKB 3ODZX 4BIEA 3NCZA 2CNVA 2OIQA 3UVPA 4J7BA 2HWPA 3E92A 4IQ6A 3OOGA 3LFNA 3VW8A 3OXIA 3KU2A 5DI1A 4EH5A 4EONA 2PZRA 1OIYA 2X8DA 3BV2A 3NRMA 4M68A 2EUFB 3C4CA 3H0ZA 4M7IA 4BCPA 4DEBA 2G1TA 4H1JA 2EXCX 4Y73A 4ONAA 1Q24A 4K9YA 5EYMA 4TPTA 4LOPA 5TR6A 5HQ0A 3UYSA 5IMXA 2R7IA 3D14A 3HV5A 3VBXA 4AFJA 4DFYA 5BYYA 3GCQA 1MRYA 2FB8A 4FKIA 3S3IA 3Q4CA 4YO4A 2H6DA 1OPJA 5AWMA 4O1OA 3VQUA 5I9VA 1XH7A 2VWZA 2ZV9A 5AFVA 2QLQA 4I6FA 4RJ7A 2YEXA 3PJ8A 4W9XA 4DGLC 2IN6A 5F9EA 4QOXA 1Q61A 5DRBA 3EN6A 2O3PA 4QNAA 3O8PA 4M15A 4RIXA 3U4UA 4D58A 4CQEA 4XG3A 2CLXA 2PVLA 4QO9A 2UZNA 4CZUA 5K5XA 3BHUA 5KHXA 3WIGA 4C58A 3CLYA 3L1SA 3W2OA 4IZYA 4E6CA 3Q6UA 2YDKA 3PSCA 3PSDA 3EQFA 5DH3A 3GBZA 4E5BA 3WF8A 2YIYA 4AUAA 3OD6X 3OTVA 2OH0E 1OIQA 2Y4IB 2VN9A 3GFEA 4L6QA 5DG5A 3U9CA 5GIOE 5LVLA 1L3RE 1OM1A 4FZDB 4FL3A 3NX8A 3FWQA 4FSMA 1U59A 4ZMEA 3LJ0A 4JX7A 4DC2A 2UW0A 1M52A 3RK5A 1ZY5A 4I41A 4BTJA 1RE8A 1OI9A 4JRVA 4O0TA 3SQQA 4OTQA 4YUQA 2A2AA 2GTMA 1OIRA 3RAHA 4I0TA 4ZJJA 3DKGA 3Q60A 2J0IA 3LHJA 3ZDIA 3QXPA 4QMQA 3KULB 3TTIA 2HW7A 4EL9A 2ITOA 4P5QA 4FKUA 4XP0A 4Y8DA 5AV3A 3RM7A 3LOKA 3QL8A 5HCZA 3U9NA 4BWKA 5AIKA 3N9XA 2HAKA 5DT0A 3QQJA 2IZTA 3GENA 3TL8A 2DYLA 1FVVA 4GJ3A 4UMQA 4XJ0A 3IW6A 1P14A 3AD5A 3R8MA 4H36A 3ZXTA 5FP6A 3FPMA 4YZDA 3UP2A 4JQ8A 5KMLA 2G2FA 4HNFA 1TQMA 2GHLA 4O0YA 3TN8A 4DHFA 2V5QA 2O65A 5LWNA 4ZZOA 2WD1A 3ZBXA 3BELA 2J50A 1WBVA 4X6QC 3R7VA 3WBLA 3HV4A 3S95A 5LOHA 1U5RA 2VWIA 2WZJA 1XH5A 4OT6A 1Q8YA 2IVUA 2HZ4A 4J96A 2GHGA 5A14A 5A46A 4Q9SA 3O50A 3GU6A 3KCKA 3ZC6A 4IWQA 5KHWA 5D10A 4R3CA 4TT7A 2CLQA 3RGFA 3FMLA 4C61A 4YTHA 3FLSA 1YWRA 3HKOA 4JLCA 4GCJA 4D4YA 5J1VA 2VU3A 3DTWA 1JKLA 1Q97A 4C38A 5B2MA 2P0CA 3VW6A 1GZNA 5HHWA 3KB7A 5FEDA 5CU0A 5J1WA 1P5EA 2CMWA 3QTQA 3DOGA 3GP0A 4U42A 3AC4A 2ITXA 4IVCA 4W4WA 3LIJA 2FSMX 3C4EA 3PXYA 3R04A 4RT7A 4U81A 4CFXA 2JBOA 3AGLA 4KBAA 1SMHA 4AA0A 3LFEA 4K11A 2JKKA 2UZLA 3SRVA 2ZB1A 2HIWA 4RX7A 4ANMA 4AXAA 5DEWA 5LVOA 4JBPA 1OKVA 3MVJA 4LQMA 4WUNA 5LMKA 2DWBA 1OPLA 3UG1A 2O5KA 4R8QA 5E8TA 4EEVA 4C3PA 1H26A 1OUKA 2VGOA 3BE9A 3FUPA 4E5WA 2JDSA 2ZDTA 3VHKA 3C4XA 3W55A 3MJ1A 3BGQA 5KMIA 4WRGA 5M07A 1BLXA 3CGFA 5HLWA 4ZTRA 5EM6A 1IRKA 1PRYA 3KVXA 4GYGA 3ERKA 4F7LA 2XRUA 2PVRA 3VBVA 4PPCA 4D55A 4FSZA 3RM6A 2PZIA 4OGRA 4IH8A 5AR5A 4JOAA 3QZIA 3PVUA 1YDSE 3NZ0A 3OY1A 2C68A 3F5UA 1OKWA 3FXXA 2O63A 4ZZMA 3CQWA 2R3QA 3LLAA 4LRJA 3B8RA 3H0YA 4I0RA 5A4TA 2SRCA 2CGXA 5D11A 1PXKA 1GZOA 2JAVA 4BYJA 1LPUA 2VX1A 1JNKA 4R5SA 3ZFYA 4CZYB 4FTAA 5J9LA 4GUEA 4W4YA 3FZRA 3T3VA 3EB0A 3I6UA 4NU1A 4MAOA 4HCVA 4GFMA 3HA6A 4C36A 1H1RA 2FSLX 1YXTA 2OG8A 4QTAA 4R7BA 2X2KA 2JIVA 2Q0BA 1KOBA 3BV3A 4RZVA 3Q4UA 4XMOA 5H8BA 5KE0A 3FEGA 3U51A 2QURA 3O96A 3HGKA 4QQ5A 5CQUA 4Y5HA 1OVEA 5KMJA 1GAGA 4BZDA 4QPAA 2UZVA 3R8VA 3C9WA 2F57A 1P4FA 4QMSA 1YI3A 1KE9A 2UV2A 3E63A 4L9IA 4UBAA 5FDPA 4AE6A 4LI5A 2PYWA 4BICA 4F7NA 5IQHA 1OB3A 3SXRA 2QOKA 2YAKA 2X9FA 4BZOA 4R78A 1LUFA 4RVMA 4QRCA 3RCDA 3GC0A 4I4EA 3RZFA 3PZEA 4ZTLA 1PXOA 5CNOA 5H9BA 4D2VA 3KULA 4V04A 4FTTA 3G0FA 2Z7SA 4FTUA 1HCLA 2ZOQA 4O86A 3QTIA 3GCUA 1AD5A 5CF4A 3CD3A 4XLVA 2IPXA 3AGMA 4RRVA 4PTCA 2J0KA 3L8SA 2OJ9A 3UQGA 3PVBA 3I1AA 4XBRA 5CWZA 2R3OA 2GS7A 2NRYA 2QR7A 3K5UA 4G5PA 1W82A 4NM0A 3VUIA 5M4FA 3SC1A 3U55A 4FV6A 3LFQA 3FMKA 3S1HA 4YJVA 3FMNA 5JRSA 4FKVA 2GS6A 5FEQA 2BR1A 2ERZE 3F7ZA 5DA3A 5BUJA 3O7LB 5B2LA 2W4KA 4BCNA 2Y6OA 2RIOA 3KREA 1H01A 1PHKA 4QQJA 3VULA 4QPSA 2BUJA 2X81A 4I93A 4BKZA 2PE1A 4D28A 3ZZWA 5DHJA 4BYIA 4CEGA 2WIPA 2XNNA 2IVTA 3RKBA 4C3RA 1CTPE 3JY9A 3OUKA 2PZYA 2XKCA 3HRBA 4AGUA 1ZYDA 2DQ7X 3REPA 4X0MA 4QNYA 2P55A 3D94A 4FEUA 4PQNA 2GQGA 4Z16A 4FKJA 4N70A 2P3GX 2V7OA 4RVTA 3TJCA 3LVPA 3PJCA 3VF9A 3RHKA 5GZAA 1FQ1B 3KA0A 4J53A 2NNWB 3UNJA 1GNGA 2WMTA 3ZUTA 2G2HA 3QTSA 3KVWA 4LV8A 4ZOGA 3ID6C 2ITTA 2P2IA 4XRLA 2XBAA 4BKJA 1SNXA 4XCUA 3CJFA 4L7FA 3JXWA 3TKUA 4LUEA 3D0EA 4YTFA 2BKKA 5JGDA 2F7XE 4ZMFA 3PLAE 3CP9A 3DKOA 3MB6A 4MD9E 1G8AA 5FXSA 4AZSA 1IA9A 2ZMDA 3CD8A 3K54A 1WZYA 1UU7A 2ACXA 1Z9XA 3UNZA 5TKDA 1AGWA 2VX0A 4KBKA 3KN6A 2FVDA 4I24A 3R21A 3HRCA 4DITA 2B9HA 4CYIA 4WOVA 2B1PA 5JH6A 3TDVA 3R2BA 4BWPA 3VBWA 3QALE 3UODA 4M8TA 4AZEA 5AEPA 1CKPA 4XG6A 1YDRE 3FMHA 4RJ5A 1PKDA 4MXOA 5HNIX 4X2NA 3C0HA 1IEPA 2W0JA 2Z7QA 3MH0A 1Q3WA 2A19B 4KRCA 4AWIA 2BHHA 3PXRA 4IX5A 1H00A 3TJDA 5KBQA 4L43A 4FKQA 5HD7A 4FIFA 4E8AA 4V0GB 4APCA 3DBQA 5DPVA 2QO9A 5ETIA 5KUPA 3QQFA 5M55A 4AN2A 4BDIA 4JG6A 5IH5A 5I0BA 3MESA 2DUVA 2VTIA 3QUEA 4FVRA 4KKGA 4EUUA 1XJDA 4OT5A 4EKKA 3F5GA 4HOKA 3DKCA 4YZ9A 3W2RA 2BROA 2UZTA 2VGPA 1WMKA 4JBOA 5CVGA 4UN0C 1DI9A 4XX9A 4CCUA 4CKRA 5IH4A 4FKWA 4I4FA 2XNBA 4J95A 3QUDA 1WBNA 3MVMA 5DVRA 3WZJA 4IIRA 3VN9A 4CFMA 4D5KA 3HV3A 3NUNA 4LGGA 4LL5A 4HJOA 4MYGA 4UALA 2F7ZE 4F9CA 4CLJA 4DLJA 4QYGA 2QOBA 2C5YA 4MXCA 2VAGA 4XYFA 4FK3A 1WBPA 4R5YA 1QCFA 3QLFA 1H1WA 2FA2A 2X8EA 2NPQA 3NNUA 4BN1A 1RW8A 3FI8A 4FIHA 1J7LA 2GTNA 4I5CA 2JDTA 5DOSA 2B4SB 5BYLA 4R6VA 3H9FA 3L8VA 1CKIA 3OCBA 4UY9A 4FV5A 3FMDA 1KE7A 3PY0A 4FV2A 3C5UA 4PTGA 4I6QA 2UZBA 2J6MA 4HPUE 4EUTA 4B8MA 4C4JA 5AV4A 3P5KA 3NNVA 4N6ZA 1P4OA 3V04A 5ANIA 3RHXA 2BHEA 5JEBA 2P2HA 2WB8A 5AR7A 1UKIA 3U6HA 4XRJA 4UWYA 1SVHA 3QYWA 3CTJA 4ALVA 2YABA 4FMQA 2W7XA 3TIZA 3KKVA 3KN5A 4ZLOA 3CY3A 2GNFA 3OTUA 5CU6A 3PUPA 3WI6A 1Q8ZA 4F65A 5HIEA 4IC8A 3S00A 4EORA 4L3LA 3F5PA 3EQDA 1Y57A 4M67A 3UO6A 2JGZA 2X39A 5BYZA 4KWPA 2B54A 4EKLA 4A4XA 2PVNA 2WTKC 2OW3A 4D2RA 3RNYA 2W1EA 3TNPC 1IAHA 1RJBA 3NUPA 4JL9A 4CT2A 4HVSA 2C5NA 2C1BA 5HNGA 2B9FA 4J71A 4X2KA 4K18A 4XOZA 5ACBC 3OWJA 3ZHPC 4B6LA 2YAAA 4ZJVA 2JIUA 5CVFA 5TE0A 5HIBA 2OSCA 2BAQA 2V0DA 3IQ7A 3FLWA 3LFFA 3DAKA 3NAYA 4QP9A 5ACKA 1I09A 3KK8A 2BZIB 1J7UA 3NUAA 4GMYA 4ZP5A 4FTJA 4FGBA 3E8DA 3QQUA 3HUBA 3KF4A 3PVWA 3QZHA 2H8HA 3LMHA 1B6CB 4NL0A 3FE3A 5CXZA 5CSPA 2JKQA 5IG1A 4DH7A 3RK7A 3V6RA 5BVNA 4X7QA 1Q41A 5IQAA 4CTBA 4KSPA 5K4JA 3ULZA 4L67A 3EOCA 3OROA 1OPKA 2C4GA 4YGAA 3BLRA 2WMAA 4RWKA 4CCBA 3RI1A 4DF3A 3MTFA 2V62A 4MQ2A 5JN2A 2IZRA 3NUUA 2HY81 4YPSA 4KIOA 4D2PA 4NH1A 3FC2A 4HYUA 5ETFA 4A4OA 1AQ1A 3IECA 4WNOA 4XV1A 3CGOA 3BWJA 5CASA 3VJOA 5E8UA 3UE4A 4HVHA 3LFAA 3ATSA 4FT9A 4M0ZA 3R02A 4DBXA 5E8ZA 4FV9A 4IDTA 3SAYA 4ASZA 4FTIA 2XK9A 1CKJA 4DLIA 4PNIA 4CVAA 4GEOA 1PKGA 5AX3A 3R1NA 3JPVA 3BCEA 3DDPA 1BKXA 3QXOA 3R1SA 3R71A 4NWMA 5DEYA 5BVWA 3V5PA 1OKYA 3FAAA 4I5MA 5I9YA 1RQQA 2UW7A 2H9VA 4BBFA 1PJKA 4V0GA 5J5TA 2XNGA 1FINA 3MB7A 4QMVA 5LCJA 3DZOA 4L3JA 1UNGA 1DAYA 3PFQA 3FBVA 4GK2A 4BCMA 3EFWA 2GU8A 4IMYA 3IOPA 2WFYA 2ERKA 5CANA 1J7IA 1S9IA 5FP5A 2R2PA 5M53A 4NKAA 3T3UA 2QOIA 1ZARA 1YKRA 4KKEA 1BMKA 3IW7A 1Y8YA 2YWVA 4LRKA 2JDOA 3I6WA 3UOHA 2VWWA 1GZ8A 4NTTA 4OTFA 1ZLTA 5CT0A 1P2AA 4CSVA 1W83A 5E1EA 3TIYA 5J7HA 4X2FA 2KULA 1HCKA 1FVTA 4NKSA 4AACA 4TWNA 4JQ7A 4EHGA 3MYGA 3ZOSA 3T8OA 3RMFA 5HI2A 4ENYA 4L3PA 3MY1A 3OWPA 5DT3A 1PW2A 2G2IA 4MD8E 5F20A 3NWWA 4UV0A 3QKLA 1GJOA 4IJPA 4M14A 2WAJA 4K77A 4P4CA 3ZUVA 4QP2A 3ZU7A 3UPZA 1KUTA 2PVJA 2BRHA 3BBTB 2WU7A 3D7TB 5DYJA 5IQCA 4BGQA 5EOLA 5IQDA 2OF2A 3E8NA 4ZTQA 3ET7A 3EH9A 3MFRA 3FLNC 4O2PA 2XM8A 3Q2JA 5IA3A 4J1RA 3FKNA 1XKKA 4JRNA 5C26A 5EKOA 3E64A 3W32A 5IU2A 5IZFA 1ZZLA 1WVXA 3KRJA 5KKRB 1PF8A 4G3FA 3GU8A 2Q83A 4M13A 4Q5HA 1JPAA 2GNLA 4U45A 4X3JA 3F82A 3S2PA 2YM3A 3F5XA 4X6RA 3V5QA 4K6ZA 2HENA 2X7FA 3DA6A 3OY3A 2PUIA 4RWIA 3AT3A 5LVMA 5JQ5A 5AV1A 3D2IA 4H05A 5LXMA 1H07A 3OWKA 4UXLA 4PDPA 2A27A 1A06A 2UZOA 5F4NA 4AZFA 4BRXA 4N57A 3Q2MA 4JVGA 4FI1A 4JT3A 4BDJA 3VIDA 2BRNA 5CU2A 2IZSA 5AUYA 2OICA 5CSXA 4EH4A 2OZAB 4XNEA 4S2ZA 3QD4A 2XNEA 5A4LA 2VWVA 4LL0A 5HTBA 3OFMA 4DEDA 1ND4A 2F2CB 4XG2A 3HV7A 3WOWA 4A9RA 1X8BA 1OL1A 3DNEA 4F9WA 4XG8A 1BYGA 3FC1X 1JSUA 4B9DA 4BBEA 5EKNA 5IUGA 4PDSA 3ZCLA 3JS2A 1OBGA 4FE2A 4O0UA 3GVUA 3U6IA 4ZK5A 2CJMA 4I5PA 3DAJA 3LW0A 3LCKA 4FX3A 3L9NA 4U9AA 2VTLA 1R39A 2PVHA 4S32A 4CMUA 4HCTA 5A6NA 3HMIA 4IM3A 4MBJA 4APPA 4BCIA 3PXKA 4NJDA 2VRXA 5CAQA 3FMMA 3RTPA 4RX5A 2YACA 5HG9A 4IZ7A 3BWFA 2QI8A 4MQ1A 3BI6A 3C5IA 3FI3A 4ZJIA 4TYGA 4O0XA 3FXZA 3MIYA 5L3AA 3VS7A 4X3FC 3VQHA 2O64A 4ACHA 3FLQA 3V51A 4I0SA 4AX8A 2Y0AA 4JQEA 2UZDA 5I9ZA 1ZWSA 1URCA 2PUUA 4FKRA 4FKTA 3UO5A 4BIBA 3OXTA 1XH6A 2R3LA 2WGJA 4YHJA 5HU3A 4ANOA 4QYEA 4G3EA 4B0GA 4D0WA 1VZOA 4RJ4A 3A7JA 3HLLA 3Q32A 4O0VA 5A4QA 5HZNA 1GOLA 3OCTA 2XIZA 3VVHA 1XH9A 3WYXA 3DKFA 4XHKB 3QTRA 2BKZA 3QC4A 4W9WA 3LXNA 3D83A 3JY0A 2BPMA 4EBWA 3MV5A 3LFCA 4YZNA 4EK8A 4DG2E 3QWJA 4LOOA 5J5SA 4FIIA 4ALWA 2JFMA 3QD0A 3PP0A 5HG8A 1WCCA 3LM5A 5AP4A 2RL5A 4EC8A 2CN8A 3W2PA 2VNWA 3MW1A 4M66A 4BDKA 4F09A 4RIYB 3R9RA 4YHFA 3HMOA 3LQ3A 4D2TA 5AR2A 4EOJA 1NT2A 4JBVA 4CXAA 4LMNA 4FYNA 4FVQA 3ENHA 1W0XC 5HLPA 4JNWA 4A9UA 1A9UA 3GU5A 4E26A 5CEOA 3CCNA 2R3MA 2PSQA 2PVYA 3Q9WA 4PMPA 5ETAA 4D1ZA 2PHKA 1XH4A 2HY0A 2EU9A 1Q3DA 4BTKA 3DK7A 1KOAA 2R3RA 1HOWA 2OIBA 3GU7A 4F9YA 5E7RA 3UDBA 1ZOEA 3HDNA 1K2PA 3R01A 4EHZA 4AT3A 2YHVA 4NM5A 5BX0A 3G5DA 3PG1A 3SDJA 4IANA 4DINA 3A60A 4QP6A 5F94A 3GQLA 4O91A 4BCKA 4EJNA 3D7TA 4RIWB 5A54A 5EM5A 3L9PA 3FZOA 5CNNA 3TEIA 4BR3A 5T6KA 3EQPA 4K2RA 3ACKA 5E92A 3VHEA 5CEIA 1S9JA 4OTIA 4AA5A 4AW5A 2VTPA 3TZ8A 4I23A 3LLTA 5AP1A 3O71A 1H27A 3IKAA 4ACGA 4O7LA 5AP7A 3EQGA 4K33A 3GI3A 4I94A 3MFSA 2I0YA 4I1ZA 4QPMA 2F4JA 3QGYA 4GV1A 3I60A 4DGOA 1YDTE 2XVDA 4ACCA 4NJ3A 3AC3A 3A4PA 3AC5A 3RINA 4IM2A 4RG0A 2XK8A 4Z55A 4EI4A 4FT7A 1YW2A 2Z02A 2CPKE 1J1CA 3W16A 4J8NA 2WMVA 2PULA 3UZRA 3PJ2A 4H1MA 3C0IA 3DXPA 1H25A 3MPTA 3DJ6A 3PA3A 4I6HA 2Z7LA 3TUBA 2EB3A 2ESMA 3BPRA 4FKLA 4HZSA 2PZPA 4C02A 5JK3A 3UJGA 5IA4A 1W7HA 2OK1A 1NA7A 1CM8A 4L01A 2PL0A 3QKKA 4TL0A 3LKMA 3MFTA 3T9TA 2Y6MA 2C6DA 3W33A 2WMBA 2I0HA 4M97A 4N4SA 3G0EA 2W1IA 1QPJA 2OZAA 2VTRA 4ZY5A 1ZZ2A 4LM5A 1H1SA 2WOUA 4PRJA 3UTOA 4OTPA 4IB1A 2YIQA 2X7OA 2I1MA 2OH4A 3F69A 5FXQA 4GT3A 4BGGA 3N4VA 3M42A 3G51A 4ZAUA 2I6LA 4EQMA 3UNKA 5C1QB 5CSVA 4RFYA 4NK9A 4JG8A 1ZY4A 2WTJA 2BRGA 1KWPA 2CGVA 3G9LX 3PXZA 2XS0A 1XO2B 4AW2A 3MJ2A 2ZV2A 2VV9A 3LMIA 4W8DA 1TQPA 1H4LA 2WTWA 4K1BA 4NIFB 4V01A 2XKEA 3UQCA 2BZJA 3PY1A 1MQ4A 4RBLA 4ASXA 3EKNA 5JKGA 1U5QA 5I4NA 4YR8A 2WXVA 3FL4A 3P23A 4C62A 4ID7A 1UWHA 1KE8A 5EW3A 4F99A 2OXDA 4I22A 5HE0A 1NY3A 3BEAA 2J5FA 2OKRA 3ZO3A 2OZOA 1R0PA 3IOKA 5ANJA 4O83A 4LMUA 5HGIA 3FYKX 3ATTA 4LRMA 2B9IA 5DWRA 2J2IB 3P78A 3KMWA 4IVBA 5H8GA 3NYVA 2B55A 2WTIA 1IG1A 2QKRA 3UC4A 2R0UA 4AW0A 3ZO2A 3IW5A 4ENXA 3HAMA 3P7BA 4QMZA 1WBSA 2PVFA 2XMYA 3KXNA 3POZA 1BUHA 2F9GA 3BHVA 3Q5IA 4DCAA 2OIDA 1KE6A 3HDMA 3OWLA 4Q9ZA 3WE4A 4C0TA 3MGYA 1M7QA 3DV3A 5AM6A 2QKWB 5IQEA 1WAKA 3W10A 3QD3A 1LR4A 2BRMA 2R3FA 5AUZA 1YVJA 2YISA 4F0FA 2F7EE 2WO6A 5AP2A 1YXXA 2VTOA 5JFXA 1F3MC 3P7AA 4JI9A 4U8ZA 3RWPA 2UVYA 4RIYA 3F88A 4UWBA 4PL4A 2NO3A 4QP1A 3A61A 5HX8A 3HAVA 2PWLA 3I81A 3PPZA 2IW6A 3BU5A 4EH8A 1Q99A 3CQUA 4FNXA 3EYHA 1JVPP 5LMAA 4XG9A 3HYHA 5AR4A 2GFSA 4PP7A 4P5ZA 3VAPA 5CQWA 5DBXA 2PY3A 3UO4A 3LJ2A 2XRWA 5I3RA 1E9HA 3MA3A 4UMPA 1GIHA 4EOQA 5AUTA 4WKQA 4D1SA 5IH6A 1M17A 1OMWA 4RFMA 5FTOA 2VTAA 2JDVA 3UG2A 4HGEA 4RIWA 5DRDA 4ZY6A 3Q5ZA 4UZHA 2IVSA 5D7VA 4IB5A 3P0MA 4KUJA 5DMZA 2X6DA 5FGKA 1PYXA 3UVQA 4TYHB 3FYJX 4EOLA 3ORXA 2QOQA 4F1TA 5HVKA 4O7WA 4E93A 4FT3A 3ZYAA 3GCVA 2OGVA 2QU6A 4EWHA 4RPVA 3Q4ZA 3TUCA 3VUDA 2XYUA 2E2BA 4GSBA 3MWUA 3G6GA 4CT1A 3F3UA 4NYEA 4YZBA 2O8YA 2YERA 4C4HA 1YXVA 5AP0A 3ZLXA 1FGIA 2J7TA 3E3PA 4QP7A 2VUWA 3V3VA 3GQIA 5AADA 3LXLA 3F66A 2BFXA 5CSWA 3NR9A 5M4IA 4BI0A 4RC4A 5AM7A 4CV9A 3M11A 5HBEA 3OBJA 2W1CA 3OHTA 3QRKA 4IWPA 1R78A 5FRIA 4ZTNA 4YZCA 2YCQA 3DU8A 1H1PA 4FOCA 5M08A 3O23A 3F2RA 4AFEA 3U4WA 3UIMA 3AT4A 4IAZA 4R3RA 3HVCA 3UZPA 3FQHA 3U87A 3EWHA 4HCUA 4L45A 5FM3A 4CRSA 1E1XA 4XP3A 2BFYA 3NGAA 4AU8A 4BCQA 4ERKA 3BX5A 3HMMA 2J4ZA 5DN3A 2I0EA 4FSUA 4CRLA 2XJ1A 1R1WA 2J9MA 4C4GA 2LGCA 5LMKC 3AC1A 4G16A 4O96A 3FMJA 3KRRA 4PDYA 5AR3A 4O7NA 4KIQA 3MS9A 3E3BX 2RFSA 3R0TA 5E1SA 4NIFA 5J9YA 2GSFA 3CE3A 5EK7A 3DXQA 4TKSA 2J5EA 4GL9A 5G6VA 5EQEA 2GNIA 3LCOA 3TM0A 4FSYA 3L9MA 3RK9A 3OVVA 3B2TA 3OXZA 1Q5KA 3F9NA 4L46A 4U7ZA 4P7EA 3EMGA 4DH8A 4KB8A 4FL1A 4QP4A 4YHTA 3UIBA 2P4IA 3G6HA 1O6KA 4XV3A 4EZ3A 4QMMA 4ZXTA 5CAPA 1Q8UA 4YLKA 3EN4A 1Q8TA 2EWAA 4FK6A 3A7IA 2ZV8A 3PLSA 3ENMA 3R1YA 5HE2A 2YFXA 4I20A 4OR5A 3IW4A 4ZTMA 3FZTA 3CKXA 3O8UA 4EH9A 2X6EA 2WPAA 4JAIA 5CT7A 2XJ0A 2YM6A 4Z9LA 5AAEA 3IG7A 5FTQA 5GJFA 2PMNX 4O7TA 1GZKA 3NNXA 3OF0A 2W1DA 3MH1A 1UA2A 5CZHA 3OMVA 5BVKA 3VRYA 3DBEA 2BILB 2XIKA 3PIZA 4MVFA 2VTTA 2AYPA 1L8TA 4BDBA 4ZLYA 2F49A 5A6OA 4QMXA 2Y4IC 3ZRLA 2I7QA 4AT5A 3FKOA 5HE1A 4CG9A 4R7IA 3AD6A 3SX9A 2YITA 3COHA 3KCFA 5LQFA 1OITA 2HOGA 4RVLA 5J87A 4D5HA 3MY0A 4Z3VA 3ORPA 4OBOA 3ZBFA 5BPYA 4LGDA 4EHEA 3L9LA 1NVSA 3FQSA 3A2CA 4WRSA 5BVDA 2YA9A 3EJ1A 3FLZA 3KL8A 1ZMVA 2YWPA 5L8KA 3LZBA 3V5JA 5CY3A 4E6DA 2C6MA 3KY2A 5D1JA 3NUYA 2ITYA 4NFMA 4TWCA 4F7SA 4O2ZA 4E6AA 2YDJA 3DLSA 3BYOA 4QP8A 5KO1A 4F08A 4G5JA 4RQVA 3GT8A 2UZWE 5IDPA 5EI2A 3PWYA 5DT4A 4GRBA 3R8UA 3I0QA 4R1YA 3ZZEA 5HORA 2WIHA 4KINA 2YDIA 2CDZA 5IA2A 5JFWA 3EQIA 4GJ2A 4NTSA 3EL8A 5AR8A 1TKIA 4W4XA 5CF6A 2JFLA 4IAKA 4L00A 3D15A 4TYHA 4FUYA 4QMWA 2W1GA 3C7QA 3MI9A 3R7EA 4BTMA 4BCFA 4WHZA 4TRLA 3NYNA 4UEUA 1H1QA 2V22A 2WMXA 3KXHA 4EOOA 3B8QA 4ZLZA 3R28A 3BGZA 3MN3A 4GKIA 4PPAA 4AW1A 1Y8GA 4E4LA 2QG7A 2BMCA 1IA8A 2ZM4A 2ZJWA 3BU6A 4ZSLA 4AF3A 4FOBA 4GG5A 3BYVA 3DBDA 3TV7A 5L2TA 2XIYA 2QHMA 4PF4A 4DTKA 5HD4A 2JD5A 3ORZA 3PSBA 4YPDA 2ZM1A 3FZSA 5CEMA 4DA5A 2JDRA 2UVXA 4E73A 4PMMA 2FUMA 5AIRA 4GT5A 5E8WA 3TNIA 3PA4A 1J91A 1H0WA 3O0GA 4IACA 3H3CA 1GIJA 3NLBA 3M1SA 1H8FA 3QC9A 1MQBA 4DEHA 2E9VA 1BI8A 4QYHA 3QCQA 4U3YA 4I6BA 3ORKA 5J7BA 3IW8A 5M56A 4UMRA 1YOJA 4KNBA 3R7UA 3FY2A 3QQGA 5M44A 4IX4A 3VRZA 3ZC5A 3OCGA 3PWDA 3R8ZA 5EYCA 4DEGA 1XBAA 4C3FA 3NDMA 4WG4A 1BL7A 5L6WL 3N51A 1M2RA 5KZ0A 2UW4A 1JWHA 4M3QA 3F3WA 3GCPA 5HESA 4EHVA 4F0GA 5GJDA 5TF9A 3MPAA 2ZV7A 2YM5A 3QGWA 4FKGA 3QRTA 4RJ8A 3DY7A 4Y95A 3LMGA 5GZ8A 1REJA 4QT1A 3S0OA 1PMNA 1YOMA 3JVRA 1YWVA 5CXHA 2XEYA 3ZS5A 4K8AA 3V8TA 4NCTA 4RJ6A 4ZTHA 3W2SA 4RGJA 4AG8A 5I9WA 2C6IA 3A8WA 4NM7A 2H34A 4DGNA 3BIZA 2WEIA 3RAKA 4PP9A 5GIPE 3LXPA 5C9CA 3WF6A 5I9UA 4ANBA 3KRLA 2UZEA 2RG5A 3BGPA 4G31A 4XS2A 5EDRA 4WBOA 2C6KA 4CTCA 3HMPA 5JFSA 4F7JA 3DFAA 1MP8A 2QO7A 3PXFA 4AP7A 1ZMUA 3IDPA 3UP7A 3OUNB 3SW4A 4E1ZA 2C0TA 3VUHA 5GINE 4CFNA 4CYJA 3JVSA 3JYAA 2C1AA 5HG5A 3TKIA 3VBYA 2VTQA 3UC3A 4G6OA 4OBQA 4FNYA 4AN9A 2WHBA 4EZ5A 5DNRA 2XK6A 5CS6A 1ZOGA 4FVPA 2WOTA 2C6LA 3KQ7A 4IZ5A 5J9ZA 2W4JA 2XUUA 4GK3A 4MKCA 4OW8A 4TY1A 3T9IA 4WNPA 2R64A 3KMUA 4MWIA 5TO8A 4CKJA 1ZRZA 3FKLA 4TW9A 4FZAB 4BCHA 4QTEA 5IQIA 2ZM3A 3C51A 3EHAA 4HYSA 5JZNA 5CAOA 4O7RA 5EQYA 5EM8A 1LEZA 2XNOA 1O6YA 4C2VA 3P86A 4WBBB 3KRWA 3VJNA 5DR2A 2Y9QA 1H08A 3W18A 2C47A 4QQCA 4QTBA 5C03A 3UOLA 4FL2A 4O6EA 2I40A 3VS4A 5M06A 3K3JA 2A4LA 3CXWA 5ITAA 4EJ7A 4IW0A 5LVPA 4ZSAA 2ITVA 1M14A 3CKWA 4FKPA 4IWOA 1XWSA 2X7GA 3OG7A 4CNHA 3ZO1A 5AA8A 1IR3A 2V55A 4I5HA 4CGAA 4O38A 3UQFA 2R5TA 3C0GA 5K5NA 4MK0A 4B99A 4EC9A 3ZMMA 1ERKA 1V0BA 2X9EA 2XK4A 4Z7GA 4NFNA 3F2AA 5FG8A 1ZYJA 4L53A 3Q3BA 5EW9A 5HX6A 1YHVA 3L8XA 3RBWA 3CS9A 3D2KA 5DE2A 4EK3A 4DGMA 2Y7JA 3NUXA 3QAME 4E4XA 5IQFA 2XCHA 4B8LA 4WA9A 3WZKA 3NIZA 4FG9A 4KABA 4ERWA 5KNJA 4AT4A 3KFAA 5K9IA 4O1PA 5EDPA 2DS1A 4IZAA 5BQ0A 4DTBA 2CKPA 4F9BA 2R3NA 2QC6A 2W5AA 3NW5A 2C5VA 4ORKA 3AXWA 5HO6A 4AOTA 3UOJA 3V5LA 4RLKA 3IPHA 3NVMB 2X0GA 3VBTA 3C4WA 3FLYA 4BDHA 4HGSA 3NMUF 4PDOA 3EN9A 4EOPA 4OAVB 3HEGA 3ORNA 3FY0A 3PA5A 3HL7A 4HPTE 3IDCA 4YC6A 4XEYA 2CNQA 2Y4PA 2XB7A 5K0XA 5FQDC 3ALNA 3E93A 4U6RA 1FGKA 4BI1A 4YJOA 5K0KA 4QTDA 4RZWA 4U80A 4CFWA 4ACDA 3PZHA 4FF8A 3CTQA 2XYNA 4A9SA 2J0MB 3D5UA 3TZMA 4AGWA 3TT0A 2UW3A 4S30A 1WVYA 4S31A 1J1BA 4W8EA 3UPXA 4QTCA 4FTQA 4FIJA 2XNPA 3DZQA 4FIGA 3D5WA 4XV2A 4OUCA 3EZVA 3ZDUA 4YJTA 2CKOA 2XZSA 3SG8A 3H10A 2UUEA 5F1ZA 4Q2AA 5GHVA 4QMUA 3F2NA 2PTKA 2FO0A 3ZSIA 4S34A 2GDOA 2YIWA 4ZEGA 2EVAA 5M09A 1JSTA 3M2WA 4JS8A 5HVJA 3ZH8A 2GS2A 2WQOA 3AG9A 2C3JA 3D9VA 3QUPA 4RFZA 3GU4A 1CMKE 4O81A 2O0UA 1J3HA 2QNJA 3FZPA 4KRDA 2BRBA 1QPCA 4TNBA 3GNIB 5JGBA 1PMUA 5L2QA 4BDEA 5GNKA 2XA4A 1YHWA 3BE2A 4YP8A 4CQGA 4EH3A 3V01A 2X2LA 4E4NA 4F64A 4FTLA 4FSTA 4IB0A 4V05A 3U6JA 3ORMA 4QYYA 1U4DA 4GH2A 4L52A 4M84A 3A7FA 3R7YA 1XQZA 2W5HA 4YTIA 3C50A 2VD5A 3P9JA 2CGWA 4LV5A 5LCKA 1W8CA 3V5TA 4BDFA 4WG5A 4TXCA 5L2SA 4IX6A 4ASDA 4FSQA 5BVFA 5I3OA 1PXLA 2BZHB 3BHHA 5CAUA 1MRVA 1VYZA 5BUIA 4Y72A 3QRJA 5EYDA 2IZUA 1PXIA 4R3PA 3R9NA 2J51A 4RX8A 1UU8A 3RP9A 5I5ZA 3QCXA 4QMLA 2C3KA 3KGAA 5K3YA 4WSQA 3BYUA 1F5QA 2IJMA 2ONLA 4IAIA 4XG7A 5EQPA 2GQSA 2ITZA 2E9NA 4O6LA 2WMRA 4MD7E 1Z5MA 5LVNA 2UZUE 3U54A 1T45A 5KMKA 2BDJA 4FV4A 3G2FA 3F7WA 2AUHA 5I9XA 1QPDA 4U40A 5HBHA 3NAXA 3VC4A 3SXSA 3AT2A 3FMEA 3VNTA 4CKIA 4BB4A 2R3HA 2QLUA 3N4UA 4D2WA 4YLLA 2ETMA 2J0JA 4YC3A 3FI4A 1YWNA 4W4VA 2G9XA 1T46A 4BL1A 5KMNA 3UGCA 4MF0A 3ZEWA 4DFNA 1G8SA 4ZSEA 2Z60A 3RPRA 2Y8OA 2WMWA 3SA0A 4U43A 3K3IA 4D9UA 3ZM4A 3QQLA 1I44A 2YLEA 4FEQA 4YC8A 2OXYA 4DH5A 2WMSA 3SOCA 2YIRA 4J52A 4F70A 2NRUA 3EQRA 2JKMA 4FTRA 2PMOX 4CFFA 5C4KA 4BFMA 4G9RA 1H24A 4MBIA 4UB7A 3RAIA 3CSVA 2LAVA 5IA1A 5J95A 3SOAA 1OIUA 4E4MA 4JJRA 5FBNC 2FSOX 4AQCA 3HP2A 1YXSA 2VTNA 4DFZE 4O84A 4U41A 1APME 2VTJA 3HRFA 4GFGA 4Z7HA 1Y6AA 4NEUA 3GC9A 5B7VA 3H9OA 4RWLA 4G6LA 3LE6A 2JC6A 4DBNA 1DM2A 3O2MA 3IONA 3R30A 3UMXA 5CEQA 3ZRMA 1VEBA 3EZRA 4IC7A 3ZXZA 1JKTA 2VX3A 2BAKA 4EH6A 3I4BA 4Y46A 4DTAA 2HW6A 3ORLA 3GGFA 4MHAA 4JR3A 4ANNA 5FXRA 5L6PA 2CN5A 2XK3A 3AMAA 4EYMA 3FI2A 1ZYLA 1XBBA 4MWHA 1EH4A 5AUVA 5HTCA 3ZM9A 4JAJA 4O0RA 3GFWA 3QHWA 4I21A 4CD0A 2YIXA 3DQWA 1OL6A 4EH7A 4WG3A 3RPOA 3DJ5A 4IB3A 3CEKA 4WT6A 1DI8A 2RF9A 3DAEA 5DLSA 1YQJA 4NW5A 3IGOA 1UVRA 4EBVA 1UU9A 4D4RA
chains in the Genus database with same CATH superfamily
2X1NA 4O0WA 3OEFX 4C4IA 4E7WA 4HW7A 3R00A 3HUCA 3TXOA 4MNEB 2REIA 4TYEA 3QLGA 5GJGA 4DEIA 4H3PA 3TDWA 4MUQA 3C4ZA 5CI6A 3VS1A 2VWXA 2YCRA 1XHAA 4MXXA 5DGZA 2EB2A 2OWBA 2QQ7A 4YO6A 4PWNA 4L68A 4CMOA 3LFBA 2IEWA 3B2WA 3F61A 3GOPA 3MPMA 4G34A 2H96A 3TTJA 3C4FA 1RDQE 2E9UA 3RWQA 1IAJA 3RCJA 4QMPA 3NPCA 4ZSJA 5KZIA 4EH2A 5HU9A 4M69B 2IWIA 2A0CX 3VONA 2O2UA 4BCJA 5JFVA 4YSMA 2PE0A 5LWMA 1SVGA 3PY3A 1KV1A 2OJIA 1G3NA 4GIIA 3CC6A 4RC2A 2R3JA 4HNIA 2OJJA 4OBPA 5CX9A 5ANKA 1OL2A 3UOKA 4QQTA 5LMBA 3I7CA 2PMIA 3QRUA 4GT4A 4KS8A 5B2KA 5KBRA 4BCGA 1WFCA 3R8PA 3P08A 4UXQA 4AZTA 5L8LA 3UDTA 3SV0A 1FBNA 3LXKA 2XK7A 2IW8A 1PMEA 4ZSGA 2QOOA 4IFGA 4MCVA 4G17A 5FBOA 4KAOA 3UIXA 2YCSA 5JZJA 1Q4LA 3DDQA 3ZO4A 3ZTXA 3ELJA 3AOXA 5D12A 4KIPA 2ETRA 3F3VA 2W06A 4IADA 3ROYA 4EZ7A 4D4VA 5JT2A 3QX4A 2XEZA 4QD6A 4AGDA 2C5OA 3CPBA 4H3BA 2PE2A 4PTEA 3D5XA 4TNDA 3QA8A 2PK9A 3FZ1A 1JKSA 1CDKA 2RG6A 3RZBA 2YM7A 1FPUA 3FXWA 3RJCA 3PPKA 4FNZA 4WUAA 3NVKI 4KD1A 2C6EA 3E7OA 4MH7A 2VO7A 1Q62A 3H9RA 4OTDA 4XLIA 3LQ5A 5FUTA 2BDWA 4UMUA 1V1KA 1OKZA 1UKHA 4DHIB 4LG4A 4JDKA 4F63A 4DT9A 4JX3A 3NW7A 4R77A 2W4OA 3WARA 1O9UA 1OL5A 2C69A 2BIKB 2GFCA 1G8JA 2C0OA 2XCKA 3HP5A 3I5ZA 5ETCA 3PPJA 1BL6A 5TT7A 2CNUA 2IVVA 4USEA 5IEVA 4LV7A 2YM4A 4YJPA 4FT5A 3UYTA 4IAFA 3BBWA 4O7YA 5B0XA 3Q9YA 3VUKA 4BIDA 5KKRC 5E91A 2R4BA 3SVVA 5C27A 1M7NA 4XV9A 1K9AA 5JMSA 4C4EA 4EYJA 1QPEA 4GFOA 1XBCA 2V7AA 1DS5A 4GU9A 4ITHA 3EYGA 2QOLA 3EFLA 4L42A 4E3CA 5CVHA 5EG3A 2GCDA 2W96B 4EK4A 2YN8A 3GOKA 2YZAA 4PY1A 4X21A 4GYIA 3W0QA 2XALA 2C6OA 2G15A 3W8LA 4ASEA 3BRBA 5T68A 2FSTX 1ATPE 2EXEA 2Q0NA 3OW3A 5L4QA 2WNTA 3DBFA 4B7TA 3SW7A 2XANA 1OZ1A 3MSSA 1TZDA 2A1AB 4AZVA 4U79A 1NVRA 3ORIA 2Z8CA 3V5WA 5C4LA 5EFQA 5IF1A 3DNDA 5AUUA 5IQBA 4NM3A 5ANGA 4CV8A 3CTHA 3SG9A 1ZXEA 2GPHA 4L44A 4HVDA 4KSQA 4FA2A 3MTLA 5DFPA 2B53A 2W1HA 3TNHA 3KRXA 2PUPA 4N0SA 3DQXA 5F95A 5AMNA 3R7IA 2HXLA 2Z2WA 4L8MA 5EI6A 3EFKA 1PMVA 2XP2A 5T3QA 1U54B 5BVOA 1UNLA 3C1XA 1OL7A 3PRIA 2XIXA 4MTAA 4MNFA 1SZMA 3OZ6A 4MX9A 4TZRA 2CHLA 4WSYA 2VO0A 4JIKA 5L2IA 4G6NA 1LP4A 3FSKA 2VZ6A 3R9HA 3DK6A 3ORTA 3SD0A 3ZLSA 4D4SA 2ZYBA 5JRQA 1JBPE 4NSTA 4FZ6A 2WTKB 2GNJA 2WQEA 3EFJA 3ANQA 4HGTA 4QYFA 2PVKA 2B9JA 2QR8A 3DJ7A 2HYYA 4QMNA 2JITA 4MNEA 1M2QA 5LARA 4D0XA 3RPVA 2EXMA 5CENA 1YOLA 4NW6A 3RAWA 1G5SA 5EH0A 3QRIA 4WNKA 4LOQA 5D41A 5KMOA 4YBKA 4ZZNA 3DTCA 4MBLA 5M4UA 4UYAA 3AC2A 5C01A 2W1ZA 3BYSA 4C59A 4C57A 4EQUA 3NYXA 4DE4A 2BVAA 3R6XA 5E8VA 4AZWA 2WTDA 4O22A 4C4FA 4YBJA 5CLPA 3TCPA 2XIRA 5FM2A 4M69A 4C34A 2WTCA 3GCSA 5AV2A 3LCSA 1W84A 5L6OA 2W9ZB 1VYWA 4TTHB 3LAUA 4AAAA 4C2WA 3BYMA 2YLFA 4TWOA 4AS0A 3AMBA 3POOA 3CY2A 4DCEA 4ANQA 5AP5A 3TZ7A 3IS5A 2E9PA 2W05A 2JAMA 2QODA 3DT1A 2RFEA 3EL7A 4FGRA 4IM0A 2CCHA 3HV6A 4YURA 2CCIA 1R3CA 3P7CA 4BGHA 4EQCA 4U97A 3DGKA 3UDSA 5AAGA 3QFVA 5GZ9A 2WQBA 4RQKA 4C35A 2BTRA 3W2CA 3TUDA 1U46A 3KF7A 4ACMA 1TQIA 4JR7A 2AQXA 2JEDA 3Q96A 4RVKA 2C3LA 1NXKA 3K2LA 5FEEA 2CGUA 2XM9A 4BKYA 4HYHA 4FEVA 3PE2A 1FVRA 3TKHA 4O21A 2ZFYA 3BEGA 2Z7RA 5HO8A 3PRFA 2J90A 3BHTA 2WKMA 5BMSA 4OLIA 3A4OX 4HVIA 2OFUA 4PPBA 4Y5QA 3PIXA 3VF8A 3OC1A 5EDQA 5CF5A 3PG3A 1ZMWA 3COMA 4G1WA 4IWDA 1CSNA 3ITZA 3COIA 4F6WA 3PE1A 3SLSA 3LCTA 2W5BA 4JIAA 5BVEA 3GUBA 4OTWA 5JGAA 2GNGA 5AP6A 2C30A 4ALUA 3PJ3A 3R2YA 4EOIA 2XAMA 4MXZA 3H30A 4FUXA 4J98A 1H28A 4PX6A 5FDXA 4JDHA 4DFBA 4F6SA 5CAVA 1DAWA 3E87A 4GK4A 3R73A 4YNOA 3GC7A 4N6YA 4ZS0A 4YJNA 1TVOA 3TG1A 3DBCA 4M12A 3CR0A 4QP3A 5EM7A 2ZB0A 4BDGA 2QO2A 4O0SA 1XH8A 2QVSE 4PUZA 3EQHA 3BL7A 2FGIA 4MXAA 3VWAA 4AAYA 3KXGA 4FEXA 2JIIA 4AXDA 4XOYA 4ITJA 5L8JA 3WILA 2HELA 3MH3A 3BLHA 3NUSA 3MVHA 3NW6A 1ZAOA 4AA4A 1OGYA 1UWJA 2KTYA 3QCYA 3U8WA 3R1QA 4FBXA 5HEZA 3IO7A 2IG7A 4BDAA 3ZSGA 5J8IA 5E90A 1PXPA 4YNEA 3OEZA 4YMJA 2ZDUA 1VR2A 4FTKA 2BDFA 4DFLA 1STCE 3C13A 4HZRA 4JDJA 4S33A 4IEBA 4BWXA 3OW4A 2W17A 1VJYA 2OFVA 3A99A 3QTXA 3BQRA 4Y85A 5HOAA 3WF9A 5E8XA 2C6TA 4YTCA 3HA8A 2R3IA 3KMMA 5A4EA 3FQEA 2PVMA 4PNKA 4YZMA 3TZ9A 4O4DA 2VWUA 2CKEA 4TN6A 3EN7A 2X2MA 1GY3A 4EK5A 1U54A 4EOKA 4ANLA 3BKBA 3CQEA 3LJ1A 4FTCA 4X2JA 1B38A 4O7ZA 3QU0A 5CZIA 4IBMA 4RSSA 4FSNA 3TACA 4BHZA 4R7HA 4FTOA 4KS7A 4FIEA 1Y6BA 2WEVA 3LFDA 3N4TA 2OBJA 3E5AA 4C8BA 4RMZA 4P2KA 3F3ZA 4IX3A 4G3GA 1UV5A 5AX9A 1FOTA 4JDIA 3TV4A 2X4FA 4RA5A 1JAMA 3QHRA 4RJ3A 4FG7A 2X0OA 4FT0A 4D1XA 3VUGA 3ZONA 2YJRA 2A98A 1WVWA 4B4LA 3AD4A 4OTGA 3R9DA 3PIYA 3WF7A 2ZAZA 5IQGA 2IO6A 2BCJA 4C33A 3AMYA 2OU7A 4ZIMA 4ZY4A 2VO6A 3ZLYA 2QOHA 3Q04A 3L8PA 3UMWA 4CG8A 2QU5A 3GEQA 4L7SA 2IF8A 5CTPA 3V8SA 4CZTA 4QEBA 4BI2A 1JOWB 4EOMA 3VS6A 5M57A 3QTZA 2BAJA 3MA6A 2VTHA 4RIOA 4WNMA 1SVEA 4FTNA 2VWYA 1R0EA 2XKDA 5CI7A 2RSVA 2FYSA 3WF5A 4F1MA 4U5JA 3DXNA 1SNUA 2PPQA 1V0OA 4FKOA 4HVGA 2ITUA 1OGUA 1REKA 1FMKA 5AAFA 4KA3A 2R9SA 3A8XA 4YJRA 5AV0A 3R7OA 3R9OA 3K5VA 5AUWA 4ARKA 3G15A 1H0VA 4LFIA 5TOZA 3KIOC 2F2UA 2RGPA 3W1FA 1OECA 2YCFA 3UBDA 5HLNA 1IASA 2WMQA 4FZ7A 5IPJA 3TNQB 4FG8A 3VO3A 4XUFA 4DGGA 3KXMA 3ANRA 2P33A 2AC3A 5HICA 1BX6A 2UVZA 5HKMA 3O51A 4UZDA 4CMTA 3PDTA 3NSZA 3QYZA 4CFUA 4X3FB 3MDYA 2BALA 4A06A 3ZSHA 4IVDA 4BDCA 2X4ZA 4F0IA 4FV8A 4NUSA 4G2FA 3GC8A 4PV0A 4Q5EA 5BNJA 5IUHA 5H2UA 4EOSA 4YSJA 3DK3A 4IE9A 3PXQA 4ZTSA 1KSWA 2PZ5A 2VWBA 3R8LA 3GXLA 3WZDA 3E7VA 4UX9A 4GIHA 5IMEA 3QA0A 1JKKA 4QMYA 2ZMCA 1W98A 3RALA 4GKHA 2J0LA 1O6LA 5ICPA 5E4HA 4KBCA 3THBA 4IHPA 3MFUA 4IDVA 4H3QA 4FEWA 3EIDA 2WU6A 2HWOA 4G3DA 3KXXA 2C5XA 2HZNA 2QONA 3D7ZA 3NIEA 3EQCA 3QQKA 5DR9A 4USFA 5H8EA 4FSWA 4OTRA 3SXFA 3JUHA 4UYNA 4WO5A 3FL5A 4MXYA 3Q53A 4IJ9A 4XP2A 3MVLA 4JMQA 3QX2A 4YJQA 3SKCA 3RNIA 3ULIA 3A7HA 4YJSA 3QF9A 3WIKA 4LUDA 4GVAA 2C3IB 2RFDA 5DIAA 3FPQA 1Z57A 2R3PA 3RVGA 3UIUA 2OLCA 3JR1A 3TI1A 4OTHA 5E8YA 1LEWA 3DCVA 3QTWA 5KMMA 5FLFA 4FZFB 3VUTA 2XJ2A 2B7AA 4J97A 4X2GA 4GG7A 2HZ0A 3COKA 2XF0A 2UW5A 5HCYA 3ZLWA 2ITQA 5CSHA 3ZUUA 4CLIA 4OAUC 4ZS4A 3Q4TA 3V6SA 3QQHA 4AOJA 5CU3A 4RX9A 2XBJA 3OBGA 5K4IA 5EOBA 5AUXA 4AGCA 4GVJA 4GS6A 3VS5A 2WQMA 4JXFA 4PMSA 5M4CA 2HCKA 2YM8A 4J8MA 3I7BA 3G33A 4DFXE 4E6QA 1NW1A 2ITWA 3MIAA 5D7AA 3D4QA 4G9CA 5HG7A 5HVYA 3DFCB 5ANEA 5J79A 4FV1A 3P79A 3CBLA 4JBQA 1ZYCA 4XG4A 3ZRKA 4FTMA 5C8MA 4UMTA 1UNHA 2VTSA 4FYOA 4BZNA 1K3AA 3W8QA 1OBDA 2JKOA 3KEXA 2GHMA 1ZOHA 3HNGA 4HGLA 3RPSA 1F0QA 1PXNA 2BIYA 5HE3A 4A4LA 3IDBA 5C8KA 4XBUA 3DLZA 2CSNA 3NEWA 4GU6A 4DAWA 2ITNA 3BHYA 4BDDA 4RLLA 4LYNA 4O7VA 3Q52A 4F4PA 3OOMA 3QZFA 3E88A 2UW9A 4FV0A 3I0OA 1NVQA 4DH1A 4FODA 4KIKB 3ETAA 4FC0A 5ANOA 4BY9E 3F3TA 5DR6A 3VBQA 1YI6A 4H39A 4NCTC 2X8IA 4YLJA 1WBTA 4A9YA 3ACJA 5KX8A 3CIKA 3P4KA 2QG5A 3O8TA 4M0YA 3V8WA 5IDNA 4TWPA 5AA9A 2ZVAA 2OF4A 3OT8A 1B39A 4NZWB 4BJJB 4U0IA 4I3ZA 1XR1A 4FICA 4TYIA 3A62A 4FV7A 4PL5A 5EHYA 1ZYSA 4A9TA 4JG7A 4A07A 3I79A 2W1FA 3UZTA 3GB2A 3VS3A 2FH9A 3HZTA 1MUOA 2JLDA 3QWKA 4IAAA 2QHNA 5JSMA 2VTMA 2XH5A 3BU3A 4MEDA 5A4CA 1M2PA 4F6UA 2B52A 4P90A 5FWKK 2CKQA 2RKUA 4ANSA 4DT8A 2QOFA 5IA5A 5EYKA 4BCOA 5ANDA 2WELA 4F9AA 3Q9ZA 4Y83A 3TNWA 2GQRA 4U3ZA 4U44A 2WMUA 4ITIA 1JLUE 4FNWA 3PVGA 5D9HA 4F1OA 3ROCA 3WE8A 3TWJA 1FMOE 3O17A 5BUEA 3LQ8A 4LGHA 4GW8A 1QMZA 1YRPA 2NP8A 2G01A 4PL3A 4MF1A 1WBOA 1E1VA 1Y91A 3QTUA 1KE5A 1UU3A 2GMXA 4X3FA 4UWCA 5HCXA 2PU8A 4USDA 1BI7A 4KKHA 2OO8X 3ALOA 3FV8A 3BLQA 4AQKA 3IGGA 5L2WA 1OUYA 4AE9A 3KC3A 5HBJA 2I0VA 1PY5A 4FV3A 3E8EA 3PJ1A 3VS0A 4BF2A 5H3QA 2UW6A 4XH6A 3FHIA 2GNHA 1YXUA 3A7GA 3WZEA 3ODYX 2W99B 3H4JA 5EHLA 3RPYA 4BBMA 4H58A 4DYMA 3EKKA 4DEAA 1KV2A 2UW8A 4IVAA 5A9UA 1PXJA 4RA4A 5FD2A 5LJJA 4RIXB 2PUNA 3DS6A 2BTSA 2JBPA 4E20A 2QD9A 1JSVA 3NNWA 3WYYA 5JQ8A 4AOIA 4FR4A 2AC5A 4AN3A 3KK9A 3R22A 2OJGA 4QMOA 2XKFA 4TYJA 5IKWA 5IUIA 3HECA 2WTVA 3P1AA 4G3CA 4D2SA 4WIHA 3IK3A 3CJGA 5E8SA 5BMMA 3WZUA 3FHRA 2OXXA 4IXPA 2C0IA 4EWQA 2ETKA 2R3KA 5CEPA 2OJFE 5EI8A 5EW8A 5IISA 5AJQA 4QMTA 3UVRA 5HTIA 4WD5A 3EQBA 3SHEA 3CPCA 3II5A 2IW9A 2YZLA 4O82A 3I5NA 4DG0E 4DG3E 1V0PA 5HNBA 3OS3A 4J99A 2E9OA 2OI4X 3KXZA 4A7CA 4DFUA 3MY5A 3VUMA 3TV6A 3PTGA 4IFCA 3EN5A 2R0IA 1TFFA 5M51A 4D9TA 2HXQA 5IA0A 5HIDA 3DPKA 2R7BA 3LCDA 1JQHA 1MRUA 4IAYA 5A3XA 4DHJA 2R3GA 3MBLA 5KCVA 3ZEPA 4DEEA 1QL6A 4BC6A 3OP5A 1Q8WA 1YI4A 4DN5A 4NT4A 3FDNA 4BTFA 4E5AX 3QD2B 2VO3A 3R63A 4RWJA 4O27B 1PXMA 1WBWA 2PMLX 3D5VA 1W2DA 3LPBA 3QCSA 4C7TA 3DB8A 3HMNA 3NCGA 3R83A 5IEYA 2XNMA 3AC8A 5CF8A 3R7GA 5G1XA 4O7SA 2HZIA 3E8CA 4HYIA 5CYIA 3MH2A 2W9FB 3AQVA 3OCSA 3QZGA 5FTGA 1URWA 5CEKA 4KIKA 2RFNA 3PP1A 1SM2A 3Q6WA 3F6XA 3LFSA 3LM0A 4YJUA 3FJQE 3PYYA 1SYKA 3QKMA 4GUBA 3VS2A 2VNYA 5CALA 3ZFXA 3G9NA 5AP3A 4CFVA 1A48A 4BVUA 2QCSA 4FKSA 5E9EA 1GIIA 3QBNA 4EK6A 3O7LD 1PYEA 4FSRA 4BJJA 4RC3A 4I92A 3BQCA 3OT3A 3Q9XA 4BHNA 2WQNA 4YU2A 3E62A 3FSFA 4PMTA 4R1VA 2HK5A 3NYOA 4K0YA 3S4QA 3W2QA 3BZ3A 4DH3A 4C37A 3SRVB 3G90X 3NS9A 1YHSA 2B0QA 3SGCA 2ONLC 2QOCA 3ZFMA 5IEXA 3W0SA 2ITPA 3HX4A 5HO7A 5EHOA 5C8NA 5CU4A 4II5A 3DB6A 2YJSA 2BZKB 3ODZX 4BIEA 3NCZA 2CNVA 2OIQA 3UVPA 4J7BA 2HWPA 3E92A 4IQ6A 3OOGA 3LFNA 3VW8A 3OXIA 3KU2A 5DI1A 4EH5A 4EONA 2PZRA 1OIYA 2X8DA 3BV2A 3NRMA 4M68A 2EUFB 3C4CA 3H0ZA 4M7IA 4BCPA 4DEBA 2G1TA 4H1JA 2EXCX 4Y73A 4ONAA 1Q24A 4K9YA 5EYMA 4TPTA 4LOPA 5TR6A 5HQ0A 3UYSA 5IMXA 2R7IA 3D14A 3HV5A 3VBXA 4AFJA 4DFYA 5BYYA 3GCQA 1MRYA 2FB8A 4FKIA 3S3IA 3Q4CA 4YO4A 2H6DA 1OPJA 5AWMA 4O1OA 3VQUA 5I9VA 1XH7A 2VWZA 2ZV9A 5AFVA 2QLQA 4FRFA 4I6FA 2YEXA 3PJ8A 4RJ7A 4W9XA 4DGLC 2IN6A 5F9EA 4QOXA 1Q61A 5DRBA 3EN6A 2O3PA 4QNAA 3O8PA 4M15A 4RIXA 3U4UA 4D58A 4CQEA 4XG3A 2CLXA 2PVLA 4QO9A 2UZNA 4CZUA 5K5XA 3BHUA 5KHXA 3WIGA 4C58A 3CLYA 3L1SA 3W2OA 4IZYA 4E6CA 3Q6UA 2YDKA 3PSCA 3PSDA 3EQFA 5DH3A 3GBZA 4E5BA 3WF8A 2YIYA 4AUAA 3OD6X 3OTVA 2OH0E 4DDGA 1OIQA 2Y4IB 2VN9A 3GFEA 4L6QA 5DG5A 3U9CA 5GIOE 5LVLA 1L3RE 1OM1A 4FZDB 4FL3A 3NX8A 3FWQA 4FSMA 1U59A 4ZMEA 3LJ0A 4JX7A 4DC2A 2UW0A 1M52A 3RK5A 1ZY5A 4I41A 4BTJA 4I6LA 1RE8A 1OI9A 4JRVA 4O0TA 3SQQA 4OTQA 4YUQA 2A2AA 2GTMA 1OIRA 3RAHA 4I0TA 4ZJJA 3DKGA 3Q60A 2J0IA 3LHJA 3ZDIA 3QXPA 4QMQA 3KULB 3TTIA 2HW7A 4EL9A 2ITOA 4P5QA 4FKUA 4XP0A 4Y8DA 5AV3A 3RM7A 3LOKA 3QL8A 5HCZA 3U9NA 4BWKA 5AIKA 4FJVA 3N9XA 2HAKA 4AXFA 5DT0A 3QQJA 2IZTA 3GENA 3TL8A 2DYLA 1FVVA 4GJ3A 4UMQA 4XJ0A 3IW6A 1P14A 3AD5A 3R8MA 4H36A 3ZXTA 2X0QA 5FP6A 3FPMA 4YZDA 3UP2A 4JQ8A 5KMLA 2G2FA 4HNFA 1TQMA 2GHLA 4O0YA 3TN8A 4DHFA 2NYAA 2V5QA 2O65A 5LWNA 4ZZOA 2WD1A 3ZBXA 3BELA 2J50A 1WBVA 4X6QC 3R7VA 3WBLA 3HV4A 3S95A 5LOHA 1U5RA 2VWIA 2WZJA 1XH5A 4OT6A 1Q8YA 2IVUA 2HZ4A 4J96A 2GHGA 5A14A 5A46A 4Q9SA 3O50A 3GU6A 3KCKA 3ZC6A 4IWQA 5KHWA 5D10A 4R3CA 4TT7A 2CLQA 3RGFA 3FMLA 4C61A 4YTHA 3FLSA 1YWRA 3HKOA 4JLCA 4GCJA 4D4YA 5J1VA 2VU3A 3DTWA 1JKLA 1Q97A 4C38A 5B2MA 2P0CA 3VW6A 1GZNA 5HHWA 3KB7A 5FEDA 5CU0A 5J1WA 1P5EA 2CMWA 3QTQA 3DOGA 3GP0A 4U42A 3AC4A 2ITXA 4IVCA 4W4WA 3LIJA 2FSMX 3C4EA 3PXYA 3R04A 4RT7A 4U81A 4CFXA 2JBOA 3AGLA 4KBAA 1SMHA 4AA0A 3LFEA 4K11A 2JKKA 2UZLA 3SRVA 2ZB1A 2HIWA 4RX7A 4ANMA 4AXAA 5DEWA 5LVOA 4JBPA 1OKVA 3MVJA 4LQMA 4WUNA 5LMKA 2DWBA 1OPLA 3UG1A 2O5KA 4R8QA 5E8TA 4EEVA 4C3PA 1H26A 1OUKA 2VGOA 3BE9A 3FUPA 4E5WA 2JDSA 2ZDTA 3VHKA 3C4XA 3W55A 3MJ1A 3BGQA 5KMIA 4WRGA 5M07A 1BLXA 3CGFA 5HLWA 4ZTRA 5EM6A 1IRKA 1PRYA 3KVXA 4GYGA 3ERKA 4F7LA 2XRUA 2PVRA 3VBVA 4PPCA 4D55A 4FSZA 3RM6A 2PZIA 4OGRA 4IH8A 5AR5A 4JOAA 3QZIA 3PVUA 1YDSE 3NZ0A 3OY1A 2C68A 3F5UA 1OKWA 3FXXA 2O63A 4ZZMA 3CQWA 2R3QA 3LLAA 4LRJA 3B8RA 3H0YA 4I0RA 5A4TA 2SRCA 2CGXA 5D11A 1PXKA 1GZOA 2JAVA 4BYJA 1LPUA 2VX1A 1JNKA 4R5SA 3ZFYA 4CZYB 4FTAA 5J9LA 4GUEA 4W4YA 3FZRA 3T3VA 3EB0A 3I6UA 4NU1A 4MAOA 4HCVA 4GFMA 3HA6A 4C36A 1H1RA 2FSLX 1YXTA 2OG8A 4QTAA 4R7BA 2X2KA 2JIVA 2Q0BA 1KOBA 3BV3A 4RZVA 3Q4UA 4XMOA 5H8BA 5KE0A 3FEGA 3U51A 2QURA 3O96A 3HGKA 4QQ5A 5CQUA 4Y5HA 1OVEA 5KMJA 1GAGA 4BZDA 4QPAA 2UZVA 3R8VA 3C9WA 2F57A 1P4FA 4QMSA 1YI3A 1KE9A 2UV2A 3E63A 4L9IA 4UBAA 5FDPA 4AE6A 4LI5A 2PYWA 4BICA 4F7NA 5IQHA 1OB3A 3SXRA 2QOKA 2YAKA 2X9FA 4BZOA 4R78A 1LUFA 4RVMA 4QRCA 3RCDA 3GC0A 4I4EA 3RZFA 3PZEA 4ZTLA 1PXOA 5CNOA 5H9BA 4D2VA 4LDTA 3KULA 4V04A 4FTTA 3G0FA 2Z7SA 4FTUA 1HCLA 2ZOQA 4O86A 3QTIA 3GCUA 1AD5A 5CF4A 3CD3A 4XLVA 2IPXA 3AGMA 4RRVA 4PTCA 3UDZA 2J0KA 3L8SA 2OJ9A 3UQGA 3PVBA 3I1AA 4XBRA 5CWZA 2R3OA 2GS7A 2NRYA 2QR7A 3K5UA 4G5PA 1W82A 4NM0A 3VUIA 5M4FA 3SC1A 3U55A 4FV6A 3LFQA 3FMKA 3S1HA 4YJVA 3FMNA 5JRSA 4FKVA 2XARA 2GS6A 5FEQA 2BR1A 2ERZE 3F7ZA 5DA3A 5BUJA 3O7LB 5B2LA 2W4KA 4BCNA 2Y6OA 2RIOA 3KREA 1H01A 1PHKA 4QQJA 3VULA 4QPSA 2BUJA 2X81A 4I93A 4BKZA 2PE1A 4D28A 3ZZWA 5DHJA 4BYIA 4CEGA 2WIPA 2XNNA 2IVTA 3RKBA 4C3RA 1CTPE 3JY9A 3OUKA 2PZYA 2XKCA 3HRBA 4AGUA 1ZYDA 2DQ7X 3REPA 4X0MA 4QNYA 2P55A 3D94A 4FEUA 4PQNA 2GQGA 4Z16A 4FKJA 4N70A 2P3GX 2V7OA 4RVTA 3TJCA 3LVPA 3PJCA 3VF9A 3RHKA 5GZAA 1FQ1B 3KA0A 4J53A 2NNWB 3UNJA 1GNGA 2WMTA 3ZUTA 2G2HA 3QTSA 3KVWA 4LV8A 4ZOGA 3ID6C 2ITTA 2P2IA 4XRLA 2XBAA 4BKJA 1SNXA 4XCUA 3CJFA 4L7FA 3JXWA 3TKUA 4LUEA 3D0EA 4YTFA 2BKKA 3BL9A 5JGDA 2F7XE 4ZMFA 3PLAE 3CP9A 3DKOA 3MB6A 4MD9E 1G8AA 5FXSA 4AZSA 1IA9A 2ZMDA 3CD8A 3K54A 1WZYA 1UU7A 2ACXA 1Z9XA 3UNZA 5TKDA 1AGWA 2VX0A 1ST4A 4KBKA 3KN6A 2FVDA 4I24A 3R21A 3HRCA 4DITA 2B9HA 4CYIA 4WOVA 2B1PA 5JH6A 3TDVA 3R2BA 4BWPA 3VBWA 3QALE 3UODA 4M8TA 4AZEA 5AEPA 1CKPA 4XG6A 1YDRE 3FMHA 4RJ5A 1PKDA 4MXOA 5HNIX 4X2NA 3C0HA 1IEPA 2W0JA 2Z7QA 3MH0A 1Q3WA 2A19B 4KRCA 4AWIA 2BHHA 3PXRA 4IX5A 1H00A 3TJDA 5KBQA 4L43A 4FKQA 5HD7A 4FIFA 4E8AA 4V0GB 4APCA 3DBQA 5DPVA 2QO9A 5ETIA 5KUPA 3QQFA 5M55A 4AN2A 4BDIA 4JG6A 5IH5A 5I0BA 3MESA 2DUVA 2VTIA 3QUEA 4FVRA 4KKGA 4EUUA 1XJDA 4OT5A 4EKKA 3F5GA 4HOKA 3DKCA 4YZ9A 3W2RA 2BROA 2UZTA 2VGPA 1WMKA 4JBOA 5CVGA 4UN0C 1DI9A 4XX9A 4CCUA 4CKRA 5IH4A 4FKWA 4I4FA 2XNBA 4QDEA 4J95A 3QUDA 1WBNA 3MVMA 5DVRA 3WZJA 4IIRA 3VN9A 4CFMA 4D5KA 3HV3A 3NUNA 4LGGA 4LL5A 4HJOA 4MYGA 4UALA 2F7ZE 4F9CA 4CLJA