4KIOA

Kinase domain mutant of human itk in complex with a covalently-binding inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
265
structure length
240
Chain Sequence
b'GSVIDPSELTFVQEIGSGLVHLGYWLNKDKVAIKTIEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery of novel irreversible inhibitors of interleukin (IL)-2-inducible tyrosine kinase (Itk) by targeting cysteine 442 in the ATP pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 240
sequence length 265
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kioA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kioA01
1SYKA 1YWRA 2REIA 3LM5A 3NEWA 2OK1A 2ZMDA 2OWBA 5BVEA 3ZRMA 3DKFA 3C5IA 3DLSA 4C2VA 4RC4A 4E4LA 4ASXA 2FB8A 3FMJA 3HYHA 4YHJA 3WBLA 3NAXA 4NKAA 3RHKA 3S2PA 3VUMA 4LYNA 1YXUA 4XRJA 4YSJA 3CS9A 4XOZA 1XR1A 5K9IA 4NYEA 3AT3A 4GFGA 4I41A 4L7FA 5GIOE 4OTPA 2C6MA 5LCJA 4EOMA 4IANA 5HCXA 3MYGA 2BFYA 3V8WA 5CEMA 2R3MA 3F7WA 2G2HA 2QOQA 1NVSA 3ORPA 3Q4CA 4C38A 5CEPA 2C0IA 4EEVA 3MH0A 5GHVA 4W9WA 3F88A 1ZYSA 4LOQA 4UZHA 4N70A 4UY9A 2EVAA 2HAKA 4KIPA 4AACA 3WE4A 4AT5A 3HGKA 3KULB 1TQPA 2BKKA 4U81A 5C03A 2JIIA 4R3RA 2B1PA 5M44A 3PG1A 2ETKA 2C69A 3R7GA 3EH9A 3F6XA 3EYGA 3FMNA 2HCKA 4FT7A 4ZY5A 1NVRA 4DGOA 3PZHA 3Q6UA 3BLQA 5HORA 3MPMA 4O7YA 5L8JA 4QTDA 4ZJIA 4K77A 4MX9A 4ITJA 4MK0A 3LQ3A 4HCTA 3RAIA 3Q4TA 3B8QA 3KMWA 3UP7A 5JFSA 2UW6A 3CE3A 4BYIA 4RIYA 4JNWA 3C4WA 3NS9A 4FIEA 3KRJA 3UC4A 2VTLA 3C4XA 2ETMA 2R9SA 3BYOA 4FV0A 4I92A 4BDAA 2OBJA 1Q61A 5ANGA 3SRVA 5EQPA 2V7OA 4M69A 3COHA 1KE7A 2WPAA 4D1XA 4OTWA 4WA9A 3U4UA 1P14A 3DV3A 3R6XA 2P3GX 3A7IA 4PWNA 2J6MA 3A99A 3RNIA 3PXZA 4IX5A 4E4XA 1PXNA 1OKWA 1ZMUA 3D15A 3O71A 4RZWA 3RMFA 3OCTA 5J7BA 3DNEA 5CSWA 5M4CA 3OUNB 2ZMCA 3F5PA 3LJ2A 1BYGA 4FT5A 4P90A 4ZY4A 4BCPA 4DFUA 1QPJA 4DGMA 5EYDA 2AC5A 4IE9A 3CC6A 4RX9A 1Q99A 5KMLA 1KOBA 2E9VA 5J9LA 2WZJA 3W2QA 3FPMA 3ITZA 3OWPA 4DEBA 4S30A 1GIJA 3CGFA 1EH4A 3QTXA 4O0UA 4PMSA 2BTSA 4BYJA 3IGGA 5GZAA 4XCUA 5FP6A 4H36A 1XBCA 1J1BA 4IFGA 1AD5A 2QOFA 1Q62A 3H30A 1H26A 3MIYA 5ANEA 3TG1A 4XMOA 4XP2A 4HYHA 4TTHB 3PYYA 5CI7A 3N51A 4JL9A 3EN5A 1BX6A 3RGFA 2OFUA 2VO7A 4BCJA 3UVPA 2IVUA 3UODA 4TNBA 3NW7A 3CEKA 5EDRA 4R5SA 3PSBA 5CXZA 1GIIA 1HCKA 3OVVA 3ACKA 3C0HA 2HYYA 2B55A 3E5AA 4EOIA 4KIQA 4PL3A 3ZOSA 2I40A 5AAGA 3R8ZA 4FG9A 2ZV7A 4QPMA 3UNJA 1W8CA 3FUPA 3NMUF 3VJOA 4RWLA 3BCEA 4YJOA 2AYPA 5CEKA 3UOJA 2W5BA 5DR9A 1UU8A 4QMYA 4RA5A 1Q8UA 3EQPA 4NUSA 2F7XE 3HMNA 3A2CA 4M14A 5AUZA 3DK3A 2W1FA 3ZHPC 3LFQA 3E3PA 3NNXA 4I6QA 3FI4A 1HOWA 1FINA 1Z5MA 2GQGA 4IWPA 2RKUA 3LCSA 4OTFA 4PNIA 4ZTSA 4Z3VA 4A07A 2VTMA 1M7NA 2KULA 4J53A 2W5HA 3LAUA 2V55A 2QO9A 4UB7A 3RJCA 2Y8OA 3I79A 3VS5A 4FKPA 5A6OA 3UIUA 2P33A 3N4TA 2YM8A 5HGIA 3KVWA 3A4OX 4LGDA 2GFSA 4YJQA 5L6OA 4M7IA 2YDIA 5IA4A 4IZ5A 4APCA 2FH9A 2VNYA 4XNEA 2XNBA 4MAOA 4XBRA 1KE5A 1YOJA 4FSRA 5HLNA 2IW8A 3ZEPA 5HIEA 3O17A 2OXDA 2A4LA 3NAYA 1I44A 2NO3A 2R64A 5M07A 4HJOA 4G3FA 5ANIA 4YBKA 4EH4A 3CR0A 5IEYA 4IHPA 5ETFA 3HP5A 1XBAA 1H28A 3KN5A 2C30A 2X2KA 4IWDA 4QYEA 2YERA 5L2SA 2W5AA 5AV4A 3EQIA 3TZMA 4F0GA 3PY1A 2IVTA 3MDYA 2XZSA 2R3IA 2J90A 1U5QA 3ACJA 5E4HA 4EUUA 4YTIA 5EM6A 3NYNA 4FX3A 4JQ8A 5EW3A 1PYXA 3QTQA 4RC3A 4WD5A 1LUFA 1WFCA 2XA4A 2VNWA 4C58A 5LJJA 4IMYA 4NK9A 5TKDA 3ZRLA 2ERKA 4E20A 4GS6A 5CSVA 5DT3A 2Z7QA 2I0VA 3O7LB 2BRNA 4G3DA 2F9GA 5A14A 2EUFB 3G9LX 1Q3WA 2IWIA 3FZTA 4FV8A 4O0VA 3ZUUA 3DKGA 4FOBA 3C0IA 2XCHA 5DPVA 4IB5A 5IQHA 2YWPA 2WTDA 5KKRC 2VTOA 2Z8CA 2ITPA 1PYEA 3PPKA 3TV6A 3UG2A 3WI6A 4QP1A 1PRYA 4J1RA 4F65A 3GEQA 3MV5A 4N6ZA 4F9BA 2YIYA 2X4FA 3QUPA 2O0UA 2RFEA 3PXRA 4GUBA 4KS7A 1FMOE 3QRTA 1PXJA 4A7CA 4YGAA 4AA4A 4YU2A 1Y91A 4YJNA 3NVMB 2W1CA 4RQVA 3TUCA 4F9AA 1M2RA 1M2PA 2B9IA 3MTFA 3QTRA 4NT4A 2CKPA 1VEBA 4L68A 3ZM9A 2JDVA 2O8YA 4FUYA 2BHHA 4YC6A 3LE6A 4MXXA 3IG7A 3R1YA 3KREA 2XNMA 4R7HA 5IA0A 2UW9A 5CF6A 4EH9A 1H1SA 5E8ZA 5AP0A 5E92A 4CYIA 1V0BA 1W82A 4C59A 3U55A 4C61A 4MNFA 3AGLA 3TUDA 3BV3A 4ANOA 2QI8A 2PZPA 4DINA 4KBAA 3FY2A 4IX3A 3QXPA 4OR5A 2C6DA 1OVEA 2CGWA 5BYLA 5B2MA 4PMMA 4RLKA 3G0EA 2C4GA 5AP4A 4C0TA 4LOPA 5FBOA 4BTFA 4EOJA 4Y5HA 5EH0A 5B0XA 3ANQA 4BDDA 4X2NA 4U0IA 4HVIA 4YTFA 3KQ7A 4O38A 2HW7A 3QRIA 1FBNA 2C5VA 4IAAA 5AX3A 2GHLA 2NRUA 3I0QA 2C3JA 3Q04A 5CSHA 2JFMA 1KWPA 2J7TA 4S32A 4TYEA 4HYSA 5AR5A 5LCKA 3RTPA 1OMWA 3VS3A 4PUZA 5ANKA 4OTQA 5M56A 3UOLA 3RK9A 4BKYA 4BCIA 3UZPA 4BGHA 2R3RA 4OUCA 3F3VA 3F3TA 5A4CA 3D5XA 2ZB1A 1RJBA 3EQBA 4AP7A 4BIDA 4O0WA 5AIKA 3ZZEA 3CQEA 4BRXA 1DAWA 1OECA 3R7OA 4RJ4A 2CJMA 5GZ8A 1UNLA 3CKWA 1MRUA 1U54B 5LWNA 4IQ6A 1W98A 3G2FA 2ZYBA 4FKGA 2W06A 4FBXA 1O6YA 3G33A 3KRXA 4FIFA 2WEVA 4OT5A 4D4SA 4PL4A 1R3CA 4G3CA 2XK9A 3DJ7A 3ZLSA 2FVDA 4BTJA 4PP7A 2XK7A 4MEDA 1GJOA 4PF4A 5D11A 4RT7A 4E4NA 3S95A 1FVVA 2E2BA 2HY81 2WMVA 4ANSA 2PHKA 3LFSA 4A06A 4E6QA 5IA1A 4LL0A 3QTIA 4GJ3A 4PPAA 5F1ZA 5L2TA 5J8IA 1NVQA 3DZOA 3UTOA 2C1AA 3ORKA 4USEA 4O86A 4I0RA 3TDWA 3DXNA 2ETRA 1P4FA 1T45A 2VTHA 3AC4A 3DAEA 4BDHA 3AD4A 2QOKA 4FYNA 4EH2A 2WMSA 4HW7A 2XYNA 3NPCA 2H96A 5CVFA 2VD5A 3AGMA 4A4LA 5KBRA 1SVGA 1PKGA 3LHJA 2XNEA 4FKQA 4P5ZA 5E90A 5IISA 2BFXA 3S0OA 4ACDA 4C2WA 1JOWB 3P79A 4Q9ZA 5C4LA 3ROCA 4L3JA 2IZTA 3MH2A 2ZAZA 4GU9A 5DT0A 3IW4A 3ZSGA 3KXNA 3PG3A 4L45A 5AIRA 4AW5A 4EOKA 5JRQA 5J1WA 2I0HA 3QGYA 2WQBA 4KIKA 4KAOA 3VUIA 4FTCA 3UMXA 3PIZA 4O21A 4D5KA 1O6LA 4F1TA 5L6WL 1J91A 5M06A 3NUUA 2J5EA 1JQHA 3K2LA 5EDQA 3AOXA 4AW1A 4AW0A 3HMOA 3LFDA 1XHAA 3RP9A 4GCJA 3L8PA 1JVPP 5HBJA 4ZLYA 2R3PA 2F4JA 1BI8A 4RIWA 1ZY5A 3L9NA 3FLZA 4IACA 1WBTA 2VWBA 3GOPA 3OCBA 4LUDA 4QYYA 3A4PA 2XIKA 3FMMA 4FIGA 4BBFA 2J9MA 2PVKA 3O50A 3WYYA 5M57A 3GFEA 4K2RA 5M51A 5CAPA 2GNFA 2W9ZB 3PJCA 3H0YA 4IWOA 1NXKA 3NYVA 3ODZX 4XP3A 4BZDA 4X2JA 3B8RA 2YDJA 3SAYA 4UX9A 3ZSIA 4JX7A 4UEUA 3ZDUA 1MRYA 2WMAA 3E93A 4HPUE 4DTBA 3QZIA 4DA5A 2QOHA 3KXXA 4QNAA 5KBQA 1H1WA 2YM6A 4F7JA 4AN9A 2BAKA 4IC7A 3CCNA 3WIGA 3SG9A 4FODA 2RGPA 4XV1A 4WUAA 4QQTA 5CY3A 2BMCA 1H08A 1OIYA 2B4SB 4I1ZA 4I6HA 3GT8A 4JRNA 4LG4A 1XH9A 4CFFA 4FSUA 1YWNA 3C1XA 4V01A 5HLWA 3N9XA 5LWMA 4NM3A 4HPTE 3QCQA 2CKEA 3FZPA 5IG1A 4LRMA 2ITTA 2O2UA 4EC9A 1IG1A 3R22A 5H8BA 1OITA 2QO7A 3FV8A 3SXRA 4D0WA 1JKLA 3K5UA 4QMNA 3H10A 3MGYA 5GJDA 1U59A 3Q53A 4WNMA 2Y0AA 3FHIA 2WU6A 4H05A 4YTCA 2UZTA 3U6IA 3EMGA 4EOQA 4O0XA 1TKIA 2B9HA 4XG7A 4L00A 4FT0A 3A7HA 3QKLA 3L8SA 4IVDA 3B2WA 3HRCA 3PSCA 3QC4A 1LPUA 1YHSA 3BGQA 4GG5A 4A9SA 4D2SA 2IVVA 4O2ZA 1W83A 2PE2A 3PWYA 3LVPA 4QMVA 5AP1A 3ZONA 4FZDB 4O82A 4DF3A 1Y6BA 2ACXA 2W4KA 3PE2A 3QYWA 3FI8A 4FZAB 1KV2A 4C35A 4R6VA 4BCOA 2R3OA 3F82A 2R7BA 3DOGA 3VF8A 4HCVA 2YIWA 4FZFB 4KIOA 4UMTA 2ZM4A 5JZJA 4HGTA 1NT2A 4X2KA 2ERZE 2B9JA 2X8IA 5ANJA 5AP7A 4APPA 3C4EA 3GCVA 1PXMA 4Z7GA 4OTHA 4Z55A 3Q5IA 3SOAA 3W33A 3F69A 3U9CA 4AA5A 4RPVA 2OJIA 4JBVA 3UP2A 1U4DA 4PNKA 2OW3A 3LLAA 1REJA 3QQKA 5AV2A 3W2PA 2PTKA 2W96B 3PVUA 5L6PA 4NTSA 3Q2JA 2PZYA 3P1AA 2BHEA 2VO6A 4J97A 4BGQA 3UPXA 3UG1A 2PL0A 4YP8A 4H3BA 1ZOEA 2BAJA 2VX1A 2WTVA 4WSQA 5I9WA 4BGGA 3GU7A 3R8LA 2JKQA 3GU5A 3BU6A 2JDTA 3NWWA 5DEYA 4XP0A 5EQYA 3C13A 2PVJA 3EJ1A 2HZIA 1JSTA 2XNGA 2LAVA 2VTJA 4RJ6A 4EOOA 3CY2A 3KRWA 4S2ZA 4XG6A 4OGRA 4LUEA 3VWAA 4YC8A 5JT2A 3ORLA 3AC5A 2WU7A 4RA4A 5HE1A 4DTAA 4EZ5A 5M55A 5JFWA 5KZIA 3D0EA 4NM5A 4JAIA 4TNDA 1R78A 5CU6A 1HCLA 3VBQA 2ITNA 2X39A 2J0JA 4O6LA 3HUCA 1L3RE 2C6OA 3SRVB 4CCUA 4D4RA 3GC9A 4M69B 5J9ZA 2IO6A 1GNGA 5CANA 4CKJA 4V0GA 4BICA 4BI0A 4PQNA 2VN9A 4ACHA 5IH5A 4WRSA 5E8YA 3ZLYA 4OAUC 2IZUA 4NFMA 1J3HA 1WBWA 5LMKA 4C4HA 2G15A 3UQFA 4QMZA 5LMKC 1ZLTA 2UZDA 3OW3A 1NW1A 2PVNA 4YZ9A 2YLEA 2FUMA 5JSMA 2OZOA 3OF0A 4RWJA 3FXWA 5HG7A 1PMEA 2JEDA 4I23A 4MNEA 4Q2AA 4D4YA 3F7ZA 3KY2A 4MBIA 4MWIA 4EH5A 2Y9QA 5HD4A 4WO5A 1IRKA 5HKMA 4F09A 2Y4IC 3OUKA 4O81A 2UW0A 3OS3A 4IM0A 3EOCA 2UW4A 3M2WA 4GRBA 4ENXA 4RG0A 1SM2A 3FMHA 3NX8A 4MD9E 4QTCA 4BR3A 4ZK5A 3VS1A 5JEBA 4NL0A 4O7VA 2WTKC 4YR8A 3GVUA 4A9YA 3ZLXA 2WO6A 3FAAA 1Q8YA 5ACKA 3W32A 4H3PA 1VR2A 5IPJA 3ANRA 5CU3A 2YIQA 4W4XA 3WF5A 3MPAA 1LR4A 3MFRA 3EQGA 4YTHA 4ZJJA 1XO2B 1JWHA 2GNJA 1JLUE 3E64A 3LCTA 4MD7E 3QTUA 2UZEA 2UZWE 4BHNA 3QUDA 2PWLA 3WIKA 3RK7A 1FMKA 3GCQA 5KO1A 2XKFA 2C6KA 3OMVA 3PPZA 3RAWA 4B8LA 2NNWB 2F2UA 4TYJA 3V04A 2OO8X 3I60A 3FEGA 4YHTA 3VBXA 2QLQA 2XNOA 4J8NA 3NCGA 4WHZA 4G2FA 3D4QA 3QQHA 2WMXA 4RMZA 3V51A 4C4GA 1Q97A 5J1VA 2QG7A 2UVXA 3VBVA 5DBXA 2X8DA 3KL8A 1PXLA 3A62A 5KMJA 4UYNA 4GG7A 5H9BA 3VAPA 5FEEA 2GQSA 1FPUA 3CSVA 4FTQA 2DQ7X 3MH1A 5CVHA 3WF7A 3MVMA 3WILA 3FE3A 1YXSA 4PDSA 5FDPA 4BCKA 3DXPA 5EOBA 3VW8A 4C4IA 3FMLA 5JK3A 3LCKA 3RPSA 4AZVA 3TN8A 2G2IA 4BCGA 2FSLX 1U5RA 4AG8A 4CFNA 3R1NA 3QWKA 3QQGA 1YRPA 3MA6A 3QYZA 2YWVA 4FIHA 1PXKA 3HAVA 2JBPA 2XKCA 3BRBA 1SVHA 2VTIA 3F3WA 4M68A 3OBJA 4CQGA 4C7TA 5HVKA 4J98A 5HEZA 3OD6X 1LEZA 4FKIA 4U80A 4EH6A 4PMPA 3OC1A 2R3QA 2ITQA 3Q9WA 1DI9A 3GU4A 1OL1A 1YI4A 3PRFA 5AP5A 5GINE 4L6QA 2CHLA 4IAIA 3RZBA 4ZMFA 4RJ3A 1W84A 4S31A 1OZ1A 1UKIA 3LXPA 4QMWA 3WARA 4M84A 2PVRA 3KVXA 2JFLA 3QQUA 1ATPE 3IECA 1OPJA 5LVPA 1A48A 1QPDA 3LMHA 4R3CA 3C4FA 3UIXA 4GT4A 1PMVA 3GCSA 5L3AA 3P7BA 3FLSA 3KB7A 4BDCA 2QU5A 5DR6A 1PJKA 4DHFA 5EHOA 5HU9A 2GHGA 4OT6A 4I93A 3W10A 2UZUE 4FSYA 1H1RA 3MVJA 3FYJX 4E6DA 1PMNA 5TOZA 1UV5A 4CMUA 3DB6A 3BE9A 2BKZA 4LMNA 5ACBC 3AMBA 4RZVA 4O7RA 3ELJA 5D1JA 3LXKA 2ZJWA 3BU5A 3PY0A 5GJGA 4WNOA 3DDQA 3NW6A 3ORXA 3PXKA 1ND4A 4ANNA 4DGLC 2A1AB 2XM8A 1UWJA 4I3ZA 4FV1A 4E6AA 1KUTA 3GUBA 1ZWSA 5HU3A 2PVYA 2J0KA 3KXGA 4UN0C 4Z7HA 2BUJA 1V1KA 3FSKA 1ZAOA 5KKRB 5CLPA 2CGXA 4XYFA 4DCAA 5CU4A 2FSTX 3VUGA 1Q8WA 2QG5A 4E1ZA 3ZRKA 2CGVA 5CQWA 2OGVA 3DAKA 2CGUA 5D9HA 3ZYAA 4AGCA 4BN1A 1H00A 4OTRA 4UV0A 3MIAA 3Q52A 2VV9A 4GJ2A 3S4QA 5HO6A 1Q3DA 3PFQA 3R8UA 4WUNA 5KUPA 3EFWA 1S9JA 2QHMA 4K8AA 3R00A 5HNBA 4QTAA 2YACA 3FMDA 5AAFA 5L8LA 4F64A 2WTCA 3FL5A 3ULIA 3DJ5A 1Q5KA 4IVCA 4IZAA 2B9FA 5FTQA 5CT0A 3TZ8A 4CXAA 3L8VA 2GDOA 2OZAA 2QOCA 3DA6A 5T68A 1CTPE 4BBMA 5EW9A 3QX4A 4FTUA 2YM5A 4W4WA 3R28A 4MXAA 4ZSEA 4QQJA 5KHWA 4QYFA 3WF8A 5JFXA 3DQWA 4WKQA 2WB8A 5KX8A 4R77A 4ACCA 2R3FA 3EL8A 1OBGA 3F9NA 4QTBA 2YM7A 4MF1A 4QPSA 2VWVA 5B2KA 2P0CA 1YKRA 3QA8A 4QMXA 3HECA 4AE6A 3OT3A 4CFMA 4ZEGA 2XBAA 4DAWA 3ZEWA 2YISA 3P9JA 1KOAA 4O0RA 4OLIA 2UVZA 5HO8A 4FV3A 2DS1A 2CNQA 2YIRA 2HENA 3TDVA 2GHMA 4J96A 2VZ6A 1RE8A 3AG9A 4FTKA 4IB1A 3AT2A 3UYTA 4CFUA 4O84A 5M4UA 4DFLA 2UUEA 3MSSA 2W1ZA 4YJTA 4C4JA 3QTSA 2H9VA 4B0GA 2WNTA 1H1PA 4K9YA 1OKYA 1OUKA 2B54A 4L01A 4UBAA 4XBUA 5K3YA 2E9NA 4FUXA 3U51A 4AQCA 3PA5A 1E1VA 4I24A 2XK8A 2BR1A 2GQRA 3TZ9A 4QYHA 3W2OA 5CEIA 2Z7RA 4ID7A 3UZTA 2VWWA 2GTMA 4DFXE 1YVJA 4CV9A 4D5HA 5H2UA 3H9RA 4IM2A 5AR4A 5C9CA 3VQUA 3A8XA 4CCBA 5LXMA 4FKTA 3MFTA 2J0IA 4ANQA 4U40A 3R8PA 3U8WA 4DC2A 2R7IA 4M8TA 3VHEA 4J71A 4H1JA 4D9UA 3QKKA 3KGAA 4K6ZA 1ZZ2A 2XJ0A 4BDJA 2XK6A 3R71A 4JBQA 3VF9A 4QMUA 3TUBA 4LGHA 3FC2A 4YJVA 4MCVA 2UW7A 4D4VA 4HGEA 4BKZA 4BDIA 3E8CA 3R1SA 4JX3A 2QNJA 2OXXA 1DM2A 2FSOX 2YM3A 4AF3A 2Q83A 2AUHA 4RVMA 1JKSA 5FG8A 3BHHA 3VS2A 2J0LA 3NNWA 5GNKA 4R8QA 3UGCA 3BYSA 4E93A 2HOGA 3HP2A 4W8DA 3TI1A 3D7TB 2QVSE 4YSMA 2VX3A 5EI6A 3ZO3A 4J99A 4FSNA 5CSXA 4FGRA 3G15A 4XHKB 3IQ7A 1XH8A 3Q5ZA 3EN6A 4NJDA 2WD1A 4WBOA 4KIKB 3COMA 5AA9A 4F70A 2ITWA 2R0UA 4FVRA 2XJ1A 2CCIA 2ITXA 4RIXA 4F7LA 3DBEA 3I7BA 4DH7A 2PE0A 2XYUA 4IIRA 5AJQA 4FKLA 1ZYLA 1U46A 4JG7A 4BTKA 5KMIA 3S00A 4XV9A 3KEXA 4F9YA 4RIWB 3RVGA 4G17A 4C4EA 3FSFA 3FZ1A 3PA4A 3LXLA 4PTCA 2ZDUA 3CP9A 3LM0A 1P4OA 3QAME 4M12A 4ITHA 4F9WA 4QYGA 1XWSA 5CS6A 3QD4A 2OXYA 3ZMMA 3ZUVA 4IAFA 3HX4A 3CIKA 5KZ0A 2B0QA 1URWA 2C3LA 3IW6A 4FT3A 1M14A 4L67A 4NJ3A 2ZM3A 3K5VA 3T3VA 1E1XA 3QRJA 1VJYA 2BZHB 4JBOA 2PMNX 1YXTA 4BL1A 3C9WA 2I1MA 4FNYA 1V0OA 2QR8A 3ZU7A 5IF1A 3KF4A 1VYWA 3FLWA 3MWUA 4PRJA 4PTGA 3CLYA 4O1PA 4RC2A 4DFNA 5BX0A 3NUNA 1H4LA 3VBTA 3BLRA 1YI6A 3DBFA 3PWDA 4CG8A 5KMMA 5C8MA 3R02A 1YDTE 1Q8TA 4TN6A 3Q2MA 2C5OA 5K5NA 4TYHA 4F63A 4BDKA 2BZIB 4H58A 3CTJA 4BKJA 5FBNC 4ZSAA 2BDJA 3BYVA 2FA2A 5TF9A 4UMQA 3ZH8A 2XRUA 3EN9A 4QMSA 5HQ0A 4II5A 5FP5A 2QU6A 4AZTA 4MH7A 4V04A 3TV7A 2BIYA 4GUEA 2O63A 1XH6A 3OWKA 4JQ7A 4KWPA 4DFBA 4G16A 2XS0A 4L3LA 3LFFA 4OW8A 4RWIA 2WEIA 4HZSA 4R1VA 5AUTA 3R04A 5FUTA 3JR1A 3GXLA 2R3GA 4U8ZA 5I3RA 3SC1A 2GU8A 4LRJA 5AWMA 3VQHA 3R9RA 3COIA 2RFDA 2OIQA 3ZSHA 5AP3A 4WBBB 2R0IA 4QO9A 1UNGA 3HL7A 4FTNA 4K1BA 2XBJA 3WZKA 1OKVA 1X8BA 4G6NA 5FEQA 4QMOA 4ACMA 5BMSA 4BBEA 4DG0E 4KBCA 4G1WA 2BILB 1H1QA 3JXWA 4XOYA 4QQCA 1CKIA 3QTWA 2JKOA 2IG7A 4EH3A 2HXLA 3D94A 3DFAA 4HCUA 4GT5A 3KKVA 1SMHA 2FYSA 2VWZA 5HNIX 1GOLA 2ZV2A 1XH5A 5HTIA 5AR3A 4GKHA 3SLSA 5DG5A 1WAKA 4BF2A 1Q24A 4U44A 3PTGA 5HVJA 3UNZA 1OPKA 3HNGA 4JOAA 5EW8A 4L42A 4C34A 4DITA 4Y83A 4LM5A 4O2PA 2W1GA 4EHZA 2YABA 2CNVA 2JIUA 3FXXA 4JT3A 4N0SA 3R7IA 1DAYA 3RM7A 5LQFA 5A4LA 3IO7A 3D2IA 3SX9A 5AM6A 3QZFA 2ZOQA 1YWVA 1XBBA 5DYJA 4I94A 2WMWA 2OI4X 3P08A 3Q96A 1LP4A 3D5VA 5EI2A 2HW6A 2X81A 3FLQA 5JH6A 1CKJA 4FTJA 2BRBA 2EWAA 4GVAA 4RX8A 4J95A 4JR7A 3ZO2A 2CNUA 5KMOA 3FKLA 4JDIA 1UU9A 4LFIA 4B4LA 4B6LA 4CT1A 4GIIA 3FQEA 3OBGA 4G5JA 4IAYA 2GNLA 4DFZE 4P5QA 3P7AA 3W2CA 1DS5A 5CEOA 4EK8A 2IW9A 2B7AA 4EHEA 2I0YA 3R9NA 1OUYA 4O7WA 1JSUA 2BVAA 5BVKA 4HOKA 3MB7A 4V0GB 3UO4A 5BUEA 2W1EA 2OIDA 4U41A 5EKOA 5AR8A 1TVOA 3UE4A 3ID6C 5M53A 3VO3A 5J95A 4K0YA 3GQLA 2X4ZA 3I6WA 5CASA 3F61A 5IDNA 4KUJA 2JD5A 5BUJA 5TE0A 5AADA 4DG2E 3G6GA 3EIDA 3ZO4A 3GQIA 4YBJA 4TYGA 2HXQA 2CN5A 2R3JA 2CN8A 3QA0A 3MH3A 4UYAA 4MNEB 2Y4IB 2R2PA 5LARA 4F6SA 3BWFA 3QQLA 5FLFA 3WE8A 3EFKA 5A54A 5HTCA 3T3UA 3GGFA 3VBWA 5TO8A 3FPQA 4MXYA 2VTTA 3BHVA 4KD1A 4ZAUA 5DE2A 2QC6A 5EI8A 3VUKA 3QU0A 3ORIA 3II5A 4A9TA 4R5YA 4FVPA 2WTKB 5ETIA 4ORKA 3DB8A 3GU8A 3KF7A 2C5NA 4Y46A 4RJ7A 5JMSA 2WIPA 3VS0A 3PIYA 4IW0A 5ETCA 5F95A 4DYMA 3QCSA 2JKMA 3E3BX 3FY0A 4ZSJA 3W2RA 3DLZA 3ORTA 4FV9A 2HK5A 5DEWA 2R3NA 2XJ2A 4ZS0A 4FA2A 2OU7A 4I6FA 1GZKA 5CZHA 4IJPA 1AQ1A 2F7EE 2HZNA 3LQ8A 2XUUA 2OJ9A 3A61A 2P4IA 1MP8A 4EL9A 3L1SA 4BCMA 1WBNA 2QKWB 4YLJA 4ZTNA 4AW2A 2UVYA 4AN3A 3MVHA 2VWIA 2HWOA 2OF4A 3KK8A 1T46A 3TTIA 1CM8A 3W1FA 3BZ3A 5F9EA 3F66A 4FVQA 4GIHA 3MPTA 2ZV8A 4CFXA 3OTVA 4YJSA 4M0YA 2XRWA 3SQQA 1B39A 5M4FA 3ORNA 4FKRA 2WMRA 4X21A 3VIDA 5J7HA 5HG5A 4RVTA 5IDPA 1FVTA 4FKVA 4ANBA 4D2VA 4BCFA 5LOHA 4E26A 4TWOA 5EM7A 4C3FA 2C68A 5E8SA 2GS6A 2V22A 4GV1A 3FZOA 3FMKA 4E5BA 4EOSA 3PUPA 3A7FA 4R7IA 3FDNA 4WSYA 1XQZA 4A9UA 3VULA 1YW2A 3LFAA 3LFEA 1YXXA 3NVKI 2ITZA 3ZLWA 3TT0A 4MBJA 4ASEA 4MD8E 3QWJA 5EYCA 4WNPA 4PMTA 5K0KA 4FEUA 5KNJA 3BHTA 4BY9E 4CMOA 3D9VA 4IJ9A 1WZYA 3NW5A 2G01A 3SXSA 3WOWA 3NUYA 4AGUA 4EOPA 5LVNA 4IB3A 2ITOA 2A19B 5AX9A 3MS9A 4TXCA 4P7EA 3C4ZA 4L7SA 1OI9A 3RAKA 4BZNA 4ITIA 4PTEA 1ZRZA 4X6QC 3COKA 5EHLA 4K18A 3OZ6A 2H6DA 3U6JA 4DG3E 5DLSA 5D12A 4FZ7A 3DBDA 4HGLA 1VZOA 3VUDA 1IEPA 5CT7A 3MB6A 3E7VA 3DAJA 1YHVA 3NUXA 5HICA 5J87A 2WGJA 3EHAA 2WTIA 4ZP5A 3UC3A 3OHTA 2C6IA 4DEGA 4W4VA 3NIZA 4R1YA 3PSDA 4U79A 3UQCA 4EJ7A 4D2PA 1J7IA 2ITVA 3QRUA 1SZMA 3WZJA 4IWQA 1FVRA 4G3GA 5D10A 2OIBA 3MTLA 3PA3A 2BDFA 2HWPA 4IDTA 2WKMA 4L9IA 3O96A 3A7GA 4U42A 5FXQA 3E92A 4CZYB 4DGNA 4XG2A 4ALVA 5LVOA 3TKUA 3BYMA 3EQRA 4PV0A 4TKSA 4M67A 4WG5A 4J8MA 4ZY6A 2WFYA 4N57A 3OEZA 1WBOA 5CQUA 4HVGA 4O0SA 5CWZA 2BZKB 2BCJA 3DU8A 4X0MA 3RKBA 4KKGA 3CKXA 4ASDA 4D9TA 1ZYCA 4O7SA 1WVWA 1OIRA 4FEXA 3LCDA 5KMNA 3TKIA 5A3XA 2JLDA 4AS0A 3G0FA 3DZQA 3P86A 4UMUA 2CKQA 3QZGA 5EM5A 2QCSA 4CQEA 4RQKA 4ZTMA 2UZNA 5AR7A 3BKBA 3HEGA 3Q32A 5I3OA 4BCNA 3TNPC 5KMKA 1ZZLA 5F94A 2JC6A 4NU1A 2GS2A 1G8AA 3I81A 5CTPA 1K2PA 2OZAB 2QONA 4NM0A 2GNIA 5JRSA 3ROYA 3MN3A 3NNVA 4EORA 5DGZA 2OF2A 2G9XA 2QD9A 4X2GA 5DHJA 4FR4A 3BQRA 2JGZA 4W8EA 3HMPA 5CU2A 4IX4A 4CTCA 3UNKA 2W7XA 2ZV9A 3HV3A 1ZYDA 3KRLA 2OJGA 4J7BA 4QP9A 2YCFA 5FXRA 5HX8A 3TEIA 1JPAA 4KB8A 4LRKA 5A9UA 5IQGA 3ORZA 4CTBA 4RIYB 2W1DA 4BWPA 3G9NA 3PJ1A 4I5PA 5A6NA 3RCJA 2WMBA 4OTIA 3Q9XA 4EC8A 3LKMA 1OL2A 2JAMA 3TNHA 5JN2A 1XJDA 4FMQA 5FXSA 2PU8A 1QPCA 4XG8A 1PXIA 5E91A 1UVRA 2XIXA 3WZEA 3OXZA 3ZC6A 4UMRA 4ERWA 1RQQA 3BGZA 2CLXA 3JPVA 1YOLA 2VTRA 3OG7A 4IX6A 5E8UA 3O8UA 2VTPA 4G3EA 3AQVA 5HNGA 4MXOA 4MYGA 3R9OA 3UOKA 4EK4A 2XF0A 5HX6A 2CPKE 1QCFA 4NSTA 4E8AA 5FWKK 3Q4UA 3SG8A 4FNWA 5EHYA 3ZFXA 3GI3A 3JYAA 2ZDTA 3SOCA 2VUWA 5L2QA 3QHWA 3R9DA 4FKUA 3I7CA 2A0CX 4G34A 3E87A 3NYOA 4YZDA 4P4CA 4L52A 4DEDA 5CAVA 3I6UA 2OKRA 5I9VA 2I7QA 4BB4A 1RW8A 3PY3A 3AMYA 3LZBA 4Q9SA 2PK9A 1IAHA 4EH8A 2UZBA 3GC0A 5EFQA 3ETAA 3V8TA 4MBLA 3NRMA 5FQDC 4IVAA 2Z2WA 3DGKA 4NW5A 3K54A 4RVLA 3ORMA 4U7ZA 1R39A 4D58A 2Y7JA 2YCRA 4ARKA 4IM3A 2YM4A 3RPYA 4DFYA 4F99A 4I0SA 4AWIA 3IS5A 3EZRA 5C1QB 5CAQA 3BBWA 5BVWA 5LVMA 3U9NA 3V5LA 5HBHA 3HZTA 3AD5A 2YEXA 3F5GA 3D14A 4WT6A 4EHGA 1V0PA 3V6SA 4ZJVA 4YZCA 4ZZOA 4DBNA 5E8TA 4BDBA 1KE8A 4JIAA 5LVLA 3BPRA 3UVQA 4LOOA 4ZZMA 2EB3A 3SA0A 2YZLA 3R8VA 3LFBA 5CENA 5IEVA 4OTDA 2XKDA 3UVRA 5D7VA 3Q6WA 5EDPA 5IMEA 1H27A 3T9IA 5ANOA 2XIYA 3ALOA 4U9AA 4CV8A 3UZRA 4D0XA 3BYUA 3MBLA 3MI9A 3VRZA 2XIRA 3BE2A 4ANMA 1WMKA 3B2TA 2A27A 2XVDA 3D83A 4FIIA 3NUPA 4JLCA 4UWBA 1PW2A 3SV0A 5A4QA 3P7CA 5FM2A 3RZFA 2JDOA 2HZ0A 4CZTA 4RIXB 5IEXA 4RJ8A 4QD6A 3H9OA 3QFVA 4Y95A 1LEWA 4CEGA 4YO4A 1XH7A 2WQMA 3ZDIA 2JITA 3E8EA 5I5ZA 3F3ZA 5AV3A 3GCUA 3WYXA 5IQEA 4AE9A 3E8NA 3VUHA 1WVYA 3REPA 2KTYA 3U87A 2F2CB 2C5YA 3CJGA 4FL1A 5BPYA 4EBWA 2Q0BA 5E8WA 1JKKA 4B7TA 4DCEA 4NEUA 3QALE 2OSCA 4JDHA 4RFYA 2HZ4A 1JBPE 4O27B 4MHAA 4XG3A 2FGIA 3L9PA 2SRCA 5CZIA 4U3ZA 2X2LA 5IUHA 4FIJA 2PZ5A 2R3LA 4EK3A 3CD8A 4B8MA 4DLIA 4AOJA 4CFWA 3BEGA 3I4BA 5IH4A 4AAAA 3H3CA 4C02A 4I4FA 2LGCA 2X9FA 2JBOA 3SW7A 3GNIB 3FBVA 1BL7A 3ZO1A 4IBMA 1KV1A 3KN6A 3QX2A 5FTGA 3QLFA 1JNKA 5J9YA 5ITAA 3KMUA 3PE1A 2R3KA 3DCVA 1OPLA 1UWHA 2E9UA 4DN5A 1YDSE 3C50A 4PX6A 3SD0A 1P2AA 4G6LA 1OM1A 2NPQA 2PMOX 4TYIA 3C0GA 4FNZA 1OIQA 2OJFE 5AV0A 3POOA 1OBDA 4TWCA 5FEDA 4F1OA 3ZTXA 4QNYA 2PULA 4FV6A 2VAGA 2VTQA 3DK6A 3Q4ZA 3V5PA 3EQFA 1UU3A 2YDKA 3ZBXA 5HCZA 4E6CA 2F7ZE 4HNIA 2ZVAA 5CEQA 5IQIA 4MQ1A 1PF8A 4FTAA 4XH6A 4JXFA 5E7RA 4M3QA 3RK5A 3KFAA 3UYSA 1Y8GA 4A4OA 4X2FA 2WTJA 4BC6A 4EHVA 4O7ZA 2PUUA 4JIKA 4F08A 4F0FA 5C01A 1OKZA 2XEYA 2O5KA 2PSQA 4PDOA 2RIOA 4AGDA 2HY0A 1Q41A 4CVAA 1JSVA 4TT7A 2PMLX 2Z7SA 2RG6A 3OCGA 2WIHA 3LCOA 2XMYA 4G9RA 5BYYA 2W9FB 2X8EA 3AD6A 3VN9A 4KNBA 3ZZWA 4QRCA 2Y6MA 3FQHA 3A8WA 2VWUA 3BV2A 1BKXA 3TIYA 4ASZA 5M09A 1AGWA 3QTZA 1ZARA 5DT4A 4OTGA 1UKHA 3NDMA 3Q9ZA 4RJ5A 3EFJA 4YJUA 4RIOA 5A46A 5C27A 4O0TA 3GENA 5IKWA 5I4NA 4DEEA 1J7UA 3SGCA 4FEQA 1CKPA 1IR3A 4MXCA 4XS2A 5CAOA 3I0OA 2DUVA 1IAJA 3QCXA 5AUVA 4BDGA 3LXNA 3OW4A 3F2AA 3MY1A 4AZEA 4EUTA 2YJRA 5CNOA 1B38A 3OEFX 4D2WA 3KC3A 2RG5A 4EZ3A 4FKSA 4JVGA 4L44A 5AAEA 3LW0A 1GY3A 3HUBA 1XH4A 3RWQA 4NZWB 5HG9A 1WVXA 1YQJA 3IOPA 3QUEA 3DNDA 3E7OA 3KU2A 1M52A 3NR9A 4BI2A 1JAMA 1WBSA 4Q5EA 4I5MA 3NCZA 4UMPA 4BHZA 3H0ZA 3EN4A 3LMGA 3MY0A 4B99A 3DXQA 1CDKA 4QT1A 3TNWA 2C6EA 4EI4A 5DVRA 3QD0A 3E63A 3AC2A 3RWPA 2R5TA 2DYLA 2Z7LA 4GVJA 5E1SA 3PVGA 4IADA 5B2LA 4BI1A 4U6RA 3W55A 4QP6A 3VJNA 3VNTA 3IW5A 4L3PA 2Q0NA 3V5WA 3BLHA 4W4YA 4M97A 5LMAA 3ZC5A 3IDBA 2Z02A 4KKEA 2C3IB 2JDRA 1Y6AA 3BELA 2OICA 1Q8ZA 2G2FA 4O96A 5F20A 3KXZA 1OL6A 1KE9A 4XLIA 2WHBA 3NLBA 1H8FA 1A9UA 2XB7A 5E1EA 1G3NA 4FEVA 2EU9A 2I0EA 4D28A 1FGKA 4IH8A 3DKOA 4QP3A 4CMTA 5AEPA 4U45A 4BDEA 3AC3A 1MRVA 3QBNA 4BZOA 1B6CB 5DNRA 3MESA 2IW6A 2YAKA 3R7UA 4FYOA 3CPCA 2GTNA 4UZDA 1P5EA 3IW8A 1YHWA 4CD0A 2RF9A 2X9EA 2CCHA 3ZS5A 4BVUA 4Y85A 2YJSA 1OGUA 4RVKA 3FKNA 3TACA 1BL6A 4GFOA 1F3MC 3HMMA 4EQCA 3R83A 3PJ8A 4O91A 5HI2A 1H0WA 2QODA 4Y72A 4I4EA 2Z60A 4AT4A 3DQXA 3HDNA 2C0OA 3JS2A 2EXMA 4M0ZA 3RAHA 3GCPA 5I9UA 2ESMA 3D5WA 4F6WA 2R3HA 3PZEA 5HBEA 4IAZA 2IZSA 5D7AA 3MW1A 3KRRA 3QL8A 3V5JA 4H3QA 2BDWA 3MFUA 4X6RA 4OBOA 5HZNA 4G6OA 5DIAA 2GCDA 1BLXA 2GSFA 4N4SA 5AUXA 2PY3A 2DWBA 4CG9A 3FQSA 1KSWA 4AZFA 3V3VA 5IH6A 3OWJA 1R0PA 3CTHA 2YLFA 2PVHA 4O1OA 4RWKA 2CKOA 4HVSA 3SXFA 4FTOA 2OFVA 4XUFA 3W8QA 1SVEA 4EZ7A 3BGPA 1YOMA 3I1AA 3QCYA 4S33A 2W1HA 4CFVA 3O8PA 2NP8A 4FTMA 5C26A 2QKRA 5HIDA 2PZIA 3TM0A 4NIFA 4ANLA 5T6KA 3MJ2A 4KSQA 4YHFA 4EK6A 2UW8A 4DBXA 3R63A 3UJGA 4FTLA 3TV4A 3EZVA 3HRFA 4I5HA 2RFNA 4FKOA 4BFMA 2WAJA 2QR7A 2W1IA 5AP2A 4ENYA 5ETAA 4ERKA 4M13A 2W4OA 4YUQA 4YURA 1O9UA 4D1SA 4PPCA 4TY1A 4AUAA 3RBWA 4YMJA 2IPXA 1SNUA 1PXPA 3DK7A 4O6EA 4LI5A 4WG3A 3VS4A 3NNUA 5A4EA 5IQFA 3OY3A 2P2IA 4JG6A 4E7WA 4BCQA 2IJMA 3FI2A 4OAVB 2YZAA 4U3YA 2C3KA 4IZYA 4GU6A 5CI6A 2QO2A 1OB3A 3CY3A 4DH3A 1MQBA 3QGWA 3OCSA 4LMUA 1GZ8A 4AX8A 3JY9A 1M2QA 3P4KA 4GMYA 2X2MA 4X3FA 5DI1A 3M42A 3P5KA 3PP0A 4DEHA 2UZLA 4X3FC 5G1XA 3UIMA 2WOUA 3G90X 3ZFYA 5HG8A 4QP2A 2YCQA 2XM9A 1H01A 3MA3A 4XG9A 3VRYA 2J2IB 2YHVA 1GIHA 4Q5HA 3HAMA 4M15A 2PMIA 3UIBA 5JKGA 2CLQA 3C7QA 1G5SA 3CQWA 1H0VA 3DBCA 4BWKA 2GNGA 1ZYJA 2ITYA 4FI1A 2V7AA 3LQ5A 4C57A 2GMXA 4ZSLA 2XP2A 3G5DA 4CLIA 3RPRA 5J5SA 3WZDA 2PVFA 3TKHA 4GEOA 4FNXA 3KCFA 3GBZA 4C8BA 2XK3A 4JBPA 4YZNA 4HYUA 3F3UA 3VC4A 4FG8A 4JI9A 3F5XA 4BTMA 4L53A 4KBKA 3S3IA 2UZOA 3I5NA 4PDPA 4WNKA 5EYKA 3QQFA 3U54A 4EWQA 5BVFA 3RCDA 3FI3A 2Y4PA 3KA0A 3QLGA 1IA8A 5AP6A 4EK5A 2A2AA 4WRGA 5DFPA 3UMWA 5FTOA 5FM3A 4CGAA 3DPKA 3F2NA 3WZUA 4PY1A 4E73A 4GYGA 3FXZA 4GSBA 2X1NA 4YZBA 3EQCA 5HESA 4E3CA 3KULA 4CT2A 4FSTA 1K3AA 3BX5A 3UDBA 3M1SA 3R30A 4XLVA 5IQAA 3JVSA 2IVSA 5KCVA 4C37A 1MUOA 4FSZA 4FSQA 5CALA 2PUIA 4FV2A 4EONA 3CTQA 4JJRA 5BQ0A 1QPEA 3NZ0A 3BBTB 4YPSA 3W8LA 4F6UA 1DI8A 2OG8A 3BU3A 4QQ5A 3WF6A 2J0MB 3AMAA 3DTCA 1APME 3TCPA 5EKNA 2QHNA 5BYZA 3MY5A 2VTAA 5HD7A 3QXOA 5AUUA 3R7YA 4FKWA 3UQGA 4UXQA 5C8KA 3LOKA 4CNHA 3HV6A 4TW9A 4O7TA 5D41A 1S9IA 1CMKE 5FGKA 1OL7A 1JKTA 1QL6A 4DH5A 2W0JA 4FZ6A 5K0XA 4FSWA 5L2WA 1M7QA 3A60A 3CPBA 2JKKA 2PZRA 5T3QA 3W18A 5IA3A 5A4TA 3QQJA 1G8SA 3DJ6A 1F0QA 1W7HA 3AC8A 1Q4LA 2W05A 3BWJA 5CXHA 3T8OA 1GZOA 4FL2A 3KCKA 2PYWA 4EQMA 2O3PA 2BZJA 2X7FA 4AGWA 5IU2A 3KXHA 2XK4A 3O2MA 3R01A 4BWXA 1TQIA 3ULZA 2EXEA 2V62A 4FT9A 5F4NA 3LMIA 5HLPA 2YAAA 3VHKA 4P2KA 3HDMA 1ERKA 3IW7A 1GZNA 3IDPA 4QOXA 4V05A 5ANDA 3SDJA 5I9ZA 5AM7A 5HE2A 5B7VA 2HIWA 5KE0A 1VYZA 4AU8A 2OLCA 5ICPA 2QOIA 5DH3A 4X3JA 5HHWA 2P55A 2B53A 2C5XA 4XV2A 5K5XA 4FEWA 4NM7A 1GAGA 3L9LA 4HNFA 4GK4A 5DRDA 1K9AA 3PIXA 3TIZA 4AFEA 1REKA 1IASA 3ZCLA 4C4FA 4EH7A 4USDA 3L9MA 3QHRA 4YNEA 4AZSA 5DA3A 4WIHA 2YIXA 4BIEA 4F7SA 4QMTA 5K4IA 5KHXA 2PUNA 3HMIA 2JIVA 4IDVA 1BI7A 4FTRA 4FK6A 2J4ZA 2WXVA 3EWHA 3MVLA 4LV5A 2W4JA 3R2BA 5I0BA 3M11A 4YNOA 2V0DA 5AR2A 3U4WA 4B9DA 4DT9A 2WOTA 3G51A 2UW5A 3HV7A 4CYJA 3VS6A 1W0XC 2BRGA 2XKEA 4AOIA 4MXZA 4HZRA 3C5UA 3TXOA 5H8EA 5HO7A 3DY7A 2E9OA 5AV1A 4Z16A 4JRVA 4YLKA 5IA5A 4UXLA 2X6EA 1NY3A 2VU3A 2YITA 3HA8A 3R2YA 3CBLA 4GL9A 3V01A 5LMBA 2WQNA 4LV8A 4EQUA 1BMKA 4YO6A 4KRCA 3IKAA 3D7TA 2VTNA 4GFMA 2BALA 5BNJA 3CQUA 3MFSA 2X7GA 4LQMA 5DRBA 4JR3A 4FKJA 3SW4A 4IAKA 2VRXA 5DWRA 3FWQA 3R8MA 4C62A 3LLTA 2EXCX 5HOAA 3ZM4A 5DMZA 2ITUA 4PDYA 3ATSA 1ZMWA 3LJ1A 4CKRA 3DBQA 5IUIA 3PVWA 5J79A 4JAJA 3ZBFA 3P78A 4RLLA 3UO6A 5GJFA 2H8HA 3RINA 2XIZA 1I09A 2WTWA 3QZHA 3KXMA 3DFCB 2X6DA 2RFSA 3RI1A 4ALWA 4O7LA 3HRBA 4KA3A 4Z9LA 5JGBA 5DN3A 3EFLA 4ZIMA 1Z57A 3SKCA 2AC3A 4Y73A 5CF5A 5IMXA 4O22A 3OTUA 5HVYA 3FZRA 3ZXZA 1STCE 2BRHA 2VO3A 4AXAA 2PPQA 2NRYA 1E9HA 4RFMA 1YDRE 4XG4A 5CYIA 3LIJA 2XEZA 3O0GA 5L4QA 1QMZA 3PP1A 4ZLOA 3F2RA 4DTKA 3UPZA 5C8NA 4EYMA 3K3IA 4RX5A 1H25A 4KKHA 2F49A 4FK3A 5TT7A 3TZ7A 3NUSA 3QD2B 3TL8A 4QTEA 1PMUA 4GW8A 1ZMVA 4NW6A 2CDZA 3HKOA 3EQHA 4OBQA 5EYMA 1FOTA 2UZVA 1F5QA 3QD3A 3OT8A 4FTTA 4U97A 3RM6A 3THBA 5AFVA 4HVHA 4JDJA 4ZTRA 3V5QA 5IA2A 1FGIA 2JDSA 1PHKA 4OBPA 3T9TA 5AA8A 3P0MA 4JG8A 3ENHA 5J5TA 5JFVA 3WF9A 3G6HA 4MTAA 1H24A 4FICA 4IEBA 5GZ9A 4C3PA 3DTWA 3NSZA 4R3PA 5HE0A 4KS8A 2E9PA 3JUHA 4BIBA 3HV4A 2WQEA 4O7NA 3BHYA 2EB2A 4MF0A 5CVGA 3DT1A 3UOHA 2WELA 4LGGA 4E5WA 1PKDA 3IONA 3Q9YA 4LL5A 5CX9A 4RFZA 4Y5QA 5E8VA 4GK2A 4TL0A 4XJ0A 4EJNA 1XKKA 4PL5A 5G6VA 2PVMA 3EKNA 4YZMA 2V5QA 3VW6A 3NYXA 4RBLA 3C51A 3EKKA 3ZUTA 3AXWA 2UV2A 1KE6A 5E9EA 2W99B 2X0GA 4WOVA 1L8TA 3ATTA 2QOBA 3BIZA 1OL5A 4ZTLA 1ZXEA 4DT8A 3FC1X 2ONLA 3POZA 3KMMA 2C6LA 4JS8A 4ACGA 4QMQA 4H1MA 1J1CA 2ONLC 1H07A 2GPHA 4HVDA 5CSPA 2R4BA 3SVVA 4R78A 2WMUA 4PP9A 4WG4A 4FTIA 3O7LD 3W2SA 4C36A 4HYIA 5H8GA 3R9HA 2BAQA 2IN6A 4IVBA 2ZB0A 3IPHA 4TZRA 5BVNA 5JQ5A 4I21A 3GP0A 4ZSGA 4M66A 2XCKA 4CLJA 5CU0A 2WMQA 3EQDA 3GC7A 1UU7A 3O23A 4MQ2A 1O6KA 3EL7A 3FKOA 3FHRA 3LJ0A 3NGAA 2BTRA 3OXIA 4G9CA 3SHEA 2WMTA 4KINA 4BCHA 4D1ZA 3BHUA 3TJDA 4TWNA 3W16A 4MWHA 3D7ZA 3CD3A 5IZFA 4FG7A 4IZ7A 3A7JA 4DEIA 3QRKA 3D2KA 4XV3A 5JZNA 2VWYA 4CRLA 4FV4A 5FRIA 4D55A 4HGSA 2PUPA 2H34A 4FL3A 3HV5A 2GNHA 2I6LA 5EK7A 4C3RA 3EYHA 4DLJA 3PXQA 4MKCA 3ZFMA 4YJPA 2QOLA 2VX0A 4ZTHA 1Y8YA 4N6YA 4YLLA 3DKCA 2OH4A 2C47A 2FO0A 4GYIA 2O64A 1R0EA 4GT3A 4DEAA 4W9XA 5EQEA 3OFMA 3GU6A 3E8DA 3EB0A 3LPBA 1PY5A 4ONAA 4QP4A 5E8XA 4D2RA 5IQBA 5I9YA 4AZWA 3PXFA 4BDFA 4CRSA 1UA2A 4PPBA 4ZMEA 4IXPA 1MQ4A 3JVRA 3PPJA 3OOGA 4XRLA 3R7VA 5FDXA 3IK3A 3UO5A 3FYKX 4RX7A 4AN2A 3N4VA 1IA9A 3OOMA 5EOLA 3TTJA 3PJ2A 5IUGA 4TRLA 1U54A 2GS7A 3P23A 4IFCA 3UBDA 4EKLA 4QPAA 4UWCA 4QMPA 3ERKA 4H39A 1R1WA 4G31A 3IDCA 3GB2A 4CZUA 3F5UA 3LFCA 4USFA 4QP8A 2OH0E 5C4KA 1A06A 2C0TA 1CSNA 2B52A 1M17A 1FQ1B 4K33A 5DR2A 3TJCA 1BUHA 4G5PA 4DE4A 4K11A 2F57A 4ZOGA 4I6BA 4EWHA 4F1MA 2VWXA 3BQCA 3GOKA 3Q60A 4FOCA 1URCA 2HELA 3PLSA 4RRVA 4QP7A 4F9CA 1ZY4A 3V6RA 3KK9A 3FL4A 3PVBA 2CMWA 3TWJA 2YFXA 3DDPA 4I22A 4NTTA 4U5JA 3RNYA 4DH8A 3Q3BA 5DOSA 4EOLA 3E62A 3R1QA 4NFNA 4AOTA 1WCCA 5HTBA 4ZLZA 3BI6A 4IC8A 2UW3A 4FV5A 5L2IA 3VBYA 1YI3A 3CXWA 4RGJA 4YJRA 3OXTA 3GFWA 2W17A 3V5TA 3BEAA 5CF8A 2XNPA 3R73A 3C4CA 3I5ZA 4Y8DA 2VGPA 2JAVA 3FZSA 3AC1A 4FSMA 1OIUA 5K4JA 5CF4A 4KRDA 4JQEA 4ZZNA 5JGAA 4RSSA 3NIEA 5HE3A 3RHXA 4CSVA 3ZXTA 1TQMA 1WBVA 3IGOA 4QMMA 3CGOA 4FGBA 1WBPA 2X7OA 3RALA 3ET7A 3HVCA 5IQDA 4J52A 2RL5A 4ALUA 5H3QA 4KABA 1ZOHA 5BUIA 2J51A 4NWMA 3U6HA 2IZRA 4FC0A 3AT4A 3VVHA 4NH1A 4MVFA 3O51A 3QKMA 2C1BA 4FF8A 5FD2A 3FMEA 3LFNA 2QQ7A 5M08A 2BIKB 2XNNA 3R7EA 4YPDA 3QF9A 4KSPA 1Y57A 2O65A 2G1TA 2GFCA 3ALNA 5AUYA 5HIBA 4F4PA 4AT3A 2RSVA 4AA0A 2OJJA 3JY0A 4JDKA 5EM8A 2WQOA 2Y6OA 4C33A 4F0IA 5L8KA 3DS6A 4TPTA 4UWYA 5CNNA 2PE1A 4AFJA 5BVDA 3D5UA 3E88A 3RPVA 1SNXA 4L8MA 2VGOA 4I5CA 4QMLA 4EYJA 4L43A 3S1HA 2C6TA 3FLYA 2PVLA 3R21A 4DGGA 3OP5A 3FLNC 5HCYA 2XH5A 3OWLA 1J7LA 4ZXTA 4F7NA 2QOOA 4NIFB 4O0YA 4A4XA 1NA7A 4DH1A 4EBVA 4FE2A 5TR6A 3OROA 2VTSA 3L8XA 3OY1A 4NCTA 4GH2A 1RDQE 4UALA 4X7QA 5AUWA 4ZS4A 4GKIA 5IQCA 5AMNA 4NCTC 4XX9A 4E4MA 4GK3A 1Z9XA 3FJQE 2YA9A 5GIPE 3K3JA 4I20A 4IB0A 5I9XA 4S34A 4TYHB 3VS7A 5BVOA 4EKKA 2FSMX 5M4IA 3O8TA 4D2TA 3RPOA 3TNIA 3QC9A 4NKSA 2QURA 5JQ8A 3NUAA 5BMMA 2BRMA 4FV7A 4R7BA 3IOKA 2BPMA 2VO0A 4L46A 5EG3A 2P2HA 5JGDA 3N4UA 4I0TA 2ZM1A 4TWPA 2CSNA 4O83A 3PDTA 2YCSA 4ZTQA 2BROA 4YC3A 4U43A 4X3FB 4CKIA 3MJ1A 2QLUA 3HA6A 1PXOA 3TNQB 1ZOGA 3PJ3A 3PRIA 3V8SA 3H9FA 5CAUA 2YN8A 3ODYX 3EN7A 3CJFA 3ENMA 3VUTA 3HLLA 4A9RA 1UNHA 2J50A 3GC8A 3PXYA 1YXVA 3R0TA 3H4JA 2J5FA 4XEYA 3PLAE 4E5AX
chains in the Genus database with same CATH superfamily
1SYKA 1YWRA 2REIA 3LM5A 3NEWA 2OK1A 2ZMDA 2OWBA 5BVEA 3ZRMA 3DKFA 3C5IA 3DLSA 4C2VA 4RC4A 4E4LA 4ASXA 2FB8A 3FMJA 3HYHA 4YHJA 3WBLA 3W0RA 3NAXA 4NKAA 3RHKA 3S2PA 3VUMA 4LYNA 1YXUA 4XRJA 4YSJA 3CS9A 4XOZA 1XR1A 5K9IA 4NYEA 3AT3A 4GFGA 4I41A 4L7FA 5GIOE 4OTPA 2C6MA 5LCJA 4EOMA 4IANA 5HCXA 3MYGA 2BFYA 3V8WA 5CEMA 2R3MA 3F7WA 2G2HA 2QOQA 1NVSA 3ORPA 3Q4CA 4C38A 5CEPA 2C0IA 4EEVA 3MH0A 5GHVA 4W9WA 3F88A 1ZYSA 4LOQA 4UZHA 4N70A 4UY9A 2EVAA 2HAKA 4KIPA 4AACA 3WE4A 4AT5A 3HGKA 3KULB 1TQPA 2BKKA 4BJJB 4U81A 5C03A 2JIIA 4R3RA 2B1PA 5M44A 3PG1A 2ETKA 2C69A 3R7GA 3EH9A 3F6XA 3EYGA 3FMNA 2HCKA 4FT7A 4ZY5A 1NVRA 4DGOA 3PZHA 3Q6UA 3BLQA 5HORA 3MPMA 4O7YA 5L8JA 4QTDA 4ZJIA 4K77A 4MX9A 4ITJA 4MK0A 3LQ3A 4HCTA 3RAIA 3Q4TA 3B8QA 3KMWA 3UP7A 5JFSA 2UW6A 3CE3A 4BYIA 4RIYA 4JNWA 3C4WA 3NS9A 4FIEA 3KRJA 3UC4A 2VTLA 3C4XA 2ETMA 2R9SA 3BYOA 4FV0A 4I92A 4BDAA 2OBJA 1Q61A 5ANGA 3SRVA 5EQPA 2V7OA 4M69A 3COHA 1KE7A 2WPAA 4D1XA 4OTWA 4WA9A 3U4UA 1P14A 3DV3A 3R6XA 2P3GX 3A7IA 4PWNA 2J6MA 3A99A 3RNIA 3PXZA 4IX5A 4JMQA 4E4XA 1PXNA 1OKWA 1ZMUA 3D15A 3O71A 4RZWA 3RMFA 3OCTA 5J7BA 3DNEA 5CSWA 5M4CA 3OUNB 2ZMCA 3F5PA 3LJ2A 1BYGA 4FT5A 4P90A 4ZY4A 4BCPA 4DFUA 1QPJA 4DGMA 5EYDA 2AC5A 4IE9A 3CC6A 1XMLA 4RX9A 1Q99A 5KMLA 1KOBA 2E9VA 5J9LA 2WZJA 3W2QA 4O4BB 3FPMA 3ITZA 3OWPA 4DEBA 4S30A 1GIJA 3CGFA 1EH4A 3QTXA 4O0UA 4PMSA 2BTSA 4BYJA 3IGGA 5GZAA 4XCUA 5FP6A 4H36A 1XBCA 1J1BA 4IFGA 1AD5A 2QOFA 1Q62A 3H30A 1H26A 3MIYA 5ANEA 3TG1A 4XMOA 4XP2A 4HYHA 4TTHB 3PYYA 5CI7A 3N51A 4JL9A 3EN5A 1BX6A 3RGFA 2OFUA 2VO7A 4BCJA 3UVPA 2IVUA 4DHIB 3UODA 4TNBA 3NW7A 3CEKA 5EDRA 4R5SA 3PSBA 5CXZA 1GIIA 1HCKA 3OVVA 3ACKA 3C0HA 2HYYA 2B55A 3E5AA 4EOIA 4KIQA 4PL3A 3ZOSA 2I40A 5AAGA 3R8ZA 4FG9A 2ZV7A 4QPMA 3UNJA 1W8CA 3FUPA 3NMUF 3VJOA 4RWLA 3BCEA 4YJOA 2AYPA 5CEKA 3UOJA 2W5BA 5DR9A 1UU8A 4QMYA 4RA5A 1Q8UA 3EQPA 4NUSA 2F7XE 3HMNA 3A2CA 4M14A 5AUZA 3DK3A 2W1FA 3ZHPC 3LFQA 3E3PA 3NNXA 4I6QA 3FI4A 1HOWA 1FINA 1Z5MA 2GQGA 4IWPA 2RKUA 3LCSA 4OTFA 4PNIA 4ZTSA 4Z3VA 4A07A 2VTMA 1M7NA 2KULA 4J53A 2W5HA 3LAUA 2V55A 2QO9A 4UB7A 3RJCA 2Y8OA 1G8KA 3I79A 3VS5A 4FKPA 5A6OA 3UIUA 2P33A 3N4TA 2YM8A 5HGIA 3KVWA 3A4OX 4LGDA 2GFSA 4YJQA 5L6OA 4M7IA 2YDIA 5IA4A 4IZ5A 4APCA 2FH9A 2VNYA 4XNEA 2XNBA 4MAOA 4XBRA 1KE5A 1YOJA 4FSRA 5HLNA 2IW8A 3ZEPA 5HIEA 3O17A 2OXDA 2A4LA 3NAYA 1I44A 2NO3A 2R64A 5M07A 4HJOA 4G3FA 5ANIA 4YBKA 4EH4A 3CR0A 5IEYA 4IHPA 5ETFA 3HP5A 1XBAA 1H28A 3KN5A 2C30A 2X2KA 4IWDA 4QYEA 2YERA 5L2SA 2W5AA 5AV4A 3EQIA 3TZMA 4F0GA 3PY1A 2IVTA 3MDYA 2XZSA 2R3IA 2J90A 1U5QA 3ACJA 5E4HA 4EUUA 4YTIA 5EM6A 3NYNA 4FX3A 4JQ8A 5EW3A 1PYXA 3QTQA 4RC3A 4WD5A 1LUFA 1WFCA 2XA4A 2VNWA 4C58A 5LJJA 4IMYA 4NK9A 5TKDA 3ZRLA 2ERKA 4E20A 4GS6A 5CSVA 5DT3A 2Z7QA 2I0VA 3O7LB 2BRNA 4G3DA 2F9GA 5A14A 2EUFB 3G9LX 1Q3WA 2IWIA 3FZTA 4FV8A 4O0VA 3ZUUA 3DKGA 4FOBA 3C0IA 2XCHA 5DPVA 4IB5A 5IQHA 2YWPA 2WTDA 5KKRC 2VTOA 2Z8CA 2ITPA 1PYEA 3PPKA 4O4CA 3TV6A 3UG2A 3WI6A 4QP1A 1PRYA 4J1RA 4F65A 3GEQA 3MV5A 4N6ZA 4F9BA 2YIYA 2X4FA 3QUPA 2O0UA 2RFEA 3PXRA 4GUBA 4KS7A 1FMOE 3QRTA 1PXJA 4A7CA 4YGAA 4AA4A 4YU2A 1Y91A 4YJNA 3NVMB 2W1CA 4RQVA 3TUCA 4F9AA 1M2RA 1M2PA 2B9IA 3MTFA 3QTRA 4NT4A 2CKPA 1VEBA 4L68A 3ZM9A 2JDVA 2O8YA 4FUYA 2BHHA 4YC6A 3LE6A 4MXXA 3IG7A 3R1YA 3KREA 2XNMA 4R7HA 5IA0A 2UW9A 5CF6A 4EH9A 1H1SA 5E8ZA 5AP0A 5E92A 4CYIA 1V0BA 1W82A 4C59A 3UDZA 3U55A 4C61A 4MNFA 3AGLA 3TUDA 3BV3A 4ANOA 2QI8A 2PZPA 4DINA 4KBAA 3FY2A 4IX3A 3QXPA 4OR5A 4DBXA 2C6DA 1OVEA 2CGWA 5BYLA 5B2MA 4PMMA 4RLKA 3G0EA 2C4GA 5AP4A 4C0TA 4LOPA 5FBOA 4BTFA 4EOJA 4Y5HA 5EH0A 5B0XA 3ANQA 4BDDA 4X2NA 4U0IA 4HVIA 4YTFA 3KQ7A 4O38A 2HW7A 3QRIA 1FBNA 2C5VA 4IAAA 5AX3A 2GHLA 2NRUA 3I0QA 2C3JA 3Q04A 5CSHA 2JFMA 1KWPA 2J7TA 4S32A 4TYEA 4HYSA 5AR5A 5LCKA 3RTPA 1OMWA 3VS3A 4PUZA 5ANKA 4OTQA 5M56A 3UOLA 3RK9A 4BKYA 4BCIA 3UZPA 4BGHA 2R3RA 4OUCA 3F3VA 3F3TA 5A4CA 3D5XA 2ZB1A 1RJBA 3EQBA 4AP7A 4BIDA 4O0WA 5AIKA 3ZZEA 3CQEA 4BRXA 1DAWA 1OECA 3R7OA 4RJ4A 2CJMA 5GZ8A 1UNLA 3CKWA 1MRUA 1U54B 5LWNA 4IQ6A 1W98A 3G2FA 2ZYBA 4FKGA 2W06A 4FBXA 1O6YA 3G33A 3KRXA 4FIFA 2WEVA 4OT5A 4D4SA 4PL4A 1R3CA 4G3CA 2XK9A 3DJ7A 3ZLSA 2FVDA 3AKLA 4BTJA 4PP7A 2XK7A 4MEDA 1GJOA 4PF4A 5D11A 4RT7A 4E4NA 3S95A 1FVVA 2E2BA 2HY81 2WMVA 4ANSA 2PHKA 3LFSA 4A06A 4E6QA 5IA1A 4LL0A 3QTIA 4GJ3A 4PPAA 5F1ZA 5L2TA 5J8IA 1NVQA 3DZOA 3UTOA 2C1AA 3ORKA 4USEA 4QDVA 4O86A 4I0RA 3TDWA 3DXNA 2ETRA 1P4FA 1T45A 2VTHA 3AC4A 3DAEA 4BDHA 3AD4A 2QOKA 4FYNA 4EH2A 2WMSA 4HW7A 2XYNA 3NPCA 2H96A 2IEWA 2VD5A 3AGMA 5CVFA 4A4LA 5KBRA 1SVGA 1PKGA 3LHJA 2XNEA 4FKQA 4P5ZA 5E90A 5IISA 2BFXA 3S0OA 4ACDA 4C2WA 3W0OA 1JOWB 3P79A 4Q9ZA 5C4LA 3ROCA 4L3JA 2IZTA 3MH2A 2ZAZA 4GU9A 5DT0A 3IW4A 3ZSGA 3KXNA 3PG3A 4L45A 5AIRA 4AW5A 4EOKA 5JRQA 5J1WA 2I0HA 3QGYA 2WQBA 4KIKA 4KAOA 3VUIA 4FTCA 3UMXA 3PIZA 4O21A 4D5KA 1O6LA 4F1TA 5L6WL 1J91A 5M06A 3NUUA 2J5EA 1JQHA 3K2LA 5EDQA 3AOXA 4AW1A 4AW0A 3HMOA 3LFDA 1XHAA 3RP9A 4GCJA 3L8PA 1JVPP 5HBJA 4O4FA 4ZLYA 2R3PA 2F4JA 1BI8A 4RIWA 1ZY5A 3L9NA 1OGYA 3FLZA 4IACA 1WBTA 2VWBA 3GOPA 3OCBA 4LUDA 4QYYA 3A4PA 2XIKA 3FMMA 4FIGA 4BBFA 4QEBA 2J9MA 2PVKA 3O50A 3WYYA 5M57A 3GFEA 4K2RA 5M51A 5CAPA 2GNFA 2W9ZB 3PJCA 3H0YA 4IWOA 1NXKA 3NYVA 3ODZX 4XP3A 4BZDA 4X2JA 3B8RA 2YDJA 3SAYA 4UX9A 3ZSIA 4JX7A 4UEUA 3ZDUA 1MRYA 2WMAA 3E93A 4HPUE 4DTBA 3QZIA 4DA5A 2QOHA 3KXXA 4QNAA 5KBQA 1H1WA 2YM6A 4F7JA 4AN9A 2BAKA 4IC7A 3CCNA 3WIGA 3SG9A 4FODA 2RGPA 4XV1A 4WUAA 4QQTA 5CY3A 2BMCA 1H08A 1OIYA 2B4SB 4I1ZA 4I6HA 3GT8A 4JRNA 4LG4A 1XH9A 4CFFA 4AXEA 4FSUA 1YWNA 3C1XA 4V01A 5HLWA 3N9XA 5LWMA 4NM3A 4HPTE 3QCQA 2CKEA 3FZPA 5IG1A 4LRMA 2ITTA 2O2UA 4EC9A 1IG1A 3R22A 5H8BA 1OITA 2QO7A 3FV8A 3SXRA 4D0WA 1JKLA 3K5UA 4QMNA 3H10A 3MGYA 5GJDA 3AKKA 1U59A 3Q53A 4WNMA 2Y0AA 3FHIA 2WU6A 4H05A 4YTCA 2UZTA 3U6IA 3EMGA 4EOQA 4O0XA 1TKIA 2B9HA 4XG7A 4L00A 4FT0A 3A7HA 3QKLA 3L8SA 4IVDA 3B2WA 3HRCA 3PSCA 3QC4A 1LPUA 1YHSA 3BGQA 4GG5A 4A9SA 4D2SA 2IVVA 2ZFYA 4O2ZA 1W83A 2PE2A 3PWYA 3LVPA 4QMVA 5AP1A 3ZONA 4FZDB 3KIOC 4O82A 1Y6BA 2ACXA 2W4KA 3PE2A 3QYWA 3FI8A 4DF3A 4FZAB 1KV2A 4C35A 4R6VA 4BCOA 2R3OA 1W2DA 2R7BA 3DOGA 3F82A 3VF8A 4HCVA 2YIWA 4FZFB 4KIOA 4UMTA 2ZM4A 5JZJA 4HGTA 1NT2A 4X2KA 2ERZE 2B9JA 2X8IA 5ANJA 5AP7A 4APPA 3C4EA 3GCVA 1PXMA 4Z7GA 4OTHA 4Z55A 3Q5IA 3SOAA 3W33A 3F69A 3U9CA 4AA5A 4RPVA 2OJIA 4JBVA 3UP2A 1U4DA 4PNKA 3P5JC 2OW3A 3LLAA 1REJA 3QQKA 5AV2A 3W2PA 2PTKA 2W96B 3PVUA 5L6PA 4NTSA 3Q2JA 2PZYA 3P1AA 2BHEA 2VO6A 4J97A 4BGQA 3UPXA 3UG1A 2PL0A 4YP8A 4H3BA 1ZOEA 2BAJA 3TYKA 2VX1A 2WTVA 4WSQA 5I9WA 4BGGA 3GU7A 3R8LA 2JKQA 3GU5A 3BU6A 2JDTA 3NWWA 5DEYA 4XP0A 5EQYA 3C13A 2PVJA 3EJ1A 2HZIA 1JSTA 2XNGA 2LAVA 2VTJA 4RJ6A 4EOOA 3CY2A 3KRWA 4S2ZA 4XG6A 4OGRA 4LUEA 3VWAA 4YC8A 5JT2A 3ORLA 3AC5A 2WU7A 4RA4A 5HE1A 4DTAA 4EZ5A 5M55A 5JFWA 5KZIA 3D0EA 4NM5A 4JAIA 4TNDA 1R78A 5CU6A 1HCLA 3VBQA 2ITNA 2X39A 2J0JA 4O6LA 3HUCA 1L3RE 2C6OA 3SRVB 4CCUA 4D4RA 3GC9A 4M69B 5J9ZA 2IO6A 1GNGA 5CANA 4CKJA 4V0GA 4BICA 4BI0A 4PQNA 2VN9A 4ACHA 5IH5A 4WRSA 5E8YA 3ZLYA 4OAUC 2IZUA 4NFMA 1J3HA 1WBWA 5LMKA 4C4HA 2G15A 3UQFA 4QMZA 5LMKC 1ZLTA 2UZDA 3OW3A 1NW1A 2PVNA 4YZ9A 2YLEA 2FUMA 5JSMA 2OZOA 3OF0A 4RWJA 3FXWA 5HG7A 1PMEA 2JEDA 4I23A 4MNEA 4Q2AA 4D4YA 3F7ZA 3KY2A 4MBIA 4MWIA 4EH5A 2Y9QA 5HD4A 4WO5A 1IRKA 5HKMA 4F09A 2Y4IC 3OUKA 4O81A 2UW0A 3OS3A 4IM0A 3EOCA 2UW4A 3M2WA 4GRBA 4ENXA 4RG0A 1SM2A 3FMHA 3NX8A 4MD9E 4QTCA 4BR3A 4ZK5A 3VS1A 5JEBA 4NL0A 4O7VA 2WTKC 4YR8A 3GVUA 4A9YA 3ZLXA 2WO6A 3FAAA 1Q8YA 5ACKA 3W32A 4H3PA 1VR2A 5IPJA 3ANRA 5CU3A 2YIQA 4W4XA 3WF5A 3MPAA 1LR4A 3MFRA 3EQGA 4YTHA 4ZJJA 1XO2B 3NFFB 1JWHA 2GNJA 1JLUE 3E64A 3LCTA 4MD7E 3QTUA 2UZEA 2UZWE 4BHNA 2AQXA 3QUDA 2PWLA 3WIKA 3RK7A 1FMKA 3GCQA 5KO1A 2XKFA 2C6KA 3OMVA 3PPZA 3RAWA 4B8LA 2NNWB 2F2UA 4TYJA 3V04A 2OO8X 3I60A 2XARA 3FEGA 4YHTA 3VBXA 2QLQA 2XNOA 4J8NA 3NCGA 4WHZA 4G2FA 3D4QA 3QQHA 2WMXA 4RMZA 3V51A 4C4GA 1Q97A 5J1VA 2QG7A 2UVXA 3VBVA 5DBXA 2X8DA 3KL8A 1PXLA 3A62A 5KMJA 4UYNA 4GG7A 5H9BA 3VAPA 5FEEA 2GQSA 1FPUA 3CSVA 4FTQA 2DQ7X 3MH1A 5CVHA 3WF7A 3MVMA 3WILA 3FE3A 1YXSA 4PDSA 5FDPA 4BCKA 2XAOA 5EOBA 3VW8A 4C4IA 3FMLA 5JK3A 3DXPA 3LCKA 3RPSA 4AZVA 3TN8A 2G2IA 4BCGA 2FSLX 1U5RA 4AG8A 4CFNA 3R1NA 3QWKA 3QQGA 1YRPA 3MA6A 3QYZA 2YWVA 4FIHA 1PXKA 3HAVA 2JBPA 2XKCA 3BRBA 1SVHA 2VTIA 3F3WA 4M68A 3OBJA 4CQGA 4C7TA 5HVKA 4J98A 5HEZA 3OD6X 1LEZA 4FKIA 4U80A 4EH6A 4PMPA 3OC1A 2R3QA 2ITQA 3Q9WA 1DI9A 3GU4A 1OL1A 1YI4A 3PRFA 5AP5A 5GINE 4L6QA 2CHLA 4IAIA 3RZBA 4ZMFA 4RJ3A 1W84A 4S31A 1OZ1A 1UKIA 3LXPA 4QMWA 3WARA 4M84A 2PVRA 3KVXA 2JFLA 3QQUA 1ATPE 3IECA 1OPJA 5LVPA 1A48A 1QPDA 3LMHA 4R3CA 3C4FA 3UIXA 4GT4A 1PMVA 3GCSA 5L3AA 3P7BA 3FLSA 3KB7A 4BDCA 2QU5A 5DR6A 1PJKA 4DHFA 5EHOA 5HU9A 2GHGA 4OT6A 4I93A 3W10A 2UZUE 4FSYA 1H1RA 3MVJA 3FYJX 4E6DA 1PMNA 5TOZA 1UV5A 4CMUA 3DB6A 3BE9A 4QDEA 2BKZA 4LMNA 5ACBC 3AMBA 4RZVA 4O7RA 3ELJA 5D1JA 3LXKA 2ZJWA 3BU5A 3PY0A 5GJGA 4WNOA 4AXCA 3DDQA 3NW6A 3ORXA 3PXKA 1ND4A 4ANNA 4DGLC 2A1AB 2XM8A 1UWJA 4I3ZA 4FV1A 4E6AA 1KUTA 3GUBA 1ZWSA 5HU3A 2PVYA 2J0KA 3KXGA 4UN0C 4Z7HA 2BUJA 1V1KA 3FSKA 1ZAOA 5KKRB 5CLPA 2CGXA 4XYFA 4DCAA 5CU4A 2FSTX 3VUGA 1Q8WA 2QG5A 4E1ZA 3ZRKA 2CGVA 5CQWA 2OGVA 3DAKA 2CGUA 5D9HA 3ZYAA 4AGCA 4BN1A 1H00A 4OTRA 4UV0A 3MIAA 3Q52A 2VV9A 4GJ2A 3S4QA 5HO6A 2NYAA 1Q3DA 3PFQA 3R8UA 4WUNA 5KUPA 3EFWA 1S9JA 2QHMA 4K8AA 3R00A 5HNBA 4QTAA 2YACA 3FMDA 5AAFA 5L8LA 4F64A 2WTCA 3FL5A 3ULIA 3DJ5A 1Q5KA 4IVCA 4IZAA 2B9FA 5FTQA 5CT0A 3TZ8A 4CXAA 3L8VA 2GDOA 2OZAA 2QOCA 3DA6A 5T68A 1CTPE 4BBMA 5EW9A 3QX4A 4FTUA 2YM5A 4W4WA 3R28A 4MXAA 4ZSEA 4QQJA 5KHWA 4QYFA 3WF8A 5JFXA 1W2FA 3DQWA 2WB8A 4WKQA 5KX8A 4R77A 4ACCA 2R3FA 3EL8A 1OBGA 3F9NA 4QTBA 2YM7A 4MF1A 4QPSA 2VWVA 5B2KA 2P0CA 1YKRA 3QA8A 4QMXA 3HECA 4AE6A 3OT3A 4CFMA 4ZEGA 2XBAA 4DAWA 3ZEWA 2YISA 3P9JA 1KOAA 4O0RA 4OLIA 2UVZA 5HO8A 4FV3A 2DS1A 2CNQA 2YIRA 2HENA 3TDVA 2GHMA 4J96A 2VZ6A 1RE8A 3AG9A 4FTKA 4IB1A 3AT2A 3UYTA 4CFUA 4O84A 5M4UA 4DFLA 2UUEA 3MSSA 2W1ZA 4YJTA 4C4JA 3QTSA 2H9VA 4B0GA 2WNTA 1H1PA 4K9YA 1OKYA 1OUKA 2B54A 4L01A 4UBAA 4XBUA 5K3YA 2E9NA 4FUXA 3U51A 4AQCA 3PA5A 1E1VA 4I24A 2XK8A 2BR1A 2GQRA 3TZ9A 4QYHA 3W2OA 5CEIA 2Z7RA 4ID7A 3UZTA 2VWWA 2GTMA 4DFXE 1YVJA 4CV9A 4D5HA 5H2UA 3H9RA 4IM2A 5AR4A 5C9CA 3VQUA 3A8XA 4CCBA 5LXMA 4FKTA 3MFTA 2J0IA 1W2CA 4ANQA 4U40A 3R8PA 3U8WA 4DC2A 2R7IA 4M8TA 3VHEA 4J71A 4H1JA 4D9UA 3QKKA 3KGAA 4K6ZA 1ZZ2A 2XJ0A 4BDJA 2XK6A 3R71A 4JBQA 3VF9A 4QMUA 4LV7A 3TUBA 4LGHA 3FC2A 4YJVA 4MCVA 2UW7A 4D4VA 4HGEA 4BKZA 4BDIA 3E8CA 3R1SA 4JX3A 2QNJA 2OXXA 1DM2A 2FSOX 2YM3A 4AF3A 2Q83A 2AUHA 4RVMA 1JKSA 5FG8A 3BHHA 3VS2A 2AEGA 2J0LA 3NNWA 5GNKA 4R8QA 3UGCA 3BYSA 4E93A 2HOGA 3HP2A 4W8DA 3TI1A 3D7TB 2QVSE 4YSMA 2VX3A 5EI6A 3ZO3A 4J99A 4FSNA 5CSXA 4FGRA 3G15A 4XHKB 3IQ7A 3W0MA 1XH8A 3Q5ZA 3EN6A 4NJDA 2WD1A 4WBOA 4KIKB 3COMA 5AA9A 4F70A 2ITWA 2R0UA 4FVRA 2XJ1A 2CCIA 2ITXA 4RIXA 4F7LA 3DBEA 3I7BA 4DH7A 2PE0A 2XYUA 4IIRA 5AJQA 4FKLA 1ZYLA 1U46A 4JG7A 4BTKA 5KMIA 3S00A 4XV9A 3KEXA 4F9YA 4RIWB 3RVGA 4G17A 4C4EA 3FSFA 3FZ1A 3PA4A 3LXLA 4PTCA 2ZDUA 3CP9A 3LM0A 1P4OA 3QAME 4M12A 4ITHA 4F9WA 4QYGA 4FJVA 1XWSA 5CS6A 3QD4A 2OXYA 3ZMMA 3ZUVA 4IAFA 3HX4A 3CIKA 5KZ0A 2B0QA 1URWA 2C3LA 3IW6A 4FT3A 1M14A 4L67A 4NJ3A 3W0NA 2ZM3A 3K5VA 3T3VA 1E1XA 3QRJA 1VJYA 2BZHB 4JBOA 2PMNX 1YXTA 4BL1A 3C9WA 2I1MA 4FNYA 1V0OA 2QR8A 3ZU7A 5IF1A 3KF4A 1VYWA 3FLWA 3MWUA 4PRJA 4PTGA 3CLYA 4O1PA 4RC2A 4DFNA 5BX0A 3NUNA 1H4LA 3VBTA 3BLRA 1YI6A 3DBFA 3PWDA 4CG8A 5KMMA 5C8MA 1XMMA 3R02A 1YDTE 1Q8TA 4TN6A 3Q2MA 2C5OA 5K5NA 4TYHA 4F63A 4BDKA 2BZIB 4H58A 3CTJA 4BKJA 5FBNC 4ZSAA 2BDJA 3BYVA 2FA2A 5TF9A 4UMQA 3ZH8A 2XRUA 3EN9A 4QMSA 5HQ0A 4II5A 5FP5A 2QU6A 4AZTA 4MH7A 4V04A 3TV7A 2BIYA 4GUEA 2O63A 1XH6A 3OWKA 4JQ7A 4KWPA 4DFBA 4G16A 2XS0A 4L3LA 3UDSA 3LFFA 4OW8A 4RWIA 2WEIA 4HZSA 4R1VA 5AUTA 3R04A 5FUTA 3JR1A 3GXLA 2R3GA 4U8ZA 5I3RA 3SC1A 2GU8A 4LRJA 5AWMA 3VQHA 3R9RA 3COIA 2RFDA 2OIQA 3ZSHA 5AP3A 4WBBB 2R0IA 4QO9A 1UNGA 3HL7A 4FTNA 4K1BA 2XBJA 3WZKA 1OKVA 1X8BA 4G6NA 5FEQA 4QMOA 4ACMA 5BMSA 4BBEA 4DG0E 4KBCA 4G1WA 2BILB 1H1QA 2X0PA 3JXWA 4XOYA 4QQCA 1CKIA 3QTWA 2JKOA 2IG7A 4EH3A 2HXLA 3D94A 3DFAA 4HCUA 4GT5A 3KKVA 1SMHA 2FYSA 2VWZA 5HNIX 1GOLA 2ZV2A 1XH5A 5HTIA 5AR3A 1VLRA 3SLSA 4GKHA 5DG5A 1WAKA 4BF2A 1Q24A 4U44A 3PTGA 5HVJA 3UNZA 1OPKA 3HNGA 4JOAA 5EW8A 4L42A 4C34A 4DITA 4Y83A 4F78A 4LM5A 4O2PA 2W1GA 4EHZA 2YABA 2CNVA 2JIUA 3FXXA 4JT3A 4N0SA 3R7IA 1DAYA 3RM7A 5LQFA 5A4LA 3IO7A 3D2IA 3SX9A 5AM6A 3QZFA 2ZOQA 1YWVA 1XBBA 5DYJA 4I94A 2WMWA 2OI4X 3P08A 3Q96A 1LP4A 3D5VA 5EI2A 2HW6A 2X81A 3FLQA 5JH6A 1CKJA 4FTJA 2BRBA 2EWAA 4GVAA 4RX8A 4J95A 4JR7A 3ZO2A 2CNUA 5KMOA 3FKLA 4JDIA 1UU9A 4LFIA 4B4LA 4B6LA 4CT1A 4GIIA 3FQEA 3OBGA 4G5JA 4IAYA 2GNLA 4DFZE 4P5QA 3P7AA 3W2CA 1DS5A 5CEOA 4EK8A 2IW9A 2B7AA 4EHEA 2I0YA 3R9NA 1OUYA 4O7WA 1JSUA 2BVAA 5BVKA 4HOKA 3MB7A 4V0GB 3UO4A 5BUEA 2W1EA 2OIDA 4U41A 3VONA 5EKOA 5AR8A 1TVOA 3UE4A 3ID6C 5M53A 3VO3A 5J95A 4K0YA 3GQLA 2X4ZA 3I6WA 5CASA 3F61A 5IDNA 4KUJA 2JD5A 5BUJA 5TE0A 5AADA 4DG2E 3G6GA 3EIDA 3ZO4A 3GQIA 4YBJA 4TYGA 2HXQA 2CN5A 2R3JA 2CN8A 3QA0A 3MH3A 4UYAA 4MNEB 2Y4IB 2R2PA 5LARA 4F6SA 3BWFA 3QQLA 5FLFA 3WE8A 3EFKA 5A54A 5HTCA 3T3UA 3GGFA 3VBWA 5TO8A 3FPQA 4MXYA 2VTTA 3BHVA 4KD1A 4ZAUA 5DE2A 2QC6A 5EI8A 3VUKA 3QU0A 3ORIA 3II5A 4A9TA 4R5YA 4FVPA 2WTKB 5ETIA 4ORKA 3DB8A 3GU8A 3KF7A 2C5NA 4Y46A 4RJ7A 5JMSA 2WIPA 3VS0A 3PIYA 4IW0A 5ETCA 5F95A 4DYMA 3QCSA 2JKMA 3E3BX 3FY0A 4ZSJA 3W2RA 3DLZA 3ORTA 4FV9A 2HK5A 5DEWA 2R3NA 2XJ2A 4ZS0A 4FA2A 2OU7A 4I6FA 1GZKA 5CZHA 4IJPA 1AQ1A 2F7EE 2HZNA 3LQ8A 2XUUA 4AXFA 2OJ9A 3A61A 2P4IA 1MP8A 4EL9A 3L1SA 4BCMA 1WBNA 2QKWB 4YLJA 4ZTNA 4AW2A 2UVYA 4AN3A 3MVHA 2VWIA 2HWOA 2OF4A 3KK8A 1T46A 4O4DA 3TTIA 1CM8A 3W1FA 3BZ3A 5F9EA 3F66A 4FVQA 4GIHA