2R4BA

Erbb4 kinase domain complexed with a thienopyrimidine inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
298
structure length
292
Chain Sequence
LVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-4
publication title 6-Ethynylthieno[3,2-d]- and 6-ethynylthieno[2,3-d]pyrimidin-4-anilines as tunable covalent modifiers of ErbB kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 292
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2r4bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2r4bA01
3LZBA 4O96A 2WOUA 3OHTA 4FNXA 4LMUA 4CYJA 3ZONA 5GJDA 3A7HA 1UU9A 1XHAA 3DNEA 3KVWA 4DEGA 1W98A 2Y6MA 4F9AA 1H1PA 3LMHA 2ZV2A 1JNKA 5BVDA 3LQ3A 2QOIA 2QU6A 2Y7JA 2X1NA 3OTUA 3CR0A 2C47A 3MY5A 3L9NA 3LFNA 1YXUA 4PRJA 4YPDA 4ZAUA 5HCYA 3P7CA 3E8NA 3QQLA 4O22A 3DV3A 4Q9SA 3PXZA 4MX9A 2X8IA 1IRKA 5FQDC 3ROCA 2PK9A 3D14A 2BDFA 1Q5KA 5L2SA 3PRIA 4BRXA 3FEGA 2W5AA 3QX4A 3B8QA 3DZOA 5EW9A 3NNUA 5I9UA 3GU7A 3UQFA 4AZTA 5CSVA 2FGIA 5EI6A 5AP2A 4O0RA 2OJJA 4WBOA 4IJPA 2GHGA 4NSTA 5HBHA 4AZFA 4DC2A 3FXXA 4BKZA 3FQSA 3QLFA 2FUMA 3NUUA 4CV8A 3FL5A 3SGCA 5FP5A 2VGOA 4V01A 3R28A 4F0IA 2ZMCA 1QCFA 4KINA 3UGCA 3WIGA 3BBTB 4L46A 1OIRA 4IDVA 3C4CA 5BYLA 3R1SA 2HELA 2VTIA 5E8YA 5CSPA 4EOSA 4CFUA 4FTUA 3ACJA 1IR3A 1Q62A 2AUHA 4U3ZA 4UMUA 3FL4A 3A7JA 3VUMA 5DWRA 1QL6A 4AN2A 3ZSHA 4AA5A 2HOGA 3I79A 4DH1A 2CKOA 3Q60A 5I9XA 5KHXA 3BHTA 3DKGA 2G2FA 3C1XA 4L8MA 4HJOA 3UIUA 3SOCA 3DAKA 4MNFA 5IUIA 2ITYA 5K3YA 5AP5A 3ZZEA 4C4JA 3GCPA 1GIIA 4I0RA 2O2UA 3Q9WA 3IQ7A 5G1XA 4D1ZA 5AR7A 4F64A 2V7OA 3EKNA 4RRVA 4ZLYA 4LUEA 4DFNA 2WGJA 2ONLA 4XYFA 5BPYA 3PY3A 3WI6A 4D2VA 4C0TA 4ID7A 2RL5A 4BCHA 3PPZA 4GU9A 4USDA 4C57A 4OUCA 4CQGA 3U54A 2QCSA 3PFQA 4IB5A 2I0EA 3JVSA 4AE9A 4YBJA 4QTBA 1Q61A 4CLJA 2I7QA 3IW5A 2P4IA 5DH3A 3KL8A 4G5PA 2WIPA 4KS7A 5E8TA 5HHWA 4IFCA 4ZLZA 3UNZA 1XH4A 4UZHA 1V0PA 4ZTMA 1YOJA 4I93A 2UZWE 3DZQA 1K3AA 1R0EA 4JBVA 4AQCA 3WF8A 1A06A 5GNKA 1U5QA 4IJ9A 2YM8A 3RINA 5BVWA 3COMA 4U9AA 3R0TA 1XH6A 3MSSA 1XH8A 2ITZA 3NUNA 4GSBA 4ERWA 2W1HA 4FNYA 2FO0A 3VF9A 3MPTA 4QMWA 4E93A 2W1IA 3VJNA 1KSWA 4YTHA 1OMWA 2E9PA 4YC3A 4CMTA 4KABA 2ZV8A 3CQUA 2YM6A 1JSUA 3A99A 1CKJA 3OUNB 3PP1A 3R71A 4A9TA 5M06A 4LM5A 5EQYA 4UALA 5JFVA 4LQMA 1UNGA 4L68A 2BHEA 2HK5A 3EIDA 2Y0AA 3GFEA 3KCKA 1LUFA 3BU5A 5AUVA 3RZFA 3W10A 5FEEA 4EYJA 4O84A 3EZVA 3KF7A 4RGJA 3DU8A 5CSWA 3NYOA 4ZY6A 3E87A 3D7ZA 2R3KA 4O21A 4RVLA 5I9VA 4YP8A 3O50A 4TRLA 4IBMA 5GINE 4X7QA 5FG8A 3BI6A 3K3IA 2X2MA 4YJNA 3CTHA 4FL2A 4FA2A 2QOKA 3L8PA 3MA3A 3U9CA 2HXLA 4O81A 4I21A 5EYKA 4YJSA 4EH9A 1K2PA 4FX3A 2E9VA 2XRUA 4NZWB 4IANA 4R1VA 3SA0A 1PKDA 2FB8A 1OECA 4BGGA 4EQUA 2QHMA 3SKCA 4DT9A 5EYCA 4AA0A 1H0WA 2XNNA 4IVCA 2NO3A 1IA8A 2R3MA 1UWJA 4PWNA 1GIJA 4I5HA 2XK3A 4ZS4A 4GKHA 3P08A 3H10A 4J52A 2ETKA 4QT1A 1PMUA 2C6MA 4G16A 5FBNC 4O7VA 1YXVA 1LP4A 2XKEA 1WMKA 4CVAA 3QUDA 3TM0A 5ANIA 4M68A 3DBQA 1M2RA 2XNEA 5GJGA 3V04A 2B9JA 1YW2A 3LFCA 1ATPE 2R3LA 2CMWA 2XM9A 3OWKA 4L7SA 3IGOA 3UBDA 5HLNA 2BTSA 3ZOSA 3W18A 5DVRA 2PVRA 1ZLTA 4P4CA 4RLKA 2JKMA 5AUZA 1PXMA 1T45A 3BELA 3UOHA 4E4NA 3T3UA 4ASEA 5JGAA 3I6WA 1YDTE 3C5UA 1DAWA 3FZOA 4AZEA 1PYXA 3ZBXA 3AD6A 3EHAA 3ZO4A 2A2AA 4C59A 3PZHA 4FF8A 1XH5A 4XG9A 5IU2A 2J51A 2BAJA 3GC7A 5DYJA 4D28A 3GU6A 4RWLA 2REIA 3T9TA 2ITUA 4HVDA 2QI8A 3ZLWA 1ZYDA 5A54A 3BRBA 3L9LA 3VULA 1RQQA 1KE8A 4FSNA 5D41A 3LM0A 2CCIA 4PUZA 2C3KA 1Z9XA 3VHKA 4IE9A 4R6VA 5EG3A 4JIKA 4IW0A 4EQCA 4ZXTA 4QTDA 2QHNA 2CGVA 5H8GA 3UO4A 4UN0C 2XNBA 2HZIA 5FTGA 2UW5A 4BWKA 5FP6A 4AOTA 4FUXA 4GT4A 4FV4A 2ZJWA 2QO7A 4ACGA 2C30A 3GXLA 4R1YA 3DCVA 3HP5A 2CJMA 2OGVA 2DS1A 2W5HA 3NW5A 4JAJA 3MJ2A 4MXOA 4YGAA 4I1ZA 5AMNA 3SW4A 4FTOA 4WNKA 1W0XC 1UNLA 3OC1A 4ZTLA 2PY3A 3MN3A 3EQDA 1FINA 4WOVA 1Q24A 2SRCA 1JKSA 4QPAA 1EH4A 2WNTA 2GNIA 2WXVA 3PZEA 4FT3A 1PXOA 1BMKA 3LHJA 3LCTA 3HECA 2OIQA 1HCKA 3QLGA 3QRTA 4G17A 4IH8A 4FVQA 4JDKA 3WZEA 3Q2JA 4ZJVA 1NVQA 4PDSA 3OS3A 4UMTA 3W33A 1R3CA 4TXCA 1I09A 2JKKA 4P2KA 3HX4A 5AR4A 3W8LA 5IEVA 3ZCLA 1GZKA 4FKIA 3ORKA 5AP6A 2I6LA 3FMKA 2RSVA 4IX3A 4ZOGA 4DEBA 4R78A 4HGTA 4DYMA 1MUOA 2VNWA 4QYGA 3V8WA 2PTKA 5C03A 5HTBA 3AXWA 4C36A 4FKOA 1UNHA 1JLUE 4X3JA 2X4ZA 3TACA 2FSOX 2R3IA 3QTXA 2F2CB 2PVFA 4KIOA 4O0SA 4UMQA 1YRPA 4EZ5A 4TL0A 2XF0A 3OBGA 4HZRA 2QNJA 3NNWA 5LXMA 4L00A 4A9SA 2HW6A 5DMZA 3D15A 3RCJA 4QYEA 3TKIA 3OOMA 3HMOA 2W06A 4J96A 1PXLA 3GC9A 5AM7A 5HNIX 4YZ9A 4Z3VA 1SVGA 2CCHA 2OJGA 2PE1A 4I22A 4AWIA 5IDPA 3VUTA 4IZYA 1SVHA 2PVLA 3NNXA 3UVPA 5A9UA 4IZ7A 2YIYA 2JFMA 3HUCA 4CQEA 5AEPA 3DJ5A 3KMMA 1APME 2XMYA 3FLNC 5EQPA 4FEQA 3QCQA 4MVFA 2YJSA 4X2NA 4XG4A 3V5QA 2JDVA 5K0KA 5I0BA 2BZJA 2FYSA 4CGAA 5LCKA 1ZAOA 2BAKA 4O2ZA 5DR6A 5EI8A 3CQWA 3IGGA 1G8SA 4IM0A 4CSVA 5KMKA 1UKIA 4U79A 4DTBA 2UZUE 3ENHA 3G9NA 3MVJA 1YDSE 3TZ9A 3UZTA 4XX9A 4BCJA 2Y8OA 4D2SA 2VWVA 2YCFA 3F3TA 3MFRA 5C1QB 5JRQA 3VQHA 3FLWA 3A2CA 3BEGA 3V51A 4ASXA 2WMWA 5DOSA 4D4SA 5HX8A 3CY2A 4MXCA 4BWPA 4JDHA 2JDOA 4RFYA 1S9IA 3NLBA 2ITOA 1Q8TA 3MJ1A 3R1NA 3TNQB 5I3RA 1NW1A 2BZHB 2HWOA 4EBVA 4XH6A 3O0GA 4YNEA 5DT4A 3RAWA 5HCXA 1SM2A 2ESMA 3H0ZA 3E7OA 5DBXA 3RNYA 2Z7LA 4U0IA 4PV0A 2V5QA 5EOLA 3TTIA 3UTOA 4U45A 3FZSA 3ULZA 5CF8A 5HNBA 4EHZA 1GOLA 1BI8A 4L3PA 3QHRA 3ZUTA 1SNXA 2E9UA 2V62A 4W8DA 3D94A 4RVTA 2J0LA 2JD5A 3KULA 2PMIA 5CX9A 3PY1A 2QG5A 4XOZA 3VS5A 3FKLA 4BCPA 4RIYA 4XV2A 4YZBA 5AM6A 5BVKA 5IQFA 4RJ7A 4DE4A 2A4LA 1WAKA 1OKVA 4O0YA 3RPYA 4C4FA 5A4EA 3WE4A 1ERKA 2X9FA 5I9WA 4FIEA 3P79A 3ZDUA 1RDQE 5FM2A 1YKRA 5ANDA 5L6PA 3GUBA 4FTQA 2ZB1A 2WU6A 4TPTA 4FKJA 2F7XE 4GCJA 5CWZA 5J87A 3CLYA 5IQAA 4YJPA 5HG7A 5HTCA 3EQIA 4FEVA 2XKDA 2R3NA 1YDRE 4E7WA 4Q5EA 4I0SA 5AV4A 2IVTA 3C0HA 3OWLA 4I4FA 4UBAA 3A8WA 2J9MA 4EH2A 4RJ3A 5AX9A 3R30A 4DFLA 5HE3A 2WEIA 4NW6A 3VJOA 4GYIA 4BDAA 5BVFA 5IA1A 5A4LA 3ZFMA 3AD4A 3NCZA 4JBPA 3EQHA 4G9RA 1G5SA 5M4CA 4LOQA 4IHPA 5AV3A 3FYJX 4I0TA 5GZAA 1P4FA 2XNGA 3P23A 3TWJA 3NR9A 4ALVA 4X3FA 3R02A 2CGWA 4O6LA 5H8EA 5KMMA 4V04A 4HPUE 3HDMA 3I0OA 4M66A 5CNNA 2YIQA 5EW8A 5CASA 3F2NA 2V55A 2P33A 3L9MA 3ATTA 3JUHA 2EVAA 4ZTRA 5JRSA 4ZJIA 5CAUA 2C5NA 2X7OA 3AG9A 2PE0A 4ANNA 5K0XA 5K5XA 2JFLA 1PJKA 1UWHA 3F7ZA 3GU4A 3LCKA 3ZM4A 4II5A 1WVXA 4QP9A 4CRSA 1KV2A 4PPBA 1PXNA 3Q9ZA 3AC2A 4AOIA 4LMNA 3GT8A 1JPAA 1BI7A 4NIFA 2J5FA 3I6UA 5C9CA 4PDYA 4BDCA 3QTZA 4D4YA 3HMPA 3IOPA 5L6OA 2X2KA 4GG5A 3AMAA 2O63A 3BYOA 4QMLA 4MWIA 3O96A 5F94A 5LOHA 3BYSA 2G15A 2PVNA 3FQHA 5AV0A 4AW1A 3RWPA 1O6KA 3BZ3A 4OT5A 3EN6A 1FGIA 2XNOA 4TY1A 4UWBA 5HIBA 4CG8A 4EK8A 5KMLA 4IX4A 3AQVA 2B52A 3P9JA 4JVGA 5AV1A 4EKKA 4CKIA 2C6KA 2WTKC 3C13A 5CLPA 5AP1A 5FDPA 2AC3A 3UOJA 1VJYA 1TVOA 1OL1A 4X2KA 3QA8A 3UJGA 1K9AA 3FDNA 4FODA 4ZSEA 3TNIA 2RFNA 4QP8A 3TZMA 4ARKA 1CMKE 3QUPA 2BKZA 4AGWA 3R9DA 4G9CA 4QTCA 4DHFA 5BMMA 4WNOA 4FG8A 2BAQA 4AU8A 2JC6A 3QBNA 2GQGA 3SC1A 1YVJA 4YC8A 3HA8A 3HDNA 4IMYA 4NW5A 3SD0A 4A9YA 3RTPA 3ZEWA 2PVYA 2UW4A 4B8MA 3UVQA 2PU8A 5C8KA 3KXHA 3ZSIA 3FYKX 3RNIA 3QCYA 2WEVA 5AP0A 3LCDA 2CKPA 3IKAA 1J3HA 3QZGA 4QMXA 2OK1A 1W82A 4R5SA 3R2BA 4EK4A 3IO7A 3KULB 4IWOA 2VU3A 2OO8X 3MH3A 2GFSA 1B39A 3RI1A 4RIYB 4FTIA 4W4YA 1Q4LA 2IPXA 5FM3A 4AW0A 5LWMA 2UZTA 4M14A 3FC1X 1UA2A 2W9ZB 1H28A 3T8OA 2VWYA 4YJRA 2FSTX 1XBBA 2BRNA 3CPBA 2GSFA 3EQBA 1H1WA 2W96B 3NPCA 5AAFA 2OJFE 2P2HA 4TYHA 3KRXA 3DFAA 4RMZA 4KRDA 4K18A 5J79A 1MRYA 3DBFA 4ACHA 4RWKA 4L43A 4LRJA 3DS6A 1REKA 2C5OA 2WAJA 3BPRA 4GFOA 4K1BA 2GPHA 3SHEA 3Q96A 2YWPA 2YDKA 4I5CA 1Y6BA 3ZSGA 3QUEA 4LOOA 1H07A 2WQNA 5HU3A 5M07A 2WD1A 5E90A 3AT3A 2CGXA 2WFYA 3ID6C 3EJ1A 4X3FB 1H01A 3DLZA 4QP6A 4FKLA 4KWPA 3FI4A 5IH6A 3Q9XA 3P7BA 2CHLA 3LJ2A 3Q4UA 2CNQA 2ITTA 2UVYA 3VC4A 4WBBB 2OLCA 1MP8A 2HZ0A 4IDTA 5CSHA 2F7EE 3T9IA 2CGUA 2IW6A 2XS0A 4FSUA 1TKIA 3PP0A 5AUWA 5HG5A 4YO6A 4XNEA 4ZY4A 2DUVA 3HNGA 2KULA 4PX6A 2UW6A 1HCLA 1ZRZA 4PTEA 3R04A 5E7RA 5H3QA 4BL1A 4MBIA 4FKQA 4W8EA 4NIFB 5AIKA 4FSQA 3AD5A 4U97A 5D1JA 1J91A 3EWHA 5AFVA 3MV5A 3F7WA 3G5DA 4FTCA 1F3MC 3QTUA 4OTHA 4TWPA 3F3VA 4I92A 1H26A 2W1GA 4F9BA 3G6HA 4XG7A 2YFXA 4MD7E 4YHTA 5CEKA 4MEDA 2J2IB 4TWOA 2BIKB 3PWYA 4JG8A 4BTFA 5AADA 4USEA 1DM2A 5A46A 4JAIA 3QQFA 4JG6A 4EH8A 5AX3A 3ZS5A 4F7JA 3K54A 3Q5ZA 5DA3A 1U59A 2HW7A 4XS2A 2WMRA 4BI2A 2OSCA 2PUUA 1KE6A 5FTOA 3UYTA 2IVUA 3GFWA 4O27B 3ZUVA 4LYNA 5CEMA 3CBLA 2C3JA 3G51A 5CQUA 4HGLA 1U54A 1AGWA 3DXNA 5HEZA 3MI9A 4QD6A 4D1SA 5KKRC 4AN9A 3TV7A 1Q99A 4GV1A 2IWIA 4TT7A 5H9BA 2G01A 1J7UA 1WVWA 4YHFA 3TDWA 1QPEA 3KC3A 4FE2A 3AGMA 3BKBA 4NJDA 4DFZE 3N4TA 1JSVA 1MQBA 2YACA 3PE1A 3AT4A 3BV2A 4EOLA 2P3GX 4MBLA 2O8YA 3ANQA 4DH3A 3VNTA 4ZTSA 3BHHA 3E3BX 5CSXA 3PVUA 4FTAA 4O86A 4RFZA 3HV5A 3QU0A 3QL8A 4O2PA 3RPSA 3FMLA 4FTKA 5HD7A 1ZARA 3C4EA 4O1OA 1KE9A 3MVHA 3MY0A 4XG8A 5K9IA 3RALA 2OKRA 4OTQA 3E92A 3MDYA 4GG7A 3MTFA 3DTCA 4TYHB 1WFCA 2OZAA 3D9VA 3C0GA 3ORMA 4RWIA 4PP9A 4EOKA 4NEUA 5AIRA 2YISA 4N70A 1PXPA 3OOGA 3QCSA 2ZB0A 4QMZA 3FMJA 3W2RA 3ENMA 4NT4A 3N4VA 2Q0BA 1ZWSA 3P1AA 1O6LA 2DYLA 3F61A 3I1AA 4E4XA 3C51A 3RAHA 5E92A 2C3LA 4QMNA 5TF9A 3HMMA 1FGKA 5HD4A 3KK8A 3GCVA 2X6EA 3ORLA 4YZCA 4FZDB 5AAGA 4JS8A 4L6QA 5EFQA 5EM7A 3VS4A 4BI0A 2YDIA 4C37A 3I0QA 4MXAA 1XJDA 4PMMA 4BDBA 5ICPA 3O8PA 2YIRA 3OEZA 2GNGA 3VBTA 2FSLX 4D0XA 2X6DA 2FSMX 3R83A 5M09A 4BCMA 3F3WA 3WZUA 1R0PA 3ET7A 4H3QA 3CGOA 5FXQA 4ZJJA 5CALA 1OKYA 4PL3A 1LPUA 4C35A 5DPVA 4FBXA 4WRGA 5TOZA 4I3ZA 2JKOA 4F1OA 4AW2A 4O7YA 2BHHA 3IW6A 2IVSA 3ETAA 3LOKA 3RPRA 5BVNA 1J1BA 3QHWA 5FD2A 2VWWA 4XRJA 1BL7A 4USFA 3DAJA 5L2TA 3LE6A 3DJ7A 3TJCA 5C8MA 4F7LA 2C0IA 2ZM1A 3D2KA 4ACMA 2B9HA 4BN1A 3C0IA 5I4NA 2ITQA 2WMUA 1QPCA 4O6EA 5AR2A 3HV6A 3L8VA 3EH9A 4TYJA 2FVDA 2XEZA 1SZMA 3ROYA 3F69A 3G6GA 2G1TA 4D1XA 4BIEA 5M51A 1O9UA 4B8LA 4MH7A 5TKDA 3VRZA 5HO7A 3BLHA 3LMGA 2R0UA 3DBCA 2PZRA 3M42A 3R73A 1JKLA 3RVGA 4Y95A 4BCIA 5LVMA 4UMRA 3S4QA 4ZSGA 3KF4A 4PNKA 3C4ZA 5EHOA 2PPQA 2R3HA 1XQZA 3EYGA 4V05A 4UY9A 3KRLA 3OG7A 3ORZA 1M7NA 3MGYA 2BKKA 2XZSA 4HYSA 2XCHA 1ZY4A 4RA5A 3RK5A 5E4HA 2ITWA 3BU6A 4KKEA 4C8BA 4QQCA 4Y8DA 2UZOA 5T68A 2GNFA 4YR8A 4BTMA 5BQ0A 4QPMA 3F3UA 4DGLC 4FVRA 3CTQA 1W7HA 2VWXA 2XRWA 3MBLA 1OKZA 4PTCA 1MRUA 1Z57A 3LQ8A 4XJ0A 3MS9A 2WB8A 4WG5A 4JDIA 2OXDA 4MAOA 5J1WA 5DE2A 3UG1A 3ZEPA 4G6OA 4XOYA 3EMGA 1HOWA 5ETCA 3PXFA 4IWDA 2BROA 1VYZA 4RQVA 2FH9A 2BRMA 3E8EA 3PVWA 1KWPA 3NAXA 4GIIA 3RM7A 1Q97A 3OD6X 5E8XA 3VS1A 3U51A 4M69A 1OL6A 3OY1A 1OIYA 3HUBA 4RIOA 1YWVA 3FHIA 3PYYA 3FLZA 1V1KA 5HU9A 4L3JA 4O7LA 4OBQA 4TNDA 4E26A 4X6QC 4FNZA 4XP2A 4MXXA 3FLYA 2W1DA 3MWUA 3ZXZA 1J7IA 4AGDA 2B54A 3GC0A 3LFSA 3BHVA 2C0OA 3O51A 3VUIA 4HW7A 2OICA 2JDTA 4GH2A 2WTVA 4RA4A 2C69A 2VX1A 4LV8A 3C4WA 1Q8UA 5CU3A 5L8JA 5B7VA 5M08A 4O0VA 3QQGA 4U40A 4EUUA 2QC6A 2J0KA 2VTHA 2OZAB 3GU5A 3VIDA 1OPJA 4NK9A 3LFAA 2J5EA 5EM5A 2QONA 2JDSA 3QD4A 4FG7A 3D83A 4MWHA 3LFDA 5A3XA 5KMIA 3PWDA 3F5PA 4FV7A 2CNVA 4C4EA 4RQKA 4ZTQA 5KMNA 3H3CA 3R2YA 4C2VA 3NDMA 2NRUA 4NTSA 3FZRA 3HL7A 2Q83A 4HVGA 3NVKI 1ZOGA 2HYYA 2PZIA 2JEDA 4GIHA 5HLPA 1JKKA 2WPAA 4JQEA 4C3FA 5DEWA 2BFXA 3CJFA 4WSYA 4QNYA 4FSYA 5DRBA 1LEWA 2XB7A 3BX5A 3R8VA 3A7FA 4MYGA 1AQ1A 3F3ZA 2IZRA 4LL5A 2UZNA 5J9LA 4FV6A 2RGPA 4PL5A 1VZOA 2YJRA 3MA6A 3U87A 5J5TA 4YTIA 3SV0A 4DG2E 2YWVA 5C27A 1YHSA 3A61A 3TL8A 2X81A 3UZRA 1OPKA 3BYUA 4QMYA 4S34A 3KFAA 3O7LB 3R9HA 3QTWA 2WTDA 3QWJA 5CT0A 3LJ1A 5JN2A 5LMKC 4DEIA 2VTOA 5EDPA 3P78A 3UIMA 3VS2A 5IH5A 4WO5A 3VBVA 2Z7SA 1RW8A 3ALNA 4QOXA 2ITXA 3Q4TA 4DGMA 1NT2A 3RP9A 3DPKA 4RZVA 4QYHA 2WHBA 4YHJA 2OH0E 3COIA 4BBFA 4MK0A 4OAVB 2RG6A 3CSVA 4BTJA 3UIXA 4ITIA 1E1VA 2OW3A 3MPAA 4IX6A 4JL9A 1WCCA 4HNFA 4RLLA 4Q5HA 4ZMEA 4N4SA 2GMXA 3KEXA 2WQMA 3R00A 3I7BA 4C62A 4NH1A 2XIYA 3MVLA 4R3RA 2UUEA 5L8KA 4D4VA 4ZY5A 5FXRA 2C0TA 1FQ1B 1H08A 3C50A 3G9LX 3QAME 1KE5A 1MQ4A 4MBJA 3NAYA 4FYNA 4MQ2A 3R8MA 3H9OA 4ANMA 4F09A 5EQEA 4S2ZA 4KIKA 3TNHA 3PJ2A 2W17A 4ITJA 4CLIA 2QD9A 3IOKA 4BTKA 3L1SA 3R7EA 5FWKK 2CLQA 2XA4A 5HOAA 4U81A 5TT7A 3MB6A 3LCOA 3TNPC 4P5ZA 3VBXA 2AC5A 4OTGA 4BCFA 3DA6A 5CU0A 3HZTA 5IQEA 3KN5A 4LUDA 3A7GA 1QPJA 4FG9A 3DKFA 4OTRA 4I4EA 5AWMA 1ZY5A 2OFUA 2W4KA 4G3FA 3WF6A 4M12A 1Y57A 3FHRA 5GHVA 4CKJA 5JEBA 1BYGA 3Q04A 5M44A 2VWIA 3ZH8A 4EEVA 4RIWA 5F9EA 4O7NA 3I5NA 4TYEA 3CXWA 2XCKA 2VX0A 4Y85A 4ZZNA 5A4QA 3MVMA 1XWSA 3OXIA 3KU2A 3QZFA 4PL4A 3BWFA 4M69B 1OKWA 1ZOHA 5JT2A 3LFBA 3R6XA 4LOPA 3JVRA 3FLQA 2C6LA 2IG7A 3HKOA 1Q8ZA 4AOJA 4RJ5A 4IWPA 3NVMB 4EONA 2WO6A 5FGKA 4YBKA 1YI4A 3BE2A 3E88A 5CF6A 2H34A 4Y5HA 4G2FA 5IMXA 3KRRA 2OIDA 5ANEA 3KKVA 3VUGA 3PDTA 4DCAA 1P4OA 3PG3A 5BMSA 2GTNA 3MESA 4IVDA 3TDVA 3UO6A 4NCTC 2WELA 3OT8A 4U43A 4U5JA 3CKWA 3CPCA 1Q41A 4FNWA 3IS5A 3RK7A 3FZ1A 1IG1A 2R3RA 5HBEA 5HKMA 2HY0A 5DFPA 4LG4A 2P55A 2VTJA 4OTWA 5J9ZA 3PXKA 4FL3A 4N6YA 3FI8A 4JXFA 2UVZA 4GVJA 3TIYA 2YEXA 4YJOA 3CE3A 2J90A 4FKRA 4QRCA 3KXZA 5A6OA 5IH4A 4GFMA 3MH2A 2ERKA 2OIBA 4FIHA 4RFMA 4CFNA 2PUIA 5IQIA 1M7QA 1TQMA 1E1XA 2WMSA 5A14A 3DFCB 3LJ0A 5CYIA 3LLAA 1ZOEA 2XIXA 3WZDA 2VZ6A 3NMUF 5HZNA 4Y83A 1X8BA 5EOBA 5ETAA 4YURA 4RG0A 1PRYA 5ETFA 5BYYA 4DFYA 4UYNA 2EUFB 3E3PA 2NP8A 4IC7A 3Q4CA 4EH3A 4XEYA 4YLLA 3SQQA 2JKQA 4A9RA 3GOKA 2OF2A 3IW8A 3R9RA 3KN6A 3FLSA 4EOQA 4JR3A 3PIZA 2R3QA 3KY2A 3WE8A 4AGCA 4CFWA 1NVSA 4GVAA 3UODA 4E6QA 4TZRA 5HG9A 3G0EA 4I6FA 3GQIA 4WT6A 4QTEA 5CAVA 4EHVA 5IISA 4IVBA 3VUDA 4EOMA 2UW8A 4DH7A 1GJOA 2XJ2A 4FOCA 4NM0A 3QFVA 5DNRA 3BE9A 2XBJA 2XJ1A 4LI5A 3TJDA 4ACCA 4XHKB 2C5XA 4FIGA 2OWBA 4XG3A 5AA9A 3U4UA 4OW8A 4YSMA 3G15A 1M17A 1FPUA 3PY0A 3MFUA 3EOCA 3ODZX 3QC4A 1H1QA 4CZTA 4D58A 4BC6A 1OUYA 1UKHA 2IW9A 3KMUA 3C7QA 2YCSA 2XM8A 4LRMA 4QMVA 1UU8A 4CNHA 5CZIA 2RFEA 4JR7A 5JFSA 3CC6A 4KIKB 5FDXA 5IDNA 3DDQA 1ZMVA 2JAVA 3SRVA 5CF4A 2HWPA 4GJ2A 4TYIA 1QMZA 2ACXA 3ZO2A 4EL9A 4FK6A 2WIHA 4Q2AA 5L3AA 4FGRA 4O7TA 2F49A 4E6AA 3QTRA 2XH5A 1IAJA 2BRGA 2O64A 4K11A 3V8TA 3UQCA 3PJ1A 4PMTA 4TTHB 1YXTA 3NX8A 2OH4A 4ALUA 1W83A 4HVSA 5C8NA 3U6JA 1R1WA 3NYNA 5CVGA 3AC8A 3FJQE 4HVIA 4E4MA 4FOBA 4OT6A 4FL1A 1GZOA 3EN9A 4KB8A 3QYWA 5L2WA 2PVHA 4KA3A 3JPVA 4TWNA 2AYPA 3IDCA 4X2GA 4HCTA 4TN6A 2G2IA 4EJNA 4RIWB 2VV9A 3O2MA 3IDBA 3UPXA 4NWMA 5CENA 2ZM4A 3R7GA 2O0UA 3FY2A 1Q3DA 3IECA 5EDQA 2HY81 4U8ZA 5CT7A 1SNUA 1Q8WA 2BALA 2X7GA 2B9IA 2W5BA 2XP2A 2UV2A 3NUPA 2HAKA 4UXLA 3GVUA 3WIKA 4X21A 4RVMA 4ZEGA 4C58A 4CT1A 3HMIA 4ENXA 1MRVA 4DN5A 4PMPA 3UO5A 3SOAA 3TZ7A 3EN4A 2H8HA 2WQOA 4QP4A 3Q53A 4DEDA 4GK3A 5BVEA 4BDGA 3IDPA 4V0GA 3HRFA 3N9XA 5LJJA 2C1AA 5LCJA 2B53A 2WMAA 3R7IA 4RC3A 4J53A 4F0FA 4D9TA 4ZTHA 2WMVA 3C4XA 4ZK5A 3COKA 3TXOA 2A27A 2OBJA 4FKWA 2B1PA 3BV3A 1RJBA 4R8QA 4XG6A 4A4XA 4JI9A 4S33A 4WHZA 3KRWA 5JKGA 1J7LA 4R7HA 1JOWB 1L8TA 3V5JA 4WIHA 2XK6A 2R7BA 4B0GA 4QYYA 3BEAA 4K2RA 4F6SA 3QKMA 3QQUA 4FKPA 4NU1A 4BBMA 4U80A 2BR1A 2VO6A 2Y4IC 4BCNA 3ALOA 4O1PA 2J0MB 2W99B 3F88A 5LMAA 1WBPA 4CCBA 4EH6A 2H6DA 2X9EA 4O0UA 4A06A 3LAUA 3QQJA 5JZJA 3IW4A 3CGFA 4H1JA 4BKJA 5HX6A 2YHVA 4A7CA 3QWKA 4AGUA 3OXZA 4XUFA 4XV1A 3TTJA 5CZHA 3NW6A 1RE8A 3SVVA 2HZNA 3CD3A 2IJMA 3OZ6A 2WTJA 2WMBA 2ZOQA 1GNGA 4D55A 3TZ8A 4XBRA 4AE6A 4FI1A 2WTKB 3RHXA 4Z55A 4J7BA 5DR2A 3U6IA 4I5PA 4L3LA 2J6MA 2RKUA 4P90A 3JR1A 3D4QA 3KREA 2QG7A 3Q9YA 2PWLA 5HLWA 3L8XA 4FSZA 3KQ7A 5JZNA 4IQ6A 4HYUA 4UWCA 2R3JA 3R8ZA 4RT7A 4HVHA 3ZC6A 4PP7A 2XIZA 4FZ6A 4CMUA 1FVRA 5AUTA 5B2MA 4DFBA 4RX7A 2ZMDA 2QLQA 4UEUA 3EQCA 4FT9A 1H8FA 3RKBA 4K33A 2XVDA 3MPMA 4L52A 4U44A 4QNAA 3SRVB 3W1FA 4JRNA 5KMJA 3TCPA 3D7TA 3NS9A 4NJ3A 4KBKA 5CEQA 4RX5A 5AUYA 2OZOA 3FQEA 3WOWA 2GCDA 2UW0A 4I41A 4KD1A 3TEIA 3UP7A 4CRLA 4M84A 2OU7A 5HQ0A 1ZYCA 4QMUA 4QQTA 4IAFA 2O5KA 1PHKA 4YNOA 2EB2A 2OJ9A 3H9FA 4BWXA 4YZNA 3V5LA 3WILA 4W9XA 1WBWA 2QU5A 4L44A 5IA4A 3DB8A 2QODA 4EUTA 1NVRA 2F2UA 4QO9A 4DH5A 2YZAA 3WF5A 2WMTA 4PF4A 5F1ZA 4DFXE 1YWRA 2QKWB 2YLEA 4I5MA 4MF0A 4GL9A 3TV6A 4QP3A 2C5YA 5L6WL 4K77A 5HNGA 4AZSA 1YI3A 3BGPA 5J9YA 4EOPA 4GS6A 5J5SA 3EFJA 5BUEA 4NUSA 3FMNA 1XR1A 3FI2A 4E20A 2I40A 4DGOA 5AP3A 4F65A 3TUCA 5E8WA 2VTLA 4PNIA 1TQPA 2C6OA 4CZYB 2CSNA 2W1ZA 4DEAA 1STCE 3IPHA 5EHLA 3ZRLA 4AT3A 3SG9A 5AV2A 5KUPA 4N0SA 3FMEA 3G90X 4RWJA 3MH1A 4FUYA 1JVPP 4PPAA 3VWAA 5JGBA 3QALE 4YMJA 4C02A 5HIEA 3DY7A 4FKVA 5DR9A 2Z7RA 4R7BA 1WVYA 5JK3A 1SMHA 1CTPE 5D7VA 5EK7A 4DCEA 2Z60A 3HP2A 1OBGA 4WRSA 3AC5A 3GEQA 4ZSLA 2IZTA 3OROA 4B6LA 3HMNA 4QMOA 3EQPA 4FKTA 4NFMA 5EDRA 4KKGA 5AR3A 4G5JA 4ZTNA 3REPA 4FV5A 3U9NA 4A4OA 1BL6A 4BDIA 2EB3A 2H9VA 4FV9A 5CU4A 2BPMA 5DGZA 3FI3A 4BCQA 3OMVA 4JBOA 2GTMA 5J7HA 2BZKB 5CTPA 2VTMA 2IW8A 4E8AA 4FT5A 3G33A 3PUPA 4XBUA 4YU2A 3PE2A 2VO0A 4C7TA 1WBTA 2ZV7A 4O83A 2EXEA 3H4JA 4M8TA 1BX6A 5DG5A 2XKCA 1ZZ2A 3DXPA 5E1EA 1Y8GA 5FBOA 3S3IA 3BGZA 3GNIB 3ZBFA 4AA4A 4FSMA 3PXQA 1WBVA 2PL0A 4W4VA 3SXSA 3K5UA 1PYEA 5BUJA 3HAVA 2G2HA 1H25A 1H1RA 3FV8A 4FTTA 4S30A 2F4JA 4G3DA 4IM2A 3GP0A 4DLJA 4WUNA 3BBWA 5I5ZA 2GS2A 3E64A 3EYHA 2JGZA 4U41A 5KX8A 3LFEA 4CTCA 2VTPA 2RFSA 3DBEA 2R3GA 2YAKA 3D5WA 2GNLA 4C4IA 4EBWA 2UZLA 4KKHA 3U8WA 3OW4A 4FVPA 3VW8A 5ANKA 5FUTA 4E3CA 2R9SA 3B2TA 4FT0A 5ANJA 4EH4A 4FSWA 5L8LA 2OG8A 4BGQA 2QOQA 3ZHPC 3U6HA 1H1SA 1ZYJA 2E9NA 2VUWA 2QOHA 4J1RA 2V22A 4JG7A 4FT7A 4AZWA 5DHJA 5KZ0A 4OBPA 4RVKA 5GJFA 5GIPE 4KSQA 5KKRB 2PMNX 3EFLA 3V5TA 3NW7A 1UV5A 4UWYA 2XNMA 5DIAA 4BGHA 4EC8A 3HAMA 3ZTXA 3LIJA 4WNPA 2B4SB 1YI6A 3LXNA 3Q6WA 1L3RE 2OF4A 4J95A 3RK9A 5CQWA 4ITHA 2GQRA 1BLXA 4QMMA 1KUTA 2VN9A 3CTJA 3SXRA 3AC4A 3V6RA 4JDJA 3T3VA 3VF8A 4N6ZA 2JLDA 2RG5A 4NKAA 4Y46A 2QOOA 4MQ1A 4BCGA 3TI1A 4O38A 4E5WA 2VD5A 3N4UA 2LAVA 1M14A 3F82A 2BMCA 4FV2A 4IIRA 3R9OA 4M7IA 3SAYA 4ANLA 3RAIA 4E6DA 4EYMA 1H4LA 3HVCA 1PXJA 4BICA 3TIZA 2ERZE 4AG8A 5JGDA 4FEWA 3TKHA 2WQEA 1IAHA 1PXIA 1CDKA 3I60A 4G3EA 1YHWA 4H3BA 1FBNA 2OXXA 2VGPA 4TYGA 4JX3A 2CN8A 4OTIA 5CVHA 5CAPA 4MD8E 1G8AA 3JY0A 5JQ5A 2XUUA 4CG9A 2DQ7X 1WBNA 4YTCA 3DDPA 2BDWA 3HRBA 3ORXA 4S31A 4DINA 3KB7A 5ETIA 3RM6A 2GNHA 1B6CB 4AFEA 4DT8A 1OM1A 2V0DA 4FR4A 4J99A 5HG8A 4DTAA 4B9DA 3ZYAA 2UZBA 4AXAA 4JIAA 2PUNA 5IQDA 1CM8A 3AT2A 1Y6AA 1Z5MA 3UVRA 2X8EA 3V01A 2W1EA 4I6QA 2C5VA 1LR4A 1KOAA 4F9YA 2GU8A 1IASA 3PIYA 2PYWA 3QKKA 3H30A 4PTGA 4DG0E 5D11A 1GIHA 3MY1A 3AMBA 3C5IA 3R22A 4XV9A 3MYGA 1ZYLA 4ENYA 4BHNA 2J0JA 2YZLA 3QD3A 3AMYA 1UU3A 5DEYA 2C4GA 4AAAA 4OR5A 3UYSA 3ZLXA 3PSDA 5LVNA 1OL5A 4NM7A 4EORA 5L4QA 4GK2A 2RFDA 3W32A 5IQGA 2PSQA 3RAKA 4CZUA 3NYVA 3PXYA 1P5EA 3UE4A 4FIFA 5HESA 4KIPA 3R1YA 3H9RA 3TT0A 3ZRMA 5B2LA 4F1TA 3CQEA 2VWBA 5LMKA 3E63A 4D2RA 4GEOA 4YSJA 3COHA 4BDEA 5K4IA 4NL0A 3QRUA 3F2AA 3QCXA 5GIOE 5KNJA 4P5QA 3DLSA 3H0YA 2R3OA 4QQJA 2ETRA 5FRIA 5J1VA 1M2PA 4EWHA 2VO3A 2EWAA 2B55A 2ITNA 5K5NA 3HV3A 2YM3A 4H39A 5EM8A 4C3RA 2RIOA 3CD8A 5HGIA 3FUPA 2WMXA 4FIIA 5LMBA 1XKKA 2Z2WA 3E7VA 3Q32A 5LARA 3O8UA 2WZJA 5K4JA 2HENA 5H8BA 2P2IA 2VWUA 3WYYA 5M55A 3FMMA 3IK3A 2YERA 3LFQA 4RIXA 2UZEA 3WYXA 4DF3A 5EI2A 2CDZA 1W84A 5I3OA 5M53A 2B7AA 2W4JA 4CFXA 2NPQA 4HCVA 3BHYA 3MW1A 4RZWA 4APCA 3FKOA 5E9EA 4BZDA 5HO6A 2GNJA 5KBRA 4FTNA 5KE0A 2XEYA 4Q9ZA 5JSMA 3E8CA 5FEDA 3QXOA 3FMDA 4IEBA 5IQHA 1DI9A 4EWQA 4TWCA 3FAAA 2PUPA 1FOTA 4CXAA 4L67A 1U54B 3GENA 2ITVA 3EZRA 3R1QA 2BFYA 5IQBA 4IAKA 3ORPA 4FKUA 4H36A 3BQRA 4ZZMA 5IG1A 1NXKA 5DT0A 4ZMFA 4CKRA 3UC3A 5F20A 5AUXA 4IAYA 4DBXA 3PA5A 4D0WA 5EYMA 2ZDTA 4QMTA 3FSKA 5DRDA 1KV1A 2W9FB 1FVVA 4W9WA 4C3PA 1SVEA 5T3QA 4FMQA 4CD0A 3M11A 3KMWA 3OVVA 4IADA 4U7ZA 4C61A 2PULA 1V0OA 3DBDA 4IZAA 4MF1A 2BRBA 4NCTA 2CNUA 1XBCA 4FV0A 5EHYA 3VO3A 1UU7A 3POZA 3D2IA 1JSTA 3QGWA 2ITPA 4HPTE 3LXKA 1OL7A 2F9GA 2EXMA 4J8MA 3F5UA 3JY9A 4CFVA 4X6RA 4D2WA 3BIZA 3Q4ZA 2XKFA 3UOKA 3DJ6A 4RC2A 4I6BA 2C1BA 1T46A 3PXRA 2C6EA 3V5WA 4A9UA 1I44A 2B9FA 4JQ8A 1OL2A 2C6IA 5DI1A 5AR8A 3RGFA 3RZBA 3WARA 4IWQA 4UZDA 4BCOA 5E8SA 5IMEA 2O65A 5M4IA 4XLIA 4XV3A 1GY3A 1VEBA 4D2TA 4AUAA 2XK9A 3CP9A 3P7AA 4IAIA 4MXYA 5FEQA 5TR6A 2VTSA 2YIWA 4O91A 3ZU7A 2QOBA 3ZMMA 4APPA 4CEGA 4XMOA 4WG3A 3EKKA 3PJCA 2F57A 4FZ7A 4MTAA 3O7LD 4MNEA 1VYWA 2JAMA 2P0CA 4GUBA 4YJVA 5KZIA 4CCUA 2E2BA 3VBWA 4AT4A 3SW7A 3PLAE 4ZIMA 4DBNA 5JQ8A 3TUBA 3TV4A 2I0HA 4DGGA 4PY1A 5B2KA 3NUYA 1R78A 2WKMA 5ITAA 4GK4A 1TQIA 5J8IA 5AJQA 3E8DA 5HVKA 1M52A 2VNYA 2CKEA 4I20A 2ZAZA 4IM3A 2CKQA 1PMNA 3M1SA 3W2CA 2PVMA 3KXXA 3LM5A 2YM5A 4F7SA 2BCJA 1JKTA 3OP5A 3FZPA 4BBEA 1LEZA 4LGDA 4QMPA 2C6TA 5CEIA 3Q5IA 3KVXA 2VTNA 3ZDIA 2NNWB 3FPQA 2VTAA 2QURA 4R7IA 4F6UA 4M97A 4WSQA 3VBQA 4P7EA 2UZDA 3EB0A 4I94A 4G3CA 3EQFA 4RIXB 5KBQA 1OBDA 3ZFYA 4GFGA 4R5YA 4X2JA 5AP4A 5C01A 4E4LA 3BQCA 1OVEA 1H24A 2EXCX 3FSFA 4FICA 4LGGA 1NY3A 5CNOA 5DN3A 2PZPA 4AZVA 4DAWA 4D9UA 4MKCA 2QOFA 3K2LA 1GZNA 2R4BA 4HGEA 5E1SA 4DFUA 3OT3A 1URWA 2CLXA 1JAMA 4RC4A 3CIKA 4F4PA 2YITA 4UV0A 3QGYA 4BF2A 2UZVA 2A0CX 2YM7A 4KSPA 3GCUA 3QYZA 4EK5A 3R8UA 3VQUA 1J1CA 4OBOA 5CAOA 3LFFA 4HCUA 4FV3A 2VTQA 3Q3BA 3UMWA 3P0MA 4MCVA 2YCRA 5JMSA 4H05A 1OUKA 2Y6OA 5HVJA 4H1MA 2LGCA 2Z7QA 3C4FA 4IVAA 4QP2A 3VAPA 4F99A 4HYIA 4CMOA 1B38A 4C2WA 3JS2A 2X2LA 4FTMA 4ZSJA 3ZXTA 2WTIA 3QRIA 3RPOA 2R64A 2QKRA 5TE0A 3UC4A 3NIZA 3HYHA 2YN8A 1FMOE 4EI4A 1OIUA 4AX8A 2F7ZE 3R9NA 4BB4A 5AA8A 4CTBA 1JBPE 3VHEA 2QOCA 3I81A 1M2QA 4TKSA 2R5TA 5HTIA 5BX0A 4O0XA 4X0MA 5CI7A 5KHWA 3BHUA 5EW3A 3OF0A 4IFGA 4Z7HA 2A19B 4FV8A 4JOAA 2BTRA 2KTYA 2QO9A 3PJ3A 3FY0A 4O7RA 2GS6A 3GC8A 4O0TA 5HICA 1YXSA 3V6SA 4BYIA 3I5ZA 4EZ7A 5IEXA 2W1CA 4RX8A 2R7IA 1PF8A 2PHKA 4OTPA 3GCSA 4JQ7A 4FC0A 3PPKA 4IB3A 4G3GA 5IA2A 1PY5A 5IEYA 3UG2A 3DB6A 2ONLC 4L45A 4XLVA 4OLIA 4EC9A 5ACBC 1FVTA 5D7AA 3NEWA 3AC1A 2VRXA 4M0ZA 1YOLA 2BZIB 4LL0A 1YOMA 5CS6A 3OWPA 3S2PA 4BDDA 4Z16A 3QZIA 3KXMA 3DAEA 1WBOA 2A1AB 3G2FA 1ZZLA 3G0FA 4BR3A 4MNEB 1YHVA 4M0YA 3VS0A 3FC2A 1W8CA 3LPBA 2X8DA 3R7YA 3OY3A 4O82A 2Y4PA 1KOBA 3AOXA 2PVJA 5E8UA 3W55A 4U3YA 3SXFA 2QLUA 3FPMA 4G6NA 5EKNA 4FKSA 3UNJA 1PMVA 4FYOA 1BKXA 2CPKE 3OW3A 4L7FA 4QPSA 5TO8A 3NRMA 5CXHA 5A6NA 4EK6A 5IA3A 3EN7A 4YPSA 2QVSE 3ITZA 3LCSA 5LVPA 2Q0NA 3QXPA 4RPVA 4CFFA 3W2OA 3LXLA 4DG3E 2UW9A 3RWQA 3I4BA 4WUAA 3VVHA 5DLSA 3GOPA 3EL7A 3FZTA 3ERKA 3KRJA 2WOTA 3GBZA 4CV9A 2GFCA 4KS8A 1DAYA 5HORA 3F66A 4LGHA 4BYJA 1GAGA 2O3PA 4PPCA 2XNPA 2C68A 3HA6A 4K8AA 4DA5A 2J0IA 3S00A 3KCFA 3ZO3A 3UP2A 5HO8A 4FEUA 4PMSA 4KBCA 4G34A 3ZO1A 5J95A 2X4FA 4FIJA 4EHEA 4YUQA 2PZ5A 5GZ9A 4ANOA 1VR2A 3CY3A 3NYXA 4ASZA 3W2PA 1DS5A 5D9HA 3ZRKA 3S0OA 4IACA 3GCQA 4DEHA 3V5PA 5I9YA 3EQGA 4XP3A 4GW8A 3RCDA 4F7NA 2H96A 2UW7A 2XK8A 5D12A 5L2QA 3RPVA 3SG8A 3NIEA 5E8VA 3TKUA 3TN8A 1A9UA 2JITA 3D5XA 3EQRA 2WU7A 3L8SA 3OBJA 2PMLX 5FLFA 4C4GA 3KXNA 4PQNA 3ULIA 3E93A 4JJRA 5E8ZA 4LFIA 4LRKA 5FXSA 5CF5A 3DOGA 5J7BA 2JBOA 1PW2A 3P86A 4GT5A 2IZUA 5AP7A 3DQWA 1V0BA 5IA5A 2XK4A 4F70A 3K3JA 1Y91A 5C26A 2PZYA 4HOKA 3RBWA 3R7UA 4W4XA 3VN9A 2UW3A 5H2UA 4WA9A 4XG2A 3MFSA 1OIQA 5M57A 1QPDA 2I0YA 4NM5A 2ETMA 5ACKA 4AW5A 4EJ7A 3GGFA 4R3CA 3FXZA 4D2PA 2YLFA 3F5GA 4RSSA 5JFWA 5C4KA 2XIKA 3AC3A 4M15A 3R8LA 3NGAA 3LXPA 3Q6UA 5CEPA 2HIWA 4ALWA 5DT3A 2HCKA 4BIBA 4J71A 2BIYA 5KO1A 4FSRA 1G3NA 4EK3A 3CCNA 3D5UA 1S9JA 4IB1A 2R3PA 4HYHA 2ZYBA 3D5VA 3NUAA 4F63A 2RF9A 4ASDA 3EN5A 4B7TA 4EZ3A 1PXKA 2GS7A 4OAUC 4GJ3A 4ORKA 3WZKA 4J8NA 4ONAA 4BIDA 2Z8CA 4FZAB 2FA2A 2ZV9A 2VO7A 4JT3A 4DLIA 3ZLSA 1P2AA 3QC9A 4U6RA 5C4LA 4ZZOA 5IUGA 2VTTA 5HE2A 3TNWA 4QP1A 5IPJA 3DXQA 2Y4IB 4L01A 3VUKA 4U42A 5LQFA 4W4WA 3S95A 3LQ5A 2DWBA 4RBLA 3Q2MA 2R2PA 3O71A 3VRYA 1XO2B 2IO6A 4JNWA 3UQGA 5JH6A 4FV1A 2XJ0A 5HBJA 3F5XA 4A07A 2VWZA 3NCGA 4FTRA 5HI2A 3WF9A 5CU2A 5I9ZA 4ZP5A 3HRCA 5JFXA 2X7FA 3W8QA 4Y5QA 4OTFA 3SX9A 4ANSA 5CANA 4F1MA 3R63A 4S32A 4L42A 3VS6A 3DT1A 4OGRA 4HGSA 3WBLA 4B99A 2W4OA 3B2WA 2PE2A 3SDJA 3QZHA 1WZYA 3NSZA 4D4RA 4F9WA 3F9NA 3BU3A 4RX9A 4BDKA 2Z02A 3EFWA 3PIXA 3BLRA 2IN6A 3A62A 1BUHA 4C4HA 4I6HA 1OB3A 4NTTA 3BYMA 3R7OA 3S1HA 2BDJA 2R3FA 4GMYA 4M13A 3PTGA 4TNBA 3N51A 3CKXA 3QTIA 3R01A 3AGLA 4YJUA 3UMXA 1CSNA 1U5RA 3OEFX 3UOLA 3IG7A 5F95A 3QD0A 1Y8YA 2QR7A 2GHLA 4H58A 4NYEA 4GU6A 1ZXEA 2BILB 1YWNA 4EOIA 4NKSA 3O17A 2OJIA 2ZM3A 5A4TA 3R8PA 1PMEA 3MTLA 3GB2A 3M2WA 3R21A 3QTQA 4GT3A 4RJ8A 5CI6A 3NUXA 5EKOA 4EQMA 3MFTA 3IONA 4UXQA 5HE1A 3DK7A 3K5VA 3ELJA 4Y73A 1CKIA 2YIXA 4BFMA 3DKOA 3MB7A 4QMQA 4FKGA 3UZPA 3PSBA 4F08A 4XRLA 5LWNA 3HEGA 4R3PA 4AP7A 5IF1A 3MH0A 4F6WA 5EYDA 2YAAA 4GRBA 4KAOA 4O7WA 4WG4A 2X39A 1ZMUA 3CS9A 4WD5A 4IXPA 5CXZA 3W16A 2BUJA 4HNIA 1F5QA 3GI3A 1H0VA 4M67A 3WZJA 2WMQA 3PPJA 5GZ8A 3UDBA 4FK3A 3OXTA 1ZMWA 3MIYA 1IEPA 4BY9E 4G6LA 4FEXA 2I0VA 4E5AX 3E5AA 2C3IB 4WNMA 5KCVA 3ZLYA 2BVAA 1AD5A 3NNVA 4FTLA 4FSTA 1E9HA 4JLCA 4CT2A 4RJ6A 5ANGA 5CAQA 3TG1A 5ANOA 4UYAA 4RJ4A 3PVBA 4MHAA 4J98A 4JBQA 3VS7A 4E1ZA 5M4UA 3I7CA 3C9WA 2JIIA 3KGAA 2EU9A 4IZ5A 4K9YA 5IUHA 3LKMA 3FWQA 4AS0A 2YCQA 3GQLA 3R7VA 1URCA 5LVLA 4PDOA 3ZUUA 4BDJA 5CEOA 1OZ1A 3A4OX 4WKQA 2OFVA 4J97A 2QQ7A 4V0GB 4BDFA 3DTWA 3OCBA 2YA9A 1ND4A 4YJQA 2PVKA 1OGUA 3POOA 2E9OA 1DI8A 4JX7A 4ZS0A 4CFMA 1U46A 3LMIA 3ODYX 1CKPA 2X0GA 4LV5A 4FGBA 1KE7A 1OI9A 4G31A 2V7AA 2UVXA 2W0JA 1ZYSA 5AR5A 1A48A 4ERKA 3P4KA 3QQHA 5HE0A 2GHMA 3F6XA 2YM4A 2WTCA 3FXWA 4GYGA 3OWJA 1JQHA 4YZMA 4EOJA 3UNKA 3PSCA 1H27A 3PJ8A 5E91A 5EH0A 3HV4A 3ORNA 4X2FA 1UVRA 3QRKA 3ORTA 2XYNA 4KNBA 2G9XA 3O23A 4K6ZA 4Z7GA 4AT5A 4L9IA 3RMFA 1FMKA 2OXYA 4E5BA 3PVGA 3NZ0A 4QQ5A 2VAGA 3O8TA 4BZOA 4PDPA 2J50A 3V3VA 3IW7A 4C34A 5M4FA 4DTKA 4N57A 1XBAA 3EFKA 2JBPA 5B0XA 4IAZA 1O6YA 1YXXA 1H00A 1XH9A 5F4NA 4BDHA 3Q52A 3QA0A 4X3FC 4I23A 4YC6A 4YLJA 5T6KA 2BRHA 3VS3A 4YJTA 4C38A 1WBSA 2NRYA 2PMOX 4IX5A 3BLQA 3LVPA 3THBA 4ACDA 3W2SA 5G6VA 3FMHA 1NA7A 3QTSA 4AN3A 3CJGA 3FKNA 4MD9E 4ZLOA 3LLTA 4XCUA 4EH7A 4ANQA 4AFJA 2HZ4A 4IB0A 5LVOA 3HLLA 1F0QA 2JIUA 4KRCA 3WF7A 1PKGA 2JIVA 3QQKA 3CEKA 4MXZA 4YO4A 3DK6A 5HCZA 4DEEA 3MIAA 4YZDA 4QP7A 4YTFA 1P14A 2HXQA 3OCSA 2W05A 5AUUA 3HV7A 3DGKA 3D7TB 3E62A 4D5HA 2YABA 3PLSA 3DKCA 4FZFB 4HZSA 3QX2A 5HVYA 4DGNA 3UPZA 4IAAA 3BYVA 4K0YA 3PRFA 4EKLA 4I24A 3DQXA 5BUIA 3OUKA 1REJA 3U4WA 4L53A 5IKWA 4QYFA 4B4LA 4E73A 3QKLA 2B0QA 4Z9LA 3UIBA 3BCEA 2W1FA 3GU8A 4OTDA 1SYKA 2ZVAA 2GDOA 3KK9A 4FTJA 3JXWA 3PG1A 4H3PA 5M56A 4GKIA 4KUJA 1XH7A 3OCTA 3ANRA 2VX3A 2XBAA 3PA4A 3L9PA 4QTAA 3VUHA 4F9CA 3FE3A 3ZC5A 4YLKA 3A7IA 3B8RA 3PA3A 4QMSA 4UB7A 4Y72A 1OITA 3ACKA 3QF9A 5CVFA 3KA0A 3HGKA 4D5KA 4JRVA 3U55A 2XYUA 4DH8A 3II5A 3VBYA 3W2QA 4C33A 3BGQA 3OFMA 4F0GA 2OI4X 5EM6A 4BKYA 4AACA 3V8SA 3DNDA 4NM3A 4EOOA 3OTVA 4UX9A 3RJCA 4ANBA 3F2RA 4O0WA 5IZFA 2QO2A 1YQJA 2QOLA 2VTRA 2WQBA 5BYZA 3ZM9A 1Q8YA 4BCKA 5KMOA 4AF3A 2Y9QA 3FBVA 4O7ZA 4GUEA 2XIRA 4A4LA 5L2IA 2XK7A 3JYAA 3RHKA 1IA9A 4M3QA 4EHGA 2I1MA 4DITA 1Q3WA 2IZSA 4ZSAA 5AAEA 5BNJA 3BWJA 4O7SA 4E6CA 2J4ZA 2C6DA 3QD2B 4IC8A 3OCGA 4KIQA 4G1WA 4CYIA 2R0IA 4EH5A 4BZNA 4UMPA 5CY3A 5IQCA 3A4PA 4NFNA 4TW9A 3TUDA 1OPLA 1GZ8A 5BVOA 3DK3A 3NWWA 3EL8A 5A4CA 1JWHA 3ATSA 4XP0A 3LW0A 5FTQA 2GQSA 3VW6A 2YDJA 2ZDUA 3A8XA 3SLSA 3QRJA 5CU6A 4BI1A 4BHZA 2WTWA 1R39A 2CN5A 3ORIA 4KBAA 5IA0A 4R77A 2W7XA 3ZZWA 3ZFXA 4BVUA 2IVVA 3A60A 1U4DA 3KXGA 3P5KA 5D10A 5HIDA 2J7TA 2JDRA 3D0EA 2QR8A 3NUSA
chains in the Genus database with same CATH superfamily
3LZBA 4O96A 2WOUA 3OHTA 4FNXA 4LMUA 4CYJA 3ZONA 5GJDA 3A7HA 1UU9A 1XHAA 3DNEA 3KVWA 4DEGA 1W98A 2Y6MA 4F9AA 1H1PA 2X0OA 3LMHA 2ZV2A 1JNKA 5BVDA 3LQ3A 2QOIA 2QU6A 2Y7JA 2X1NA 3OTUA 3CR0A 2C47A 3NFGB 3MY5A 3L9NA 3LFNA 1YXUA 4PRJA 4YPDA 4ZAUA 5HCYA 3P7CA 3E8NA 3QQLA 4O22A 3DV3A 4Q9SA 3PXZA 4MX9A 2X8IA 1IRKA 5FQDC 3ROCA 2PK9A 3D14A 2BDFA 1Q5KA 5L2SA 3PRIA 4BRXA 3FEGA 2W5AA 3QX4A 3B8QA 3DZOA 5EW9A 3NNUA 5I9UA 3GU7A 3UQFA 4AZTA 5CSVA 2FGIA 5EI6A 5AP2A 4O0RA 2OJJA 4WBOA 4IJPA 2GHGA 3W0PA 4NSTA 5HBHA 4AZFA 4DC2A 3FXXA 4BKZA 3FQSA 3QLFA 2FUMA 3NUUA 4CV8A 3FL5A 3SGCA 5FP5A 2VGOA 4V01A 3R28A 4F0IA 2ZMCA 1QCFA 4KINA 3UGCA 3WIGA 3BBTB 4L46A 1OIRA 4IDVA 3C4CA 5BYLA 3R1SA 2HELA 2VTIA 5E8YA 5CSPA 4EOSA 4CFUA 4FTUA 3ACJA 1IR3A 1Q62A 2AUHA 4U3ZA 4UMUA 3FL4A 3A7JA 3VUMA 5DWRA 1QL6A 4AN2A 3ZSHA 4AA5A 2HOGA 3I79A 4DH1A 2CKOA 3Q60A 5I9XA 5KHXA 3BHTA 3DKGA 2G2FA 3C1XA 4L8MA 2XALA 4HJOA 3UIUA 3SOCA 3DAKA 4MNFA 5IUIA 2ITYA 5K3YA 5AP5A 3ZZEA 4C4JA 3GCPA 1GIIA 4I0RA 2O2UA 3Q9WA 3IQ7A 5G1XA 4D1ZA 5AR7A 4F64A 2V7OA 3EKNA 4RRVA 4ZLYA 4LUEA 4DFNA 2WGJA 2ONLA 4XYFA 5BPYA 3PY3A 3WI6A 4D2VA 4C0TA 4ID7A 2RL5A 4BCHA 3PPZA 4GU9A 4USDA 4C57A 4OUCA 4CQGA 3U54A 2QCSA 3PFQA 4IB5A 2I0EA 3JVSA 4AE9A 4YBJA 4QTBA 1Q61A 4CLJA 2I7QA 3IW5A 2P4IA 5DH3A 3KL8A 4G5PA 2WIPA 4KS7A 5E8TA 5HHWA 4IFCA 4ZLZA 3UNZA 1XH4A 4UZHA 1V0PA 4ZTMA 1YOJA 4I93A 2UZWE 3DZQA 1K3AA 1R0EA 4JBVA 4AQCA 3W0MA 3WF8A 1A06A 5GNKA 1U5QA 4IJ9A 2YM8A 1TFFA 3RINA 5BVWA 3COMA 4U9AA 1W2CA 3R0TA 1XH6A 3MSSA 1XH8A 2ITZA 3NUNA 4GSBA 4ERWA 2W1HA 4FNYA 2FO0A 3VF9A 3MPTA 4QMWA 4E93A 2W1IA 3VJNA 1KSWA 4YTHA 1OMWA 2E9PA 4YC3A 4CMTA 4KABA 3BL7A 2ZV8A 3CQUA 2YM6A 1JSUA 3A99A 1CKJA 3OUNB 3PP1A 3R71A 4A9TA 5M06A 4LM5A 4O4FA 4UALA 5EQYA 5JFVA 4LQMA 1UNGA 4L68A 2BHEA 2HK5A 3EIDA 2Y0AA 3GFEA 3KCKA 1LUFA 3BU5A 5AUVA 3RZFA 3W10A 5FEEA 4EYJA 4O84A 3EZVA 3KF7A 4RGJA 3DU8A 5CSWA 3NYOA 4ZY6A 3E87A 3D7ZA 2R3KA 4O21A 4RVLA 5I9VA 4YP8A 3O50A 3W0OA 4TRLA 4IBMA 5GINE 4X7QA 5FG8A 3BI6A 3K3IA 2X2MA 4YJNA 3CTHA 4FL2A 4FA2A 2QOKA 3L8PA 3MA3A 3U9CA 2HXLA 3TYKA 4O81A 4I21A 5EYKA 4YJSA 4EH9A 1K2PA 4FX3A 2E9VA 2XRUA 4NZWB 4IANA 4R1VA 3SA0A 1PKDA 2FB8A 1OECA 4BGGA 4EQUA 2QHMA 3SKCA 4DT9A 5EYCA 4AA0A 1H0WA 2XNNA 4IVCA 2NO3A 1IA8A 2R3MA 1UWJA 4PWNA 1GIJA 4I5HA 2XK3A 4ZS4A 4GKHA 3P08A 3H10A 4J52A 2ETKA 4QT1A 1PMUA 2C6MA 4G16A 5FBNC 3AKKA 1YXVA 1LP4A 4O7VA 2XKEA 1WMKA 4CVAA 2XAMA 3QUDA 3TM0A 5ANIA 4M68A 3DBQA 1M2RA 2XNEA 5GJGA 3V04A 2B9JA 1YW2A 3LFCA 1ATPE 2R3LA 2CMWA 2XM9A 3OWKA 4L7SA 3IGOA 3UBDA 5HLNA 2BTSA 3ZOSA 3W18A 5DVRA 2PVRA 1ZLTA 4P4CA 4RLKA 2JKMA 5AUZA 1PXMA 1T45A 3BELA 3UOHA 4E4NA 3T3UA 4ASEA 5JGAA 3I6WA 1YDTE 3C5UA 2A98A 1DAWA 3FZOA 4AZEA 1PYXA 3ZBXA 3AD6A 3EHAA 3ZO4A 2A2AA 4C59A 3PZHA 4FF8A 1XH5A 4XG9A 5IU2A 2J51A 2BAJA 3GC7A 5DYJA 4D28A 3GU6A 4RWLA 2REIA 3T9TA 2ITUA 4HVDA 2QI8A 3ZLWA 1ZYDA 5A54A 3BRBA 3L9LA 3VULA 1RQQA 1KE8A 4FSNA 5D41A 3LM0A 2CCIA 4PUZA 2C3KA 1Z9XA 3VHKA 4IE9A 4R6VA 5EG3A 4JIKA 4IW0A 4EQCA 4ZXTA 4QTDA 2QHNA 2CGVA 5H8GA 3UO4A 4UN0C 1G8JA 2XNBA 2HZIA 5FTGA 4AAYA 2UW5A 4BWKA 5FP6A 4AOTA 4FUXA 4GT4A 4FV4A 2ZJWA 2QO7A 4ACGA 2C30A 3GXLA 4R1YA 3DCVA 3HP5A 1ST4A 2CJMA 2OGVA 2DS1A 2W5HA 3NW5A 4JAJA 3MJ2A 4MXOA 4YGAA 4I1ZA 5AMNA 3SW4A 4FTOA 4WNKA 1W0XC 1UNLA 3OC1A 4ZTLA 2PY3A 3MN3A 3EQDA 1FINA 4WOVA 1Q24A 2SRCA 1JKSA 4QPAA 1EH4A 2WNTA 2GNIA 2WXVA 3PZEA 4FT3A 1PXOA 1BMKA 3LHJA 3LCTA 3HECA 2OIQA 1HCKA 3QLGA 3QRTA 4G17A 4IH8A 4FVQA 4JDKA 3WZEA 3Q2JA 4ZJVA 1NVQA 1XMLA 4PDSA 3OS3A 4UMTA 3W33A 1R3CA 4TXCA 1I09A 2JKKA 4P2KA 3HX4A 5AR4A 3W8LA 5IEVA 3ZCLA 1GZKA 4FKIA 3ORKA 4DDIA 5AP6A 2I6LA 3FMKA 2RSVA 4IX3A 4ZOGA 4DEBA 4R78A 4HGTA 4DYMA 1MUOA 2VNWA 4QYGA 3V8WA 2PTKA 5C03A 5HTBA 3AXWA 4C36A 4FKOA 1UNHA 1JLUE 4X3JA 2X4ZA 3TACA 2FSOX 2R3IA 3QTXA 2F2CB 2PVFA 4KIOA 4O0SA 4UMQA 1YRPA 4EZ5A 4TL0A 2XF0A 3OBGA 4HZRA 3W0SA 2QNJA 3NNWA 5LXMA 4L00A 4A9SA 2HW6A 5DMZA 3D15A 3RCJA 4QYEA 3TKIA 3OOMA 3HMOA 2W06A 4J96A 1PXLA 3GC9A 5AM7A 5HNIX 4YZ9A 4Z3VA 1SVGA 2CCHA 2OJGA 2PE1A 4I22A 4AWIA 5IDPA 3VUTA 4IZYA 1SVHA 2PVLA 3NNXA 3UVPA 5A9UA 4IZ7A 2YIYA 2JFMA 3HUCA 4CQEA 5AEPA 3DJ5A 3KMMA 1APME 2XMYA 3FLNC 5EQPA 4FEQA 3QCQA 4MVFA 2YJSA 4X2NA 4XG4A 3V5QA 2JDVA 5K0KA 5I0BA 2BZJA 2FYSA 4CGAA 5LCKA 1ZAOA 2BAKA 4O2ZA 5DR6A 5EI8A 3CQWA 3IGGA 1G8SA 4IM0A 4CSVA 5KMKA 1UKIA 4U79A 4DTBA 2UZUE 3ENHA 3G9NA 3MVJA 3W0QA 1YDSE 3TZ9A 3UZTA 4XX9A 4BCJA 2Y8OA 4D2SA 2VWVA 2YCFA 3F3TA 3MFRA 5C1QB 5JRQA 3VQHA 3FLWA 3A2CA 3BEGA 3V51A 4ASXA 2WMWA 5DOSA 4D4SA 5HX8A 3CY2A 4MXCA 4BWPA 4JDHA 2JDOA 4RFYA 1S9IA 3NLBA 2ITOA 1Q8TA 3MJ1A 3R1NA 3TNQB 5I3RA 1NW1A 2BZHB 2HWOA 4EBVA 4XH6A 3O0GA 4YNEA 5DT4A 3RAWA 5HCXA 1SM2A 2ESMA 3H0ZA 3E7OA 5DBXA 3RNYA 2Z7LA 4U0IA 4PV0A 2V5QA 5EOLA 3TTIA 3UTOA 4U45A 3FZSA 3ULZA 5CF8A 5HNBA 4EHZA 1GOLA 1BI8A 4L3PA 3QHRA 3ZUTA 1SNXA 2E9UA 2V62A 4W8DA 3D94A 4RVTA 2J0LA 2JD5A 3KULA 2PMIA 5CX9A 3PY1A 2QG5A 4XOZA 3VS5A 2IF8A 3FKLA 4BCPA 4RIYA 4XV2A 4YZBA 5AM6A 5BVKA 5IQFA 4RJ7A 4DE4A 2A4LA 1WAKA 1OKVA 4O0YA 3RPYA 4C4FA 5A4EA 3WE4A 1ERKA 2X9FA 5I9WA 4FIEA 3P79A 3ZDUA 1RDQE 5FM2A 1YKRA 5ANDA 5L6PA 3GUBA 4FTQA 2ZB1A 2WU6A 4TPTA 4AXDA 4FKJA 2F7XE 4GCJA 5CWZA 5J87A 3CLYA 5IQAA 4YJPA 5HG7A 5HTCA 3EQIA 4FEVA 2XKDA 2R3NA 1YDRE 4E7WA 4Q5EA 4I0SA 5AV4A 2IVTA 3C0HA 3OWLA 4I4FA 4UBAA 3A8WA 2J9MA 4EH2A 4RJ3A 5AX9A 3R30A 4DFLA 5HE3A 2WEIA 4NW6A 3VJOA 4GYIA 4BDAA 5BVFA 5IA1A 5A4LA 3ZFMA 3AD4A 3NCZA 4JBPA 3EQHA 4G9RA 1G5SA 5M4CA 4LOQA 4IHPA 5AV3A 3FYJX 4I0TA 5GZAA 1P4FA 2XNGA 3P23A 3TWJA 3NR9A 4ALVA 4X3FA 3R02A 2CGWA 4O6LA 5H8EA 5KMMA 4V04A 4HPUE 3HDMA 3I0OA 4M66A 5CNNA 2YIQA 5EW8A 5CASA 3F2NA 2V55A 2P33A 3L9MA 3ATTA 3JUHA 2EVAA 4ZTRA 5JRSA 4ZJIA 5CAUA 2C5NA 2X7OA 3AG9A 2PE0A 4ANNA 5K0XA 5K5XA 2JFLA 1PJKA 1UWHA 3F7ZA 3GU4A 3LCKA 3ZM4A 4II5A 1WVXA 4QP9A 4CRSA 1KV2A 4PPBA 1PXNA 3Q9ZA 3AC2A 4AOIA 4LMNA 3GT8A 1JPAA 1BI7A 4NIFA 4O4DA 2J5FA 3I6UA 5C9CA 4PDYA 4BDCA 3QTZA 4D4YA 3HMPA 3IOPA 5L6OA 2X2KA 4GG5A 3AMAA 2O63A 3BYOA 4QMLA 4MWIA 3O96A 5F94A 5LOHA 3BYSA 2G15A 2PVNA 3FQHA 5AV0A 4AW1A 3RWPA 1O6KA 3BZ3A 4OT5A 3EN6A 1FGIA 2XNOA 4TY1A 4UWBA 5HIBA 4CG8A 4EK8A 5KMLA 4IX4A 3AQVA 2B52A 3P9JA 4JVGA 5AV1A 4EKKA 4CKIA 2C6KA 2WTKC 3C13A 5CLPA 5AP1A 5FDPA 2AC3A 3UOJA 1VJYA 1TVOA 1OL1A 4X2KA 3QA8A 3UJGA 1K9AA 3FDNA 4FODA 4ZSEA 3TNIA 2RFNA 4QP8A 3TZMA 4ARKA 1CMKE 3QUPA 2BKZA 4AGWA 3R9DA 4G9CA 4QTCA 4DHFA 5BMMA 4WNOA 4FG8A 2BAQA 4AU8A 2JC6A 3QBNA 2GQGA 3SC1A 1YVJA 4YC8A 3HA8A 3HDNA 4IMYA 4NW5A 3SD0A 4A9YA 3RTPA 3ZEWA 2PVYA 2UW4A 4B8MA 3UVQA 2PU8A 5C8KA 3KXHA 3ZSIA 3ML1A 3FYKX 3RNIA 3QCYA 2WEVA 5AP0A 3LCDA 2CKPA 3IKAA 1J3HA 3QZGA 4QMXA 2OK1A 1W82A 4R5SA 3R2BA 4EK4A 3IO7A 3KULB 4IWOA 2VU3A 2OO8X 3MH3A 2GFSA 1B39A 3RI1A 4RIYB 4FTIA 4W4YA 1Q4LA 2IPXA 5FM3A 4AW0A 5LWMA 2UZTA 4M14A 3FC1X 1UA2A 2W9ZB 1H28A 3T8OA 2VWYA 4YJRA 2FSTX 1XBBA 2BRNA 3CPBA 2GSFA 3EQBA 1H1WA 2W96B 3NPCA 5AAFA 2OJFE 2P2HA 4TYHA 3KRXA 3DFAA 4RMZA 4KRDA 4K18A 5J79A 1MRYA 3DBFA 4ACHA 4RWKA 4L43A 4LRJA 3DS6A 1REKA 2C5OA 2WAJA 3BPRA 4GFOA 4K1BA 2GPHA 3SHEA 3Q96A 2YWPA 2YDKA 4I5CA 1Y6BA 3ZSGA 3QUEA 4LOOA 1H07A 2WQNA 5HU3A 5M07A 2WD1A 5E90A 3AT3A 2CGXA 2WFYA 3ID6C 3EJ1A 4X3FB 1H01A 3DLZA 4QP6A 4FKLA 4KWPA 3FI4A 5IH6A 3Q9XA 3P7BA 2CHLA 3LJ2A 3Q4UA 2CNQA 2ITTA 2UVYA 3VC4A 4WBBB 2OLCA 4AXFA 1MP8A 2HZ0A 4IDTA 5CSHA 2F7EE 3T9IA 2CGUA 2IW6A 2XS0A 4FSUA 1TKIA 3PP0A 5AUWA 5HG5A 4YO6A 4XNEA 2AQXA 4ZY4A 2DUVA 3HNGA 2KULA 4PX6A 2UW6A 1HCLA 1ZRZA 4PTEA 3R04A 5E7RA 5H3QA 4BL1A 4MBIA 4FKQA 4W8EA 4NIFB 5AIKA 4FSQA 3AD5A 4U97A 5D1JA 1J91A 3EWHA 5AFVA 3MV5A 3F7WA 3G5DA 4FTCA 1F3MC 3QTUA 4OTHA 4TWPA 3F3VA 4I92A 1H26A 2W1GA 4F9BA 3G6HA 4XG7A 2YFXA 4MD7E 4YHTA 5CEKA 2X0QA 4MEDA 2J2IB 4TWOA 2BIKB 3PWYA 4JG8A 4BTFA 5AADA 4USEA 1DM2A 5A46A 1XMMA 4JAIA 3QQFA 4JG6A 4EH8A 5AX3A 3ZS5A 4F7JA 3K54A 3Q5ZA 5DA3A 1U59A 2HW7A 4XS2A 2WMRA 4BI2A 2OSCA 2PUUA 1KE6A 5FTOA 3UYTA 2IVUA 3GFWA 4O27B 3ZUVA 4LYNA 5CEMA 3CBLA 2C3JA 3G51A 5CQUA 4HGLA 1U54A 1AGWA 3DXNA 5HEZA 3MI9A 4QD6A 4D1SA 5KKRC 4AN9A 3TV7A 1Q99A 4GV1A 2IWIA 4TT7A 5H9BA 2G01A 1J7UA 1WVWA 4YHFA 3TDWA 1QPEA 3KC3A 4FE2A 3AGMA 3BKBA 4NJDA 4DFZE 3N4TA 1JSVA 1MQBA 2YACA 3PE1A 3AT4A 3BV2A 4EOLA 2P3GX 4MBLA 2O8YA 3ANQA 4DH3A 3VNTA 4ZTSA 3BHHA 3E3BX 5CSXA 3PVUA 4FTAA 4O86A 4RFZA 3HV5A 2IEWA 3QU0A 3QL8A 2X0PA 4O2PA 3RPSA 3FMLA 4FTKA 5HD7A 1ZARA 3C4EA 4O1OA 1KE9A 3MVHA 3MY0A 4XG8A 5K9IA 3RALA 2OKRA 4OTQA 3E92A 3MDYA 4GG7A 3MTFA 3DTCA 4TYHB 1WFCA 2OZAA 3D9VA 3C0GA 3ORMA 4RWIA 4PP9A 4EOKA 4NEUA 5AIRA 2YISA 4N70A 1PXPA 3OOGA 3QCSA 2ZB0A 4QMZA 3FMJA 3W2RA 3ENMA 4NT4A 3N4VA 2Q0BA 1ZWSA 3P1AA 1O6LA 2DYLA 3F61A 3I1AA 4E4XA 3C51A 3RAHA 5E92A 2C3LA 4QMNA 5TF9A 3HMMA 1FGKA 5HD4A 3KK8A 3GCVA 2X6EA 3ORLA 4YZCA 4FZDB 5AAGA 4JS8A 4L6QA 5EFQA 5EM7A 3VS4A 4BI0A 2YDIA 4C37A 3I0QA 4MXAA 1XJDA 4PMMA 4BDBA 5ICPA 3O8PA 2YIRA 3OEZA 2GNGA 3VBTA 2FSLX 4D0XA 2X6DA 2FSMX 3R83A 5M09A 4BCMA 3F3WA 3WZUA 1R0PA 3ET7A 4H3QA 3CGOA 5BV3A 5FXQA 4ZJJA 5CALA 1OKYA 4PL3A 1LPUA 4C35A 5DPVA 4FBXA 4WRGA 5TOZA 4I3ZA 2JKOA 4F1OA 4AW2A 4O7YA 2BHHA 3IW6A 2IVSA 3ETAA 3LOKA 3RPRA 5BVNA 1J1BA 3QHWA 5FD2A 2VWWA 4XRJA 1BL7A 4USFA 3DAJA 5L2TA 3LE6A 3DJ7A 3TJCA 5C8MA 4F7LA 2C0IA 2ZM1A 3D2KA 4ACMA 2B9HA 4BN1A 3C0IA 5I4NA 2ITQA 2WMUA 1QPCA 4O6EA 5AR2A 3HV6A 3L8VA 3EH9A 4TYJA 2FVDA 2XEZA 1SZMA 3ROYA 3F69A 3G6GA 2G1TA 4D1XA 4BIEA 5M51A 1O9UA 4B8LA 3NFFB 4MH7A 5TKDA 3VRZA 5HO7A 3BLHA 3LMGA 2R0UA 3DBCA 2PZRA 3M42A 3R73A 1JKLA 3RVGA 4Y95A 4BCIA 5LVMA 4UMRA 3S4QA 4ZSGA 3KF4A 4PNKA 3C4ZA 5EHOA 2PPQA 2R3HA 1XQZA 3EYGA 4V05A 4UY9A 3KRLA 3OG7A 3ORZA 1M7NA 3MGYA 2BKKA 2XZSA 3AKJA 4HYSA 2XCHA 1ZY4A 4RA5A 3RK5A 5E4HA 2ITWA 3BU6A 2XAOA 4KKEA 4C8BA 4QQCA 4Y8DA 2UZOA 5T68A 2GNFA 4YR8A 4BTMA 5BQ0A 4QPMA 3F3UA 4DGLC 1OGYA 4FVRA 3CTQA 1W7HA 2VWXA 2XRWA 3MBLA 1OKZA 4PTCA 1MRUA 1Z57A 3LQ8A 4XJ0A 3MS9A 2WB8A 4WG5A 4JDIA 2OXDA 4MAOA 5J1WA 5DE2A 3UG1A 3BL9A 3ZEPA 4G6OA 4XOYA 3EMGA 1HOWA 5ETCA 3PXFA 4IWDA 2BROA 1VYZA 4RQVA 3W0NA 2FH9A 2BRMA 3E8EA 3PVWA 1KWPA 3NAXA 4GIIA 3RM7A 1Q97A 3OD6X 5E8XA 3VS1A 3U51A 4M69A 1OL6A 3OY1A 4DDGA 1OIYA 3HUBA 4RIOA 1YWVA 3FHIA 3PYYA 3FLZA 1V1KA 5HU9A 4L3JA 4O7LA 4OBQA 4TNDA 4E26A 4X6QC 4FNZA 4XP2A 4MXXA 3FLYA 2W1DA 3MWUA 3ZXZA 1J7IA 4AGDA 2B54A 3GC0A 3LFSA 3BHVA 2C0OA 3O51A 3VUIA 4HW7A 2OICA 2JDTA 4GH2A 2WTVA 4LV7A 4RA4A 2C69A 2VX1A 4LV8A 3C4WA 1Q8UA 5CU3A 5L8JA 5B7VA 5M08A 4O0VA 3QQGA 4U40A 4EUUA 2QC6A 2J0KA 2VTHA 2OZAB 3GU5A 3VIDA 1OPJA 4NK9A 3LFAA 2J5EA 5EM5A 2QONA 2JDSA 3QD4A 4FG7A 3D83A 4MWHA 3LFDA 5A3XA 5KMIA 3PWDA 3F5PA 4FV7A 2CNVA 4C4EA 3VONA 4RQKA 4ZTQA 5KMNA 3H3CA 3R2YA 4C2VA 3NDMA 2NRUA 4NTSA 3FZRA 3HL7A 2Q83A 4HVGA 3NVKI 1ZOGA 2HYYA 2PZIA 2JEDA 4GIHA 5HLPA 1JKKA 2WPAA 4JQEA 4C3FA 5DEWA 2BFXA 3CJFA 4WSYA 4QNYA 4FSYA 5DRBA 1LEWA 2XB7A 3BX5A 3R8VA 3A7FA 4MYGA 1AQ1A 3F3ZA 2IZRA 4LL5A 2UZNA 5J9LA 4FV6A 2RGPA 4PL5A 1VZOA 2YJRA 3MA6A 3U87A 5J5TA 4YTIA 3SV0A 4DG2E 2YWVA 5C27A 1YHSA 3A61A 3TL8A 2X81A 3UZRA 1OPKA 3BYUA 4QMYA 4S34A 3KFAA 3O7LB 3R9HA 3QTWA 2WTDA 3QWJA 5CT0A 3LJ1A 5JN2A 5LMKC 4DEIA 2VTOA 5EDPA 3P78A 3UIMA 3VS2A 5IH5A 4WO5A 3VBVA 2Z7SA 1RW8A 3ALNA 4QOXA 2ITXA 3Q4TA 4DGMA 1NT2A 3RP9A 3DPKA 4RZVA 4QYHA 2WHBA 4YHJA 2OH0E 3COIA 4BBFA 4MK0A 4OAVB 2RG6A 3CSVA 4BTJA 3UIXA 4ITIA 1E1VA 2OW3A 3MPAA 4IX6A 4JL9A 1WCCA 4HNFA 4RLLA 4Q5HA 4ZMEA 4N4SA 2GMXA 3KEXA 2WQMA 3R00A 3I7BA 4C62A 4NH1A 2XIYA 3MVLA 4R3RA 2UUEA 5L8KA 4D4VA 4ZY5A 5FXRA 2C0TA 1FQ1B 1H08A 3C50A 3G9LX 3QAME 1KE5A 1MQ4A 4MBJA 3NAYA 4FYNA 4MQ2A 3R8MA 3H9OA 4ANMA 4F09A 4QDEA 5EQEA 4S2ZA 4KIKA 3TNHA 3PJ2A 2W17A 4ITJA 4CLIA 2QD9A 3IOKA 4BTKA 3L1SA 3R7EA 5FWKK 2CLQA 2XA4A 5HOAA 4U81A 5TT7A 3MB6A 3LCOA 3TNPC 4P5ZA 3VBXA 2AC5A 4OTGA 4BCFA 3DA6A 5CU0A 3HZTA 5IQEA 3KN5A 4LUDA 3A7GA 1QPJA 4FG9A 3DKFA 4OTRA 4I4EA 5AWMA 1ZY5A 2OFUA 2W4KA 4G3FA 3WF6A 4M12A 1Y57A 3FHRA 5GHVA 4CKJA 5JEBA 1BYGA 3Q04A 4DHIB 5M44A 2VWIA 3ZH8A 4EEVA 4RIWA 5F9EA 4O7NA 3I5NA 4TYEA 3CXWA 2XCKA 2VX0A 4Y85A 4ZZNA 5A4QA 3MVMA 1XWSA 3OXIA 3KU2A 3QZFA 4PL4A 3BWFA 4M69B 4MUQA 1OKWA 1ZOHA 5JT2A 3LFBA 3R6XA 4LOPA 3JVRA 3FLQA 2C6LA 2IG7A 3HKOA 1Q8ZA 4AOJA 4RJ5A 4IWPA 3NVMB 4EONA 2WO6A 5FGKA 4YBKA 1YI4A 3BE2A 3E88A 5CF6A 2H34A 4Y5HA 4G2FA 5IMXA 3KRRA 2OIDA 5ANEA 3KKVA 3VUGA 3PDTA 4DCAA 1P4OA 3PG3A 5BMSA 2GTNA 3MESA 4IVDA 3TDVA 3UO6A 4NCTC 2WELA 3OT8A 4U43A 4U5JA 3CKWA 3CPCA 1Q41A 4FNWA 3IS5A 3RK7A 3FZ1A 1IG1A 2R3RA 5HBEA 5HKMA 2HY0A 5DFPA 4LG4A 2P55A 2VTJA 4OTWA 5J9ZA 3PXKA 4FL3A 4N6YA 3FI8A 4JXFA 2UVZA 4GVJA 3TIYA 2YEXA 4YJOA 3CE3A 2J90A 4FKRA 4QRCA 3KXZA 5A6OA 5IH4A 4GFMA 3MH2A 2ERKA 2OIBA 4FIHA 4RFMA 4CFNA 2PUIA 5IQIA 1M7QA 1TQMA 1E1XA 2WMSA 5A14A 3DFCB 3LJ0A 5CYIA 3LLAA 1ZOEA 2XIXA 3WZDA 2VZ6A 3NMUF 5HZNA 4Y83A 1X8BA 5EOBA 5ETAA 4YURA 4RG0A 1PRYA 5ETFA 5BYYA 4DFYA 4UYNA 2EUFB 3E3PA 2NP8A 4IC7A 3Q4CA 4EH3A 4XEYA 4YLLA 3SQQA 2JKQA 4A9RA 3GOKA 2OF2A 3IW8A 3R9RA 3KN6A 3FLSA 4EOQA 4JR3A 3PIZA 2R3QA 3KY2A 3WE8A 4AGCA 4CFWA 3PUFC 1NVSA 4GVAA 3UODA 4E6QA 4TZRA 5HG9A 3G0EA 4I6FA 3GQIA 4WT6A 4QTEA 5CAVA 4EHVA 5IISA 4IVBA 3VUDA 4EOMA 2UW8A 4DH7A 1GJOA 2XJ2A 4FOCA 4NM0A 3QFVA 5DNRA 3BE9A 2XBJA 2XJ1A 4LI5A 3TJDA 4ACCA 4XHKB 2C5XA 4FIGA 2OWBA 4XG3A 5AA9A 3U4UA 4OW8A 4YSMA 3G15A 1M17A 1FPUA 3PY0A 3MFUA 3EOCA 3ODZX 3QC4A 1H1QA 4CZTA 4D58A 4BC6A 1OUYA 1UKHA 2IW9A 3KMUA 3C7QA 2YCSA 2XM8A 4LRMA 4QMVA 1UU8A 4CNHA 5CZIA 2RFEA 4JR7A 5JFSA 3CC6A 4KIKB 5FDXA 5IDNA 3DDQA 1ZMVA 2JAVA 3SRVA 5CF4A 1TZDA 2HWPA 4GJ2A 4TYIA 1QMZA 2ACXA 3ZO2A 4EL9A 4FK6A 2ZFYA 2WIHA 4Q2AA 5L3AA 4FGRA 4O7TA 2F49A 4E6AA 3QTRA 2XH5A 1IAJA 2BRGA 2O64A 4K11A 3V8TA 3UQCA 3PJ1A 4PMTA 4TTHB 1YXTA 3NX8A 2OH4A 4ALUA 1W83A 4HVSA 5C8NA 3U6JA 1R1WA 3NYNA 5CVGA 3AC8A 3KIOC 3FJQE 4HVIA 4E4MA 4FOBA 4OT6A 4FL1A 1GZOA 3EN9A 4KB8A 3QYWA 5L2WA 2PVHA 4KA3A 3JPVA