2O2UA

Crystal structure of human jnk3 complexed with n-(3-cyano-4,5,6,7-tetrahydro-1-benzothien-2-yl)-2-fluorobenzamide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
355
structure length
319
Chain Sequence
NQFYSVEVGDSTFTVLKRYQNLKPIGSGGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLAVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYHTIEEWKELIYKEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 10
publication title N-(3-Cyano-4,5,6,7-tetrahydro-1-benzothien-2-yl)amides as potent, selective, inhibitors of JNK2 and JNK3.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 319
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2o2uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2o2uA01
4EH4A 4WRGA 4V04A 5J1VA 3IDPA 2CGXA 3DXNA 2R3QA 3BHVA 4NM5A 3V5QA 4AFJA 2PZ5A 3QQHA 4U80A 3DFCB 4RVKA 5E8TA 5AUWA 4LOPA 2VTHA 2ZOQA 5FBOA 3COMA 2H8HA 2WIHA 3R00A 3VWAA 1WVXA 2VWZA 3Q04A 4YTHA 4FV2A 1F0QA 4IWQA 4RWKA 5T3QA 3UOJA 3DKFA 4KKGA 4J97A 4B7TA 1BYGA 3ZLXA 3TM0A 4EOSA 1Q8YA 4BGHA 4DFZE 3CXWA 4II5A 4U41A 3R04A 1JQHA 2V7AA 5HG9A 3V6RA 3R71A 2G2FA 3ZS5A 5ACBC 3NR9A 5CQUA 3R9NA 1V1KA 4FC0A 3GC7A 4X7QA 5FLFA 3C50A 1ZMVA 2R64A 3FMMA 3PA5A 1OIUA 3CCNA 4Z7GA 1PXKA 4FF8A 4QMTA 1OKZA 1P4FA 2HXQA 1AGWA 2OJ9A 4L44A 4O2PA 5FXSA 4MQ2A 3VQUA 2QR7A 3MI9A 5T6KA 5FEDA 4M7IA 5J79A 3VS1A 3QC9A 3JS2A 4FEUA 1Q3DA 3BYOA 3HP2A 3IW6A 3L9PA 4YJOA 3V8TA 4G31A 3HRBA 4OT6A 3RJCA 3AGLA 3ZH8A 5I9UA 4BBMA 3MFUA 4KBKA 4UB7A 4BCHA 1DAWA 4F6SA 4F7SA 3IQ7A 5FWKK 2ZDTA 3ZDIA 3UP7A 2C5XA 4IZ5A 4IVDA 3GB2A 5CVGA 1CKJA 3I4BA 1FMOE 5IQIA 2RFDA 3R7UA 4D2WA 3R8PA 3W2RA 4ZLZA 4X3FA 4D9UA 4U7ZA 4U43A 4D4SA 4FTOA 4QMLA 4AT4A 2ZDUA 4Q2AA 2XK8A 1UU3A 1Q8ZA 2ZMCA 3A8WA 3F5UA 4FG7A 4NH1A 2XNEA 4NM0A 2FSMX 3GU7A 4G34A 4IDVA 5BQ0A 5M07A 3R8LA 3Q5IA 4JXFA 3W2QA 2GTNA 3Q9XA 4O91A 1R3CA 3NNWA 1GOLA 2QODA 4ENXA 5KUPA 1WCCA 3P1AA 4YJRA 4IZAA 3DBQA 3N51A 4JNWA 4X2GA 1PYXA 5F4NA 5BMMA 3FKOA 2HXLA 3VS0A 3WF9A 4D2PA 1SM2A 4GK2A 1PXMA 4I20A 4NL0A 4NKSA 1CM8A 3UG1A 3LQ8A 4W4YA 3KRLA 2Y0AA 4EOLA 2VZ6A 2ZB1A 5HBJA 4R77A 5J7HA 4FX3A 2VWBA 4JQEA 4EKKA 2WQEA 4IB5A 5BYZA 4BCJA 5CT7A 5IG1A 4WSYA 1JPAA 3HMMA 3PY0A 4FT5A 4I1ZA 3RK9A 1G5SA 1OKWA 4QNAA 4QYFA 5E8XA 4O82A 3ZBXA 2J0KA 3U55A 2O3PA 4FKQA 4HNFA 3FYJX 4FZDB 5DG5A 2XRWA 1HOWA 1JBPE 2YHVA 3IOPA 4IX5A 4AGDA 4CMOA 3SGCA 4ZMFA 5L6WL 4P2KA 4TYEA 1VJYA 2XKFA 5DA3A 4O81A 3CEKA 4F1TA 2VX1A 4NSTA 3EHAA 2XUUA 4XV1A 1W83A 5KZ0A 2OW3A 4MXZA 4U0IA 2P2IA 5IEXA 2I0VA 1YHWA 4BHNA 3GENA 2BRMA 3MY5A 4MHAA 1BI8A 3VC4A 4RIYB 4DFLA 3O50A 2OWBA 4E1ZA 4IJPA 3MY0A 3U6IA 3TEIA 5IEVA 1WAKA 1QPCA 1YW2A 3Q32A 4DFNA 3C4ZA 4BDIA 4F0FA 5C1QB 3H9FA 5L8LA 1V0PA 2Z7RA 3DBCA 2EXEA 4TWOA 3KEXA 5E4HA 4L9IA 2Z8CA 2FA2A 2J50A 2QU5A 5AV3A 4OTHA 4LYNA 3VUTA 3MESA 2DS1A 4FK6A 4D55A 2C6EA 2GS7A 3QTSA 5HLPA 4CNHA 2YIQA 2UV2A 3TKIA 2X2MA 1SZMA 3MVMA 4CFVA 3IW7A 5FBNC 1JSTA 4FGRA 3PYYA 2VO0A 3D7TB 5L2WA 4MNEA 4WIHA 4LMUA 5HTBA 2JDVA 1ZY4A 2CJMA 4EUTA 3SW7A 1J91A 4O6EA 3WZKA 2YM8A 4Y5QA 4KUJA 3VUMA 3D94A 3KL8A 5IMXA 2B53A 2G9XA 2E9VA 2I7QA 2YLFA 4F9CA 3ERKA 4YPDA 5TOZA 2AUHA 3UQGA 5HKMA 4APPA 3VQHA 3L8XA 4V0GB 4NM3A 3EL7A 1OBGA 1W7HA 4BVUA 3RI1A 3BV2A 1LEWA 3R22A 3EQBA 1Q8WA 2BROA 2C4GA 3BYUA 3GCQA 3VHEA 5AUTA 3CC6A 3G90X 3OUKA 3V8WA 4I22A 4EEVA 5IEYA 5J9ZA 3R0TA 4O0TA 2PUPA 3HL7A 3D2IA 3EJ1A 4K18A 4LGHA 2X6DA 3GQLA 3LCTA 3NUPA 4W4XA 4XH6A 4FTAA 2UW8A 4IFGA 5K4IA 3DQXA 5DOSA 3TN8A 3ZEPA 4BDGA 4OTIA 3AOXA 3GQIA 4XOZA 3FWQA 5CAVA 2UZOA 4MF0A 3FEGA 1YXSA 3ZC5A 4M97A 3UZRA 2GNHA 1ZYSA 4JBPA 3R28A 1U5RA 3KCFA 2KTYA 4BDJA 4XV9A 3P86A 4OBPA 4JR3A 4UX9A 2OJFE 2FB8A 4GT4A 5DT0A 5FD2A 4AGUA 3UG2A 3Q96A 2OGVA 4HVSA 2R3OA 3O71A 4HCVA 1ZY5A 2PVYA 4TNDA 3SG9A 4RFMA 3A7JA 3I6UA 4PMTA 5HO6A 3B8RA 5AUXA 4QMPA 3VS3A 4YZMA 1ZZLA 4XBUA 4IB1A 4Y8DA 5LMAA 2P55A 4BIBA 1ATPE 3OXTA 4RFYA 1OECA 3BU5A 3CE3A 4GVJA 4NU1A 3WE8A 1R39A 3KU2A 3KGAA 4FV6A 1XR1A 3Q4UA 1H25A 3ID6C 2YIYA 3W55A 4I3ZA 4NJ3A 1R78A 2WOTA 3V5TA 3DU8A 4XV2A 4MD7E 4M0YA 5M51A 1XQZA 3PLSA 2CKEA 3CTJA 1LPUA 5CAOA 1FVVA 3VUDA 4OT5A 5JGBA 2C0TA 4U81A 4E4MA 2GTMA 3KXNA 5DBXA 1PMUA 3P9JA 4XBRA 3ZTXA 5CAQA 3NZ0A 4FVRA 1PKDA 4F7JA 3FMHA 1RJBA 2QOQA 2WQOA 4M14A 4XP3A 3FLYA 5KNJA 4E20A 3BWJA 3RWPA 4YO4A 4J8MA 3OOGA 2RG5A 3FI4A 4AZSA 2QOFA 3KRXA 2HZIA 3QZFA 5AAFA 3V01A 2WMTA 2R3JA 3H0ZA 3COKA 3NUXA 3PE2A 4UYAA 2VTIA 5CU2A 2GS2A 3LCOA 4CSVA 2IW6A 2OZAB 2ERKA 3E63A 3ORMA 3P08A 4O1OA 3ZSGA 3AMAA 2JIVA 3I5NA 5L6PA 4GSBA 4QO9A 4DEEA 5IQEA 5CNOA 1W0XC 5CF8A 3BBTB 3L9MA 1CSNA 4JI9A 3TZ8A 2YCRA 3D15A 4GK3A 3RPVA 4ALUA 1M7QA 4S2ZA 3O96A 1UKIA 3ZSIA 3NUNA 4U40A 4B0GA 4IVCA 4S30A 2CKQA 5BVOA 4GS6A 2UUEA 3EKNA 3IW8A 4AA4A 1XH9A 3FLZA 5DHJA 4BBFA 4ENYA 2BKKA 5HHWA 4PNIA 3KULB 4FVPA 4CKIA 3L9NA 2CCHA 3NUYA 4HZRA 3C5UA 1T46A 5CZHA 4ZSEA 5EDRA 2JDSA 3ZXTA 2J0JA 5AP7A 2BDWA 4XJ0A 4X2NA 4JG6A 2HCKA 2ITOA 1IR3A 4FNXA 4BWKA 3UVQA 3PXRA 5L3AA 5HZNA 3RWQA 4D4VA 4EOIA 3VULA 1P14A 4B4LA 1M17A 2FSOX 3FJQE 4D58A 4BC6A 1H24A 5A6NA 3QWKA 4U3YA 3QXOA 4CV9A 3D9VA 3MWUA 3UNJA 2PVLA 2PMNX 2QOBA 3Q6WA 5HD7A 3TJDA 5KCVA 5IKWA 3V8SA 1YHSA 2RFSA 3LCSA 5C9CA 4R7BA 2VV9A 2QO2A 4Q5HA 3HX4A 1ZWSA 5E9EA 3ZYAA 3OWPA 4LG4A 2UW5A 4FL2A 3EQIA 3FZTA 2W4KA 3GC8A 3GI3A 5DMZA 5ICPA 1U54A 4O0UA 3FSFA 2GS6A 2DQ7X 4QMYA 4R5SA 3PJCA 1VR2A 5BUIA 5HOAA 3QTUA 4JAJA 3AG9A 4RWIA 5DT4A 4YTFA 1PRYA 4YLKA 2QURA 3E8DA 3QRIA 2E9NA 2R3PA 2UZNA 4L6QA 4PF4A 4RA5A 4RC4A 4Z7HA 3UQFA 4N57A 2XNPA 1H28A 1NVRA 3DJ7A 4WG5A 4HCTA 5JFWA 4Q9ZA 3IONA 3LAUA 3RTPA 2ACXA 4W8EA 2J0MB 4EH9A 5D11A 2XIKA 4FV1A 4TYGA 4EZ7A 2A1AB 2R5TA 1OL5A 4FTKA 2BMCA 4KABA 4UBAA 4BIEA 5CEMA 1JKKA 1RDQE 3BHTA 2XBAA 4KIKB 5D7AA 5K0XA 1XO2B 4DG0E 5G1XA 5IUHA 3PA3A 2UW4A 4YU2A 2KULA 5IA5A 2VO3A 2WNTA 1K9AA 1H07A 3F7WA 5HE3A 4IB3A 3HMPA 4WSQA 2A19B 2A27A 3A4PA 5JMSA 2QU6A 2W0JA 2R3MA 3MJ1A 2QKRA 4RJ8A 3U8WA 4JBVA 4KIQA 4BF2A 1Q61A 3ZU7A 4P4CA 2G15A 1IEPA 1SMHA 3DGKA 4XRLA 5FTQA 4NUSA 1H8FA 2OG8A 1VYWA 3E92A 4UWBA 3CY2A 4QRCA 4ZOGA 2BALA 1LR4A 5AR4A 2WAJA 1M52A 4RMZA 5F1ZA 2PHKA 1UKHA 3GOKA 5IA1A 3Q9WA 5BUJA 5K5XA 1CMKE 3VNTA 1XKKA 2W96B 3B2WA 2B55A 3FZPA 3O8TA 5L2IA 1FMKA 1Q4LA 5HIEA 4UMUA 1XBBA 5HO7A 3KXZA 5LJJA 4YLJA 2X9EA 4RIWA 2PVMA 1GNGA 2XEZA 3LVPA 4GH2A 4FV3A 4GFGA 4GYGA 4MWHA 3EN9A 4L7FA 3ZRKA 5E8ZA 3Q4ZA 3LQ3A 1TQPA 3EQHA 2CDZA 1XWSA 5T68A 1E9HA 4QPMA 4B8MA 1OM1A 3PTGA 1KV1A 2UZDA 2BHHA 4ZJIA 5KMJA 3KXXA 3FMLA 3F6XA 3N9XA 1OGUA 5C03A 2PVHA 3JYAA 1H1PA 5IUGA 3W1FA 4MEDA 2BR1A 1KV2A 1ZMUA 3KREA 4IAIA 5KMOA 4RLLA 2J7TA 1YI3A 1OL7A 3O2MA 4EHGA 2UZBA 4X21A 2QG7A 5I9ZA 4I93A 2F49A 2ZVAA 3LCKA 1ZMWA 4L01A 2WGJA 1OMWA 3AMBA 4EWQA 3GVUA 5LVLA 3A7FA 3GC0A 3MY1A 4BGQA 4QMZA 4BI0A 2HZ0A 4E8AA 1BKXA 4YO6A 4NFNA 4PMPA 1UU7A 4BTFA 3O17A 5JEBA 4IWOA 3UMXA 3WARA 4AOIA 4AS0A 2BDFA 4BCPA 4FSWA 4FEWA 2OF2A 2GFSA 4IAYA 3ZRMA 2X2LA 4A9RA 3PVWA 2GPHA 4XG9A 4Y83A 2WFYA 4FBXA 2I0YA 2PU8A 2XJ2A 3QYZA 4AP7A 4ASXA 2Y8OA 3PIZA 4JRVA 1XBAA 5AJQA 3UO4A 1ERKA 4F7LA 3KMWA 2Y4PA 3LE6A 3T9TA 2BIKB 2W1EA 3BHYA 1PY5A 2XCKA 4AQCA 3BE2A 3PJ2A 4AT5A 5AX9A 4GV1A 3FZOA 3NSZA 3E3BX 3TV7A 5A54A 2YISA 5AP3A 3FSKA 5HBHA 5H8GA 4C37A 3OW4A 4P5QA 4HVDA 3H4JA 3SLSA 5HTCA 5IZFA 4NYEA 4J52A 3VBXA 2H9VA 4D0WA 2XK6A 2PZPA 5IA4A 4AFEA 1GAGA 2VRXA 3F61A 1WFCA 2C30A 3IDCA 3OBJA 3QTRA 1TVOA 3V5WA 3UOHA 1SVGA 5K4JA 2XEYA 1Y6BA 3TI1A 2JGZA 3O8PA 1URCA 4NZWB 5EYMA 3RNYA 5BYLA 3U54A 3IW5A 4RC3A 2UW3A 3CQWA 3MTLA 5FTOA 4CYJA 3QHRA 3KQ7A 3A4OX 5FGKA 1DM2A 4E26A 3DK3A 3KXGA 4O83A 4I94A 3I6WA 4P90A 4ZS0A 1W98A 5KMNA 3JY0A 3QRJA 5H8BA 5EKNA 3TDVA 4O7LA 2IPXA 4NJDA 1UA2A 4ZSGA 1OVEA 2YJSA 3NS9A 3UOKA 1YXXA 4AACA 3V5JA 3RKBA 3OEZA 4DH7A 5AA9A 2H6DA 3BHUA 3QHWA 4RVMA 4CV8A 2C0OA 5CYIA 3R7EA 2QLUA 3EN7A 2NPQA 3F5XA 3G0FA 3GCSA 3NNVA 4FKLA 3QCSA 4FTJA 5L8JA 2OXDA 4UXLA 2VTPA 5AV2A 4ACMA 4DBNA 2CNVA 3ZO2A 4BDAA 3KRWA 1J7UA 2YCQA 3GCVA 3FQSA 3HECA 3KRRA 4YUQA 3RPSA 2ZYBA 2W1HA 2V5QA 2WQNA 3OF0A 1ZYJA 5E91A 3UO6A 2FGIA 5ANDA 3OHTA 3RK5A 4HW7A 1G8SA 3NPCA 3JR1A 3N4VA 3G33A 3G6HA 4ITIA 4WO5A 3OROA 1U5QA 4D5HA 2PVKA 3H0YA 2VWYA 5M4FA 3VVHA 3PRIA 4R78A 1W8CA 4CFFA 5E7RA 4Y72A 4FKTA 2LGCA 3GU6A 4NWMA 3NLBA 5CU4A 3OTUA 3C9WA 4U5JA 1UVRA 2WU6A 2ZM3A 3QTQA 4XP0A 4TYIA 3F5PA 3F3ZA 2BFYA 3GP0A 4FIIA 4L67A 5DN3A 4CRLA 3N4TA 3POOA 3OFMA 2W17A 1YXVA 4YC8A 4CFWA 4F9AA 4R5YA 3QRTA 2H34A 2IVTA 3TT0A 2W5HA 4DEBA 4EH6A 3LJ1A 3SG8A 1AD5A 3PP0A 4EH7A 4M8TA 4NM7A 5DH3A 4BDKA 4ANMA 2FSLX 4XG8A 4CQEA 2IW9A 2RG6A 4BDCA 4O7ZA 1Q99A 5CXZA 4I92A 4JX3A 5BX0A 3MPAA 5I3OA 3MIYA 3DXPA 1TKIA 2BTSA 2CLXA 3R7VA 3W18A 4XG2A 2I40A 5M53A 4GCJA 3IGGA 4TKSA 5J5TA 5CZIA 3EFLA 3QUEA 4J8NA 4R7HA 3I79A 5GJFA 4ORKA 2BTRA 3O8UA 4L46A 4QNYA 4UALA 3VF9A 3W2CA 4C7TA 4QMOA 4CGAA 2C6OA 3F3VA 5LWMA 4UZDA 5LVNA 4JIAA 4JDKA 5IUIA 3R8MA 3LFFA 3WIGA 3LOKA 3E3PA 5HE1A 3NIZA 4DLJA 1JNKA 3AC3A 3JUHA 5CX9A 2CN8A 4PV0A 3K5UA 4CG8A 4O84A 1K3AA 3R8UA 4DTKA 4JQ8A 2PVFA 4YJPA 3QZHA 5FG8A 4CFMA 1QPEA 3LFBA 1KWPA 4GW8A 2OIBA 1XH8A 4USFA 4C4HA 2PUNA 2OI4X 1ZYDA 2R3IA 3SOCA 4G17A 4WNMA 4DYMA 3QRKA 4C33A 1PXIA 2X7GA 3Q6UA 4F0IA 4HGEA 3R9OA 3EB0A 1R0PA 3R73A 5CF6A 5KKRC 2HY0A 3PZHA 5EI6A 3QTZA 3ZZWA 4YSJA 2OIQA 3NRMA 4RWJA 5IQFA 2R0UA 1PYEA 4I6BA 1ZARA 4YJSA 4NIFB 4XS2A 5AIRA 4USEA 4DN5A 2WMWA 2CMWA 2CNQA 1ZZ2A 3GU5A 4XLIA 3LFEA 5F95A 4GT3A 4TYHB 4NK9A 5FP6A 4RX5A 1X8BA 4JG8A 4MK0A 3OWLA 1REKA 4PP7A 2C3IB 2F9GA 4LUDA 4N6ZA 4GFMA 3A7IA 5E8SA 5IPJA 3OY1A 1FGKA 2C3JA 2BZHB 4D5KA 3MIAA 1J7LA 4M3QA 4FG8A 4FIJA 4OGRA 3R2YA 3DBEA 4LRKA 3UIXA 3ZRLA 5JGAA 3JVRA 4A9TA 4FOCA 2W7XA 4MF1A 3QUPA 3WE4A 1B6CB 3LFDA 4IMYA 4EOPA 5CEPA 5IDNA 3F2NA 5L8KA 4QP3A 3FLNC 2HW6A 4Y46A 3PRFA 2GHMA 3LW0A 3FI8A 3QKLA 4BCKA 4FV0A 2JLDA 5HCXA 2PZYA 3AC1A 2Z2WA 3DAKA 1OIRA 4EOQA 5CSXA 4H36A 5AP0A 4ZS4A 2J6MA 4IXPA 1P5EA 2C69A 2VTAA 3ATSA 5AV1A 4M67A 4V01A 2CPKE 2A4LA 5CI6A 3KVXA 1YHVA 2E2BA 1NA7A 4O0VA 4OTWA 4YPSA 2WHBA 3FMDA 3F2RA 3I5ZA 3ZUTA 5HU9A 2O65A 4RIYA 2B0QA 4GIHA 3P7AA 5JFSA 5JZJA 1GIIA 4JLCA 1OL2A 2EB2A 2C3KA 5AP4A 5AP2A 4YNEA 3CS9A 3VO3A 1QPJA 1R1WA 3WOWA 2YM7A 4K8AA 3UC4A 1K2PA 3DT1A 5TT7A 1SVHA 2QHNA 1M7NA 5F20A 2YM6A 5LCJA 4WOVA 1J1BA 1FPUA 3IS5A 4D2SA 4EOOA 1YDRE 2UVZA 2X4FA 4KSPA 1FVRA 4A07A 4QTEA 4IC7A 4PDSA 4D9TA 3MSSA 4BTMA 4CCBA 3PXFA 4H58A 5I9YA 4ZZNA 4CQGA 4OTRA 1H01A 3D7TA 3QC4A 1CKIA 3TZ9A 4FTIA 2E9OA 3Q60A 4FTNA 1O6YA 4XLVA 5HCZA 4K33A 4E93A 3AC8A 2X7OA 4X2FA 2PWLA 4GVAA 4NCTA 3SXSA 3DLZA 4IAKA 5A9UA 3QQGA 1FOTA 4EOKA 1OIYA 3ELJA 3ULIA 2IN6A 3WZJA 2JKQA 2O63A 3COIA 4PMMA 5L4QA 2VTRA 3V3VA 3ZHPC 3PPKA 4UWYA 3EIDA 4FKPA 4FTMA 4EONA 1PMNA 4F4PA 2JFLA 3QKMA 4MBJA 4EOMA 1KUTA 4OLIA 1A9UA 3P7BA 3RM6A 1FINA 3DQWA 2O0UA 2PL0A 3EFKA 3M2WA 3LFSA 3NEWA 2F7ZE 4U8ZA 5CSVA 4A06A 3KMMA 3K2LA 5CU0A 4CT1A 1GZNA 3TNQB 4ZTSA 3K5VA 5EW9A 4BWPA 5GINE 5HVJA 4I0SA 4AXAA 3UVRA 1OZ1A 4J99A 1U4DA 4GG5A 5AP6A 3RCDA 3RP9A 4JDHA 4U45A 5AUVA 3SRVB 4AZEA 3EH9A 1GIHA 3BLHA 3EOCA 4H3PA 3BGZA 4FSMA 3BGQA 3ORNA 4RC2A 3TNHA 4XG6A 5M06A 2R4BA 2EWAA 1IA9A 4ALWA 4QYYA 3KK9A 4L42A 3TV4A 2X4ZA 1Y57A 4GL9A 4S33A 3ZBFA 2XMYA 5BVDA 3LLAA 2RFNA 2Y9QA 3ORXA 4FL3A 5L2QA 3MPMA 4PPBA 3I0OA 3T3VA 3RCJA 1H1SA 4QPAA 3TCPA 2OJJA 4I4EA 4C59A 3QGWA 5JKGA 2R3GA 4D2VA 2WTIA 4A9YA 3RGFA 2B52A 2VU3A 4I5MA 5EK7A 3W2OA 5EI2A 3DK7A 4FNZA 2XNMA 1MRVA 4YBJA 2PTKA 3QZGA 3ZO3A 2C1AA 3D0EA 5LMKC 2WELA 3ENMA 2J5EA 2JBOA 4GU6A 3SKCA 5LQFA 3WZUA 3IGOA 3E7OA 5TO8A 2YWVA 3R9HA 1V0BA 4Z16A 3IW4A 4FV7A 3F3UA 3QL8A 3OG7A 1T45A 2V0DA 4IM0A 2Z60A 4M69B 5CY3A 5K0KA 4JJRA 4CG9A 3DKGA 2OZOA 5GIPE 3QU0A 4RJ5A 3RVGA 1PKGA 4DFYA 4LQMA 4FEQA 4BRXA 4UMRA 3QTIA 4DEIA 3QGYA 5EW8A 4RX8A 4FKIA 3F9NA 4RRVA 2XNBA 3I81A 3E87A 4ANSA 3SDJA 2B9HA 1P4OA 4EK6A 5CNNA 3GFWA 4MH7A 3PLAE 1F3MC 3PXKA 4OW8A 3FZRA 5A4EA 1QL6A 4BKYA 5CVFA 3ZMMA 2OZAA 1PF8A 3FUPA 4ACDA 3PG3A 2VGPA 4FK3A 3BIZA 4ZJVA 4ZSAA 5I9WA 2QOHA 2A0CX 4IAAA 4YBKA 4BI1A 3H30A 5KMIA 1DI9A 3F3TA 4KKHA 4F65A 2W1IA 2YAKA 5D41A 4CRSA 2UVXA 2ZV8A 1GY3A 2W4JA 3G2FA 2RKUA 3HEGA 1FGIA 1A06A 1HCKA 3MYGA 4FKJA 4KKEA 4IH8A 3BRBA 3DK6A 2WU7A 3LIJA 3D83A 4OTGA 1WBSA 4ZY5A 3VAPA 4EZ3A 3KK8A 2FYSA 2Z7LA 2PMOX 2XIZA 2OSCA 5AUUA 2UZLA 2X0GA 3E8CA 5HORA 3LMIA 1YOJA 2ONLA 1H00A 4RLKA 4O7VA 5AEPA 3QD2B 3O51A 4FG9A 4KINA 3UIMA 1H4LA 1Q8TA 2J90A 3B2TA 2CSNA 3KULA 4MBIA 4MD8E 4TWNA 1O9UA 5IA2A 4G6LA 4E4XA 4D1ZA 2ITPA 1XBCA 2Y6MA 4F0GA 4A4OA 4J1RA 2JC6A 3D4QA 1BLXA 3A7GA 3DBDA 3EYGA 4XNEA 4B8LA 3P0MA 4IDTA 5HEZA 3HVCA 4J7BA 4FIHA 4M13A 2WQBA 2YZAA 2YCSA 3PPZA 4FIEA 3R2BA 2CGVA 5HG5A 4FZ7A 3ZLWA 3WF8A 4PTCA 3OCBA 4FT0A 5ETAA 1U46A 2IVVA 4UY9A 2UVYA 2OJIA 2BAJA 4KS8A 5I9VA 4WNKA 3R01A 4XG7A 3TTJA 4F09A 4DG3E 4O7RA 5AWMA 4F08A 3M42A 3FYKX 4RIOA 3W8LA 5M4CA 5AX3A 2PE0A 3ETAA 4IEBA 5D1JA 2SRCA 3Q4CA 4BDFA 3RPRA 4L52A 4O1PA 4QPSA 5EYCA 3UDBA 3CQUA 3E8EA 3UPXA 2WPAA 1ND4A 4WNOA 4BZDA 5AAGA 3CKWA 2IW8A 3D2KA 3GEQA 4O22A 3MB6A 3WYYA 1KSWA 2CKOA 4DT8A 2Y4IB 4GKIA 4K77A 2XP2A 2GDOA 4FSZA 1ZXEA 3KN6A 4FT3A 4F1OA 4H39A 5CF5A 4CMUA 5I3RA 1NW1A 3JPVA 2V22A 2VWXA 5CSHA 4ANOA 2JAVA 5DYJA 4FKOA 4O0YA 5CF4A 1WBTA 3BWFA 4MNEB 1JOWB 3ZSHA 4KSQA 2JITA 4DEAA 3R1YA 4DT9A 5DR2A 1DI8A 1TQMA 2WEIA 1H08A 3G9LX 2QO7A 4K9YA 2E9UA 2YDKA 2I0HA 3C4EA 2OICA 5AADA 3OCSA 1EH4A 3FI2A 1F5QA 4KIKA 2RSVA 3DFAA 5C27A 2B1PA 2QI8A 1H0WA 5HG7A 1BI7A 3SHEA 4DC2A 2JKMA 5I5ZA 5DPVA 1KOBA 3R8ZA 3LXKA 2UZVA 4ZEGA 2C5NA 5A14A 3VS6A 3RZFA 5BNJA 1Y91A 2WMRA 5CVHA 3NAYA 2WXVA 4ERWA 3BYSA 5EQEA 5FQDC 4FOBA 3BBWA 2XIXA 4R6VA 4YJTA 2F7EE 4B9DA 3TTIA 4IX6A 3UZTA 5CENA 3RAKA 4QMWA 4RFZA 4AN3A 3DNDA 4IM2A 4ZK5A 3DB6A 4WT6A 2VD5A 4C4JA 5FEQA 3O7LD 4IWDA 3ZM4A 3ORIA 4KRDA 5FM2A 3V6SA 5KHWA 1S9JA 4E3CA 4C3PA 4PDYA 4RIXB 2C5OA 3RHXA 3BU3A 4O0RA 5KBRA 1UWHA 4DBXA 1WBNA 3DZOA 4GEOA 4P7EA 4PX6A 2WZJA 2XZSA 3PZEA 4NTTA 4PL4A 3UQCA 3MH2A 4YR8A 4Z9LA 3CP9A 4FUXA 4YZ9A 4F9YA 2JDTA 2BCJA 2J2IB 4GU9A 4D0XA 4G6OA 3R8VA 3FPQA 3DCVA 3CD3A 2JKKA 4JDIA 1M2RA 2R3HA 3FLQA 4K1BA 4MD9E 4PDPA 3HLLA 2QCSA 3Q53A 5EQYA 2NRYA 1JSUA 4G9RA 4L3PA 5KKRB 5DR6A 5C4KA 4BB4A 1B39A 2XK4A 3QQKA 5L2SA 4BTKA 2BZJA 2VAGA 2I1MA 4IJ9A 3FMNA 2YCFA 3TZMA 4QMNA 3G5DA 3CQEA 4JRNA 5AV4A 5HU3A 4K2RA 4XUFA 2QKWB 3N4UA 3CPBA 4GFOA 1BX6A 4YJUA 3TUCA 2ITNA 4JOAA 3UYTA 3HGKA 4AN2A 5HLNA 3IG7A 2VTQA 3COHA 4J95A 5B2KA 3ATTA 4BCOA 4WG4A 4DITA 2EB3A 2QOOA 1PXJA 3PFQA 3WBLA 2OH0E 2XJ0A 4IACA 3GT8A 2PK9A 3NUUA 4ACHA 4CFNA 2GQSA 4ZXTA 5CEOA 4DHFA 3MH1A 2IO6A 2PE2A 2WB8A 2UZUE 4XX9A 2OO8X 3P79A 3R1QA 5AIKA 5H9BA 4WKQA 3EQCA 4AW0A 4ZY4A 4EKLA 2X9FA 3ACJA 1GZ8A 4BKJA 3ZC6A 4IAFA 4M84A 3SW4A 2VTOA 4CTBA 3NAXA 3WYXA 3I60A 2X6EA 3I7CA 1MRYA 2P2HA 4DFBA 2CN5A 2XF0A 3BV3A 3GNIB 4JG7A 5ANIA 1UV5A 1J3HA 3PJ3A 4FUYA 2X39A 3NW7A 2VTNA 4AF3A 4X2JA 5C8NA 2R7BA 4EK4A 1O6KA 1U59A 2ITZA 4AU8A 4OTFA 4EH2A 4AT3A 4H3QA 2HY81 1MQBA 2G2HA 4C8BA 2G01A 2GNGA 3S95A 3PDTA 4MX9A 4RJ6A 4ZTMA 3QA8A 5A6OA 5HTIA 4MXYA 4H1MA 5LXMA 2OFVA 3GBZA 2ZM1A 4RJ4A 4C34A 4TW9A 2OF4A 3ZUVA 4DGMA 2Z7SA 3II5A 2J9MA 2FSTX 1OL6A 2JIIA 5J7BA 3KVWA 4BCQA 5JT2A 3FMJA 3RK7A 1YQJA 2Q0BA 4DCAA 2XA4A 4G16A 4I6HA 4CXAA 4QQCA 2X8EA 2GFCA 4IB0A 4BCMA 3HA8A 5H2UA 1IRKA 5K3YA 3NW6A 4KS7A 2BVAA 2XVDA 1A48A 1UU9A 3BE9A 4IX3A 2QR8A 2ZV7A 3PSDA 4XRJA 4TN6A 4TNBA 3DAEA 2V7OA 3MA3A 4FSNA 3NVMB 2IWIA 2BDJA 4CFXA 5FEEA 5HICA 4HJOA 4XOYA 2X2KA 2RGPA 3EMGA 1WZYA 3GC9A 5KMKA 3BYMA 3RPYA 5CWZA 1YDTE 3V51A 5BVEA 1FVTA 1OPKA 5GZ9A 3ZONA 4EYJA 3A7HA 3G51A 3NIEA 1YWVA 4YZCA 4QT1A 4Y5HA 2WKMA 2FVDA 3FHRA 3NNUA 4FNYA 4AN9A 2W9FB 3EQRA 2OXYA 4EQMA 2HAKA 3R30A 4NEUA 3PVGA 5TR6A 5A3XA 3OS3A 4BHZA 1KE6A 3PIXA 4YLLA 5FXQA 5CTPA 3MGYA 2WTWA 1BMKA 2YDJA 3FY0A 4IC8A 4PY1A 3QCQA 3QX2A 2X1NA 3P23A 4ITJA 4LFIA 4BDHA 2WTJA 3P7CA 4E6AA 3FHIA 1WBPA 3A60A 2OBJA 2XK7A 4TXCA 4EHZA 3PXZA 5HNIX 3KXHA 4FL1A 2WEVA 4RQVA 5D9HA 2NNWB 5EI8A 3AD6A 5BVKA 3LFQA 5A4QA 4WUNA 2JBPA 3CLYA 4W9XA 1Q97A 2GNJA 3TG1A 4J53A 4C62A 2R2PA 3LFCA 3ULZA 4ANNA 4AE6A 5JRSA 2C47A 3FV8A 1Q41A 3DV3A 3NYXA 3ZFXA 4AGCA 3C4WA 1E1VA 2J4ZA 3MVJA 4UEUA 1MRUA 1SVEA 5J95A 4BZNA 5M56A 4AGWA 4O7SA 5JN2A 1PMVA 4OBOA 4FSRA 4W8DA 4AZWA 3GU4A 4X3JA 4JAIA 3LM0A 4FVQA 2OU7A 4YC6A 3LKMA 4WBBB 4YHFA 3LLTA 2IZSA 3RAWA 3IK3A 1Q3WA 2W06A 3Q9YA 3QQUA 2DWBA 3L1SA 3OBGA 2C3LA 3L8PA 3MPTA 3PWDA 4KBCA 3G15A 1ZLTA 3VS2A 2XNGA 4CEGA 2WMUA 1AQ1A 1RQQA 3C0HA 3FDNA 3Q4TA 3T9IA 3FC1X 3AT3A 2X7FA 2J0LA 3CKXA 5EW3A 3BZ3A 4RJ3A 4HYHA 5HQ0A 2PYWA 3PG1A 1S9IA 4J96A 3EFWA 2GNIA 5JFXA 4ZIMA 3WZDA 3HMNA 4ANBA 3C4CA 2IZUA 3DPKA 3TZ7A 3VUKA 3VHKA 3VS5A 2O64A 2YM5A 5AM6A 4OR5A 2WMQA 4MWIA 5ETFA 2PVRA 3QQFA 5EM5A 4IX4A 2W5AA 4DGLC 1ZOGA 1BL7A 2BRHA 2YM4A 5EFQA 4HGTA 4G1WA 4CLJA 4EJ7A 5IQGA 4BYIA 2BHEA 3D14A 2Y7JA 2YERA 3DA6A 4RIWB 2C6LA 4V05A 2PVJA 1PW2A 5LOHA 3CJGA 3QTXA 5EOBA 3FE3A 2PE1A 3QF9A 4G3FA 4QQJA 5TE0A 3TL8A 2Z02A 3NW5A 4FZFB 2IJMA 2X81A 3UIBA 1MQ4A 3ROCA 4E4NA 3PJ1A 4L43A 3W10A 4N70A 4XYFA 2ZB0A 4NIFA 1YXTA 3F2AA 3FKNA 4TYJA 4RA4A 2Y4IC 2IZRA 4E4LA 1G8AA 1SNUA 4TYHA 3QTWA 3W33A 5FTGA 3R7YA 5AR5A 2BIYA 4D2TA 2UW7A 1M2QA 3LZBA 4FV4A 4DAWA 4KWPA 4OAUC 2QHMA 3NDMA 3RINA 4X2KA 4B6LA 3THBA 3FL5A 2VTMA 3E64A 3F5GA 3OY3A 5TKDA 3NX8A 4AW2A 4BY9E 4NTSA 1PXOA 2XK3A 3AT2A 5AUZA 3OUNB 3ZCLA 4WUAA 4DGGA 3H3CA 2UW0A 2QLQA 4FSTA 1Z9XA 3DLSA 1GZKA 2X8IA 4LV8A 3TUDA 2QNJA 3TNWA 1IAHA 4FZAB 5AMNA 3ANRA 4FTCA 5F9EA 4NKAA 4S31A 4TWCA 4UXQA 5HX6A 1OPJA 3QCYA 3GGFA 4ZZMA 3DOGA 4FSUA 3TJCA 3NNXA 4IFCA 1GJOA 2O2UA 3V5PA 5K9IA 4JR7A 3NWWA 4I41A 4TTHB 3W2SA 3C4XA 3OP5A 1OL1A 3G6GA 1WMKA 4NT4A 4UYNA 1IASA 1SYKA 4TPTA 3ET7A 4G6NA 4XEYA 3NUAA 5HIDA 4PWNA 5IQCA 1XH7A 4AUAA 3PIYA 4KBAA 3VBTA 1YKRA 3VRZA 4JBOA 1Q5KA 3KKVA 3NUSA 4BR3A 3CTHA 5CAUA 5AR2A 3ZO4A 3E93A 3UGCA 4C3FA 1OB3A 2HENA 4BI2A 3I0QA 3MH3A 4FR4A 3EZVA 2UW6A 4G9CA 4DFUA 3NYOA 1J7IA 5IQAA 5DRDA 2G1TA 3PXQA 5EYKA 3S2PA 4IANA 4BDDA 5JQ8A 4QYGA 3LQ5A 2HIWA 4YJNA 3ORKA 4C4GA 3O0GA 4EI4A 1KE7A 3UP2A 5LWNA 4YC3A 4C58A 4M15A 2C6MA 4EHVA 4O27B 4AZVA 3NCGA 2R3NA 3RBWA 2WMAA 1XH5A 2HYYA 3LJ0A 4O2ZA 4GT5A 4O7TA 3QRUA 3HDNA 4F99A 3ZXZA 3RHKA 1JAMA 4GRBA 5J9LA 5EM8A 5A46A 3HV7A 2VTJA 4DEDA 4R3PA 3KCKA 4RVLA 2R3KA 3W16A 3VBVA 3HRFA 5IA0A 1NXKA 2XM8A 3TXOA 5JZNA 4PQNA 5C8MA 2FH9A 4Y95A 3ZO1A 3HMIA 1OITA 2ITQA 3V04A 3HA6A 3R02A 3TIYA 4CFUA 2JDOA 3R7OA 5HVYA 5EDQA 4GUBA 1UU8A 3OT3A 3DZQA 1URWA 4LGGA 3MTFA 4F63A 2VO6A 4ASZA 3A8XA 3QX4A 4G3DA 5TF9A 2PZIA 5DGZA 5GHVA 1JLUE 2ITXA 3QA0A 4UV0A 2VTSA 4HZSA 4FEVA 4DE4A 2XBJA 3TDWA 5LVOA 3IKAA 4AZTA 4N6YA 3SRVA 3ENHA 5DR9A 3IDBA 3OWJA 5CI7A 4QP9A 3I7BA 2Y6OA 4RGJA 1KE5A 4PTGA 4CKJA 1FQ1B 4A9UA 4I5HA 2F57A 1XHAA 5E1SA 4RSSA 5I4NA 3KRJA 3VUHA 2QG5A 2ETKA 4PRJA 4DFXE 3DAJA 4LMNA 3SXFA 3K54A 3GCPA 3OCTA 3ZUUA 3ZOSA 2ITUA 4DH5A 3CPCA 2RF9A 3O23A 4BICA 4FNWA 4Q9SA 4C4FA 4F7NA 4HOKA 1ZAOA 5DEWA 5E8YA 4BFMA 4MXXA 4ZLOA 4MXAA 5M08A 2BRNA 4BDEA 3FZ1A 3QLGA 4ITHA 2EXCX 4TZRA 1TQIA 1ZRZA 5E8VA 2GQRA 3OXIA 4L7SA 2WD1A 4O0XA 4GIIA 1Q24A 1HCLA 2GSFA 3FKLA 3IECA 4MAOA 3HP5A 4D28A 5JSMA 4PMSA 2IG7A 1OKVA 3S00A 4I5CA 3FXWA 4F9BA 5M09A 4ZTLA 4MKCA 4EC8A 1DS5A 2UZTA 2W4OA 4S34A 4YJVA 4A4XA 3E5AA 4O7NA 3HMOA 4XHKB 4X0MA 2BZIB 3AT4A 1M2PA 3BHHA 2W99B 4M69A 1GIJA 5JQ5A 4FZ6A 5JRQA 3ORLA 1W84A 2ESMA 5CU6A 5J5SA 2RL5A 5BVWA 2YA9A 1H1QA 3MS9A 4YURA 3OCGA 2BPMA 2PY3A 5AR3A 4ZSJA 3GOPA 3R9RA 4MCVA 1I09A 4FV8A 4EORA 4FTQA 3CD8A 4FTLA 4IQ6A 5KBQA 5M44A 4GJ2A 2CLQA 3HZTA 4LOQA 3BI6A 5HNBA 4XV3A 1Y6AA 4V0GA 4KB8A 4YTIA 4QP8A 4M0ZA 5BMSA 2VWIA 3PJ8A 3UTOA 3EQFA 4XG4A 4Z3VA 2VTLA 2B4SB 2Z7QA 3BPRA 3R6XA 5G6VA 3QZIA 4TWPA 3E62A 5E8WA 4EBWA 4ZLYA 4FKGA 3DY7A 4QMUA 3CGFA 4U42A 3U6JA 3OT8A 3H10A 4KA3A 5D10A 5IQBA 5ANJA 5LCKA 5HLWA 4GKHA 5EH0A 4U3ZA 4LL0A 5K5NA 4BBEA 5B2LA 2V62A 3EFJA 3GCUA 3P5KA 2VUWA 4HGLA 4GMYA 4I0RA 4ZSLA 1JSVA 3UOLA 1UWJA 2C5YA 4EBVA 4EZ5A 4I5PA 3KY2A 5JGDA 1XJDA 5I0BA 3UNKA 2PZRA 5A4TA 3UVPA 3ZDUA 4C35A 3SC1A 2PSQA 1YXUA 5DI1A 2YEXA 1O6LA 2F2CB 3GUBA 3KFAA 3VW8A 5D7VA 4F64A 3VW6A 1W82A 2HOGA 5HG8A 4FYOA 2CGWA 1Y8GA 2BILB 3F88A 2GHLA 4AOJA 2EVAA 2OH4A 2PVNA 3OD6X 4UWCA 3LM5A 1ZOEA 4B99A 5ITAA 4AOTA 3WILA 5J8IA 1KE9A 3QALE 4ZAUA 4DA5A 4RG0A 3PSCA 4LOOA 4O86A 2AYPA 4TT7A 4M68A 2W05A 4TRLA 3EYHA 3HV5A 4ZP5A 4HVGA 5HD4A 5C4LA 1PXPA 4ZTHA 2QOCA 2C6IA 1KOAA 3S0OA 1BUHA 3DB8A 4O6LA 4QTCA 4OBQA 3UNZA 1LUFA 2A2AA 4IBMA 5FP5A 3ROYA 3V5LA 3PY1A 4N0SA 2NRUA 3BEAA 4YGAA 3KB7A 2XIRA 2ITVA 2XNOA 2WMXA 2ZMDA 3RALA 4C36A 3D5UA 3UPZA 3I1AA 1CDKA 5ANKA 3ORPA 2GMXA 5IQDA 4FT7A 3LMHA 3S4QA 4FIFA 4PP9A 3TIZA 4PNKA 4EK3A 1JKSA 4DCEA 4PPCA 2BRGA 4H1JA 1IG1A 2REIA 3HUCA 1NT2A 4DEGA 3UE4A 3C0GA 3R7IA 3AQVA 4DEHA 3DKOA 3E88A 2EXMA 4R8QA 3DJ6A 4KD1A 2OLCA 3QQLA 1I44A 4PUZA 3WIKA 3JVSA 3SQQA 3C5IA 4U97A 4YZNA 3LXNA 4U44A 4CZUA 4FGBA 3FBVA 4FMQA 3MDYA 3FXZA 3D7ZA 4G3EA 2GNFA 4X3FB 1Q8UA 3T3UA 2WMBA 3ORZA 3ZEWA 4FODA 2GQGA 2UW9A 3F66A 4AA0A 4W4VA 3PPJA 5M57A 4FV9A 2W1FA 2WTDA 2QC6A 5IH6A 1OPLA 3TNIA 4OAVB 2J5FA 2JEDA 4GUEA 5KZIA 1IAJA 4WD5A 5KE0A 2LAVA 4D4YA 4CCUA 2QONA 4EJNA 1H26A 2R0IA 2YZLA 4L3JA 2XNNA 4H3BA 4IAZA 4C02A 2JDRA 1ZYCA 4F1MA 4DLIA 3NMUF 3BELA 2BRBA 3BGPA 3BYVA 4ERKA 4UMPA 5C8KA 3AD5A 4PDOA 4BCIA 3DS6A 2XYNA 2WO6A 4RX7A 2QOIA 4MYGA 3ZM9A 3NYNA 3ZLSA 5E92A 1H0VA 2G2IA 4LRJA 4R1VA 4HNIA 5KMLA 4GJ3A 2ITYA 3HNGA 3KC3A 3ODZX 5HO8A 4BWXA 4QMQA 5JFVA 4H05A 3OW3A 4ACCA 3PE1A 4APCA 4CKRA 3AC4A 5LARA 3VUIA 2JD5A 4F9WA 4YJQA 2JFMA 3FC2A 2ZV2A 4RIXA 3OOMA 5AR7A 2VO7A 2QQ7A 4WNPA 1YOLA 2W1CA 3POZA 5LMBA 2GNLA 3IPHA 3TV6A 1L8TA 4DTAA 4ZTRA 2PMIA 1RE8A 1OBDA 3SVVA 1CTPE 5HE0A 3DDQA 2WTKB 3KF7A 4FKVA 2JKOA 5M4IA 1P2AA 3SXRA 2GCDA 4HPTE 4F6WA 5L2TA 4HYIA 3QD0A 4NFMA 3EN4A 2HELA 5KO1A 1Q62A 3Q3BA 4IVAA 4ANQA 2ZAZA 2ETMA 2XKCA 4GG7A 4QD6A 2QOLA 3FQEA 4PL5A 3CR0A 4FKRA 4IE9A 3BCEA 3F82A 2I6LA 2XH5A 5EM6A 4JQ7A 4MVFA 3RAHA 4C0TA 5BYYA 4GK4A 1YWNA 4G5JA 3T8OA 5H3QA 2C6DA 1JKTA 4O7YA 2B9IA 3HV4A 1MP8A 3BKBA 3R21A 4LM5A 5EKOA 4MNFA 5DLSA 3C7QA 3HAVA 4BCNA 2W1GA 4NW6A 1V0OA 5HBEA 1XH4A 2QVSE 3G0EA 1QMZA 2PMLX 4FE2A 3IO7A 4OTPA 4A4LA 1RW8A 1WBVA 4QP2A 5DT3A 1STCE 4X6QC 4YHJA 4IM3A 2E9PA 3MV5A 4I23A 2RIOA 4FTTA 4R7IA 4C38A 5IU2A 3RPOA 5KMMA 4DGOA 4XG3A 4L68A 4C57A 1R0EA 4ZJJA 1YOMA 3CY3A 3EQDA 4HCUA 5AP5A 4ZTNA 3RAIA 3DXQA 4OTQA 4KRCA 1H1RA 5AA8A 2XYUA 3M1SA 2YM3A 1OI9A 2NO3A 3DJ5A 4JT3A 4ASEA 3PXYA 4EK8A 2PUIA 3A62A 3TUBA 3E7VA 2XIYA 4RWLA 4UMQA 4AWIA 3D5VA 2EUFB 4LL5A 1VZOA 3AGMA 2WMSA 2PULA 4ONAA 4YZBA 4D1SA 3MA6A 4QTBA 3U51A 3OC1A 2ITTA 5CALA 5CSWA 4MXOA 3AC5A 3LXPA 5DRBA 5BVFA 3D5WA 3E8NA 2C68A 4EH8A 4EK5A 4AA5A 1WVYA 3KXMA 4DINA 1KE8A 5FXRA 4OUCA 1QPDA 3FZSA 3GFEA 3L8VA 2CNUA 4CT2A 2YIRA 3QCXA 5IDPA 5HGIA 4J98A 3NYVA 1OUYA 5HI2A 4R3RA 3UMWA 4EL9A 5D12A 1VYZA 3QUDA 3Q9ZA 1L3RE 4W9WA 5A4CA 4I24A 2XJ1A 3RNIA 3ANQA 3LMGA 2OXXA 3CIKA 3R7GA 5EDPA 5IQHA 4QP7A 5B2MA 2BFXA 3VBWA 4JDJA 3EQPA 3MBLA 4FKWA 4RT7A 4QTAA 3QLFA 4UMTA 3U87A 1E1XA 5CS6A 4QOXA 4KAOA 3AXWA 3KA0A 2WOUA 4YNOA 2IZTA 5HX8A 1YWRA 2CGUA 4USDA 2BUJA 2YFXA 1UNHA 4NW5A 3MB7A 4BDBA 1BL6A 5AM7A 2R3RA 4JVGA 4FKSA 1UNGA 3TKHA 3U9NA 2OFUA 2DYLA 4LI5A 2R3LA 4E6QA 3HRCA 1M14A 3QD3A 3DTWA 4R3CA 2YWPA 4CVAA 2WQMA 4ZY6A 4ID7A 5IH5A 5LVPA 3BQCA 4TL0A 5C26A 2AC5A 4G2FA 2VX3A 3FAAA 2FUMA 3R83A 2FO0A 3PUPA 3VRYA 4QQTA 3OZ6A 2HZNA 3H9RA 3RM7A 5FDXA 4YP8A 4E5BA 2ZM4A 3A61A 4RPVA 4BN1A 5DVRA 3ZLYA 4E5WA 4EH3A 2CKPA 3BQRA 2JIUA 4MQ1A 4WBOA 4RBLA 4EC9A 5F94A 3WI6A 4EYMA 2OKRA 4ASDA 3R1SA 4QP4A 3GXLA 4ALVA 4ANLA 1GZOA 3ORTA 3MJ2A 2BKZA 4I4FA 4C4EA 1NVQA 1Y8YA 4QYHA 4UZHA 2C5VA 3ZFYA 4EOJA 2XB7A 4EQUA 3B8QA 5J9YA 2XK9A 4RJ7A 3U9CA 5AUYA 3HV6A 4AW5A 3UO5A 4PTEA 4HYUA 5LMKA 1APME 4FT9A 3MFTA 3OTVA 3PWYA 2J51A 3IOKA 4G3CA 2YLEA 4EUUA 5DEYA 4FEXA 4E7WA 3F3WA 3FLWA 4E6CA 2P4IA 2YIWA 3G9NA 5AFVA 4CMTA 1ZOHA 3OVVA 3QFVA 3QYWA 4MBLA 3BU6A 2WTCA 2IVUA 4I0TA 2C1BA 5AR8A 3BEGA 1LP4A 3EZRA 3MH0A 4FSYA 3PSBA 4O21A 3TNPC 5ACKA 1WBOA 5GJDA 3AMYA 5HCYA 1J1CA 2JAMA 4I6QA 5EHYA 5IA3A 5HNGA 3FL4A 3W32A 3SOAA 4C61A 4JS8A 2B9FA 3Q52A 4ARKA 3OMVA 2QOKA 4BIDA 4CLIA 3P78A 4FKUA 1MUOA 4E6DA 3VBYA 3BLQA 3NGAA 4YHTA 5EM7A 2YITA 4RVTA 3EL8A 4JX7A 4D4RA 3H9OA 3NCZA 4M66A 4R1YA 3UC3A 3DBFA 2WTVA 4WG3A 5C01A 2UZWE 3OEFX 2P0CA 4HPUE 3TACA 1YDSE 3SV0A 1VEBA 3UBDA 1U54B 3GU8A 3ALOA 2NP8A 3U4UA 5JH6A 4FI1A 3MFSA 3HAMA 3AD4A 4L3LA 1H27A 3SX9A 4GYIA 3VJNA 4HVIA 1REJA 2WIPA 2X8DA 2J0IA 3C51A 4C2VA 4O7WA 4O96A 4U79A 2VWWA 4TY1A 4O0SA 5HIBA 5E1EA 4DH8A 4ACGA 3JY9A 3C13A 2I0EA 4Z55A 2YACA 2F2UA 4QMSA 4I6FA 3ZZEA 3SD0A 3UIUA 4X3FC 3WF7A 3R63A 4I21A 3C1XA 2YN8A 2C0IA 3VJOA 4FIGA 3EN6A 3K3IA 4NCTC 3RZBA 5DIAA 4CD0A 3CGOA 3O7LB 2IVSA 3LFNA 3REPA 4E5AX 4LV5A 3KMUA 4XCUA 4XMOA 1OKYA 3C4FA 2Q83A 3DNEA 3FY2A 2B54A 2Q0NA 3KF4A 3R9DA 5GIOE 3NVKI 3LCDA 4BGGA 1XH6A 3UYSA 5LVMA 4E73A 4KNBA 3FQHA 3SA0A 5I9XA 1PJKA 3U6HA 5AP1A 2BAQA 4BTJA 3PY3A 3WF6A 2ERZE 3OWKA 1Z5MA 3KN5A 5ANEA 3UJGA 1YI6A 4IZYA 3W2PA 3FXXA 4CYIA 4A7CA 2XCHA 4WA9A 2XKDA 3FPMA 1YRPA 4FSQA 3U4WA 3UZPA 2R3FA 2C6KA 5KX8A 5CSPA 2GU8A 2F7XE 5IISA 3FI3A 3PP1A 2W5BA 3VF8A 4FTRA 1G3NA 2VNWA 2XKEA 3CTQA 4QP1A 2O8YA 4RZVA 5B7VA 5ETCA 5DFPA 2RFEA 5BPYA 5FRIA 3VS7A 5IF1A 5L6OA 3S1HA 5GNKA 4HYSA 3EWHA 3D5XA 1JVPP 4LGDA 5CEQA 2VX0A 4LRMA 2F4JA 4CTCA 4M12A 1DAYA 1JWHA 2P33A 4N4SA 4L45A 5CU3A 4O0WA 4JBQA 4FICA 4RZWA 5CLPA 5M4UA 1UNLA 2HWOA 2R7IA 4L53A 2WTKC 1H1WA 2EU9A 3Q2JA 5EYDA 3ZFMA 1ZYLA 3HDMA 2VTTA 2OJGA 4CZYB 2BZKB 2R9SA 4QP6A 3VS4A 2H96A 4L00A 3MVHA 3VBQA 4J71A 4XP2A 2VWVA 1B38A 5CANA 3HUBA 4FA2A 4MXCA 2ZJWA 2HWPA 5EHLA 3FLSA 2VWUA 4C2WA 3QAME 2QO9A 2YAAA 5DWRA 4U9AA 5EOLA 3M11A 4YMJA 3MW1A 5CAPA 5GZAA 3MVLA 1PHKA 4ZZOA 5DNRA 3LXLA 4JL9A 1IA8A 1LEZA 3HV3A 4MTAA 4QQ5A 2OIDA 3LHJA 4UN0C 2W9ZB 3HKOA 3QQJA 3PVBA 5ANGA 5AV0A 4IVBA 4X6RA 2AC3A 3ITZA 4DTBA 2VGOA 2CHLA 5CQWA 4ZMEA 3ALNA 4DGNA 4K11A 4YZDA 2P3GX 1PXNA 2YJRA 4Y73A 5ETIA 5HESA 3P4KA 5AAEA 3F69A 4HVHA 4W4WA 4YSMA 4AAAA 4BKZA 4DH3A 5KHXA 4RX9A 3Q5ZA 4IZ7A 3VIDA 4EH5A 2DUVA 1PMEA 2XM9A 3CJFA 4FTUA 4OTDA 2ETRA 4LUEA 3JXWA 5CT0A 4BZOA 3CSVA 4EQCA 2W1DA 2VN9A 4D2RA 1QCFA 4JIKA 1SNXA 4RQKA 4QMMA 1OIQA 4KIOA 5E90A 3OXZA 5H8EA 3QKKA 5CEIA 1PXLA 4YTCA 2GHGA 5M55A 4F70A 4WHZA 2O5KA 5B0XA 2B9JA 3A2CA 2XRUA 3BX5A 3LFAA 4BCFA 4C3RA 5FM3A 4CZTA 3L8SA 3ACKA 4S32A 4IADA 4A9SA 3MN3A 4AG8A 3MFRA 4AX8A 2HW7A 3DDPA 3ODYX 1OUKA 3QBNA 1WBWA 3CBLA 3FMEA 5A4LA 4D1XA 2ONLC 3A99A 3SAYA 2HK5A 3HYHA 3WF5A 2B7AA 3DTCA 1YI4A 2W1ZA 4IHPA 1JKLA 4QYEA 5J87A 4IIRA 4EWHA 3R1NA 5CXHA 5BUEA 3LPBA 2YIXA 1YVJA 5J1WA 2PPQA 3F7ZA 3K3JA 4AE9A 2C6TA 2ITWA 4QMVA 4QMXA 5EG3A 3TKUA 1NVSA 5DE2A 5EQPA 5CEKA 1WVWA 2YABA 3W8QA 5ANOA 3QWJA 4AW1A 4BYJA 3BLRA 3EKKA 4EHEA 3S3IA 5FUTA 5BVNA 2VNYA 3RMFA 3PA4A 3TWJA 4K6ZA 4Y85A 4PPAA 4G3GA 3Q2MA 2QD9A 4L8MA 5EHOA 4DG2E 4G5PA 2BAKA 3EQGA 4K0YA 3PVUA 4DH1A 2CCIA 5CASA 5IH4A 2HZ4A 3AC2A 5JK3A 2XS0A 3UODA 2ZV9A 3QXPA 4ZTQA 3VUGA 4AZFA 2V55A 4FV5A 5FDPA 1FBNA 3L9LA 4FYNA 4DF3A 3EN5A 4WRSA 2PUUA 2UZEA 3FMKA 5IMEA 4O38A 2YDIA 4PL3A 5GZ8A 4BCGA 1NY3A 4HGSA 4IWPA 2WMVA 4C4IA 3VN9A 3DKCA 4P5ZA 3C0IA 1CKPA 4F6UA 4IW0A 5HVKA 4KIPA 3QD4A 2OK1A 5HE2A 3WZEA 4BL1A 4U6RA 5E8UA 4QTDA 1Z57A 4Q5EA 5GJGA 3LJ2A
chains in the Genus database with same CATH superfamily
4EH4A 4WRGA 4V04A 5J1VA 3TYKA 3IDPA 2CGXA 3DXNA 2R3QA 3BHVA 4NM5A 3V5QA 4AFJA 1G8KA 2PZ5A 3QQHA 4U80A 3DFCB 4RVKA 5E8TA 5AUWA 4LOPA 2VTHA 2ZOQA 5FBOA 3COMA 2H8HA 2WIHA 3R00A 3VWAA 1WVXA 2VWZA 3Q04A 4YTHA 4FV2A 1F0QA 4IWQA 4RWKA 5T3QA 3UOJA 3DKFA 4KKGA 4J97A 4B7TA 1BYGA 3ZLXA 3TM0A 4EOSA 1Q8YA 4BGHA 4DFZE 3CXWA 4II5A 3BL7A 4U41A 3R04A 1JQHA 2V7AA 5HG9A 3V6RA 3R71A 2G2FA 3ZS5A 5ACBC 3NR9A 5CQUA 3R9NA 1V1KA 4FC0A 3GC7A 4X7QA 5FLFA 3C50A 1ZMVA 2R64A 3FMMA 3PA5A 1OIUA 3CCNA 4Z7GA 1PXKA 4FF8A 4QMTA 1OKZA 1P4FA 2HXQA 1AGWA 2OJ9A 4L44A 4O2PA 5FXSA 4MQ2A 3VQUA 2QR7A 3MI9A 5T6KA 5FEDA 4M7IA 5J79A 3VS1A 3QC9A 3JS2A 4FEUA 1Q3DA 3BYOA 3HP2A 3IW6A 3L9PA 4YJOA 3V8TA 4G31A 3HRBA 4OT6A 3RJCA 3AGLA 3ZH8A 5I9UA 4BBMA 3MFUA 4KBKA 4UB7A 4BCHA 1DAWA 4F6SA 4F7SA 3IQ7A 5FWKK 2ZDTA 3ZDIA 3UP7A 2C5XA 4IZ5A 4O4BB 4IVDA 3GB2A 5CVGA 1CKJA 3I4BA 1FMOE 5IQIA 2RFDA 3R7UA 4D2WA 3R8PA 3W2RA 4ZLZA 4X3FA 4D9UA 4U7ZA 4U43A 4D4SA 4FTOA 4QMLA 4AT4A 2ZDUA 4Q2AA 2XK8A 1UU3A 1Q8ZA 2ZMCA 3A8WA 3F5UA 4FG7A 4NH1A 2XNEA 4NM0A 2FSMX 3GU7A 4G34A 4IDVA 5BQ0A 5M07A 3R8LA 3Q5IA 4JXFA 3W2QA 2GTNA 3Q9XA 4O91A 1R3CA 3NNWA 1GOLA 2QODA 4ENXA 5KUPA 1WCCA 3P1AA 4YJRA 4IZAA 3DBQA 3N51A 4JNWA 4X2GA 1PYXA 5F4NA 5BMMA 3FKOA 2HXLA 3VS0A 3WF9A 4D2PA 1SM2A 4GK2A 1PXMA 4I20A 4NL0A 4NKSA 1CM8A 3UG1A 3LQ8A 4W4YA 3KRLA 2Y0AA 4EOLA 2VZ6A 2ZB1A 5HBJA 4R77A 5J7HA 4FX3A 2VWBA 4JQEA 4EKKA 2WQEA 4IB5A 5BYZA 4BCJA 5CT7A 5IG1A 4WSYA 1JPAA 3HMMA 2XARA 3PY0A 4FT5A 4I1ZA 3RK9A 1G5SA 1OKWA 4QNAA 4QYFA 5E8XA 4O82A 3ZBXA 2J0KA 3U55A 2O3PA 4FKQA 4HNFA 3FYJX 4FZDB 5DG5A 2XRWA 1HOWA 1JBPE 2YHVA 3IOPA 4IX5A 4AGDA 4CMOA 3SGCA 4ZMFA 5L6WL 4P2KA 4TYEA 1VJYA 2XKFA 5DA3A 4O81A 3CEKA 4F1TA 2VX1A 4NSTA 3EHAA 2XUUA 4XV1A 1W83A 5KZ0A 2OW3A 4MXZA 4U0IA 2P2IA 5IEXA 2I0VA 1YHWA 4BHNA 3GENA 2BRMA 3MY5A 4MHAA 1BI8A 3VC4A 4RIYB 4DFLA 3O50A 2OWBA 4E1ZA 4IJPA 3MY0A 3U6IA 3TEIA 5IEVA 1WAKA 1QPCA 1YW2A 3Q32A 4DFNA 3C4ZA 4BDIA 4F0FA 5C1QB 3H9FA 5L8LA 1V0PA 2Z7RA 3DBCA 4QEBA 2EXEA 4TWOA 3KEXA 5E4HA 4L9IA 2Z8CA 2FA2A 2J50A 2QU5A 5AV3A 4OTHA 4LYNA 3VUTA 3MESA 2DS1A 4FK6A 4D55A 2C6EA 2GS7A 3QTSA 5HLPA 4CNHA 2YIQA 2UV2A 3TKIA 2X2MA 1SZMA 3MVMA 4CFVA 3IW7A 5FBNC 1JSTA 4FGRA 3PYYA 2VO0A 3D7TB 4QDVA 5L2WA 4MNEA 4WIHA 4LMUA 5HTBA 2JDVA 1ZY4A 2CJMA 3W0NA 4EUTA 3SW7A 1J91A 4O6EA 3WZKA 2YM8A 4Y5QA 4KUJA 3VUMA 3D94A 3KL8A 5IMXA 2B53A 2G9XA 2E9VA 2I7QA 2YLFA 4F9CA 3ERKA 4YPDA 5TOZA 2AUHA 3UQGA 5HKMA 4APPA 3VQHA 3L8XA 4V0GB 4NM3A 1G8JA 3EL7A 1OBGA 1W7HA 4BVUA 3RI1A 3BV2A 1LEWA 3R22A 3EQBA 5BV3A 1Q8WA 2BROA 2C4GA 3BYUA 3GCQA 3VHEA 5AUTA 3CC6A 3G90X 3OUKA 3V8WA 4I22A 4EEVA 5IEYA 5J9ZA 3R0TA 4O0TA 2PUPA 3HL7A 3D2IA 3EJ1A 4K18A 4LGHA 2X6DA 3GQLA 3LCTA 3NUPA 4W4XA 4XH6A 4FTAA 2UW8A 4IFGA 5K4IA 3DQXA 5DOSA 3TN8A 3ZEPA 4BDGA 4OTIA 3AOXA 3GQIA 4XOZA 3FWQA 5CAVA 2UZOA 4MF0A 3FEGA 1YXSA 3ZC5A 3NFFB 4M97A 3UZRA 2GNHA 1ZYSA 2X0PA 4JBPA 3R28A 2NYAA 1U5RA 3KCFA 2KTYA 4BDJA 4O4FA 3P86A 4OBPA 4XV9A 4JR3A 4UX9A 2OJFE 2FB8A 4GT4A 5DT0A 5FD2A 4AGUA 3UG2A 3Q96A 2OGVA 4HVSA 2R3OA 3O71A 4HCVA 1ZY5A 2PVYA 4TNDA 3SG9A 4RFMA 3A7JA 3I6UA 4PMTA 5HO6A 3B8RA 5AUXA 4QMPA 3VS3A 4YZMA 1ZZLA 4XBUA 4IB1A 4Y8DA 5LMAA 2P55A 4BIBA 1ATPE 3OXTA 4RFYA 1OECA 3BU5A 3CE3A 4GVJA 4NU1A 3WE8A 1R39A 3KU2A 3KGAA 4FV6A 1XR1A 3Q4UA 1H25A 3ID6C 2YIYA 3W55A 4I3ZA 4NJ3A 1R78A 2WOTA 3V5TA 3DU8A 4XV2A 4MD7E 4M0YA 5M51A 1XQZA 3PLSA 2CKEA 3CTJA 1LPUA 5CAOA 1FVVA 3VUDA 4OT5A 5JGBA 2C0TA 1ST0A 4U81A 4E4MA 2GTMA 3KXNA 2X0OA 5DBXA 1PMUA 3P9JA 4XBRA 3ZTXA 5CAQA 3NZ0A 4FVRA 1PKDA 4F7JA 3FMHA 1RJBA 2QOQA 2WQOA 4M14A 4XP3A 3FLYA 5KNJA 4E20A 3BWJA 3RWPA 4YO4A 4J8MA 3OOGA 2RG5A 3FI4A 4AZSA 2QOFA 3KRXA 2HZIA 3QZFA 5AAFA 3V01A 2WMTA 2R3JA 3H0ZA 3COKA 3NUXA 3PE2A 4UYAA 2VTIA 5CU2A 2GS2A 3LCOA 4CSVA 2IW6A 2OZAB 2ERKA 3E63A 3ORMA 3P08A 4O1OA 3ZSGA 3AMAA 2JIVA 3I5NA 5L6PA 4GSBA 4QO9A 4DEEA 5IQEA 5CNOA 1W0XC 5CF8A 3BBTB 3L9MA 1CSNA 4JI9A 3TZ8A 2YCRA 3D15A 4GK3A 3RPVA 4ALUA 1M7QA 4S2ZA 3O96A 1UKIA 3ZSIA 3NUNA 4U40A 4B0GA 4IVCA 4S30A 2CKQA 5BVOA 4GS6A 2UUEA 3PFYA 3EKNA 3IW8A 4AA4A 3AKLA 1XH9A 3FLZA 5DHJA 4BBFA 4ENYA 2BKKA 5HHWA 4PNIA 3KULB 4FVPA 4CKIA 3L9NA 2CCHA 3NUYA 4HZRA 3C5UA 1T46A 5CZHA 4ZSEA 5EDRA 2JDSA 3ZXTA 2J0JA 5AP7A 2BDWA 4XJ0A 4X2NA 4JG6A 2HCKA 2ITOA 1IR3A 4FNXA 4BWKA 3UVQA 3PXRA 5L3AA 5HZNA 3RWQA 4D4VA 4EOIA 3VULA 1P14A 4B4LA 1M17A 2FSOX 3FJQE 4D58A 4BC6A 1H24A 5A6NA 3QWKA 4U3YA 3QXOA 4CV9A 3D9VA 3MWUA 3UNJA 2PVLA 2PMNX 2QOBA 3Q6WA 5HD7A 3TJDA 5KCVA 5IKWA 3V8SA 1YHSA 2RFSA 3LCSA 5C9CA 4R7BA 2VV9A 2QO2A 4Q5HA 3HX4A 1ZWSA 5E9EA 3ZYAA 3OWPA 4LG4A 2XALA 2UW5A 4FL2A 3EQIA 3FZTA 2W4KA 3GC8A 3GI3A 5DMZA 5ICPA 4F78A 1U54A 4O0UA 3FSFA 2GS6A 2DQ7X 4QMYA 4R5SA 3PJCA 1VR2A 5BUIA 5HOAA 3QTUA 4JAJA 3AG9A 4RWIA 5DT4A 4YTFA 1PRYA 4YLKA 2QURA 3E8DA 3QRIA 2E9NA 2R3PA 2UZNA 4L6QA 4PF4A 4RA5A 4RC4A 4Z7HA 3UQFA 4N57A 2XNPA 1H28A 1NVRA 3DJ7A 4WG5A 4HCTA 5JFWA 4Q9ZA 3IONA 3LAUA 3RTPA 2ACXA 4W8EA 2J0MB 4EH9A 5D11A 2XIKA 4FV1A 4TYGA 4EZ7A 2A1AB 2R5TA 1OL5A 4FTKA 2BMCA 4KABA 4UBAA 4BIEA 5CEMA 1JKKA 1RDQE 3BHTA 2XBAA 4KIKB 5D7AA 5K0XA 1XO2B 4DG0E 5G1XA 5IUHA 3PA3A 2UW4A 4YU2A 2KULA 3AKJA 5IA5A 2XAOA 2VO3A 2WNTA 1K9AA 1H07A 3F7WA 5HE3A 4IB3A 3HMPA 4WSQA 2A19B 2A27A 3A4PA 5JMSA 2QU6A 2W0JA 2R3MA 3MJ1A 2QKRA 4RJ8A 3U8WA 4JBVA 4KIQA 4BF2A 1Q61A 3ZU7A 4P4CA 2G15A 1IEPA 1SMHA 3DGKA 4XRLA 5FTQA 4NUSA 1H8FA 2OG8A 1VYWA 3E92A 4UWBA 3CY2A 4QRCA 4ZOGA 2BALA 1LR4A 5AR4A 2WAJA 1M52A 4RMZA 5F1ZA 2PHKA 1UKHA 3GOKA 5IA1A 3Q9WA 5BUJA 5K5XA 1CMKE 3VNTA 1XKKA 2W96B 3B2WA 2B55A 3FZPA 3O8TA 5L2IA 1FMKA 1Q4LA 5HIEA 4UMUA 1XBBA 5HO7A 3KXZA 5LJJA 4YLJA 2X9EA 4RIWA 2PVMA 1GNGA 2XEZA 3LVPA 4GH2A 4FV3A 4GFGA 4GYGA 4MWHA 3EN9A 4L7FA 3ZRKA 5E8ZA 3Q4ZA 3LQ3A 1TQPA 3EQHA 4I6LA 2CDZA 1XWSA 5T68A 1E9HA 4QPMA 4B8MA 1OM1A 3PTGA 1KV1A 2UZDA 2BHHA 4ZJIA 5KMJA 3KXXA 3FMLA 3F6XA 3N9XA 1OGUA 5C03A 2PVHA 3JYAA 1H1PA 5IUGA 3W1FA 4MEDA 2BR1A 1KV2A 1ZMUA 3KREA 4IAIA 5KMOA 4RLLA 2J7TA 1YI3A 1OL7A 3O2MA 4EHGA 2UZBA 4X21A 2QG7A 5I9ZA 4I93A 1XMLA 2F49A 2ZVAA 3LCKA 1ZMWA 4L01A 2WGJA 1OMWA 3AMBA 4EWQA 3GVUA 5LVLA 3A7FA 3GC0A 3MY1A 4BGQA 4QMZA 4BI0A 2HZ0A 4E8AA 1BKXA 4YO6A 4NFNA 4PMPA 1UU7A 4BTFA 3O17A 5JEBA 4IWOA 3UMXA 3WARA 4AOIA 4AS0A 2BDFA 4BCPA 4FSWA 4FEWA 2OF2A 2GFSA 4IAYA 3ZRMA 2X2LA 4A9RA 3PVWA 2GPHA 4XG9A 4Y83A 2WFYA 4FBXA 2I0YA 4JMQA 2PU8A 2XJ2A 3QYZA 4AP7A 4ASXA 2Y8OA 3PIZA 4JRVA 1XBAA 5AJQA 3UO4A 1ERKA 4F7LA 3KMWA 2Y4PA 3LE6A 3T9TA 2BIKB 2W1EA 3BHYA 1PY5A 2XCKA 4AQCA 3BE2A 3PJ2A 4AT5A 5AX9A 4GV1A 3FZOA 3NSZA 3E3BX 3TV7A 5A54A 2YISA 5AP3A 3FSKA 5HBHA 5H8GA 4C37A 3OW4A 4P5QA 4HVDA 3H4JA 3SLSA 5HTCA 5IZFA 4NYEA 4J52A 3VBXA 2H9VA 4D0WA 2XK6A 2PZPA 5IA4A 4AFEA 1GAGA 2VRXA 3F61A 1WFCA 2C30A 3IDCA 3OBJA 3QTRA 1TVOA 3V5WA 3UOHA 1SVGA 5K4JA 2XEYA 1Y6BA 3TI1A 2JGZA 3O8PA 1URCA 4NZWB 5EYMA 3RNYA 5BYLA 3U54A 3IW5A 4RC3A 2UW3A 3CQWA 3MTLA 5FTOA 4CYJA 3QHRA 3KQ7A 3A4OX 5FGKA 1DM2A 4E26A 3DK3A 3KXGA 4O83A 4I94A 3I6WA 4P90A 4ZS0A 1W98A 5KMNA 3JY0A 3QRJA 5H8BA 5EKNA 3TDVA 4O7LA 2IPXA 4NJDA 1UA2A 4ZSGA 1OVEA 2YJSA 3NS9A 3UOKA 1YXXA 4AACA 3V5JA 3RKBA 3OEZA 4DH7A 5AA9A 2H6DA 3BHUA 3QHWA 4RVMA 4CV8A 2C0OA 5CYIA 3R7EA 2QLUA 3EN7A 2NPQA 3F5XA 3G0FA 3GCSA 3NNVA 4FKLA 3QCSA 4FTJA 5L8JA 2OXDA 4UXLA 2VTPA 5AV2A 4ACMA 4DBNA 2CNVA 3ZO2A 4BDAA 3KRWA 1J7UA 2YCQA 3GCVA 3FQSA 3HECA 3KRRA 4YUQA 3RPSA 2ZYBA 2W1HA 2V5QA 2WQNA 3OF0A 1ZYJA 5E91A 3UO6A 2FGIA 5ANDA 3OHTA 3RK5A 4HW7A 1G8SA 3NPCA 3JR1A 3N4VA 3G33A 3G6HA 4ITIA 4WO5A 3OROA 1U5QA 4D5HA 2PVKA 3H0YA 2VWYA 5M4FA 3VVHA 3PRIA 4R78A 1W8CA 4CFFA 5E7RA 4Y72A 4FKTA 2LGCA 3GU6A 4NWMA 3NLBA 5CU4A 3OTUA 3C9WA 4U5JA 1UVRA 2WU6A 2ZM3A 3QTQA 4XP0A 4TYIA 3F5PA 3F3ZA 2BFYA 3GP0A 4FIIA 4L67A 5DN3A 4CRLA 3N4TA 3POOA 3OFMA 2W17A 1YXVA 4YC8A 4CFWA 4F9AA 4R5YA 3QRTA 2H34A 2IVTA 3TT0A 2W5HA 4DEBA 4EH6A 3LJ1A 3SG8A 3BLAA 1AD5A 3PP0A 4EH7A 4M8TA 4NM7A 5DH3A 4BDKA 4ANMA 2FSLX 4XG8A 4CQEA 2IW9A 2RG6A 4BDCA 4O7ZA 1Q99A 5CXZA 4I92A 4JX3A 5BX0A 3MPAA 5I3OA 3MIYA 3DXPA 1TKIA 2BTSA 2CLXA 3R7VA 3W18A 4XG2A 2I40A 5M53A 4GCJA 3IGGA 4TKSA 5J5TA 5CZIA 1W2CA 3EFLA 3QUEA 4J8NA 4R7HA 3I79A 5GJFA 4ORKA 2BTRA 3O8UA 4L46A 4QNYA 4UALA 3VF9A 2A98A 3W2CA 4C7TA 4QMOA 4CGAA 2C6OA 3F3VA 5LWMA 4UZDA 5LVNA 4JIAA 4JDKA 5IUIA 3R8MA 3LFFA 3WIGA 3LOKA 3E3PA 5HE1A 3NIZA 4DLJA 1JNKA 3AC3A 3JUHA 5CX9A 2CN8A 2IEWA 3K5UA 4PV0A 4CG8A 4O84A 1K3AA 3R8UA 4DTKA 4JQ8A 2PVFA 4YJPA 3QZHA 5FG8A 4CFMA 1QPEA 3LFBA 1KWPA 4GW8A 2OIBA 1XH8A 4USFA 4C4HA 2PUNA 2OI4X 1ZYDA 2R3IA 3SOCA 4G17A 4WNMA 4DYMA 3QRKA 4C33A 1PXIA 2X7GA 3Q6UA 4F0IA 4HGEA 3R9OA 3EB0A 1R0PA 3R73A 5CF6A 5KKRC 2HY0A 3PZHA 5EI6A 3QTZA 3ZZWA 4YSJA 2OIQA 3NRMA 4RWJA 5IQFA 2R0UA 1PYEA 4I6BA 1ZARA 4YJSA 4NIFB 4XS2A 5AIRA 4USEA 4DN5A 2WMWA 2CMWA 2CNQA 1ZZ2A 3GU5A 4XLIA 3LFEA 5F95A 4GT3A 4TYHB 4NK9A 5FP6A 4RX5A 1X8BA 4JG8A 4MK0A 3OWLA 1REKA 4PP7A 2C3IB 2F9GA 4LUDA 4N6ZA 4GFMA 3A7IA 5E8SA 5IPJA 3OY1A 1FGKA 2C3JA 2BZHB 4D5KA 3MIAA 1J7LA 4M3QA 4FG8A 4FIJA 4OGRA 3R2YA 3DBEA 4LRKA 3UIXA 3ZRLA 5JGAA 3JVRA 4A9TA 4FOCA 2W7XA 4MF1A 3QUPA 3WE4A 1B6CB 3LFDA 4IMYA 4EOPA 5CEPA 5IDNA 3F2NA 5L8KA 4QP3A 3FLNC 2HW6A 4Y46A 3PRFA 2GHMA 3LW0A 3FI8A 3QKLA 4BCKA 4FV0A 2JLDA 5HCXA 2PZYA 3AC1A 2Z2WA 3DAKA 1OIRA 4EOQA 5CSXA 4H36A 5AP0A 4ZS4A 2J6MA 4IXPA 1P5EA 2C69A 2VTAA 3ATSA 5AV1A 4M67A 4V01A 2CPKE 2A4LA 5CI6A 3KVXA 1YHVA 2E2BA 1NA7A 4O0VA 4OTWA 4YPSA 2WHBA 3FMDA 3F2RA 3I5ZA 3ZUTA 5HU9A 2O65A 4RIYA 2B0QA 4GIHA 3P7AA 5JFSA 5JZJA 1GIIA 4JLCA 1OL2A 2EB2A 2C3KA 5AP4A 5AP2A 4YNEA 3CS9A 3VO3A 1QPJA 1R1WA 3WOWA 2YM7A 4K8AA 3UC4A 3W0MA 1K2PA 3DT1A 5TT7A 1SVHA 2QHNA 1M7NA 5F20A 2YM6A 5LCJA 4WOVA 1J1BA 1FPUA 3IS5A 4D2SA 4EOOA 1YDRE 2UVZA 2X4FA 4KSPA 1FVRA 4A07A 4QTEA 4IC7A 4PDSA 4D9TA 3MSSA 4BTMA 4CCBA 3PXFA 4H58A 5I9YA 4ZZNA 4CQGA 4OTRA 1H01A 4BJJB 3D7TA 3QC4A 1CKIA 3TZ9A 4FTIA 2E9OA 3Q60A 4FTNA 1O6YA 4XLVA 5HCZA 4K33A 4E93A 3AC8A 2X7OA 4X2FA 2PWLA 4GVAA 4NCTA 3SXSA 3DLZA 4IAKA 5A9UA 3QQGA 1FOTA 4EOKA 1OIYA 3ELJA 3ULIA 2IN6A 3WZJA 2JKQA 2O63A 3COIA 4PMMA 5L4QA 2VTRA 3V3VA 3ZHPC 3PPKA 4UWYA 3EIDA 4FKPA 4FTMA 4EONA 1PMNA 4F4PA 2JFLA 3QKMA 4MBJA 4EOMA 1KUTA 4OLIA 1A9UA 3P7BA 3RM6A 1FINA 3DQWA 2O0UA 2PL0A 3EFKA 3M2WA 3LFSA 3NEWA 2F7ZE 4U8ZA 5CSVA 4A06A 3KMMA 3K2LA 5CU0A 4CT1A 1GZNA 3TNQB 4ZTSA 3K5VA 5EW9A 4BWPA 5GINE 5HVJA 4I0SA 4AXAA 3UVRA 1OZ1A 4J99A 1U4DA 4GG5A 5AP6A 3RCDA 3RP9A 4JDHA 4U45A 5AUVA 3SRVB 4AZEA 3EH9A 1GIHA 3BLHA 3EOCA 4H3PA 3BGZA 4FSMA 3BGQA 3ORNA 4RC2A 3TNHA 4XG6A 5M06A 2R4BA 2EWAA 1IA9A 4ALWA 3TMOA 4QYYA 3KK9A 4L42A 3TV4A 2X4ZA 1Y57A 4GL9A 4S33A 3ZBFA 2XMYA 5BVDA 3LLAA 2RFNA 2Y9QA 3ORXA 4FL3A 5L2QA 3MPMA 4PPBA 3I0OA 3T3VA 3RCJA 1H1SA 4QPAA 3TCPA 2OJJA 4I4EA 4C59A 3QGWA 1VLRA 5JKGA 2R3GA 4D2VA 2WTIA 4A9YA 3W0QA 3RGFA 2B52A 2VU3A 4I5MA 5EK7A 3W2OA 5EI2A 3DK7A 4FNZA 2XNMA 1MRVA 3W0RA 4YBJA 2PTKA 3QZGA 3ZO3A 2C1AA 3D0EA 5LMKC 2WELA 3ENMA 2J5EA 2JBOA 4GU6A 3SKCA 5LQFA 4AXDA 3WZUA 3ML1A 3IGOA 3E7OA 5TO8A 2YWVA 3R9HA 1V0BA 4Z16A 3IW4A 4FV7A 3F3UA 3QL8A 3OG7A 1T45A 2V0DA 4IM0A 2Z60A 4M69B 5CY3A 5K0KA 3UDZA 4DHIB 4JJRA 4CG9A 3DKGA 2OZOA 5GIPE 3QU0A 4RJ5A 3RVGA 1PKGA 4DFYA 4LQMA 4FEQA 4BRXA 4UMRA 3QTIA 4DEIA 3KIOC 3QGYA 5EW8A 4RX8A 4FKIA 3F9NA 4RRVA 2XNBA 3I81A 3E87A 4ANSA 3SDJA 2B9HA 1P4OA 4EK6A 5CNNA 3GFWA 4MH7A 3PLAE 1F3MC 3PXKA 4OW8A 3FZRA 5A4EA 1QL6A 4BKYA 5CVFA 3ZMMA 2OZAA 1PF8A 3FUPA 4ACDA 3PG3A 2VGPA 4FK3A 3BIZA 4ZJVA 4ZSAA 5I9WA 2QOHA 2A0CX 4IAAA 4YBKA 4BI1A 3H30A 5KMIA 1DI9A 3F3TA 4KKHA 4F65A 2W1IA 2YAKA 5D41A 4CRSA 2UVXA 2ZV8A 1GY3A 2W4JA 3G2FA 2RKUA 3HEGA 1FGIA 1A06A 1HCKA 3MYGA 4FKJA 4KKEA 4IH8A 3BRBA 4LV7A 3DK6A 2WU7A 3LIJA 3D83A 4OTGA 1WBSA 4ZY5A 3VAPA 4EZ3A 3KK8A 2FYSA 2Z7LA 2PMOX 2XIZA 2OSCA 5AUUA 2UZLA 2X0GA 3E8CA 5HORA 3LMIA 1YOJA 2ONLA 1H00A 4RLKA 4O7VA 5AEPA 3QD2B 3O51A 4FG9A 4KINA 3UIMA 2XAMA 1H4LA 1Q8TA 2J90A 3B2TA 2CSNA 3KULA 4MBIA 4MD8E 4TWNA 1O9UA 5IA2A 4G6LA 4E4XA 4D1ZA 2ITPA 1XBCA 2Y6MA 4F0GA 4A4OA 4J1RA 2JC6A 3D4QA 1BLXA 3A7GA 3DBDA 3EYGA 4XNEA 4B8LA 3P0MA 4IDTA 5HEZA 3HVCA 4J7BA 4FIHA 4M13A 2WQBA 2YZAA 2YCSA 3PPZA 4FIEA 3R2BA 2CGVA 5HG5A 4FZ7A 3ZLWA 3WF8A 4PTCA 3OCBA 4FT0A 5ETAA 1U46A 2IVVA 4UY9A 2UVYA 2OJIA 2BAJA 4KS8A 5I9VA 4WNKA 3R01A 4XG7A 3TTJA 4F09A 4DG3E 4O7RA 5AWMA 4F08A 3M42A 3FYKX 4RIOA 3W8LA 5M4CA 5AX3A 2PE0A 3ETAA 4IEBA 5D1JA 2SRCA 3Q4CA 4BDFA 3RPRA 4L52A 4O1PA 4QPSA 5EYCA 3UDBA 3CQUA 3E8EA 3UPXA 2WPAA 1ND4A 4WNOA 4BZDA 5AAGA 3CKWA 2IW8A 3D2KA 3GEQA 4O22A 3MB6A 3WYYA 1KSWA 2CKOA 4DT8A 2Y4IB 4GKIA 4K77A 2XP2A 2GDOA 4FSZA 1ZXEA 3KN6A 4FT3A 4F1OA 4H39A 5CF5A 4CMUA 5I3RA 1NW1A 3JPVA 2V22A 2VWXA 5CSHA 4ANOA 2JAVA 5DYJA 4FKOA 4O0YA 5CF4A 1WBTA 3BWFA 4MNEB 1JOWB 3ZSHA 4KSQA 2JITA 4DEAA 3R1YA 4DT9A 5DR2A 1DI8A 1TQMA 2WEIA 1H08A 3G9LX 2QO7A 4K9YA 2E9UA 2YDKA 2I0HA 3C4EA 2OICA 5AADA 3OCSA 1EH4A 3FI2A 1F5QA 4KIKA 2RSVA 3DFAA 5C27A 2B1PA 2QI8A 1H0WA 5HG7A 1BI7A 3SHEA 4DC2A 2JKMA 5I5ZA 5DPVA 1KOBA 3R8ZA 3LXKA 2UZVA 4ZEGA 2C5NA 5A14A 3VS6A 3RZFA 3O5AA 5BNJA 1Y91A 2WMRA 5CVHA 3NAYA 2WXVA 4ERWA 3BYSA 5EQEA 5FQDC 4FOBA 3BBWA 2XIXA 4R6VA 4YJTA 2F7EE 4B9DA 3TTIA 4IX6A 3UZTA 5CENA 3RAKA 4QMWA 4RFZA 4AN3A 3DNDA 4IM2A 4ZK5A 3DB6A 4WT6A 2VD5A 4C4JA 5FEQA 3O7LD 4IWDA 3ZM4A 3ORIA 4KRDA 5FM2A 3V6SA 5KHWA 1S9JA 4E3CA 4C3PA 4PDYA 4RIXB 2C5OA 3RHXA 3BU3A 4O0RA 5KBRA 1UWHA 4DBXA 1WBNA 3DZOA 4GEOA 4P7EA 4PX6A 2WZJA 2XZSA 3PZEA 4NTTA 4PL4A 3UQCA 3MH2A 4YR8A 4Z9LA 3CP9A 4FUXA 4YZ9A 4F9YA 2JDTA 2BCJA 2J2IB 4GU9A 4D0XA 4G6OA 3R8VA 1W2DA 3FPQA 3DCVA 3CD3A 2JKKA 4JDIA 1M2RA 2R3HA 3FLQA 4K1BA 4MD9E 4PDPA 3HLLA 2QCSA 3Q53A 5EQYA 2NRYA 1JSUA 4G9RA 4L3PA 5KKRB 5DR6A 3W0SA 5C4KA 4BB4A 1B39A 2XK4A 3QQKA 5L2SA 3AKKA 4BTKA 2BZJA 2VAGA 2I1MA 4IJ9A 3FMNA 2YCFA 3TZMA 4QMNA