4UXLA

Structure of human ros1 kinase domain in complex with pf-06463922
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
288
Chain Sequence
IENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSIYKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pf-06463922 is a Potent and Selective Next-Generation Ros1/Alk Inhibitor Capable of Blocking Crizotinib-Resistant Ros1 Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ROS
total genus 91
structure length 288
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4uxlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4uxlA01
4CRLA 2PMIA 4EH8A 2YM8A 1SYKA 1YRPA 4LI5A 4OR5A 5H9BA 4FSYA 4O0YA 2X4FA 5DH3A 4EOQA 3UZPA 2UW4A 4CXAA 4QMUA 4LUEA 4O83A 4DFYA 4O82A 2YDKA 4A06A 3MVLA 3FMEA 1URCA 3FKOA 3OWPA 4K0YA 3QQUA 2OW3A 3VBYA 3FI4A 5A4QA 3W10A 3KREA 2R3FA 4E5AX 2PE1A 3M42A 4J52A 1MRYA 2OO8X 1RQQA 5E91A 1H8FA 2WKMA 4MXZA 5KX8A 4MXOA 4C4JA 5A14A 4D2WA 5JZJA 4HYSA 3D7TA 4GVJA 3KXXA 3K3IA 4EYMA 2PUIA 2UW8A 4CZUA 4IFCA 3BHVA 5HICA 5CF6A 3LMIA 2WAJA 1PMNA 5IH6A 4UZDA 4BTKA 4QYYA 4YSMA 4FSZA 4O22A 2YWVA 5JK3A 4YLJA 5HQ0A 3ATTA 2VTJA 3TT0A 4FF8A 3W2RA 3GCSA 5T68A 3TNIA 5JFSA 2XVDA 4GFGA 4N6ZA 2WQEA 4WOVA 5AR2A 4G3CA 2BAQA 3KU2A 2Y6OA 3NDMA 4CFWA 2GHGA 4JDKA 4P4CA 1YXUA 4TY1A 1ZZLA 5AP2A 1XJDA 3PDTA 2XP2A 5IDNA 1G5SA 4M7IA 3H0ZA 2BDWA 2UZEA 3OBJA 2F49A 2PUUA 3NEWA 4R5YA 4NUSA 3ZM4A 4F08A 5BUJA 3F5GA 3BWFA 4XG8A 1UNLA 1U54A 1RJBA 4RVLA 2VWUA 4ZSGA 3I0OA 3QQLA 4I92A 4EC8A 2J4ZA 1PHKA 1P4FA 3PXQA 3VS7A 4FSQA 3COIA 4GYGA 2VN9A 3IG7A 4X6RA 4NYEA 4TYHA 5L8KA 2P33A 3HA8A 2IVTA 4YJPA 4ZY4A 3D2IA 2I0HA 3E93A 4JR7A 5BVWA 4L67A 5HX6A 4ZZNA 2YEXA 4G34A 3RNIA 3GU7A 3O8UA 2GS2A 2RG5A 3VBVA 4KKGA 5HE0A 3BU5A 3VF9A 4C3FA 5JGDA 4G5JA 3JY0A 3A7HA 3KGAA 3MJ2A 4G9CA 2JEDA 3VNTA 4BBEA 3PWDA 4MXXA 4PTEA 3T3UA 3NLBA 4I24A 3SG8A 4IX3A 3T9TA 3ZEWA 3SD0A 4BIBA 4RLLA 4Y46A 4YJVA 3G9NA 4MXAA 4U80A 5CALA 3LMHA 4L01A 1A9UA 3ORZA 3RWPA 2Y9QA 5I3RA 3RPYA 2F9GA 4EOPA 4JLCA 4F0IA 1KV1A 3HAVA 3FXWA 3UOHA 4MYGA 4FV5A 4YC6A 4FKQA 4J96A 3VVHA 4ENXA 3LKMA 3KA0A 4FE2A 4L44A 4O7ZA 2FYSA 3RPRA 3LJ1A 3C51A 3LCTA 3NYVA 5L2IA 2V55A 3LCDA 3P78A 4Y72A 4EH9A 5C1QB 1L8TA 4J7BA 4IDTA 4USEA 4OBPA 1XQZA 3VWAA 4U43A 2VNWA 2WMUA 5DEWA 4RA5A 3VQUA 4I1ZA 5FLFA 4GIHA 4I5PA 1O6KA 4C61A 2G2HA 1W83A 5DI1A 1WBPA 3I6WA 3DBDA 3ZXZA 4TKSA 4ZMFA 3FLYA 5AP7A 3P7CA 3LAUA 2HZ0A 3RALA 4CCUA 2X4ZA 3ZFXA 2W1IA 2CLQA 5AP6A 4OTPA 3BLRA 5DHJA 3R7UA 3RI1A 3RVGA 4M3QA 4PPCA 2O0UA 2V22A 2WMWA 4RJ8A 5EW9A 3ZLYA 4F64A 4EJNA 3IW5A 5FRIA 4FK3A 3ZRMA 1ZY4A 4CFFA 1G8AA 2HWPA 4EBVA 2C3IB 4O2PA 3W2OA 2PE0A 3P08A 3MFTA 4CRSA 3EQGA 4I6BA 3C5UA 3FY0A 4PMTA 4TYGA 3QHRA 4FV9A 5BPYA 3DK6A 3SRVA 4IH8A 4O81A 1ZYJA 3DT1A 3GC0A 3EMGA 4QYHA 3QCQA 2EU9A 2YM6A 3R7GA 4FNYA 1GZKA 4XYFA 3ITZA 4C36A 4DH3A 4E4NA 5LQFA 3EQHA 4DFLA 3U54A 2C1BA 2OJ9A 3NYNA 3Q2MA 2IW9A 5BVDA 2I6LA 4YU2A 3NNWA 3QFVA 1V0PA 4XV9A 5A4TA 4IB1A 4CQGA 2JDTA 4RGJA 1ZZ2A 5JFVA 4MF0A 3FQSA 5JH6A 2J0JA 3DXPA 3L8XA 3QKLA 4RVMA 5GZAA 3TNQB 3NS9A 3U51A 3DFAA 4AAAA 3R1QA 2JBOA 4YZMA 5E8VA 1BMKA 2CGWA 2J50A 4AW2A 4ALVA 2BFYA 3PY1A 4I0SA 3MS9A 4IWDA 4USFA 4U40A 2UVXA 2X8DA 1ZARA 2XKFA 4MD9E 4YBKA 1LEZA 2OJGA 3UOJA 5TOZA 3NSZA 1JOWB 2CCHA 3P86A 1YXXA 3BWJA 3L9NA 3M11A 4G16A 4FUXA 3ELJA 4IVDA 4RZVA 4CFXA 1MQ4A 4C3PA 3ENMA 1CDKA 4GT5A 4FTNA 2C6LA 3KRJA 4Y8DA 5G6VA 2BALA 3FJQE 3VULA 4GJ3A 2V0DA 4GEOA 1W0XC 3PA5A 4X3FA 1K9AA 2RSVA 5E7RA 3QRUA 5M09A 1Y8GA 1ZMUA 3VO3A 4EZ5A 2O64A 4GH2A 4OGRA 4OT6A 3V04A 3LQ3A 4EK4A 4UMTA 2Y8OA 2ZV9A 4G3GA 4EH4A 5K0XA 5IUIA 4S32A 3U6HA 4HNFA 1KE8A 5LMAA 4CKJA 3CLYA 1HOWA 3LFBA 3LCOA 1H26A 4IWOA 4XP2A 5EW3A 3KC3A 4IM2A 3I6UA 4YP8A 3TZ7A 3UJGA 5D12A 4IZ5A 3HECA 3L8SA 4FKJA 2R3PA 1DM2A 4B8MA 1XH8A 2C1AA 2CNUA 3LW0A 3UO5A 2B55A 2XM9A 2GDOA 1YWVA 3GEQA 4CKIA 2F7EE 1SM2A 3ORIA 3QLFA 3S0OA 4HCUA 4CCBA 4RMZA 5AJQA 2ITPA 4XG6A 2G1TA 5HG9A 2WTJA 3KRLA 2ONLC 3ID6C 4D2VA 3FY2A 1OIRA 3PYYA 2ZDTA 3CEKA 4XRLA 1ND4A 3JYAA 4GYIA 4AA0A 3QQGA 3FI8A 4GKHA 4FGBA 3AOXA 3ULZA 5GINE 3AD6A 4UBAA 2JDSA 5DR9A 2X9FA 1IG1A 2J9MA 4N4SA 3CXWA 1TKIA 1WVWA 4FV0A 4ZSLA 2QCSA 1H27A 2WMTA 4XP0A 5HESA 2ACXA 5TKDA 3ZUVA 2PULA 4LGDA 1KV2A 3GCQA 1YI6A 3GQLA 4ID7A 4MKCA 5KMNA 3GOPA 1ZMWA 4MX9A 4BDFA 4QP3A 3P23A 4FIJA 4RIOA 4L8MA 4E73A 4BCNA 1LUFA 4JOAA 3THBA 5CAVA 3HUBA 3L8PA 4G3FA 5E8XA 4GSBA 4QQ5A 4F65A 3PG3A 3MY1A 4IHPA 2YWPA 4JQEA 4FSUA 2ZM1A 3U9NA 3D83A 5FBOA 3RZBA 4FL3A 3TZ9A 2VTOA 2C6OA 3NWWA 4FTAA 4D4RA 2WU7A 2OJFE 3O17A 4M97A 1WVXA 4JNWA 4H3PA 3UBDA 3D7TB 4I20A 4J53A 4WG5A 4DYMA 4F7NA 5CYIA 4RT7A 1H07A 1R78A 3D5UA 5M51A 3K5VA 3FZSA 3N9XA 4J98A 2GNIA 4Q2AA 4IAFA 4C8BA 3FXZA 4IZ7A 1AGWA 4I6QA 2CN5A 4AT5A 3RJCA 2CPKE 4CYIA 3VUTA 4FIIA 3EQRA 2IPXA 4YLLA 5KZIA 3SXRA 2B9HA 4EOKA 3JUHA 3PVWA 1JLUE 5HBEA 5EKOA 2W1HA 2RF9A 2W1GA 3TZ8A 4D2TA 3DJ6A 4JT3A 4BWXA 3F2AA 2PZPA 5CT0A 3G6GA 5L2WA 4XHKB 2FSLX 1CTPE 3Q9WA 4XS2A 4F9BA 3TNPC 5L3AA 1OPLA 5FEQA 2VO0A 3VBWA 4Z7GA 4F9CA 1UVRA 5EI8A 2UV2A 2Z60A 1O9UA 3PSDA 1R0PA 2H8HA 4IC8A 1KE6A 4FT7A 5EH0A 4ZXTA 3TXOA 3LFAA 3UP2A 2WZJA 1OL2A 1BYGA 3ZZWA 1VYZA 4BY9E 4Y85A 4G6LA 4XNEA 5LMKC 3FLWA 1UKIA 3Q4UA 4I94A 2AYPA 3AD5A 4TXCA 5DMZA 3JXWA 1TQMA 5I9WA 3ULIA 4UV0A 2CGUA 3U8WA 5CS6A 4PQNA 5HGIA 4DEIA 2ITXA 3ZYAA 4ANMA 4XP3A 4OAVB 3MI9A 3COMA 5ANOA 4FKLA 1ZAOA 2J0LA 3RAWA 2XIKA 5IA2A 2ZMDA 3NCZA 4WG4A 4DT8A 1JNKA 2BZJA 3KFAA 1PXJA 1ZYDA 3OW4A 4FT0A 5CAPA 2V7OA 3NPCA 3HGKA 2NRUA 4P7EA 4PTCA 5BMSA 3PZEA 4ZZMA 2J51A 4RZWA 3DNEA 5HEZA 4QMPA 2NO3A 4ONAA 4ZTRA 5FQDC 1IAHA 4EHEA 4FL2A 3R8UA 4AZWA 2PVMA 5E92A 4BIDA 3FEGA 2J0MB 3TKHA 4EH7A 1YVJA 4DG2E 2QHNA 4ZAUA 3HUCA 1OVEA 4FIFA 3UQFA 4ACHA 3R6XA 2YISA 1I09A 1OL7A 2C5YA 3FI3A 4UWBA 3D15A 4UMQA 4ZMEA 2Q0BA 4FZ7A 2Z02A 5FM2A 3UGCA 3WF5A 4FKTA 4CTCA 5L2QA 1FPUA 2OKRA 4NIFB 1SMHA 3DCVA 5BVOA 3CBLA 3R63A 5A4CA 2PUNA 4LRMA 4JQ7A 3FMNA 3LXNA 3QTQA 5KE0A 3ROCA 3UIMA 4C4HA 4O2ZA 5IQDA 2E9PA 3AT4A 3FQHA 5C8MA 3AC8A 4D9UA 3P4KA 3UDBA 5JFXA 3Q4TA 3QCYA 4C2VA 3FHIA 4KIPA 4R1YA 2C47A 3QD4A 3IK3A 5EYCA 3NMUF 3U6IA 3ZBFA 2BFXA 3NAYA 2VX3A 4AFJA 4D1ZA 2ONLA 5CU6A 4I0TA 3L1SA 3V5WA 2C69A 4QYGA 4FUYA 4BI2A 2PVLA 4ACGA 4Q9SA 2WTCA 3KMMA 3MH3A 4DAWA 1J91A 1UV5A 5CEKA 5K5XA 2VRXA 5AAEA 1GZ8A 3F88A 3QQHA 1Y6BA 1OKWA 2XNEA 3FYKX 3PIYA 2VX0A 4PUZA 3VC4A 4AG8A 2O65A 3WZJA 4EL9A 3A62A 3F7ZA 3RAKA 1B6CB 4FR4A 2YCRA 3GI3A 4DEAA 2OLCA 3TEIA 5CASA 5CAUA 4S2ZA 4AOJA 4CTBA 4RIYB 5HO7A 3L9MA 4X21A 4O96A 4RWKA 3SLSA 4F0FA 2BZKB 3ORLA 2PTKA 4HGLA 2W1CA 1H1RA 3KN6A 3OD6X 5CWZA 3LFCA 2WO6A 4BCMA 2HW6A 2WMXA 2EB2A 3PJ3A 1YOMA 1LR4A 5CU2A 5HTCA 3E87A 3ETAA 3NNVA 4ZOGA 4RC4A 1H25A 2R3KA 3OTVA 2B53A 3C0HA 4W4XA 3DOGA 2OZOA 4R7IA 4YJRA 3VJNA 4FVRA 3CE3A 3P79A 2OIDA 1ZOEA 3ZLWA 4ALWA 1PMEA 3A99A 4AN9A 2C6DA 4E8AA 2EXMA 2QOHA 1Q4LA 2IVSA 2RFSA 3UIBA 3WOWA 4AZFA 3MDYA 3WE4A 3ZSHA 4KB8A 4XX9A 4FMQA 3ENHA 3C50A 1STCE 1YDSE 4EOOA 2LAVA 3CCNA 4FTJA 1WBOA 2HXLA 3ZO3A 2IN6A 1JBPE 5FM3A 4BGQA 4FV4A 5I9VA 4KRCA 3RNYA 5JQ5A 1T46A 4L53A 2F7ZE 3PXYA 1M14A 2OZAA 3QD3A 3ZLSA 3WIKA 1REKA 2QOOA 5HCZA 4J8MA 4LUDA 4TZRA 4I23A 3FC2A 4P5ZA 3E64A 2QR8A 4S31A 3ZLXA 4KIKA 2ESMA 3D5VA 2VTRA 5HU9A 5CSVA 5LVOA 5CVGA 4R3CA 3TIYA 2O8YA 3FSFA 1YI4A 4K1BA 3POZA 4C35A 3GU4A 1W8CA 2BILB 2YM3A 1Q97A 4YR8A 4BIEA 1OIQA 2VX1A 3FLNC 4QTDA 5BYYA 2YA9A 4JRNA 3PPZA 2Q83A 2I1MA 3V5TA 2OSCA 4IWPA 4E6DA 2HXQA 3S4QA 1SVGA 4PWNA 3QYZA 2GNFA 5AP5A 1PXKA 5HIDA 4DFBA 2FO0A 3AXWA 3QUPA 3QZHA 4FVQA 4FIGA 4H1MA 4QPMA 3CTJA 3KK8A 4QTBA 2C3LA 5C26A 3FMHA 1B39A 2GMXA 3C4FA 4II5A 5GJFA 3OROA 5AM7A 4FT5A 2C5NA 2H96A 5A3XA 5HNGA 4NU1A 3F3TA 5HD4A 2ITWA 2RFDA 4WNOA 5L2SA 4AA5A 1OBDA 4JXFA 4JX3A 4ASZA 4MBIA 4WBOA 3TTJA 4ZJVA 2GFSA 4EUUA 4IB5A 3UVPA 2JIIA 4GFMA 3EOCA 4RIWA 1HCKA 1PW2A 1A48A 4TYIA 1APME 4EKKA 4OTQA 4G5PA 5AUZA 2XK7A 5KMMA 3TDWA 3BGPA 3VQHA 4U42A 2ETRA 5IISA 4RPVA 2Y0AA 4RVTA 2XIXA 2IVUA 3MFUA 4IM0A 2UZUE 4EWHA 4AE9A 4BTMA 1BUHA 4B4LA 3UYTA 2YJSA 2UZNA 2BMCA 4AP7A 5J1WA 4ALUA 3DJ5A 2WU6A 3NUAA 3CJGA 1OPKA 4XEYA 1DI9A 3A4OX 4C58A 4X6QC 2UZLA 4IB0A 2P2HA 3DBFA 4BDKA 4S33A 1BKXA 4GL9A 3U87A 4D2RA 3PA4A 4IIRA 5HU3A 3F82A 4PMSA 2UZVA 5DNRA 4KAOA 4EH2A 3OG7A 5J5TA 4ERWA 4QP9A 4J1RA 3C13A 4B6LA 4FTMA 3DAEA 4E3CA 4RIXA 1H1PA 1OL1A 3E3PA 3H9FA 3PG1A 4TYEA 4E5WA 2YCQA 3NW7A 4JI9A 5K5NA 2V62A 3ZO2A 3MV5A 2PVNA 3DB6A 4QP7A 3QTXA 4YC3A 5I9UA 2BVAA 1GIHA 4CMTA 3EFWA 4CZYB 2IG7A 4HOKA 5KMJA 4NEUA 4A9TA 1JSUA 2WQOA 5EFQA 3WE8A 4L45A 3BEGA 2OWBA 3HMIA 4W8DA 3FPMA 4JBQA 4KA3A 2WTVA 3FV8A 3POOA 3Q9ZA 5CVFA 4YPSA 4EOSA 5KHXA 4O6LA 1OL5A 4LL5A 3UPXA 4TT7A 5DLSA 4NT4A 4TTHB 4MQ1A 4YO6A 3SW7A 3MH2A 3VBXA 4XBRA 3MTLA 1H24A 3NIZA 4IXPA 3E3BX 4TWNA 5CU4A 4WBBB 4CEGA 2XK3A 1E1XA 3HMNA 3UMXA 5L2TA 4LV8A 5KZ0A 3V5LA 2OJJA 3CTHA 2XNBA 2R3HA 4CD0A 3R9HA 4DF3A 2W99B 3OEZA 2XM8A 3Q3BA 5AX9A 3NIEA 5E9EA 3BBWA 4PX6A 3ZM9A 4N57A 3T9IA 5ITAA 5CZIA 3F3UA 4BGGA 3QZFA 3WYYA 1CSNA 3LFNA 3OF0A 3PE2A 1KUTA 3OXTA 4MF1A 3VHEA 5HI2A 5FXQA 4WT6A 2CJMA 3F3ZA 1U5RA 3TWJA 4C7TA 4LGGA 1IAJA 2PZ5A 5ETCA 3QQJA 5IZFA 2YIRA 4L42A 4R7HA 2UZWE 5KMKA 4O7SA 4C4GA 3WARA 3T3VA 4DTKA 3AC1A 5E8UA 4FNZA 3DZQA 1PXMA 2VWZA 3DBEA 3SAYA 3TUDA 2BIYA 3IW7A 3VUMA 4GJ2A 4BCPA 2OFVA 4PMMA 4PPAA 5L4QA 5B2MA 2XRUA 2EXEA 4A9RA 2XKDA 4O21A 2ITUA 4MNEA 1SNXA 5CU3A 1OECA 2FSOX 1PXNA 3HV3A 2BHHA 2E9NA 4WRGA 2C5OA 3JS2A 3JVRA 4JL9A 3KKVA 1S9JA 2WTDA 4ZIMA 4BYJA 4O7TA 5LMBA 3NZ0A 4IDVA 4YNOA 3OBGA 2QOIA 3E92A 1IEPA 4XJ0A 4DFNA 4CQEA 4LG4A 4F6UA 3MY5A 1VZOA 2GNGA 3FLQA 5TR6A 1PXOA 3KMWA 2R3GA 2C6IA 2GS6A 3UC3A 1E9HA 3F3WA 4IJ9A 2WTKC 4WSYA 2XKCA 1W98A 2R9SA 3MVHA 5A4LA 2XNNA 3KB7A 4OBQA 2QOFA 5HBJA 3V01A 2GSFA 4IZYA 4KS7A 4O0WA 4XV1A 4ZS0A 5I4NA 2UW0A 4E4LA 5L8LA 3L9LA 4L46A 4M14A 3BPRA 4X2GA 2B7AA 5AUVA 5GHVA 1V0BA 3CR0A 4BKYA 1K2PA 3KXZA 4H3BA 3I60A 4ZTHA 4QMQA 3DS6A 5E4HA 3QWJA 2XJ1A 4RSSA 5AV3A 4J99A 3BHHA 4K18A 1H08A 4QMMA 1U59A 4F7SA 5CSHA 2ERZE 4JQ8A 3I79A 4Q5EA 4ZK5A 2DWBA 3PE1A 3LQ5A 3C0GA 2B9FA 2JC6A 3DPKA 2B1PA 4MNFA 2WIPA 3FAAA 2PVRA 1PXPA 3ZRKA 3UYSA 3BBTB 4BHZA 4I21A 1OGUA 3HV4A 5CEMA 3H9RA 3CQUA 1UNHA 1JAMA 4NIFA 5DT0A 4IJPA 5AEPA 4FIHA 5KKRB 3CD3A 2C0OA 4FSRA 3R04A 3TUCA 2R3QA 3HX4A 2VGPA 4KS8A 2OIBA 4BTJA 4GUBA 5CF8A 5DE2A 3A61A 4HGSA 2ITVA 4U8ZA 3BU6A 2RFNA 3FLSA 2W1ZA 5M4UA 4WRSA 2GS7A 4WUNA 4EKLA 4FBXA 4O0RA 4XV2A 3RK7A 2CN8A 4ZS4A 3LM5A 3RKBA 2YLFA 4D58A 2FSMX 2ZB1A 3EQIA 4O0VA 3RAIA 4ARKA 1A06A 4D2PA 3LLTA 4FKOA 2C3JA 4XG9A 1P5EA 4E4XA 3OTUA 4NSTA 4XMOA 2R4BA 4PP7A 2IZUA 1UA2A 1VYWA 1DAYA 3BHTA 1CM8A 3OZ6A 3IGGA 3CC6A 4NTTA 3RCJA 3Q60A 4Z55A 3WILA 5FTQA 2FH9A 2PVHA 5G1XA 5IQEA 2WPAA 2AC3A 2BDJA 2E9UA 2ITOA 2Y7JA 4LGHA 4NZWB 4YTCA 4UWCA 3VUGA 2YZAA 1PKDA 4APCA 5M53A 4OTHA 4EHGA 1T45A 5EDPA 2XEZA 2I0VA 2IO6A 2IZTA 3W2QA 2X6DA 3TKUA 5M55A 4E4MA 3PIXA 3BIZA 3BQRA 3ZBXA 1WMKA 4FYNA 4FKRA 3L8VA 2WTIA 5EM8A 4O7NA 4IEBA 2O63A 4CKRA 5M07A 1Q8TA 2OICA 1ZXEA 3K5UA 4RC3A 5EK7A 1BLXA 3HV7A 4GV1A 4BCHA 2PUPA 2HY81 3UVRA 2QKRA 3A7JA 3UTOA 4GKIA 4BR3A 3SKCA 4M0YA 2HAKA 2ZV2A 4JBOA 3P5KA 4U45A 2HZIA 4FNXA 5CSWA 5IQAA 5DR2A 4LM5A 3E63A 2ETKA 4JRVA 2QU5A 1XBCA 4TN6A 3HAMA 4RJ3A 4IVCA 5H8BA 4GIIA 3G33A 3QRKA 4IQ6A 3V6RA 4CYJA 1ZWSA 4DCEA 3MPAA 4EBWA 3COKA 2QC6A 3EIDA 3HMMA 5EQYA 2IJMA 4KIKB 5D1JA 4G31A 2YZLA 2VNYA 2HWOA 2UUEA 2W9FB 5BQ0A 2HY0A 3BGQA 2OFUA 5JT2A 2KTYA 2XA4A 2BAJA 3QTRA 2UW6A 3OEFX 5LMKA 3UNKA 2BRMA 3QD0A 3E8CA 2I0EA 3RTPA 4OLIA 5A4EA 2R3MA 3WYXA 4WNMA 2I40A 3AD4A 2QG7A 3KVXA 5C03A 2WMSA 3E8EA 4LMUA 2QURA 4RC2A 2XYNA 4TWOA 3RCDA 1Q8WA 4B8LA 3EZRA 4CMOA 4DBXA 1PXIA 3KMUA 1XHAA 4ANBA 1AD5A 2UZBA 4BCFA 3V5PA 2O5KA 4UMPA 2WMQA 3KXGA 5IA3A 2OJIA 3NUPA 4L9IA 5HVJA 3ZC6A 2XBJA 3ZFYA 4QMOA 1P4OA 5BVKA 4QP2A 4HVDA 3R02A 4Y5QA 3N4TA 3KXMA 4IVBA 4QOXA 5HG8A 3DLZA 2BHEA 3GFEA 5ETAA 2R0UA 1SZMA 4LL0A 5L6WL 3PZHA 4EYJA 5B2LA 4Y5HA 1YXTA 5HE1A 4QTCA 4RIWB 5FEDA 4FV1A 3MFSA 4E1ZA 2YDJA 4J71A 2Z7LA 2YAAA 3ZXTA 2PVKA 3EH9A 4U81A 4U79A 2WIHA 3NYXA 2XEYA 2X9EA 3HVCA 3V51A 4FEUA 3D7ZA 1Q8ZA 1XH9A 3CPBA 1QPJA 4X2FA 4IMYA 3HZTA 1OIYA 1M17A 2XKEA 1XBBA 4OTDA 2WB8A 4JJRA 5ANGA 4MBLA 2PVFA 3OY1A 1J7LA 4JAJA 3D9VA 3HA6A 4FOBA 3Q4ZA 4DGLC 3R9RA 5DEYA 2RFEA 3FWQA 3UPZA 3O8PA 5AV1A 2YABA 3A7IA 4L3LA 4U7ZA 2RL5A 1YHVA 3Q6WA 4OT5A 4AZSA 4HGTA 4D4SA 5IQIA 3R2YA 5ETFA 5JFWA 1OIUA 5DYJA 4YTFA 2ZJWA 2OBJA 5HCXA 3DV3A 3AC2A 3C4CA 3B8QA 3MPMA 3VBQA 4BI1A 1QCFA 4AZTA 5M57A 3TUBA 4LFIA 3WZKA 4YBJA 3EN5A 4AACA 5HCYA 4ANQA 3NCGA 3NNXA 3ZHPC 2RKUA 1BL7A 5FXSA 5CNOA 2VTQA 4EQUA 5EDQA 5LVLA 3R7OA 4YHJA 3ZO4A 2VWVA 4NFMA 4GU6A 5FXRA 5IQGA 3QUDA 3BYOA 1Q3DA 1Q62A 2PMNX 2X2KA 3GCVA 3LZBA 4UXQA 2XCKA 4ZZOA 4DT9A 1FOTA 2HZNA 1EH4A 2A19B 5DPVA 5M4FA 2F4JA 3QKKA 4PPBA 1XH6A 4R1VA 5HO6A 3RGFA 2C6TA 2BIKB 4UYAA 3VRYA 1KWPA 4NTSA 3NUSA 3ORPA 3ZMMA 2F2UA 4FZFB 3F66A 3UODA 4K8AA 5DVRA 1WCCA 4USDA 5CEOA 2Y4IB 3HRCA 1O6LA 5IKWA 3BV2A 2XNPA 4MH7A 4F0GA 4H39A 4D0XA 3R7VA 3G6HA 3FLZA 4KKEA 5I9YA 2BRNA 3VS2A 4OTRA 5E90A 1SVHA 1R1WA 2W5HA 5BVEA 5IQCA 3EZVA 2VD5A 1OL6A 4R5SA 4ZTLA 1M2QA 2UVYA 4N70A 4D5HA 2JIUA 4MXCA 4Z3VA 2W4OA 2YCFA 3AT2A 5BX0A 4I41A 1I44A 2PSQA 2GQSA 4ZTMA 2B9IA 5ANKA 3ROYA 4YJUA 2W17A 3ZEPA 5FEEA 4NM0A 1XH7A 3LFDA 3I5ZA 3IDBA 3QLGA 4NJ3A 2CKOA 4O84A 4NW6A 5ANEA 4EK3A 4EHZA 4QP8A 4IFGA 5A6NA 3NVMB 3I4BA 4X3FC 4JDJA 4QNAA 4BICA 4PP9A 5JRQA 3ZCLA 1ZLTA 4QMLA 4C4IA 3MY0A 3QKMA 3DKGA 1GZNA 3W2CA 4NWMA 4QPSA 3DK7A 3PLAE 4JG6A 3BLQA 3TNHA 2B54A 3PRIA 5FP6A 4YZNA 4BHNA 1PY5A 3EYGA 3OC1A 4RX8A 4M68A 2ITYA 1KE7A 3F5UA 1LP4A 3BCEA 4V0GB 4L3PA 3TCPA 3FZRA 3DDQA 2LGCA 4WHZA 5B2KA 3D2KA 2QKWB 3B8RA 4E26A 1PRYA 4K2RA 3D94A 1MRUA 2QOQA 4G6NA 4MHAA 3K3JA 4IM3A 5EM6A 5CEPA 1ZYSA 3HMOA 4DN5A 2QR7A 1FGKA 3GNIB 4L7FA 3LFEA 3V8WA 1M52A 3QTWA 3MSSA 5AX3A 3SXSA 4EI4A 1OPJA 3NUUA 3NUNA 3OT8A 4FTUA 3C4XA 4WA9A 4O7RA 1H1SA 3VUDA 4D4VA 4BFMA 3GXLA 3R1NA 4PRJA 1BX6A 4C2WA 4HYHA 5EQPA 3QC9A 4AA4A 3R83A 4HCVA 1LEWA 2YHVA 2ZM4A 3A8XA 5IA0A 2CNQA 3PY0A 4CZTA 1V1KA 2XH5A 1U4DA 1XR1A 4QYEA 3PJCA 4YC8A 3UIUA 5GIPE 3TN8A 2J2IB 2JDRA 4WIHA 5HVYA 3Q2JA 4BDCA 1Q5KA 3R71A 2QOBA 1YOJA 4QMVA 3RWQA 2JAVA 3ZONA 2BUJA 4BDIA 4I6FA 4BZNA 3KCFA 2EUFB 4DGNA 3H10A 4F1OA 2WQNA 1NXKA 5KBRA 2G2FA 5AMNA 4K33A 2HZ4A 2PZYA 2R3IA 4HZRA 4E7WA 4M8TA 2GNLA 3A60A 4E6QA 2BKZA 4IBMA 4JIAA 4OBOA 3EN6A 4A4LA 3L9PA 5GJDA 4DFXE 2Z2WA 4MTAA 2E2BA 3HP2A 2VZ6A 3AGMA 3HRFA 4EZ3A 4IE9A 4X7QA 5HHWA 5K3YA 3RPVA 2XNMA 4GUEA 5CU0A 3U6JA 2CKPA 4EOLA 4O0SA 5DWRA 1NT2A 3EL7A 2CLXA 2ITZA 4A07A 2BKKA 3KY2A 4UMUA 2W5BA 3FL5A 1IRKA 4BI0A 4UALA 1HCLA 1NVSA 5BYLA 2FUMA 3QYWA 3SC1A 1W82A 1OKYA 4Y95A 4O7VA 2YM5A 5B0XA 3TJCA 3S1HA 4EK8A 2O2UA 5H3QA 1WBWA 3G5DA 3OOMA 4TNBA 1QPCA 3BRBA 4O0TA 4FSTA 1BI8A 3G51A 3BYUA 4MQ2A 1XO2B 2C5XA 5AA9A 2BAKA 3EQCA 3OUNB 2GNHA 3KULA 4ANOA 4EOIA 4M69B 2VTMA 5IQBA 4FZDB 4ENYA 1YQJA 2PU8A 1VR2A 1Z5MA 3ANRA 4NFNA 4I5MA 1F0QA 2A1AB 2BTRA 3FZOA 2YJRA 2IVVA 5DT3A 5IUGA 3P9JA 4G6OA 2NRYA 4CV9A 4YMJA 3VW8A 3UMWA 1WBNA 4ZTQA 1Q24A 2PVYA 2R2PA 3HRBA 1CMKE 4D5KA 5FDXA 3WF7A 3LFFA 3O23A 4ASXA 3EN7A 5KUPA 1J1CA 3FE3A 4BZOA 3DJ7A 1ERKA 3NYOA 3ZDIA 3QCSA 3PXRA 5ANJA 4QQJA 4H05A 3K54A 3R8MA 3QWKA 4CMUA 4BDJA 4KIOA 4IWQA 1WBSA 5KHWA 5CANA 3JY9A 1ZOHA 5LVMA 3EFKA 5FGKA 4G9RA 4FKIA 3Q04A 3BYVA 4FV8A 3R9DA 3FZTA 4G2FA 3E62A 3C0IA 4RG0A 5J7HA 3CQEA 4BKJA 3UOLA 3S00A 3Q6UA 2CGXA 2ZAZA 4B7TA 3HV5A 5HNIX 3ALNA 1UWJA 3IW8A 5HORA 4FKWA 2C4GA 4YJTA 3SG9A 4MAOA 5AUWA 3CIKA 4G17A 2Y4PA 4KINA 4UB7A 1WAKA 5AR5A 3ZOSA 3BI6A 5BNJA 3QGWA 1Y57A 3EKNA 3QZGA 4IAIA 3C5IA 2BRBA 2YITA 4NH1A 4XG3A 4UN0C 3I7CA 1REJA 4A9YA 4FX3A 3KRWA 4GT4A 3W16A 2EB3A 2QHMA 3GUBA 5HO8A 3OS3A 4ZSAA 1GZOA 2C6MA 4LRKA 3NW6A 1XH5A 1JKSA 4ITIA 4DEDA 2HYYA 4G3EA 3SGCA 2JKOA 2W5AA 3MW1A 4O86A 4MEDA 4BCGA 3P1AA 4HGEA 3FL4A 4YZDA 4YHFA 3I7BA 4FG7A 5E1SA 3SHEA 4YJOA 3TM0A 2R3LA 4CFNA 3M2WA 2VTTA 3REPA 5IMXA 3OUKA 4BGHA 1M2RA 2BRHA 2R64A 3O0GA 4MWHA 4PL4A 3R7IA 4OTFA 1FVVA 1CKPA 4O27B 2YDIA 2XB7A 1YWRA 2JBPA 4XOYA 4TWCA 4ZTNA 1J1BA 5ACKA 2X2MA 3EB0A 5AUTA 2V7AA 4MCVA 4ASEA 4FKUA 1XWSA 1BL6A 2Z7QA 4XLVA 2BZIB 5EHYA 2B9JA 4APPA 4BZDA 3LM0A 4L43A 5IEVA 5AR8A 2YIWA 3IW4A 4D0WA 3ET7A 5IPJA 5DIAA 2X1NA 2QG5A 3TIZA 4L00A 3D5XA 4YURA 2R5TA 4AOTA 3C4ZA 4QMYA 2UZDA 3QRJA 4EH3A 1UU8A 2P0CA 3GU8A 5IEXA 2QOLA 2PK9A 3BGZA 4MNEB 3UO6A 2XNGA 4M0ZA 4I4EA 4KBAA 4K77A 4FKGA 2I7QA 4DTBA 4PDOA 5AP1A 1QMZA 1SNUA 3MIAA 2ZVAA 2O3PA 2VWIA 4A9UA 3PP0A 4H36A 4FTOA 4XCUA 3MIYA 2UVZA 3Q32A 4UXLA 5LJJA 5BYZA 5J9ZA 3H30A 2W9ZB 4ACCA 5M4IA 4PV0A 4FEXA 4O6EA 3RMFA 4DEEA 5J8IA 4ERKA 1PJKA 1JKKA 5C8NA 4PY1A 2YM4A 3AC5A 3EYHA 4IAKA 4NKSA 3QGYA 5CF5A 5IA4A 5I3OA 1ZYCA 2OXDA 2UW5A 3D5WA 1ATPE 2BPMA 1KE9A 2G01A 3NGAA 2UZTA 4AQCA 1Q61A 5JEBA 2G9XA 3JPVA 4AW5A 3WF8A 4W8EA 4AFEA 4YPDA 1IR3A 2R3JA 2R3RA 5LWMA 4DBNA 3Q53A 2C3KA 4JDHA 4F9AA 3PTGA 4EUTA 2H34A 3GB2A 1GNGA 3UP7A 5L6OA 4D4YA 3DBCA 5M4CA 3PLSA 3A7FA 5TF9A 5DG5A 4B9DA 4DH8A 2YN8A 1DI8A 2X8EA 4AWIA 3DXNA 1CKIA 2YFXA 4I5CA 3OCTA 5FTGA 5HLPA 3DA6A 5CI6A 1SVEA 3AG9A 3N51A 4BKZA 5JSMA 3VS5A 4AGDA 5AIKA 2VO3A 2VTPA 3LXKA 2W0JA 3UZRA 2WMAA 2AUHA 2WFYA 1PYXA 5EG3A 4DG3E 3KEXA 4IVAA 4FG8A 4WNKA 1Q41A 3BLHA 3D4QA 3NVKI 5C9CA 1PMVA 3CKWA 5CAOA 1TQIA 5GNKA 1KSWA 2WGJA 2GU8A 5I5ZA 4N6YA 3MN3A 5J1VA 4O38A 4W4WA 5AR3A 5AADA 3UOKA 5AR7A 3LMGA 5AP4A 3DNDA 1Q3WA 2F57A 3HL7A 3O7LB 4IX6A 3PUPA 3GC7A 4C38A 3HP5A 3EWHA 4RFYA 3VAPA 2VWXA 5CQWA 4R7BA 4Q9ZA 5J9YA 4QP4A 4FV7A 5IG1A 3Q52A 4XV3A 3F9NA 3WF6A 4W4VA 1JSVA 3H9OA 4EORA 1RE8A 4JIKA 4N0SA 3QXPA 3QC4A 4DC2A 3EQFA 3Q9XA 4J95A 4RJ4A 4QQCA 4PNKA 5FP5A 3VS6A 3DKFA 1F5QA 2OXXA 2XNOA 4O0XA 3HV6A 4KABA 4H3QA 3W1FA 3DQWA 4F09A 4TYJA 5DA3A 4UX9A 4RX9A 4IW0A 1IA8A 3KQ7A 3FUPA 2J6MA 5D7VA 4QMSA 5HKMA 3HLLA 5F20A 1WZYA 2VV9A 4BCQA 4ZJJA 3ZSIA 3KULB 4QQTA 4QP6A 5C4KA 2CSNA 2VWBA 4FK6A 5EYKA 4XBUA 3EN9A 3VN9A 3VS4A 3CS9A 5CAQA 3RPSA 3GVUA 5JQ8A 4FEQA 4EZ7A 3MWUA 3GCPA 2PPQA 3LCSA 3PSBA 3SX9A 3KCKA 1YI3A 4QMWA 4AW0A 5CZHA 3BX5A 3EQDA 3QQFA 4YSJA 5J5SA 2WD1A 2QLUA 1OZ1A 2R3OA 3NAXA 4QP1A 5DRBA 3E88A 4ITJA 3TV7A 3RM7A 1NW1A 3R01A 4F7LA 3IO7A 3C4EA 1M2PA 5H8GA 3FBVA 2VAGA 4NK9A 3VRZA 1LPUA 3KVWA 4HPUE 2QD9A 3ZU7A 2ITNA 2FGIA 4JR3A 4KBCA 4DCAA 2OI4X 3EHAA 4AF3A 1FGIA 4IAAA 4AUAA 3AC3A 3PPKA 5EOBA 2QOKA 3BELA 3BHYA 5KKRC 4A9SA 4F6SA 2X2LA 4DLIA 2OH4A 3CTQA 4R3RA 4HNIA 4JAIA 2QU6A 3R8PA 5HD7A 3RAHA 3DKCA 2GPHA 5ETIA 3VJOA 4BDAA 4E93A 4F1TA 3ZUUA 3HKOA 3MA3A 3SQQA 5GZ8A 4ORKA 3OMVA 1H01A 4GCJA 1OUYA 4NM5A 2RG6A 3IGOA 4CNHA 4FTKA 2VGOA 4NCTA 1Y6AA 2VUWA 3CD8A 5CXHA 4BDBA 3LVPA 4EQMA 4CG8A 2I0YA 1KE5A 2UW7A 5ANDA 5E8TA 5LXMA 4R77A 2HOGA 1JPAA 1B38A 4PF4A 2WTWA 4X3FB 4A4XA 5JRSA 5AAFA 2QQ7A 2XK8A 4FV6A 5IUHA 3GU6A 3LE6A 3UVQA 3LLAA 3IW6A 5EHLA 4GG7A 3GFWA 4S34A 3RK5A 5AA8A 4R3PA 2CCIA 2W1FA 2YACA 5DFPA 5JZNA 1Y91A 2CKEA 3LHJA 1RDQE 3QD2B 4QD6A 2GQRA 4EC9A 2UW9A 3FC1X 3GC8A 3PFQA 3VUKA 3DAJA 2W06A 3QA0A 4DH1A 3ORTA 4XH6A 2GTMA 2BDFA 3R8ZA 2QOCA 3A8WA 2FB8A 5EKNA 4KWPA 4KRDA 5LCKA 5J95A 4E6AA 3V5JA 4FA2A 2ETMA 3KL8A 3ODYX 3LOKA 5KMIA 5DGZA 2C6KA 4HPTE 5BMMA 1BI7A 1IASA 3E8DA 3HMPA 5I9XA 5AM6A 5ACBC 5JKGA 1U46A 4V0GA 4ZSJA 4ACMA 5IF1A 2C68A 3V5QA 2X7OA 4NKAA 3R28A 3DK3A 5EW8A 3RBWA 3FMMA 2JITA 4WO5A 4BN1A 3DDPA 3JVSA 3BZ3A 4MD8E 4C3RA 4CLJA 2EXCX 2BTSA 3A7GA 2J90A 5EDRA 2GQGA 3DFCB 3GU5A 4MBJA 3NRMA 5KBQA 2CNVA 4L68A 3SOAA 3SRVB 4FC0A 4AX8A 4BF2A 1UWHA 4FTQA 4G1WA 4JG7A 5AV4A 1TVOA 3UQGA 3COHA 4RQKA 3NX8A 1ZY5A 2X0GA 3C1XA 1GIIA 1NVRA 2ITQA 2W05A 3DZOA 4IC7A 3SW4A 3CGOA 4I22A 4QPAA 5IH4A 3II5A 1S9IA 2JFLA 4QMTA 1FMOE 4C62A 4R78A 4BWPA 3GOKA 3DAKA 3TG1A 4YHTA 1FQ1B 2J0KA 4G3DA 3EQBA 3QTIA 3MTFA 3OCGA 3ORNA 4FZ6A 5E8ZA 1MUOA 3FZ1A 3O8TA 4XOZA 5EI2A 2OF4A 3OCSA 5I9ZA 4OW8A 5CTPA 3WIGA 4ZP5A 5EYMA 5HVKA 2WEIA 3TKIA 4PL3A 4YO4A 3ZUTA 3DBQA 4IX5A 3BYMA 4BCOA 4O0UA 4NJDA 1JSTA 4Y83A 4I93A 3CY2A 4XG4A 4EOJA 3FMKA 5JGBA 4DFUA 3VS1A 3MVMA 1UKHA 3WI6A 5LCJA 4BDGA 2KULA 2C30A 4J8NA 4YUQA 2VTNA 4O7WA 3BE2A 2WNTA 4YJQA 2PZRA 4O1PA 2Y6MA 4DH5A 4X3JA 5KO1A 4C0TA 2X8IA 4C34A 3QALE 5BVFA 3WZUA 4EOMA 4FSNA 2DQ7X 3DXQA 4JDIA 4PDYA 3G90X 3QF9A 2C0IA 2JIVA 3N4UA 1F3MC 3MFRA 3IDCA 4FV2A 3PSCA 5CXZA 5HTIA 4FEWA 1W84A 3KXHA 4QMXA 3PJ1A 4LYNA 3DLSA 5IH5A 4IACA 3W33A 4QNYA 2QONA 3ATSA 3G2FA 3UG1A 5LVPA 3HDNA 4GS6A 1GJOA 4KIQA 3W32A 1Q8UA 3TTIA 4KNBA 4F63A 2YM7A 4M69A 1FBNA 4MVFA 5JGAA 4HW7A 2XK4A 5HNBA 3TI1A 4GFOA 4K6ZA 5H8EA 3QL8A 3UNJA 1P14A 2WOUA 3F5PA 3OOGA 4FYOA 4D1XA 3V3VA 4WNPA 4L52A 4X2JA 3QX2A 4DITA 3S3IA 5F1ZA 1QPDA 5CI7A 5LARA 4KSPA 4RFZA 4RWJA 3TACA 3ZO1A 2ZYBA 5CF4A 2CKQA 3NR9A 3MYGA 4EK6A 1UNGA 1Z9XA 5IMEA 2XJ2A 3FDNA 5JN2A 4W4YA 5KMLA 3CKXA 1IA9A 1AQ1A 4MWIA 3EQPA 2WHBA 2B52A 4BDEA 2BCJA 2FVDA 4I5HA 1MRVA 3AMBA 4PNIA 1H1WA 4HVHA 1JKLA 4RJ6A 5TT7A 4X2NA 3UC4A 4IANA 2P55A 3E7VA 4GRBA 3IQ7A 3Q9YA 5CX9A 3VUIA 3ALOA 4D1SA 3OW3A 5EQEA 1YW2A 2PZIA 4DEHA 3OP5A 3QUEA 4F9WA 1GAGA 4ITHA 3VS0A 3BV3A 3OT3A 3AMAA 5GJGA 3RM6A 3RHXA 1M7QA 2A2AA 4TL0A 3PXFA 3BE9A 3E5AA 2QO9A 2OZAB 3QRIA 2VU3A 5IA5A 5J87A 3AMYA 4FKPA 3QHWA 4RJ5A 3TV6A 2B4SB 2B0QA 5CQUA 3AQVA 5C4LA 4ZY5A 4AGWA 4O7YA 4NCTC 4HVIA 1Q99A 3B2TA 3KRXA 2C6EA 4H1JA 5E8YA 5M44A 3VUHA 3WZEA 5T6KA 4A4OA 1OI9A 1FMKA 4YJNA 2J0IA 4BC6A 4FT3A 5KMOA 3VF8A 4LQMA 5E1EA 1OB3A 4GMYA 4FL1A 4RA4A 3U55A 4AGCA 4RRVA 3OXIA 4GVAA 4LV5A 4AE6A 3R8VA 4GW8A 2J5FA 1OBGA 1ZYLA 5CT7A 2GNJA 5CSXA 4HYUA 4YZCA 3ZDUA 4AT3A 5JMSA 3MESA 2FA2A 3I0QA 1QL6A 5K4IA 4E6CA 4AS0A 2W1EA 5L8JA 4BRXA 3MH0A 2XYUA 3P0MA 1XH4A 4UY9A 3OCBA 2A4LA 3W18A 4BDDA 1KOAA 4YTHA 3UE4A 5CNNA 4BVUA 4RX5A 2PL0A 3EFJA 3PRFA 5EI6A 3NUYA 1OKVA 1GOLA 4PMPA 3PJ8A 5FG8A 1H28A 4BBMA 5AFVA 3LIJA 3IPHA 3TJDA 4FNWA 4WSQA 4W9XA 2VTAA 3VBTA 4QMNA 2X39A 3BQCA 4P5QA 1PXLA 3QA8A 4DH7A 1YWNA 4GK4A 3V8TA 4NM7A 4AU8A 3FSKA 1TQPA 5K9IA 2YIYA 3FMJA 3EFLA 2OXYA 3R00A 4CFUA 3F5XA 4FKVA 3RP9A 2VTSA 3F2RA 1L3RE 3ACJA 3OWJA 4QRCA 2F2CB 3CY3A 5D10A 3PXKA 4JS8A 3MA6A 4PL5A 3ACKA 3F61A 3G0EA 3PP1A 4DGMA 4PDPA 1H4LA 4F70A 3SXFA 4C33A 1Z57A 2ZMCA 3LQ8A 4DE4A 3BEAA 3E8NA 2NNWB 2YIXA 2P2IA 4XRJA 4M84A 3R1SA 2OF2A 4UMRA 3LXPA 2PE2A 3PVGA 5AR4A 5HE2A 3R7YA 2IW6A 1NVQA 2OK1A 5C8KA 2HELA 2OH0E 1JVPP 3KF4A 4X2KA 4IADA 1JKTA 3RPOA 1NA7A 2NP8A 2VWYA 2QI8A 3H3CA 3LJ2A 3MB7A 2IZSA 5DRDA 2HIWA 1Y8YA 3OWLA 3TL8A 3D14A 4BCJA 2OG8A 2E9VA 3OFMA 5F94A 4BTFA 4PTGA 3IOKA 4C37A 4YGAA 3ERKA 1XBAA 2V5QA 4FIEA 4V05A 3PVBA 5AWMA 1FVRA 4XUFA 4DEGA 5AUUA 2QNJA 3FMDA 2X7GA 2JKMA 3FYJX 4TRLA 5E8SA 3O2MA 4CLIA 4LOQA 2YLEA 5EM5A 5AV2A 2Z7SA 4JBPA 3WF9A 4F99A 1RW8A 4AT4A 3FKNA 4WG3A 1GY3A 2REIA 3IS5A 3QCXA 5HG5A 4UWYA 3IONA 4ZTSA 3LFSA 4EJ7A 2G2IA 4HVGA 5KCVA 4V04A 5A9UA 3ORKA 1WBVA 5F4NA 3G0FA 2GFCA 3NUXA 4U41A 3W8QA 4FG9A 3ZH8A 2RIOA 3IECA 1X8BA 4I6HA 2XF0A 3CPCA 3R30A 4DGOA 4CGAA 4CSVA 2Z8CA 2ZM3A 3KF7A 3PPJA 2XIRA 4KD1A 4YZBA 2XIZA 2CDZA 2CMWA 3QAME 1FVTA 5TO8A 5KNJA 5M08A 3SDJA 4AZVA 5D9HA 1YDTE 4U97A 4IAZA 3VS3A 5DBXA 3KK9A 2X7FA 3QQKA 3K2LA 3R21A 4OTWA 4DHFA 4JX7A 3R1YA 4GG5A 4D55A 2R7IA 4DINA 1G8SA 5FUTA 2GHMA 2VO6A 3CQWA 2BZHB 4U3ZA 5E8WA 3U4UA 3RINA 2WQMA 4AN3A 4AZEA 3W8LA 3GQIA 3PIZA 4B99A 4C4FA 1DAWA 1W7HA 4HCTA 3W55A 4DGGA 1R39A 4ZY6A 4XLIA 5M06A 3O51A 1FINA 1OITA 4BL1A 4WD5A 4ANNA 5IQHA 4F4PA 4NM3A 1OUKA 3A4PA 5J79A 5D41A 3BKBA 2QVSE 2WMRA 4F6WA 4RIXB 5C01A 4A7CA 3DGKA 2XMYA 1G3NA 2QO7A 3CP9A 3MH1A 3Q96A 4EK5A 5CY3A 4FOCA 2PYWA 4CVAA 4FTLA 4LOPA 4I4FA 3ZRLA 2Y4IC 4D9TA 2Z7RA 1K3AA 4QYFA 3OWKA 2JDVA 5C27A 4R6VA 4O7LA 4RBLA 4JG8A 5IEYA 2GTNA 2JLDA 3O71A 3F6XA 4RLKA 4Z16A 4KSQA 5HE3A 4EEVA 4IAYA 2XZSA 4UEUA 4U44A 4ZEGA 4ZSEA 4EH5A 4KKHA 2QODA 3TNWA 4FSMA 5CENA 5HG7A 4I3ZA 3HDMA 2FSTX 3ZSGA 4E20A 2R0IA 3R0TA 5L6PA 1MQBA 4RJ7A 1U54B 3MB6A 3WZDA 5HOAA 2A0CX 4XG7A 3F2NA 3QX4A 4X0MA 2JGZA 2WMBA 5AV0A 4ANLA 2GCDA 5FD2A 3EL8A 4PDSA 4C4EA 2X81A 3MJ1A 3OXZA 3S2PA 3UIXA 2P4IA 2P3GX 4MD7E 4HZSA 1YXVA 2PVJA 4OTGA 4RIYA 4IB3A 4FV3A 2W96B 5A54A 5EYDA 4CG9A 2DUVA 3BHUA 3KXNA 1OKZA 4L7SA 3R7EA 3VHKA 2AC5A 4DG0E 4EHVA 5HTBA 3F69A 5A46A 3Q5ZA 3RHKA 3UO4A 1YHSA 3LCKA 5LOHA 5EOLA 3KN5A 2PWLA 3KRRA 4JVGA 3UNZA 4U6RA 2DYLA 4U3YA 3C7QA 3IDPA 3Q4CA 1P2AA 2YCSA 3P7AA 4AN2A 4LMNA 3CJFA 3QXOA 4UYNA 2XS0A 3QZIA 4GU9A 4QO9A 2ZDUA 2E9OA 1OMWA 3PY3A 5GIOE 4DTAA 2W1DA 4YTIA 2CGVA 3SA0A 4FODA 4QMZA 2VTIA 4C59A 4FEVA 3V8SA 1JWHA 1M7NA 2XUUA 4HYIA 2Q0NA 2ZV7A 3GBZA 2F7XE 4V01A 4TWPA 3ZFMA 1H0WA 3W2PA 2JAMA 5J9LA 4K11A 4ZJIA 3DY7A 4ZLZA 3CGFA 3RZFA 3PWYA 4CT2A 4D2SA 4UZHA 1ZRZA 3FZPA 3MGYA 5CLPA 3TDVA 4QTAA 4J97A 2UZOA 3EJ1A 3R22A 4BCIA 4BCKA 3GGFA 2WOTA 4K9YA 1VEBA 2ZV8A 3ODZX 3G9LX 4FGRA 5DT4A 5M56A 3P7BA 4MK0A 2PMLX 3IKAA 3DB8A 1UU9A 5IU2A 2R7BA 3AGLA 2WEVA 4XG2A 4EWQA 4S30A 5FBNC 3GP0A 3D0EA 4GK2A 3O7LD 3R9OA 5F9EA 5HZNA 2R3NA 1J3HA 3PXZA 5IQFA 4M12A 3QRTA 2XBAA 4P90A 2W4KA 3EN4A 3R8LA 1YOLA 3FXXA 5K0KA 5DOSA 2HW7A 4EH6A 3Q5IA 2NPQA 4FT9A 2WMVA 3DKOA 5IDPA 3GC9A 4Q5HA 2OU7A 4GK3A 3I1AA 5F95A 4D28A 4FI1A 3LFQA 3MBLA 2X6EA 3FMLA 2VWWA 1MP8A 2JD5A 4U5JA 2ZB0A 4I0RA 4RX7A 1YHWA 4BDHA 3GENA 3MPTA 2IZRA 4ZLYA 5FDPA 4U9AA 2WTKB 4FSWA 1ZOGA 5BUIA 5EM7A 4HVSA 3S95A 3FKLA 4BWKA 4JBVA 3A2CA 3GT8A 1ZMVA 3V6SA 2JKKA 5D7AA 5HX8A 3N4VA 2BRGA 2HENA 4ANSA 5B7VA 5DR6A 1YKRA 1UU3A 2XCHA 4H58A 4L3JA 4Z9LA 3M1SA 4FTTA 4RFMA 1J7IA 4Y73A 4B0GA 1WFCA 3ZTXA 2JDOA 1PYEA 5FWKK 3UZTA 2VTHA 5T3QA 4ACDA 2SRCA 4RWLA 4DFZE 3UQCA 5BUEA 4KUJA 4C02A 4L6QA 1U5QA 1OM1A 2HCKA 3DU8A 3LXLA 4CV8A 4AOIA 3F7WA 4TNDA 2EWAA 2PMOX 2XK6A 4M15A 5BVNA 2EVAA 3R73A 5IA1A 3HYHA 2ERKA 2GHLA 3NNUA 1VJYA 2DS1A 2ITTA 1WBTA 4CT1A 3QTSA 2XK9A 1Q8YA 1R3CA 3E7OA 4R8QA 4YJSA 3OVVA 5DN3A 3GCUA 5D11A 3I5NA 1H00A 4U0IA 4TW9A 1GIJA 4FTCA 4KBKA 5ANIA 4ZLOA 5AAGA 2RGPA 4IZAA 5I0BA 1V0OA 3R9NA 4DEBA 4BYIA 3DQXA 4FICA 1J7UA 1WVYA 4F9YA 4EQCA 2YERA 2W4JA 4RWIA 2G15A 4WKQA 3U4WA 3B2WA 4M13A 4C57A 5LWNA 2H9VA 2HK5A 1DS5A 4YZ9A 5AP3A 1PKGA 5AP0A 2VTLA 3FHRA 4F1MA 4ASDA 4LOOA 3F3VA 3VW6A 3PJ2A 1URWA 3AT3A 3FQEA 4NW5A 4RQVA 1O6YA 2YIQA 5GZ9A 3BU3A 3W2SA 2OGVA 4P2KA 5AUYA 3WBLA 3JR1A 5AUXA 3OHTA 3UG2A 1CKJA 3MVJA 2PY3A 4O91A 3CSVA 3H4JA 4TYHB 3T8OA 5K4JA 3ORMA 3TZMA 2WQBA 1YXSA 2YAKA 3H0YA 4OUCA 5CEIA 4OAUC 3G15A 4O1OA 5TE0A 3TV4A 5AIRA 4EONA 3DTWA 3AC4A 3U9CA 3ZZEA 3FI2A 2UW3A 2IW8A 3ANQA 4RVKA 2A27A 3HNGA 2BR1A 2PHKA 2QLQA 3O50A 5FTOA 1NY3A 4WUAA 4DLJA 3PA3A 3SOCA 3QTUA 3VIDA 4FTIA 4YNEA 5HLWA 1H1QA 5LVNA 4QT1A 5HIEA 2H6DA 1E1VA 4YLKA 4AXAA 4BB4A 5ICPA 3DTCA 2WXVA 5CEQA 1YDRE 2W7XA 2XIYA 4F7JA 4DA5A 4LRJA 4HJOA 1UU7A 2CHLA 3O96A 3R2BA 4IX4A 3HEGA 4OTIA 3I81A 5CVHA 2VO7A 4AGUA 4E5BA 4AW1A 5HLNA 2WELA 4FZAB 3ZS5A 1JQHA 5H2UA 2JFMA 3C4WA 4BBFA 4M66A 5A6OA 4FVPA 4QTEA 1PF8A 1R0EA 2C0TA 1KOBA 3QBNA 1XKKA 5EHOA 1PMUA 5HBHA 4Z7HA 4FTRA 3SV0A 3RK9A 3OY3A 3BYSA 3ZC5A 5CSPA 3FPQA 5HIBA 4MXYA 3NW5A 3QU0A 2J5EA 1H0VA 2XJ0A 2C5VA 5J7BA 2BROA 2IWIA 2QO2A 3C9WA 3LPBA 3PVUA 3QTZA 3IOPA 4TPTA 4M67A 4NL0A 4W9WA 2JKQA 2OIQA 3LJ0A 3ORXA 4GT3A 4CFMA 4CFVA 4FKSA 1QPEA 2XRWA 3SVVA 2ZOQA 2J7TA 3EKKA
chains in the Genus database with same CATH superfamily
3AKKA 4CRLA 2PMIA 4EH8A 2YM8A 1SYKA 1YRPA 4LI5A 4OR5A 5H9BA 4FSYA 4O0YA 2X4FA 5DH3A 4EOQA 3UZPA 2UW4A 4CXAA 3UDTA 4QMUA 4LUEA 4O83A 4DFYA 4O82A 2YDKA 4A06A 3MVLA 3FMEA 1URCA 3FKOA 3OWPA 4K0YA 3QQUA 2OW3A 3VBYA 3FI4A 5A4QA 3W10A 3KREA 2R3FA 4E5AX 2PE1A 3M42A 4J52A 1MRYA 2OO8X 1RQQA 5E91A 1H8FA 2WKMA 4MXZA 5KX8A 4MXOA 4C4JA 5A14A 4D2WA 5JZJA 4HYSA 3D7TA 4GVJA 3KXXA 3K3IA 4EYMA 2PUIA 2UW8A 4CZUA 5BV3A 4IFCA 3BHVA 5HICA 5CF6A 3LMIA 2WAJA 1PMNA 5IH6A 4UZDA 4BTKA 4QYYA 4YSMA 4FSZA 4O22A 2YWVA 5JK3A 4BJJB 4YLJA 5HQ0A 4O4BB 2VTJA 3ATTA 3TT0A 4FF8A 3W2RA 3GCSA 4O4CA 5T68A 3TNIA 2XVDA 4GFGA 4N6ZA 5JFSA 2WQEA 4WOVA 5AR2A 4G3CA 2BAQA 3KU2A 2Y6OA 3NDMA 4CFWA 2GHGA 4JDKA 4P4CA 1YXUA 4TY1A 1ZZLA 5AP2A 1XJDA 3PDTA 2XP2A 5IDNA 1G5SA 4DHZA 4M7IA 3H0ZA 2BDWA 2UZEA 3OBJA 2F49A 2PUUA 3NEWA 4R5YA 4NUSA 3ZM4A 4F08A 5BUJA 3F5GA 3BWFA 4XG8A 1UNLA 1U54A 1RJBA 4RVLA 2VWUA 4ZSGA 3I0OA 3QQLA 4I92A 4EC8A 2J4ZA 1PHKA 1P4FA 3PXQA 3VS7A 4FSQA 3COIA 4GYGA 2VN9A 3IG7A 4X6RA 4NYEA 4TYHA 5L8KA 2P33A 3HA8A 2IVTA 4YJPA 4ZY4A 3D2IA 2I0HA 3E93A 4JR7A 5BVWA 4L67A 5HX6A 4ZZNA 2YEXA 4G34A 3RNIA 3GU7A 3O8UA 2GS2A 2RG5A 3VBVA 4KKGA 5HE0A 3BU5A 3VF9A 4C3FA 5JGDA 4G5JA 3JY0A 3A7HA 3KGAA 3MJ2A 4G9CA 2JEDA 3VNTA 4BBEA 3PWDA 4MXXA 4PTEA 3T3UA 3NLBA 4I24A 3SG8A 4IX3A 3T9TA 1W2CA 3ZEWA 3SD0A 4BIBA 4RLLA 4Y46A 4YJVA 3G9NA 4MXAA 4U80A 5CALA 3LMHA 4L01A 1A9UA 3ORZA 3RWPA 2Y9QA 5I3RA 3RPYA 2F9GA 4EOPA 4JLCA 4F0IA 1KV1A 3HAVA 3FXWA 3UOHA 4MYGA 4FV5A 4YC6A 4FKQA 4J96A 3VVHA 4ENXA 3LKMA 3KA0A 4FE2A 4L44A 4O7ZA 2FYSA 3RPRA 3LJ1A 3C51A 3LCTA 3NYVA 5L2IA 2V55A 3LCDA 3P78A 4Y72A 4EH9A 5C1QB 1L8TA 4J7BA 4IDTA 4USEA 4OBPA 1XQZA 3VWAA 4U43A 2VNWA 2WMUA 5DEWA 4RA5A 3VQUA 4I1ZA 5FLFA 4GIHA 4I5PA 1O6KA 4C61A 2G2HA 1W83A 5DI1A 1WBPA 3I6WA 3DBDA 3ZXZA 4TKSA 4ZMFA 3FLYA 5AP7A 3P7CA 3LAUA 2HZ0A 3RALA 4CCUA 2X4ZA 3ZFXA 2W1IA 2CLQA 5AP6A 4OTPA 3BLRA 5DHJA 3R7UA 3RI1A 3RVGA 4M3QA 4PPCA 2O0UA 2V22A 2WMWA 4RJ8A 5EW9A 3ZLYA 4F64A 4EJNA 3IW5A 5FRIA 4FK3A 3ZRMA 1ZY4A 4CFFA 1G8AA 2HWPA 4EBVA 2C3IB 4O2PA 3W2OA 2PE0A 3P08A 3MFTA 4CRSA 3EQGA 4I6BA 3C5UA 3FY0A 4PMTA 4TYGA 3QHRA 4FV9A 5BPYA 3DK6A 3SRVA 4IH8A 4O81A 1ZYJA 3DT1A 3GC0A 3EMGA 4QYHA 3QCQA 2EU9A 2YM6A 3R7GA 4FNYA 1GZKA 4XYFA 3ITZA 4C36A 4DH3A 4E4NA 5LQFA 3EQHA 4DFLA 3U54A 2C1BA 2OJ9A 3NYNA 3Q2MA 2IW9A 5BVDA 2I6LA 4YU2A 3NNWA 3QFVA 1V0PA 4XV9A 5A4TA 4IB1A 4CQGA 2JDTA 4RGJA 1ZZ2A 5JFVA 4MF0A 3FQSA 5JH6A 2J0JA 3DXPA 3L8XA 3QKLA 4RVMA 5GZAA 3TNQB 3NS9A 3U51A 3DFAA 4AAAA 3R1QA 2JBOA 4YZMA 5E8VA 1BMKA 2CGWA 2J50A 4AW2A 4ALVA 2BFYA 3PY1A 4I0SA 3MS9A 4IWDA 4USFA 4U40A 2UVXA 2X8DA 1ZARA 2XKFA 4MD9E 4YBKA 1LEZA 2OJGA 3UOJA 5TOZA 3NSZA 1JOWB 2CCHA 3P86A 1YXXA 3BWJA 3L9NA 3M11A 4G16A 4FUXA 3ELJA 4IVDA 4RZVA 4CFXA 3PUFC 1MQ4A 4C3PA 3ENMA 1CDKA 4GT5A 4FTNA 2C6LA 3KRJA 4Y8DA 5G6VA 2BALA 3FJQE 3VULA 4GJ3A 2V0DA 4GEOA 1W0XC 3PA5A 4X3FA 1K9AA 2RSVA 5E7RA 3QRUA 5M09A 1Y8GA 1ZMUA 3VO3A 4EZ5A 2O64A 4GH2A 4OGRA 4OT6A 3V04A 4FRFA 3LQ3A 4EK4A 4UMTA 2Y8OA 2ZV9A 4G3GA 4EH4A 5K0XA 5IUIA 4S32A 3U6HA 4HNFA 1KE8A 5LMAA 4CKJA 3CLYA 1HOWA 3LFBA 3LCOA 1H26A 4IWOA 4XP2A 5EW3A 3KC3A 4IM2A 3I6UA 4YP8A 3TZ7A 3UJGA 5D12A 4IZ5A 3HECA 4F78A 3L8SA 4FKJA 2R3PA 1DM2A 4B8MA 1XH8A 2C1AA 2CNUA 3KIOC 3LW0A 3UO5A 2B55A 2XM9A 2GDOA 1YWVA 3GEQA 4CKIA 2F7EE 1SM2A 3ORIA 3QLFA 3S0OA 4HCUA 4CCBA 4RMZA 5AJQA 2ITPA 4XG6A 2G1TA 5HG9A 2WTJA 3KRLA 2ONLC 3ID6C 4D2VA 3FY2A 1OIRA 3PYYA 2ZDTA 3CEKA 4XRLA 1ND4A 3JYAA 4GYIA 4AA0A 3QQGA 3FI8A 4GKHA 4FGBA 3AOXA 3ULZA 5GINE 3AD6A 4UBAA 2JDSA 5DR9A 2X9FA 1IG1A 2J9MA 4N4SA 3CXWA 1TKIA 1WVWA 4FV0A 4ZSLA 2QCSA 1H27A 2WMTA 4XP0A 5HESA 2ACXA 5TKDA 3ZUVA 2PULA 4LGDA 1KV2A 3GCQA 1YI6A 3GQLA 4ID7A 4MKCA 5KMNA 3GOPA 1ZMWA 4MX9A 4BJJA 4BDFA 4QP3A 3P23A 4FIJA 4RIOA 4L8MA 4E73A 4BCNA 1LUFA 4JOAA 3THBA 5CAVA 3HUBA 3L8PA 4G3FA 5E8XA 4GSBA 4QQ5A 4F65A 3PG3A 3MY1A 4IHPA 2YWPA 4JQEA 4FSUA 2ZM1A 3U9NA 3D83A 5FBOA 3RZBA 4FL3A 3TZ9A 4DDGA 2VTOA 2C6OA 3NWWA 4FTAA 4D4RA 2WU7A 2OJFE 3O17A 4M97A 1WVXA 4JNWA 4H3PA 3UBDA 3D7TB 4I20A 4J53A 4WG5A 4DYMA 4F7NA 4O4EA 5CYIA 4RT7A 1H07A 1R78A 3D5UA 5M51A 3K5VA 3FZSA 3N9XA 4J98A 2GNIA 4Q2AA 4IAFA 4C8BA 3FXZA 4IZ7A 1AGWA 4I6QA 2CN5A 4AT5A 3RJCA 2CPKE 4CYIA 3VUTA 4FIIA 3EQRA 2IPXA 4YLLA 5KZIA 3SXRA 2B9HA 4EOKA 3JUHA 3PVWA 1JLUE 5HBEA 5EKOA 2W1HA 2RF9A 2W1GA 3TZ8A 4D2TA 3DJ6A 4JT3A 4BWXA 3F2AA 2PZPA 5CT0A 3G6GA 5L2WA 4XHKB 2FSLX 1CTPE 3Q9WA 4XS2A 4F9BA 3TNPC 5L3AA 1OPLA 5FEQA 2VO0A 3VBWA 4Z7GA 4F9CA 3UDSA 1UVRA 5EI8A 2UV2A 2Z60A 1O9UA 3PSDA 1R0PA 2H8HA 4IC8A 1KE6A 4FT7A 5EH0A 4ZXTA 3TXOA 3LFAA 3UP2A 2WZJA 1OL2A 1BYGA 3ZZWA 1VYZA 4BY9E 4Y85A 2AQXA 4G6LA 4XNEA 3FLWA 1UKIA 3Q4UA 4I94A 5LMKC 2AYPA 3AD5A 4TXCA 5DMZA 3JXWA 1TQMA 3W0RA 5I9WA 3ULIA 4UV0A 2CGUA 3U8WA 5CS6A 4PQNA 5HGIA 4DEIA 2ITXA 3ZYAA 4ANMA 4XP3A 4OAVB 3MI9A 3COMA 5ANOA 4FKLA 1ZAOA 2J0LA 3RAWA 2XIKA 5IA2A 2ZMDA 3NCZA 4WG4A 4DT8A 1JNKA 2BZJA 3KFAA 1PXJA 1ZYDA 3OW4A 4FT0A 5CAPA 2V7OA 3NPCA 3HGKA 2NRUA 4P7EA 4PTCA 5BMSA 3PZEA 4ZZMA 2J51A 4RZWA 3DNEA 5HEZA 4QMPA 2NO3A 4ONAA 4ZTRA 5FQDC 1IAHA 4EHEA 4FL2A 3R8UA 4AZWA 2PVMA 5E92A 4BIDA 3FEGA 2J0MB 3TKHA 4EH7A 1YVJA 4DG2E 2QHNA 4ZAUA 3HUCA 1OVEA 4FIFA 3UQFA 4ACHA 3R6XA 2YISA 1I09A 1OL7A 2C5YA 3FI3A 4UWBA 3D15A 4UMQA 4ZMEA 2Q0BA 4FZ7A 2Z02A 5FM2A 3UGCA 3WF5A 4FKTA 4CTCA 5L2QA 1FPUA 2OKRA 4NIFB 1SMHA 3P5JC 3DCVA 5BVOA 3CBLA 3R63A 5A4CA 2PUNA 4LRMA 4JQ7A 3FMNA 3LXNA 3QTQA 5KE0A 3ROCA 3UIMA 4C4HA 4O2ZA 5IQDA 2E9PA 3AT4A 3FQHA 5C8MA 3AC8A 4D9UA 3P4KA 3UDBA 5JFXA 3Q4TA 3QCYA 4C2VA 3FHIA 4KIPA 4R1YA 2C47A 3QD4A 3IK3A 5EYCA 3NMUF 3U6IA 3ZBFA 2BFXA 3NAYA 2VX3A 4AFJA 4D1ZA 2ONLA 5CU6A 4I0TA 3L1SA 3V5WA 2C69A 4QYGA 4FUYA 4BI2A 2PVLA 4ACGA 4Q9SA 2WTCA 3KMMA 3MH3A 4DAWA 1J91A 3VONA 1UV5A 5CEKA 5K5XA 2VRXA 5AAEA 1GZ8A 3F88A 3QQHA 1Y6BA 3ML1A 1OKWA 2XNEA 3FYKX 3PIYA 2VX0A 4PUZA 3VC4A 4AG8A 2O65A 3WZJA 4EL9A 3A62A 3F7ZA 3RAKA 1B6CB 4FR4A 2YCRA 3GI3A 4DEAA 2OLCA 3TEIA 5CASA 5CAUA 4S2ZA 4AOJA 4CTBA 4RIYB 5HO7A 3L9MA 4X21A 4O96A 4RWKA 3SLSA 4F0FA 2BZKB 3ORLA 2PTKA 4HGLA 2W1CA 1H1RA 3KN6A 3OD6X 5CWZA 3LFCA 2WO6A 4BCMA 2HW6A 4AXFA 2WMXA 2EB2A 3PJ3A 1YOMA 1LR4A 5CU2A 5HTCA 3E87A 3ETAA 3NNVA 4ZOGA 4RC4A 1H25A 2R3KA 3OTVA 2B53A 3C0HA 4W4XA 3DOGA 2OZOA 4R7IA 4YJRA 3VJNA 4FVRA 3TYKA 4AXEA 3CE3A 3P79A 3PFYA 2OIDA 1ZOEA 3ZLWA 4ALWA 1PMEA 3A99A 4AN9A 2C6DA 4E8AA 2EXMA 2QOHA 1Q4LA 2IVSA 2RFSA 3UIBA 3WOWA 4AZFA 3MDYA 3WE4A 3ZSHA 4KB8A 4XX9A 4FMQA 3ENHA 3C50A 1STCE 1YDSE 4EOOA 2LAVA 3CCNA 4FTJA 1WBOA 2HXLA 3ZO3A 2IN6A 1JBPE 5FM3A 4BGQA 4FV4A 5I9VA 4KRCA 3RNYA 5JQ5A 1T46A 4L53A 2F7ZE 3PXYA 1M14A 2OZAA 3QD3A 3ZLSA 3WIKA 1REKA 2QOOA 5HCZA 4J8MA 4LUDA 4TZRA 4I23A 3FC2A 4P5ZA 3E64A 2QR8A 4S31A 3ZLXA 4KIKA 2ESMA 3D5VA 2VTRA 5HU9A 5CSVA 5LVOA 5CVGA 4R3CA 3TIYA 3TMOA 2O8YA 3FSFA 1YI4A 4K1BA 3POZA 4C35A 3GU4A 1W8CA 2BILB 2YM3A 1Q97A 4YR8A 4BIEA 1OIQA 2VX1A 3FLNC 4QTDA 5BYYA 2YA9A 4JRNA 3PPZA 2Q83A 2I1MA 3V5TA 2OSCA 4IWPA 4E6DA 2HXQA 3S4QA 1SVGA 4PWNA 3QYZA 2GNFA 5AP5A 1PXKA 5HIDA 4DFBA 2FO0A 3AXWA 3QUPA 3QZHA 4FVQA 4FIGA 4H1MA 4QPMA 3CTJA 3KK8A 4QTBA 3W0OA 2C3LA 3BL9A 5C26A 3FMHA 1B39A 2GMXA 3C4FA 4II5A 5GJFA 3OROA 5AM7A 4FT5A 2C5NA 2H96A 5A3XA 5HNGA 4NU1A 3F3TA 5HD4A 2ITWA 2RFDA 4WNOA 5L2SA 4AA5A 1OBDA 4JXFA 4JX3A 4ASZA 4MBIA 4WBOA 3TTJA 4ZJVA 2GFSA 4EUUA 4IB5A 3UVPA 1ST0A 2JIIA 4GFMA 3EOCA 4RIWA 1HCKA 1PW2A 1A48A 4TYIA 1APME 4EKKA 4OTQA 4G5PA 5AUZA 2XK7A 5KMMA 3TDWA 3BGPA 3VQHA 3NFFB 4U42A 2ETRA 5IISA 4RPVA 2Y0AA 4RVTA 2XIXA 2IVUA 3MFUA 4IM0A 2UZUE 4EWHA 4AE9A 4BTMA 1BUHA 4B4LA 3UYTA 2YJSA 2UZNA 2BMCA 4AP7A 5J1WA 4ALUA 3DJ5A 2WU6A 3NUAA 3CJGA 1OPKA 4XEYA 1DI9A 3A4OX 4C58A 4X6QC 2UZLA 4IB0A 2P2HA 3DBFA 4BDKA 4S33A 1BKXA 4GL9A 3U87A 4D2RA 3PA4A 4IIRA 5HU3A 3F82A 4PMSA 2UZVA 5DNRA 4KAOA 4EH2A 3OG7A 5J5TA 4ERWA 4QP9A 4J1RA 3C13A 4B6LA 4FTMA 2NYAA 3DAEA 4E3CA 4RIXA 1H1PA 1OL1A 3E3PA 3H9FA 3PG1A 4TYEA 4E5WA 2YCQA 3NW7A 4JI9A 5K5NA 2V62A 3ZO2A 3MV5A 2PVNA 3DB6A 4QP7A 3QTXA 4YC3A 5I9UA 2BVAA 1GIHA 4CMTA 3EFWA 4CZYB 2IG7A 4HOKA 5KMJA 4NEUA 4A9TA 1JSUA 2WQOA 5EFQA 3WE8A 1TZDA 4L45A 3BEGA 2OWBA 3HMIA 4W8DA 3FPMA 4JBQA 4KA3A 2WTVA 3FV8A 3POOA 3Q9ZA 5CVFA 4YPSA 4EOSA 5KHXA 4O6LA 1OL5A 4LL5A 3UPXA 4TT7A 5DLSA 4NT4A 4TTHB 4MQ1A 4YO6A 3SW7A 3MH2A 3VBXA 4XBRA 3MTLA 1H24A 3NIZA 4IXPA 3E3BX 4TWNA 5CU4A 4WBBB 4CEGA 2XK3A 1E1XA 3HMNA 3UMXA 5L2TA 4LV8A 5KZ0A 3V5LA 2OJJA 3CTHA 2XNBA 2R3HA 4CD0A 3R9HA 4DF3A 2W99B 3OEZA 2XM8A 3Q3BA 5AX9A 3NIEA 5E9EA 3BBWA 4PX6A 3ZM9A 4N57A 3T9IA 5ITAA 5CZIA 3F3UA 4BGGA 3QZFA 3WYYA 1CSNA 3LFNA 3OF0A 3PE2A 1KUTA 3OXTA 4MF1A 3VHEA 5HI2A 5FXQA 4WT6A 2CJMA 3F3ZA 1U5RA 3TWJA 4C7TA 4LGGA 1IAJA 2PZ5A 5ETCA 3QQJA 5IZFA 2YIRA 4L42A 4R7HA 2UZWE 5KMKA 4O7SA 4C4GA 3WARA 3T3VA 4DTKA 3AC1A 5E8UA 4FNZA 3DZQA 1PXMA 2VWZA 3DBEA 3SAYA 3TUDA 2BIYA 3IW7A 3VUMA 4GJ2A 4BCPA 2OFVA 4PMMA 4PPAA 5L4QA 5B2MA 2XRUA 2EXEA 4A9RA 2XKDA 4O21A 2ITUA 4MNEA 1SNXA 5CU3A 1OECA 2FSOX 1PXNA 3HV3A 2BHHA 2E9NA 4WRGA 2C5OA 3JS2A 3JVRA 4JL9A 3KKVA 1S9JA 2WTDA 4ZIMA 4BYJA 4O7TA 5LMBA 3BLAA 3NZ0A 4IDVA 4YNOA 3OBGA 2QOIA 3E92A 1IEPA 4XJ0A 4DFNA 4CQEA 4LG4A 4F6UA 3MY5A 1VZOA 2GNGA 3FLQA 5TR6A 1PXOA 3KMWA 2R3GA 2C6IA 2GS6A 3UC3A 1E9HA 3F3WA 4IJ9A 2WTKC 4WSYA 2XKCA 1W98A 2R9SA 3MVHA 5A4LA 2XNNA 3KB7A 4OBQA 2QOFA 5HBJA 3V01A 2GSFA 4IZYA 4KS7A 4O0WA 4XV1A 4ZS0A 5I4NA 2UW0A 4E4LA 5L8LA 3L9LA 4L46A 4M14A 3BPRA 4X2GA 2B7AA 5AUVA 5GHVA 1V0BA 3CR0A 4BKYA 1K2PA 3KXZA 4H3BA 3I60A 4ZTHA 4QMQA 3DS6A 5E4HA 3QWJA 2XJ1A 4RSSA 5AV3A 4J99A 3BHHA 4K18A 1H08A 4QMMA 1U59A 4F7SA 5CSHA 2ERZE 4JQ8A 3I79A 4Q5EA 4ZK5A 2DWBA 3PE1A 3LQ5A 3C0GA 2B9FA 2JC6A 3DPKA 2B1PA 4MNFA 2WIPA 3FAAA 2PVRA 1PXPA 3ZRKA 3UYSA 3BBTB 4BHZA 4I21A 1OGUA 3HV4A 5CEMA 3H9RA 3CQUA 3W0MA 1UNHA 1JAMA 4NIFA 5DT0A 4IJPA 5AEPA 4FIHA 5KKRB 3CD3A 2C0OA 4FSRA 3R04A 3TUCA 2R3QA 3HX4A 2VGPA 4KS8A 2OIBA 4BTJA 4GUBA 5CF8A 5DE2A 3A61A 4HGSA 2ITVA 4U8ZA 3BU6A 2RFNA 3FLSA 2W1ZA 5M4UA 4WRSA 2GS7A 4WUNA 4EKLA 4FBXA 4O0RA 4XV2A 3RK7A 2CN8A 4ZS4A 3LM5A 3RKBA 2YLFA 4D58A 2FSMX 2ZB1A 3EQIA 4O0VA 3RAIA 4ARKA 1A06A 4D2PA 3LLTA 4FKOA 2C3JA 4XG9A 1P5EA 4E4XA 3OTUA 4NSTA 4XMOA 2R4BA 4PP7A 2IZUA 1UA2A 1VYWA 1DAYA 3BHTA 1CM8A 3OZ6A 3IGGA 3CC6A 4NTTA 3RCJA 3Q60A 4Z55A 3WILA 5FTQA 2FH9A 2PVHA 5G1XA 5IQEA 2WPAA 2AC3A 2BDJA 2E9UA 2ITOA 2Y7JA 4LGHA 4NZWB 4YTCA 4UWCA 3VUGA 2YZAA 1PKDA 4APCA 5M53A 4OTHA 4EHGA 1T45A 5EDPA 2XEZA 2I0VA 2IO6A 2IZTA 3W2QA 2X6DA 3TKUA 5M55A 4E4MA 3PIXA 3BIZA 3BQRA 3ZBXA 1WMKA 4FYNA 4FKRA 3L8VA 2WTIA 5EM8A 4O7NA 4IEBA 2O63A 4CKRA 5M07A 1Q8TA 2OICA 1ZXEA 3K5UA 4RC3A 5EK7A 1BLXA 3HV7A 4GV1A 4BCHA 2PUPA 2HY81 3UVRA 2QKRA 3A7JA 3UTOA 4GKIA 2XARA 3SKCA 4BR3A 4M0YA 2HAKA 2ZV2A 4JBOA 3P5KA 4U45A 2HZIA 4FNXA 5CSWA 5IQAA 5DR2A 4LM5A 3E63A 2ETKA 4JRVA 2QU5A 1XBCA 4TN6A 3HAMA 4RJ3A 4IVCA 5H8BA 4GIIA 3G33A 3QRKA 4IQ6A 3V6RA 4CYJA 1ZWSA 4DCEA 3MPAA 4EBWA 3COKA 2QC6A 3EIDA 2XANA 3HMMA 5EQYA 2IJMA 4KIKB 5D1JA 4G31A 2YZLA 2VNYA 2HWOA 2UUEA 2W9FB 5BQ0A 2HY0A 3BGQA 2OFUA 5JT2A 2KTYA 2XA4A 2BAJA 3QTRA 2UW6A 3OEFX 5LMKA 3UNKA 2BRMA 3QD0A 3E8CA 2I0EA 3RTPA 4OLIA 5A4EA 2R3MA 3WYXA 4WNMA 2I40A 3AD4A 2QG7A 3KVXA 5C03A 2WMSA 3E8EA 4LMUA 2QURA 4RC2A 2XYNA 4TWOA 3RCDA 1Q8WA 4B8LA 3EZRA 4CMOA 4DBXA 1PXIA 3KMUA 1XHAA 4ANBA 1AD5A 2UZBA 4BCFA 3V5PA 2O5KA 4UMPA 2WMQA 3KXGA 5IA3A 2OJIA 3NUPA 4L9IA 5HVJA 3ZC6A 2XBJA 3ZFYA 4QMOA 1P4OA 5BVKA 4QP2A 4HVDA 3R02A 4Y5QA 3N4TA 3KXMA 4IVBA 4QOXA 5HG8A 3DLZA 2BHEA 3GFEA 5ETAA 2R0UA 1SZMA 4LL0A 5L6WL 3PZHA 4EYJA 5B2LA 4Y5HA 1YXTA 5HE1A 4QTCA 4RIWB 5FEDA 4FV1A 3MFSA 4E1ZA 2YDJA 4J71A 2Z7LA 2YAAA 3ZXTA 2PVKA 3EH9A 4U81A 4U79A 2WIHA 3NYXA 2XEYA 2X9EA 3HVCA 3V51A 4FEUA 3D7ZA 1Q8ZA 1XH9A 3CPBA 1QPJA 4X2FA 3UDZA 4IMYA 3HZTA 1OIYA 1M17A 2XKEA 1XBBA 4OTDA 2WB8A 4JJRA 5ANGA 4MBLA 2PVFA 3OY1A 1J7LA 4JAJA 3D9VA 3HA6A 4FOBA 3Q4ZA 4DGLC 3R9RA 5DEYA 2RFEA 3FWQA 3UPZA 3O8PA 5AV1A 2YABA 3A7IA 4L3LA 4U7ZA 2RL5A 1YHVA 3Q6WA 4OT5A 4AZSA 4HGTA 4D4SA 5IQIA 3R2YA 5ETFA 5JFWA 1OIUA 5DYJA 4YTFA 2ZJWA 2OBJA 5HCXA 3DV3A 3AC2A 3C4CA 3B8QA 3MPMA 3VBQA 4BI1A 1QCFA 4AZTA 5M57A 3TUBA 2AEGA 4LFIA 3WZKA 4YBJA 3EN5A 4AACA 5HCYA 4ANQA 3NCGA 3NNXA 3ZHPC 2RKUA 1BL7A 5FXSA 5CNOA 1XMLA 2VTQA 4EQUA 5EDQA 5LVLA 3R7OA 4YHJA 3ZO4A 2VWVA 4NFMA 4GU6A 5FXRA 5IQGA 3QUDA 3BYOA 1Q3DA 1Q62A 2PMNX 2X2KA 3GCVA 3LZBA 4UXQA 2XCKA 4ZZOA 4DT9A 1FOTA 2HZNA 1EH4A 2A19B 5DPVA 5M4FA 2F4JA 3QKKA 4PPBA 1XH6A 4R1VA 5HO6A 3RGFA 2C6TA 2BIKB 4UYAA 3VRYA 1KWPA 4NTSA 4QDEA 3NUSA 3ORPA 3ZMMA 2F2UA 4FZFB 3F66A 3UODA 4K8AA 5DVRA 1WCCA 4USDA 5CEOA 2Y4IB 3HRCA 1O6LA 5IKWA 3BV2A 2XNPA 4MH7A 4F0GA 4H39A 4D0XA 3R7VA 3G6HA 3FLZA 4KKEA 5I9YA 2BRNA 3VS2A 4OTRA 5E90A 1SVHA 1R1WA 2W5HA 5BVEA 5IQCA 3EZVA 2VD5A 1OL6A 4R5SA 4ZTLA 1M2QA 2UVYA 4N70A 4D5HA 3AKLA 2JIUA 4MXCA 4Z3VA 2W4OA 2YCFA 3AT2A 5BX0A 4I41A 1I44A 2PSQA 2GQSA 4ZTMA 2B9IA 5ANKA 3ROYA 4YJUA 2W17A 3ZEPA 5FEEA 4NM0A 1XH7A 3LFDA 3I5ZA 3IDBA 3QLGA 4NJ3A 2CKOA 4O84A 4NW6A 5ANEA 4EK3A 4EHZA 4QP8A 4IFGA 5A6NA 3NVMB 3I4BA 4X3FC 4JDJA 4QNAA 4BICA 4PP9A 5JRQA 3ZCLA 1ZLTA 4QMLA 4C4IA 3MY0A 3QKMA 3DKGA 1GZNA 3W2CA 4NWMA 4QPSA 3DK7A 3PLAE 4JG6A 3BLQA 3TNHA 2B54A 3PRIA 5FP6A 4YZNA 4BHNA 1PY5A 3EYGA 3OC1A 4RX8A 4M68A 2ITYA 1KE7A 3F5UA 1LP4A 3BCEA 4V0GB 4L3PA 3TCPA 3FZRA 3DDQA 2LGCA 4WHZA 5B2KA 3D2KA 2QKWB 3B8RA 4E26A 1PRYA 4K2RA 3D94A 1MRUA 2QOQA 4G6NA 4MHAA 3K3JA 4IM3A 5EM6A 5CEPA 1ZYSA 3HMOA 4DN5A 2QR7A 1FGKA 3GNIB 4L7FA 3LFEA 3V8WA 1M52A 3QTWA 3MSSA 5AX3A 3SXSA 4EI4A 1OPJA 3NUUA 3NUNA 3OT8A 4FTUA 3C4XA 4WA9A 4O7RA 1H1SA 3VUDA 4D4VA 4BFMA 3GXLA 3R1NA 4PRJA 1BX6A 4C2WA 4HYHA 5EQPA 3QC9A 4AA4A 3R83A 4HCVA 3W0QA 1LEWA 2YHVA 2ZM4A 3A8XA 5IA0A 2CNQA 3PY0A 4CZTA 1V1KA 2XH5A 1U4DA 1XR1A 4QYEA 3PJCA 4YC8A 3UIUA 5GIPE 3TN8A 2J2IB 2JDRA 4WIHA 5HVYA 3Q2JA 4BDCA 1Q5KA 3R71A 2QOBA 1YOJA 4QMVA