2O2UA

Crystal structure of human jnk3 complexed with n-(3-cyano-4,5,6,7-tetrahydro-1-benzothien-2-yl)-2-fluorobenzamide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
355
structure length
319
Chain Sequence
NQFYSVEVGDSTFTVLKRYQNLKPIGSGGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLAVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYHTIEEWKELIYKEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-(3-Cyano-4,5,6,7-tetrahydro-1-benzothien-2-yl)amides as potent, selective, inhibitors of JNK2 and JNK3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 10
total genus 105
structure length 319
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2o2uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2o2uA01
3ZFXA 4TWCA 4AZTA 4AW5A 2G01A 2B0QA 3FMJA 4XP2A 3RK7A 4IVAA 5IEXA 4PMMA 3PY3A 5I9WA 2C69A 3PXKA 4J8MA 4W4YA 3R7EA 3L8SA 4RWJA 5AEPA 4CRLA 2XRUA 1GZNA 4L9IA 2XK6A 3ALOA 4P5ZA 5HOAA 3W2OA 4TL0A 3PLAE 3MB6A 3O96A 4ENYA 1YDSE 4F7JA 4QO9A 3VUIA 2C6OA 3U87A 5KMIA 5C4LA 3EQHA 3VRYA 4CFUA 5ITAA 4ZTLA 3E92A 4UB7A 3HAMA 3FLZA 3R9HA 1KSWA 4NM3A 2VN9A 3MH3A 1ZYJA 4QYFA 5HNBA 5J1WA 2OLCA 4KA3A 1YI3A 3NPCA 4GG5A 4W4VA 4R3CA 4YJQA 3IGGA 2BKKA 2IJMA 4YJUA 3R00A 4FSTA 4IVCA 4M69A 1XBAA 4XLVA 3EB0A 2VRXA 3LAUA 1QL6A 3VUMA 1H08A 3ZUVA 4EC9A 3O51A 5LMBA 1ZRZA 1NY3A 5IEYA 2QOFA 4H1MA 5CX9A 3DBQA 4F09A 5EKOA 4S2ZA 4APCA 3W2SA 5CEKA 3P9JA 4WA9A 4ZSGA 4IFCA 1H27A 2JDOA 3QC9A 4F7NA 3KU2A 5DEWA 2VTMA 5DPVA 2WTJA 2GQSA 4KBCA 5EDQA 2I0YA 3OTVA 4RJ3A 5M09A 4KS8A 5BMSA 5IH6A 2IVUA 3GU8A 5GNKA 3P0MA 1JKTA 2UZLA 3N51A 4R5SA 3FC2A 2BDWA 1ZMVA 1B38A 2YLFA 3O7LB 2VTSA 2XK3A 4UYAA 3RAIA 3UIMA 4A9SA 4FYNA 3A7JA 4ZTNA 2YEXA 2BCJA 4DEHA 4RC4A 4CVAA 4YURA 3GCVA 2AC5A 3ZBXA 1OL7A 4I6BA 1KE6A 3H9FA 5EHOA 3W32A 3FXXA 1PXIA 3R1YA 4BICA 5BNJA 3ZSHA 1YXUA 2JFMA 4I22A 3KXGA 5CEIA 2JLDA 3A7GA 2XNGA 3DV3A 5AUVA 2VZ6A 3A99A 2OI4X 3A7IA 1PKDA 3KY2A 3R1SA 4KB8A 2QOKA 3DPKA 4TTHB 5E8WA 1K3AA 4YJPA 3HV5A 5AUUA 4KS7A 2XIZA 3LQ8A 4DINA 2W5AA 4FSQA 4FTCA 3OCSA 1QPJA 3MBLA 4O0SA 3VAPA 4ACDA 4HVDA 2RFSA 2WTKB 4I0TA 5AWMA 5FDXA 4TT7A 4FIEA 5TR6A 2W1FA 2WGJA 3JXWA 3S95A 4LG4A 4XOZA 2HOGA 3HDMA 5M06A 4OBOA 4BRXA 4CKRA 2I0EA 3P7CA 2QOIA 2WO6A 5DN3A 3ZH8A 4PX6A 4FZAB 4QMVA 4EK3A 4WT6A 4AZSA 4QP4A 4FK6A 3QTWA 2CJMA 4FKGA 3ZRMA 4FT0A 2EUFB 4FOCA 4B4LA 4EH6A 3HZTA 4LUDA 4MQ1A 1Y6BA 2QVSE 5HD4A 3IW8A 3D83A 4YHFA 2RG6A 3MPMA 2R3JA 2PWLA 3QRKA 2QOHA 5L2SA 4MD8E 5KZIA 4FKJA 3DXQA 4DCAA 2BZJA 3QD3A 3GCQA 4GG7A 4U97A 4FL2A 4U40A 4F6UA 2R3FA 4O96A 1ZZ2A 2J51A 2PSQA 4ASXA 3BHTA 4O86A 1J3HA 4IB3A 4AAAA 3D5XA 3A62A 5KNJA 3MPAA 4O82A 3PA4A 4IMYA 3JVSA 2Z7SA 3NRMA 4D4VA 4NK9A 4WHZA 3VS7A 3C4FA 4LOOA 2A27A 1LEWA 2FUMA 4W9XA 3ORKA 3GU7A 2VUWA 5DFPA 4PP7A 4NYEA 2OXXA 3MY0A 4KKGA 4RIWB 3TZ8A 3KA0A 3AT3A 2W1HA 1OB3A 4F1OA 4PP9A 2UW3A 4QYHA 4M0YA 5IG1A 1XR1A 4TXCA 3EN4A 1Z9XA 2HENA 3RAWA 5EI2A 3GGFA 3V8WA 5T6KA 3R71A 5HU9A 2QQ7A 2ETKA 5GZ9A 2JAVA 1YVJA 2VWYA 3RZBA 5J79A 3MFRA 3BCEA 2OWBA 4UXQA 4MTAA 1H28A 3KRJA 3D94A 3DXNA 3P78A 2VO6A 3ZBFA 1SNXA 3CBLA 3PJ3A 5HHWA 4YPDA 1Q5KA 5ANDA 4IBMA 4C3FA 2BKZA 3G0FA 5CQWA 4AUAA 1DS5A 4YTFA 3HRFA 1GIIA 1GZ8A 1YI4A 2C30A 1Q99A 2V7OA 3CY3A 2GS7A 3EZVA 4EH9A 5C8NA 5JKGA 4WOVA 4XCUA 4BB4A 5HG9A 4YNOA 3PJCA 4Q5EA 4BKYA 3DJ7A 3KQ7A 3PJ8A 4XG8A 4FA2A 3LW0A 3PVGA 4FV1A 3ODZX 2YJSA 1J7IA 5FUTA 3VN9A 2GNHA 3BGPA 3DCVA 4X6RA 2V22A 5CF4A 4Q2AA 3L1SA 4BCOA 4QQ5A 4ZMFA 4M12A 2ZAZA 4L42A 4K18A 5M53A 5IQFA 2PPQA 3C1XA 3DGKA 3DZQA 4U45A 4MXCA 2YITA 3R02A 4DG2E 4EJ7A 3ANQA 5EW8A 4D2TA 3R2BA 4K9YA 4P5QA 5CSHA 4CV8A 5IZFA 2X39A 3A2CA 5DRBA 4DFLA 1FGIA 2E9UA 2J5EA 4J7BA 3F3TA 4YR8A 3EQPA 3AD4A 4PDYA 3IQ7A 4Y73A 3MVMA 4RJ5A 3UQFA 4MNFA 3DA6A 2X0GA 1TVOA 2IW6A 5A46A 4HPUE 5ETIA 3Q52A 3GCUA 4C2WA 4UX9A 2AYPA 3RVGA 4ACGA 5H8GA 4YLJA 4ENXA 4PMPA 5L8JA 3DKFA 1UNLA 4X6QC 4YC6A 4YTCA 3GU4A 2ONLA 1F0QA 2B7AA 2XS0A 3VS5A 4DC2A 1YQJA 4BTFA 4E5BA 4FOBA 3GT8A 4IZ7A 5CEQA 3Q2MA 3ZCLA 3NNVA 3BV2A 3FZSA 1T46A 2OJ9A 3NIEA 4V01A 3UZRA 4MXZA 4JI9A 3BYOA 3ZEWA 4PTCA 3CY2A 4KRCA 3MFTA 4D2WA 2UZBA 3FUPA 5B0XA 4YGAA 2CDZA 2P2HA 3UNJA 5FEDA 5D7AA 4PNIA 4OTHA 1FPUA 3DK6A 4NSTA 3OCBA 4M69B 4O0RA 3BHVA 1REKA 4BZOA 4OTWA 1OI9A 3QGWA 4FKOA 2X7GA 4MQ2A 4X2NA 2PK9A 3KFAA 4X21A 1YOLA 1JQHA 2WQEA 3F88A 4F9YA 4OLIA 4LOPA 5I3OA 4FKSA 2ESMA 3H0ZA 3DNEA 2GSFA 5DH3A 3E88A 1NVQA 4CQGA 1ZMUA 4FEQA 3RK5A 1J7UA 2UV2A 5M4UA 2PVYA 5FGKA 4ALVA 4GJ2A 1FOTA 4HYSA 1ZAOA 4GSBA 2P33A 2ETMA 4LMUA 3V3VA 4FKQA 4N6ZA 4FNXA 3IDCA 3DK7A 2XBAA 4EQMA 2YDJA 3QTQA 4I23A 4XP3A 5HCYA 4AGUA 1WAKA 3PXFA 4NKAA 4PWNA 1Z57A 4AW1A 2WEVA 4C37A 3L8VA 2WMWA 1TKIA 3RPYA 3EL7A 2XF0A 3WIGA 2R3NA 3KKVA 2C5NA 2E9NA 2F2CB 1YHSA 3FHIA 3BU6A 4GS6A 4Y72A 3S00A 3PWYA 3R8MA 2R3MA 4MEDA 5IQCA 2XCHA 4FICA 5JQ5A 1SVHA 2VTHA 3A4OX 2W5BA 4U42A 5HVKA 4JG6A 5J9YA 2PE2A 4DTBA 3E8EA 2IO6A 5JMSA 3EKNA 4IAIA 3M1SA 4V0GB 3EN6A 4XV2A 2CSNA 1UU9A 2X1NA 1YOMA 3MVLA 4DE4A 4EHZA 1UKHA 2ZV7A 4QMWA 5FDPA 4O83A 3GC7A 3RM6A 4O7ZA 4D1ZA 4PY1A 4IH8A 2WQOA 4DFZE 4O7YA 1WMKA 1PXKA 1YXTA 4D2RA 4YNEA 2F2UA 4JXFA 3E8DA 1PY5A 2XK9A 4MXAA 2ZJWA 1VYZA 1KE7A 3FV8A 3ORLA 2BAJA 3PE2A 2OZOA 5IISA 5CAVA 3PG1A 3DFAA 4I93A 4HCUA 3CQWA 4U81A 3KXXA 5G6VA 5IUHA 1SZMA 1PYXA 1Y8YA 2QODA 4QP1A 3SX9A 4E6DA 1GNGA 3BV3A 4NW6A 3BPRA 3MSSA 1A48A 3SW4A 2XIYA 3GQLA 3MS9A 4FNWA 4GYGA 5CAUA 3LJ1A 1WBWA 1KV1A 2VNWA 4FG7A 3R8VA 4YJTA 3G2FA 5DT0A 4CLJA 5EQEA 2PE1A 4BR3A 2O64A 4G3FA 4JR3A 2OF2A 4MCVA 1MQ4A 3VUTA 3O23A 4AA4A 3RCJA 3Q2JA 5A4LA 3PSCA 5B7VA 3HAVA 1E1VA 4U5JA 3OY1A 2VTPA 4K8AA 4L00A 3NEWA 1UNGA 2Q0BA 3R1NA 5JGBA 4KIKB 3RZFA 3OXTA 4CEGA 4EK8A 4EK5A 4BCGA 4MKCA 3IW4A 2VWVA 3VBXA 3D4QA 3NUSA 4S30A 5K5NA 1G5SA 4F9BA 5AP0A 3PPJA 5GZAA 4LUEA 2VTTA 3OWPA 4RIYB 5AIKA 3V51A 4OR5A 5AP6A 3C13A 4AW2A 3BZ3A 1FINA 2YERA 3EWHA 1R0EA 3UO4A 2HXLA 2HIWA 4I5MA 3W55A 4J97A 2X4FA 5CF5A 5IA0A 4QYGA 1J1CA 2QHNA 3FL4A 2V55A 2VTOA 3KN6A 4F64A 4F99A 4Z16A 3EJ1A 3Q6WA 1WVXA 4CFMA 4YBKA 2C3KA 3D15A 4AZFA 4IM3A 4USEA 4FEVA 2GU8A 1FMOE 4FX3A 5HKMA 3RWPA 5JT2A 3VQUA 5E8YA 1OGUA 4R7IA 2DS1A 3GCPA 4ZTRA 4FZ7A 2NRYA 3QALE 5IH5A 1PW2A 4AA5A 3KMMA 4NWMA 2BR1A 3NAYA 4ALWA 2QO7A 2PMOX 3VS3A 2WOTA 2ZMCA 4JDKA 3QX2A 3HNGA 1IRKA 3MH1A 5I9XA 3ENMA 3HX4A 4G6OA 2YACA 4IACA 4UMQA 3OP5A 3QHRA 4R5YA 3Q4UA 1YW2A 2JD5A 2J6MA 2YWPA 3VBQA 5CSWA 3UBDA 4GCJA 4D58A 4R78A 4BI2A 4YJRA 4AU8A 5DMZA 4O2ZA 2Y6OA 4CFVA 4UWBA 1YWRA 4M15A 2R0UA 3FLNC 1OL1A 4QMUA 4E93A 3ZO4A 3GI3A 1H1QA 3V04A 4RWLA 3G33A 4TWPA 3RJCA 3V5PA 3W2RA 1U46A 5LVMA 3BEAA 3O2MA 5A4EA 3WZUA 4QPAA 5EM5A 2W17A 4ZLZA 2WTKC 4CSVA 3CKXA 5FTQA 3DFCB 2UZUE 2XNMA 3ENHA 2R3RA 3FJQE 3TI1A 2G1TA 4TW9A 4C34A 3HEGA 4TYHA 2OXDA 4YC8A 5KCVA 3CEKA 1BL7A 1ZY4A 1BL6A 3PVBA 4PUZA 4FV2A 4Y46A 1CKIA 1OIRA 3CTHA 2V62A 5BUJA 4IHPA 3PVUA 1J91A 4A9TA 1W98A 4APPA 5IA2A 3CP9A 1PXPA 4BDHA 4C8BA 4EQCA 3BLQA 5A6NA 4IJ9A 4FODA 4L67A 5D12A 3O8PA 2HWPA 3ZU7A 1UNHA 4NW5A 4BGQA 3JS2A 4ZLYA 3VS0A 2ITTA 1XHAA 3E8NA 5J5SA 4JLCA 3F82A 3OEZA 4IJPA 3I7CA 2WXVA 3I7BA 4K33A 2BFYA 4KSPA 4QQCA 4B8LA 5DHJA 1REJA 3QBNA 4I5HA 2OF4A 3ZZEA 2PZRA 4RA4A 3QTIA 3QA8A 4EK4A 2UZVA 3MJ2A 3IO7A 3COMA 3PZHA 3BRBA 3R7GA 5I3RA 3II5A 2QCSA 4YHTA 1KOAA 1PMNA 1M2RA 2CN8A 4RLKA 4UBAA 1K9AA 2J2IB 3FLWA 4YJVA 5E8VA 2B55A 5D41A 4BCIA 4FNZA 1JNKA 1ZLTA 4EH8A 5KBRA 3ZDUA 4USFA 4PQNA 5EOLA 2B9JA 3IS5A 3DZOA 5HD7A 4ANOA 4DN5A 5T68A 1L8TA 4FSNA 4N57A 4DBNA 1CM8A 5CSXA 3KRXA 4YSJA 1TQMA 5C4KA 5BX0A 5EDRA 2W05A 4KNBA 3ZSGA 4C4IA 1Q41A 3BYVA 4QT1A 3PLSA 3QU0A 2O0UA 1BKXA 3NX8A 3VO3A 4U41A 4ANBA 3QYZA 3R63A 5EM7A 2XKCA 5HE0A 2I6LA 2BDFA 3D5VA 3ZFMA 3V5QA 3QKMA 3BI6A 3HA8A 3TTIA 3IW6A 3HMIA 2XBJA 4ERKA 1OIUA 2F7ZE 4AT3A 3RNIA 5AJQA 5TE0A 4JAJA 3GXLA 4IDTA 3QLFA 4CFNA 3ZC5A 5GJDA 4GEOA 4A4XA 4ZEGA 3FMNA 5CNOA 4BCMA 2OK1A 4C58A 4ZY4A 2X2MA 4YTHA 5KKRB 4C38A 3AC1A 5LOHA 3FBVA 3FL5A 4E3CA 3R7VA 4NZWB 1WCCA 1XJDA 2RL5A 2ZDUA 1STCE 3NCGA 2OFUA 3A4PA 4QTDA 4WKQA 4M3QA 4YHJA 1G8SA 3LFSA 1RQQA 5IUIA 3RPOA 1U59A 2C6LA 4PL4A 4PPCA 4I0SA 3NUPA 5JFWA 2BZKB 4LI5A 3MN3A 3VQHA 2XNPA 2G2IA 3UC4A 2B9HA 3UIBA 3MPTA 2X2LA 2PVNA 3BGZA 3GFEA 3F5PA 1A06A 3EYHA 4I0RA 3P7BA 4DITA 4MF0A 5IA3A 2XCKA 2QOLA 4BDJA 4FV5A 3QTSA 5CXHA 3E3BX 1W8CA 4BCHA 2JC6A 5E8ZA 4HVSA 4OTFA 3E7OA 3SQQA 4QPSA 2XNNA 1WFCA 2UZWE 4QMNA 3A7FA 1H1PA 2XVDA 1U54B 4EEVA 5EM8A 2BAKA 3NCZA 1UWHA 4S34A 4WBOA 4RWIA 3BHUA 4ACMA 5HICA 4C4GA 1ZOHA 4KKEA 4WSYA 1O6LA 2IVVA 1I44A 3MDYA 5DIAA 1Q8WA 4ANLA 3UJGA 4TYHB 3Q53A 4X3JA 5CLPA 5D7VA 3R83A 4F1TA 3VF9A 2WTIA 5K5XA 4JRNA 4Y5HA 3FMEA 2B9IA 4MBIA 1Y57A 4ZIMA 4YLKA 4DCEA 4KSQA 4MD7E 2OH4A 2G9XA 2PTKA 1XO2B 3AMBA 4XMOA 3UO5A 4AZEA 3PY1A 4AOJA 1ZYSA 5JSMA 2QO2A 2R3PA 4WD5A 3MW1A 3C9WA 5C01A 3CLYA 4FTQA 3FSKA 4R1VA 5IQDA 3HMPA 5M07A 4XS2A 4IW0A 4PMSA 5HORA 3CJFA 1U54A 2WFYA 1H00A 1M2QA 1V0PA 1OZ1A 4Y85A 5CU3A 5KZ0A 4ZZNA 4U43A 4XUFA 5LVNA 2YJRA 5HU3A 2ITPA 3FKNA 3RNYA 4D1SA 4I94A 3KF7A 4FV0A 1OITA 4DGGA 3UVPA 3H9OA 3EFLA 3HRCA 3EN5A 5F20A 3QFVA 5BYYA 4IZYA 5CS6A 5CU6A 4I3ZA 5J87A 4YJOA 3OBJA 1GIJA 1PMUA 5DNRA 2FYSA 2O3PA 5CSVA 2WMTA 5J8IA 3UYSA 3NVMB 2GQGA 2QURA 2PVFA 3AC3A 4QMTA 5HE2A 1KE9A 2BDJA 2CMWA 2WD1A 3NUYA 4GT3A 4MXOA 5AX9A 3QZGA 2E2BA 3QTZA 4WG3A 4EQUA 3WE4A 4R7BA 3ORTA 4JG7A 4G3CA 4HGLA 5CEPA 2QI8A 3AT4A 3T8OA 3BHHA 3MIYA 5CT7A 2XNEA 4AE6A 4UV0A 4PNKA 5GJFA 1OL6A 3NDMA 3EKKA 3FPMA 4FTIA 4BC6A 3P23A 4NIFA 4CTBA 3VUGA 4BCKA 4FC0A 1UVRA 4YPSA 1PXLA 5BVFA 3KVXA 4FT7A 1IR3A 4OTRA 4YZBA 5DRDA 4EOLA 2W96B 4EOQA 5DWRA 2PZ5A 4JIKA 4UZHA 3OZ6A 3DBDA 2JIUA 5CEMA 3EHAA 3ID6C 4H05A 2JKKA 3D7TA 3T9TA 3H0YA 2PU8A 5AP5A 3K5VA 3IOKA 4RMZA 4C02A 2I7QA 3CQUA 2BIYA 3DQXA 5G1XA 3IPHA 4FTJA 3UG2A 4HVHA 1S9JA 3PRIA 3LE6A 5ETAA 4DFYA 4GKIA 3EQBA 2WTCA 2Y6MA 4FI1A 4JOAA 5FD2A 3WYYA 5JGAA 4YZ9A 2HW6A 2IG7A 5AFVA 1G3NA 3W18A 2BMCA 3L9PA 5HEZA 2ITNA 4JBPA 3SXRA 5E7RA 3CC6A 4CZTA 5H8EA 3OF0A 1Q97A 3GC8A 3PVWA 4QMOA 3MYGA 2I1MA 4RX8A 3ZRLA 5JEBA 1ZARA 5IMXA 2BHHA 4M8TA 2HZ4A 4EBWA 2YAKA 2UW5A 2W4KA 1UWJA 2IZUA 3G51A 3HKOA 2PZPA 4LRKA 2CNQA 4HCTA 3BYSA 3CS9A 5F95A 3CKWA 3SDJA 1PKGA 3Q5ZA 2X9EA 3BYMA 2WMXA 3KC3A 1TQIA 3MVHA 4OGRA 5DBXA 4EJNA 4ITIA 2WIPA 4NU1A 1OUKA 3ETAA 4U79A 3V8SA 3CJGA 5HQ0A 3QTRA 3OHTA 4FT5A 1ZWSA 2XKDA 4FSWA 2BPMA 2ZOQA 2AUHA 5FM2A 4AGCA 2XKFA 4WG4A 4E73A 3OCGA 3WYXA 4A4OA 3SD0A 4F1MA 4I4FA 3F7ZA 3WARA 3LCTA 3U6IA 5IQGA 3ET7A 5FWKK 4CG8A 5E8UA 4LGDA 5IQEA 3ROYA 1U4DA 5J7BA 3LCKA 3UIXA 4I6FA 4CNHA 4ZSAA 4P2KA 4G34A 3BE9A 4WRGA 4KKHA 3QL8A 2C0TA 2C0IA 2W1CA 3GFWA 3QRJA 3QZFA 3THBA 2W1IA 4BDCA 4DAWA 1CSNA 5AP7A 3ORPA 4RQVA 1WBOA 5LVLA 3H9RA 3KULA 1OVEA 4FIGA 5AR3A 4FV8A 3O17A 4JG8A 4PV0A 4TY1A 2QO9A 3QXPA 3COHA 4FF8A 3UVQA 4DH3A 4Z3VA 3NYXA 2JFLA 2UVZA 4O2PA 2GFSA 3OOMA 4WNMA 3CR0A 1H0VA 3C0GA 4M66A 3R7IA 2XP2A 3FI2A 4E8AA 2WQMA 5JFSA 2NNWB 4BTJA 3HP5A 4CFFA 3QYWA 3P79A 4RRVA 4BDEA 2YM5A 3SLSA 3IW7A 3KRRA 3KF4A 2QOCA 4CQEA 4IX4A 4O1PA 4XG6A 5EM6A 4KINA 3VS6A 5LCKA 4ACHA 2NO3A 5EOBA 1UU7A 4K77A 2X8EA 3B2WA 2OIBA 4X0MA 4D1XA 4RJ6A 5FXQA 3DDQA 2CGVA 4ASEA 5AMNA 4E4LA 4XYFA 4JAIA 2BTSA 2FO0A 3PE1A 5BYZA 3ZSIA 1WBNA 4NH1A 3IONA 4PL5A 3OCTA 1FMKA 4O91A 4W4WA 5HX6A 2WQNA 2O2UA 4CV9A 3FI3A 4N6YA 4MNEB 1FQ1B 3TDWA 4Z7GA 4YTIA 4FK3A 4O7NA 2PUNA 1U5QA 2P0CA 2GMXA 5M4CA 1OBGA 4ZSLA 1FVTA 5EKNA 2YCRA 2W1EA 4FMQA 3VNTA 4BDDA 2P4IA 3DAEA 4M7IA 1IEPA 4KABA 1YHVA 1YRPA 3E3PA 4KIQA 4UALA 2AC3A 4GV1A 4BY9E 2B53A 3LQ3A 1YDRE 4BFMA 1P14A 4CMUA 2CKQA 4FV4A 1FBNA 2R4BA 3DOGA 3BLRA 3VJNA 5HLPA 4TWNA 3OWKA 3C50A 3RPRA 5HNIX 2VWXA 3LMGA 3E93A 5EH0A 3B2TA 4JJRA 3RMFA 3TIYA 4BDAA 3BWJA 4YU2A 5CEOA 4NJDA 2FGIA 1TQPA 2RGPA 5L2WA 3ULIA 1RW8A 5HTBA 1LEZA 3NSZA 4FKRA 4S33A 2GPHA 1ZYLA 4C7TA 2VTQA 2WZJA 4RJ4A 2ZM4A 3WZDA 3WF7A 2JAMA 1R3CA 3O7LD 5F1ZA 3SAYA 1LR4A 4E4MA 4IAZA 5JH6A 3Q9YA 4XV3A 1MRYA 3G6HA 3UO6A 2IZRA 4GVAA 3S3IA 4EOJA 4FNYA 3V01A 3FLYA 3UMWA 4CZYB 4DA5A 4EL9A 3LLTA 3QQLA 4ZTSA 4YO4A 2YCFA 1URCA 4Y5QA 4D4YA 3WZEA 2X6EA 3Q4CA 4O7TA 2QOOA 1X8BA 2J0MB 3ZC6A 4EH4A 4EYMA 4IVBA 4ORKA 3ZMMA 3CPBA 3FMKA 4R3RA 1J1BA 2EB3A 5C8MA 3QD2B 2PULA 3HV3A 2UUEA 4FKVA 4GFGA 5IA1A 3LQ5A 4J53A 4CGAA 3TT0A 3OFMA 4RFZA 5BYLA 4BDGA 5BVNA 2QR7A 4BBMA 4AWIA 2PUIA 4G3GA 3DK3A 4V04A 5FEQA 5BMMA 2R3IA 2VX1A 4CKIA 5IU2A 2HZ0A 2Y4PA 3KMWA 4NM0A 3SKCA 3W8QA 5KMJA 5CF8A 2JDSA 2VWUA 2FSOX 3VJOA 3WIKA 2CPKE 4JDHA 2LAVA 3VULA 5BVWA 3EQFA 2VWIA 2PZIA 1BI8A 2BRMA 2X81A 4EOOA 4BIDA 1H8FA 3HLLA 5HG5A 3VBYA 4ARKA 4J8NA 2B4SB 5BVEA 4FTTA 4MYGA 1WBVA 4LV5A 4MAOA 4XV1A 2JBPA 2GNGA 2YIXA 1PXOA 3F5UA 4NKSA 3TCPA 4ASZA 5IH4A 2Z7RA 3PDTA 1Q3DA 2GTMA 3KRLA 4O21A 5CI7A 4LGGA 1L3RE 4HPTE 4L46A 1Q24A 5HZNA 5H2UA 4GL9A 1JAMA 1V0OA 4M13A 3FPQA 2A4LA 4W4XA 4BDKA 2VWBA 3FZ1A 4DH5A 1JKSA 1ZZLA 4H3QA 2JITA 5L6WL 4FT3A 4XH6A 5CT0A 4QPMA 1YOJA 1LUFA 1Q8TA 3GP0A 3VF8A 4FVQA 3I0QA 4KBAA 3WZJA 4Y83A 5D9HA 4YUQA 4E7WA 4QTAA 3OC1A 2Q83A 4K1BA 2CLQA 1PMEA 3ERKA 1PHKA 2UZOA 2CHLA 3QRIA 4N0SA 4QMZA 4RFYA 2CN5A 2ZM3A 3Q4TA 4AN2A 2XEZA 5I9VA 5HLNA 4PTGA 2JDVA 4O0XA 2C5OA 2G2HA 2ITQA 3OT3A 2C3JA 4DEIA 4WUNA 2SRCA 3VS1A 3TG1A 3KXMA 4E4NA 4FTLA 4F70A 2P3GX 5CZHA 5BVOA 3KREA 3A61A 3TNWA 4IXPA 3NNUA 3NAXA 4E5AX 2XJ2A 3F2AA 3PY0A 2Z02A 5A54A 5FTGA 1JWHA 2Y4IC 3FEGA 3CGFA 3Q4ZA 2R7BA 1YKRA 4O6EA 4XNEA 5FLFA 4EWHA 1ND4A 4H1JA 3QHWA 1OL5A 4O7SA 3F3VA 4AZWA 1IA9A 4XRJA 1I09A 4EK6A 3UNKA 4RG0A 3M2WA 5AAGA 3JYAA 4S32A 4LFIA 4DEEA 3UTOA 5A9UA 4YZMA 5CXZA 4CMTA 1SVGA 1IASA 4L52A 1FGKA 2WHBA 3C0IA 4GMYA 4AFEA 4BWKA 2PYWA 3PTGA 2C6IA 4EOSA 5AAEA 5K4IA 4G9RA 4RX9A 4E26A 1DM2A 1OKYA 3PXQA 3QZIA 4DG3E 4IDVA 4UMPA 3TM0A 3GOKA 4FIJA 1JBPE 4ZK5A 5KMMA 4ZTMA 4O6LA 1APME 3U9CA 3IOPA 3QLGA 5LWNA 3N4TA 2JGZA 3PWDA 4E6CA 4FEXA 2VTLA 4I4EA 3NNXA 3QGYA 2CKPA 1PRYA 3I5ZA 2W4OA 1CTPE 4ID7A 2EWAA 4ZJJA 3NW5A 4JDJA 4JQ7A 4NM7A 2PHKA 4J95A 4L68A 3UOHA 1T45A 3D5WA 4F9AA 4O7RA 5D10A 2YM3A 3UG1A 2X6DA 2ITVA 4BCQA 1XKKA 2WAJA 4CZUA 4DEBA 3C7QA 5H8BA 4ZY6A 4Q9SA 3UVRA 4KUJA 1SVEA 2WKMA 3ZLWA 3ZYAA 4ANMA 5TOZA 3CTQA 5DLSA 1JOWB 3ZUUA 3R28A 4O38A 5CENA 1E9HA 4O7VA 3TUDA 3QQGA 3OEFX 3QTUA 4NJ3A 3CSVA 4JVGA 4PDSA 4F6SA 4AGWA 5L6PA 3DS6A 2QKRA 5K0XA 1MRVA 2GDOA 2YABA 2UW7A 3EQDA 4ZS4A 5CU0A 3FKLA 3QD4A 4FKUA 3HUBA 2YN8A 4D0WA 2PZYA 5GIPE 3W2QA 4D0XA 4QRCA 3VW8A 4L45A 2R0IA 4GK4A 4AACA 4H3BA 3UOJA 1OMWA 4B0GA 4FZ6A 4EH2A 2ZV2A 3N4UA 3QCXA 2C47A 3R9DA 3SA0A 4DBXA 3EFKA 2XK8A 4J1RA 4QMLA 4F65A 4BIBA 3CPCA 4ZZOA 4ACCA 5LQFA 3ORNA 4C4EA 3JY0A 1BI7A 4OTDA 4CMOA 4A07A 3MJ1A 1H1SA 5LXMA 2YAAA 4FV7A 2OJIA 3VUHA 3VS2A 2PY3A 4AE9A 3HYHA 4M0ZA 3U4UA 1XBBA 3IDBA 4ZJIA 2PVMA 2WTDA 5JQ8A 2X8IA 2CGWA 3MVJA 3ZZWA 3KK9A 3ZUTA 1Q61A 4FT9A 4G17A 5L2IA 1SMHA 4QYYA 3K2LA 3FYJX 3V8TA 2W0JA 3LM5A 4UWYA 4B7TA 5EDPA 3H4JA 4QMMA 4O0VA 2WOUA 3LVPA 4DGNA 2V7AA 3RPVA 3TNPC 3VBTA 3S0OA 3U54A 1MRUA 2F7XE 1O9UA 3PRFA 4IIRA 4UWCA 3W1FA 4IX5A 4RJ8A 4A06A 3QWJA 5F94A 4FSZA 4CKJA 4HZRA 4EHEA 3OMVA 2WELA 2BVAA 3A60A 3NUUA 5DT4A 5H3QA 5I0BA 3DTWA 1OUYA 3F5XA 3FKOA 3C4EA 3NIZA 5AP2A 3QQHA 2BRNA 4CXAA 3B8QA 3FYKX 1IAHA 4U3YA 2XJ0A 5J7HA 3QRUA 1OPKA 4C4FA 3LXPA 4BBFA 1GJOA 2VV9A 3OUNB 3LIJA 5AUYA 4A4LA 2C3LA 3AT2A 3V6RA 3ZONA 3E5AA 4AXAA 2YIQA 4FVRA 3AC8A 3HV7A 1JSTA 4BKZA 3WE8A 3ORXA 1XBCA 4TRLA 1JKLA 4X2JA 3TJCA 3AD5A 3UPZA 4QP6A 3G9NA 5FM3A 5L8LA 4IAAA 4DF3A 4MWIA 3PP1A 5IQHA 3I0OA 4NCTA 2B52A 2QOQA 4ITJA 4UY9A 3HMMA 4L8MA 2QLUA 4JQ8A 3SHEA 1F5QA 3GEQA 4GFMA 5L6OA 3GNIB 1HCKA 4O27B 3ZOSA 4E4XA 2J0JA 1R78A 2ZB0A 4ITHA 4YLLA 5GINE 3DAKA 1NVRA 3Q60A 3F3ZA 3FQHA 5EW3A 4QYEA 4G31A 4DTAA 2HZIA 1HCLA 3RM7A 3A7HA 3KK8A 4B99A 2FSLX 4EOPA 4ZY5A 3W2CA 4U80A 5DEYA 2O5KA 2VTIA 4RJ7A 4A7CA 2PL0A 2H9VA 3U51A 3SRVB 2XUUA 1WVWA 3L9LA 4G9CA 3CE3A 1PXNA 2IN6A 4IANA 2UW6A 4KD1A 5IUGA 3IK3A 4X2FA 3R2YA 4BCNA 4WNKA 1JLUE 3I6UA 1OIYA 2DUVA 2ITXA 3I6WA 4YJSA 2Y9QA 3KULB 4RIXB 4BGGA 4RIWA 2OIDA 3HRBA 4JX3A 4MD9E 4IC8A 3D2IA 3RINA 2YDIA 3AC5A 4FTNA 3RALA 4MHAA 5C9CA 2J9MA 4FVPA 2IZSA 4TN6A 5KMOA 5C8KA 2EVAA 4I6QA 2C6DA 2QR8A 2W1GA 4G5PA 4R6VA 4YBJA 4E6QA 2OGVA 4KIOA 2BROA 3DJ5A 4HCVA 3SG9A 4WRSA 5M57A 4OAUC 2VGOA 2DWBA 4X3FA 3R0TA 4JBQA 1DAYA 3BU3A 1NA7A 3QAME 2VO3A 3V5JA 3ZTXA 4CRSA 4X2GA 1OM1A 3M11A 3UQGA 5TO8A 1ZOGA 2X7FA 3QKKA 1IAJA 3F2RA 3D14A 4DH8A 1KV2A 4A9YA 4DT9A 2C0OA 5IPJA 1PMVA 1Q4LA 5HE3A 3O0GA 2ZMDA 5C1QB 1Z5MA 1R39A 1WBSA 2VNYA 4XP0A 2R9SA 5C27A 3D5UA 3KEXA 3VBVA 5KHWA 1VJYA 4AT5A 4IZ5A 4XG3A 3LFNA 3F61A 3PIYA 2C5XA 5IF1A 4I1ZA 4DEAA 3MY5A 3W2PA 3NW7A 3UZPA 5CQUA 2J0KA 4JBOA 3QCQA 5JFXA 5M55A 2YIYA 4IE9A 2QG7A 3H10A 2VX3A 3QXOA 2ITZA 4L44A 2OJFE 2UZEA 1UU3A 1GAGA 3P7AA 1ATPE 5CZIA 5AV4A 3HP2A 5GHVA 2O63A 2OFVA 4N70A 2UZNA 1GZKA 2I0HA 3A8XA 2NP8A 2HY81 3MGYA 5DOSA 1RE8A 2O8YA 4FEUA 4OT5A 3RTPA 4BWPA 5M08A 4LL0A 1Q3WA 1IA8A 1WBTA 4EHGA 3CGOA 5CF6A 4TYJA 3LFQA 3N9XA 5CI6A 2FSMX 2BZIB 3FZRA 4FL1A 4EZ5A 3ALNA 1AQ1A 2CNVA 4LMNA 4G2FA 4DFXE 3ORIA 3ZLSA 3ZDIA 3AD6A 4FBXA 3KB7A 4PTEA 2HW7A 4TNBA 3L9NA 3GCSA 3OW4A 3Q9XA 4RC2A 1OECA 3TV7A 3VHEA 3WF6A 4OTQA 5AUWA 1M17A 3PZEA 4I5PA 4ZMEA 4WSQA 2YA9A 3ZRKA 2WTVA 1GZOA 5CU2A 4YO6A 3GOPA 4BCJA 2RSVA 1XH8A 3DKCA 4C57A 5HBEA 4B8MA 4EKKA 3Q32A 3EQGA 3GU6A 2EXCX 4B9DA 4YMJA 3PFQA 5CALA 4MVFA 3EMGA 5BPYA 4OBQA 3EOCA 4GK3A 2XM9A 3LZBA 4XG2A 2R3QA 5AR7A 3UQCA 2YISA 1SNUA 3DY7A 3PXYA 4AOIA 3MWUA 3KL8A 3DB8A 4XG4A 5BVKA 4IQ6A 1H07A 5D1JA 2RF9A 2C1AA 2CCHA 2PMIA 3TWJA 2VWZA 3FI4A 3P1AA 4FKLA 4HYHA 4FTOA 5IA4A 3PIZA 2IW9A 5HBJA 2VX0A 4LRJA 5M44A 3AMYA 2PMLX 4NL0A 3FMLA 1Y6AA 3IW5A 3MA6A 2B1PA 5FQDC 4GUBA 4DYMA 4F08A 3QRTA 3FY0A 2IW8A 3UPXA 3VHKA 3GC0A 4C2VA 3HL7A 4G6LA 3UDBA 4MBLA 3UIUA 3PYYA 4OUCA 2R5TA 5JN2A 1FVRA 3G15A 4UZDA 1LP4A 4TKSA 3OD6X 5ANJA 1AGWA 3DQWA 4EUUA 3EL8A 3MFSA 4R1YA 4XX9A 4NEUA 5ACKA 4U6RA 3QWKA 2WMAA 5E91A 5IA5A 3TZ9A 4J71A 5BQ0A 4H39A 1QCFA 1QMZA 2I0VA 3I81A 3O8UA 5BVDA 3SRVA 4RFMA 4GT5A 4CT2A 4GRBA 3I1AA 5LVPA 4LM5A 3L8PA 4WG5A 4WO5A 3SV0A 2O65A 4I24A 5E92A 5EHYA 5CYIA 2ZV8A 4HW7A 3CTJA 2EXEA 4RZVA 4D9UA 1EH4A 1ZMWA 4M97A 3PA5A 4AX8A 4JBVA 4U44A 3GVUA 4RIXA 1Q62A 2X7OA 2HXQA 4EOKA 3EIDA 3WF5A 4E1ZA 2XB7A 4D4SA 1W0XC 4QP9A 2WMVA 3ELJA 2YLEA 3K5UA 5KHXA 3FXZA 5LWMA 2GQRA 3JVRA 3MI9A 1BMKA 1URWA 2WMQA 4HYUA 4FEWA 3PA3A 4FKWA 3L8XA 5KO1A 4PMTA 3SG8A 4TYEA 3C4CA 5AR2A 3FC1X 4PPBA 3ATSA 3FXWA 2R7IA 3TUBA 2A19B 1ZXEA 4HZSA 3TXOA 3TTJA 3MV5A 3WF8A 3LXNA 1W7HA 2BFXA 3OT8A 4O0WA 5LMAA 5J1VA 4IB5A 2R64A 4EH3A 1Y91A 3NUXA 5FP5A 3FMDA 4FSRA 2HAKA 4QMPA 5K9IA 1S9IA 4L7FA 5M4FA 4JDIA 4Y8DA 3OOGA 5ANEA 4JX7A 2VO0A 4D5HA 4QMSA 4XBUA 3VC4A 5E8XA 3GQIA 3MFUA 4IADA 4L3JA 5I5ZA 3NVKI 4C62A 4DHFA 4I41A 4P4CA 2WIHA 3HVCA 4XJ0A 2CLXA 4DH7A 3IKAA 5F4NA 5DR6A 2X8DA 2XMYA 4BYIA 4TWOA 5EQPA 3KCFA 5L2QA 4A9UA 5HE1A 4TPTA 2A2AA 4P90A 4ZOGA 5A3XA 4QMQA 3LHJA 3NZ0A 3QUPA 4FKPA 3Q5IA 3JY9A 3TV6A 4EKLA 4CG9A 4NUSA 4L3PA 5GJGA 3WILA 2CCIA 4ZTQA 4ZSJA 2H8HA 4G3DA 3G9LX 4LGHA 2ZYBA 5CVGA 1PXJA 4H3PA 4DLIA 3SVVA 3BBWA 1ZY5A 3MTLA 4IM0A 2QKWB 4MK0A 3RCDA 2J4ZA 2J0IA 3OWJA 3VUDA 3TN8A 5AUXA 4MX9A 2C68A 2J7TA 4C33A 5M56A 2YIRA 4MNEA 1PF8A 3EFWA 3KN5A 4XG7A 3DU8A 4OTIA 2XIRA 3ATTA 2ONLC 3QQUA 4BVUA 3S1HA 2OU7A 2OICA 2BHEA 3RWQA 1KUTA 3QD0A 3Q9WA 4HGSA 4DGLC 3O71A 3WOWA 2FB8A 4EHVA 4Z55A 4FTKA 1AD5A 2EU9A 2ZB1A 3AXWA 1R1WA 3ULZA 2BIKB 1DI9A 3EFJA 2ERZE 5AR8A 4F0IA 4RPVA 1BYGA 5TF9A 2XRWA 3H3CA 5AV1A 5AV3A 2OW3A 2VTJA 3ZLXA 2HZNA 2J5FA 4BN1A 5B2MA 4GYIA 3BYUA 4E20A 4F7LA 1VEBA 3Q3BA 2C6KA 2VD5A 3MB7A 3EN7A 4M68A 1JPAA 3F5GA 2JEDA 3OTUA 4EH5A 3NMUF 3HV4A 5CU4A 4FTAA 2C6MA 4GK2A 3RHKA 3FQEA 1XH4A 4H36A 3O50A 4B6LA 2OXYA 1JVPP 3BQCA 5HIDA 4D55A 3D2KA 5HBHA 4QTBA 2W4JA 3UNZA 3NYNA 2J90A 1MQBA 4FGRA 5EQYA 1OPJA 2H6DA 2OH0E 2QU6A 3R30A 1XH6A 1ERKA 3BLHA 4QNAA 5E8SA 3RAKA 5KUPA 4O7WA 3BKBA 3N4VA 3COIA 3OG7A 5FXSA 2I40A 3Q96A 1ZYCA 4DEGA 5AX3A 3QZHA 3F3UA 3TKIA 2WTWA 2F57A 3PP0A 4ZP5A 3K54A 5C26A 3ZXZA 2X2KA 2DQ7X 1YI6A 3EQIA 5EYCA 4RZWA 3V6SA 5M4IA 2G2FA 1Q8UA 3LFDA 4G3EA 4CFWA 3PPZA 1XH9A 5H9BA 3NR9A 2Z2WA 2RIOA 2XNOA 1J7LA 3NWWA 3LMHA 4AZVA 3DLSA 5IQAA 4FG9A 4Q5HA 4J96A 4BDBA 2BRHA 2LGCA 4IC7A 3LKMA 4NTSA 1QPDA 1ZOEA 3PJ1A 4DLJA 2OG8A 5HIEA 4XEYA 3JR1A 5DE2A 2C5VA 3AG9A 2Z60A 1B6CB 3PPKA 5AM7A 3KXHA 5J95A 2OSCA 2Z7QA 5BUEA 5I9ZA 4U7ZA 5AP1A 3R22A 5IDPA 4LOQA 2EXMA 4R3PA 4BKJA 4FR4A 3W8LA 4FUXA 4CFXA 1LPUA 2PE0A 5HI2A 5AV0A 5LJJA 4FTUA 3TKUA 3VWAA 4YZNA 3JUHA 4BGHA 1XQZA 1MP8A 2CGUA 4RA5A 4AF3A 4AQCA 1YDTE 2W06A 3AC4A 5HNGA 2XIXA 4DH1A 5D11A 2F4JA 2UVXA 4AN3A 4RC3A 1OIQA 2ITYA 2YIWA 3AGLA 3UC3A 2VWWA 2KULA 3BE2A 3BU5A 4KWPA 5AUTA 2GFCA 2FVDA 4RVMA 2YM4A 1H25A 2XK4A 3POZA 4C3RA 4FL3A 1UU8A 2R3LA 3K3JA 1B39A 1VR2A 1H0WA 4MF1A 4AN9A 4EC8A 5AIRA 4JRVA 4NT4A 3TV4A 2OO8X 3ACJA 4JT3A 5L8KA 1H26A 4L53A 4DGOA 1CMKE 2ACXA 3PJ2A 2A1AB 3GENA 3UOKA 4QTEA 3LM0A 3PG3A 4HGEA 4U9AA 2R2PA 4PPAA 4CYJA 5AM6A 1Y8GA 5ETFA 5CAOA 3U8WA 4RVLA 4ANSA 3PSDA 4OTPA 3F2NA 4LL5A 5EYMA 2GS2A 2H96A 3RAHA 4YC3A 2YM7A 3WI6A 3CQEA 3LFFA 4NIFB 3QA0A 3NS9A 4F0GA 2FA2A 2DYLA 5HO8A 3F7WA 2UZDA 5HO6A 4EI4A 5EYKA 2YHVA 3LJ2A 4GJ3A 3G0EA 4EWQA 3W16A 3HGKA 2VU3A 4JS8A 3DAJA 3FLQA 3OW3A 4IWDA 4PL3A 3LPBA 4CCUA 4DFBA 5HTIA 5ANOA 2JIVA 2ITOA 3OWLA 1PJKA 4I5CA 3T3VA 4GKHA 5CAQA 5AADA 4FV3A 5CNNA 3RGFA 4BI1A 5HG8A 3ITZA 1BLXA 4FV6A 3FI8A 3DBCA 2GS6A 2P2IA 2W1ZA 4WUAA 4YJNA 5FG8A 3U6JA 1P4FA 2RFNA 4FG8A 1K2PA 2WMSA 2HCKA 3OXZA 2XNBA 1YWNA 3FMHA 4FZDB 3OUKA 4FSUA 1ZYDA 3HMNA 3QTXA 3PXRA 1W82A 4D28A 3TZMA 4IVDA 4JQEA 4IM2A 1G8AA 3C4XA 1XH5A 2C6EA 2IWIA 3OY3A 4O0YA 2PMNX 5EG3A 4QQTA 5IQBA 4DFUA 4HJOA 5ANIA 2ERKA 4L3LA 4AS0A 1YWVA 2YM6A 4PF4A 1WZYA 5HVYA 4DGMA 3W10A 1JSVA 4FUYA 4RSSA 3QF9A 4I21A 5LARA 3KCKA 2F9GA 2W99B 1JSUA 5HESA 4AFJA 1H1WA 3BIZA 3CCNA 4EOIA 3FLSA 4W8EA 3OVVA 3R7YA 3AMAA 2OZAB 3VS4A 4YZCA 3D0EA 4YZDA 4BWXA 2C3IB 3BGQA 3C5UA 4AP7A 3E62A 2HWOA 4RQKA 1XWSA 2BZHB 2UW4A 3DB6A 3BWFA 2R3HA 3LJ0A 4HYIA 4GH2A 3AGMA 2PVJA 5E4HA 2X4ZA 2Y8OA 3FDNA 5KKRC 3ZO1A 4D2PA 3OBGA 4FIHA 1M7NA 5FXRA 2E9VA 2YWVA 2J50A 3KXZA 4RIOA 4DG0E 4AW0A 5J5TA 4ZAUA 2B9FA 4E5WA 3V5LA 2YZAA 4IAYA 5KMLA 2WU6A 3HA6A 5DI1A 2BALA 3NNWA 4P7EA 4KIKA 2R3GA 1GY3A 4LQMA 2V5QA 3T3UA 3VW6A 3ORMA 1CKJA 5EYDA 4C4HA 3VRZA 4TZRA 1SYKA 2A0CX 3AOXA 2IPXA 4GUEA 4M67A 3BEGA 3EN9A 5EW9A 5DR2A 5ETCA 2C1BA 4RIYA 3DBEA 5DA3A 4DFNA 3AQVA 2JDTA 3MESA 5IDNA 3TUCA 4O0TA 3UE4A 2WU7A 4L01A 3EQCA 5KMNA 5FP6A 4JIAA 4BTKA 4AG8A 1P2AA 3LCSA 2IZTA 4XBRA 4AGDA 1PXMA 4IEBA 2JKMA 4F63A 1R0PA 2OKRA 5A14A 4PDPA 5I9UA 5KMKA 4RGJA 3CIKA 3OS3A 2OIQA 2Z8CA 2F7EE 3L9MA 3FSFA 1H1RA 3DTCA 3TJDA 2BILB 4RVTA 2YCSA 4IWPA 3FQSA 2YM8A 3NGAA 2E9OA 5K0KA 4J52A 5DT3A 1NT2A 4QOXA 2J0LA 5EHLA 3UODA 4YSMA 1RJBA 3C4ZA 4L43A 4U8ZA 2W9FB 2HELA 4EBVA 4BDIA 3BX5A 3UZTA 4HOKA 1UKIA 5FRIA 3R9OA 4Z9LA 3QCYA 1JKKA 3EH9A 1W83A 3ZHPC 1VZOA 5CAPA 4EZ3A 3GBZA 3TACA 4CYIA 2C6TA 3R8ZA 3TEIA 2QG5A 5GIOE 3MA3A 2OBJA 5IKWA 1KE5A 2GHGA 3MH2A 3UGCA 5HIBA 4BHNA 5IEVA 3R8PA 3RI1A 2OJGA 3QC4A 4A9RA 2VGPA 5FEEA 1OKVA 2XKEA 4V0GA 1SM2A 4D5KA 4IB0A 3LXLA 4X7QA 5BUIA 3FZPA 3K3IA 3QQFA 4L6QA 3CD8A 4FTMA 3DKGA 3SXFA 3RKBA 3V5WA 4IZAA 4FKTA 3QCSA 4FTRA 4V05A 4WNOA 5DVRA 5FTOA 5L4QA 4OAVB 5A4TA 3D9VA 5JRSA 5HTCA 3BBTB 4MBJA 3R6XA 3C4WA 3F69A 3ZFYA 4HNFA 4DT8A 4GT4A 2HY0A 3PUPA 3E8CA 3B8RA 1OKZA 2RG5A 4RWKA 3SXSA 3C5IA 2GNLA 3R7OA 3JPVA 5GZ8A 2UW8A 3OROA 1RDQE 4ZTHA 3R8LA 4MWHA 4O81A 2GNFA 3DLZA 3FHRA 3LXKA 2JBOA 5JZNA 5AAFA 3R9NA 3RBWA 1P4OA 5K3YA 2XZSA 3HV6A 4TYGA 3FE3A 3VBWA 3VIDA 4QMYA 2VTNA 3GU5A 5IQIA 3C0HA 4BYJA 2XYNA 4C3PA 4QP3A 2GHLA 5AUZA 4BL1A 1FVVA 4PRJA 4EYJA 3FAAA 2FSTX 5HGIA 3G5DA 2W1DA 2VTRA 4EORA 3ZS5A 4ZZMA 4R8QA 4RX7A 3O8TA 4BI0A 4E6AA 4W8DA 4U0IA 3RPSA 3WBLA 2E9PA 4G6NA 4DEDA 4EZ7A 5AA8A 5J9LA 3FMMA 3G90X 2XEYA 5L2TA 3HUCA 3MTFA 3E87A 3IECA 5LMKC 4R77A 1BX6A 3GC9A 4QD6A 3TNIA 4FZFB 3FZTA 4ANNA 2PUPA 4C0TA 4ZLOA 2WPAA 5F9EA 1M52A 2X9FA 4UN0C 4LRMA 1V0BA 3FY2A 4XRLA 4EONA 4ONAA 3LCDA 3I5NA 4IB1A 3IGOA 3MIAA 1OPLA 3DDPA 3TL8A 4WBBB 5AP3A 5FBNC 4WIHA 4J99A 3R9RA 2PVKA 3DXPA 3U55A 4F9WA 3E7VA 3QX4A 5DG5A 3BELA 3UOLA 2XIKA 3T9IA 3ZO2A 4X3FB 3DNDA 3V5TA 3P5KA 5B2LA 2IVSA 5AA9A 2CKEA 4ERWA 3PIXA 2QC6A 3I60A 3SOAA 5ACBC 1OKWA 1H24A 4ZS0A 2HYYA 3R01A 3MY1A 5EI8A 2XA4A 4USDA 4LYNA 3REPA 4ZXTA 2WEIA 4JNWA 1OBDA 3PSBA 4BZDA 3F6XA 2ETRA 3KXNA 1QPEA 3HDNA 3R04A 5DR9A 5AR4A 2ZV9A 4II5A 1O6KA 4X2KA 3DKOA 1M7QA 5EK7A 4BTMA 2WMUA 3S4QA 3D7ZA 4BF2A 5IMEA 3OXIA 3Q6UA 5JFVA 3EZRA 3KGAA 5CWZA 3M42A 4K6ZA 5HCXA 2Z7LA 5K4JA 2R3KA 1WBPA 2QNJA 4NFMA 2YFXA 4XV9A 3ZLYA 4CCBA 2OZAA 2WMRA 3CD3A 2ITUA 4XG9A 2UW9A 1PYEA 3ZM4A 2YZLA 4AT4A 5HX8A 2QU5A 2R3OA 4FSYA 3TIZA 4MXYA 4EUTA 2CNUA 3LLAA 3TZ7A 1HOWA 4U3ZA 4F0FA 4TNDA 2B54A 1IG1A 3IDPA 4I20A 3LCOA 4OTGA 3BHYA 4QP2A 2JDRA 5L3AA 4O0UA 4I6HA 1NXKA 3DBFA 2H34A 3ORZA 2VAGA 5JK3A 4HVIA 4G1WA 2FH9A 3RHXA 2V0DA 1UV5A 4CTCA 5JZJA 2OJJA 4CLIA 2W5HA 3A8WA 1WVYA 2XM8A 4RT7A 2REIA 4D9TA 5A6OA 3ZM9A 4QP7A 3SC1A 4KAOA 4L7SA 2QLQA 2QD9A 5DGZA 2RFDA 3COKA 1Q8YA 2VO7A 3ACKA 4BZNA 1KE8A 4RLLA 1BUHA 2PVLA 1Q8ZA 4ZJVA 4Y95A 2XK7A 5E8TA 5B2KA 2ITWA 4ALUA 5AP4A 4RVKA 2EB2A 4GW8A 4F4PA 4J98A 4QQJA 2GHMA 2Y0AA 3Q9ZA 4R7HA 5EI6A 3GUBA 4MH7A 3P08A 4IWQA 4GVJA 5JGDA 2QHMA 2G15A 1H4LA 3AC2A 2PVHA 4EOMA 1O6YA 2XH5A 3E63A 2UVYA 3F9NA 3I4BA 3I79A 1V1KA 4M14A 5FBOA 5HG7A 3U4WA 3IG7A 1P5EA 4CT1A 2WQBA 3VVHA 5HVJA 4GU6A 4F6WA 3F3WA 5CSPA 5KX8A 2C4GA 2ZM1A 3W33A 3VUKA 5TKDA 4BBEA 5LMKA 5I9YA 1YHWA 2BUJA 3FWQA 1A9UA 2W7XA 2PUUA 3NW6A 5CY3A 3HECA 4KIPA 3PXZA 4IAKA 3SOCA 3QKLA 4MXXA 4AOTA 3CXWA 4X3FC 5E1EA 4ZSEA 1M14A 2BAQA 2UZTA 2NPQA 4D2SA 4F9CA 2C5YA 4O7LA 3R21A 4OT6A 3QUEA 1H01A 1NVSA 4GIIA 2JKQA 3F66A 4HNIA 1DAWA 3QQJA 4IAFA 3S2PA 5M51A 1NW1A 4Q9ZA 4I92A 3TNHA 4O84A 3G6GA 1CKPA 5E90A 4JR7A 3R8UA 4C4JA 4RX5A 2KTYA 4FE2A 2QOBA 3LFCA 3ODYX 4TYIA 3WF9A 4EH7A 2W9ZB 3MH0A 1VYWA 3TDVA 5CTPA 3ZO3A 4C59A 2XYUA 1MUOA 5KBQA 4K0YA 5HCZA 4BCFA 4ANQA 2GCDA 5A4CA 5I4NA 4S31A 4QNYA 4UXLA 4OW8A 3C51A 4O22A 4BIEA 2Y7JA 3Q04A 1YXXA 4NFNA 2F49A 4NTTA 4UEUA 5TT7A 5HO7A 5LCJA 4KRDA 4HGTA 5T3QA 2CKOA 4BHZA 3P86A 4KBKA 1DI8A 3KVWA 3D7TB 3LFBA 5CVHA 1M2PA 4N4SA 5CANA 3NYOA 3NYVA 3NUAA 3UMXA 3UP7A 2ZDTA 4C36A 5ANKA 5E1SA 5LVOA 2YCQA 3SGCA 4FSMA 3EYGA 2Q0NA 2WMBA 4IWOA 2GTNA 3FZOA 5ANGA 2IVTA 4FGBA 4D4RA 1UA2A 1U5RA 4FIFA 4FV9A 4K2RA 4K11A 4NCTC 4IFGA 4C35A 2WB8A 4XHKB 4LV8A 4GIHA 4FIIA 3GB2A 2RKUA 2WNTA 3RK9A 3SW7A 4XOYA 4RBLA 2JKOA 1OL2A 3RP9A 5HLWA 3DJ6A 4O1OA 3EQRA 4UYNA 2JIIA 2NRUA 2P55A 1GIHA 4QTCA 3UP2A 5AR5A 2ZVAA 4IX6A 4D2VA 2CGXA 4G16A 4PDOA 5AV2A 3BQRA 4ASDA 4HVGA 1W84A 3LFAA 1KWPA 2YDKA 4G5JA 1KOBA 1XH7A 3NLBA 4QMXA 4BDFA 4BCPA 1F3MC 5J9ZA 3ROCA 4UMUA 2BRBA 4F7SA 5C03A 2BRGA 3E64A 3POOA 2UW0A 3HMOA 3U9NA 3P4KA 4UMRA 4M84A 3R1QA 4CD0A 3KMUA 2HK5A 4IX3A 4AA0A 4C61A 4NM5A 2VTAA 2QONA 5CASA 5ICPA 2XJ1A 2Y4IB 4FYOA 4GFOA 1YXVA 3QQKA 5CVFA 4OBPA 3NUNA 4QP8A 5EFQA 3UYTA 5A4QA 2PVRA 4JL9A 3QUDA 4WNPA 4W9WA 5DYJA 3LFEA 4DTKA 5JRQA 5E9EA 4XLIA 3U6HA 2BTRA 2GNJA 1E1XA 4H58A 5KE0A 3ZXTA 2RFEA 1GOLA 3TNQB 3LOKA 3KRWA 4GU9A 4FKIA 3TKHA 3ZEPA 3R73A 4Z7HA 4UMTA 1CDKA 3ANRA 3DT1A 3H30A 1QPCA 1YXSA 4YP8A 2GNIA 3R7UA 3LMIA 3WZKA
chains in the Genus database with same CATH superfamily
3ZFXA 4TWCA 4AZTA 4AW5A 2G01A 2B0QA 3FMJA 4XP2A 3RK7A 4IVAA 5IEXA 4PMMA 3PY3A 5I9WA 2C69A 3PXKA 4J8MA 4W4YA 3R7EA 3L8SA 4RWJA 5AEPA 4CRLA 2XRUA 1GZNA 4L9IA 2XK6A 3ALOA 4P5ZA 5HOAA 3W2OA 4TL0A 3PLAE 3MB6A 3O96A 4ENYA 1YDSE 4F7JA 4QO9A 3VUIA 2C6OA 3U87A 5KMIA 5C4LA 3EQHA 3VRYA 4CFUA 5ITAA 4ZTLA 3E92A 4UB7A 3HAMA 3FLZA 3R9HA 1KSWA 4NM3A 2VN9A 1G8JA 3MH3A 1ZYJA 4QYFA 5HNBA 5J1WA 2OLCA 4KA3A 1YI3A 3NPCA 4GG5A 4W4VA 4R3CA 4YJQA 3IGGA 2BKKA 2IJMA 4YJUA 3W0MA 3R00A 4FSTA 4IVCA 4M69A 1XBAA 3TYKA 4XLVA 3EB0A 2VRXA 3LAUA 1QL6A 3VUMA 1H08A 3ZUVA 4EC9A 3O51A 5LMBA 1ZRZA 1NY3A 5IEYA 2QOFA 4H1MA 5CX9A 3DBQA 4F09A 5EKOA 4I6LA 4S2ZA 4APCA 3W2SA 5CEKA 3P9JA 4WA9A 4ZSGA 4IFCA 1H27A 2JDOA 3QC9A 4F7NA 3KU2A 5DEWA 2VTMA 5DPVA 2WTJA 2GQSA 4KBCA 5EDQA 2I0YA 3OTVA 4RJ3A 5M09A 4KS8A 5BMSA 5IH6A 2IVUA 3GU8A 5GNKA 3P0MA 1JKTA 2UZLA 3N51A 4R5SA 3FC2A 2BDWA 1ZMVA 1B38A 2YLFA 3O7LB 2VTSA 2XK3A 4UYAA 3RAIA 3UIMA 4A9SA 4FYNA 3A7JA 4ZTNA 2YEXA 2BCJA 4DEHA 4RC4A 4CVAA 4YURA 3GCVA 2AC5A 3ZBXA 1OL7A 4I6BA 1KE6A 3H9FA 5EHOA 3W32A 3FXXA 1PXIA 3R1YA 4BICA 5BNJA 3ZSHA 1YXUA 2JFMA 4I22A 3KXGA 5CEIA 2JLDA 3A7GA 2XNGA 3DV3A 5AUVA 2VZ6A 3A99A 2OI4X 3A7IA 1PKDA 3KY2A 3R1SA 4KB8A 2QOKA 3DPKA 4TTHB 5E8WA 1K3AA 4YJPA 3HV5A 5AUUA 4KS7A 2XIZA 3LQ8A 4DINA 2W5AA 4FSQA 4FTCA 3OCSA 1QPJA 3MBLA 4O0SA 3VAPA 4ACDA 4HVDA 2RFSA 2WTKB 4I0TA 5AWMA 5FDXA 4TT7A 4FIEA 5TR6A 2W1FA 2WGJA 3JXWA 3S95A 4LG4A 4XOZA 2HOGA 3HDMA 5M06A 4OBOA 4BRXA 4CKRA 2I0EA 3P7CA 2QOIA 2WO6A 5DN3A 3ZH8A 4PX6A 4FZAB 4QMVA 4EK3A 4WT6A 4AZSA 4QP4A 4FK6A 3QTWA 2CJMA 4FKGA 3ZRMA 4FT0A 2EUFB 4FOCA 4B4LA 4EH6A 3HZTA 4LUDA 4MQ1A 1Y6BA 2QVSE 5HD4A 3IW8A 3D83A 4YHFA 2RG6A 3MPMA 2R3JA 2PWLA 3QRKA 2QOHA 5L2SA 4MD8E 5KZIA 4FKJA 3DXQA 4DCAA 2BZJA 3QD3A 3GCQA 4GG7A 4U97A 4FL2A 4U40A 4F6UA 2R3FA 4O96A 1ZZ2A 2J51A 2PSQA 4ASXA 3BHTA 4O86A 1J3HA 4IB3A 4AAAA 3D5XA 3A62A 5KNJA 3MPAA 4O82A 3PA4A 4IMYA 3JVSA 2Z7SA 3NRMA 4D4VA 4NK9A 4WHZA 3VS7A 3C4FA 4LOOA 2A27A 1LEWA 2FUMA 4W9XA 3ORKA 3GU7A 2VUWA 5DFPA 4PP7A 3AKJA 4NYEA 2OXXA 3MY0A 4KKGA 4RIWB 3TZ8A 3KA0A 3AT3A 2W1HA 1OB3A 4F1OA 4PP9A 2UW3A 4QYHA 4M0YA 5IG1A 1XR1A 4TXCA 3EN4A 1Z9XA 2HENA 3RAWA 5EI2A 3GGFA 3V8WA 5T6KA 3R71A 5HU9A 2QQ7A 2ETKA 5GZ9A 2JAVA 1YVJA 2VWYA 3RZBA 5J79A 3MFRA 3BCEA 2OWBA 4UXQA 4MTAA 1H28A 3KRJA 3D94A 3DXNA 3P78A 2VO6A 3ZBFA 4QDEA 1SNXA 3CBLA 3PJ3A 5HHWA 4YPDA 1Q5KA 5ANDA 4IBMA 4C3FA 2BKZA 3G0FA 5CQWA 4AUAA 1DS5A 4YTFA 3HRFA 1GIIA 1GZ8A 1YI4A 2C30A 1Q99A 2V7OA 3CY3A 2GS7A 3EZVA 4EH9A 5C8NA 5JKGA 4WOVA 4XCUA 4BB4A 5HG9A 4YNOA 3PJCA 4Q5EA 4BKYA 3DJ7A 3KQ7A 3PJ8A 4XG8A 4FA2A 3LW0A 3PVGA 4FV1A 3ODZX 2YJSA 1J7IA 5FUTA 3VN9A 2GNHA 3BGPA 3DCVA 4X6RA 2V22A 5CF4A 1G8KA 4Q2AA 3L1SA 4BCOA 4QQ5A 4ZMFA 4M12A 2ZAZA 4L42A 4K18A 5M53A 5IQFA 2PPQA 3C1XA 3DGKA 3DZQA 4U45A 4MXCA 2YITA 3R02A 4DG2E 4EJ7A 3ANQA 5EW8A 4D2TA 3R2BA 4K9YA 4P5QA 5CSHA 4CV8A 5IZFA 2X39A 3A2CA 5DRBA 4DFLA 1FGIA 2E9UA 1W2CA 2J5EA 4J7BA 3F3TA 4YR8A 3EQPA 3AD4A 4PDYA 3IQ7A 4Y73A 3MVMA 4RJ5A 3UQFA 4MNFA 3DA6A 2X0GA 2X0PA 1TVOA 2IW6A 5A46A 4HPUE 5ETIA 3Q52A 3GCUA 4C2WA 4AXCA 4UX9A 2AYPA 3RVGA 4ACGA 5H8GA 4YLJA 4ENXA 4PMPA 5L8JA 3DKFA 1UNLA 4X6QC 4YC6A 4YTCA 3GU4A 2ONLA 1F0QA 2B7AA 2XS0A 3VS5A 4DC2A 1YQJA 4BTFA 4E5BA 4FOBA 3GT8A 4IZ7A 5CEQA 3Q2MA 3ZCLA 3NNVA 3BV2A 3FZSA 1T46A 2OJ9A 3NIEA 4V01A 3UZRA 4MXZA 4JI9A 3BYOA 3ZEWA 4PTCA 3CY2A 3PFYA 4KRCA 3MFTA 4D2WA 2UZBA 3FUPA 5B0XA 4YGAA 2CDZA 2P2HA 3UNJA 5FEDA 5D7AA 4PNIA 4OTHA 1FPUA 3DK6A 4NSTA 3OCBA 4M69B 4O0RA 3BHVA 1REKA 4BZOA 4OTWA 1OI9A 3QGWA 4FKOA 2X7GA 4MQ2A 4X2NA 2PK9A 3KFAA 4X21A 1YOLA 1JQHA 2WQEA 3F88A 4F9YA 4OLIA 4LOPA 5I3OA 4FKSA 2ESMA 3H0ZA 3DNEA 2GSFA 5DH3A 3E88A 1NVQA 4CQGA 1ZMUA 4FEQA 3RK5A 1J7UA 2UV2A 5M4UA 2PVYA 5FGKA 4ALVA 4GJ2A 1FOTA 4HYSA 1ZAOA 4GSBA 2P33A 2ETMA 4LMUA 3V3VA 4FKQA 4N6ZA 4FNXA 3IDCA 3DK7A 2XBAA 4EQMA 2YDJA 3QTQA 4I23A 4XP3A 5HCYA 4AGUA 1WAKA 3PXFA 4NKAA 4PWNA 1Z57A 4AW1A 2WEVA 4C37A 3L8VA 2WMWA 1TKIA 3RPYA 3EL7A 2XF0A 3WIGA 2R3NA 3KKVA 2C5NA 2E9NA 2F2CB 1YHSA 3FHIA 3BU6A 4GS6A 4Y72A 3S00A 3PWYA 3R8MA 2R3MA 4MEDA 5IQCA 2XCHA 4FICA 5JQ5A 1SVHA 2VTHA 3A4OX 2W5BA 4U42A 5HVKA 4JG6A 5J9YA 2PE2A 4DTBA 3E8EA 2IO6A 5JMSA 3EKNA 4IAIA 3M1SA 4DHJA 4V0GB 3EN6A 4XV2A 2CSNA 1UU9A 2X1NA 1YOMA 3MVLA 4DE4A 4EHZA 1UKHA 2ZV7A 4QMWA 5FDPA 4O83A 3GC7A 3RM6A 4O7ZA 4D1ZA 4PY1A 4IH8A 2WQOA 4DFZE 4O7YA 1WMKA 1PXKA 1YXTA 4D2RA 4YNEA 2F2UA 4JXFA 3E8DA 1PY5A 2XK9A 4MXAA 2ZJWA 1VYZA 1KE7A 3FV8A 3ORLA 2BAJA 3PE2A 2OZOA 5IISA 5CAVA 2ZFYA 3PG1A 3DFAA 4I93A 4HCUA 3CQWA 4U81A 3KXXA 5G6VA 5IUHA 1SZMA 1PYXA 1Y8YA 2QODA 4QP1A 3SX9A 4E6DA 1GNGA 3BV3A 4NW6A 3BPRA 3MSSA 1A48A 3SW4A 2XIYA 3GQLA 3MS9A 4FNWA 4GYGA 5CAUA 3LJ1A 1WBWA 1KV1A 2VNWA 4FG7A 3R8VA 4YJTA 3G2FA 5DT0A 4CLJA 5EQEA 2PE1A 4BR3A 2O64A 4G3FA 4JR3A 2OF2A 4MCVA 1MQ4A 3VUTA 3O23A 4AA4A 3RCJA 3Q2JA 5A4LA 3PSCA 5B7VA 3HAVA 1E1VA 4U5JA 3OY1A 2VTPA 4K8AA 4L00A 3NEWA 4DHIB 3P5JC 1UNGA 2Q0BA 3R1NA 5JGBA 4KIKB 3RZFA 3OXTA 4CEGA 4EK8A 4EK5A 4BCGA 4MKCA 3IW4A 2VWVA 3VBXA 3D4QA 3NUSA 4S30A 5K5NA 1G5SA 4F9BA 5AP0A 3PPJA 5GZAA 4LUEA 2VTTA 3OWPA 4RIYB 5AIKA 3V51A 4OR5A 5AP6A 3C13A 4AW2A 3BZ3A 1FINA 2YERA 3EWHA 1R0EA 3UO4A 2HXLA 2HIWA 4I5MA 3W55A 4J97A 2X4FA 5CF5A 5IA0A 4QYGA 1J1CA 2QHNA 3FL4A 2V55A 2VTOA 3KN6A 4F64A 4F99A 4Z16A 3EJ1A 3Q6WA 1WVXA 4CFMA 4YBKA 2C3KA 3D15A 4AZFA 4IM3A 4USEA 4FEVA 2GU8A 4AQKA 1FMOE 4FX3A 5HKMA 3RWPA 5JT2A 3VQUA 5E8YA 1OGUA 4R7IA 2DS1A 3GCPA 4ZTRA 4FZ7A 2NRYA 3QALE 5IH5A 1PW2A 4AA5A 3KMMA 4NWMA 3BL9A 2BR1A 3NAYA 4ALWA 2QO7A 2PMOX 3VS3A 2WOTA 2ZMCA 4JDKA 3QX2A 3HNGA 1IRKA 3MH1A 5I9XA 3ENMA 3HX4A 4G6OA 2YACA 4IACA 4UMQA 3OP5A 3QHRA 4R5YA 3Q4UA 1YW2A 2JD5A 2J6MA 2YWPA 3VBQA 5CSWA 3UBDA 4GCJA 4D58A 4R78A 4BI2A 4YJRA 4AU8A 5DMZA 4O2ZA 2Y6OA 4CFVA 4UWBA 1YWRA 4M15A 2R0UA 3FLNC 1OL1A 4QMUA 4E93A 3ZO4A 3GI3A 1H1QA 3V04A 4RWLA 3G33A 4TWPA 3RJCA 3V5PA 3W2RA 1U46A 5LVMA 3BEAA 3O2MA 5A4EA 3WZUA 4QPAA 5EM5A 2W17A 3UDSA 4ZLZA 2WTKC 4CSVA 3CKXA 5FTQA 3DFCB 2UZUE 2XNMA 3ENHA 2R3RA 3FJQE 3TI1A 2G1TA 4TW9A 4C34A 3HEGA 4TYHA 2OXDA 4YC8A 5KCVA 3CEKA 1BL7A 1ZY4A 3BL7A 1BL6A 3PVBA 4PUZA 4FV2A 4BJJA 4Y46A 1CKIA 1OIRA 3CTHA 2V62A 5BUJA 4IHPA 3PVUA 1J91A 4A9TA 1W98A 4APPA 5IA2A 3CP9A 1PXPA 4BDHA 4C8BA 4EQCA 3BLQA 5A6NA 4IJ9A 4FODA 4L67A 5D12A 3O8PA 2HWPA 3ZU7A 1UNHA 4NW5A 4BGQA 3JS2A 4ZLYA 3VS0A 2ITTA 1XHAA 3E8NA 5J5SA 4JLCA 3F82A 3OEZA 4IJPA 3I7CA 2WXVA 3I7BA 4K33A 2BFYA 4KSPA 4QQCA 4B8LA 5DHJA 1REJA 3QBNA 4I5HA 2OF4A 3TMOA 3ZZEA 2PZRA 4RA4A 3QTIA 3QA8A 4EK4A 2UZVA 3MJ2A 3IO7A 3COMA 3PZHA 3BRBA 3R7GA 5I3RA 3II5A 2QCSA 4YHTA 1KOAA 1PMNA 1M2RA 2CN8A 2XAMA 4RLKA 4UBAA 1K9AA 2J2IB 3FLWA 4YJVA 5E8VA 2B55A 5D41A 4BCIA 4FNZA 1JNKA 1ZLTA 4EH8A 5KBRA 3ZDUA 3W0RA 2XAOA 4USFA 4PQNA 5EOLA 2B9JA 3IS5A 3DZOA 5HD7A 4ANOA 4DN5A 5T68A 1L8TA 4FSNA 4N57A 4DBNA 1CM8A 5CSXA 3KRXA 4YSJA 1TQMA 5C4KA 5BX0A 5EDRA 2W05A 4KNBA 3ZSGA 4C4IA 1Q41A 3BYVA 4QT1A 3PLSA 3QU0A 2O0UA 1BKXA 2X0QA 3NX8A 4U41A 3VO3A 4ANBA 3QYZA 3R63A 5EM7A 2XKCA 5HE0A 2I6LA 2BDFA 3D5VA 3ZFMA 3V5QA 3QKMA 3BI6A 3HA8A 3TTIA 3IW6A 3HMIA 2XBJA 4ERKA 1OIUA 2F7ZE 4AT3A 3RNIA 4AXEA 5AJQA 5TE0A 4JAJA 3GXLA 4IDTA 3QLFA 4CFNA 3ZC5A 5GJDA 4GEOA 4A4XA 4ZEGA 3FMNA 5CNOA 4BCMA 2OK1A 4C58A 4ZY4A 2X2MA 4YTHA 5KKRB 4C38A 3AC1A 5LOHA 3FBVA 3FL5A 4E3CA 3R7VA 4NZWB 1WCCA 1XJDA 2RL5A 2ZDUA 1STCE 3NCGA 2OFUA 3A4PA 4QTDA 4WKQA 4M3QA 4YHJA 1G8SA 3LFSA 1RQQA 5IUIA 3RPOA 1U59A 2C6LA 4PL4A 4PPCA 4I0SA 3NUPA 5JFWA 2BZKB 4LI5A 3MN3A 3VQHA 2XNPA 2G2IA 3UC4A 2B9HA 3UIBA 3MPTA 2X2LA 2PVNA 3BGZA 3GFEA 3F5PA 1A06A 3EYHA 4I0RA 3P7BA 4DITA 4MF0A 5IA3A 2XCKA 2QOLA 4BDJA 4FV5A 3QTSA 5CXHA 3E3BX 1W8CA 4BCHA 2JC6A 5E8ZA 4HVSA 4OTFA 3E7OA 3SQQA 4QPSA 2XNNA 1WFCA 2UZWE 4QMNA 3A7FA 1H1PA 2XVDA 1U54B 4EEVA 5EM8A 2BAKA 3NCZA 1UWHA 4S34A 4WBOA 4FRFA 4RWIA 3BHUA 4ACMA 5HICA 4C4GA 1ZOHA 4KKEA 4WSYA 1O6LA 2IVVA 1I44A 3MDYA 5DIAA 1Q8WA 4ANLA 3UJGA 4TYHB 3Q53A 4X3JA 5CLPA 5D7VA 3R83A 4F1TA 3VF9A 2WTIA 5K5XA 4JRNA 4Y5HA 3FMEA 4BJJB 2B9IA 4MBIA 1Y57A 4ZIMA 4YLKA 4DCEA 4KSQA 4MD7E 2OH4A 2G9XA 2PTKA 1XO2B 3AMBA 4XMOA 3UO5A 4AZEA 3PY1A 4AOJA 1ZYSA 5JSMA 2QO2A 2R3PA 4WD5A 3MW1A 3C9WA 5C01A 3CLYA 4FTQA 3FSKA 4R1VA 1ST4A 5IQDA 3HMPA 5M07A 4XS2A 4IW0A 4PMSA 5HORA 3CJFA 1U54A 2WFYA 4O4FA 1H00A 3NFFB 1M2QA 1V0PA 1OZ1A 4Y85A 5CU3A 5KZ0A 4ZZNA 4U43A 4XUFA 5LVNA 2YJRA 5HU3A 2ITPA 3FKNA 3RNYA 4D1SA 4I94A 3KF7A 4FV0A 1OITA 4DGGA 3UVPA 3H9OA 3EFLA 3HRCA 3EN5A 5F20A 3QFVA 5BYYA 4IZYA 5CS6A 5CU6A 4I3ZA 5J87A 4YJOA 3OBJA 1GIJA 1PMUA 5DNRA 2FYSA 2O3PA 5CSVA 2WMTA 5J8IA 3UYSA 3NVMB 2IEWA 2GQGA 2QURA 2PVFA 3AC3A 4QMTA 5HE2A 1KE9A 2BDJA 2CMWA 2WD1A 3NUYA 4GT3A 4MXOA 5AX9A 3QZGA 2E2BA 3QTZA 4WG3A 4EQUA 3WE4A 4R7BA 3ORTA 4JG7A 4G3CA 4HGLA 5CEPA 2QI8A 3AT4A 3T8OA 3BHHA 3MIYA 5CT7A 2XNEA 4AE6A 4UV0A 4PNKA 5GJFA 1OL6A 3NDMA 3EKKA 3FPMA 4FTIA 4BC6A 3P23A 4NIFA 4CTBA 3VUGA 4BCKA 4FC0A 1UVRA 4YPSA 1PXLA 5BVFA 3KVXA 4FT7A 1IR3A 4OTRA 4YZBA 5DRDA 4EOLA 2W96B 4EOQA 5DWRA 2PZ5A 4JIKA 4UZHA 3OZ6A 3DBDA 2JIUA 5CEMA 3EHAA 3ID6C 4H05A 2JKKA 3D7TA 3T9TA 3H0YA 2PU8A 5AP5A 3K5VA 3IOKA 4RMZA 4C02A 2I7QA 3CQUA 2BIYA 3DQXA 5G1XA 3IPHA 4FTJA 3UG2A 4HVHA 1S9JA 3PRIA 3LE6A 5ETAA 4DFYA 4GKIA 3EQBA 2WTCA 2Y6MA 4FI1A 4JOAA 5FD2A 3WYYA 5JGAA 4YZ9A 2HW6A 2IG7A 5AFVA 1G3NA 3W18A 2BMCA 3L9PA 5HEZA 2ITNA 4JBPA 3SXRA 5E7RA 3CC6A 4CZTA 5H8EA 3OF0A 1Q97A 3GC8A 3PVWA 4QMOA 3MYGA 2I1MA 4RX8A 3ZRLA 5JEBA 1ZARA 5IMXA 2BHHA 4M8TA 2HZ4A 4EBWA 2YAKA 2UW5A 2W4KA 1UWJA 2IZUA 3G51A 3HKOA 2PZPA 4LRKA 2CNQA 4HCTA 3BYSA 3CS9A 5F95A 3CKWA 3SDJA 1PKGA 3Q5ZA 2X9EA 3BYMA 2WMXA 3KC3A 1TQIA 3MVHA 4OGRA 5DBXA 4EJNA 4ITIA 2WIPA 4NU1A 1OUKA 3ETAA 4U79A 3V8SA 3CJGA 5HQ0A 3QTRA 3OHTA 4FT5A 1ZWSA 2XKDA 4FSWA 2BPMA 2ZOQA 2AUHA 5FM2A 4AGCA 2XKFA 4WG4A 4E73A 3OCGA 3WYXA 4A4OA 3SD0A 4F1MA 4I4FA 3F7ZA 3WARA 3LCTA 3U6IA 5IQGA 3ET7A 5FWKK 4CG8A 5E8UA 4LGDA 5IQEA 3ROYA 1U4DA 5J7BA 3LCKA 3UIXA 4I6FA 4CNHA 4ZSAA 4P2KA 4G34A 3BE9A 4WRGA 4KKHA 3QL8A 2C0TA 2C0IA 2W1CA 3GFWA 3QRJA 3QZFA 4DHZA 3THBA 2W1IA 4BDCA 4DAWA 1CSNA 5AP7A 3ORPA 4RQVA 1WBOA 5LVLA 3H9RA 3KULA 1OVEA 4FIGA 5AR3A 4FV8A 3O17A 4JG8A 4PV0A 4TY1A 2QO9A 3QXPA 3COHA 4FF8A 3UVQA 4DH3A 4Z3VA 3NYXA 2JFLA 2UVZA 4O2PA 2GFSA 3OOMA 4WNMA 3CR0A 1H0VA 3C0GA 4M66A 3R7IA 2XP2A 3FI2A 4E8AA 2WQMA 5JFSA 2NNWB 4BTJA 3HP5A 4CFFA 3QYWA 3P79A 4RRVA 4BDEA 2YM5A 3SLSA 3IW7A 3KRRA 3KF4A 2QOCA 4CQEA 1TZDA 4IX4A 4O1PA 4XG6A 5EM6A 4KINA 3VS6A 5LCKA 4ACHA 2NO3A 5EOBA 1UU7A 4K77A 2X8EA 3B2WA 2OIBA 4X0MA 4D1XA 4RJ6A 5FXQA 3DDQA 2CGVA 4ASEA 5AMNA 4E4LA 4XYFA 4JAIA 2BTSA 2FO0A 3PE1A 5BYZA 3ZSIA 1WBNA 4NH1A 3IONA 4PL5A 3OCTA 1FMKA 4O91A 4W4WA 5HX6A 2WQNA 2O2UA 4CV9A 3FI3A 4N6YA 4MNEB 1FQ1B 3TDWA 4Z7GA 4YTIA 4FK3A 4O7NA 2PUNA 1U5QA 2P0CA 2GMXA 5M4CA 1OBGA 4ZSLA 1FVTA 5EKNA 2YCRA 2W1EA 4FMQA 3VNTA 4BDDA 2P4IA 3DAEA 4M7IA 1IEPA 4KABA 1YHVA 1YRPA 3E3PA 4KIQA 4UALA 2AC3A 4GV1A 4BY9E 2B53A 3LQ3A 1YDRE 4BFMA 1P14A 4CMUA 2CKQA 4FV4A 1FBNA 2R4BA 3DOGA 3BLRA 3VJNA 5HLPA 4TWNA 3OWKA 3C50A 3RPRA 5HNIX 2VWXA 3LMGA 3E93A 5EH0A 3B2TA 4JJRA 3RMFA 3TIYA 4BDAA 3BWJA 4YU2A 5CEOA 4NJDA 4DDGA 2FGIA 1TQPA 3KIOC 2RGPA 5L2WA 3ULIA 1RW8A 5HTBA 1LEZA 3NSZA 4FKRA 4S33A 2GPHA 1ZYLA 4C7TA 2VTQA 2WZJA 4RJ4A 2ZM4A 3WZDA 3WF7A 2JAMA 1R3CA 3O7LD 5F1ZA 3SAYA 1LR4A 4E4MA 4IAZA 5JH6A 3Q9YA 4XV3A 1MRYA 3G6HA 3UO6A 2IZRA 4GVAA 3S3IA 4EOJA 4FNYA 3V01A 3FLYA 3UMWA 4CZYB 4DA5A 4EL9A 3LLTA 3QQLA 4ZTSA 4YO4A 2YCFA 1URCA 4Y5QA 4D4YA 3WZEA 2X6EA 3Q4CA 4O7TA 2QOOA 1X8BA 2J0MB 3ZC6A 4EH4A 4EYMA 4IVBA 4ORKA 3ZMMA 3CPBA 3FMKA 4R3RA 1J1BA 2EB3A 5C8MA 3QD2B 2PULA 3HV3A 2UUEA 4FKVA 4GFGA 5IA1A 3LQ5A 4J53A 4CGAA 3TT0A 3OFMA 4RFZA 5BYLA 4BDGA 5BVNA 2QR7A 4BBMA 4AWIA 2PUIA 4G3GA 3DK3A 4V04A 5FEQA 5BMMA 2R3IA 2VX1A 4CKIA 5IU2A 2HZ0A 2Y4PA 3KMWA 4NM0A 3SKCA 3W8QA 5KMJA 5CF8A 2JDSA 2VWUA 2FSOX 3VJOA 3WIKA 2CPKE 4JDHA 2LAVA 3VULA 5BVWA 3EQFA 2VWIA 2PZIA 1BI8A 2BRMA 2X81A 4EOOA 4BIDA 1H8FA 3HLLA 5HG5A 3VBYA 4ARKA 4J8NA 2B4SB 5BVEA 4FTTA 4MYGA 1WBVA 4LV5A 4MAOA 4O4BB 2JBPA 4XV1A 2GNGA 2YIXA 1PXOA 3F5UA 4NKSA 3TCPA 4ASZA 5IH4A 2Z7RA 3PDTA 1Q3DA 2GTMA 3KRLA 4O21A 5CI7A 4LGGA 1L3RE 4HPTE 4L46A 1Q24A 5HZNA 5H2UA 4GL9A 1JAMA 1V0OA 4M13A 3FPQA 2A4LA 4W4XA 4BDKA 2VWBA 3FZ1A 4DH5A 1JKSA 1ZZLA 4H3QA 2JITA 5L6WL 4FT3A 4XH6A 5CT0A 4QPMA 1YOJA 1LUFA 1Q8TA 3GP0A 3VF8A 4FVQA 3I0QA 4KBAA 3WZJA 4Y83A 5D9HA 4YUQA 4E7WA 4QTAA 3OC1A 2Q83A 4K1BA 2CLQA 1PMEA 3ERKA 1PHKA 2UZOA 2CHLA 3QRIA 4N0SA 4QMZA 4RFYA 2CN5A 2ZM3A 3Q4TA 3W0QA 4AN2A 2XEZA 5I9VA 5HLNA 4PTGA 2JDVA 4O0XA 2C5OA 2G2HA 2ITQA 3OT3A 2C3JA 4DEIA 4WUNA 2SRCA 3VS1A 3TG1A 3KXMA 4E4NA 4FTLA 3W0OA 4F70A 2P3GX 5CZHA 5BVOA 3KREA 3A61A 3TNWA 4IXPA 3NNUA 3NAXA 4E5AX 2XJ2A 3F2AA 3PY0A 2Z02A 5A54A 5FTGA 1JWHA 2Y4IC 1XMLA 4DDIA 3FEGA 3CGFA 3Q4ZA 2R7BA 1YKRA 4O6EA 4XNEA 5FLFA 4EWHA 1ND4A 4H1JA 3QHWA 1OL5A 4O7SA 3F3VA 4AZWA 1IA9A 4XRJA 1I09A 4EK6A 3UNKA 4RG0A 3M2WA 5AAGA 3JYAA 4S32A 4LFIA 4DEEA 3UTOA 5A9UA 4YZMA 5CXZA 4CMTA 1SVGA 1IASA 4L52A 1FGKA 2WHBA 3C0IA 4GMYA 4AFEA 4BWKA 2PYWA 3PTGA 2C6IA 4EOSA 5AAEA 5K4IA 4G9RA 4RX9A 4E26A 1DM2A 1OKYA 3PXQA 3QZIA 4DG3E 4IDVA 4UMPA 3TM0A 3GOKA 4FIJA 1JBPE 4ZK5A 5KMMA 4ZTMA 4O6LA 1APME 3U9CA 3IOPA 3QLGA 5LWNA 3N4TA 2JGZA 3PWDA 4E6CA 4FEXA 2VTLA 4I4EA 3NNXA 3QGYA 2CKPA 1PRYA 3I5ZA 2W4OA 1CTPE 4ID7A 2EWAA 4ZJJA 3NW5A 4JDJA 4JQ7A 4NM7A 2PHKA 4J95A 4L68A 3UOHA 1T45A 3D5WA 4F9AA 4O7RA 5D10A 2YM3A 3UG1A 2X6DA 2ITVA 4BCQA 1XKKA 2WAJA 4CZUA 4DEBA 3C7QA 5H8BA 4ZY6A 4Q9SA 3UVRA 4KUJA 1SVEA 2WKMA 3ZLWA 3ZYAA 4ANMA 5TOZA 3CTQA 5DLSA 1JOWB 3ZUUA 3R28A 4O38A 5CENA 1E9HA 4O7VA 3TUDA 3QQGA 3OEFX 3QTUA 4NJ3A 3CSVA 4JVGA 4PDSA 4F6SA 4AGWA 5L6PA 3DS6A 2QKRA 5K0XA 1MRVA 2GDOA 2YABA 2UW7A