2O2UA

Crystal structure of human jnk3 complexed with n-(3-cyano-4,5,6,7-tetrahydro-1-benzothien-2-yl)-2-fluorobenzamide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
355
structure length
319
Chain Sequence
NQFYSVEVGDSTFTVLKRYQNLKPIGSGGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLAVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYHTIEEWKELIYKEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 10
publication title N-(3-Cyano-4,5,6,7-tetrahydro-1-benzothien-2-yl)amides as potent, selective, inhibitors of JNK2 and JNK3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 319
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2o2uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2o2uA01
1YXTA 4AZFA 3VUTA 5LWNA 3NNXA 3E3PA 5KUPA 4M7IA 4YJOA 4N0SA 4P90A 3S0OA 3SRVA 1PXOA 4AQCA 4FKUA 3WZUA 5AAGA 1MRUA 2P4IA 5BYYA 4I5PA 3HAMA 4IAKA 4Y46A 2P2HA 5HCXA 4EORA 4ALVA 4M84A 3MPTA 3R02A 3IW5A 4U5JA 2I7QA 5KHXA 4FC0A 3UC3A 5CT0A 4LI5A 1J7IA 3RJCA 1HCKA 1YWRA 3FLYA 1G5SA 4KD1A 4G16A 2QD9A 4DYMA 4LGHA 3RAKA 4FE2A 1ERKA 3OZ6A 3ETAA 5K4JA 4CD0A 2BZKB 1J3HA 4PMPA 2EU9A 5I9XA 4E4NA 4ZXTA 4FYOA 2E2BA 3I6UA 3MTLA 4AOIA 1L3RE 3SRVB 3V5WA 3S2PA 4EOKA 4C33A 3C0GA 3V6RA 2O63A 5D11A 4A9UA 5DA3A 3VO3A 5HEZA 3R7IA 4OTFA 4NTTA 4NEUA 4I0TA 2UW5A 4G3CA 1M2RA 4EK5A 3TUDA 4O2ZA 3PG1A 4QP2A 5IA3A 3B2WA 1XH9A 3TJDA 3FLWA 3R63A 4BKYA 2XK7A 3VBQA 2CJMA 3CJGA 3OTVA 1FQ1B 4GG7A 1URWA 4U40A 1XH5A 4F9YA 1AQ1A 3FSFA 5C26A 2OU7A 5J7BA 2XCKA 3FBVA 4IM2A 4BBMA 4ZTMA 2P55A 4LMNA 3QLFA 4NM3A 5AR7A 4IX6A 3QF9A 2PHKA 3OCGA 3ODYX 3A7GA 4FIJA 4KABA 3C4XA 5LWMA 2PVKA 2IVSA 2VWXA 3RPOA 3N4VA 1G8SA 2F7EE 4YHTA 5A6OA 3R1YA 4DC2A 4RX8A 4JNWA 5FEDA 4GVJA 4CTBA 1J91A 3UOJA 4CT2A 5JFSA 3DAJA 1YXXA 3FEGA 4BIDA 4PPBA 3CPBA 2B9JA 4S2ZA 4OTWA 3WIGA 3QQLA 2CGUA 1DAWA 2VTHA 4IXPA 4RC3A 4AZVA 1PYEA 4FA2A 1H8FA 2FGIA 1A9UA 4E6AA 3GC0A 3ZBXA 4DEEA 2VWZA 4HZRA 4ERWA 3LKMA 4TW9A 3ZUVA 4FEXA 2C47A 1UU7A 4W4WA 3DXNA 4FVRA 3TV6A 3LFQA 3UODA 5L8LA 4HOKA 4AGCA 3R2BA 5C8MA 4JBPA 4PMTA 2GPHA 3SXSA 2WMXA 3I6WA 3FDNA 2HXLA 3N9XA 1O6LA 1OI9A 5DG5A 4UZHA 4L67A 4U80A 2OXDA 4S31A 2VWBA 4BIEA 5CASA 2Z7QA 3NW7A 4PL4A 5ICPA 5BNJA 4IAYA 3UIBA 4NKSA 3RP9A 2QHMA 4ARKA 5BUEA 1OPJA 4EOSA 3FZ1A 2OZOA 4RVLA 1LUFA 4O0TA 4O38A 4RX9A 4RQVA 4GFGA 2PPQA 5HG7A 1WBVA 2VWUA 4TYIA 1P14A 4XYFA 4EONA 5B2MA 4QO9A 3HA6A 4FVQA 2Q83A 3MB7A 4XUFA 2XBJA 1HOWA 3HP2A 5AP0A 5KMOA 2VRXA 2WMUA 4D1SA 5EQEA 4TTHB 2YN8A 3AC5A 3MS9A 1QPEA 2YFXA 3A7JA 3FMLA 4X0MA 3PG3A 3PVUA 3R7YA 2FUMA 4DG3E 3FI4A 4EH8A 1YRPA 2HY0A 4RRVA 3OXTA 1UU8A 1BL7A 5AAEA 5AAFA 3OOGA 2RFNA 4MXYA 4BCGA 3BGQA 4N57A 3QZGA 2OG8A 2JC6A 4Z9LA 4JVGA 5AR3A 4BGQA 2R7BA 2YZLA 1KSWA 5KZIA 4CFNA 4O83A 2JIVA 3TDVA 3UPZA 5HE2A 4MF0A 5FXRA 4G6LA 2C6EA 2EXEA 2UW3A 3UIMA 5LMAA 1T45A 4UMQA 4BI2A 4ZJVA 2HZIA 2PSQA 3FE3A 2PWLA 4YLKA 4YGAA 5DLSA 2B4SB 2RL5A 3R1SA 2XJ1A 5D7VA 5J8IA 2OJ9A 3FC2A 1YI3A 3GI3A 4FIFA 2YDKA 4QMQA 1IEPA 4L52A 4CFFA 3WF9A 5E90A 5AV0A 4CLJA 3QHRA 3F2RA 3KVXA 4A9SA 4AU8A 1APME 4I41A 4BFMA 4XJ0A 3A4PA 3ORIA 4AFEA 3H9FA 4MQ1A 5HBEA 2J90A 2QQ7A 3F6XA 3I4BA 3KCKA 4Z55A 2BDWA 4UYNA 2X7FA 2WU7A 4MCVA 2EB2A 3KN6A 5CF8A 2BIYA 2W05A 3AC3A 5ACKA 4NIFA 3JXWA 2XK4A 2YERA 3LHJA 5DT3A 4PDYA 4R1YA 3IG7A 3FL4A 1TVOA 3L8XA 4U42A 5AEPA 2WMBA 4E8AA 4U79A 2CCIA 4MH7A 1ZOGA 2VTSA 4FKJA 4HYSA 5AIKA 4JS8A 5CAVA 4XEYA 5DIAA 2X4ZA 4GIIA 3VHKA 3GCPA 3DB8A 5EM5A 1FVVA 1WVYA 1Z57A 3PXKA 3O71A 3W32A 3T8OA 3DA6A 2GFSA 2YCQA 2ITQA 4XLIA 3ENMA 4BZDA 4AF3A 3U4WA 4H05A 5J5TA 3WYXA 1REJA 5H8GA 1SVGA 3AOXA 4UMTA 5L8KA 5CT7A 3TG1A 1OL6A 3C51A 2QOFA 4LRMA 5IEXA 3R7GA 3SC1A 4XH6A 4DHFA 3DJ6A 3HECA 4JDKA 4ONAA 5IQDA 2XRWA 4BDIA 5BX0A 3W8QA 1OUKA 2W1DA 4BB4A 5C9CA 5HE3A 1PRYA 2IWIA 3LM5A 3CLYA 3PLAE 2RG5A 5IA5A 4D2WA 4FNXA 3NUXA 4H3QA 4WHZA 4BDAA 5HX8A 1DI8A 3NGAA 4G34A 5KX8A 4ZS4A 1UNGA 3PPJA 4FL3A 5CWZA 4XG3A 2CLXA 4FV0A 1PXIA 4IADA 3LJ1A 3F7ZA 4DEIA 2H6DA 5HVYA 2H96A 3LJ2A 4PDOA 4ACDA 3BU6A 1YHVA 4MXXA 3Q3BA 3MW1A 2R3PA 4JAIA 4ZY6A 3HRCA 4G31A 2W1ZA 3F82A 3Q60A 5IA0A 4GRBA 4LG4A 5AM6A 3R9NA 3FAAA 3O8PA 2F2UA 2GNIA 2Y6MA 4JIKA 2GNFA 2R3JA 2Z7SA 4K2RA 2WMSA 4EHEA 3IW7A 1Q8UA 3HNGA 4RIXA 3W18A 4QQJA 2XIZA 5BVOA 2DUVA 3RHXA 1H25A 5DRDA 5EDQA 3W2QA 2F49A 5ETIA 5JZNA 5K5NA 2VTPA 3MBLA 4PP9A 4FUYA 4RWKA 5K5XA 4HVHA 2XKEA 4ZZNA 4YBJA 5J1WA 3JY9A 1LEWA 3LM0A 4BGHA 2XIXA 4C4IA 2Z8CA 1XKKA 2ITTA 3LMIA 3SAYA 2R3OA 4N6ZA 4FODA 3ALNA 3NUSA 5DEWA 3TKIA 2P3GX 5DEYA 4GMYA 2VO0A 3ZZEA 1GZ8A 5BVEA 1KOAA 5TOZA 4BYJA 4HVGA 4CFUA 4FYNA 4KB8A 3TACA 3OXIA 2BZJA 3F5GA 4YZCA 2IW8A 4O0VA 3G0FA 1H1PA 4LQMA 4RIXB 3ORLA 1TQIA 4GUEA 4J1RA 4DEDA 4BWXA 4R3CA 3ACKA 5KKRB 1Q8YA 1ZYCA 5C4KA 5EOLA 2Y4PA 5GZ9A 4F0IA 1OB3A 3D83A 2JITA 4BCOA 3EQCA 2GSFA 4M69B 2WEIA 2QOBA 4DH8A 4GIHA 4YC8A 3T9IA 4DTBA 3Q4TA 2QOLA 4FSUA 4QP9A 3QTXA 3DLSA 4YLLA 4OT6A 4YMJA 2AYPA 2YM7A 5CF4A 5EW3A 4K77A 4ALUA 3F7WA 4OLIA 5E4HA 4OBQA 2HK5A 5CQUA 3ZEWA 3TUBA 2OH0E 4NCTA 4YPSA 3QGWA 2J6MA 4UN0C 1VYZA 4FIEA 1M2QA 3QTRA 4PMMA 3DBEA 5BUIA 4TRLA 4YJNA 3UBDA 3UC4A 4BRXA 2XMYA 3KU2A 4XS2A 5HE1A 2XH5A 4FSRA 4NJDA 2B9HA 2QURA 1OL1A 4L45A 4YZDA 3DPKA 3C1XA 3PXQA 4PPCA 5TKDA 1OL7A 3ZZWA 4G9RA 5CS6A 3P5KA 4ZLOA 3W1FA 3NNVA 2NRUA 4G6NA 1B39A 3OWPA 4A4OA 2WTKC 4F70A 4AP7A 4C36A 3AD5A 4RJ7A 1BL6A 3V5LA 3M11A 5FDPA 2E9UA 5A4TA 2YJRA 2NP8A 4XMOA 3HRFA 1KUTA 3SG9A 5CEOA 3D0EA 4YURA 4FKLA 4BBFA 3MN3A 3IK3A 3L1SA 4KIQA 5IDNA 1FMOE 3QTWA 3MB6A 4I5HA 4M0ZA 4RIWA 3UOKA 5BUJA 2PUIA 1SYKA 2C6TA 4AW0A 2VZ6A 4DFYA 3PY3A 5GHVA 3NIEA 4BN1A 4USFA 4HNFA 1H1WA 4V0GA 1TKIA 3AC4A 4JQ7A 3ERKA 4QPAA 3E8NA 4XV1A 2X8DA 3MIYA 3VJNA 3MY0A 3QZIA 5IG1A 3EZVA 1ZMWA 4L53A 2VTIA 3DKGA 5M56A 4AGDA 5CVFA 2J51A 4WUAA 2W1HA 3F3WA 4X2FA 1NY3A 5CI7A 3TKUA 3WF6A 2WMRA 4O6EA 3DQWA 2OIBA 3PP1A 4YJSA 1W84A 5ITAA 2JDVA 3KXNA 1A48A 2GQSA 3H9OA 4EBVA 2ZV9A 4RIWB 3CR0A 4B9DA 1H07A 3M42A 2PVRA 4EK6A 2B53A 3I60A 4H58A 4U3ZA 4DEAA 3KA0A 2B54A 1YXSA 3K5VA 5A4CA 3G33A 1MUOA 3BYVA 1Y8GA 2A0CX 3AGMA 4PX6A 5ETAA 4FEVA 2ZV8A 4I5MA 5HESA 5AV2A 5IQEA 3BWFA 2FO0A 1BYGA 1RJBA 2JBOA 4IAZA 4TT7A 4FEWA 4NJ3A 2P2IA 3FMEA 4QTCA 3R8UA 4ZSLA 4BICA 3FI3A 3DDPA 5DMZA 2QO9A 4KBKA 4FT3A 4GH2A 1WMKA 3VBVA 5CU3A 4WG3A 2IVTA 1WBOA 3IW8A 4A07A 1NXKA 2ZOQA 4ZY5A 1GZOA 3CY3A 4U41A 2C3JA 2W1IA 5HNIX 4MXCA 1ZAOA 4A7CA 2BCJA 4G6OA 2PMIA 3LW0A 2DWBA 4ZY4A 3BHUA 2HW6A 3ACJA 3V04A 5I4NA 4XV3A 1PMVA 4GK3A 4K0YA 3VULA 3FXWA 4QNYA 5EM7A 4E7WA 1H24A 4M14A 4ENXA 5CY3A 5T3QA 5ANEA 3WE8A 1ZY4A 1Q61A 1QCFA 1YKRA 3FC1X 2VGPA 1XWSA 2UW4A 3KL8A 4F09A 1G8AA 5M09A 3JS2A 1OMWA 3EHAA 4B6LA 4KS8A 4X2NA 5FLFA 4WOVA 5KMIA 3CEKA 5KZ0A 2OW3A 1XH8A 4UX9A 4EH7A 1ATPE 1SM2A 2WMVA 3KEXA 4DLJA 3B8RA 3CKXA 1PHKA 3VQUA 5HO8A 2GQRA 2B9FA 5M07A 4GU9A 2JBPA 4F1OA 3F2AA 5AADA 2RKUA 3HMPA 4TYHB 1U46A 3CXWA 3D5UA 4FL2A 2C3IB 2HELA 4FG9A 2LAVA 2R3LA 3ET7A 3GP0A 4V04A 3D15A 4E4MA 2PL0A 4YUQA 4KIPA 5HO7A 5IZFA 4ASZA 2HZ0A 3AXWA 3BGPA 3QU0A 3UG1A 5AX3A 2QONA 2XYUA 3N51A 4EJ7A 4M66A 3P7AA 3BHTA 4BDHA 4DEBA 2PZ5A 3R83A 3O23A 4IW0A 4UB7A 3ULZA 4IZ7A 4C02A 5M08A 4X3FA 1LP4A 3DNDA 4EBWA 4XBUA 4D4YA 4EC8A 4NCTC 3QCYA 3P0MA 2PVLA 4IAAA 1OGUA 5HIBA 3QXPA 3TNQB 2VNWA 3GT8A 4ZEGA 4PP7A 5CTPA 2YCRA 4L8MA 3C4FA 4YZBA 2I0EA 4GT5A 3LFBA 4RJ8A 4G1WA 5AR2A 5AP3A 4EK3A 4C3FA 4O7TA 3OEZA 2AUHA 3B2TA 4WKQA 2G9XA 3HMIA 4O7WA 1W83A 3CGFA 2IZRA 4QMXA 3JYAA 4H39A 4HNIA 5EDRA 1R39A 5AR8A 4QP6A 4E5WA 5LOHA 4G3EA 3HZTA 3LXKA 3MWUA 1MQBA 5HCYA 3PXZA 1BMKA 1NT2A 2GNJA 4HZSA 3NYOA 3MIAA 3PXRA 3HX4A 4FKIA 4QOXA 1F0QA 3EN6A 3LCTA 2XF0A 3A4OX 3DCVA 4IZYA 4FV4A 3E63A 3HMNA 3R21A 4X6RA 4XHKB 1YHSA 4XX9A 3SV0A 2V7OA 3UMWA 5LMKA 4DH1A 3E88A 2ITVA 2KULA 4YHJA 3TXOA 3Q9XA 4AZSA 2XK9A 4D1ZA 1YI4A 3DJ7A 4EEVA 5EK7A 1O6YA 1U5QA 3IO7A 4RVTA 5CI6A 4AX8A 4HVDA 2W06A 4L46A 4YJRA 4D2RA 4F9CA 1XBBA 2YAAA 3EIDA 4ERKA 5KMKA 2QOKA 3OWJA 1URCA 3W2PA 5GZAA 4Y5QA 4AA0A 4FZFB 3EL7A 3V8TA 4D5HA 5BYLA 5K4IA 3I79A 2YIQA 3BRBA 3PVBA 4EQUA 4Z16A 1JSTA 5CU2A 4MX9A 5ANJA 2R7IA 4FSYA 3U54A 3UMXA 3ZHPC 4BI0A 3QTQA 2ZB0A 3FZOA 5JQ8A 4R77A 3P08A 4PPAA 5BMMA 1LR4A 2YM4A 2XEYA 1NVQA 3R7VA 5IMEA 5EI2A 4ZOGA 3EZRA 4FBXA 4CKJA 4O6LA 4EWHA 3QRTA 5C8KA 3FZPA 4L01A 2YLEA 3AG9A 4HYIA 4F1MA 1DI9A 3FMDA 4U8ZA 5AWMA 4EH2A 2R3MA 2AC5A 3AMYA 3FLQA 3OY3A 2GQGA 1NVSA 4ITHA 4R8QA 3QUDA 2X39A 2Y9QA 3PA3A 2YDIA 2V7AA 4CCUA 4JG7A 3THBA 1H0WA 4FL1A 5AA9A 4Y8DA 5EM6A 4KAOA 4Q2AA 2HAKA 4RIOA 5GNKA 4D2SA 2RFEA 2QO7A 2WQNA 3MV5A 3OC1A 2ITZA 2VTRA 3R7OA 3P23A 3LXPA 1K9AA 1ZY5A 2F2CB 2GTNA 2PMLX 3IOPA 4FV6A 4XP0A 4DITA 3KXMA 3NUAA 1WAKA 3HVCA 3KK8A 3PJ3A 1IR3A 3A7IA 2WQMA 4BDKA 1WVWA 2LGCA 3I7BA 4YTFA 3MFSA 5IKWA 3RZBA 3QYZA 5L6PA 5C03A 4M67A 3FQSA 4YSMA 5F94A 3KY2A 4O1OA 2B0QA 4KKGA 2WNTA 4O91A 5E8WA 3IW6A 3ORKA 4U45A 4P2KA 2BR1A 3PVGA 5EYDA 3Q4UA 4PL3A 5E9EA 4CVAA 1SNUA 4FTTA 2V22A 3EQBA 3MPAA 5FG8A 3ZSHA 4YSJA 5IDPA 3FMNA 4DE4A 1WBPA 4JXFA 4A06A 3NIZA 3LCSA 3NDMA 4O82A 3CTHA 3C4EA 4ACHA 1GOLA 3WARA 5HX6A 5J95A 5M57A 2C0OA 3DFCB 3Q32A 2GNHA 1FOTA 3I81A 4RFYA 3HEGA 3COIA 5CNOA 2IZSA 4ASDA 2UW8A 4YJQA 4JJRA 5IU2A 3DV3A 4MNEA 1M14A 4D5KA 4EK8A 1U59A 1ZOHA 3FXXA 3VW6A 2X7OA 3OFMA 1SZMA 2QOCA 3CQUA 3RINA 5HBHA 3KXXA 3PA5A 4P7EA 1XO2B 2OJJA 3H0YA 5DOSA 3C7QA 1H27A 4X3FC 2X9EA 2OF4A 1F5QA 3I0QA 1OIUA 2IVUA 5H8BA 3TTJA 4R5SA 4YTCA 2WQBA 5EW9A 5HTIA 5E1SA 3QZHA 3ZLYA 4CSVA 1ZOEA 3FQHA 1DM2A 5CAOA 3EQFA 5IH4A 5H8EA 3TT0A 3LFSA 5BVFA 5IQHA 5J79A 4CG9A 1H0VA 2Y4IB 2PYWA 4MNEB 2IJMA 3MVMA 4FUXA 1V0OA 2X2KA 5ANIA 5GJFA 1YHWA 3KRJA 3PY1A 4GU6A 4WNOA 4BDDA 2Y6OA 1I44A 4DFNA 5J9LA 4XP3A 3L8PA 2ZM3A 3FPMA 4A4XA 2CPKE 2GMXA 4OBPA 4FV2A 2UVYA 3C50A 4KA3A 5L2WA 5B0XA 4MTAA 3H0ZA 4KIOA 2UZWE 3QD0A 3ZBFA 3KCFA 3W8LA 4GJ3A 3MA3A 1ZLTA 4YNOA 5GIPE 4R78A 4D0XA 1YWNA 4RX5A 3IGGA 4DG0E 2OI4X 4AN9A 2ZYBA 2YM8A 4AW2A 5LMKC 4IVDA 3UJGA 4S32A 3GOKA 5ANOA 3D4QA 3NWWA 1KWPA 3E8CA 2OXYA 2QKWB 4RJ3A 4EKKA 5CXZA 5CF5A 4U6RA 3CSVA 2PVJA 2W17A 3HKOA 3HV3A 2VX0A 4MQ2A 2ITXA 2ITUA 4NFNA 2HOGA 4YZMA 5HG5A 3UP2A 2C1BA 2RGPA 5DN3A 4YO6A 2BVAA 5HO6A 3G51A 5DT0A 3DKFA 3OWKA 5M06A 3R28A 5CF6A 3G6GA 2XIKA 3FPQA 3FSKA 4MXOA 4F0GA 2J0JA 4A4LA 4KRCA 2F9GA 3EQIA 3QA0A 3QQGA 2OIDA 2CGVA 4CFXA 2QOQA 4F64A 5CAQA 1S9IA 3GCSA 3Q04A 4NM7A 3VNTA 4F6WA 4TN6A 3BV2A 3BYMA 3BLHA 5LVNA 4RLLA 4WBBB 5HLWA 4GVAA 4IVAA 4RQKA 4EUTA 1H1SA 3G6HA 4I94A 4S34A 3CD3A 3NVMB 3AT2A 3KF7A 3LFEA 5BVNA 4QP8A 4LL0A 5E91A 3QQHA 5A54A 2GS2A 3G5DA 5J87A 5L3AA 2OZAB 2JDSA 2YACA 5FXSA 4L42A 3CIKA 1WFCA 5AJQA 4YNEA 1Q99A 4EC9A 3DTCA 2W9ZB 2ZDTA 2YAKA 4F6SA 5TE0A 5AP4A 3LCKA 2XNEA 3R30A 2E9VA 3B8QA 4OTHA 4A9YA 4F9BA 1EH4A 3GC7A 4YZNA 5IQCA 1XQZA 4ZMFA 4L68A 2W4KA 2YM6A 2OWBA 3NS9A 3SKCA 3D5WA 4M15A 1BLXA 4L3PA 3ZXTA 5JRQA 3IPHA 2NPQA 4AZEA 4DGNA 3MFUA 3QQUA 5AUXA 4O0YA 4HYHA 1PXKA 3OW4A 5M4UA 3RPYA 1H08A 4UWCA 2BDFA 2VWVA 3MDYA 5CSWA 2YISA 2EWAA 2X2MA 4PTGA 4IM3A 2X6EA 3RHKA 1VZOA 3D5VA 3VS5A 3DT1A 5JFWA 1FINA 4ZTSA 2C6IA 3A60A 4X3JA 1OKYA 4ZTNA 2XM9A 2XNOA 4APCA 2G15A 3DBDA 2JDOA 4U97A 5KMMA 1Q24A 3R01A 4EH9A 5CSPA 5B2KA 3R9OA 3K3JA 3CPCA 3II5A 3WILA 3UNKA 1OECA 3Q5ZA 2PK9A 2R0IA 5HNBA 4YJVA 1RQQA 4G5PA 1UWJA 3ROYA 1M7NA 4WNKA 5BMSA 2C3KA 2Y4IC 1XJDA 3NSZA 4KSPA 3ZSIA 3U6JA 2HZNA 4BCJA 2Y8OA 3KQ7A 4YJTA 5D7AA 2QKRA 4CZTA 3MH3A 4IBMA 3P4KA 1YQJA 3FLZA 4FIIA 5LARA 4QYGA 4K1BA 3DBCA 3JVSA 4RLKA 1PY5A 1W7HA 4G3DA 2UZOA 4E4XA 5GINE 5EKNA 4O0RA 1BUHA 4IJPA 3QWKA 4XV2A 3KXGA 2QCSA 3REPA 4F7SA 1E1XA 3OT8A 3FJQE 1PKDA 1PXLA 2JFMA 5CSVA 3K3IA 3PJ8A 5AV3A 3R9DA 2GS6A 4AACA 3T3VA 4C62A 4DCEA 4O7ZA 3O2MA 5AP6A 2X8IA 3EFLA 4Y95A 4APPA 2X0GA 4FTLA 5AM7A 4IX3A 4NL0A 2YIXA 3QGYA 4FKGA 3UVPA 1KE8A 2BFYA 2ZAZA 3UQCA 4FTAA 5CZHA 4IH8A 4J8MA 5F4NA 3FHIA 4FSNA 5AUTA 3JPVA 5DH3A 1OPLA 3G15A 3U9CA 5GJGA 1HCLA 3T9TA 3VS1A 3BQCA 1FVTA 4LM5A 4RJ4A 3F69A 2XCHA 3IECA 2GNLA 4GJ2A 1UA2A 4TWOA 3UO5A 1YDTE 4LV5A 4IQ6A 4UMUA 2G2FA 3GU5A 5FDXA 5A4LA 2W1GA 4IWPA 1VR2A 1JKKA 3OUNB 3C13A 1IAHA 2WU6A 3GC8A 3VS7A 4RJ5A 1QMZA 3HGKA 3W2OA 3KMMA 3GCQA 4PF4A 3TL8A 2BRGA 3RTPA 5CXHA 3Q6UA 3WF7A 4FKPA 1ZYSA 4IC7A 5L6OA 4EWQA 4P5QA 2H8HA 3A62A 3E64A 2XJ2A 4X7QA 2UZBA 5CX9A 2QLUA 4O0XA 4WBOA 2J5FA 3DBQA 4I1ZA 4IM0A 3U4UA 4F0FA 4BF2A 4CGAA 5M51A 4K9YA 4HPUE 5CALA 2QO2A 2VWWA 2Z60A 2PMOX 2XIYA 2J5EA 3ODZX 3V51A 3FMHA 4NM5A 5KMNA 3NCGA 3NPCA 4CFWA 2CKQA 4FR4A 4E1ZA 3VF9A 2CN5A 3Q5IA 4II5A 4EYMA 3DOGA 2WO6A 2QOIA 5FP5A 3WZJA 2G01A 5FGKA 4QYHA 3SLSA 3CBLA 3HV7A 4HCVA 4O2PA 2ZB1A 3ORNA 4LOPA 2E9PA 4FSMA 1ZYDA 1LPUA 2X2LA 2ZVAA 4C37A 4QMLA 4NKAA 4Q9SA 4R1VA 5JFVA 1FGKA 3GOPA 2B55A 1YW2A 4B8LA 3OUKA 4R7BA 1YOMA 4PWNA 1OIQA 1WBSA 3HLLA 5HVJA 4CFVA 1GIJA 2J0LA 3GUBA 4OTRA 1ZYJA 4BC6A 2ZM4A 2W1FA 4J97A 4FMQA 5EFQA 4WSYA 4IACA 4MBJA 1XHAA 2J4ZA 3QRKA 4JBVA 2WTCA 2CN8A 3RPVA 3ZCLA 5JSMA 4QMMA 4BCPA 2ACXA 3UZPA 3CC6A 2BROA 2UW9A 2F7XE 2OO8X 3C4WA 3FY2A 4BVUA 3DK6A 5DWRA 3C5IA 3JY0A 2O5KA 4I0SA 4F65A 1JVPP 1PXMA 3FI2A 4IANA 2VU3A 4YTIA 4M69A 5IQAA 3SA0A 4FTCA 4L9IA 2PY3A 5EYKA 3BKBA 2ZM1A 3V5TA 4FTMA 4KIKB 4TZRA 3KGAA 1XH6A 3FXZA 2XUUA 3HMMA 5DR2A 3ZONA 3GFWA 4ANMA 3A8XA 4OTQA 3FHRA 1ND4A 4LGGA 4IC8A 4AGWA 1PKGA 1GY3A 5KMLA 4YC6A 4DINA 3GENA 4ZSAA 1W8CA 3QCXA 4U43A 2Y7JA 4TYJA 4X2JA 5CU0A 3O7LB 5HKMA 5EKOA 4H3PA 1XH4A 3KRLA 4UBAA 1FMKA 3IOKA 1Y8YA 2NRYA 3Q2MA 4R7HA 5FM3A 3BIZA 5AIRA 3LLAA 4DTAA 4FTUA 3LOKA 3PFQA 2CKOA 1B38A 4RX7A 3WF8A 1Y57A 1PMEA 4IWOA 4AT4A 2JDRA 3OROA 2UW6A 4HCUA 2JD5A 2J0IA 4GT4A 3UP7A 1JLUE 3NX8A 1ZZ2A 4O21A 5CQWA 3BU5A 1MRYA 1XH7A 2PMNX 2VWYA 3Q4CA 3E8DA 4IAIA 4BBEA 4DLIA 2C68A 5K3YA 5BVWA 2G1TA 1QL6A 2QLQA 1J1CA 5JGAA 3P78A 2IZUA 1PJKA 1Q3WA 4L44A 1ZMVA 3F88A 3OHTA 1T46A 3OW3A 4QMYA 2WQOA 4QP4A 5HGIA 2I0HA 2DS1A 2WELA 3GQIA 3UVQA 5IISA 2BRMA 2W4OA 2ZV2A 3ZDIA 5E8ZA 4M97A 4USEA 4MVFA 3MJ1A 4CRSA 3QHWA 3O7LD 2Z7RA 4OTPA 3VBWA 3BI6A 4OT5A 5HTCA 3DK7A 5LVOA 2VTNA 2C6LA 3R73A 3EFKA 4A9RA 4CCBA 2PZRA 3KK9A 2CGWA 4DTKA 2J0KA 4EOLA 5IQBA 2OH4A 3UG2A 2PUNA 1A06A 4QP7A 4BWKA 5L2IA 4RZVA 3ZOSA 4Y5HA 1KE5A 5CSXA 3FYJX 4ASEA 4EL9A 1J7UA 4I23A 3V6SA 3ZXZA 3PXFA 3BEGA 3QBNA 3I0OA 5KBQA 2IG7A 3NYVA 4FG7A 3TM0A 4NYEA 3F5PA 4AN3A 5E8TA 4JAJA 4BGGA 3IQ7A 3BE9A 3DB6A 3L9NA 3VUMA 2UZVA 4ZP5A 3GFEA 3PE1A 5M4CA 2YM5A 3OS3A 3D5XA 4FSTA 4GT3A 3S3IA 4C34A 3BCEA 3DBFA 3LQ3A 3AD4A 4C35A 4AWIA 1W0XC 3W16A 3QXOA 4LRKA 2JAVA 5KNJA 3WE4A 2W5BA 4Q9ZA 3R6XA 4ZK5A 2X6DA 3CJFA 1G3NA 5IUHA 4NW5A 3QTUA 3R1QA 4UXQA 3FLSA 2R3QA 4AE9A 3W55A 4I6BA 4RZWA 2UW0A 3R71A 4BKJA 4MBLA 1FPUA 3E62A 4ZSEA 2Q0NA 4TY1A 5IEYA 4DT8A 3EQPA 3F5UA 1E9HA 3LPBA 1ZXEA 3HL7A 3V5QA 3RPRA 3VBXA 4FTKA 1PMUA 4ZAUA 5HBJA 1KOBA 1Q8ZA 2AC3A 4NU1A 3EFJA 4JDHA 3ZLWA 4MAOA 3TZMA 4BTKA 2QG7A 2EVAA 4FICA 4HGEA 4IEBA 1XBCA 2QR7A 2UVXA 2XNMA 3QC4A 4IZAA 5CLPA 2F7ZE 3SX9A 2DQ7X 2VO3A 4EOMA 3MJ2A 3R8VA 4NH1A 2OFUA 3RM6A 1WBWA 4AZWA 2PZYA 4EZ5A 1K3AA 4DBNA 4AN2A 3VS0A 2R0UA 3LXLA 3NZ0A 5FBNC 2HWPA 4MK0A 4JRNA 2XK8A 3RAWA 3MH0A 4FTOA 2PVHA 4FV5A 5ETCA 3DAKA 4O7SA 5HG9A 4AT5A 3QWJA 2O8YA 4MWHA 5AP5A 4FEUA 3OBGA 5HNGA 3TV7A 4AXAA 4AGUA 4ZZMA 4CQEA 2YWPA 3F2NA 4TYHA 3TKHA 3DXPA 5FQDC 5KKRC 3DZOA 5CAPA 5HU3A 5IA4A 3NRMA 1SNXA 3VWAA 3PXYA 2YJSA 5F95A 1LEZA 3SW7A 4RT7A 1CTPE 2A4LA 3LJ0A 4JIAA 4LV8A 4MKCA 5EW8A 3ORZA 4EHZA 1Q8WA 5KBRA 3Q6WA 4RMZA 2CLQA 4BCQA 3R00A 4I6HA 5JEBA 3PWYA 1OPKA 4I6QA 1QPDA 4HYUA 1H28A 2O0UA 5AX9A 3MH2A 4FIHA 3R7UA 3JUHA 1U4DA 2QHNA 4NUSA 4DFBA 4LFIA 4I0RA 3Q96A 2YEXA 1UU9A 4DFUA 4LRJA 4FF8A 3KMWA 4KRDA 5BYZA 3ZMMA 2UW7A 2QU6A 3F3UA 2YIWA 3P86A 3MFRA 3DTWA 1XBAA 4O7NA 3OG7A 3P7BA 4D55A 3UQFA 4FT5A 4J99A 5CU6A 3EL8A 3AT4A 4AA4A 3ID6C 4G2FA 5EI6A 5AUYA 3RI1A 1OKVA 5CU4A 2A2AA 4EKLA 2BZHB 3MSSA 3VIDA 2BRHA 4DH3A 3TI1A 3PLSA 3EMGA 1JWHA 2JLDA 3FMJA 2SRCA 1GIIA 3EQRA 4IIRA 4F4PA 4AUAA 1P4FA 4K33A 4JOAA 3WOWA 4D4RA 2VUWA 4FGBA 4XG4A 3RALA 4D4SA 1GIHA 5HZNA 2ZMCA 1JOWB 5EH0A 5B7VA 3ELJA 3FZTA 4PMSA 4PV0A 5HG8A 5LVPA 4ITJA 5H9BA 3U51A 4AG8A 3G9LX 2WOTA 4S30A 1GZKA 3ULIA 3GU4A 4I5CA 1YOJA 3G2FA 3PSDA 3RCDA 4D58A 2WB8A 3VUDA 1S9JA 1YXUA 1YXVA 3TN8A 1UKHA 5G6VA 4ZTQA 3ATTA 3WZKA 2WKMA 3EN9A 4QPSA 4YZ9A 2YIRA 2ETRA 2C0TA 4TWNA 4ACGA 5M4IA 5DR9A 3OP5A 5DPVA 2Y0AA 3DU8A 3R8LA 2J50A 3F5XA 3O0GA 4G9CA 3BZ3A 4QT1A 2I6LA 4I6FA 1H1QA 1PMNA 4FNZA 1YOLA 1JSVA 2PVYA 4HVSA 4LGDA 3FMKA 1FGIA 3EQDA 4MF1A 1H26A 3LQ5A 3SOAA 3DDQA 3QA8A 4JR7A 4KBAA 5EYCA 4LUDA 4WRSA 5CEKA 5JZJA 4FSQA 4WNPA 5DFPA 2G2IA 4CMTA 3QRJA 3BLRA 3OD6X 2HZ4A 2GS7A 4O81A 3GXLA 2OBJA 2XM8A 3PIZA 4F7LA 4QMUA 5EHOA 3ORTA 2ITWA 5HLPA 3SHEA 5E7RA 3NEWA 3EN7A 4BKZA 3MPMA 3ZLXA 4C58A 2C4GA 4DCAA 2BTRA 1OIYA 2XKFA 2R64A 4FNYA 5LVMA 2YIYA 3C4CA 3QQKA 4TWCA 3QFVA 4LOOA 3CY2A 5DNRA 2YCSA 2GNGA 3QD4A 4TWPA 4FTJA 3HV6A 3UQGA 3AT3A 2VTLA 4ORKA 4D9UA 3ITZA 2QODA 5LQFA 3TIZA 4FKSA 1JKTA 2XK3A 4EZ7A 2UV2A 3OCBA 3ZRMA 5J1VA 2ITOA 3W2RA 4RBLA 3UTOA 4FOBA 3CKWA 3ZTXA 4AAAA 4B4LA 5DT4A 3VQHA 4PDSA 1X8BA 3ORMA 4B99A 5HD4A 1UNHA 5GJDA 1MP8A 2HIWA 4NW6A 2W1CA 3HAVA 3LQ8A 3RPSA 1UWHA 2C5VA 4IWQA 1KE9A 4NWMA 3AC1A 3ATSA 2YZAA 2BPMA 3HUCA 3TJCA 4HPTE 3ZYAA 3BPRA 3HDNA 2PZPA 3CGOA 3DKCA 3QD3A 4LOQA 4TL0A 2YA9A 4RWJA 4OTIA 4MEDA 3LCOA 3LCDA 3EB0A 3GB2A 3R7EA 2X7GA 3DZQA 4IDTA 4RFZA 3RK5A 5JN2A 5I9UA 3PZEA 4QYYA 4AOTA 4C57A 4O22A 4DN5A 2YDJA 4L7SA 3ZS5A 3H10A 2OSCA 4XCUA 4O7VA 2FA2A 3G9NA 4MD8E 5CANA 5JKGA 3TIYA 2EXCX 4DGOA 4USDA 1W98A 1UU3A 2V55A 3BHVA 3BBWA 4W4XA 4EK4A 3PSBA 4DF3A 4O0UA 2R5TA 3Q9WA 2XK6A 1U54B 3G0EA 1RE8A 3A7HA 2R3GA 2XBAA 3Q9YA 4R7IA 3SOCA 1YVJA 4KBCA 3VAPA 3I5NA 4U9AA 4IB5A 2EB3A 4BDEA 4F7NA 5HTBA 3U8WA 3HV4A 5L2QA 3ALOA 3ZLSA 4RFMA 3DQXA 5CENA 3ZO3A 5HI2A 1BI7A 2JIIA 4WG5A 5DI1A 3ZC5A 4O96A 4O7RA 2F4JA 1XR1A 1CMKE 3D14A 4C4EA 5IH5A 5EQPA 3MI9A 3OTUA 4V01A 3ZSGA 2O65A 4BI1A 2JKQA 3UO4A 4TYGA 2XB7A 4K11A 2UZNA 4G5JA 3TNHA 3TZ8A 2C6MA 3EKNA 3LFNA 4FT7A 3GQLA 3FUPA 3TNPC 4GK2A 5FTOA 4EH4A 4E6CA 3EWHA 4ACMA 4XLVA 4EH3A 4FZ6A 1P5EA 1TQMA 5A6NA 5AA8A 3COMA 4GS6A 4WSQA 4E20A 4GKIA 5F9EA 2J2IB 5KE0A 4XG2A 2H34A 2OXXA 4TNBA 5L2TA 3NLBA 5CYIA 3SVVA 2BALA 4YO4A 1O6KA 4XG9A 3Q4ZA 3QAME 5HOAA 3U6HA 5ANDA 4ZTRA 2W9FB 4EOQA 3POZA 1BI8A 4JL9A 3UNZA 2BAQA 3VJOA 1M17A 1CKPA 2UVZA 4FK3A 4G17A 3PRIA 3UPXA 4CKIA 3E7VA 2C1AA 3BV3A 3QTZA 4WT6A 4XOZA 1V0PA 3GGFA 4FV7A 2ITPA 5I9VA 4PNIA 4QMPA 2C69A 3BYUA 4C4FA 2PVMA 4QQTA 3COHA 4H36A 4O0WA 3O8TA 4ZMEA 4E5AX 3K2LA 3U55A 4GL9A 1RDQE 3RK7A 4D4VA 4O7YA 3L9PA 1H01A 3H30A 1MRVA 3DS6A 3FYKX 4KWPA 4C3PA 3ZFXA 2WHBA 2KTYA 2WIHA 3DFAA 4L6QA 2JEDA 3AGLA 4UV0A 3MY1A 2C6DA 3F3VA 3LMGA 5BQ0A 4QTEA 2HENA 5I3OA 4TNDA 4UWYA 2HCKA 3E7OA 3F66A 5L6WL 4QQ5A 3BU3A 5KHWA 1W82A 3O17A 3UZRA 5CVHA 3W2CA 4IMYA 5HHWA 3NUUA 3PSCA 3GEQA 4PDPA 4B8MA 2PVNA 2JKMA 4Y85A 4MD9E 2GU8A 3U87A 2XNBA 3K5UA 3MGYA 1V1KA 3NNWA 5EI8A 3A7FA 4CYIA 4Z7HA 3ANQA 2V5QA 3UYTA 5CEIA 4E93A 3NW5A 4LMUA 5I3RA 5IQGA 4UXLA 2ETKA 4CMUA 3GVUA 2OZAA 2C6OA 3FV8A 4E26A 3UVRA 4X21A 4X6QC 5FEEA 4KNBA 3FZSA 5EHYA 4KINA 4I92A 1OKWA 4R3RA 3UE4A 1OM1A 3VC4A 4L7FA 5BVKA 3IGOA 2A19B 4JG8A 1KE6A 4HCTA 4Q5EA 1IA8A 5EDPA 2W0JA 4DGLC 1ZWSA 2CMWA 2RIOA 3BX5A 3KRRA 4QTDA 4E6QA 3P79A 5E8XA 3PWDA 4BDGA 2XEZA 5I0BA 3OXZA 4ANLA 4EQCA 5GIOE 3RNIA 2XNGA 5C01A 4L43A 3PE2A 3GU6A 3ZH8A 3JR1A 2XYNA 4QMOA 1F3MC 5FD2A 3VS6A 4C4GA 3EN5A 4EJNA 2JKKA 4PL5A 2BIKB 3H9RA 3C9WA 2IZTA 4UMPA 4CZYB 5IQFA 3V5JA 4JBQA 4C61A 4D0WA 2R3RA 3P1AA 3MVLA 3HP5A 3M2WA 3ZFMA 5JH6A 2UZTA 4CLIA 4CKRA 3PJCA 4F08A 3PY0A 4Y83A 5DVRA 2IW9A 4UALA 4I93A 4GYIA 2R4BA 2YM3A 3GU7A 3PJ1A 4QMZA 3RAHA 1PXPA 3ZRLA 5F1ZA 2P33A 3PJ2A 4IVCA 4BHZA 4GEOA 2XS0A 3NW6A 4BWPA 4D2PA 2ONLA 4MWIA 5ANGA 2WMTA 4FT9A 1P4OA 3MA6A 4GKHA 2RG6A 4AT3A 2CDZA 4XG8A 2VV9A 4M68A 4FV8A 5D10A 5AR5A 4Z7GA 5DR6A 1H4LA 4EYJA 1SVHA 3RWQA 4FVPA 5DGZA 5AR4A 1H00A 2VX3A 3R8PA 1Y91A 2C5XA 4F63A 3O50A 3E8EA 5EG3A 4XRJA 3QKLA 1VJYA 2VTTA 2ESMA 4BCNA 1OKZA 5FBOA 1ZYLA 2ZMDA 3HUBA 4JBOA 5H3QA 3NVKI 1R1WA 4C8BA 3QQFA 3NUNA 5DRBA 4B7TA 3KN5A 4FV3A 1BKXA 4U81A 2HY81 4ACCA 2Z7LA 3C0HA 1NVRA 2C30A 4BY9E 2VAGA 3FZRA 3V8SA 4F7JA 3BHHA 3HDMA 3UO6A 4BR3A 1CKJA 2I0VA 4FIGA 4GV1A 4O27B 3HV5A 3RNYA 4IFGA 2QOHA 3CQWA 5K0KA 1CKIA 2FSOX 4PRJA 4RJ6A 3DJ5A 2UUEA 2WMQA 5IUGA 3FKOA 2PE0A 3SD0A 4ZJIA 3E93A 5I9YA 3QRIA 2YITA 5A4EA 4NSTA 5E92A 3QC9A 3R8MA 2YHVA 3ZUUA 3CTQA 2VX1A 2JFLA 3NUPA 4FZ7A 3R0TA 4YC3A 5E8VA 3ZDUA 3RAIA 4C2VA 4C38A 3BHYA 4CV9A 2GHLA 3POOA 2UZLA 3OEFX 4G3GA 2GDOA 4FKRA 4ID7A 2RFSA 4IX5A 3ROCA 3OF0A 5FTGA 3TDWA 1Z5MA 2W99B 1TQPA 4FNWA 5HORA 4F9WA 4JX7A 3RMFA 4A9TA 4O0SA 4RVMA 4C7TA 4JX3A 3QX4A 1Q97A 4QRCA 3D2KA 5FXQA 4EH5A 2XP2A 5A14A 3TUCA 5AUUA 1I09A 4ANQA 4BCFA 4NK9A 4DG2E 1M2PA 1ZMUA 3GU8A 2W1EA 1MQ4A 3QL8A 5CEPA 4E5BA 2BRNA 4BHNA 5JT2A 1WVXA 3CE3A 3PDTA 3QCSA 3KVWA 3LVPA 3VRYA 4FEQA 4BZOA 2VO7A 4IZ5A 4RWLA 2FSMX 1V0BA 3PIXA 4X2KA 4I21A 4K6ZA 4XG6A 2R3HA 3OBJA 2BZIB 2YCFA 4IB0A 4BTMA 4ZIMA 5E8UA 5CEQA 4BCHA 1PXNA 1Q4LA 5D9HA 2WOUA 3P7CA 4U44A 5TF9A 3SGCA 1KV2A 2ERKA 4IFCA 2W96B 1R3CA 4IDVA 3VS3A 4CQGA 1R0EA 3KFAA 2B52A 3ZUTA 1H1RA 3R04A 1JAMA 2VD5A 3C4ZA 1Q8TA 3SQQA 3LZBA 3QX2A 4FTIA 2WTWA 4CV8A 4IJ9A 2G2HA 2Q0BA 2ERZE 3VF8A 4V05A 5JGDA 4GYGA 5D1JA 5B2LA 4CG8A 5CZIA 4BTFA 2BTSA 3OY1A 4FKOA 4E73A 5IEVA 5G1XA 4GUBA 1WBNA 4RPVA 3UZTA 4O7LA 4I4FA 4WUNA 4P5ZA 4R5YA 4N4SA 3VBTA 4BL1A 1KE7A 2WTKB 4PTEA 4WNMA 2VTOA 4W9XA 1YI6A 3MTFA 3FL5A 2FH9A 2V62A 4QTBA 1U5RA 2BAKA 2XVDA 3OCTA 4MYGA 2OLCA 3NYXA 2J7TA 4J53A 4QP1A 4YU2A 4KIKA 3HA8A 1ZZLA 4AW1A 3DKOA 3R22A 4AZTA 4O86A 3OCSA 4M8TA 4YR8A 2WIPA 3FY0A 4U7ZA 4ZZOA 5IF1A 1FBNA 4OR5A 3C0IA 3IDBA 4RGJA 3AC8A 4J52A 1Q41A 4NIFB 4ZSGA 4BCMA 5K9IA 2XNPA 3TCPA 1REKA 3TNWA 2PTKA 2VTJA 5AP7A 1Q62A 5A4QA 1IRKA 5HVKA 5HCZA 4UWBA 4F99A 2QOOA 4QMSA 1L8TA 2QG5A 3JVRA 4BZNA 1OBGA 2QR8A 3IDCA 3KXHA 4YPDA 5HD7A 4BDJA 3K54A 1ZRZA 4FTQA 3P9JA 4FV1A 4O1PA 3VUIA 3TEIA 5E8YA 3QALE 2ONLC 3KRWA 4ANOA 1M7QA 4BTJA 3V01A 2BFXA 4AE6A 3L8VA 4EH6A 4XV9A 3AC2A 5EYMA 3AD6A 3SXFA 4IAFA 4KSQA 2E9OA 4W8EA 3OOMA 2IO6A 5AUWA 4QMNA 3BE2A 5LMBA 3ZEPA 4PTCA 4ALWA 5D41A 2OIQA 4L3LA 2CKEA 3UNJA 4FKQA 3UDBA 4JLCA 5IUIA 5M55A 3VN9A 4TXCA 3EJ1A 5J9ZA 3RKBA 3SXRA 4RWIA 2YWVA 2XRUA 3MFTA 3FMMA 4J71A 4QMWA 5AP1A 5AV1A 2HWOA 4GK4A 3KB7A 2R3KA 5DE2A 4BCKA 4CT1A 3CCNA 3RVGA 5D12A 4ZS0A 2JDTA 2OJIA 4UEUA 2E9NA 4K8AA 2JGZA 5K0XA 3Q2JA 4GW8A 2OF2A 4PUZA 3FKLA 3A99A 4JQ8A 1STCE 3AMAA 2FYSA 4U3YA 3SW4A 1Q3DA 3OMVA 5FUTA 1OVEA 3F3ZA 2QC6A 4EOOA 5F20A 4KS7A 4KKEA 1GZNA 1OUYA 3IKAA 1YDSE 2H9VA 3QLGA 1Z9XA 4DFLA 4PNKA 3IW4A 4I4EA 3QTIA 4D1XA 2QVSE 2EXMA 3PZHA 3U6IA 4W9WA 2IVVA 2BDJA 3CS9A 1VYWA 4FKWA 4D2TA 1IG1A 3UOHA 5M44A 3EQGA 4E3CA 3W2SA 3KXZA 5AV4A 4FT0A 4EQMA 5IA1A 3CD8A 4WIHA 3O96A 3KREA 3BYOA 2REIA 3HRBA 2XNNA 3RM7A 4CNHA 1IA9A 2C0IA 3QD2B 1GAGA 4FSZA 4FTNA 4GCJA 1ZARA 3GNIB 1NA7A 3CP9A 3NYNA 3DGKA 4YLJA 4YHFA 4CEGA 3N4UA 3VHEA 5LCJA 4XG7A 3PPZA 4NFMA 4XBRA 3KMUA 3EOCA 4FKTA 4WD5A 2W5AA 4CZUA 2FSLX 5IMXA 3EFWA 3QYWA 3ZM9A 3MY5A 3A2CA 2WTDA 5LXMA 4WRGA 1AGWA 2WTJA 4H1JA 4JDJA 3OWLA 5FP6A 3FKNA 3BEAA 3DK3A 3EYHA 3WZEA 4ANBA 4M12A 4UMRA 5M53A 2R3FA 5EM8A 4DH7A 5M4FA 1Y6AA 3D7ZA 3LMHA 3WBLA 2FB8A 2CNUA 5E1EA 5FTQA 4EOJA 4HGTA 4FG8A 3R9HA 3NAXA 4LL5A 1UV5A 4FK6A 2UZDA 1OBDA 2C3LA 4EOPA 4DEHA 2X1NA 3VW8A 2J0MB 2CCHA 1QPJA 4H3BA 1P2AA 3ZU7A 2R9SA 4CRLA 5BPYA 3PA4A 3VS2A 4OGRA 3BYSA 3F9NA 5L4QA 4I3ZA 3ENHA 4C2WA 3EKKA 3ZM4A 2R3IA 4FZAB 3DXQA 3WIKA 2WTIA 4RC4A 2WEVA 2WD1A 4MXAA 4QPMA 3SDJA 5AFVA 4FGRA 1OL5A 4CYJA 2O2UA 2HYYA 3DAEA 5LJJA 1JPAA 5TO8A 1VEBA 5CAUA 4EUUA 2PZIA 4GFMA 3VUKA 3WZDA 5A9UA 1SMHA 3ORPA 4RIYA 1UNLA 5JFXA 4XRLA 5DBXA 3WYYA 4WA9A 3UIXA 3MESA 3DY7A 2VN9A 3E5AA 3KRXA 1CM8A 5HIDA 2C5YA 2PE2A 1NW1A 3LFFA 3WI6A 3I1AA 2I1MA 2B9IA 2XKCA 3I7CA 2VTAA 4D28A 2HW7A 3ZFYA 4HVIA 1OIRA 3PP0A 3QCQA 4FSWA 4J98A 4V0GB 4NM0A 3BQRA 2OICA 2RFDA 3GBZA 4JRVA 5AUVA 3KF4A 3LIJA 3I5ZA 3KC3A 3OT3A 4ZJJA 3TZ9A 5IA2A 1YDRE 3E3BX 3PVWA 4U0IA 4ASXA 4P4CA 4XOYA 5HQ0A 3S1HA 2W4JA 4FTRA 1JQHA 2BRBA 3Q52A 4JR3A 4MXZA 4RIYB 4CTCA 5H2UA 4JT3A 4PY1A 1R78A 5EQYA 2O64A 3RBWA 4IE9A 2C5NA 4YTHA 2BAJA 5A3XA 4FI1A 3U9NA 3AMBA 5KMJA 4FX3A 2PU8A 2VWIA 2ZDUA 3NCZA 2WTVA 4N70A 5ETFA 3ZO1A 4IB3A 4TYEA 3FQEA 3TWJA 4J95A 3S95A 4HGSA 4AW5A 1BX6A 1KV1A 2ZJWA 4EHVA 3UYSA 2ETMA 2B1PA 4DGGA 5C1QB 3VBYA 5J7HA 4OAVB 4KUJA 2PE1A 1OZ1A 4JI9A 3C5UA 4D9TA 2UZEA 1JNKA 2I40A 3E92A 3NR9A 1GJOA 4ZTLA 5T6KA 5TT7A 2CNQA 4RC2A 2X8EA 3QKKA 4YP8A 4CFMA 2CNVA 3FWQA 1YWVA 3FI8A 4S33A 4IX4A 2ITYA 1JKSA 4YJUA 2R3NA 1PW2A 4Z3VA 3AQVA 3MH1A 3MVJA 4L00A 5HE0A 3H3CA 3RK9A 3EYGA 5JMSA 2XA4A 3Q9ZA 4ENYA 5ANKA 4QYFA 4Y73A 3LFCA 2A27A 3S00A 2EUFB 4K18A 4UZDA 5CEMA 4JG6A 4EHGA 2X4FA 3MVHA 4BIBA 2BHEA 1SVEA 5E8SA 3CQEA 2ZV7A 2V0DA 4ZLYA 4AOJA 4M0YA 5EOBA 3HYHA 5A46A 4C59A 2A1AB 1OITA 3BLQA 1JBPE 4ZTHA 3ZO2A 5LVLA 4E4LA 4XP2A 5I9ZA 1QPCA 3QTSA 5IPJA 4F6UA 2BHHA 5DHJA 2BKZA 1FVRA 4WO5A 4GFOA 2QI8A 3D9VA 2WMAA 3COKA 2NNWB 3W10A 4DFXE 4JQEA 4GSBA 5I9WA 1IAJA 4CMOA 2WAJA 2VGOA 2XJ0A 5FEQA 3GCUA 3VUHA 2OGVA 4J96A 5FM2A 3EH9A 4HJOA 5C27A 2BUJA 4F1TA 3RZFA 5HIEA 2JIUA 2W5HA 4OUCA 3V3VA 3NMUF 2JAMA 3IS5A 1CDKA 1CSNA 4M3QA 5EHLA 3R8ZA 4EOIA 5T68A 1IASA 4ANNA 4C4JA 2DYLA 4ZSJA 4FOCA 4E6DA 3N4TA 5DYJA 4RA4A 5HLNA 1DS5A 4DA5A 2GHGA 2GTMA 4HGLA 3F61A 4MBIA 3PTGA 5AMNA 2QU5A 5LCKA 4QMTA 4YBKA 2WXVA 3ZO4A 3EQHA 1RW8A 3DNEA 2OKRA 4L3JA 3T3UA 3FLNC 3L9MA 5ACBC 4O84A 3S4QA 3QZFA 1M52A 3L8SA 3M1SA 3PYYA 4OW8A 4DEGA 4OTGA 2GHMA 4X3FB 4AS0A 3ORXA 3SG8A 3UOLA 3IONA 4I20A 2WMWA 5JGBA 2BILB 4N6YA 1O9UA 2O3PA 4IVBA 4QTAA 3LXNA 4I24A 3TV4A 1PF8A 1UKIA 4FKVA 4TKSA 1OL2A 4FZDB 4W8DA 4AA5A 3PRFA 1Y6BA 1K2PA 2YABA 4C0TA 2C6KA 2VTQA 2IW6A 3D7TA 4WG4A 3E87A 5C8NA 3VVHA 4MD7E 2VO6A 3QUPA 2UZUE 4ZLZA 5KCVA 5C4LA 2CSNA 2FSTX 3BELA 4AFJA 4PQNA 3LFDA 4M13A 4W4VA 5FWKK 5AP2A 1U54A 1JSUA 3V5PA 4BDCA 2NO3A 2VNYA 3QQJA 3D2IA 4W4YA 2B7AA 4BYIA 3EN4A 3QRUA 4FV9A 1Q5KA 4BDFA 5BVDA 3OVVA 4G3FA 2ITNA 1E1VA 2I0YA 4OAUC 2P0CA 3RCJA 3ANRA 2WGJA 4RA5A 3UIUA 4H1MA 4CXAA 5I5ZA 4EZ3A 3D7TB 4IWDA 5L2SA 3H4JA 2YLFA 2CKPA 3LFAA 4QYEA 2OJGA 4J7BA 5HU9A 4MHAA 4QD6A 4UYAA 3MYGA 4R3PA 1JKLA 2XZSA 1GNGA 2GFCA 2X81A 4BCIA 3R9RA 2WPAA 2VTMA 3CTJA 5CSHA 2PULA 4XNEA 2OJFE 4Y72A 3RGFA 2IN6A 2GCDA 4KKHA 5FRIA 4UY9A 4ITIA 4X2GA 3KULA 4RVKA 5CNNA 4IHPA 4DH5A 2R2PA 3NUYA 3VRZA 5IH6A 3TNIA 2WZJA 4F9AA 4C3RA 1PXJA 1J1BA 5JRSA 3ZRKA 3RWPA 5J9YA 3TZ7A 2C5OA 3TTIA 4NT4A 4TPTA 4MNFA 5J5SA 4I22A 5HICA 1WCCA 4QNAA 4D2VA 3NNUA 4NZWB 2XIRA 4QMVA 4RG0A 3QKMA 2W7XA 3O8UA 3R1NA 4NTSA 2Z2WA 4JDIA 4OTDA 4DBXA 2QNJA 1J7LA 2PUUA 2IPXA 1UVRA 3WF5A 3GCVA 1R0PA 4RSSA 3PIYA 4DT9A 2F57A 2JKOA 2PVFA 2CHLA 2OFVA 2RSVA 3L9LA 3QUEA 4GG5A 4J8NA 4R6VA 2WQEA 2OK1A 3BGZA 4DAWA 3W33A 2RF9A 3KULB 3BWJA 3PUPA 3PPKA 4B0GA 3D94A 2BMCA 2WFYA 4OBOA 3V8WA 2J9MA 4DFZE 5AUZA 3GC9A 3BBTB 4YJPA 3VS4A 1AD5A 5KO1A 5JK3A 4LYNA 3Q53A 4Q5HA 2FVDA 5L8JA 3O51A 3F3TA 3A61A 1DAYA 3G90X 3LAUA 5IQIA 3HMOA 4C4HA 3DLZA 4IB1A 2PUPA 3LE6A 3NAYA 1WZYA 5JQ5A 5CVGA 3IDPA 2BKKA 4LUEA 3LLTA 4QQCA 4EI4A 4HW7A 2Z02A 1B6CB 4DGMA 5GZ8A 2XKDA 4BDBA 3A8WA 2CGXA 1PYXA 3ZC6A 3R2YA 4QP3A 1WBTA 2HXQA 3KKVA 3UGCA 4ANSA 5TR6A 2X9FA 3VUGA
chains in the Genus database with same CATH superfamily
1YXTA 4AZFA 3VUTA 5LWNA 3NNXA 3E3PA 5KUPA 4M7IA 4YJOA 4N0SA 4P90A 3S0OA 3SRVA 4FJVA 1PXOA 4AQCA 4FKUA 3WZUA 5AAGA 1MRUA 2P4IA 5BYYA 4I5PA 3HAMA 4IAKA 4Y46A 2P2HA 5HCXA 4EORA 4ALVA 4M84A 3MPTA 3R02A 3IW5A 4U5JA 2I7QA 5KHXA 4FC0A 3UC3A 5CT0A 4LI5A 1J7IA 3RJCA 1HCKA 1YWRA 3FLYA 1G5SA 4KD1A 4G16A 2QD9A 4DYMA 4LGHA 3RAKA 4FE2A 1ERKA 3OZ6A 3ETAA 5K4JA 4CD0A 2BZKB 1J3HA 4PMPA 2EU9A 5I9XA 4E4NA 4ZXTA 4FYOA 2E2BA 3I6UA 3MTLA 4AOIA 1L3RE 3SRVB 3V5WA 3S2PA 4EOKA 4C33A 3C0GA 3V6RA 2O63A 5D11A 4A9UA 5DA3A 3VO3A 5HEZA 3R7IA 4OTFA 4NTTA 4NEUA 4I0TA 2UW5A 4G3CA 1M2RA 4EK5A 3TUDA 4O2ZA 3PG1A 4QP2A 5IA3A 3B2WA 1XH9A 3TJDA 3FLWA 3R63A 4BKYA 2XK7A 3VBQA 2CJMA 3CJGA 3OTVA 1FQ1B 4GG7A 1URWA 4U40A 1XH5A 4F9YA 1AQ1A 3FSFA 5C26A 2OU7A 5J7BA 2XCKA 3FBVA 4IM2A 4BBMA 4ZTMA 2P55A 4LMNA 3PFYA 3QLFA 4NM3A 5AR7A 4IX6A 3QF9A 2PHKA 3OCGA 3ODYX 3A7GA 4FIJA 4KABA 3C4XA 5LWMA 2PVKA 2IVSA 2VWXA 3RPOA 3N4VA 1G8SA 2F7EE 4YHTA 5A6OA 3R1YA 4DC2A 4RX8A 4JNWA 5FEDA 4GVJA 4CTBA 1J91A 3UOJA 4CT2A 5JFSA 3DAJA 1YXXA 3FEGA 4BIDA 4PPBA 3CPBA 2B9JA 4S2ZA 4OTWA 3WIGA 3QQLA 2CGUA 1DAWA 2VTHA 4IXPA 4RC3A 4AZVA 1PYEA 1XMLA 4FA2A 1H8FA 2FGIA 1A9UA 4E6AA 3GC0A 3ZBXA 4DEEA 2VWZA 4HZRA 4ERWA 3LKMA 4TW9A 3ZUVA 4FEXA 2C47A 1UU7A 4W4WA 3DXNA 4FVRA 3TV6A 3LFQA 3UODA 5L8LA 4HOKA 4AGCA 3R2BA 5C8MA 4JBPA 4PMTA 2GPHA 3SXSA 2WMXA 3I6WA 3FDNA 2HXLA 3N9XA 1O6LA 1OI9A 5DG5A 4UZHA 4L67A 4U80A 2OXDA 4S31A 2VWBA 4BIEA 5CASA 2Z7QA 3NW7A 3UDSA 4PL4A 5ICPA 5BNJA 4IAYA 3UIBA 4NKSA 3RP9A 2QHMA 4ARKA 5BUEA 1OPJA 4EOSA 3FZ1A 2OZOA 4RVLA 1LUFA 4O0TA 4O38A 4RX9A 4RQVA 4GFGA 2PPQA 5HG7A 1WBVA 2VWUA 4TYIA 1P14A 4XYFA 2X0OA 4EONA 5B2MA 4QO9A 3HA6A 4FVQA 2Q83A 3MB7A 4XUFA 2XBJA 1HOWA 3HP2A 5AP0A 5KMOA 2VRXA 2WMUA 4D1SA 5EQEA 4TTHB 2YN8A 3AC5A 3MS9A 1QPEA 2YFXA 3A7JA 3FMLA 4X0MA 3PG3A 3PVUA 3R7YA 2FUMA 4DG3E 3FI4A 4EH8A 1YRPA 2HY0A 4RRVA 3OXTA 1UU8A 1BL7A 5AAEA 5AAFA 3OOGA 2RFNA 4MXYA 4BCGA 3BGQA 4N57A 1W2DA 3QZGA 2OG8A 2JC6A 4Z9LA 4JVGA 5AR3A 4BGQA 2R7BA 2YZLA 1KSWA 5KZIA 4CFNA 4O83A 2JIVA 3TDVA 3UPZA 5HE2A 4MF0A 5FXRA 4G6LA 2C6EA 2EXEA 2UW3A 3UIMA 5LMAA 3O5AA 1T45A 4UMQA 4BI2A 4ZJVA 2HZIA 2PSQA 3FE3A 2PWLA 4YLKA 4YGAA 5DLSA 2B4SB 2RL5A 3R1SA 2XJ1A 5D7VA 5J8IA 2OJ9A 3FC2A 1YI3A 2AQXA 3GI3A 2YDKA 4FIFA 4QMQA 1IEPA 4L52A 4CFFA 3WF9A 5E90A 5AV0A 4CLJA 3QHRA 3F2RA 3KVXA 4A9SA 4AU8A 1APME 4I41A 4BFMA 4XJ0A 3A4PA 3ORIA 4AFEA 3H9FA 4MQ1A 5HBEA 2J90A 2QQ7A 3F6XA 3I4BA 3KCKA 4Z55A 2BDWA 4UYNA 2X7FA 2WU7A 4MCVA 2EB2A 3KN6A 5CF8A 2BIYA 2W05A 3AC3A 5ACKA 4NIFA 3JXWA 2XK4A 2YERA 3LHJA 5DT3A 4PDYA 4R1YA 3IG7A 3FL4A 1TVOA 3L8XA 4U42A 5AEPA 2WMBA 4E8AA 4U79A 2CCIA 4MH7A 1ZOGA 2VTSA 4FKJA 4HYSA 5AIKA 4JS8A 5CAVA 4XEYA 5DIAA 2X4ZA 4GIIA 3VHKA 3GCPA 3DB8A 5EM5A 1FVVA 1WVYA 1Z57A 3PXKA 3O71A 3W32A 3T8OA 3DA6A 2GFSA 2YCQA 2ITQA 4XLIA 3ENMA 4BZDA 4AF3A 3U4WA 4H05A 5J5TA 3WYXA 1REJA 5H8GA 1SVGA 3AOXA 4UMTA 5L8KA 5CT7A 3TG1A 1OL6A 3C51A 2QOFA 4LRMA 3TMOA 5IEXA 3R7GA 3SC1A 4XH6A 4DHFA 3DJ6A 3HECA 4JDKA 4ONAA 5IQDA 2XRWA 4BDIA 5BX0A 3W8QA 1OUKA 2W1DA 4BB4A 5C9CA 5HE3A 1PRYA 2IWIA 3LM5A 3CLYA 3PLAE 2RG5A 5IA5A 4D2WA 4FNXA 3NUXA 4H3QA 4WHZA 4BDAA 5HX8A 1DI8A 3NGAA 4G34A 5KX8A 4ZS4A 1UNGA 3PPJA 4FL3A 5CWZA 4XG3A 2CLXA 4FV0A 1PXIA 4IADA 3LJ1A 3F7ZA 4DEIA 2H6DA 5HVYA 2H96A 3LJ2A 4PDOA 4ACDA 3BU6A 1YHVA 4MXXA 3Q3BA 3MW1A 2R3PA 4JAIA 4ZY6A 3HRCA 4G31A 2W1ZA 3F82A 3Q60A 5IA0A 4GRBA 4LG4A 5AM6A 3R9NA 3FAAA 3O8PA 2F2UA 2GNIA 2Y6MA 4JIKA 2GNFA 2R3JA 2Z7SA 4K2RA 2WMSA 4EHEA 3IW7A 1Q8UA 3HNGA 4RIXA 3W18A 4QQJA 2XIZA 1G8JA 5BVOA 2DUVA 3RHXA 1H25A 5DRDA 5EDQA 3W2QA 2F49A 5ETIA 5JZNA 5K5NA 2VTPA 3MBLA 4PP9A 4FUYA 4RWKA 5K5XA 4HVHA 2XKEA 4ZZNA 4YBJA 5J1WA 3JY9A 1LEWA 3LM0A 4BGHA 2XIXA 4C4IA 2Z8CA 1XKKA 2ITTA 3LMIA 3SAYA 2R3OA 4N6ZA 4FODA 3ALNA 3NUSA 5DEWA 3TKIA 2P3GX 5DEYA 4GMYA 2VO0A 3ZZEA 1GZ8A 5BVEA 1KOAA 5TOZA 4BYJA 4HVGA 4CFUA 4FYNA 4KB8A 3TACA 3OXIA 2BZJA 3F5GA 4YZCA 2IW8A 4O0VA 3G0FA 1H1PA 4LQMA 4RIXB 3ORLA 1TQIA 4GUEA 4J1RA 4DEDA 4BWXA 4R3CA 3ACKA 5KKRB 1Q8YA 1ZYCA 5C4KA 5EOLA 2Y4PA 5GZ9A 3W0NA 4F0IA 1OB3A 3D83A 2JITA 4BCOA 3EQCA 2GSFA 4M69B 2WEIA 2QOBA 4DH8A 3BL9A 4GIHA 4YC8A 3T9IA 4DTBA 3Q4TA 2QOLA 4FSUA 4QP9A 3QTXA 3DLSA 4YLLA 4OT6A 4YMJA 2AYPA 2YM7A 5CF4A 5EW3A 4K77A 4ALUA 3F7WA 4OLIA 5E4HA 4OBQA 2HK5A 5CQUA 3ZEWA 3TUBA 2OH0E 4NCTA 4YPSA 3QGWA 2J6MA 4UN0C 1VYZA 4FIEA 1M2QA 3QTRA 4PMMA 3DBEA 5BUIA 4TRLA 4YJNA 3UBDA 3UC4A 4BRXA 2XMYA 3KU2A 4XS2A 5HE1A 2XH5A 4FSRA 4NJDA 2B9HA 2QURA 1OL1A 4L45A 4YZDA 3DPKA 3C1XA 3PXQA 4PPCA 5TKDA 1OL7A 3ZZWA 4G9RA 5CS6A 3P5KA 4ZLOA 3W1FA 3NNVA 2NRUA 3W0QA 4G6NA 1B39A 3OWPA 4A4OA 2WTKC 4F70A 4AP7A 2AEGA 4C36A 3AD5A 4RJ7A 1BL6A 3V5LA 3M11A 5FDPA 2E9UA 5A4TA 2YJRA 2NP8A 4XMOA 3HRFA 1KUTA 3SG9A 5CEOA 3D0EA 4YURA 4FKLA 4BBFA 3MN3A 3IK3A 3L1SA 4KIQA 5IDNA 1FMOE 3QTWA 3MB6A 4I5HA 4M0ZA 4RIWA 3UOKA 5BUJA 2PUIA 1SYKA 2C6TA 4AW0A 2VZ6A 4DFYA 3PY3A 5GHVA 3NIEA 4BN1A 4USFA 4HNFA 1H1WA 4V0GA 1TKIA 3AC4A 4JQ7A 3ERKA 4QPAA 3E8NA 4XV1A 2X8DA 3MIYA 3VJNA 3MY0A 3QZIA 5IG1A 3EZVA 1ZMWA 4L53A 2VTIA 3DKGA 5M56A 4AGDA 5CVFA 2J51A 4WUAA 2W1HA 3F3WA 4X2FA 1NY3A 5CI7A 3TKUA 3WF6A 2WMRA 4O6EA 3DQWA 2OIBA 3PP1A 4YJSA 1W84A 5ITAA 2JDVA 3KXNA 1A48A 2GQSA 3H9OA 4EBVA 2ZV9A 4RIWB 3CR0A 4B9DA 1H07A 3M42A 2PVRA 4EK6A 2B53A 3I60A 4H58A 4U3ZA 4DEAA 3KA0A 4DHZA 2B54A 1YXSA 3K5VA 5A4CA 3G33A 1MUOA 3BYVA 1Y8GA 2A0CX 3AGMA 4PX6A 5ETAA 4FEVA 2ZV8A 4I5MA 5HESA 5AV2A 5IQEA 3BWFA 2FO0A 1BYGA 1RJBA 2JBOA 4IAZA 4TT7A 4FEWA 4NJ3A 2P2IA 3FMEA 4QTCA 3R8UA 4ZSLA 4BICA 3FI3A 3DDPA 5DMZA 2QO9A 4KBKA 4FT3A 4GH2A 1WMKA 3VBVA 5CU3A 4WG3A 2IVTA 1WBOA 3IW8A 4A07A 1NXKA 2ZOQA 4ZY5A 1GZOA 3CY3A 4U41A 2C3JA 2W1IA 5HNIX 4MXCA 1ZAOA 4A7CA 2BCJA 4G6OA 2PMIA 3LW0A 2DWBA 4ZY4A 3BHUA 2HW6A 3ACJA 3V04A 5I4NA 1TFFA 4XV3A 1PMVA 4GK3A 4K0YA 3VULA 3FXWA 4QNYA 5EM7A 4E7WA 1H24A 4M14A 4ENXA 5CY3A 5T3QA 5ANEA 3WE8A 1ZY4A 1Q61A 1QCFA 1YKRA 3FC1X 2VGPA 1XWSA 2UW4A 3KL8A 4F09A 1G8AA 5M09A 3JS2A 1OMWA 3EHAA 4B6LA 4KS8A 4X2NA 5FLFA 3TYKA 4WOVA 5KMIA 3CEKA 5KZ0A 2OW3A 1XH8A 4UX9A 4EH7A 1ATPE 1SM2A 2WMVA 3KEXA 4DLJA 3B8RA 3CKXA 1PHKA 3VQUA 5HO8A 2GQRA 2B9FA 5M07A 4GU9A 2JBPA 4F1OA 3F2AA 5AADA 2RKUA 3HMPA 4TYHB 1U46A 3CXWA 3D5UA 4FL2A 2C3IB 2HELA 4FG9A 2LAVA 2R3LA 3ET7A 3GP0A 4V04A 3D15A 4E4MA 2PL0A 4YUQA 4KIPA 5HO7A 5IZFA 4ASZA 2HZ0A 3AXWA 3BGPA 3QU0A 3UG1A 5AX3A 2QONA 2XYUA 3N51A 4EJ7A 4M66A 3P7AA 3BHTA 4BDHA 4DEBA 2PZ5A 3R83A 3O23A 4IW0A 4UB7A 3ULZA 4IZ7A 4C02A 5M08A 4X3FA 1LP4A 3DNDA 4EBWA 3P5JC 4XBUA 4D4YA 4EC8A 4NCTC 3QCYA 3P0MA 2PVLA 4IAAA 1OGUA 5HIBA 3QXPA 3TNQB 2VNWA 3GT8A 4ZEGA 4PP7A 3W0PA 5CTPA 2YCRA 4L8MA 3C4FA 4YZBA 2I0EA 4GT5A 3LFBA 4RJ8A 4G1WA 5AR2A 5AP3A 4EK3A 4C3FA 4O7TA 3OEZA 2AUHA 3B2TA 4WKQA 2G9XA 3HMIA 4O7WA 1W83A 3CGFA 2IZRA 4QMXA 3JYAA 4H39A 4HNIA 5EDRA 1R39A 5AR8A 4QP6A 4E5WA 5LOHA 4G3EA 3HZTA 3LXKA 3MWUA 1MQBA 5HCYA 3PXZA 1BMKA 1NT2A 2GNJA 4HZSA 3NYOA 3MIAA 3PXRA 3HX4A 4FKIA 4QOXA 1F0QA 3EN6A 3LCTA 2XF0A 3A4OX 3DCVA 4IZYA 4FV4A 3E63A 3HMNA 3R21A 4X6RA 4XHKB 1YHSA 4XX9A 3SV0A 2V7OA 3UMWA 5LMKA 1VLRA 4F78A 4DH1A 3E88A 2ITVA 2KULA 4YHJA 3TXOA 3Q9XA 4AZSA 2XK9A 4D1ZA 4O4BB 1YI4A 3DJ7A 4EEVA 5EK7A 1O6YA 1U5QA 3IO7A 4RVTA 5CI6A 4AX8A 4HVDA 2W06A 4L46A 4YJRA 4D2RA 4LDTA 4F9CA 1XBBA 2YAAA 3EIDA 4ERKA 5KMKA 2QOKA 3OWJA 1URCA 3W2PA 5GZAA 4Y5QA 4AA0A 4FZFB 3EL7A 3V8TA 4D5HA 5BYLA 5K4IA 3I79A 2YIQA 3BRBA 3PVBA 4EQUA 4Z16A 1JSTA 5CU2A 4DT9A 4MX9A 5ANJA 2R7IA 4FSYA 3U54A 3UMXA 3ZHPC 4BI0A 3QTQA 1TZDA 2ZB0A 3FZOA 5JQ8A 4R77A 3P08A 4PPAA 5BMMA 1LR4A 2YM4A 2XEYA 1NVQA 3R7VA 5IMEA 5EI2A 4ZOGA 3EZRA 4FBXA 4CKJA 4O6LA 4EWHA 3QRTA 5C8KA 3FZPA 4L01A 2YLEA 3AG9A 4HYIA 4F1MA 1DI9A 3FMDA 4U8ZA 5AWMA 3AKLA 4EH2A 2R3MA 2AC5A 3AMYA 3FLQA 3OY3A 2GQGA 1NVSA 4ITHA 4R8QA 3QUDA 2X39A 2Y9QA 3PA3A 2YDIA 2V7AA 4CCUA 4JG7A 3THBA 1H0WA 4FL1A 5AA9A 4Y8DA 5EM6A 4KAOA 4Q2AA 2HAKA 4RIOA 5GNKA 4D2SA 2RFEA 4AAYA 2QO7A 2WQNA 3MV5A 3OC1A 2ITZA 2VTRA 3R7OA 3P23A 3LXPA 1K9AA 1ZY5A 2F2CB 2GTNA 2PMLX 3IOPA 4FV6A 4XP0A 4DITA 3KXMA 3NUAA 1WAKA 3HVCA 3KK8A 3PJ3A 1IR3A 3A7IA 2WQMA 4BDKA 1WVWA 2LGCA 3I7BA 4YTFA 3MFSA 5IKWA 3RZBA 3QYZA 5L6PA 5C03A 4M67A 3FQSA 4YSMA 5F94A 3KY2A 4O1OA 2B0QA 4KKGA 2WNTA 2IEWA 4O91A 5E8WA 3IW6A 3ORKA 4U45A 4P2KA 2BR1A 3PVGA 5EYDA 3Q4UA 4PL3A 5E9EA 4CVAA 1SNUA 4FTTA 2V22A 3EQBA 4AXCA 3MPAA 5FG8A 3ZSHA 4YSJA 5IDPA 3FMNA 4DE4A 1WBPA 4JXFA 4A06A 3NIZA 3LCSA 3NDMA 4O82A 3CTHA 3C4EA 4ACHA 1GOLA 3WARA 5HX6A 5J95A 5M57A 2C0OA 3DFCB 3Q32A 2GNHA 1FOTA 3I81A 4RFYA 3HEGA 3COIA 5CNOA 2IZSA 4ASDA 2UW8A 4YJQA 4JJRA 5IU2A 3DV3A 4MNEA 1M14A 4D5KA 4EK8A 1U59A 1ZOHA 3FXXA 3VW6A 2X7OA 3OFMA 1SZMA 2QOCA 3CQUA 3RINA 5HBHA 3KXXA 3PA5A 4P7EA 1XO2B 2OJJA 3H0YA 5DOSA 3C7QA 1H27A 4X3FC 2X9EA 2OF4A 1F5QA 3I0QA 1OIUA 2IVUA 5H8BA 3TTJA 4R5SA 4DDGA 4DHJA 4YTCA 2WQBA 5EW9A 5HTIA 5E1SA 3QZHA 3ZLYA 4CSVA 1ZOEA 3FQHA 1DM2A 5CAOA 3EQFA 5IH4A 5H8EA 3TT0A 3LFSA 5BVFA 5IQHA 5J79A 4CG9A 1H0VA 2Y4IB 2PYWA 4MNEB 2IJMA 3MVMA 4FUXA 1V0OA 2X2KA 5ANIA 5GJFA 1YHWA 3KRJA 3PY1A 4GU6A 4WNOA 4BDDA 2Y6OA 1I44A 4DFNA 5J9LA 4XP3A 3L8PA 2ZM3A 3FPMA 4A4XA 2CPKE 2GMXA 4OBPA 4FV2A 2UVYA 3C50A 4KA3A 5L2WA 5B0XA 4MTAA 3H0ZA 4KIOA 2UZWE 3QD0A 3ZBFA 3KCFA 3W8LA 4GJ3A 3MA3A 1ZLTA 4YNOA 5GIPE 4R78A 4D0XA 1YWNA 4RX5A 3IGGA 4DG0E 2OI4X 4AN9A 2ZYBA 2YM8A 4AW2A 5LMKC 4IVDA 3UJGA 4S32A 3GOKA 5ANOA 3D4QA 3NWWA 1KWPA 3E8CA 2OXYA 2QKWB 4RJ3A 4EKKA 5CXZA 5CF5A 4U6RA 3CSVA 2PVJA 2W17A 3HKOA 3HV3A 2VX0A 4MQ2A 2ITXA 2ITUA 4NFNA 2HOGA 4YZMA 5HG5A 3UP2A 2C1BA 2RGPA 5DN3A 4YO6A 2BVAA 5HO6A 3G51A 5DT0A 3DKFA 3OWKA 5M06A 3R28A 5CF6A 3G6GA 2XIKA 3FPQA 3FSKA 4MXOA 4F0GA 2J0JA 4A4LA 4KRCA 2F9GA 3EQIA 3QA0A 3QQGA 2OIDA 2CGVA 4CFXA 2QOQA 4F64A 5CAQA 1S9IA 3GCSA 3Q04A 4NM7A 3VNTA 4F6WA 4TN6A 3BV2A 3BYMA 3BLHA 5LVNA 4RLLA 4WBBB 5HLWA 4GVAA 4IVAA 4RQKA 4EUTA 1H1SA 3G6HA 4I94A 4S34A 3BLAA 3CD3A 3NVMB 3AT2A 3KF7A 3LFEA 5BVNA 4QP8A 4LL0A 5E91A 3QQHA 5A54A 2GS2A 3G5DA 5J87A 5L3AA 2OZAB 2JDSA 2YACA 5FXSA 4L42A 3CIKA 1WFCA 5AJQA 4YNEA 1Q99A 4EC9A 3DTCA 2W9ZB 2ZDTA 2YAKA 4F6SA 5TE0A 5AP4A 3LCKA 2XNEA 3R30A 2E9VA 3B8QA 4OTHA 4A9YA 4F9BA 1EH4A 3GC7A 4YZNA 5IQCA 1XQZA 4ZMFA 4L68A 2W4KA 2YM6A 2OWBA 3NS9A 3SKCA 3D5WA 4M15A 1BLXA 4L3PA 3ZXTA 5JRQA 3IPHA 2NPQA 4AZEA 4DGNA 3MFUA 3QQUA 5AUXA 4O0YA 4HYHA 1PXKA 3OW4A 5M4UA 3RPYA 1H08A 4UWCA 2BDFA 2VWVA 3MDYA 5CSWA 2YISA 2EWAA 2X2MA 4PTGA 4IM3A 2X6EA 3RHKA 1VZOA 3D5VA 3VS5A 3DT1A 5JFWA 1FINA 4ZTSA 2C6IA 3A60A 4X3JA 1OKYA 4ZTNA 2XM9A 2XNOA 4APCA 2G15A 3DBDA 2JDOA 4U97A 5KMMA 1Q24A 3R01A 4EH9A 3W0RA 5CSPA 5B2KA 3R9OA 3K3JA 3CPCA 3II5A 3WILA 3UNKA 1OECA 3Q5ZA 2PK9A 2R0IA 5HNBA 4YJVA 1RQQA 4G5PA 1UWJA 3ROYA 1M7NA 4WNKA 5BMSA 2C3KA 2Y4IC 1XJDA 3NSZA 4KSPA 3ZSIA 3U6JA 2HZNA 4BCJA 2Y8OA 3KQ7A 4YJTA 5D7AA 2QKRA 4CZTA 3MH3A 2IF8A 4IBMA 3P4KA 1YQJA 3FLZA 4FIIA 5LARA 4QYGA 4K1BA 3DBCA 3JVSA 4RLKA 1PY5A 1W7HA 4G3DA 2UZOA 4E4XA 5GINE 5EKNA 4O0RA 1BUHA 4IJPA 3QWKA 4XV2A 3KXGA 2QCSA 3REPA 4F7SA 1E1XA 3OT8A 3FJQE 1PKDA 1PXLA 2JFMA 5CSVA 3K3IA 3PJ8A 5AV3A 3R9DA 2GS6A 4AACA 3T3VA 4C62A 4DCEA 4O7ZA 3O2MA 5AP6A 2X8IA 3EFLA 4Y95A 4APPA 2X0GA 4FTLA 5AM7A 4IX3A 3UDZA 4NL0A 2YIXA 3QGYA 4FKGA 3UVPA 1KE8A 2BFYA 2ZAZA 3UQCA 4FTAA 5CZHA 4IH8A 4J8MA 5F4NA 3FHIA 4FSNA 5AUTA 3JPVA 5DH3A 1OPLA 3G15A 3U9CA 5GJGA 1HCLA 3T9TA 3VS1A 3BQCA 1FVTA 4LM5A 4RJ4A 3F69A 2XCHA 3IECA 2GNLA 4GJ2A 1UA2A 4TWOA 3UO5A 1YDTE 4LV5A 4IQ6A 4UMUA 2G2FA 3GU5A 5FDXA 5A4LA 2W1GA 4IWPA 1VR2A 1JKKA 3OUNB 3C13A 1IAHA 2WU6A 3GC8A 3VS7A 4RJ5A 1QMZA 3HGKA 3W2OA 3KMMA 3GCQA 4PF4A 3TL8A 2BRGA 3RTPA 5CXHA 3Q6UA 3WF7A 4FKPA 1ZYSA 4IC7A 5L6OA 4EWQA 4P5QA 2H8HA 3A62A 3E64A 2XJ2A 4X7QA 2UZBA 5CX9A 2QLUA 4O0XA 4WBOA 2J5FA 3DBQA 4I1ZA 4IM0A 3U4UA 4F0FA 4BF2A 4CGAA 5M51A 4K9YA 4HPUE 5CALA 2QO2A 2VWWA 2Z60A 2PMOX 2XIYA 2J5EA 3ODZX 3V51A 3FMHA 4NM5A 5KMNA 3NCGA 3NPCA 4CFWA 2CKQA 4FR4A 4E1ZA 3VF9A 2CN5A 3Q5IA 4II5A 4EYMA 3DOGA 2WO6A 2QOIA 5FP5A 3WZJA 2G01A 5FGKA 4QYHA 3SLSA 3CBLA 3HV7A 4HCVA 4O2PA 2ZB1A 3ORNA 4LOPA 2E9PA 4FSMA 1ZYDA 1LPUA 2X2LA 2ZVAA 4C37A 4QMLA 4NKAA 4Q9SA 4R1VA 5JFVA 1FGKA 3GOPA 2B55A 1YW2A 4B8LA 3OUKA 4R7BA 1YOMA 4PWNA 1OIQA 1WBSA 3HLLA 5HVJA 4CFVA 1GIJA 2J0LA 3GUBA 4OTRA 1ZYJA 4BC6A 2ZM4A 2W1FA 4J97A 4FMQA 5EFQA 4WSYA 4IACA 4MBJA 1XHAA 2J4ZA 3QRKA 4JBVA 2WTCA 2CN8A 3RPVA 3ZCLA 5JSMA 4QMMA 4BCPA 2ACXA 3UZPA 3CC6A 2BROA 2UW9A 2F7XE 2OO8X 3C4WA 3FY2A 4BVUA 3DK6A 5DWRA 3C5IA 3JY0A 2O5KA 4I0SA 4F65A 1JVPP 1PXMA 3FI2A 4IANA 2VU3A 4YTIA 4M69A 5IQAA 3SA0A 4FTCA 4L9IA 2PY3A 5EYKA 3BKBA 4AXDA 2ZM1A 3V5TA 4FTMA 4KIKB 4TZRA 3KGAA 1XH6A 3FXZA 2XUUA 3HMMA 5DR2A 3ZONA 2X0QA 3GFWA 4ANMA 3A8XA 3PUFC 4OTQA 3FHRA 1ND4A 4LGGA 4IC8A 4AGWA 1PKGA 1GY3A 5KMLA 4YC6A 4DINA 3GENA 4ZSAA 1W8CA 3QCXA 4U43A 2Y7JA 4TYJA 4X2JA 5CU0A 3O7LB 5HKMA 5EKOA 4H3PA 1XH4A 3KRLA 4UBAA 1FMKA 3IOKA 1Y8YA 2NRYA 3Q2MA 4R7HA 5FM3A 3BIZA 5AIRA 3LLAA 4DTAA 4FTUA 3LOKA 3PFQA 2CKOA 1B38A 4RX7A 3WF8A 1Y57A 1PMEA 4IWOA 4AT4A 2JDRA 3OROA 2UW6A 4HCUA 2JD5A 2J0IA 4GT4A 3UP7A 1JLUE 3NX8A 1ZZ2A 4O21A 5CQWA 3BU5A 1MRYA 1XH7A 2PMNX 2VWYA 3Q4CA 3E8DA 4IAIA 4BBEA 4DLIA 2C68A 5K3YA 5BVWA 2G1TA 1QL6A 2QLQA 1J1CA 5JGAA 3P78A 2IZUA 1PJKA 1Q3WA 4L44A 1ZMVA 3F88A 3OHTA 1T46A 3OW3A 4QMYA 2WQOA 4QP4A 5HGIA 2I0HA 2DS1A 2WELA 3GQIA 3UVQA 5IISA 2BRMA 2W4OA 2ZV2A 3ZDIA 5E8ZA 4M97A 4USEA 4MVFA 3MJ1A 4CRSA 3QHWA 3O7LD 2Z7RA 4OTPA 3VBWA 3BI6A 4OT5A 5HTCA 3DK7A 5LVOA 2VTNA 2C6LA 3R73A 3EFKA 4A9RA 4CCBA 2PZRA 3KK9A 2CGWA 4DTKA 2J0KA 4EOLA 5IQBA 2OH4A 3UG2A 2PUNA 1A06A 4QP7A 4BWKA 5L2IA 4RZVA 3ZOSA 4Y5HA 1KE5A 5CSXA 3FYJX 4ASEA 4EL9A 1J7UA 4I23A 3V6SA 3ZXZA 3PXFA 3BEGA 3QBNA 3I0OA 5KBQA 2IG7A 3NYVA 4FG7A 3TM0A 4NYEA 3F5PA 4AN3A 5E8TA 4JAJA 4BGGA 3IQ7A 3BE9A 3DB6A