4IXPA

Crystal structure of maternal embryonic leucine zipper kinase (melk)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
334
structure length
334
Chain Sequence
KDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIRIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIAFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Maternal embryonic leucine zipper kinase
publication title Structural basis for the regulation of maternal embryonic leucine zipper kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 334
sequence length 334
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ixpA00
1UA2A 4IWQA 5LMKC 4KKGA 4DGNA 3SKCA 2W9ZB 3MA3A 4ENYA 1YWNA 5JGAA 3IPHA 3Q3BA 1H01A 3FI3A 4RC2A 4IB0A 5C27A 2OF2A 1OIUA 3BWFA 3NAYA 3OTVA 2XA4A 5EW8A 3P79A 3ZO1A 4EBVA 3OWKA 2VO0A 3LLTA 3W16A 4ERKA 3MVMA 3ZSIA 4U3YA 4KKEA 4GG5A 4PQNA 2Y0AA 2XIKA 1ZLTA 4L8MA 3DKCA 3PE2A 4DLIA 5B2LA 3ZHPC 2YFXA 4IB1A 4F0IA 4EZ3A 1PW2A 4L01A 4J8MA 3JY9A 4B9DA 5TO8A 5J9ZA 3I79A 2XK8A 3R6XA 4D2RA 4F4PA 3VUMA 2J6MA 1YDTE 4I1ZA 4PNIA 4EKLA 5EM8A 1UVRA 3EYHA 3EFLA 1XBCA 2Y7JA 3DKGA 3E8NA 2WIPA 3QQJA 4X2KA 3V3VA 4TXCA 3ZLWA 4D2TA 4D55A 4L7FA 5T3QA 3FZSA 4ZSLA 1MRVA 4O38A 4EHZA 4YHTA 5LMKA 4JXFA 1KE5A 5JSMA 3MY5A 5EK7A 5CEQA 4C4IA 2QO9A 1H4LA 4FSTA 4LV8A 3JXWA 4RIXB 3PWDA 3MPTA 4J95A 4USDA 2WTKB 2WO6A 3ZDUA 5CI7A 5IEYA 5AV3A 3COMA 3VBQA 4YZDA 4E6CA 2X4ZA 2P3GX 4U8ZA 4HGSA 3NX8A 4R1YA 3U6IA 1YXSA 4IZ5A 4PP7A 4QMMA 3KVWA 4QMOA 4CV8A 1M2QA 2CPKE 5HKMA 4V0GB 3FWQA 4MQ1A 3UO4A 5A9UA 4F1MA 2W99B 4ALUA 5FEEA 4H36A 4QP9A 3BU6A 3FY0A 5CY3A 3V8WA 4OUCA 4YZCA 2BRGA 3GC8A 1WBTA 4ZLZA 3OXIA 3S0OA 3OD6X 4BIEA 1OPLA 4CZTA 3MBLA 2R9SA 4YC8A 2VNWA 1YQJA 3EFKA 3I6UA 3FXXA 4KWPA 5ICPA 4ANMA 1ZAOA 3V5WA 3ORXA 3P23A 1GIJA 4G3CA 5J5TA 3E3PA 4G3DA 3QTQA 3E7OA 5A4LA 2UZNA 2WTKC 4CXAA 4ZJJA 2GU8A 3PVWA 5DPVA 4RIYA 3ZU7A 1BKXA 4ZJVA 4ALVA 2OJFE 4M0YA 3FL5A 3RCJA 4K9YA 2YDIA 4FA2A 4MBJA 1J1BA 2UVXA 4DEGA 4QTAA 5HEZA 5HBJA 2VTHA 4FKPA 4E3CA 4WUNA 4AOTA 2R7IA 1SVGA 3QQGA 5HQ0A 1WBSA 4F9WA 4I4EA 2ZM4A 2YABA 3IONA 3ENHA 3ORKA 4GT5A 4U44A 3HRCA 1FGKA 5I0BA 5KMLA 5L8KA 3G0EA 4IJ9A 4MHAA 2EB3A 4EZ7A 3BU5A 1XR1A 4MEDA 4FGBA 5M4IA 3FQEA 3Q53A 3GB2A 4OBOA 4ZOGA 1A9UA 3GC0A 2NRYA 5BVNA 1PXLA 3EQGA 2PE1A 4BDFA 2F2UA 4IANA 1PXIA 3R7VA 1PXNA 4X7QA 2OJJA 5ANOA 5FDPA 2PVYA 3NCGA 5CNOA 1YWRA 3JPVA 5LVMA 4YR8A 5HZNA 1CDKA 4FZ6A 1Y8GA 3FQHA 2XRWA 2UW4A 4FKQA 3FJQE 4FTMA 5LVLA 2EB2A 4BCJA 3PY1A 4RG0A 3PSCA 2XUUA 3SDJA 3MN3A 3EQFA 4YNOA 3V6RA 3F5PA 3KKVA 5J87A 5A4TA 5IISA 5GJDA 2FSTX 3IGOA 3PVGA 4JIKA 4HVSA 2BDWA 3Q60A 3E87A 2JBPA 2YIXA 3NW7A 4FKIA 1BX6A 1ZMWA 4OR5A 3OW3A 3WYXA 3UQFA 4YHFA 3UVQA 2WQNA 4ALWA 3VS6A 4FC0A 4ZP5A 1JQHA 4P4CA 3MJ1A 4IHPA 4EORA 4EOPA 3CE3A 4NW6A 3HV6A 3FUPA 3I60A 3R63A 4DFXE 4DEEA 4EH8A 5JZJA 3TUCA 3BHHA 4BGQA 3ZBFA 3BQCA 4LFIA 5M44A 3FYKX 5EI8A 1H1SA 3P7CA 1YHWA 5AR3A 4BTMA 5CAUA 3O8TA 4CFFA 4IZAA 4D1XA 3F61A 4R5SA 3VS5A 4XOZA 2C5XA 1MQ4A 3GQLA 3KQ7A 1U54A 3WBLA 3OCSA 4JQEA 1UU8A 3FZ1A 4L53A 3I0OA 4BCQA 5LVPA 5J5SA 4O2PA 4DH5A 4XP0A 2PZYA 2QKWB 3TV6A 3R01A 4G17A 5HBEA 1ATPE 4EHEA 4ANNA 5EM7A 3GUBA 4XP2A 3VBVA 5LVOA 5H3QA 1BYGA 2HY0A 2WMAA 2BILB 3E64A 5CQWA 3DOGA 2QCSA 4MXZA 4YGAA 2X2KA 2BROA 3UOHA 2W4JA 3V5TA 2WOUA 2HOGA 4IADA 3WZKA 4DG0E 4NM5A 2DWBA 3F7ZA 1IG1A 4BI0A 2Y9QA 4G9CA 3ALOA 2XMYA 3MVJA 4CKRA 2B54A 3WZEA 2PK9A 2PMLX 3F2NA 3QTUA 3R83A 4RX7A 4UBAA 1SYKA 5AV4A 4O22A 3G2FA 5ITAA 4AS0A 3KVXA 1Q5KA 1R3CA 3E8CA 5C9CA 1YXUA 2PVJA 3IDCA 4KSPA 3LXKA 5KHWA 3O71A 4AFEA 2O0UA 4ASZA 4BDGA 5HX6A 4ZSJA 2RFDA 2JITA 4O0XA 4FTCA 1DAWA 3VAPA 3GENA 3DBCA 3D9VA 3KK9A 4C2VA 3P78A 2WD1A 4GJ3A 5KMJA 4KBCA 5CU6A 4ZK5A 4DFZE 2OI4X 3H30A 3PIZA 4FSYA 5M4FA 2BDJA 1PKDA 4F0FA 3EQRA 1CKJA 2W9FB 3DZQA 5ACKA 3T3UA 4TYEA 1GY3A 1OKVA 2PZRA 4KB8A 1YXVA 2HENA 1G5SA 2IWIA 3LFEA 4PPCA 4ANQA 2XNGA 5H8EA 2FSLX 2JBOA 3HVCA 4RFZA 4LUEA 3C51A 3IW5A 3NIEA 3KXNA 3QL8A 4AGDA 5KX8A 5FGKA 2JC6A 4YUQA 5LARA 1S9IA 1CMKE 4M68A 4CTBA 3KK8A 3D94A 3UNZA 3BE2A 4BICA 4DGMA 2Z7RA 3HMNA 2OZOA 4NKSA 3V01A 4EH2A 3KGAA 2QQ7A 3CKXA 5FDXA 3PIYA 1M52A 5CVGA 4RGJA 5CTPA 4FVPA 2OH4A 1ERKA 2IZSA 4JG8A 3V8SA 3RPRA 2YWPA 1Z9XA 1T45A 1GOLA 3ZCLA 4EZ5A 4L3JA 4K1BA 3CXWA 4C61A 3HYHA 3OMVA 1QPJA 2XIYA 4YNEA 4Z7HA 5M56A 3KF4A 4RLLA 3QLFA 1U5RA 3K5UA 3NDMA 4WG4A 1KE8A 4WIHA 2H9VA 5FTOA 3H10A 4IX4A 2X4FA 3R2BA 4JNWA 5HLPA 4XS2A 4G5JA 5DLSA 4E8AA 5GZ8A 3EHAA 5EFQA 4AZSA 2P55A 2QI8A 3ANQA 4O1PA 1Q4LA 4E6AA 4KA3A 2VO7A 3FPMA 2B9IA 4IVCA 5L3AA 3DDQA 4HYHA 4CVAA 4I92A 3VIDA 3VS1A 4CQEA 3DQWA 5AX3A 1FQ1B 2WTIA 2VGPA 3KMMA 2C6MA 4R3CA 3ZRLA 3W2RA 3HMOA 1JKLA 1GNGA 4OTRA 4YLKA 5HLWA 2P33A 2XYNA 3HA6A 4TZRA 3R9DA 1GIHA 4G3EA 4LGDA 4R7IA 3R7IA 4CRSA 5IA1A 2YCQA 1Y8YA 2JDSA 5DNRA 2BMCA 4RFYA 4RJ3A 4FTOA 4RVKA 5B7VA 4RZWA 3GCUA 3LCTA 3P0MA 4I0RA 4RMZA 3ZUUA 4TWPA 2C68A 4MH7A 5DEYA 2X2MA 3QTSA 5AR4A 3TZ7A 3UMWA 4M69B 3PVUA 3OWJA 4MXOA 4TL0A 5F94A 2C6DA 2JLDA 3PG3A 4EHGA 4IH8A 5CSHA 5CXHA 3MYGA 3GFEA 3ULIA 3T9TA 2H8HA 1TQMA 3QD4A 3ZFXA 2CGUA 3NUNA 4IC7A 3F3UA 3NW6A 4X21A 4YTCA 4O0UA 4HVGA 3OBGA 3Q9WA 1FVVA 4EHVA 3C4WA 5EM6A 3RTPA 4EOIA 3G6HA 4XG3A 3VRYA 4F70A 3FI4A 4IFGA 4FG9A 2GHLA 3RPVA 3UIUA 4AT3A 5KBRA 2WTVA 3QXOA 5DT3A 4YJRA 2UW3A 2ZM1A 4NIFA 4M13A 2VU3A 4FTLA 1H1WA 4I0SA 3BEAA 4NW5A 4RIOA 1FPUA 4AA5A 1L3RE 2ZDTA 5TF9A 2UZTA 5EKNA 2LGCA 4WNPA 3NNXA 5CS6A 5ANKA 3FC2A 4F6WA 5BMSA 4OAVB 4JR7A 3KULB 4Y46A 1NVSA 3F7WA 5FTQA 3QKMA 4AU8A 2QOQA 4ZLOA 4WSYA 3UC3A 2FA2A 3O8UA 2W1DA 3FYJX 3DLZA 2XJ2A 4PF4A 3EQCA 2I0VA 4BCOA 5DT0A 1XH9A 2RG6A 3BGPA 2BFYA 2CN5A 2Z7QA 3E5AA 3C4XA 3Q9YA 3QTXA 4IQ6A 2YDKA 3FDNA 4ITHA 4KS8A 3NGAA 2UW9A 2YJSA 4PMMA 5HVJA 4F7SA 3B2WA 4USEA 3TT0A 5IEVA 5TKDA 4MKCA 2QO7A 2W1GA 5HG7A 4I5MA 3CTQA 5HNGA 2C30A 4LL5A 2RGPA 3TXOA 2R5TA 4LRJA 4RRVA 3WARA 4FL2A 5DMZA 2OICA 3REPA 4BCIA 4FZAB 3COKA 2I0YA 2VWXA 4I5HA 3RHXA 2X7GA 4JX7A 4AN9A 1RDQE 5AAFA 1JSUA 2H34A 4GVJA 4GFMA 1MRYA 3T9IA 4MVFA 4KRCA 1RW8A 3DJ7A 3PTGA 3LFAA 3Q52A 4RC3A 5TOZA 4EKKA 3ERKA 4PX6A 2UZVA 2AC5A 3BYOA 2NRUA 1YKRA 3I5ZA 3MS9A 1PKGA 4KRDA 3RKBA 4PPAA 4DC2A 4W8EA 2X9FA 3AT4A 4QMVA 4FMQA 5EKOA 5C8KA 5J95A 3TCPA 4F7NA 3E3BX 2JDVA 2RG5A 4C38A 4AGCA 4JRVA 3IS5A 1KWPA 3HMMA 4TWNA 4C58A 5BUIA 3QKLA 4GCJA 2XK9A 3PPKA 4AG8A 4FIFA 3D83A 2RFSA 5M4UA 3ZOSA 3SA0A 3ELJA 5D11A 5DRBA 4HYSA 5FP6A 4E6DA 3RMFA 2VD5A 4Q9SA 3GGFA 4MD9E 3Q04A 4F9BA 4G6LA 5EDRA 3WF5A 4R3PA 3G9LX 4ZJIA 3G0FA 3CD3A 3IECA 2PMNX 4PMSA 4NT4A 4RSSA 3B8QA 1OIYA 4QYGA 2O63A 3BYMA 1KE9A 2OW3A 3F5UA 5CAPA 2AUHA 4R8QA 5CU2A 4ZTMA 3UGCA 4JS8A 4QP6A 2BZJA 3FZRA 4BDIA 2PVLA 5CSWA 5A4CA 2BAKA 2PVRA 1P5EA 3CD8A 4QMXA 3S95A 3DAEA 4FIIA 3UPZA 3EQHA 3QA8A 5FM2A 4HZSA 3O17A 4FT7A 3BPRA 2VTNA 2YERA 4JQ7A 3VQHA 4YZNA 3MV5A 3LOKA 2FB8A 3PFQA 2GDOA 3KRXA 4FK6A 3OTUA 1WBWA 2YM5A 3KCFA 3MTLA 2YISA 1GAGA 5DN3A 2EUFB 4CT1A 5HORA 2PVMA 3U51A 3TIYA 4D1SA 4FKWA 3W33A 3PWYA 3KB7A 5D7AA 1OPJA 3GXLA 3CGFA 3TJCA 1PXJA 3D14A 2X9EA 4BIBA 3W55A 2WGJA 4F9CA 5C26A 2IN6A 4FYNA 3TZ8A 2QOFA 3VN9A 5HNIX 4M12A 3DFCB 5D7VA 4RLKA 1IR3A 2OZAA 3C4ZA 4MXCA 3UODA 4BDKA 2W05A 5C1QB 2VTAA 3G6GA 5M4CA 1ZOHA 2ETKA 4CSVA 1GZOA 3QQUA 4EH9A 3F3WA 4HVHA 5HCXA 4DH8A 3VNTA 3Q2MA 5E8SA 3ACKA 2YEXA 4XV2A 2HXLA 2W0JA 3CP9A 4YJTA 2UZUE 3OS3A 3V5JA 4BCGA 4D4SA 4UX9A 3D2IA 2JIVA 4FKSA 5E90A 5IH4A 3BGQA 1U59A 4AA4A 2C5OA 3CR0A 4IAKA 3RGFA 3Q6UA 5DRDA 5AUTA 1OKZA 2GTNA 5BYYA 4ZS0A 5HU9A 4ZXTA 4FUYA 3ZDIA 2A27A 2ITZA 2VWIA 3B8RA 4W4XA 1UU7A 1KSWA 4RVTA 3R9NA 4Y5HA 4HPTE 4QMPA 1UU9A 4AW2A 3MH2A 4EC9A 4MWIA 2R0UA 4HVIA 2XP2A 3ITZA 3QZFA 1U5QA 5CEIA 4UZDA 5KCVA 1EH4A 1CM8A 4J1RA 3VO3A 2XYUA 3ZONA 2Y8OA 5CALA 4GFOA 4O96A 4X3JA 4AT4A 1Q97A 3RWPA 2C1BA 3SHEA 2ONLA 4Y83A 5TR6A 4YZBA 3C50A 4XV1A 3IOPA 1ZYDA 1REJA 2GS6A 2BZIB 3KN5A 4I93A 5ANIA 4GIIA 2GNIA 4M7IA 5IF1A 2WHBA 2ETMA 2V55A 2WQOA 4IIRA 3PXKA 4ZEGA 4D2VA 1YXTA 5EI6A 2WB8A 2PVNA 4FL3A 2PUUA 4Q9ZA 4FL1A 4PTGA 3W8QA 3QRKA 4PV0A 4RQVA 4FZDB 2GCDA 3UOKA 4FF8A 4Z7GA 1ZYJA 3AD6A 4A9TA 3R9HA 4YSJA 3C4FA 3IW4A 3QQHA 2ZV9A 4EH4A 3GCVA 5IPJA 1APME 4IZ7A 4O1OA 1ZY5A 2XEZA 1ZY4A 3HMIA 2ZV8A 4FBXA 4Q2AA 1CKIA 3V51A 4A4OA 4APPA 2QOHA 2J0LA 3TWJA 4L67A 2XNPA 4GK2A 2YAKA 4BI1A 4ZZNA 4WOVA 4S2ZA 3V04A 4NUSA 4CNHA 5IMXA 3MY0A 4FIGA 5HD7A 2DUVA 2PHKA 5CEMA 3EOCA 3KMUA 2WXVA 3UNJA 2ITYA 4D9TA 2RSVA 3PXYA 4BC6A 4FT9A 2XCKA 4QMYA 3NUYA 4YP8A 4QP4A 1J1CA 1I09A 1R0PA 2GNFA 5B2MA 3EFJA 5I9WA 3FMEA 1X8BA 4FIJA 3PXRA 5D1JA 4FTTA 3NRMA 3GQIA 4GJ2A 3RPYA 3QA0A 4JG6A 5GHVA 4FEQA 1W98A 2R3LA 4WBBB 4FSQA 3ZXZA 1W7HA 4D4VA 4IAYA 4AGWA 1B39A 3GU4A 5D9HA 3EQIA 1YI3A 4FT3A 4RBLA 5BVWA 3FAAA 2XKFA 3OUKA 3TV4A 3SW7A 2WEVA 4IWPA 5B2KA 1UWHA 4C57A 3PVBA 3DLSA 5CEPA 4ZSGA 3IK3A 1Z57A 3A7IA 4F09A 2OF4A 4F63A 3EQDA 3ZSGA 5M57A 3ZM4A 3ENMA 3ORNA 4GU9A 3HDMA 4UWBA 4EONA 4O27B 4XOYA 3V5QA 3BYUA 4UYNA 4ZTHA 5DVRA 1XBBA 3HP2A 3R02A 2BTSA 3NSZA 4C36A 4DEIA 3GVUA 3UQCA 3UNKA 5CF5A 5KO1A 3PZEA 3QTRA 4AW5A 4JBQA 1UKHA 4C37A 1ZZ2A 2J0MB 4I6HA 4XHKB 2R64A 2R0IA 4RZVA 3MB7A 4F9AA 3W8LA 4A9UA 3I1AA 4RA5A 5L6PA 4EQMA 3BX5A 1O9UA 3CPCA 3EQBA 3IDBA 4XLIA 3ROCA 3HL7A 3NWWA 5HG5A 5DH3A 3HV3A 4EK8A 4XEYA 2QR8A 3FLWA 3QUEA 2REIA 5I3OA 4L42A 4YSMA 3KU2A 4XBUA 5DIAA 3ZZEA 4G2FA 4CYIA 5HBHA 3QTWA 3POOA 4F6UA 1R39A 5AEPA 3PA3A 5T6KA 2ZMDA 3UO6A 4GT4A 4RIYB 5CLPA 4CT2A 1OB3A 1JSTA 3BI6A 4OT6A 4XRJA 3W2CA 2WTJA 4HW7A 2CKEA 1STCE 3GI3A 4C62A 2ERKA 2F2CB 5AUZA 4D0WA 2IJMA 3HLLA 1SMHA 2JEDA 3R2YA 4UMQA 4K2RA 3W2OA 5DG5A 5EYKA 1H26A 4U43A 3PRFA 4I6QA 4ZZMA 4J8NA 3WYYA 4KIQA 2NO3A 2UW8A 4QP7A 3POZA 1Y6BA 2BALA 2WTWA 2CCHA 1J91A 3RPSA 4Y72A 1XH8A 3AC3A 2KULA 3FL4A 4N0SA 4NFNA 3EZVA 5ETCA 4A07A 3Q5IA 2QOBA 2BRNA 2ITOA 4ASEA 4FTKA 5DT4A 4YJPA 5ANJA 1A06A 2FH9A 4RC4A 4OBPA 5AM6A 2F7XE 2AYPA 2C3JA 5JRSA 4WNOA 1IEPA 4QYFA 4U40A 2UZDA 5FM3A 3O0GA 2VUWA 3C4CA 3F69A 4LUDA 4O0TA 3U4UA 1HOWA 3DBQA 3K2LA 4L43A 4DH7A 4WD5A 4IFCA 4TNDA 4AUAA 5K5NA 1VR2A 3DPKA 3PUPA 3PP1A 4IVDA 1UNLA 3DBEA 3F3TA 3CPBA 2C0OA 4C3PA 2PVKA 3RK9A 4AW0A 5E8ZA 3DAKA 3F3ZA 2HELA 3NUSA 3OC1A 4FR4A 3H9OA 5I9UA 3QD2B 5BUJA 4L44A 2A19B 2OJ9A 2JIUA 4AF3A 4FNZA 3OCTA 1TVOA 4IB5A 5L2QA 3VJOA 3ODZX 3EZRA 4EC8A 4WT6A 5T68A 4PRJA 4D2SA 4HCUA 1PHKA 3RNYA 2WQEA 4KAOA 4WKQA 4MXYA 4JR3A 4EBWA 2XRUA 1VYZA 3P1AA 3HV7A 4KS7A 4CYJA 4BFMA 4FKJA 3KXGA 5FLFA 5KZ0A 2GPHA 2X6EA 3AC4A 3TV7A 4OTIA 3IGGA 3PIXA 3DAJA 5AAGA 3ALNA 3RAKA 2B1PA 2Z8CA 1G3NA 2OH0E 4L6QA 4FVRA 4U80A 3NUXA 4FSMA 3QC9A 3RAIA 3MPMA 1U46A 2YM4A 4GYIA 5F20A 3HX4A 5E1EA 3DBDA 2YITA 3DV3A 3ZYAA 4LMNA 5FXRA 3I81A 3PJ3A 4QMLA 3Q32A 3RBWA 3GFWA 3FY2A 4FTRA 3QHWA 4KKHA 5CSPA 3WF8A 2XM8A 4FSNA 4HGTA 2B4SB 4N6ZA 4XCUA 3QD0A 4U42A 2IW6A 2V0DA 1FVRA 2XM9A 3BHYA 4LGHA 5IUGA 2J5EA 3ZUTA 1BUHA 3QQLA 4DLJA 3PJ1A 2YIRA 3QX2A 3COHA 4NKAA 4IM3A 1Q8ZA 3QCQA 4O0SA 4RIWA 2YCRA 5HCZA 4RX8A 1H0VA 3RK7A 4DFLA 1YWVA 4ACHA 4BDJA 3ZBXA 3LQ5A 5JRQA 3HP5A 5LOHA 5EW9A 4FODA 4X2NA 3VUDA 4I22A 3K3JA 5DWRA 3R8PA 2G15A 3EWHA 4GL9A 3FHIA 3R8UA 5A4EA 2QHNA 4OTWA 4LMUA 3C9WA 4RJ8A 2IVTA 3TTIA 3HNGA 1WBVA 1FINA 4AWIA 4EEVA 2XEYA 3LCSA 4I0TA 5JFWA 4NWMA 1XJDA 2HW7A 4R7HA 4GEOA 2BR1A 2R3QA 4CMUA 2B7AA 3RALA 5JMSA 2UVZA 3EL8A 4Y73A 1Z5MA 5CVFA 4EOOA 4F6SA 2QODA 3FC1X 2KTYA 1YHSA 2ETRA 4H3PA 4FICA 4YJOA 1R0EA 3MH0A 3W2QA 4G31A 3ETAA 3BKBA 1WFCA 3KRLA 3MGYA 3WF6A 4CD0A 5KE0A 4USFA 2OGVA 1ZWSA 4L68A 4DTKA 4ID7A 2EXMA 2OXYA 4QPSA 3WF9A 4YLLA 5FG8A 4EUUA 5HIEA 3QKKA 2WMVA 4QYYA 3VVHA 4HOKA 4DGGA 5IUIA 4U3ZA 3LCDA 2B9HA 3ZFMA 5LMAA 3L1SA 1OKYA 4IJPA 4FKOA 5F9EA 5EM5A 2VN9A 3BQRA 5LJJA 1F3MC 2XBJA 4PMPA 2F49A 2HW6A 1H25A 2C0TA 2QONA 4S33A 2C6LA 4G34A 2EXCX 4PMTA 3PXFA 4NSTA 4EYMA 4FV0A 1UKIA 2F4JA 2W1HA 2YDJA 3QZIA 5EDPA 4DAWA 2PMIA 4EL9A 2P2IA 2ZB0A 4RX5A 3C4EA 1E1VA 2RIOA 4TYHA 4TYJA 2WMUA 2W1IA 4DEHA 2WTDA 2X7OA 4E1ZA 5ANEA 1OGUA 3O7LD 3OT8A 4FTIA 4WG3A 1XKKA 1P4FA 1WBNA 4AZVA 2X8IA 5IA2A 3ODYX 3B2TA 3CJFA 3OF0A 3AMYA 4TYIA 4UXLA 4CEGA 3OEZA 4JRNA 4HVDA 2JDRA 2A1AB 4OTFA 5H9BA 3UYSA 1O6YA 3HUCA 4X2JA 4BWPA 4EOSA 2F7ZE 3S1HA 2Q0BA 1O6KA 2R4BA 2PY3A 4W4YA 3WZUA 3ORIA 4MBIA 3KRJA 1M17A 4G3GA 4MK0A 4M97A 3QTZA 4XV9A 4C0TA 3MFSA 1ZARA 4GU6A 4AX8A 4P5ZA 5KMNA 3FLYA 3AD4A 3CY2A 3ZC6A 1UV5A 3KFAA 5F4NA 3H0YA 4L3PA 4OTPA 3CIKA 5CENA 1RQQA 3D7TA 3QYWA 3FMJA 2ITTA 4KD1A 4A9SA 4EOQA 1W84A 3VS3A 4C59A 3DBFA 5H8BA 3TNQB 4KIKA 4EOLA 2AC3A 1JNKA 4D4YA 3ACJA 4FV5A 2B52A 2VWWA 1V0BA 4JQ8A 2RL5A 3N51A 2QURA 5HIBA 4ACDA 4MWHA 3LJ0A 3O50A 3BV3A 4AE9A 4E5WA 2RF9A 3QUPA 5AR8A 4F65A 5M51A 2J0IA 3BU3A 4JG7A 2BZHB 4NK9A 2Z2WA 1K2PA 1KE7A 2WFYA 3WF7A 4A9YA 1VJYA 2VTTA 3NYOA 4GUEA 5A6NA 4QPMA 1ZYLA 2X6DA 2XBAA 3L9LA 3Q4TA 1JWHA 4NIFB 3TZMA 5J7BA 3OW4A 4IDVA 3A99A 1DM2A 4I94A 3GOPA 3R1SA 5CQUA 5K9IA 5KMKA 2C1AA 1WCCA 2YIQA 1OMWA 3QWKA 5AP6A 1JKKA 2W1EA 4XG2A 1IRKA 2J0KA 2EWAA 3GEQA 5AP4A 2W5BA 4YPSA 2WMSA 4FKUA 4I20A 4PDOA 3M2WA 3RINA 3W18A 5J7HA 4MNEA 4S30A 2XIZA 3MDYA 1Q8UA 2VTSA 3GBZA 3GCPA 3VS4A 2P4IA 1PMNA 1BL7A 3OWPA 3ZH8A 4FV2A 3AT2A 5HHWA 4Z16A 4ANLA 5LWNA 5GZ9A 3P4KA 4CFNA 4NM3A 5C8NA 1JAMA 3M11A 3NYXA 4M14A 5JFSA 4JT3A 4OW8A 4L45A 3DK7A 1Q8YA 2OJGA 4J52A 5I9YA 3H4JA 3LCKA 1P2AA 3HV5A 4FG7A 5LCJA 4L7SA 4FG8A 4OLIA 3OY3A 4L46A 3D7ZA 4QMZA 4X3FA 4AZTA 5E1SA 3S4QA 4OTQA 2GS7A 3R7OA 4RJ5A 1QPEA 3ZC5A 2YCFA 3JY0A 4I5CA 2HCKA 3OFMA 3BELA 3R22A 3LFCA 3KF7A 2EU9A 2GNGA 3C5UA 1LR4A 4QQ5A 5AUWA 3VC4A 4XRLA 4FKLA 3AMBA 3ZEWA 5JT2A 2XJ1A 4FT5A 1BMKA 2XNNA 3A4PA 3GU5A 3O51A 3PSBA 3ORZA 4G1WA 4FV1A 3SXRA 4QP8A 1OL7A 4UWCA 3OWLA 2E9PA 5AUXA 4BWXA 4BVUA 4MD7E 5J9YA 5EG3A 3AGLA 4J53A 3LFQA 3UG2A 4BDBA 4MNFA 3KA0A 1RJBA 4LG4A 3QRUA 2VAGA 2BUJA 2YCSA 2VTPA 4FNXA 4M84A 3EN4A 3D0EA 3Q4UA 5CVHA 4QMSA 4WUAA 3U6HA 2VTIA 2WELA 3MFUA 5D10A 1NVQA 3DXNA 1H27A 3NCZA 4J7BA 4X6RA 5A6OA 5LQFA 4BDHA 5BNJA 3Q6WA 2BRBA 4FOCA 4F0GA 3PP0A 5DR9A 2V62A 4PTEA 5IMEA 5BPYA 4R5YA 1OECA 3CTHA 4RT7A 2VX1A 1WVXA 2XKEA 2BVAA 4V01A 4BBMA 1PXMA 4ANBA 1SNXA 2OK1A 2WMBA 4BKJA 4BCPA 3NS9A 2UZEA 5IUHA 3BGZA 3G90X 5AX9A 3R7EA 4ASDA 4IVBA 4GH2A 2BPMA 3RNIA 2QNJA 4GV1A 5BVDA 3R7YA 4XYFA 5CT0A 1V1KA 2HYYA 2PWLA 5GZAA 2QOIA 3RJCA 4KIPA 5FQDC 1UWJA 5HNBA 5CANA 2CGXA 4I23A 3TKHA 4AOJA 2YN8A 3FXZA 4QTBA 2HXQA 3KY2A 2X1NA 2EXEA 2HAKA 1OIRA 2Z60A 5LCKA 1QL6A 2UV2A 3UOJA 3AC1A 5M53A 2OO8X 3R30A 3O8PA 5HTBA 2JDTA 4Z9LA 2J9MA 1XQZA 1XH5A 2OZAB 1Y91A 2QOLA 5AP0A 2J2IB 3OOMA 5HO8A 3UVRA 3OBJA 4BYIA 3FKLA 1OIQA 1CSNA 5C03A 4DG3E 4DYMA 5GNKA 4EOJA 2R3PA 4QP2A 4U5JA 3UZPA 3TNPC 3SW4A 3F5XA 1BLXA 2V7OA 3IOKA 2Y4IB 3TTJA 3VS2A 5CASA 4WRSA 4IX6A 3FMNA 5AUVA 4AN3A 5BVOA 4O91A 2W7XA 3CC6A 4UWYA 5FBNC 4IACA 2WU7A 2UZLA 4NJDA 2Y4PA 5CZHA 5AP2A 1UNGA 4RWLA 4EWHA 4U7ZA 3VW6A 1ZOGA 1YDSE 5CU3A 5AV0A 4K8AA 1NY3A 2Y6OA 4XNEA 5IEXA 2GMXA 4E4XA 2VWBA 5BVKA 5AR7A 2RFEA 4Y85A 3AOXA 3R8LA 3FKOA 3R9OA 4LV5A 3CLYA 3THBA 2XB7A 4BN1A 4F64A 2HZNA 4AN2A 1H07A 4CFUA 5IDPA 1DS5A 4JIAA 4IW0A 4D9UA 2GHMA 4MXXA 4FTAA 4O6EA 3UE4A 3FLNC 4FTNA 2HWOA 2OJIA 1XH4A 3DZOA 3MFRA 2VNYA 4RQKA 1PJKA 2XF0A 2Y4IC 1NA7A 3D5XA 3H9FA 4TT7A 3RM7A 4QO9A 3RWQA 4R1VA 4MYGA 4D2PA 3IW7A 3NYNA 4PL4A 5AR5A 3ORMA 2ZJWA 4GMYA 2PZPA 4W9XA 2QC6A 3WI6A 2VRXA 3DKFA 1ZYCA 4ANOA 2V7AA 2R3FA 4TW9A 5HD4A 2WAJA 5FXQA 1PY5A 1SNUA 2YZAA 5AP3A 4FK3A 1V0PA 1ZOEA 3A7JA 4NM7A 5IH5A 5B0XA 5EW3A 4EUTA 3G51A 1JVPP 2FGIA 3BYSA 3AD5A 2ONLC 2C6KA 3SRVA 2G1TA 3TKUA 4C4HA 4E20A 4OTDA 3BCEA 2Q0NA 3RHKA 3TZ9A 4YU2A 4BTJA 3WIGA 4I41A 4XP3A 4HNFA 3E92A 5ACBC 3NLBA 2GNJA 3TUBA 2C3IB 4BIDA 4OAUC 4E93A 4EOKA 2X8EA 5J8IA 1P4OA 4PDSA 4XUFA 1H1QA 3UTOA 4XH6A 2VWZA 4JAJA 4FV4A 3GU7A 2IZTA 2IW8A 5LXMA 3CCNA 5IA5A 5EOLA 3W1FA 2O3PA 1MQBA 3C0GA 3UIBA 3V6SA 2ESMA 3SXFA 3FXWA 4QOXA 4JI9A 5E92A 3L8XA 5L8LA 3OVVA 2QLUA 4K11A 4YJNA 4F99A 3M1SA 3MW1A 5A3XA 2VX0A 5L6WL 4BCFA 4GFGA 3MVLA 3HKOA 1DI9A 4OTHA 4U45A 1R78A 3CTJA 3DA6A 3T8OA 4O0RA 2VO6A 3FKNA 5G1XA 3EN5A 2HZIA 3PA5A 3VUHA 3DK3A 2HY81 3IG7A 5D41A 5ETFA 3EFWA 1YVJA 2YIYA 5E8VA 2QKRA 4N4SA 4BCMA 3QCSA 1Y57A 1ZXEA 3ZXTA 3F66A 1TQPA 3GU8A 4GRBA 2YM3A 3HGKA 3HUBA 4W4VA 2XZSA 4O0VA 4IE9A 1WZYA 4Q5EA 4UY9A 3NIZA 3AC8A 5ANGA 4NCTA 4EWQA 4QTEA 4XJ0A 4QMTA 4H1MA 5KMMA 2JKOA 3BZ3A 2FO0A 2WOTA 2P0CA 5EOBA 1ZYSA 2PE0A 1URWA 4CMTA 3OP5A 3NEWA 4CQGA 4IWDA 3OROA 3SD0A 2WU6A 2BIYA 3A7HA 5E8UA 5HCYA 3LW0A 3BLRA 5IH6A 5KNJA 2B53A 3V5PA 2PE2A 3CY3A 4A9RA 3DS6A 1F0QA 3D5WA 1YRPA 3AC2A 3E63A 4I21A 2IW9A 3R73A 3U6JA 4W4WA 4NM0A 3OT3A 5AMNA 5L4QA 4UEUA 5EI2A 2IZRA 1V0OA 3QGWA 1HCKA 3O23A 1KV2A 2CLQA 4U6RA 3VW8A 4A4XA 2WMWA 4QQTA 5KKRC 3F5GA 3NW5A 3PJ2A 4DFNA 4YTFA 1WAKA 3QQFA 5FD2A 4TTHB 2C5YA 4EI4A 1O6LA 1PMUA 3FLZA 2WMXA 3P5KA 1FOTA 4GT3A 3G5DA 4OTGA 1OKWA 4ZTNA 3MB6A 3VBYA 3W2PA 3I5NA 2OIQA 1JSVA 1HCLA 2ZB1A 2RFNA 3MIYA 4J97A 1M2RA 4HCVA 4NTTA 3I0QA 4X2FA 5CSXA 4L52A 2FVDA 3VHEA 4QP3A 5JFVA 3CS9A 4J71A 4R3RA 3C0IA 3DTCA 2BAJA 3ORTA 4CFXA 4UMPA 2Y6MA 3ORLA 4WBOA 4IX5A 4ANSA 4O0WA 4U41A 5HE3A 3TNHA 3IQ7A 1KOBA 2X2LA 4TN6A 2C5NA 4NH1A 3HMPA 4YC3A 4XMOA 2J4ZA 1OUKA 2C3LA 2J51A 3UO5A 2PMOX 2FUMA 2IVSA 5FEDA 2P2HA 3F82A 4J98A 5CEOA 3TNIA 4TY1A 4UYAA 4WNMA 1ZZLA 3EIDA 2PVHA 4QNAA 4HYUA 2QD9A 4EOMA 3JVRA 2C3KA 4ZAUA 2NPQA 4FVQA 2BRHA 2VGOA 4BBEA 3KXHA 3TN8A 4CTCA 4B99A 4IEBA 3BBWA 3R04A 4G6OA 5ETAA 3UBDA 3Q9XA 4LOPA 5F1ZA 4G3FA 2UW0A 4A4LA 1BI8A 2CN8A 4CCBA 3KRWA 2R3IA 4YPDA 5JQ5A 2HZ0A 5EHLA 4JBOA 1H24A 1TKIA 3AG9A 1NVRA 1LP4A 3DNEA 2F57A 4AFJA 3DFAA 3WE4A 2E9VA 5L8JA 4BB4A 3PZHA 3I7BA 2YLFA 1FGIA 4TRLA 3GCQA 5HG8A 3FMLA 2JFMA 2FSMX 2XK4A 4QP1A 2W1CA 4EQUA 2ITQA 3H3CA 2WQBA 3EKNA 5E7RA 3LQ8A 1SVHA 4YTIA 3JS2A 4XV3A 3MJ2A 3UOLA 5K3YA 3LZBA 1BI7A 3LFBA 3ZMMA 3BLHA 4BCHA 3PJCA 1MP8A 4M15A 4LGGA 4GW8A 4CV9A 3FLQA 2OXDA 4E4LA 4YBJA 5AP1A 4KNBA 3ZS5A 2HIWA 3HRBA 3LCOA 2JAMA 4W9WA 2O5KA 5DR6A 2W4OA 5K5XA 4PTCA 4O2ZA 1GJOA 3CQUA 2OSCA 2R3JA 2OG8A 2VTRA 3Q4CA 5HE0A 2CCIA 2PL0A 3CJGA 4BHNA 4TPTA 1OPKA 5CAOA 4YZ9A 3ZO2A 3VWAA 2R3KA 2XIRA 4ZTSA 3Q96A 4LOOA 4JDKA 2CJMA 2JAVA 4FTQA 4C3RA 2J0JA 2B55A 2BZKB 4K33A 1REKA 4RA4A 4RIWB 5HLNA 2GHGA 4AQCA 4E6QA 2BHHA 3CQWA 2HK5A 2XJ0A 3E93A 4TYGA 2Z7LA 5AP7A 3UIXA 5J9LA 3UG1A 5EYCA 4UMUA 4WRGA 3F88A 4F08A 5IA0A 2OXXA 1YOMA 4FT0A 5AP5A 4HJOA 3HZTA 4F1TA 2BRMA 4BZNA 1DAYA 4H39A 2OIDA 3PRIA 5A54A 1OL1A 4FX3A 4RVMA 2BKZA 4EQCA 4FNWA 3DK6A 4S31A 1LUFA 3UZTA 4FIEA 5CF4A 3ZTXA 3LM0A 2GQGA 5DFPA 4QYHA 3SX9A 2V5QA 5IG1A 5J79A 4CFVA 3RI1A 3L9NA 4QT1A 5CAQA 4M66A 3BLQA 1YDRE 2GFSA 2A0CX 1GZKA 3R1NA 3KXXA 4HYIA 5AV2A 3H9RA 2R3NA 3FSKA 3VF8A 1KE6A 4DG2E 3VUGA 5HICA 4M0ZA 1Y6AA 4I24A 2J90A 3EB0A 4IXPA 4G9RA 2YJRA 3TJDA 3DDPA 3QZHA 5BYZA 4ZIMA 1Q62A 4NFMA 3ZEPA 2R3HA 3RK5A 4AZWA 3V8TA 4BTFA 4NU1A 4E5AX 5ETIA 3Q9ZA 4LM5A 3VHKA 4DEBA 2CGWA 1W83A 3CQEA 4IWOA 4YLJA 1VEBA 4FKGA 4ONAA 3ZLYA 2JKMA 5HI2A 2W96B 1KOAA 2PSQA 2WMQA 5M55A 1Q99A 4Y95A 3RZFA 4EH6A 1AGWA 1W8CA 2YHVA 3QYZA 3NAXA 4RX9A 4C7TA 2C6EA 4S32A 3VQUA 4P7EA 3F6XA 4C02A 4D5HA 4B6LA 5JFXA 5K0KA 5HG9A 1PF8A 1U54B 3DJ5A 3LJ1A 3R8MA 3NPCA 4LYNA 4TYHB 4GVAA 3P9JA 4YTHA 4FSWA 2JKKA 3RZBA 3HA8A 2BIKB 3C1XA 3A8WA 5IU2A 2QOKA 3QQKA 5CT7A 5CU0A 2OFVA 3BHTA 2YLEA 2W5HA 3OY1A 4ITJA 4RWIA 5F95A 4DINA 5KMOA 3LFNA 4XLVA 5HE1A 4M8TA 3QU0A 2VV9A 2GS2A 3LFFA 4FKTA 5EHYA 3FZPA 2NP8A 4XX9A 3KL8A 3O96A 4FZFB 5DOSA 4GG7A 1B6CB 3IKAA 3VF9A 3GNIB 3MIAA 3LMGA 4AA0A 3ET7A 3F9NA 4IDTA 4CCUA 4A06A 4ACCA 3RAHA 1SVEA 3FMDA 3MH1A 2QU6A 1CTPE 4IAIA 3A62A 4QQJA 3OZ6A 4I5PA 5BQ0A 2Z7SA 2DS1A 1OL6A 4O0YA 4YJUA 5HVYA 5BX0A 3VRZA 4C2WA 3E88A 3MI9A 3D7TB 4PL3A 2WKMA 3QXPA 4G16A 3DU8A 5DBXA 3OUNB 1YXXA 1OUYA 2OWBA 2ITXA 4KIKB 5L6OA 1H00A 4BDCA 4ACMA 1UNHA 3PA4A 4BCNA 1GZNA 2X8DA 4JBVA 4RPVA 1Q3WA 3LPBA 3DB8A 1ZMUA 2UW5A 3EMGA 4QYEA 3HV4A 5EYMA 2ZV7A 4U81A 5IA4A 5C01A 4MQ2A 2BAQA 3PPJA 4BZOA 3U87A 3P7AA 4P90A 3UPXA 4U97A 4MF1A 4EH5A 2ITNA 4U79A 2ZMCA 3GOKA 4X0MA 5ANDA 2XK6A 5K4IA 4PDPA 4FIHA 4J96A 2H6DA 2XNMA 3WE8A 4FUXA 2O2UA 1H08A 2ERZE 3O7LB 3UDBA 2BFXA 4RWKA 3R1YA 4JDIA 5FWKK 3LAUA 4GS6A 4RIXA 5FEQA 2QO2A 4DFYA 4EK5A 2XNBA 3ZFYA 5D12A 5HO7A 4YZMA 2OBJA 2HZ4A 2XH5A 1DI8A 1I44A 2UW7A 4G5PA 4MNEB 3BIZA 3MTFA 3ULZA 4DGLC 5AAEA 4IVAA 5JKGA 2I40A 3D15A 3DY7A 4UV0A 3UP2A 4ACGA 2XKCA 4V0GA 3FHRA 3TL8A 1PXPA 2W17A 4FTUA 3ZZWA 5LVNA 1Q3DA 3EQPA 3FBVA 3CBLA 5BUEA 5JGBA 3NUUA 3FZTA 2WTCA 5I4NA 3AC5A 4RWJA 5HESA 4BL1A 4C4FA 4DHFA 3JUHA 4X3FB 4YMJA 4IM2A 4ZZOA 2A4LA 5HTCA 4E7WA 3LM5A 3IW6A 4PL5A 4F7JA 1R1WA 5JQ8A 3GT8A 4S34A 4EYJA 4H58A 1B38A 4JL9A 4XG4A 3NUPA 4KBAA 2G9XA 1PMVA 3A7FA 3FE3A 5HE2A 2X7FA 1GIIA 5CU4A 3N9XA 2J50A 1XHAA 2RKUA 3D2KA 2GTMA 3O2MA 3PLSA 3R7GA 4I4FA 4K77A 4DEAA 1SM2A 4E73A 4FSZA 4EJNA 3KMWA 2QVSE 3G33A 4ZTQA 1MRUA 2VX3A 3K5VA 2DQ7X 3PE1A 3TIZA 3C7QA 3NZ0A 1QPCA 3A8XA 5A46A 4Z55A 3FZOA 1XBAA 5HGIA 4QMQA 3BE9A 4X6QC 3QFVA 1U4DA 4MCVA 3OHTA 3DJ6A 3AT3A 4DITA 4PNKA 2OFUA 4ZSAA 4MXAA 1OVEA 3G9NA 4LOQA 4X3FC 5JZNA 4MX9A 3VS7A 4YO4A 3GCSA 3DQXA 2C4GA 3MH3A 3MA6A 3R8VA 1XWSA 5I5ZA 3QAME 2VWVA 4KBKA 5AWMA 5BVFA 2QG5A 2W06A 3PY0A 4XBRA 3FI2A 4CKJA 2E9NA 4QMWA 3ZRKA 5I3RA 2ITUA 5I9XA 3CGOA 4AGUA 3A60A 4DBNA 4AZFA 3AQVA 3SVVA 2W1FA 2XK7A 1H1RA 2EVAA 5AA8A 2J5FA 3EL7A 1ZRZA 5E91A 5IDNA 2W4KA 3EKKA 3ORPA 3RCDA 3W32A 3OOGA 4CRLA 3QF9A 2UZOA 3MWUA 3I7CA 4RJ4A 3FMMA 3QZGA 4LRMA 2E2BA 4QMUA 4UMTA 4JJRA 1JBPE 3P7BA 4ARKA 1UU3A 4KINA 4YURA 4HGLA 5FBOA 5CF6A 1JKSA 4BGGA 4YBKA 3QRTA 5IA3A 4C4EA 2PZIA 1FVTA 2CGVA 5I9VA 4BI2A 2VWUA 4JLCA 2GNLA 2ZDUA 4AZEA 4FV3A 5A4QA 3SXSA 3TEIA 4YJSA 3QALE 5JN2A 1YOLA 4NTSA 2I0EA 3L8PA 3C13A 4WNKA 5CZIA 4E5BA 4DGOA 4IAFA 5HO6A 2LAVA 5EHOA 3R8ZA 4OT5A 4CLJA 4K0YA 4FTJA 4PUZA 2XK3A 3R00A 2X0GA 3RAWA 3IW8A 3ZLXA 5IZFA 2YM8A 3MVHA 2JKQA 3NR9A 3VBXA 3SC1A 1JPAA 4JAIA 4JOAA 4APCA 1H1PA 3PSDA 4FSRA 4YO6A 5H2UA 4B4LA 4UB7A 2QLQA 2ZV2A 2XVDA 4L3LA 3ANRA 2GFCA 4HNIA 5CNNA 3ROYA 3TG1A 1Q24A 2XNOA 4AT5A 1SZMA 1YI4A 2YA9A 4BDAA 3EJ1A 4DN5A 4ZY4A 3LIJA 3C0HA 3UJGA 5LWMA 3A4OX 3KXMA 1H0WA 1OL2A 4DH1A 2C47A 2VO3A 4F1OA 4ZTRA 3EN7A 5AV1A 3HRFA 3PY3A 3QLGA 2VZ6A 3DKOA 2W5AA 3KCKA 3U4WA 3ZO4A 3U9NA 4AW1A 1LEZA 2I0HA 1S9JA 1TQIA 2C6OA 4IC8A 4OGRA 5GJFA 4NEUA 4Q5HA 4C35A 3BWJA 3FMHA 2UW6A 2C6TA 1LPUA 5FXSA 3BRBA 2YIWA 3OEFX 4YJQA 5IKWA 4QTDA 2JD5A 3VS0A 3KXZA 5I9ZA 2I1MA 5DE2A 4GIHA 4U0IA 2VTMA 2R3OA 3LJ2A 5EH0A 4B8MA 3IDPA 3BBTB 3PYYA 2FYSA 1XH7A 4M67A 3KN6A 3WZJA 3SOCA 3UVPA 4JVGA 5CWZA 3TACA 4UXQA 5AR2A 1H8FA 5DGZA 3RM6A 2C5VA 3H0ZA 3FLSA 1YOJA 4A7CA 1WVYA 2VTLA 4NZWB 3JVSA 4XG7A 4IX3A 4BWKA 3QWJA 4QPAA 3TUDA 3EYGA 3A7GA 4BDEA 1YI6A 2IZUA 4IAAA 3TKIA 3E62A 4JDJA 4ERWA 5L2SA 4PY1A 3SLSA 3QCYA 2ZYBA 2WNTA 5DEWA 2BTRA 3SRVB 3I4BA 3VULA 1IASA 1PYEA 3KC3A 1RE8A 5FP5A 3RP9A 5JK3A 1QMZA 4YJVA 3A61A 4EK6A 5GJGA 3PPZA 5L2WA 4TNBA 2PTKA 3GC7A 3COIA 4TWCA 5FRIA 4FKRA 5J1WA 1OM1A 4IAZA 4H3QA 5K4JA 4BRXA 2CLXA 5KZIA 2E9UA 3FPQA 5CSVA 3WIKA 2BDFA 1JOWB 2R2PA 3DGKA 3P86A 3LFDA 4G6NA 2J7TA 4CLIA 3L9MA 4DH3A 2SRCA 4BCKA 4FV8A 3Q5ZA 4CFMA 2VTQA 3D4QA 1NXKA 3HDNA 4ITIA 4O6LA 3WILA 2GNHA 3VJNA 1JKTA 5BMMA 3FQSA 2HWPA 3S2PA 3LE6A 3DTWA 2X81A 1FMKA 3UC4A 4F7LA 3E7VA 4FV7A 2CSNA 4IB3A 5AIKA 3OXZA 1Q61A 2UZWE 4FI1A 4FSUA 2XCHA 3MSSA 4Y5QA 4BBFA 2ZOQA 4GUBA 5J1VA 1VZOA 4V05A 4RJ7A 4D2WA 4HGEA 5G6VA 1Q8TA 2UVYA 1WMKA 3Q4ZA 4IBMA 4II5A 2ZM3A 5DR2A 5EDQA 5HX8A 2YAAA 4WO5A 3U9CA 1PXKA 4Y8DA 3F2AA 4WA9A 4FV6A 3QGYA 3P08A 4XG8A 3D5UA 1T46A 3PG1A 5DA3A 4ZY5A 4FZ7A 5HIDA 4ZSEA 4M69A 4E26A 5CXZA 2PZ5A 4GYGA 4CZYB 3R0TA 2R3GA 3DNDA 3OXTA 5CYIA 2F7EE 2JFLA 4MTAA 3ZLSA 4BGHA 2JGZA 4B0GA 2A2AA 3AXWA 3U8WA 3UP7A 5E8YA 2GSFA 2QOOA 3FMKA 4FYOA 3W10A 2C6IA 4YHJA 1MUOA 4HPUE 4YC6A 3PXZA 4D5KA 4XG9A 4C4GA 4D1ZA 1K3AA 3VBTA 2ITWA 3OCBA 4GK4A 4C4JA 3E8DA 4C3FA 3QD3A 1QCFA 3K54A 3FSFA 2ACXA 3JYAA 4BHZA 2JDOA 5CF8A 5LMBA 1XH6A 4FNYA 4AOIA 4B8LA 3VUIA 2ITPA 4BKZA 3QRIA 1URCA 4NCTC 1OITA 3SV0A 4WSQA 4M3QA 2IVUA 3EH9A 4KABA 2E9OA 4AAAA 2O8YA 2R3MA 3KULA 4B7TA 4I6BA 3DB6A 5TE0A 4D0XA 1W82A 3KRRA 3NYVA 5HTIA 1CKPA 5AADA 4BF2A 2XS0A 4KSQA 3R28A 4D58A 2CHLA 2WZJA 4WG5A 4GK3A 2YACA 4TKSA 4V04A 4CFWA 1KV1A 3R21A 3SOAA 2IVVA 4N70A 3ZUVA 1WBOA 1QPDA 3EN6A 5AA9A 2UZBA 3LFSA 3IO7A 4NJ3A 4ZLYA 4I3ZA 4CZUA 4EK3A 4W8DA 4BYJA 3NNWA 3QBNA 4EH7A 4OBQA 4JBPA 3CKWA 2QOCA 4LRKA 4C33A 1OZ1A 3LXNA 3QHRA 2VTJA 4K6ZA 3AMAA 4F9YA 3F3VA 4PWNA 3WZDA 1AQ1A 3GU6A 2O64A 4RVLA 4DCEA 3ZO3A 3S3IA 3W2SA 2CMWA 5KHXA 3BYVA 2WEIA 3QC4A 4HCTA 4EH3A 2DYLA 2QR7A 1H28A 1Q8WA 2G01A 3BHUA 5KKRB 4QTCA 2R7BA 3OCGA 4XG6A 3PXQA 4UZHA 1JLUE 4FV9A 1M2PA 3GP0A 3ZSHA 3K3IA 2R3RA 1OI9A 3MFTA 3TI1A 3ZRMA 5AUUA 4ASXA 3QRJA 3UQGA 3WOWA 3QUDA 3NNVA 1F5QA 5H8GA 2UUEA 3EN9A 4AXAA 4H3BA 4N6YA 2ZAZA 2BCJA 3SQQA 3VUKA 5KBQA 4AP7A 2B9JA 1Q41A 5TT7A 3LXLA 4HZRA 2G2IA 2WPAA 3HECA 5AIRA 4L9IA 3SAYA 5JEBA 3E8EA 1IA8A 4D28A 4UALA 3LHJA 3FV8A 4ZY6A 4ENXA 3AGMA 4CKIA 4QMNA 5HU3A 2VWYA 3A2CA 3DT1A 5AM7A 5L2IA 5CX9A 4IZYA 4MAOA 4BZDA 1E1XA 1J3HA 1VYWA 2QHMA 4QD6A 3KEXA 3L9PA 3UYTA 2BHEA 2ITVA 4LI5A 5DHJA 5A14A 3L8SA 4MD8E 4WHZA 1YW2A 3BEGA 5AUYA 3UIMA 3D5VA 5E8WA 2V22A 4RFMA 3BHVA 3QCXA 1YHVA 2X39A 2YM6A 4P5QA 4RJ6A 4Z3VA 1W0XC 2JIIA 5DI1A 1E9HA 5HOAA 4GSBA 3OG7A 5L2TA 2W1ZA 4O21A 4PPBA 1WBPA 4EK4A 3I6WA 1PYXA 2IO6A 4PP9A 4U9AA 2G2HA 4E4MA 2XNEA 2OIBA 3II5A 1M14A 4D4RA 3QX4A 1XO2B 3BV2A 3QTIA 4CMOA 4C34A 5JGDA 1PXOA 3LVPA 4BDDA 3MPAA 2WIHA 4UN0C 4AE6A 4TWOA 4MF0A 5AJQA 4L00A 2H96A 2YM7A 4QQCA 3DCVA 3HEGA 2O65A 4H1JA 2OKRA 4IMYA 4QNYA 2I6LA 3R7UA 4DEDA 5JH6A 2F9GA 3RPOA 1M7QA 3VUTA 2WMTA 5BVEA 5C8MA 3GC9A 1AD5A 1OL5A 2C0IA 3T3VA 5KUPA 1GZ8A 2G2FA 4IM0A 1K9AA 4FKVA 4FOBA 5E8XA 2ZVAA 1LEWA 3UMXA 1FMOE 3R1QA 3LXPA 3R71A 4C8BA 3CEKA 3M42A 4UMRA 1M7NA 2PVFA 1WVWA 3VBWA 1BL6A 4QRCA 2QU5A 4R6VA 2XIXA 4J99A 2B9FA 2C69A 4JX3A 4KIOA 2WQMA 3RVGA 3PJ8A 5KMIA 1ZMVA 5CEKA 4MBLA 4ZTLA 5HVKA 3S00A 4E4NA 3MY1A 4JDHA 4BTKA 5K0XA 4I6FA 5CI6A 4LQMA 4BKYA 2FSOX 2WMRA 2VTOA 5EYDA 3TNWA 3NNUA 3V5LA 3L8VA 4LL0A 1P14A 4P2KA 4AACA 2XKDA 5CAVA 4K18A 2CDZA 2OU7A 4X2GA 1PMEA 5E8TA
chains in the Genus database with same CATH superfamily
1UA2A 4IWQA 5LMKC 4KKGA 4DGNA 3SKCA 2W9ZB 3MA3A 4ENYA 1YWNA 5JGAA 3IPHA 3Q3BA 1H01A 3FI3A 4RC2A 4IB0A 5C27A 2OF2A 1OIUA 3BWFA 3NAYA 3OTVA 2XA4A 5EW8A 3P79A 3ZO1A 4EBVA 3OWKA 2VO0A 3LLTA 3W16A 4ERKA 3MVMA 3ZSIA 4U3YA 4KKEA 4GG5A 4PQNA 2Y0AA 2XIKA 1ZLTA 4L8MA 3DKCA 3PE2A 4DLIA 5B2LA 3ZHPC 2YFXA 4IB1A 4F0IA 4EZ3A 1PW2A 4L01A 4J8MA 3JY9A 4B9DA 5TO8A 5J9ZA 3I79A 2XK8A 3R6XA 4D2RA 4F4PA 3VUMA 2J6MA 1YDTE 4I1ZA 4PNIA 4EKLA 5EM8A 1UVRA 3EYHA 3EFLA 1XBCA 2Y7JA 3DKGA 3E8NA 2WIPA 3QQJA 4X2KA 3V3VA 4TXCA 3ZLWA 4D2TA 4D55A 4L7FA 5T3QA 3FZSA 4ZSLA 1MRVA 4O38A 4EHZA 4YHTA 5LMKA 4JXFA 1KE5A 5JSMA 3MY5A 5EK7A 5CEQA 4C4IA 2QO9A 1H4LA 4FSTA 4LV8A 3JXWA 4RIXB 3PWDA 3MPTA 4J95A 4USDA 2WTKB 2WO6A 3ZDUA 5CI7A 5IEYA 5AV3A 3COMA 3VBQA 4YZDA 4E6CA 2X4ZA 2P3GX 4U8ZA 4HGSA 3NX8A 4R1YA 3U6IA 1YXSA 4IZ5A 4PP7A 4QMMA 3KVWA 4QMOA 4CV8A 1M2QA 2CPKE 5HKMA 4V0GB 3FWQA 4MQ1A 3UO4A 5A9UA 4F1MA 2W99B 4ALUA 5FEEA 4H36A 4QP9A 3BU6A 3FY0A 5CY3A 3V8WA 4OUCA 4YZCA 2BRGA 3GC8A 1WBTA 4ZLZA 3OXIA 3S0OA 3OD6X 4BIEA 1OPLA 4CZTA 3MBLA 2R9SA 4YC8A 2VNWA 1YQJA 3EFKA 3I6UA 3FXXA 4KWPA 5ICPA 4ANMA 1ZAOA 3V5WA 3ORXA 3P23A 1GIJA 4G3CA 5J5TA 3E3PA 4G3DA 3QTQA 3E7OA 5A4LA 2UZNA 2WTKC 4CXAA 4ZJJA 2GU8A 3PVWA 5DPVA 4RIYA 3ZU7A 1BKXA 4ZJVA 4ALVA 2OJFE 4M0YA 3FL5A 3RCJA 4K9YA 2YDIA 4FA2A 4MBJA 1J1BA 2UVXA 4DEGA 4QTAA 5HEZA 5HBJA 2VTHA 4FKPA 4E3CA 4WUNA 4AOTA 2R7IA 1SVGA 3QQGA 5HQ0A 1WBSA 4F9WA 4I4EA 2ZM4A 2YABA 3IONA 3ENHA 3ORKA 4GT5A 4U44A 3HRCA 1FGKA 5I0BA 5KMLA 5L8KA 3G0EA 4IJ9A 4MHAA 2EB3A 4EZ7A 3BU5A 1XR1A 4MEDA 4FGBA 5M4IA 3FQEA 3Q53A 3GB2A 4OBOA 4ZOGA 1A9UA 3GC0A 2NRYA 5BVNA 1PXLA 3EQGA 2PE1A 4BDFA 2F2UA 4IANA 1PXIA 3R7VA 1PXNA 4X7QA 2OJJA 5ANOA 5FDPA 2PVYA 3NCGA 5CNOA 1YWRA 3JPVA 5LVMA 4YR8A 5HZNA 1CDKA 4FZ6A 1Y8GA 3FQHA 2XRWA 2UW4A 4FKQA 3FJQE 4FTMA 5LVLA 2EB2A 4BCJA 3PY1A 4RG0A 3PSCA 2XUUA 3SDJA 3MN3A 3EQFA 4YNOA 3V6RA 3F5PA 3KKVA 5J87A 5A4TA 5IISA 5GJDA 1TZDA 2FSTX 3IGOA 3PVGA 4JIKA 4HVSA 2BDWA 3Q60A 3E87A 2JBPA 2YIXA 3NW7A 4FKIA 1BX6A 1ZMWA 4OR5A 3OW3A 3WYXA 3UQFA 4YHFA 3UVQA 2WQNA 4ALWA 3VS6A 4FC0A 4ZP5A 1JQHA 4P4CA 3MJ1A 4IHPA 4EORA 4EOPA 3CE3A 4NW6A 3HV6A 3FUPA 3I60A 3R63A 4DFXE 4DEEA 4EH8A 5JZJA 3TUCA 3BHHA 4BGQA 3ZBFA 3BQCA 4LFIA 5M44A 3FYKX 5EI8A 1H1SA 3P7CA 1YHWA 5AR3A 4BTMA 5CAUA 3O8TA 4CFFA 4IZAA 4D1XA 3F61A 4R5SA 3VS5A 4XOZA 2C5XA 1MQ4A 3GQLA 3KQ7A 1U54A 3WBLA 3OCSA 4JQEA 1UU8A 3FZ1A 4L53A 3I0OA 4BCQA 5LVPA 5J5SA 4O2PA 4DH5A 4XP0A 2PZYA 2QKWB 3TV6A 3R01A 4G17A 5HBEA 1ATPE 4EHEA 4ANNA 5EM7A 3GUBA 4XP2A 3VBVA 5LVOA 5H3QA 1BYGA 2HY0A 2WMAA 2BILB 3E64A 5CQWA 3DOGA 2QCSA 4MXZA 4YGAA 2X2KA 2BROA 3UOHA 2W4JA 3V5TA 2WOUA 2HOGA 4IADA 3WZKA 4DG0E 4NM5A 2DWBA 3F7ZA 1IG1A 4BI0A 2Y9QA 4G9CA 3ALOA 2XMYA 3MVJA 4CKRA 2B54A 3WZEA 2PK9A 2PMLX 3F2NA 3QTUA 3R83A 4RX7A 4UBAA 1SYKA 5AV4A 4O22A 3G2FA 5ITAA 4AS0A 3KVXA 1Q5KA 1R3CA 3E8CA 5C9CA 1YXUA 2PVJA 3IDCA 4KSPA 3LXKA 5KHWA 3O71A 4AFEA 2O0UA 4ASZA 4BDGA 5HX6A 4ZSJA 2RFDA 2JITA 4O0XA 4FTCA 1DAWA 3VAPA 3GENA 3DBCA 3D9VA 3KK9A 4C2VA 3P78A 2WD1A 4GJ3A 5KMJA 4KBCA 5CU6A 4ZK5A 4DFZE 2OI4X 3H30A 3PIZA 4FSYA 5M4FA 2BDJA 1PKDA 4F0FA 3EQRA 1CKJA 2W9FB 3DZQA 5ACKA 4O4EA 3T3UA 4TYEA 1GY3A 1OKVA 2PZRA 4KB8A 1YXVA 2HENA 1G5SA 2IWIA 3LFEA 4PPCA 4ANQA 2XNGA 5H8EA 2FSLX 2JBOA 3HVCA 4RFZA 4LUEA 3C51A 3IW5A 3NIEA 3KXNA 3QL8A 4AGDA 5KX8A 5FGKA 2JC6A 4YUQA 5LARA 1S9IA 1CMKE 4M68A 4CTBA 3KK8A 3D94A 3UNZA 3BE2A 4BICA 4DGMA 2Z7RA 3HMNA 2OZOA 4NKSA 3V01A 4EH2A 3KGAA 2QQ7A 3CKXA 5FDXA 3PIYA 1M52A 5CVGA 4RGJA 5CTPA 4FVPA 2OH4A 1ERKA 2IZSA 4JG8A 3V8SA 3RPRA 2YWPA 1Z9XA 1T45A 1GOLA 3ZCLA 4EZ5A 4L3JA 4K1BA 3CXWA 4C61A 3HYHA 3OMVA 1QPJA 2XIYA 4YNEA 4Z7HA 5M56A 3KF4A 4RLLA 3QLFA 1U5RA 3K5UA 3NDMA 4WG4A 1KE8A 4WIHA 2H9VA 5FTOA 3H10A 4IX4A 2X4FA 3R2BA 4JNWA 5HLPA 4XS2A 4G5JA 5DLSA 4E8AA 5GZ8A 3EHAA 5EFQA 4AZSA 2P55A 2QI8A 3ANQA 4O1PA 1Q4LA 4E6AA 4KA3A 2VO7A 3FPMA 2B9IA 4IVCA 5L3AA 3DDQA 4HYHA 4CVAA 4I92A 3VIDA 3VS1A 4CQEA 3DQWA 5AX3A 1FQ1B 2WTIA 2VGPA 3KMMA 2C6MA 4R3CA 3ZRLA 3W2RA 3HMOA 1JKLA 1GNGA 4OTRA 4YLKA 5HLWA 2P33A 2XYNA 3HA6A 4TZRA 3R9DA 1GIHA 4G3EA 4LGDA 4R7IA 3R7IA 4CRSA 5IA1A 2YCQA 1Y8YA 2JDSA 5DNRA 2BMCA 4RFYA 4RJ3A 4FTOA 4RVKA 5B7VA 4RZWA 3GCUA 3LCTA 3P0MA 4I0RA 4RMZA 3ZUUA 4TWPA 2C68A 4MH7A 5DEYA 2X2MA 3QTSA 5AR4A 3TZ7A 3UMWA 4M69B 3PVUA 3OWJA 4MXOA 4TL0A 5F94A 2C6DA 2JLDA 3PG3A 4EHGA 4IH8A 5CSHA 5CXHA 3MYGA 3GFEA 3ULIA 3T9TA 2H8HA 1TQMA 3QD4A 3ZFXA 2CGUA 3NUNA 4IC7A 3F3UA 3NW6A 4X21A 4YTCA 4O0UA 4HVGA 3OBGA 3Q9WA 1FVVA 4EHVA 3C4WA 5EM6A 3RTPA 4EOIA 3G6HA 4XG3A 3VRYA 4F70A 3FI4A 4IFGA 4FG9A 2GHLA 3RPVA 3UIUA 4AT3A 5KBRA 2WTVA 3QXOA 5DT3A 4YJRA 2UW3A 2ZM1A 4NIFA 4M13A 2VU3A 4FTLA 1H1WA 4I0SA 3BEAA 4NW5A 4RIOA 1FPUA 4AA5A 1L3RE 2ZDTA 5TF9A 2UZTA 5EKNA 2LGCA 4WNPA 3NNXA 5CS6A 5ANKA 3FC2A 4F6WA 5BMSA 4OAVB 4JR7A 3KULB 4Y46A 1NVSA 3F7WA 5FTQA 3QKMA 4AU8A 2QOQA 4ZLOA 4WSYA 3UC3A 2FA2A 3O8UA 2W1DA 3FYJX 3DLZA 2XJ2A 4PF4A 3EQCA 2I0VA 4BCOA 5DT0A 1XH9A 2RG6A 3BGPA 2BFYA 2CN5A 2Z7QA 3E5AA 3C4XA 3Q9YA 3QTXA 4IQ6A 2YDKA 3FDNA 4ITHA 4KS8A 3NGAA 2UW9A 2YJSA 4PMMA 5HVJA 4F7SA 3B2WA 4USEA 3TT0A 5IEVA 5TKDA 4MKCA 2QO7A 2W1GA 5HG7A 4I5MA 3CTQA 5HNGA 2C30A 4LL5A 2RGPA 3TXOA 2R5TA 4LRJA 4RRVA 3WARA 4FL2A 5DMZA 2OICA 3REPA 4BCIA 4FZAB 3COKA 2I0YA 2VWXA 4I5HA 3RHXA 2X7GA 4JX7A 4AN9A 1RDQE 5AAFA 1JSUA 2H34A 4GVJA 4GFMA 1MRYA 3T9IA 4MVFA 4KRCA 1RW8A 3DJ7A 3PTGA 3LFAA 3Q52A 4RC3A 5TOZA 4EKKA 3ERKA 4PX6A 2UZVA 2AC5A 3BYOA 2NRUA 1YKRA 3I5ZA 3MS9A 1PKGA 4KRDA 3RKBA 4PPAA 4DC2A 4W8EA 2X9FA 3AT4A 4QMVA 4FMQA 5EKOA 5C8KA 5J95A 3TCPA 4F7NA 3E3BX 2JDVA 2RG5A 4C38A 4AGCA 4JRVA 3IS5A 1KWPA 3HMMA 4TWNA 4FRFA 4C58A 5BUIA 3QKLA 4GCJA 2XK9A 3PPKA 4AG8A 4FIFA 3D83A 2RFSA 5M4UA 3ZOSA 3SA0A 3ELJA 5D11A 5DRBA 4HYSA 5FP6A 4E6DA 3RMFA 2VD5A 4Q9SA 3GGFA 4MD9E 3Q04A 4F9BA 4G6LA 5EDRA 3WF5A 4R3PA 3G9LX 4ZJIA 3G0FA 3CD3A 3IECA 2PMNX 4PMSA 4NT4A 4RSSA 3B8QA 1OIYA 4QYGA 2O63A 3BYMA 1KE9A 2OW3A 3F5UA 5CAPA 2AUHA 4R8QA 5CU2A 4ZTMA 3UGCA 4JS8A 4QP6A 2BZJA 3FZRA 4BDIA 2PVLA 5CSWA 5A4CA 2BAKA 2PVRA 1P5EA 3CD8A 4QMXA 3S95A 3DAEA 4FIIA 3UPZA 3EQHA 3QA8A 5FM2A 4HZSA 3O17A 4FT7A 3BPRA 2VTNA 2YERA 4JQ7A 3VQHA 4YZNA 3MV5A 3LOKA 2FB8A 3PFQA 2GDOA 3KRXA 4FK6A 3OTUA 1WBWA 2YM5A 3KCFA 3MTLA 2YISA 1GAGA 5DN3A 2EUFB 4CT1A 5HORA 2AQXA 2PVMA 3U51A 3TIYA 4D1SA 4FKWA 3W33A 3PWYA 3KB7A 5D7AA 1OPJA 3GXLA 3CGFA 3TJCA 1PXJA 3D14A 2X9EA 4BIBA 3W55A 2WGJA 4F9CA 5C26A 2IN6A 4FYNA 3TZ8A 2QOFA 3VN9A 5HNIX 4M12A 3DFCB 5D7VA 4RLKA 1IR3A 2OZAA 3C4ZA 4MXCA 4O4DA 3UODA 4BDKA 2W05A 5C1QB 2VTAA 3G6GA 5M4CA 1ZOHA 2ETKA 4CSVA 1GZOA 3QQUA 4EH9A 3F3WA 4HVHA 5HCXA 4DH8A 3VNTA 3Q2MA 5E8SA 3ACKA 2YEXA 4XV2A 2HXLA 2W0JA 3CP9A 4YJTA 2UZUE 3OS3A 3V5JA 4BCGA 4D4SA 4UX9A 3D2IA 2JIVA 4FKSA 5E90A 5IH4A 3BGQA 1U59A 4AA4A 2C5OA 3CR0A 4IAKA 3RGFA 3Q6UA 5DRDA 5AUTA 1OKZA 2GTNA 5BYYA 4ZS0A 5HU9A 4ZXTA 4FUYA 3ZDIA 2A27A 2ITZA 2VWIA 3B8RA 4W4XA 1UU7A 1KSWA 4RVTA 3R9NA 4Y5HA 4HPTE 4QMPA 1UU9A 4AW2A 3MH2A 4EC9A 4MWIA 2R0UA 4HVIA 2XP2A 3ITZA 3QZFA 1U5QA 5CEIA 4UZDA 5KCVA 1EH4A 1CM8A 4J1RA 3VO3A 2XYUA 3ZONA 2Y8OA 5CALA 4GFOA 4O96A 4X3JA 4AT4A 1Q97A 3RWPA 2C1BA 3SHEA 2ONLA 4Y83A 5TR6A 4YZBA 3C50A 4XV1A 3IOPA 1ZYDA 1REJA 2GS6A 2BZIB 3KN5A 4I93A 5ANIA 4GIIA 2GNIA 4M7IA 5IF1A 2WHBA 2ETMA 2V55A 2WQOA 4IIRA 3PXKA 4ZEGA 4D2VA 1YXTA 5EI6A 2WB8A 2PVNA 4FL3A 2PUUA 4Q9ZA 4FL1A 4PTGA 3W8QA 3QRKA 4PV0A 4RQVA 4FZDB 2GCDA 3UOKA 4FF8A 4Z7GA 1ZYJA 3AD6A 4A9TA 3R9HA 4YSJA 3C4FA 3IW4A 3QQHA 2ZV9A 4EH4A 3GCVA 5IPJA 1APME 4IZ7A 4O1OA 1ZY5A 2XEZA 1ZY4A 3HMIA 2ZV8A 4FBXA 4Q2AA 1CKIA 3V51A 4A4OA 4APPA 2QOHA 2J0LA 3TWJA 4L67A 2XNPA 4GK2A 2YAKA 4BI1A 1W2DA 4ZZNA 4WOVA 4S2ZA 3V04A 4NUSA 4CNHA 5IMXA 3MY0A 4FIGA 5HD7A 2DUVA 2PHKA 5CEMA 3EOCA 3KMUA 2WXVA 3UNJA 2ITYA 4D9TA 2RSVA 3PXYA 4BC6A 4FT9A 2XCKA 4QMYA 3NUYA 4YP8A 4QP4A 1J1CA 1I09A 1R0PA 2GNFA 5B2MA 3EFJA 5I9WA 3FMEA 1X8BA 4FIJA 3PXRA 5D1JA 4FTTA 3NRMA 3GQIA 4GJ2A 3RPYA 3QA0A 4JG6A 5GHVA 4FEQA 1W98A 2R3LA 4WBBB 4FSQA 3ZXZA 1W7HA 4D4VA 4IAYA 4AGWA 1B39A 3GU4A 5D9HA 3EQIA 1YI3A 4FT3A 4RBLA 5BVWA 3FAAA 2XKFA 3OUKA 3TV4A 3SW7A 2WEVA 4IWPA 5B2KA 1UWHA 4C57A 3PVBA 3DLSA 5CEPA 4ZSGA 3IK3A 1Z57A 3A7IA 4F09A 2OF4A 4F63A 3EQDA 3ZSGA 5M57A 3ZM4A 3ENMA 3ORNA 4GU9A 3HDMA 4UWBA 4EONA 4O27B 4XOYA 3V5QA 3BYUA 4UYNA 4ZTHA 5DVRA 1XBBA 3HP2A 3R02A 2BTSA 3NSZA 4C36A 4DEIA 3GVUA 3UQCA 3UNKA 5CF5A 5KO1A 3PZEA 3QTRA 4AW5A 4JBQA 1UKHA 4C37A 1ZZ2A 2J0MB 4I6HA 4XHKB 2R64A 2R0IA 4RZVA 3MB7A 4F9AA 3W8LA 4A9UA 3I1AA 4RA5A 5L6PA 4EQMA 3BX5A 1O9UA 3CPCA 3EQBA 3IDBA 4XLIA 3ROCA 3HL7A 3NWWA 5HG5A 5DH3A 3HV3A 4EK8A 4XEYA 2QR8A 3FLWA 3QUEA 2REIA 5I3OA 4L42A 4YSMA 3KU2A 4XBUA 5DIAA 3ZZEA 4G2FA 4CYIA 5HBHA 3QTWA 3POOA 4F6UA 1R39A 5AEPA 3PA3A 5T6KA 2ZMDA 3UO6A 4GT4A 4RIYB 5CLPA 4CT2A 1OB3A 1JSTA 3BI6A 4OT6A 4XRJA 3W2CA 2WTJA 4HW7A 2CKEA 1STCE 3GI3A 4C62A 2ERKA 2F2CB 5AUZA 4D0WA 2IJMA 3HLLA 1SMHA 2JEDA 3R2YA 4UMQA 4K2RA 3W2OA 5DG5A 5EYKA 1H26A 4U43A 3PRFA 4I6QA 4ZZMA 4J8NA 3WYYA 4KIQA 2NO3A 2UW8A 4QP7A 3POZA 1Y6BA 2BALA 2WTWA 2CCHA 1J91A 3RPSA 4Y72A 1XH8A 3AC3A 2KULA 3FL4A 4N0SA 4NFNA 3EZVA 5ETCA 4A07A 3Q5IA 2QOBA 2BRNA 2ITOA 4ASEA 4FTKA 5DT4A 4YJPA 5ANJA 1A06A 2FH9A 4RC4A 4OBPA 5AM6A 2F7XE 2AYPA 2C3JA 5JRSA 4WNOA 1IEPA 4QYFA 4U40A 2UZDA 5FM3A 3O0GA 2VUWA 3C4CA 3F69A 4LUDA 4O0TA 3U4UA 1HOWA 3DBQA 3K2LA 4L43A 4DH7A 4WD5A 4IFCA 4TNDA 4AUAA 5K5NA 1VR2A 3DPKA 3PUPA 3PP1A 4IVDA 1UNLA 3DBEA 3F3TA 3CPBA 2C0OA 4C3PA 2PVKA 3RK9A 4AW0A 5E8ZA 3DAKA 3F3ZA 2HELA 3NUSA 3OC1A 4FR4A 3H9OA 5I9UA 3QD2B 5BUJA 4L44A 2A19B 2OJ9A 2JIUA 4AF3A 4FNZA 3OCTA 1TVOA 4IB5A 5L2QA 3VJOA 3ODZX 3EZRA 4EC8A 4WT6A 5T68A 4PRJA 4D2SA 4HCUA 1PHKA 3RNYA 2WQEA 4KAOA 4WKQA 4MXYA 4JR3A 4EBWA 2XRUA 1VYZA 3P1AA 3HV7A 4KS7A 4CYJA 4BFMA 4FKJA 3KXGA 5FLFA 5KZ0A 2GPHA 2X6EA 3AC4A 3TV7A 4OTIA 3IGGA 3PIXA 3DAJA 5AAGA 3ALNA 3RAKA 2B1PA 2Z8CA 1G3NA 2OH0E 4L6QA 4FVRA 4U80A 3NUXA 4FSMA 3QC9A 3RAIA 3MPMA 1U46A 2YM4A 4GYIA 5F20A 3HX4A 5E1EA 3DBDA 2YITA 3DV3A 3ZYAA 4LMNA 5FXRA 3I81A 3PJ3A 4QMLA 1W2CA 3Q32A 3RBWA 3GFWA 3FY2A 4FTRA 3QHWA 4KKHA 5CSPA 3WF8A 2XM8A 4FSNA 4HGTA 2B4SB 4N6ZA 4XCUA 3QD0A 4U42A 2IW6A 2V0DA 1FVRA 2XM9A 3BHYA 4LGHA 5IUGA 2J5EA 3ZUTA 1BUHA 3QQLA 4DLJA 3PJ1A 2YIRA 3QX2A 3COHA 4NKAA 4IM3A 1Q8ZA 3QCQA 4O0SA 4RIWA 2YCRA 5HCZA 4RX8A 1H0VA 3RK7A 4DFLA 1YWVA 4ACHA 4BDJA 3ZBXA 3LQ5A 5JRQA 3HP5A 5LOHA 5EW9A 4FODA 4X2NA 3VUDA 4I22A 3K3JA 5DWRA 3R8PA 2G15A 3EWHA 4GL9A 3FHIA 3R8UA 5A4EA 2QHNA 4OTWA 4LMUA 3C9WA 4RJ8A 2IVTA 3TTIA 3HNGA 1WBVA 1FINA 4AWIA 4EEVA 2XEYA 3LCSA 4I0TA 5JFWA 4NWMA 1XJDA 2HW7A 4R7HA 4GEOA 2BR1A 2R3QA 4CMUA 2B7AA 3RALA 5JMSA 2UVZA 3EL8A 4Y73A 1Z5MA 5CVFA 4EOOA 4F6SA 2QODA 3FC1X 2KTYA 1YHSA 2ETRA 4H3PA 4FICA 4YJOA 1R0EA 3MH0A 3W2QA 4G31A 3ETAA 3BKBA 1WFCA 3KRLA 3MGYA 3WF6A 4CD0A 5KE0A 4USFA 2OGVA 1ZWSA 4L68A 4DTKA 4ID7A 2EXMA 2OXYA 4QPSA 3WF9A 4YLLA 5FG8A 4EUUA 5HIEA 3QKKA 2WMVA 4QYYA 3VVHA 4HOKA 4DGGA 5IUIA 4U3ZA 3LCDA 2B9HA 3ZFMA 5LMAA 3L1SA 1OKYA 4IJPA 4FKOA 5F9EA 5EM5A 2VN9A 3BQRA 5LJJA 1F3MC 2XBJA 4PMPA 2F49A 2HW6A 1H25A 2C0TA 2QONA 4S33A 2C6LA 4G34A 2EXCX 4PMTA 3PXFA 4NSTA 4EYMA 4FV0A 1UKIA 2F4JA 2W1HA 2YDJA 3QZIA 5EDPA 4DAWA 2PMIA 4EL9A 2P2IA 2ZB0A 4RX5A 3C4EA 1E1VA 2RIOA 4TYHA 4TYJA 2WMUA 2W1IA 4DEHA 2WTDA 2X7OA 4E1ZA 5ANEA 1OGUA 3O7LD 3OT8A 4FTIA 4WG3A 1XKKA 1P4FA 1WBNA 4AZVA 2X8IA 5IA2A 3ODYX 3B2TA 3CJFA 3OF0A 3AMYA 4TYIA 4UXLA 4CEGA 3OEZA 4JRNA 4HVDA 2JDRA 2A1AB 4OTFA 5H9BA 3UYSA 1O6YA 3HUCA 4X2JA 4BWPA 4EOSA 2F7ZE 3S1HA 2Q0BA 1O6KA 2R4BA 2PY3A 4W4YA 3WZUA 1W2FA 3ORIA 4MBIA 3KRJA 1M17A 4G3GA 4MK0A 4M97A 3QTZA 4XV9A 4C0TA 3MFSA 1ZARA 4GU6A 4AX8A 4P5ZA 5KMNA 3FLYA 3AD4A 3CY2A 3ZC6A 1UV5A 3KFAA 5F4NA 3H0YA 4L3PA 4OTPA 3CIKA 5CENA 1RQQA 3D7TA 3QYWA 3FMJA 2ITTA 4KD1A 4A9SA 4EOQA 1W84A 3VS3A 4C59A 3DBFA 5H8BA 3TNQB 4KIKA 4EOLA 2AC3A 1JNKA 4D4YA 3ACJA 4FV5A 2B52A 2VWWA 1V0BA 4JQ8A 2RL5A 3N51A 2QURA 5HIBA 4ACDA 4MWHA 3LJ0A 3O50A 3BV3A 4AE9A 4E5WA 2RF9A 3QUPA 5AR8A 4F65A 5M51A 2J0IA 3BU3A 4JG7A 2BZHB 4NK9A 2Z2WA 1K2PA 1KE7A 2WFYA 3WF7A 4A9YA 1VJYA 2VTTA 3NYOA 4GUEA 5A6NA 4QPMA 1ZYLA 2X6DA 2XBAA 3L9LA 3Q4TA 1JWHA 4NIFB 3TZMA 5J7BA 3OW4A 4IDVA 3A99A 1DM2A 4I94A 3GOPA 3R1SA 5CQUA 5K9IA 5KMKA 2C1AA 1WCCA 2YIQA 1OMWA 3QWKA 5AP6A 1JKKA 2W1EA 4XG2A 1IRKA 2J0KA 2EWAA 3GEQA 5AP4A 2W5BA 4YPSA 2WMSA 4FKUA 4I20A 4PDOA 3M2WA 3RINA 3W18A 5J7HA 4MNEA 4S30A 2XIZA 3MDYA 1Q8UA 2VTSA 3GBZA 3GCPA 3VS4A 2P4IA 1PMNA 1BL7A 3OWPA 3ZH8A 4FV2A 3AT2A 5HHWA 4Z16A 4ANLA 5LWNA 5GZ9A 3P4KA 4CFNA 4NM3A 5C8NA 1JAMA 3M11A 3NYXA 4M14A 5JFSA 4JT3A 4OW8A 4L45A 3DK7A 1Q8YA 2OJGA 4J52A 5I9YA 3H4JA 3LCKA 1P2AA 3HV5A 4FG7A 5LCJA 4L7SA 4FG8A 4OLIA 3OY3A 4L46A 3D7ZA 4QMZA 4X3FA 4AZTA 5E1SA 3S4QA 4OTQA 2GS7A 3R7OA 4RJ5A 1QPEA 3ZC5A 2YCFA 3JY0A 4I5CA 2HCKA 3OFMA 3BELA 3R22A 3LFCA 3KF7A 2EU9A 2GNGA 3C5UA 1LR4A 4QQ5A 5AUWA 3VC4A 4XRLA 4FKLA 3AMBA 3ZEWA 5JT2A 2XJ1A 4FT5A 1BMKA 2XNNA 3A4PA 3GU5A 3O51A 3PSBA 3ORZA 4G1WA 4FV1A 3SXRA 4O4FA 1OL7A 4QP8A 4UWCA 3OWLA 2E9PA 5AUXA 4BWXA 4BVUA 4MD7E 5J9YA 5EG3A 3AGLA 4J53A 3LFQA 3UG2A 4BDBA 4MNFA 3KA0A 1RJBA 4LG4A 3QRUA 2VAGA 2BUJA 2YCSA 2VTPA 4FNXA 4M84A 3EN4A 3D0EA 3Q4UA 5CVHA 4QMSA 4WUAA 3U6HA 2VTIA 2WELA 3MFUA 5D10A 1NVQA 3DXNA 1H27A 3NCZA 4J7BA 4X6RA 5A6OA 5LQFA 4BDHA 5BNJA 3Q6WA 2BRBA 4FOCA 4O4CA 4F0GA 3PP0A 5DR9A 2V62A 4PTEA 5IMEA 5BPYA 4R5YA 1OECA 3CTHA 4RT7A 2VX1A 1WVXA 2XKEA 2BVAA 4V01A 4BBMA 1PXMA 4ANBA 1SNXA 2OK1A 2WMBA 4BKJA 4BCPA 3NS9A 2UZEA 5IUHA 3BGZA 3G90X 5AX9A 3R7EA 4ASDA 4IVBA 4GH2A 2BPMA 3RNIA 2QNJA 4GV1A 5BVDA 3R7YA 4XYFA 5CT0A 1V1KA 2HYYA 2PWLA 5GZAA 2QOIA 3RJCA 4KIPA 5FQDC 1UWJA 5HNBA 5CANA 2CGXA 4I23A 3TKHA 4AOJA 2YN8A 3FXZA 4QTBA 2HXQA 3KY2A 2X1NA 2EXEA 2HAKA 1OIRA 2Z60A 5LCKA 1QL6A 2UV2A 3UOJA 3AC1A 5M53A 2OO8X 3R30A 3O8PA 5HTBA 2JDTA 4Z9LA 2J9MA 1XQZA 1XH5A 2OZAB 1Y91A 2QOLA 5AP0A 2J2IB 3OOMA 5HO8A 3UVRA 3OBJA 4BYIA 3FKLA 1OIQA 1CSNA 5C03A 4DG3E 4DYMA 5GNKA 4EOJA 2R3PA 4QP2A 4U5JA 3UZPA 3TNPC 3SW4A 3F5XA 1BLXA 2V7OA 3IOKA 2Y4IB 3TTJA 3VS2A 5CASA 4WRSA 4IX6A 3FMNA 5AUVA 4AN3A 5BVOA 4O91A 2W7XA 3CC6A 4UWYA 5FBNC 4IACA 2WU7A 2UZLA 4NJDA 2Y4PA 5CZHA 5AP2A 1UNGA 4RWLA 4EWHA 4U7ZA 3VW6A 1ZOGA 1YDSE 5CU3A 5AV0A 4K8AA 1NY3A 2Y6OA 4XNEA 5IEXA 2GMXA 4E4XA 2VWBA 5BVKA 5AR7A 2RFEA 4Y85A 3AOXA 3R8LA 3FKOA 3R9OA 4LV5A 3CLYA 3THBA 2XB7A 4BN1A 4F64A 2HZNA 4AN2A 1H07A 4CFUA 5IDPA 1DS5A 4JIAA 4IW0A 4D9UA 2GHMA 4MXXA 4FTAA 4O6EA 3UE4A 3FLNC 4FTNA 2HWOA 2OJIA 1XH4A 3DZOA 3MFRA 2VNYA 4RQKA 1PJKA 2XF0A 2Y4IC 1NA7A 3D5XA 3H9FA 4TT7A 3RM7A 4QO9A 3RWQA 4R1VA 4MYGA 4D2PA 3IW7A 3NYNA 4PL4A 5AR5A 3ORMA 2ZJWA 4GMYA 2PZPA 4W9XA 2QC6A 3WI6A 2VRXA 3DKFA 1ZYCA 4ANOA 2V7AA 2R3FA 4TW9A 5HD4A 2WAJA 5FXQA 1PY5A 1SNUA 2YZAA 5AP3A 4FK3A 1V0PA 1ZOEA 3A7JA 4NM7A 5IH5A 5B0XA 5EW3A 4EUTA 3G51A 1JVPP 2FGIA 3BYSA