4UXLA

Structure of human ros1 kinase domain in complex with pf-06463922
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
288
Chain Sequence
IENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSIYKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ROS
publication title Pf-06463922 is a Potent and Selective Next-Generation Ros1/Alk Inhibitor Capable of Blocking Crizotinib-Resistant Ros1 Mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 288
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4uxlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4uxlA01
3E7VA 4ANQA 3IQ7A 3UP2A 4B4LA 4FTCA 2KULA 4BYJA 1VR2A 4O1PA 3IGGA 3IW5A 5IMXA 5CT0A 4Y83A 1F5QA 2R7BA 5L2SA 3OWPA 4JS8A 3W2RA 4FIGA 4E6CA 3ZH8A 3LFBA 2J51A 2V0DA 1YXTA 3GU5A 5FEEA 3ZDIA 3WOWA 3DKCA 2PZIA 3NWWA 4E6QA 4JDHA 3Q2JA 4M7IA 1CKJA 5L8KA 1BYGA 4QMYA 2PE0A 2H9VA 4EKKA 1ZYDA 2YM8A 3WILA 2YN8A 5ANJA 4ZZOA 2R3RA 3A7HA 4EI4A 2C6MA 4OUCA 2HWPA 4HYIA 4X3FC 5GJDA 4XV1A 1VYZA 3FXXA 3IOPA 1E1XA 1ZYJA 4A9SA 3JVRA 3PXZA 2DWBA 3QYWA 2BALA 4AA0A 3BHVA 4R77A 3IGOA 4TYGA 2UZBA 4F7NA 5H8BA 2ERKA 2J50A 5DRBA 5AX9A 5GHVA 5C1QB 5FP6A 3V5WA 5IMEA 3D9VA 1PRYA 2HCKA 5CAPA 5DIAA 3DA6A 4YJUA 2CKQA 3FL5A 2X0GA 4QPSA 3DBQA 1P14A 2VN9A 4ZAUA 4IC8A 4NM5A 3HP2A 4IDTA 1PXKA 4RC4A 2WIPA 3T9TA 3LJ0A 3MA3A 4PTGA 3A8XA 2YJRA 5EHOA 1PMVA 1PMUA 4I22A 2YDKA 4PMSA 4X2FA 2OJGA 4F1OA 3PY3A 1LUFA 5A46A 3R7UA 2IW8A 4XCUA 2OH4A 2NRUA 3FY2A 3FLQA 5CQUA 1R0EA 3FKLA 5H2UA 3P78A 3OOGA 1WBTA 3R8MA 1XBAA 4CCBA 3CY3A 3D5WA 4RJ7A 1TVOA 3PFQA 3GC7A 2XNEA 3I0QA 1JPAA 4YLJA 5ANEA 2C1BA 3BCEA 2CNVA 4M69A 4EYMA 5ACBC 2WQOA 4ANOA 5E8TA 2BVAA 3DJ6A 3V3VA 3IONA 5B0XA 2W9FB 1UA2A 1WVWA 3BWJA 4JX7A 3IW7A 3BBWA 4M0YA 2VTJA 5DMZA 2YJSA 3D4QA 2W96B 4IAAA 3ZUUA 3E62A 3ANQA 4G2FA 4QQ5A 3R1NA 5C26A 4Y95A 3HKOA 4NL0A 4X6RA 1Q97A 4P4CA 1WAKA 1FQ1B 4Q5HA 4NKSA 1Q8ZA 4PP9A 3UDBA 1MQ4A 4YNOA 4BL1A 4FV2A 1YW2A 2XNGA 2HWOA 2VWWA 3UP7A 1SMHA 3BQRA 1QPDA 1ZAOA 3V01A 4KS8A 1T45A 4KINA 3RINA 4RWIA 5JQ5A 3KXXA 5HO8A 3GU6A 4FEQA 5IQDA 5A6OA 1MRVA 5AUUA 5L6OA 4AGWA 1PXIA 2OZAA 4LRKA 3QX4A 4FEUA 4K18A 4P5ZA 4DH8A 4QYYA 2C0IA 3F5XA 3RZFA 2VU3A 2IWIA 2I0EA 3TKUA 2W1EA 1X8BA 2OXYA 3RWPA 1J3HA 3R8LA 4WBOA 2ZM1A 2PE1A 2YM4A 4FV8A 5DH3A 4QP1A 1TQIA 4MVFA 3PVWA 5HD7A 3FMNA 4IWDA 4EQMA 3U54A 1Z5MA 3UC4A 2YCSA 3GU7A 4WD5A 1OKYA 1H28A 2P2IA 4LOQA 3V5PA 4A07A 5JGDA 4FG7A 2IZUA 3D14A 3SG8A 5ETIA 4ID7A 5I3OA 3HAMA 1HOWA 3RAWA 4B8MA 3H0YA 3E87A 3TUDA 1XQZA 4XP0A 4NZWB 5B2MA 3TACA 3BEGA 2Z60A 2WMAA 3NNVA 3SW4A 5LWNA 1W82A 4NU1A 3R7OA 5HE2A 1FMKA 2Z7LA 4UYNA 4AOTA 4QQCA 5A6NA 5LVOA 2RFEA 1CKIA 4IC7A 4BI0A 2CGUA 2XJ2A 1BL7A 3DNDA 2C6OA 2YITA 3CJFA 3ERKA 2XIYA 4G3CA 2EB3A 4RC2A 4FV4A 1LEZA 3QC4A 3A99A 4NJ3A 2Y6OA 2C0TA 4FSTA 1LPUA 1P4OA 1JSTA 1RE8A 3QTZA 5HBHA 4C2WA 4RIOA 4YJOA 2WTVA 4QMOA 2WEVA 3E8EA 3FWQA 4IFCA 2QO9A 2XNMA 4GVJA 3JUHA 3E92A 4AZTA 4L8MA 4N57A 3GBZA 5LVMA 3TKHA 4X3JA 5J9YA 3THBA 3LIJA 3NW6A 3LFCA 5E7RA 2CNUA 4E4LA 4I4EA 4XV2A 4FT3A 4MHAA 5I9VA 5CSHA 2JDVA 2X81A 3KY2A 2BRHA 4D58A 5IDPA 3IW6A 4YHTA 5A4TA 5EKNA 3RPVA 1H24A 3LQ8A 5J5SA 3BV3A 4O96A 4WHZA 2BPMA 3R9OA 3PVBA 5KMIA 4F9AA 2C5XA 1URCA 2W4KA 1REJA 4GYGA 4BBFA 2X2LA 2XIRA 4HZRA 4NM3A 3RBWA 1OL1A 3TWJA 4OTIA 5A14A 5IH5A 1FBNA 3CQWA 2XK7A 3I7BA 2VX0A 4PMPA 2WMBA 4LUEA 2P0CA 5L2IA 3Q4TA 3C0GA 3PXYA 4HGTA 4ZP5A 4D2RA 1AD5A 2PHKA 2VWXA 4AN3A 2OXXA 1OKWA 3DZOA 3W16A 3NMUF 4GJ2A 2RG5A 3MB7A 3QD3A 3AMYA 3QXOA 3ORTA 4QYGA 4I6HA 3ZONA 4F0IA 5FXSA 4IJPA 4ARKA 4U0IA 3MJ1A 1XH8A 4FIEA 5CENA 2BTSA 3V8WA 4QMPA 1V0OA 1ZOHA 3MFSA 3RAKA 3GC8A 2BHEA 2X39A 3OW3A 3CXWA 2VGOA 2RSVA 1PHKA 4FV0A 4MEDA 4LOOA 3SLSA 3VUDA 4BKZA 3NEWA 2JFLA 4J99A 4RC3A 2VWVA 3VVHA 3QA0A 3P23A 2X7GA 4EZ5A 3V5JA 1P2AA 3VQHA 4L45A 4QMNA 4U3ZA 4PDYA 3N4UA 1MRUA 4BI2A 5BNJA 5ACKA 4PTEA 2B53A 4WNMA 3TXOA 2BCJA 1OUYA 1OPJA 4O0SA 4QQTA 3G51A 2PVMA 3PIXA 2A27A 3CS9A 1LEWA 2WO6A 2FA2A 5IA1A 3DZQA 4AAAA 4RWJA 4HPUE 5HKMA 3HX4A 3K54A 4FR4A 2HK5A 1OITA 4M12A 4FT0A 3K5UA 3D2KA 5KX8A 4BHZA 5I0BA 3CPCA 2O5KA 4APPA 1BUHA 5AP6A 4EHVA 5CU6A 5DT0A 4FKJA 3G15A 2ITZA 3A7JA 3ENHA 1H25A 3KKVA 3MY1A 2VNWA 3F5UA 2ZDTA 2LAVA 3UO6A 5IUHA 1GZKA 4DG0E 3ZO3A 1MUOA 3V51A 4D4SA 5CF4A 2XS0A 1M2RA 2O2UA 3ZM9A 5T3QA 4YBKA 2J7TA 3QQKA 4X2GA 3DDPA 3QF9A 4GSBA 4GK2A 4N0SA 1P4FA 3CLYA 1JQHA 4NCTC 2GS2A 4FKQA 1UNGA 1M17A 4I0SA 3NYVA 3QZHA 5HG8A 4CSVA 4TKSA 2IO6A 3B2TA 4EQUA 3OF0A 5KKRB 5FWKK 3SAYA 3U6IA 4D1XA 4IDVA 4AGUA 2XKCA 2B9IA 4JNWA 5HI2A 3VBVA 4A9TA 4D4VA 4PQNA 3IKAA 1QPEA 4HW7A 2XK4A 3O8TA 4LL5A 3MGYA 5IH6A 4L3PA 2RGPA 4E3CA 4P7EA 3SRVA 2IZTA 2GDOA 3OXIA 4K0YA 2XJ1A 4MTAA 5KO1A 4FMQA 4IB1A 1YKRA 3Q3BA 4XEYA 1JKSA 4DGNA 4BCNA 1H1SA 3BU3A 3FSKA 4IMYA 1JNKA 4U6RA 5FDXA 3NW5A 2IZRA 3T8OA 4DBNA 5JGAA 2G2HA 2QOLA 1R3CA 1YHWA 4OR5A 4R3PA 3AC5A 4QMTA 4RA4A 3TJDA 2HENA 4B0GA 2F7EE 4BCOA 4EH9A 3MWUA 4GRBA 1W7HA 1ZYLA 2B7AA 3ZEWA 4CTCA 3R7IA 3ITZA 1WVYA 3S4QA 1URWA 3OBGA 4RVMA 3S0OA 5C03A 3UGCA 5M44A 3DPKA 1VEBA 2QCSA 2V22A 2OIDA 3ULZA 1NW1A 4MXZA 3CR0A 4FSWA 5L2QA 3VBYA 3W2SA 4C35A 4D9UA 4BGQA 3FLWA 3C0IA 4MXCA 5CU0A 4O0WA 4HNFA 5E8XA 3WARA 4ASEA 3M1SA 2UZVA 5GJGA 4YJTA 4H39A 5AR8A 4EOLA 4EC9A 4OTQA 5IF1A 4RJ5A 2XNNA 5EW9A 4ZEGA 3VS2A 3FZRA 3L8PA 4DEAA 4MNEA 3OFMA 3ORZA 2ZMDA 4X3FA 2J0MB 5HU3A 1CSNA 1OI9A 4IZ7A 4TZRA 4UX9A 2B54A 3K2LA 4UY9A 3OVVA 3P5KA 3OEZA 4KAOA 4L7FA 5FQDC 4AFEA 4C33A 4NT4A 1G5SA 1B39A 4Y5QA 2V55A 2QU6A 2GNJA 4Y72A 4L7SA 2BDFA 2WTIA 3L9MA 4GJ3A 1I09A 3DKGA 3FHRA 1UU9A 3UNJA 5K5XA 3ZBXA 5TKDA 4ZS0A 4AA5A 3NUXA 2JBPA 4O7VA 1Q41A 2W1HA 3I7CA 3M11A 3NNWA 4L42A 4JDIA 3BLRA 3N51A 3COKA 1OKZA 5H8EA 3ULIA 1KV2A 4CTBA 3GFEA 5J9ZA 2QG7A 3HV5A 3GUBA 4O2PA 5AV1A 5FBNC 4OAVB 2AUHA 2XEZA 1RDQE 2JFMA 4G9RA 2PWLA 4QP4A 4BDAA 4ZS4A 2F49A 3G0EA 4QMVA 3P08A 3R6XA 4NFNA 3NAYA 5AP4A 3A62A 3NCZA 2H6DA 4CFNA 5HEZA 2C30A 3MFRA 3ZM4A 4M13A 3VS0A 3O7LD 5IG1A 5HVJA 1NXKA 4XOYA 3RNYA 4CKJA 1SVEA 4FV3A 3ZC6A 5CF6A 5JRSA 1ZMVA 4I5HA 3TV7A 4Z3VA 4MF0A 5CEQA 4F1TA 4F4PA 4GL9A 5D1JA 3CP9A 3F3VA 3UBDA 4ACHA 2JAMA 2OU7A 5I3RA 5CAVA 4R7BA 2J90A 4U3YA 4EK3A 1PMNA 2Z02A 4XMOA 5CQWA 5DOSA 5BMSA 4DEDA 5JT2A 4DG3E 3EOCA 5DRDA 2J6MA 3EKNA 3EHAA 4MBJA 4TW9A 4C57A 5T6KA 4I3ZA 3QFVA 3ZRLA 3ORLA 3QKKA 4I20A 4PY1A 4W4WA 4TT7A 3DB6A 4JG7A 1KE5A 4ZXTA 5M51A 3DCVA 2H8HA 4EOSA 3GQIA 4QMWA 5CI6A 5KZIA 3W32A 4KD1A 3DAJA 3F2NA 2QHNA 2BUJA 4YTIA 4KIKA 4NSTA 4TYEA 2PPQA 4I24A 1VYWA 2W17A 2Z7QA 3FMMA 3O0GA 1FVVA 1Q24A 2GHGA 5C8MA 5TF9A 2VNYA 3RVGA 4RIWB 3C4FA 5EG3A 2VV9A 3LQ3A 2UZTA 4G3DA 3FKNA 3KXMA 3LFAA 4FEWA 1H8FA 3HMMA 4X7QA 2YM3A 4BFMA 4F7SA 4NIFB 2BIKB 3E7OA 4FNWA 3UNKA 4AWIA 1BL6A 4FODA 4DCEA 4QMZA 4GVAA 3W33A 4BN1A 3TM0A 5FDPA 2WB8A 5JMSA 5HNBA 2OWBA 3ET7A 1PKGA 3RP9A 2ESMA 3K3IA 2GQRA 1YHSA 4FTAA 2R3PA 2CGVA 3NIZA 2R3LA 5EOLA 3PDTA 2DS1A 4FIFA 4J98A 4HGSA 4JBVA 2PMLX 4DH1A 4JBOA 5AUYA 2XNBA 4TYJA 3FI4A 1OPLA 5AIKA 3L1SA 4L67A 3U4UA 3TEIA 3V8TA 2WHBA 4BIDA 4JRNA 2PVYA 5M53A 3DXQA 2BAJA 4GEOA 3QZFA 2UW6A 4ZJIA 1W84A 4CFVA 2BRMA 5EYDA 2GQGA 5HHWA 4AT3A 3UQCA 2XK6A 1ZMWA 3SHEA 4C7TA 1GNGA 1ZYSA 4FYOA 3V04A 3WE8A 4C36A 4FEVA 3JY9A 1OM1A 3MESA 4B7TA 1Q8WA 4D55A 3KK9A 3OXTA 5AUXA 3G5DA 4RRVA 2ZM4A 3ORXA 3EWHA 2KTYA 1PXOA 3P7CA 3R02A 3UZRA 3O51A 4ZSJA 2ACXA 3BRBA 4DINA 5IQGA 3ZU7A 3QGYA 4HZSA 2G9XA 5CALA 4ZSGA 3PE1A 4YZDA 3R7VA 4AQCA 3FZSA 3ZOSA 3ID6C 1RQQA 3BQCA 3LXNA 4YJPA 3TZMA 2RFNA 3VS7A 1IAHA 1XBBA 1JKLA 3GXLA 4I21A 4O22A 4XOZA 4IAZA 4K8AA 5L6PA 3LAUA 1UU8A 3LMIA 2UW9A 4IAFA 2I0YA 3KCKA 3RI1A 4JBQA 4AG8A 2HZ4A 1UKHA 3KGAA 3R30A 2X4FA 4N6YA 3UC3A 5HCZA 4AOIA 4BDBA 4PUZA 4ZLOA 3Q04A 4U41A 4ACGA 4MBLA 5EQYA 3R8ZA 1YI4A 3ZLXA 2J0JA 3OEFX 4U97A 3SV0A 4OBPA 2XRWA 2DYLA 2CGWA 4ITIA 4MQ2A 5AV4A 3CQEA 3L9NA 3QU0A 3MDYA 4LM5A 3QD4A 2IW9A 3OZ6A 3ALOA 3NIEA 3AC3A 3E64A 2R5TA 2GS6A 3QD2B 1Q8YA 4RT7A 2C5NA 3RCJA 5CVGA 2IN6A 4FKSA 4ZJVA 5J9LA 2VAGA 4U43A 1U59A 2GPHA 3QLFA 4CV8A 2JKOA 3PPZA 2R3FA 4D0XA 2G1TA 2CCHA 3L8VA 5H9BA 3RNIA 5IEVA 3QHWA 2R3OA 3NAXA 2XIXA 4JI9A 2IZSA 5CVFA 2ERZE 4XV9A 3I5ZA 3CBLA 5KBQA 3W2CA 4MAOA 1HCKA 5F20A 3Q60A 2JGZA 3R73A 3ZFMA 2BRGA 4MNFA 1GJOA 4TTHB 4DHFA 4C59A 4KBAA 4MX9A 5LXMA 5AV0A 3GU8A 2JKQA 3F7WA 5CI7A 4E6AA 1H1WA 3HNGA 4CT2A 2J0KA 5HNGA 3PJCA 4M14A 4QTAA 2W06A 3KULB 4UMPA 2YFXA 5IQHA 3BIZA 2X8EA 3Q9ZA 4XNEA 3MH3A 3ODZX 2YCRA 3OHTA 4UMUA 4AF3A 3GGFA 2PUPA 3CY2A 4YHJA 4GS6A 3ZUVA 4ZTNA 3DBDA 3HMIA 3PVUA 2HOGA 4JLCA 2ONLC 2W1FA 5T68A 2VTTA 4KB8A 5AR4A 4F9BA 5BPYA 2J0LA 1PXLA 5AR5A 4R5SA 4IVCA 4MD9E 1F0QA 5EM6A 5CS6A 3WZUA 3BE9A 3MPAA 5DE2A 5CNNA 2FSTX 5C01A 5BVDA 1OUKA 1M52A 3OT8A 4EK5A 4EH7A 4LMNA 5C9CA 2CN8A 3C1XA 4TWOA 4QP9A 5F95A 3IPHA 3G6GA 2YIXA 4EOIA 4EONA 3D83A 3IDCA 4C4JA 5HX8A 5AP3A 4EH5A 4FUXA 1A06A 5E91A 2XF0A 3TDWA 5EK7A 2CJMA 4E8AA 4K2RA 4RZVA 3W1FA 2VTNA 4NCTA 4RWKA 5LARA 1NA7A 4R6VA 5LQFA 3AMAA 3JY0A 4I0RA 4I92A 4JG8A 2WU6A 2Q0BA 1WVXA 5HNIX 4AOJA 5IDNA 3S00A 3F3TA 4AT4A 4G34A 1NT2A 4FK3A 3GCUA 4GT3A 4H3BA 3DKFA 4PL4A 1OIYA 1PYXA 3R9DA 2DUVA 4EQCA 4O0TA 4RX9A 1H08A 4TRLA 4I6QA 4RX7A 3RHXA 4O38A 4RJ3A 3LCKA 1JLUE 4HJOA 4RX8A 4RWLA 2UVXA 4KRCA 4EH4A 4O7WA 3WF5A 3ZZWA 4MF1A 2FGIA 5KMOA 3NS9A 5CZHA 3QRKA 4E4XA 4DGGA 4ORKA 3MV5A 5ANKA 5CXHA 2Q83A 2PZPA 2XIKA 3S3IA 4GKIA 3LQ5A 4WBBB 4O0RA 3A7FA 3ELJA 2HZIA 5CU4A 4IB5A 4Y46A 3KA0A 2XCHA 4PPBA 1FINA 4U8ZA 4KKEA 3LMGA 2BZHB 2PVLA 2A2AA 5FTOA 4C37A 4AW0A 2F7ZE 4AGDA 4CV9A 4CRLA 5DGZA 4HVIA 4MWHA 4OBOA 2A4LA 2WQBA 2AYPA 3GNIB 4BCJA 2WKMA 5JEBA 3RMFA 3NUNA 1YOLA 1Y91A 3COHA 5DEWA 1R78A 4TYHB 3UOJA 3IDBA 3DXPA 4FIHA 3R83A 2X6DA 2OBJA 2UZDA 3N4VA 2NO3A 3SXSA 4FTUA 1Q4LA 4TN6A 3I81A 3TZ7A 4DLJA 5BYYA 1OB3A 4FSUA 4FT5A 3I60A 3JYAA 5B2KA 4CNHA 2BIYA 4D2PA 2X2KA 3IW8A 3B8RA 4FL1A 3TZ9A 5BUJA 4BDGA 3LZBA 4PNIA 3TJCA 3R8UA 5GIPE 5K0KA 3QC9A 4FYNA 2WMVA 4H58A 3U9CA 4RIXA 5E92A 2J9MA 2I0HA 2RL5A 3EL7A 5M4CA 4J71A 1OBGA 3DTWA 3VF8A 2GNGA 1H27A 4CFFA 4Y8DA 3R1QA 3Q53A 2RIOA 3NYXA 1XH9A 3QA8A 2XRUA 3TNPC 3VRZA 2PZYA 4A7CA 2CMWA 4W4YA 5E90A 3ORMA 2R64A 3DK7A 4LGDA 1B38A 4L44A 1ZMUA 4QP2A 3O17A 5BVNA 4AX8A 2VX1A 5E4HA 1ERKA 1SVGA 3HL7A 3PZHA 4IZYA 5BVWA 4S34A 4TWCA 1XJDA 5AAFA 3ZXTA 3T3UA 5IISA 2QU5A 1W98A 4ZJJA 5CAQA 1Q5KA 4Q9SA 5IQBA 5M55A 2Y4PA 2X4ZA 5HO7A 4UWCA 3DBFA 3RAHA 5K3YA 4YTFA 3DJ7A 4FKUA 5BVKA 5JZJA 1GOLA 4HCVA 3LFNA 3NPCA 4CKRA 3MVLA 5GINE 4X6QC 5CASA 3EKKA 4JRVA 3AQVA 1XH4A 3ZLSA 1IASA 2GQSA 4R1YA 4I94A 3B2WA 5AFVA 4OTDA 4O7YA 4C8BA 1MQBA 3ROYA 3BYVA 3QQFA 4I5PA 2GNFA 4F99A 2GNHA 1L3RE 5FM2A 1R1WA 3POOA 2JLDA 3CQUA 3PE2A 3OC1A 3SVVA 4XG7A 4HGEA 4KRDA 3RPOA 4F1MA 4PX6A 3LCOA 4XG9A 1SNUA 4J97A 4A9RA 3DLSA 3G9NA 4PDSA 2CHLA 4ALWA 4O7TA 4DCAA 1CM8A 4FZAB 5D11A 1Q99A 2WQNA 3BPRA 3UODA 4GH2A 2WQMA 4OW8A 3ALNA 2Y4IB 2VTIA 2OIQA 4E20A 4HYSA 4L6QA 5FEQA 5C8KA 2VTOA 1H07A 5FEDA 3QTRA 3VULA 4H3PA 5AP1A 3R9HA 1J7LA 4FVPA 4DGOA 3DGKA 3ANRA 2JKKA 4IEBA 2A1AB 2E9OA 3Q4ZA 3R04A 5M06A 3WBLA 4O86A 4FV5A 3L8SA 3S95A 4FSMA 3DS6A 4QMMA 4N4SA 1BMKA 3FV8A 4FIIA 3UIUA 4BICA 1WBSA 4D1ZA 1UWHA 4LMUA 4FT9A 1ATPE 1OL5A 4HOKA 4KA3A 3U8WA 5HCYA 4ALVA 4MBIA 4RZWA 1AQ1A 3EZVA 4H36A 4IVBA 4KSQA 4UXLA 5DN3A 3BU6A 3R0TA 4WO5A 5JQ8A 4QYFA 1SYKA 2VTRA 4WIHA 4YC8A 4BWPA 1Y6AA 4H3QA 1PY5A 2BTRA 3QZGA 4QP6A 2I40A 2BAKA 3FZPA 3C5UA 1JWHA 1V0PA 1O6YA 3LXPA 3OT3A 4OBQA 2XM8A 3OBJA 4CQGA 4MXOA 1YDRE 3BX5A 5IQCA 2FO0A 1WBVA 2Y9QA 3QTUA 4GG7A 5J95A 2VO3A 3CGOA 2I6LA 3FMJA 4N6ZA 4AW5A 3PA3A 3RM6A 4O81A 2V62A 4WKQA 2C6EA 4O6LA 4DH7A 3PP1A 2A0CX 2P4IA 4NYEA 3F2RA 4G6NA 4BCPA 4O83A 4ENYA 5KZ0A 3MH1A 2FUMA 1H1RA 3UOHA 5CLPA 3FPMA 4CFWA 5CT7A 2EB2A 4G3FA 4YP8A 5G1XA 5HE1A 3E8NA 5EQEA 3D7ZA 2BILB 2XK3A 3GCPA 5HOAA 5CF8A 2W1ZA 3MVJA 4O1OA 1XO2B 3ZRMA 4C0TA 3KF4A 3BE2A 4DFYA 1STCE 2HW6A 1SM2A 1H1QA 4M69B 4RFYA 3WYXA 3PXKA 1G8AA 2VTMA 4PDOA 3SKCA 4BRXA 4FKPA 5AP7A 4O21A 1LP4A 5AAGA 3VBTA 2UW7A 4UMQA 3FAAA 4OLIA 2C6TA 5J87A 4GUBA 4GK3A 1GZ8A 4J8NA 4KIQA 1S9JA 5FM3A 4IHPA 2NP8A 4MD8E 4WSQA 1M7QA 3OCSA 3R22A 4KIPA 1AGWA 2JITA 3PTGA 4HYUA 4IANA 4C4EA 3P1AA 4MD7E 4ANMA 2WU7A 2OXDA 3RJCA 5C27A 3KU2A 3LFFA 5HICA 2HIWA 1YI6A 4AUAA 3UOLA 2HY0A 4L3LA 2ZVAA 4EZ7A 4DG2E 4Z16A 4X2KA 4USEA 4E4NA 1M2PA 2VTAA 4FT7A 3QTQA 3WI6A 5D7AA 4D28A 2C4GA 4NKAA 1JVPP 2ZV8A 4WG3A 2OZAB 5GJFA 1UV5A 3QWKA 3BELA 3ZUTA 3GT8A 4QP3A 5KE0A 4IZAA 2RFDA 5EW3A 5GIOE 3QTIA 3VIDA 1FMOE 3IW4A 3QBNA 3VC4A 5DEYA 4EK4A 4B99A 2ZB1A 4FKLA 2WAJA 4N70A 2XYUA 5KMJA 5AMNA 5EKOA 4F9WA 5CWZA 5JFVA 5HESA 3T3VA 5A4CA 4U40A 3CTJA 4E5BA 2Y6MA 3D2IA 3F3UA 3MW1A 4TXCA 5FG8A 1Y8GA 4RVKA 2YZAA 1Q8TA 1KE9A 4GW8A 4WNKA 2OF2A 2QG5A 2VO0A 3QLGA 2HXLA 2PVHA 2CKOA 4EORA 4BHNA 4ZIMA 4CZYB 4IWOA 2C69A 2ONLA 5D12A 3TZ8A 3DDQA 1A48A 3KN6A 4BIBA 5CF5A 3HV4A 4LGHA 4ZTHA 1LR4A 1IA8A 1OL6A 4AN2A 5DLSA 4XLIA 4PTCA 2OICA 3VO3A 3WZKA 3VJOA 1H26A 4USFA 4U80A 3SOCA 4UMTA 5I9XA 5IKWA 3RAIA 4A9YA 4DEGA 4PL5A 5CU3A 3QCXA 4L3JA 5IA0A 4FF8A 3GC0A 5AR7A 3MIYA 5GNKA 4XRJA 5L6WL 3QD0A 5AUVA 4U5JA 5AEPA 3F61A 3QTSA 1G8SA 1YDTE 4YLLA 3AXWA 5DR6A 4TNDA 2YDJA 4OGRA 2B9FA 4YZ9A 5IA2A 4JVGA 3UO4A 3PP0A 3DTCA 4YMJA 4DFUA 4EBWA 3QCSA 3HDNA 5AX3A 1W83A 3U6JA 1J91A 5HGIA 5A4EA 4O84A 3DNEA 5F94A 5I9UA 4XP2A 1V1KA 2VWYA 2CCIA 4Q2AA 4FNXA 4XS2A 1E1VA 4DITA 2O8YA 2VTSA 5E8SA 5K5NA 4JDKA 4ACCA 1JSVA 4BTKA 3MTLA 4AGCA 4D2WA 5AM7A 3R9RA 2WTJA 4D1SA 4BR3A 1XBCA 4BGGA 4XG8A 2EUFB 2W9ZB 2PZ5A 5DT4A 3DFCB 4QMLA 3RKBA 3QKMA 4BCQA 3VHKA 2XYNA 2UVZA 2WZJA 2XK8A 3H3CA 3KVXA 5DWRA 5AUZA 2VD5A 4CD0A 2ETRA 1WBPA 3CTHA 4CZUA 2BZIB 4J8MA 3BYSA 1T46A 2OG8A 1U5RA 2OI4X 4FV9A 5CNOA 5HE3A 4DT9A 1YDSE 4EOJA 4KIOA 4MCVA 5TO8A 4H1JA 1FPUA 4PP7A 1JKKA 3ZSGA 3PG3A 3AD4A 3KXNA 3NNXA 3CKXA 2JDTA 3FLZA 4FTJA 3R7YA 1H4LA 4CYIA 5BMMA 5AUTA 1JKTA 1IRKA 4GFOA 2YHVA 1ZWSA 4J52A 3AG9A 3UOKA 4XBRA 3WF8A 4APCA 1YXVA 3IECA 5LWMA 2WELA 3P7AA 4JDJA 5FTQA 4G17A 5IQFA 4QPAA 2R3NA 4DYMA 1ZY5A 2PTKA 2OZOA 1XR1A 1PYEA 4W8DA 2QOFA 5DNRA 3FY0A 4YURA 1J1BA 2E9PA 1UWJA 3TDVA 3MH0A 1YXUA 3A7GA 3QKLA 5EHLA 4IXPA 4V0GA 3R71A 4C61A 3C0HA 3OCTA 4CG8A 3Q4UA 4U9AA 3QZIA 4M84A 1XWSA 3I0OA 4PWNA 4FC0A 3OTUA 1OBDA 2IJMA 4FNYA 3PY1A 3GOKA 3NLBA 3PXFA 2QKWB 3RALA 2AC5A 4P90A 3W2QA 1KSWA 4ZSEA 2CDZA 3BYMA 2OJJA 4WA9A 3PJ1A 3FMEA 4O0UA 2PMNX 2Y4IC 3VS5A 2PSQA 3MTFA 3M42A 1Z9XA 2H34A 3LM5A 5A3XA 4AZWA 2BROA 5CU2A 4F70A 4HCUA 5HG9A 3LCTA 4NTSA 3KF7A 5DPVA 5D41A 3UPZA 2J2IB 4FZDB 3JVSA 3LJ1A 4U79A 3RGFA 5KCVA 2REIA 3LPBA 4ZTLA 2XCKA 3HUCA 4KBCA 4WNOA 5I4NA 3PJ2A 3VS1A 5JSMA 5HBJA 4IB0A 3DXNA 2UW5A 4ALUA 2JKMA 3PVGA 4KABA 5AAEA 2OJ9A 1Y6BA 4F64A 2OLCA 4QOXA 1IAJA 4S30A 3SDJA 3I1AA 4IZ5A 4XG2A 2P2HA 5DR2A 3LLTA 2OH0E 1ZZ2A 1G3NA 4EH6A 5CZIA 4QO9A 4Q9ZA 3CTQA 5M4UA 1OZ1A 3HLLA 2PY3A 1FGIA 2XB7A 2XMYA 3Q9XA 4IJ9A 5FXQA 4O7LA 3QRUA 5JFXA 5E8UA 3IG7A 3SRVB 3U87A 4IVDA 3QX2A 3CCNA 4PPAA 5CSXA 4R5YA 5EYCA 4XH6A 1H0WA 5I9WA 3KB7A 4PF4A 4W9XA 4WNPA 4I4FA 3G0FA 5TE0A 2JEDA 1UNLA 3DV3A 1W8CA 3F5PA 3FLSA 3O71A 4JT3A 3TV6A 4RVLA 1R0PA 4A4OA 1PKDA 2HXQA 5ANOA 1DS5A 1U4DA 2QR7A 4FUYA 4JG6A 1FVTA 4K6ZA 4QPMA 5EDQA 3LXKA 5HQ0A 2Y8OA 4FEXA 2IVTA 1Q62A 2VO7A 3B8QA 3SXRA 4E5WA 5EI8A 5TR6A 4ZLZA 1J1CA 3D0EA 5D9HA 3ZFXA 2PUIA 2UV2A 2PMOX 5E8ZA 3HECA 3NDMA 4Y73A 1H01A 2P3GX 4DEEA 4CGAA 4I93A 4IM0A 3C51A 4AZEA 4M67A 5A9UA 3HMPA 5AP0A 4UV0A 4F6SA 3EFWA 3W55A 2JAVA 2X6EA 4MNEB 5JKGA 4IWPA 4FV6A 2VRXA 2XBAA 2YM5A 4QT1A 5M4IA 4Z7HA 4RIYA 2ZV7A 3BYOA 4WUAA 4ERKA 5JGBA 3IS5A 2VGPA 3HAVA 2F4JA 4G31A 3U6HA 4UEUA 3EH9A 3LCDA 4QTEA 2VO6A 4LRJA 5ITAA 3EYHA 3FI3A 2UZUE 1VZOA 4JIKA 4YSMA 3D7TA 2BKKA 4O7RA 1KE6A 2HW7A 3ACJA 2I0VA 5HTCA 5ANDA 1HCLA 4O27B 3HRBA 4BI1A 2XUUA 2HZNA 4QMUA 3D5VA 4XBUA 3LKMA 4ANNA 4QTCA 4U44A 1BI8A 2CKPA 5CYIA 3W2PA 4FBXA 5CSPA 2G01A 3AGMA 3O8PA 3FL4A 2JIUA 3GEQA 2XP2A 2XJ0A 5IUIA 5HZNA 2W7XA 3PXRA 4I1ZA 4CQEA 3SQQA 3HUBA 1EH4A 2GS7A 4XYFA 3OOMA 3NX8A 2EWAA 2ITQA 3V6RA 4CLIA 5FUTA 4CRSA 5IUGA 2QOIA 4YO6A 3EN5A 3VBQA 4FV1A 4F6UA 4EWHA 3I6UA 4AXAA 3W10A 3ZXZA 3MPMA 4AN9A 4IFGA 4JXFA 3QTWA 4NJDA 4FG8A 1MRYA 2YIWA 2RKUA 4FICA 3BHUA 3FJQE 4EH2A 4FZ7A 2P55A 5HU9A 2XVDA 1M2QA 5BYZA 1ZY4A 4BCKA 4QMXA 3UIBA 4TNBA 4EYJA 5J1VA 1KE8A 3FE3A 2IG7A 1OL7A 4BIEA 3BHYA 2PU8A 5BVEA 4FTKA 4M66A 1PXPA 5DHJA 3C9WA 2BRNA 4II5A 3AT2A 5AP5A 3F9NA 3ETAA 3POZA 4M97A 2W1CA 1A9UA 4KS7A 4NM0A 3PPKA 2X7FA 3F82A 3OMVA 5E8WA 3QQGA 5KMMA 2ZYBA 1XH6A 4UMRA 3KRXA 4RJ8A 3UPXA 3RHKA 3R7EA 4RX5A 3FC1X 3N9XA 3U55A 3C7QA 2X9FA 3D5XA 1WCCA 4YC3A 3C4EA 1L8TA 5AADA 4BGHA 1QPCA 3P4KA 3QRIA 3UE4A 3VWAA 4E4MA 2CNQA 4AS0A 3GCVA 4M8TA 2VTHA 2WOTA 3BI6A 1WBWA 4QQJA 5CY3A 3UMXA 4R3CA 3W8QA 5HLPA 4ZLYA 2UW8A 3MY0A 3Q6UA 2J0IA 2HAKA 3HEGA 2GCDA 4Y5HA 3P79A 1UKIA 2F9GA 3FQSA 4LQMA 4D5HA 3I4BA 3NZ0A 2E9VA 3DK3A 3WF7A 3ZDUA 4HVHA 5KKRC 3EJ1A 3OWLA 2GU8A 3KQ7A 4FKWA 4G6LA 1Z57A 4C3RA 4ENXA 3KREA 3PZEA 1ZARA 4BDIA 3PIYA 4GT5A 4JQEA 1IEPA 4JQ8A 4B6LA 5C4LA 3R7GA 2F7XE 3ORPA 2QC6A 3EYGA 4XG4A 4FKIA 3MPTA 4CMTA 2OO8X 1PXMA 4WG5A 4WRSA 3QYZA 4C58A 2PVRA 3A2CA 2O0UA 3RPSA 4LL0A 4L00A 3RK7A 3DY7A 3P86A 4FKGA 4WT6A 4BKYA 3ZLWA 1Y8YA 2QOBA 3U4WA 4GU9A 3PA5A 3DBEA 4IVAA 2WOUA 2B9HA 4QD6A 4YNEA 2BFYA 2E9NA 1CTPE 4O0YA 3F5GA 2YZLA 3H4JA 2JDSA 2PZRA 4TYHA 5I5ZA 2F2UA 1OIUA 1PXNA 3F3ZA 1OECA 5E8VA 2CKEA 4O0VA 4QYEA 4I6BA 2ZV2A 3QCYA 3Q52A 2CGXA 3MFTA 4YPSA 3WF9A 2YDIA 4ANLA 3V6SA 4BZOA 5LCJA 4D9TA 1DAYA 5AA8A 5K4JA 4JJRA 5KNJA 3E8DA 5BVOA 3Q5ZA 3FMHA 3MVMA 5L2WA 5FTGA 1DM2A 2QURA 1BKXA 3DFAA 4E1ZA 2B0QA 4IW0A 2SRCA 3FC2A 4IX4A 5KHXA 4EKLA 2CPKE 2WXVA 3BBTB 5TOZA 3C4XA 3DJ5A 2P33A 4F7JA 4IM2A 4XLVA 5E9EA 1JOWB 3F88A 3FSFA 4IAKA 4EJ7A 5L8JA 4FZFB 4A4LA 2CLXA 3BYUA 4X21A 4WRGA 4BY9E 4IX5A 2VX3A 5IH4A 3FXWA 3S1HA 3GENA 2WNTA 2YWPA 4I5MA 1I44A 5AA9A 2FB8A 3CPBA 4TL0A 4NW6A 1UNHA 3TNQB 3EB0A 3WE4A 3IK3A 3GQLA 4YUQA 5CEMA 3U51A 1APME 2XZSA 5G6VA 4ZTRA 1GAGA 2WQEA 3OW4A 4EH3A 3NNUA 4O7SA 1Y57A 4JBPA 3C5IA 2O3PA 4L53A 2YM7A 4FOBA 5EHYA 3KXZA 1IG1A 2QVSE 3ACKA 1OPKA 3QRJA 2ITWA 4H1MA 2GFCA 3E5AA 3L9LA 4RJ6A 3AD5A 1P5EA 3QWJA 5J79A 3W18A 2QODA 1FOTA 3DT1A 3FLNC 3SGCA 5F1ZA 1PMEA 3CD3A 3FYKX 4BB4A 4K11A 2OK1A 2OF4A 2WTWA 4J53A 3KRRA 2E2BA 2OIBA 3QAME 3SXFA 1K2PA 4AACA 5CAUA 5LMKC 2WMQA 4LV8A 2OKRA 4RLLA 3HVCA 5A4LA 5HLWA 4RVTA 3LFQA 4DFBA 4ZOGA 4QP8A 1PXJA 2UZLA 3NR9A 2YIYA 2PUUA 3DB8A 2NRYA 3SOAA 4NUSA 4X2NA 4PRJA 4C2VA 5FRIA 4X0MA 3UTOA 4E7WA 2JD5A 3Q32A 5M09A 3FMDA 3FMKA 2W0JA 2WMSA 4Z9LA 3BZ3A 3RM7A 3MY5A 3EFKA 4NWMA 2WPAA 4GV1A 1YXXA 3BGZA 2R3IA 3FBVA 4LFIA 4UWYA 4G5PA 4XJ0A 1KV1A 3VHEA 4QP7A 5JH6A 5M4FA 2IPXA 3LMHA 4DBXA 1WFCA 2YM6A 4FOCA 3LFSA 2W1GA 1VJYA 3Q5IA 3E3PA 3IOKA 4OTFA 3VS4A 3ZSHA 4PDPA 4EOKA 3PLAE 5C8NA 2YERA 1YWVA 2G15A 3R8PA 3PSBA 4W9WA 3SG9A 5IEXA 5B2LA 4FTIA 4ACDA 4JR3A 4C4GA 4LI5A 4WOVA 5DBXA 2ITOA 3RPRA 4ASZA 3VS6A 4FKTA 2R0UA 3DBCA 4A9UA 5J7HA 4ITHA 1W0XC 4FKVA 1CKPA 3A4PA 3HGKA 4BYIA 2W4OA 2PULA 4OTHA 3E93A 5FXRA 4RFZA 3FI8A 4RQKA 4FGBA 3QQUA 2X7OA 3OD6X 4RJ4A 4BWXA 2QOKA 2EXEA 2VTLA 4F0FA 2X9EA 4GFGA 3TI1A 4HVSA 4D2TA 2BRBA 1NVSA 2QQ7A 3AC4A 4ZTSA 4F6WA 3TUCA 2QLUA 5A4QA 4AP7A 3MJ2A 4FGRA 4DLIA 2W1IA 3UIXA 4YU2A 4ZSAA 4OAUC 2B55A 3HV7A 2V5QA 4LV5A 3ORIA 5D10A 3MH2A 4IX6A 3A60A 3MA6A 5E8YA 2YAAA 5HO6A 4OTPA 4BDCA 1U54B 4TYIA 4YJVA 4O2ZA 4E73A 4EHEA 5CEPA 3QHRA 2IVUA 3EQIA 3UVQA 4JAJA 4ZSLA 3O8UA 2X8DA 3PSCA 3TNIA 2YABA 4BZDA 3TNWA 4D2SA 5CX9A 3KRWA 3O2MA 1TQPA 3BLQA 4FSYA 5AV2A 5AM6A 5IA5A 3MSSA 2C3JA 4JL9A 4FTRA 4FVRA 3REPA 3VW8A 4F63A 3KVWA 1XHAA 3HV3A 4J95A 3VS3A 2QOCA 5A54A 4IQ6A 4J1RA 3I6WA 3ZO4A 4CT1A 1TKIA 5D7VA 5J7BA 3UO5A 3PRFA 1FGKA 4EJNA 4G3GA 3AC2A 4MXYA 4MKCA 4FA2A 1WBNA 3RWQA 4E26A 2H96A 3CSVA 5CTPA 1NY3A 3QRTA 2QR8A 1OIQA 2C5OA 2XNOA 4G5JA 2OJIA 2XKDA 4NW5A 5BUEA 4ZZNA 4RBLA 4DEBA 3H9OA 5ANIA 3BV2A 3CC6A 4PMMA 3SC1A 4DGMA 4CG9A 2BZKB 4UALA 1OKVA 4ITJA 5M57A 5LMBA 2PVJA 3O96A 4XG3A 5EI6A 3NYNA 4YBJA 3HMOA 3MYGA 3R63A 4YO4A 4D5KA 4EOQA 3KEXA 3OY1A 4IX3A 1DI9A 4I0TA 5BUIA 5KHWA 4I6FA 4RIXB 3ZLYA 3ENMA 3NVKI 4G3EA 4U45A 5H3QA 4E93A 2C0OA 3D15A 3Q96A 3KFAA 4C62A 4AZVA 2XM9A 5IA4A 2WMUA 2GNIA 1V0BA 3OXZA 3BHHA 3EQFA 3MVHA 4DC2A 3OP5A 1SVHA 3WYYA 3NRMA 3ODYX 2BKZA 3EN7A 2Z7RA 2R0IA 2R3QA 4HVDA 2W5BA 4UXQA 4EHZA 4ERWA 1K9AA 1BX6A 4GK4A 3V5QA 2FH9A 3LM0A 4C4IA 3T9IA 3I79A 5DFPA 3GOPA 4L9IA 3R28A 2O63A 4AW1A 4O0XA 4WSYA 2BDWA 4D4YA 5BQ0A 3PJ8A 2QD9A 4DH3A 4GKHA 3ATSA 3R21A 3O50A 3DU8A 3Q9WA 4FZ6A 3VW6A 3KCFA 4F9CA 3LW0A 4NTTA 5I9YA 2UW4A 3C4CA 1O6LA 2W99B 3UVPA 4F65A 3E8CA 2ZAZA 5CEIA 3PWYA 1KE7A 4FG9A 2UZOA 2PUNA 1GIJA 3H9FA 5EM5A 3K3JA 3LVPA 3RPYA 2W4JA 3N4TA 1OVEA 2YCQA 2NPQA 3GFWA 4MXAA 4Y85A 4BDHA 3VUTA 5JRQA 3QUDA 4XUFA 5J5TA 3MN3A 3QQHA 5AWMA 1B6CB 3DLZA 4EL9A 3O23A 4G16A 3MBLA 5IA3A 5E1SA 4YGAA 5ANGA 4B8LA 2ZOQA 2VWIA 3H0ZA 4C3FA 1GIIA 4BDJA 3UZTA 1Q3WA 2OW3A 3EMGA 3NUUA 3Q6WA 2FSLX 2QONA 3QTXA 4ZY4A 3EN9A 3E3BX 3OWJA 2C3KA 2XH5A 3HZTA 4KKHA 2C1AA 2GTNA 1PF8A 1U5QA 3FI2A 4NK9A 5CSWA 5DT3A 4S33A 3RK9A 3M2WA 1YXSA 2BR1A 1OMWA 2QO2A 2QOQA 4G9CA 4BCGA 4V05A 1UU3A 1CDKA 5HVKA 1H1PA 4M0ZA 5HORA 4Z55A 3ZZEA 4TPTA 2I7QA 2WMXA 2PVKA 5LCKA 2ZDUA 5DR9A 3ZMMA 2Z2WA 2WFYA 2HZ0A 5L8LA 4PPCA 2HYYA 3PWDA 4DTKA 4FSNA 4BCIA 3EQHA 5HTBA 2BMCA 3R1SA 4EK6A 3SX9A 4QTBA 4RMZA 3QXPA 2F2CB 2YIRA 4FNZA 3SA0A 2PE2A 4TWPA 4DGLC 2OSCA 2JDOA 3PSDA 4ZMEA 4YPDA 2WTCA 3CD8A 2R3GA 3GU4A 3TIZA 3TTIA 3R9NA 5J8IA 4KSPA 2X1NA 3QUPA 3KRJA 5BX0A 2F57A 3BU5A 3FEGA 3GB2A 3NUSA 2ZB0A 4YZCA 4KKGA 4O7NA 2HELA 3L8XA 3OCBA 4RQVA 4C4FA 3LOKA 4EHGA 1ZOEA 3JR1A 3SW7A 3IDPA 3VF9A 1YRPA 4FK6A 5HVYA 2UZEA 4FTOA 3BHTA 4LG4A 4YHFA 5F4NA 4BDKA 1ZLTA 3CGFA 3JPVA 4Z7GA 2W05A 3OUNB 3COIA 3OROA 3QALE 3SD0A 4RPVA 4BCMA 1F3MC 3HV6A 3UVRA 4AA4A 1TQMA 4CMUA 3AOXA 5DA3A 3VUGA 2JDRA 5K4IA 3A8WA 3F66A 3FZ1A 4I41A 5CAOA 3EN4A 3W8LA 4BBEA 3EQPA 4K33A 3H10A 5AR2A 2YLEA 3HP5A 4U7ZA 4H05A 2QOOA 4J7BA 5M07A 3RK5A 3D94A 4HCTA 4OT5A 4RGJA 5E1EA 5C4KA 5HTIA 4LRMA 1S9IA 3F7ZA 1KWPA 2WTKB 3KXGA 4YZNA 3LXLA 3BGQA 1U46A 4ZZMA 4ZY5A 4R3RA 3PXQA 1XKKA 1J7IA 4W8EA 3OWKA 3QUEA 4JIAA 5AP2A 2X2MA 5I9ZA 2LGCA 4FKOA 4MH7A 2YACA 3ZS5A 2G2IA 3KN5A 1ZOGA 3AT3A 4R7IA 5JK3A 4EEVA 5IQIA 4FTMA 4RA5A 3CIKA 2R3JA 2BHHA 4XX9A 2OFUA 3UYTA 2XK9A 3UQGA 5M08A 2VTPA 2GNLA 2R7IA 4L43A 1KUTA 4EOOA 1ND4A 3VRYA 3PPJA 5AR3A 2DQ7X 3H9RA 2VUWA 3RZBA 3BKBA 3VN9A 2WGJA 4CVAA 3EFJA 4ZMFA 3PLSA 3KXHA 4BTMA 5EH0A 4S32A 4U42A 3EIDA 4R1VA 4YJRA 3TNHA 3GCSA 4EUTA 3NW7A 3HDMA 5L4QA 4FTTA 1QPJA 2J5EA 4TWNA 3S2PA 4C38A 5EYMA 4BCHA 2G2FA 3KC3A 1JAMA 4RSSA 3OUKA 4MK0A 4F09A 5LMKA 4S2ZA 2W5AA 3C50A 3K5VA 3VUMA 3AD6A 3BLHA 4FTLA 2O65A 2IVSA 4ANSA 4RG0A 2VZ6A 3II5A 1PW2A 3G9LX 2XBJA 4LUDA 3NYOA 4DEIA 5AV3A 3GC9A 1Q8UA 4J96A 3GI3A 3LFDA 4GG5A 4GT4A 4CYJA 5EOBA 3UIMA 3EN6A 5JN2A 3OY3A 1WBOA 3PG1A 1WZYA 4YC6A 3QQJA 3TUBA 3V5TA 4D0WA 1QL6A 3FUPA 1M7NA 4FIJA 1YVJA 3Q2MA 4F9YA 2QO7A 4AT5A 3GP0A 4BF2A 4UZHA 2C6IA 4LYNA 4CFXA 5B7VA 4EK8A 3VNTA 5CANA 2RFSA 4QNAA 4OTRA 5GZ8A 2YCFA 2WTDA 4MQ1A 1J7UA 2UW3A 4RIWA 2PMIA 2YWVA 4QTDA 2RG6A 1SNXA 4YJQA 2EXCX 3JS2A 4NIFA 2B9JA 4LGGA 4FL3A 1H00A 2YLFA 2OGVA 4JOAA 4NFMA 3WIGA 3NVMB 2QOHA 1YQJA 2W5HA 4DAWA 5H8GA 1BI7A 1ZZLA 2WEIA 4LOPA 1K3AA 4YJSA 3VUHA 4U81A 5HX6A 5K9IA 4IBMA 3P9JA 3QQLA 5FBOA 3KMMA 5EDRA 3H30A 3MB6A 4EUUA 2Y7JA 1CMKE 3ORKA 5IEYA 3ZEPA 2ETKA 2C6KA 3C13A 4GMYA 4ZK5A 2IW6A 5HE0A 3HMNA 2YAKA 4M3QA 2WMWA 4CCUA 4C4HA 2Y0AA 2ZM3A 4HYHA 5LVPA 4FE2A 3W2OA 3ZO1A 4WUNA 4CMOA 4FX3A 4I23A 3WZEA 3WZJA 5EQPA 3GCQA 3ZSIA 2GTMA 2YA9A 2EXMA 5EFQA 5EYKA 3ZTXA 3WIKA 4K9YA 4ONAA 2CLQA 2QNJA 2JIVA 5IQAA 5DI1A 4IACA 3KL8A 1YOMA 3TN8A 3ATTA 1ZRZA 4QNYA 4O6EA 4BC6A 4O91A 5CXZA 5AIRA 1MP8A 3UG1A 5HIBA 4KUJA 3MFUA 3G6HA 4PL3A 2Z8CA 3BGPA 3DAKA 4R8QA 3TIYA 4DFXE 2Z7SA 5HLNA 3FZTA 3KMWA 4JX3A 2UVYA 2FSOX 2VWUA 5LOHA 5AJQA 3D5UA 3ORNA 3G90X 3NUPA 4IB3A 2YISA 4HNIA 3LFEA 4IAIA 2ETMA 4JQ7A 4QRCA 1M14A 4WG4A 4YLKA 2ITUA 1REKA 2UUEA 4OTWA 2BDJA 4V0GB 5TT7A 4D2VA 3A7IA 4I5CA 5EI2A 2ITYA 1PJKA 5F9EA 3PIZA 4X3FB 1YI3A 2C5YA 2V7AA 1FVRA 3A61A 4CFMA 5GZAA 4YZMA 3FKOA 3HRCA 3OCGA 3V8SA 5M56A 2XA4A 1GZNA 4RFMA 1RW8A 3TCPA 4GIHA 3WZDA 3F6XA 4FL2A 2C3LA 2CN5A 4R78A 4CXAA 2X8IA 4L52A 3UZPA 3TG1A 3FLYA 3ZYAA 2XEYA 2R3MA 3CKWA 4DFLA 4CLJA 4BWKA 4YSJA 4YTHA 1UVRA 1QCFA 2EVAA 2HY81 2WMRA 3HA8A 2C6LA 4QYHA 2NNWB 2VWZA 3RCDA 5HD4A 2PVFA 1JSUA 2Q0NA 4QMSA 3DQWA 3PY0A 4AZSA 4IH8A 5HBEA 4BTJA 4KBKA 2EU9A 4P5QA 3OTVA 3OS3A 4O82A 2QLQA 3DK6A 4V04A 4L68A 4ZTQA 3UG2A 4QMQA 5KMKA 1OL2A 1WMKA 3EQRA 3VJNA 4IWQA 1YWRA 3EQCA 4P2KA 1DAWA 3NGAA 3PRIA 4BKJA 2PYWA 1ZYCA 4UBAA 3R00A 2O64A 3PJ3A 3Q4CA 4EBVA 2PL0A 4IAYA 2PK9A 4GYIA 3JXWA 1NVRA 3PUPA 2RF9A 2XKFA 4BZNA 3KULA 3NCGA 4DT8A 4DFNA 4FSQA 4EC8A 3FYJX 3QCQA 5JFWA 3LCSA 5EM8A 2ITTA 1O9UA 4YR8A 3G33A 2C3IB 4ASXA 2A19B 3MI9A 2OJFE 3A4OX 3UJGA 2VTQA 4EZ3A 5L3AA 4USDA 3R8VA 3BEAA 2ZV9A 4DH5A 3AC1A 5ETCA 1GIHA 4ACMA 4B9DA 5IU2A 3VQUA 5IPJA 1Q61A 2UW0A 4FKRA 3AMBA 2ITNA 2JBOA 4XHKB 3VUKA 2J4ZA 3BWFA 1YOJA 2QHMA 5CSVA 4W4XA 4KNBA 4DTAA 5LMAA 4NM7A 1H0VA 3FZOA 2B4SB 5JZNA 4AE9A 2WD1A 1QMZA 1GZOA 3ZFYA 3UNZA 4HGLA 3HRFA 2C6DA 4OTGA 3EL8A 3ROCA 4CKIA 4GUEA 3CJGA 4M68A 3FQHA 4CFUA 4DEHA 3HYHA 3VUIA 5CVHA 1ZXEA 5ETFA 1IA9A 2YEXA 3V5LA 2ITXA 2PVNA 3DKOA 4UN0C 3WF6A 2BZJA 2C68A 4KIKB 3EFLA 4IE9A 2VWBA 4L46A 3TT0A 2R3HA 4DFZE 3COMA 4JR7A 3F2AA 1JBPE 4RLKA 3Q9YA 5BYLA 5ICPA 2BAQA 2WMTA 4AU8A 1KOBA 4AW2A 4A06A 4R7HA 3KMUA 2WTKC 1BLXA 1YHVA 5HIDA 4FTNA 4BBMA 5KMLA 3DAEA 4RIYB 3MS9A 3VBXA 3PYYA 3C4WA 3VAPA 3NUAA 3RTPA 3ZRKA 2ZMCA 4CEGA 3TV4A 3FPQA 4IM3A 5GZ9A 2E9UA 3TKIA 2FVDA 4UB7A 3VBWA 3D7TB 3P0MA 3DOGA 4W4VA 2R9SA 5DVRA 1NVQA 5HG7A 2CSNA 2R2PA 3NUYA 4XV3A 2BFXA 4BDFA 3TTJA 2R3KA 4BDEA 4GIIA 5K0XA 3ZHPC 3R01A 3R1YA 3EQGA 3AC8A 3FHIA 2B52A 5JFSA 3DQXA 5FLFA 4FI1A 3R2BA 3KRLA 4IIRA 4ZTMA 4DE4A 3C4ZA 3PA4A 5AUWA 3OG7A 4F0GA 5LVNA 4XRLA 3TL8A 1OIRA 5HCXA 1RJBA 2GHLA 2XKEA 4BTFA 3CEKA 4S31A 4E5AX 3FDNA 4K1BA 3ZO2A 2C5VA 4O7ZA 4F08A 4HPTE 4EOPA 4UWBA 5FP5A 4GU6A 4YTCA 2OFVA 2FSMX 3G2FA 1OGUA 3QL8A 4MWIA 3ZC5A 2I1MA 5LVLA 2GMXA 4M15A 5HG5A 3L9PA 3HA6A 3LHJA 5IZFA 1Q3DA 1SZMA 1GY3A 2YIQA 5ETAA 2C47A 3F69A 1XH5A 1YWNA 2ZJWA 2GSFA 2JIIA 4D4RA 1XH7A 2B1PA 4DN5A 2R4BA 2XIZA 5HIEA 2QI8A 4YZBA 5EDPA 1DI8A 3EQDA 3FMLA 2GHMA 3UYSA 3U9NA 4G1WA 3KK8A 4FV7A 4OT6A 4V01A 4CZTA 4PMTA 3I5NA 5L2TA 3MIAA 4FSZA 1R39A 4Q5EA 2UZNA 4NEUA 5EW8A 3UQFA 4FVQA 3GVUA 5DG5A 4C02A 4K77A 5FGKA 1E9HA 2J5FA 3LJ2A 5CEOA 4DA5A 4L01A 1UU7A 4JAIA 4E6DA 4ASDA 2AC3A 4BVUA 4MXXA 3FXZA 4GFMA 3ZBFA 4C3PA 5BVFA 3E63A 4YJNA 1KOAA 5CEKA 3O7LB 3QGWA 4UYAA 1IR3A 4ANBA 5LJJA 5J1WA 3CE3A 4PV0A 4EH8A 4GCJA 4FTQA 4BDDA 5DYJA 4DTBA 3NSZA 3ZCLA 4AZFA 3LLAA 4HVGA 4ZY6A 5KMNA 4TY1A 4UZDA 2ITVA 5KUPA 4DF3A 3UMWA 4EOMA 2JC6A 5IQEA 3AGLA 4G6OA 4FSRA 4MYGA 3FQEA 2QKRA 4NH1A 3EZRA 3AT4A 4XP3A 3IO7A 2V7OA 5FD2A 4F7LA 4IADA 1U54A 2W1DA 3E88A 4AE6A 2UZWE 4KWPA 4A4XA 4BCFA 2XNPA 4XG6A 4C34A 2WIHA 2GFSA 3EQBA 1O6KA 4EWQA 4PNKA 2IVVA 2FYSA 3F3WA 3LE6A 3P7BA 4X2JA 2ITPA 3R2YA 5KBRA 4AFJA 5EM7A
chains in the Genus database with same CATH superfamily
3E7VA 4ANQA 3IQ7A 3UP2A 4B4LA 4FTCA 2KULA 4BYJA 3BLAA 1VR2A 4O1PA 3IGGA 3IW5A 5IMXA 5CT0A 4Y83A 1F5QA 2R7BA 5L2SA 3OWPA 4JS8A 3W2RA 4FIGA 4E6CA 3ZH8A 3LFBA 2J51A 2V0DA 1YXTA 3GU5A 5FEEA 3ZDIA 3WOWA 3DKCA 2PZIA 3NWWA 4E6QA 4JDHA 3Q2JA 4M7IA 1CKJA 5L8KA 1BYGA 4QMYA 2PE0A 1XMMA 2H9VA 4EKKA 1ZYDA 2YM8A 3WILA 2YN8A 5ANJA 4ZZOA 2R3RA 3A7HA 4EI4A 2C6MA 4OUCA 2HWPA 4HYIA 4X3FC 5GJDA 4XV1A 1VYZA 3FXXA 3IOPA 1E1XA 1ZYJA 4A9SA 3JVRA 3PXZA 2DWBA 3QYWA 2BALA 4AA0A 3BHVA 4R77A 3IGOA 4TYGA 2UZBA 4F7NA 4QDEA 5H8BA 2ERKA 2J50A 5DRBA 5AX9A 5GHVA 5C1QB 5FP6A 3V5WA 5IMEA 3D9VA 1PRYA 2HCKA 5CAPA 5DIAA 3DA6A 4YJUA 2CKQA 3FL5A 2X0GA 4QPSA 3DBQA 1P14A 2VN9A 4ZAUA 4IC8A 4NM5A 3HP2A 4IDTA 1PXKA 4RC4A 2WIPA 3T9TA 3LJ0A 3MA3A 4PTGA 3A8XA 2YJRA 5EHOA 1PMVA 1PMUA 4I22A 2YDKA 4PMSA 4X2FA 2OJGA 4F1OA 3PY3A 1LUFA 5A46A 2XARA 3R7UA 2IW8A 4XCUA 2OH4A 2NRUA 3FY2A 3FLQA 5CQUA 1R0EA 3FKLA 5H2UA 3P78A 3OOGA 1WBTA 3R8MA 1XBAA 4CCBA 3CY3A 3D5WA 4RJ7A 1TVOA 3PFQA 3GC7A 2XNEA 3I0QA 1JPAA 4YLJA 5ANEA 2C1BA 3BCEA 2CNVA 4M69A 4EYMA 5ACBC 2WQOA 4ANOA 5E8TA 2BVAA 3DJ6A 3V3VA 3IONA 5B0XA 2W9FB 1UA2A 1WVWA 3BWJA 4JX7A 3IW7A 3BBWA 4O4DA 4M0YA 2VTJA 5DMZA 2YJSA 3D4QA 2W96B 4IAAA 3ZUUA 3E62A 3ANQA 4G2FA 4QQ5A 3R1NA 5C26A 4Y95A 3HKOA 4NL0A 4X6RA 1Q97A 4P4CA 1WAKA 1FQ1B 4Q5HA 4NKSA 1Q8ZA 4PP9A 3UDBA 1MQ4A 4YNOA 4BL1A 4FV2A 1YW2A 2XNGA 2HWOA 2VWWA 3UP7A 1SMHA 3BQRA 1QPDA 1ZAOA 3V01A 4KS8A 1T45A 4KINA 3RINA 4RWIA 5JQ5A 2ZFYA 3KXXA 5HO8A 3GU6A 4FEQA 5IQDA 5A6OA 1MRVA 5AUUA 5L6OA 4AGWA 1PXIA 2OZAA 4LRKA 3QX4A 4FEUA 4K18A 4P5ZA 4DH8A 4QYYA 2C0IA 3F5XA 3RZFA 2VU3A 2IWIA 2I0EA 3TKUA 2W1EA 1X8BA 2OXYA 3RWPA 1J3HA 3R8LA 4WBOA 2ZM1A 2PE1A 2YM4A 4FV8A 5DH3A 4QP1A 1TQIA 4MVFA 3PVWA 5HD7A 3FMNA 4IWDA 4EQMA 3U54A 1Z5MA 3UC4A 2YCSA 3GU7A 4WD5A 1OKYA 1H28A 2P2IA 4LOQA 3V5PA 4A07A 5JGDA 4FG7A 2IZUA 3D14A 3SG8A 5ETIA 4ID7A 5I3OA 3HAMA 1HOWA 3RAWA 4B8MA 3H0YA 3E87A 3TUDA 1XQZA 4XP0A 4NZWB 5B2MA 3TACA 3BEGA 2Z60A 2WMAA 3NNVA 3SW4A 5LWNA 1W82A 4NU1A 3R7OA 5HE2A 1FMKA 2Z7LA 4UYNA 4AOTA 4QQCA 5A6NA 5LVOA 2RFEA 1CKIA 4IC7A 4BI0A 2CGUA 2XJ2A 1BL7A 3DNDA 2C6OA 2YITA 3CJFA 3ML1A 3ERKA 2XIYA 4G3CA 2EB3A 4RC2A 4FV4A 1LEZA 3QC4A 3A99A 4NJ3A 2Y6OA 2C0TA 4FSTA 1LPUA 1P4OA 1JSTA 1RE8A 3QTZA 1TZDA 5HBHA 4RIOA 4C2WA 4YJOA 2WTVA 4QMOA 2WEVA 3E8EA 3FWQA 4IFCA 2QO9A 2XNMA 4GVJA 3JUHA 3E92A 4AZTA 4L8MA 4N57A 3GBZA 5LVMA 3TKHA 4X3JA 5J9YA 3THBA 3LIJA 3NW6A 3LFCA 5E7RA 2CNUA 4E4LA 4I4EA 4XV2A 4FT3A 4MHAA 5I9VA 5CSHA 2JDVA 4LV7A 2X81A 3KY2A 2BRHA 4D58A 5IDPA 3IW6A 4YHTA 5A4TA 5EKNA 3RPVA 1H24A 3LQ8A 5J5SA 3BV3A 4O96A 4WHZA 2BPMA 3R9OA 3PVBA 5KMIA 4F9AA 2C5XA 1URCA 2W4KA 1REJA 4GYGA 4BBFA 2X2LA 2XIRA 4HZRA 4NM3A 3RBWA 1OL1A 3TWJA 4OTIA 5A14A 5IH5A 1FBNA 3CQWA 2XK7A 3I7BA 2VX0A 4PMPA 2WMBA 4LUEA 2P0CA 5L2IA 3Q4TA 3C0GA 3PXYA 4HGTA 4ZP5A 4D2RA 1AD5A 2PHKA 2VWXA 4AN3A 2OXXA 1OKWA 3DZOA 3W16A 3NMUF 4GJ2A 2RG5A 3MB7A 3QD3A 3AMYA 3QXOA 3ORTA 4QYGA 4I6HA 3ZONA 4F0IA 5FXSA 4IJPA 4ARKA 4O4EA 4U0IA 3MJ1A 1XH8A 4FIEA 5CENA 2BTSA 3V8WA 4QMPA 1V0OA 1ZOHA 3MFSA 3RAKA 3GC8A 2BHEA 2X39A 3OW3A 3CXWA 2VGOA 2RSVA 1PHKA 4FV0A 4MEDA 4LOOA 3SLSA 3VUDA 4BKZA 3NEWA 2JFLA 4J99A 4RC3A 2VWVA 3VVHA 3QA0A 3P23A 2X7GA 4EZ5A 3V5JA 1P2AA 3VQHA 4L45A 4QMNA 4U3ZA 4PDYA 3N4UA 1MRUA 4BI2A 5BNJA 5ACKA 4PTEA 2B53A 4WNMA 3TXOA 2BCJA 1OUYA 1OPJA 4O0SA 4QQTA 3G51A 2PVMA 3PIXA 2A27A 3CS9A 1LEWA 2WO6A 2FA2A 5IA1A 3DZQA 4AAAA 4RWJA 4HPUE 5HKMA 3HX4A 3K54A 4FR4A 2HK5A 1OITA 4M12A 4QEBA 4FT0A 3K5UA 3D2KA 5KX8A 4BHZA 5I0BA 3CPCA 2O5KA 4APPA 1BUHA 5AP6A 4EHVA 5CU6A 5DT0A 4FKJA 3G15A 2ITZA 3A7JA 3ENHA 1H25A 3KKVA 3MY1A 2VNWA 3F5UA 2ZDTA 2LAVA 3UO6A 5IUHA 1GZKA 4DG0E 3ZO3A 1MUOA 3V51A 4D4SA 5CF4A 2XS0A 1M2RA 2O2UA 3ZM9A 3W0QA 5T3QA 4YBKA 2J7TA 3QQKA 4X2GA 3DDPA 3QF9A 4GSBA 4GK2A 4N0SA 1P4FA 3CLYA 1JQHA 4NCTC 2GS2A 4FKQA 1UNGA 1M17A 4I0SA 3NYVA 3QZHA 5HG8A 4CSVA 4TKSA 2IO6A 3B2TA 4EQUA 3OF0A 5KKRB 5FWKK 3SAYA 3U6IA 4D1XA 4IDVA 4AGUA 3UDZA 2XKCA 2B9IA 4JNWA 5HI2A 3VBVA 4A9TA 4D4VA 4PQNA 3IKAA 1QPEA 4HW7A 2XK4A 3O8TA 4LL5A 3MGYA 5IH6A 4L3PA 2RGPA 4E3CA 4P7EA 3SRVA 2IZTA 4QDVA 2GDOA 3OXIA 4K0YA 2XJ1A 4MTAA 5KO1A 4FMQA 4IB1A 1YKRA 3Q3BA 4XEYA 1JKSA 4DGNA 4BCNA 1H1SA 3BU3A 3FSKA 4IMYA 1JNKA 4U6RA 5FDXA 3NW5A 2IZRA 3T8OA 4DBNA 5JGAA 2G2HA 2QOLA 1R3CA 1YHWA 4OR5A 4R3PA 3AC5A 4QMTA 4RA4A 3TJDA 2HENA 4B0GA 2F7EE 4BCOA 4EH9A 3MWUA 4GRBA 1W7HA 1ZYLA 2B7AA 2X0OA 3ZEWA 4CTCA 3R7IA 3ITZA 1WVYA 3S4QA 3W0PA 1URWA 3OBGA 4RVMA 3S0OA 2X0QA 5C03A 3UGCA 3DPKA 5M44A 1VEBA 2QCSA 2V22A 2OIDA 3ULZA 1NW1A 4MXZA 3CR0A 4FSWA 5L2QA 3VBYA 3W2SA 4C35A 4D9UA 4BGQA 3FLWA 3C0IA 4MXCA 5CU0A 4O0WA 4HNFA 5E8XA 3WARA 4ASEA 3M1SA 2UZVA 5GJGA 4BJJB 4YJTA 4H39A 5AR8A 4EOLA 4EC9A 4OTQA 5IF1A 4RJ5A 2XNNA 5EW9A 4ZEGA 3VS2A 3FZRA 3L8PA 4DEAA 4MNEA 3OFMA 3ORZA 4AXDA 2ZMDA 4X3FA 2J0MB 5HU3A 1CSNA 1OI9A 4IZ7A 4TZRA 4UX9A 2B54A 3K2LA 4UY9A 3OVVA 3P5KA 3OEZA 4KAOA 4L7FA 5FQDC 4AFEA 4C33A 5BV3A 4NT4A 1G5SA 1B39A 4Y5QA 2V55A 2QU6A 2GNJA 4Y72A 4L7SA 2BDFA 2WTIA 3L9MA 4GJ3A 1I09A 3DKGA 3FHRA 1UU9A 3UNJA 5K5XA 3ZBXA 5TKDA 4ZS0A 4AA5A 3NUXA 2JBPA 4O7VA 1Q41A 2W1HA 3I7CA 3M11A 3NNWA 4L42A 4JDIA 3BLRA 3N51A 3COKA 1OKZA 5H8EA 3ULIA 1KV2A 4CTBA 3GFEA 5J9ZA 2QG7A 3HV5A 3GUBA 4O2PA 5AV1A 5FBNC 4OAVB 2AUHA 2XEZA 1RDQE 2JFMA 4G9RA 2PWLA 4QP4A 4BDAA 4ZS4A 2F49A 3G0EA 4QMVA 3P08A 3R6XA 4NFNA 3NAYA 5AP4A 3A62A 3NCZA 2H6DA 4CFNA 5HEZA 2C30A 3MFRA 3ZM4A 4M13A 3VS0A 3O7LD 5IG1A 5HVJA 3VONA 1NXKA 4XOYA 1TFFA 3RNYA 4CKJA 1SVEA 4FV3A 3ZC6A 5CF6A 5JRSA 1ZMVA 4I5HA 3TV7A 4Z3VA 4MF0A 5CEQA 4F1TA 4F4PA 4GL9A 5D1JA 3CP9A 3F3VA 3UBDA 4ACHA 2JAMA 2OU7A 5I3RA 5CAVA 4R7BA 3W0NA 2J90A 4U3YA 4EK3A 1PMNA 2Z02A 4XMOA 5CQWA 5DOSA 5BMSA 4DEDA 5JT2A 4DG3E 3EOCA 5DRDA 2J6MA 3EKNA 3EHAA 4MBJA 4TW9A 4C57A 5T6KA 4I3ZA 3QFVA 3ZRLA 3ORLA 3QKKA 4I20A 3UDSA 4PY1A 4W4WA 4TT7A 3DB6A 4JG7A 1KE5A 4ZXTA 5M51A 3DCVA 2H8HA 4EOSA 3GQIA 4QMWA 5CI6A 5KZIA 3W32A 4KD1A 3DAJA 3F2NA 2QHNA 2BUJA 4YTIA 4KIKA 4NSTA 4TYEA 2PPQA 4I24A 1VYWA 2W17A 2Z7QA 3FMMA 3O0GA 1FVVA 1Q24A 2GHGA 5C8MA 5TF9A 2VNYA 3RVGA 4RIWB 3C4FA 5EG3A 2VV9A 3LQ3A 2UZTA 4G3DA 3FKNA 3KXMA 3LFAA 4FEWA 1H8FA 3HMMA 4X7QA 2YM3A 4BFMA 4F7SA 4NIFB 2BIKB 3E7OA 4FNWA 3UNKA 4AWIA 2XAMA 1BL6A 4FODA 4DCEA 4QMZA 4GVAA 3W33A 4BN1A 3TM0A 5FDPA 2WB8A 5JMSA 5HNBA 2OWBA 3ET7A 1PKGA 3RP9A 2ESMA 3K3IA 2GQRA 1YHSA 4FTAA 2R3PA 2CGVA 3NIZA 2R3LA 5EOLA 3PDTA 2DS1A 4FIFA 4J98A 4HGSA 4JBVA 2PMLX 4DH1A 4JBOA 5AUYA 2XNBA 4TYJA 3FI4A 1OPLA 5AIKA 3L1SA 4L67A 3U4UA 3TEIA 3V8TA 2WHBA 4BIDA 4JRNA 2PVYA 5M53A 3DXQA 2BAJA 4GEOA 3QZFA 2UW6A 4LDTA 4ZJIA 1W84A 4CFVA 2BRMA 5EYDA 2GQGA 5HHWA 4AT3A 3UQCA 2XK6A 1ZMWA 3SHEA 4C7TA 1GNGA 1ZYSA 4FYOA 3V04A 3WE8A 4C36A 4FEVA 3JY9A 1OM1A 3MESA 4B7TA 1Q8WA 4D55A 3KK9A 3OXTA 5AUXA 3G5DA 4RRVA 2ZM4A 3ORXA 3EWHA 2KTYA 1PXOA 3P7CA 3R02A 3UZRA 3O51A 4ZSJA 2ACXA 3BRBA 4DINA 5IQGA 3ZU7A 3QGYA 4HZSA 2G9XA 5CALA 4ZSGA 3PE1A 4YZDA 3R7VA 4AQCA 3FZSA 3ZOSA 3ID6C 1RQQA 3BQCA 3LXNA 4YJPA 3TZMA 2RFNA 3VS7A 1IAHA 1XBBA 1JKLA 3GXLA 4I21A 4O22A 4XOZA 4IAZA 4K8AA 5L6PA 3LAUA 1UU8A 3LMIA 2UW9A 4IAFA 2I0YA 3KCKA 3RI1A 4JBQA 4AG8A 2HZ4A 1UKHA 3KGAA 3R30A 2X4FA 4N6YA 3UC3A 5HCZA 4AOIA 4BDBA 4PUZA 4ZLOA 3Q04A 4U41A 4ACGA 4MBLA 5EQYA 3R8ZA 1YI4A 3ZLXA 2J0JA 3OEFX 4U97A 3SV0A 4OBPA 2XRWA 2DYLA 2CGWA 4ITIA 4MQ2A 5AV4A 3CQEA 3L9NA 3QU0A 3MDYA 4LM5A 3QD4A 2IW9A 3OZ6A 3ALOA 3NIEA 3AC3A 3E64A 2R5TA 2GS6A 3QD2B 1Q8YA 4RT7A 2C5NA 3RCJA 5CVGA 2IN6A 4FKSA 4ZJVA 5J9LA 2VAGA 4U43A 1U59A 2GPHA 3QLFA 4CV8A 2JKOA 3PPZA 2R3FA 4D0XA 2G1TA 2CCHA 3L8VA 5H9BA 3RNIA 5IEVA 3QHWA 2R3OA 3NAXA 2XIXA 4JI9A 2IZSA 5CVFA 2ERZE 4XV9A 3I5ZA 3CBLA 5KBQA 3W2CA 4MAOA 1HCKA 5F20A 3Q60A 2JGZA 3R73A 2NYAA 3ZFMA 2BRGA 4MNFA 1GJOA 4TTHB 4DHFA 4C59A 4KBAA 4MX9A 5LXMA 5AV0A 3GU8A 2JKQA 3F7WA 5CI7A 4E6AA 1H1WA 3HNGA 4CT2A 2J0KA 5HNGA 3PJCA 4M14A 4QTAA 2W06A 3KULB 4UMPA 2YFXA 5IQHA 3BIZA 2X8EA 3Q9ZA 4XNEA 3MH3A 3ODZX 2YCRA 3OHTA 4UMUA 4AF3A 3GGFA 2PUPA 3CY2A 4YHJA 4GS6A 3ZUVA 4ZTNA 3DBDA 3HMIA 3PVUA 2HOGA 4JLCA 2ONLC 2W1FA 5T68A 2VTTA 4KB8A 5AR4A 4F9BA 5BPYA 2J0LA 1PXLA 5AR5A 4R5SA 4IVCA 4MD9E 1F0QA 5EM6A 5CS6A 3WZUA 3BE9A 3MPAA 5DE2A 1VLRA 5CNNA 2FSTX 5C01A 5BVDA 4DHZA 1OUKA 1M52A 3OT8A 4EK5A 4EH7A 4LMNA 5C9CA 2CN8A 3C1XA 4TWOA 4QP9A 5F95A 3IPHA 3G6GA 2YIXA 4EOIA 4EONA 3D83A 3IDCA 4C4JA 5HX8A 5AP3A 4EH5A 4FUXA 1A06A 5E91A 2XF0A 3TDWA 5EK7A 2CJMA 4E8AA 4K2RA 4RZVA 3W1FA 2VTNA 4NCTA 4RWKA 5LARA 1NA7A 4R6VA 5LQFA 1G8JA 3AMAA 3JY0A 4I0RA 4I92A 4JG8A 2WU6A 2Q0BA 1WVXA 5HNIX 4AOJA 5IDNA 3S00A 3F3TA 4AT4A 4G34A 1NT2A 4FK3A 3GCUA 4GT3A 4H3BA 3DKFA 4PL4A 1OIYA 1PYXA 3R9DA 2DUVA 4EQCA 4O0TA 4RX9A 1H08A 4TRLA 4I6QA 4RX7A 3RHXA 4O38A 4RJ3A 3LCKA 1JLUE 4HJOA 4RX8A 4RWLA 2UVXA 4KRCA 4EH4A 4O7WA 3WF5A 3ZZWA 4MF1A 2FGIA 5KMOA 3NS9A 5CZHA 3QRKA 4E4XA 4DGGA 4ORKA 3MV5A 5ANKA 5CXHA 2Q83A 2PZPA 2XIKA 3S3IA 4GKIA 3LQ5A 4WBBB 4O0RA 3A7FA 3ELJA 2HZIA 5CU4A 4IB5A 4Y46A 3KA0A 2XCHA 4PPBA 1FINA 4U8ZA 4KKEA 3LMGA 2BZHB 2PVLA 2A2AA 5FTOA 4C37A 4AW0A 2F7ZE 4AGDA 4CV9A 4CRLA 5DGZA 4HVIA 4MWHA 3W0RA 4OBOA 2A4LA 2WQBA 2AYPA 3GNIB 4BCJA 2WKMA 5JEBA 2IF8A 3RMFA 3NUNA 1YOLA 1Y91A 3COHA 5DEWA 1R78A 4TYHB 3UOJA 3IDBA 3DXPA 4FIHA 3R83A 2X6DA 2OBJA 2UZDA 3N4VA 2NO3A 3SXSA 4FTUA 1Q4LA 4TN6A 3I81A 3TZ7A 4DLJA 5BYYA 1OB3A 4FSUA 4FT5A 3I60A 3JYAA 5B2KA 4CNHA 2BIYA 4D2PA 2X2KA 3IW8A 3B8RA 4FL1A 3TZ9A 5BUJA 4BDGA 3LZBA 4PNIA 3TJCA 3R8UA 5GIPE 5K0KA 3QC9A 4FYNA 2WMVA 4H58A 3U9CA 4RIXA 5E92A 2J9MA 2I0HA 2RL5A 3EL7A 5M4CA 4J71A 1OBGA 3DTWA 3VF8A 2GNGA 1H27A 4CFFA 4Y8DA 3R1QA 3Q53A 2RIOA 3NYXA 1XH9A 3QA8A 2XRUA 3TNPC 3VRZA 2PZYA 4A7CA 2CMWA 4W4YA 5E90A 3ORMA 2R64A 3DK7A 4LGDA 1B38A 4L44A 1ZMUA 4QP2A 3O17A 5BVNA 4AX8A 2VX1A 5E4HA 1ERKA 1SVGA 3HL7A 3PZHA 4IZYA 5BVWA 4S34A 4TWCA 1XJDA 5AAFA 3ZXTA 3T3UA 5IISA 2QU5A 1W98A 4ZJJA 5CAQA 1Q5KA 4Q9SA 5IQBA 5M55A 2Y4PA 2X4ZA 5HO7A 4UWCA 3DBFA 3RAHA 5K3YA 4YTFA 3DJ7A 4FKUA 5BVKA 5JZJA 1GOLA 4HCVA 3LFNA 3NPCA 4CKRA 3MVLA 5GINE 4X6QC 3O5AA 5CASA 3EKKA 4JRVA 3AQVA 1XH4A 3ZLSA 1IASA 2GQSA 4R1YA 4I94A 3B2WA 5AFVA 4OTDA 4O7YA 4C8BA 1MQBA 3ROYA 3BYVA 3QQFA 4I5PA 2GNFA 4F99A 2GNHA 1L3RE 5FM2A 1R1WA 3POOA 2JLDA 3CQUA 3PE2A 3OC1A 3SVVA 4XG7A 4HGEA 4KRDA 3RPOA 4F1MA 4PX6A 3LCOA 4XG9A 1SNUA 4J97A 4A9RA 3DLSA 3G9NA 4PDSA 2CHLA 4ALWA 4O7TA 4DCAA 1CM8A 4FZAB 5D11A 1Q99A 2WQNA 3BPRA 3UODA 4GH2A 2WQMA 4OW8A 3ALNA 2Y4IB 2VTIA 2OIQA 4E20A 4HYSA 4L6QA 5FEQA 5C8KA 2VTOA 1H07A 5FEDA 3QTRA 3VULA 4H3PA 5AP1A 3R9HA 1J7LA 2A98A 4FVPA 3DGKA 4DGOA 3ANRA 2JKKA 4IEBA 2A1AB 2E9OA 3Q4ZA 3R04A 5M06A 3WBLA 4O86A 4FV5A 3L8SA 3S95A 4FSMA 3DS6A 4QMMA 4N4SA 1BMKA 3FV8A 4FIIA 3UIUA 4BICA 1WBSA 4D1ZA 1UWHA 4LMUA 4FT9A 1ATPE 1OL5A 4HOKA 4KA3A 3U8WA 5HCYA 4ALVA 4MBIA 4RZWA 4AXCA 1AQ1A 3EZVA 4H36A 4IVBA 4KSQA 4UXLA 5DN3A 3BU6A 3R0TA 4WO5A 5JQ8A 3W0OA 4QYFA 2AEGA 1SYKA 2VTRA 4WIHA 4YC8A 4BWPA 1Y6AA 4H3QA 1PY5A 2BTRA 3QZGA 4QP6A 2I40A 2BAKA 3FZPA 3C5UA 1JWHA 1V0PA 1O6YA 3LXPA 3OT3A 4OBQA 2XM8A 3OBJA 4CQGA 4MXOA 1YDRE 3BX5A 5IQCA 2FO0A 1WBVA 2Y9QA 3QTUA 4GG7A 5J95A 2VO3A 3CGOA 2I6LA 3FMJA 4N6ZA 4AW5A 3PA3A 3RM6A 4O81A 2V62A 4WKQA 2C6EA 3UDTA 4O6LA 4DH7A 3PP1A 2A0CX 2P4IA 4NYEA 3F2RA 4G6NA 4BCPA 4O83A 4ENYA 5KZ0A 3MH1A 2FUMA 1H1RA 3UOHA 5CLPA 3FPMA 4CFWA 5CT7A 2EB2A 4G3FA 4YP8A 5G1XA 5HE1A 3E8NA 5EQEA 3D7ZA 2BILB 2XK3A 3GCPA 5HOAA 5CF8A 2W1ZA 3MVJA 4O1OA 1XO2B 3ZRMA 4C0TA 3KF4A 3BE2A 4DFYA 1STCE 2HW6A 1SM2A 1H1QA 4M69B 4O4CA 4RFYA 3PXKA 3WYXA 1G8AA 2VTMA 4PDOA 4DDIA 3SKCA 4BRXA 4FKPA 5AP7A 4O21A 1LP4A 5AAGA 3VBTA 2XALA 2UW7A 4UMQA 3FAAA 4OLIA 2C6TA 5J87A 4GUBA 4GK3A 1G8KA 1GZ8A 4J8NA 4KIQA 1S9JA 5FM3A 4IHPA 2NP8A 4MD8E 4WSQA 1M7QA 3OCSA 3R22A 4KIPA 1AGWA 2JITA 3PTGA 4HYUA 4IANA 4C4EA 3P1AA 4MD7E 4ANMA 2WU7A 2OXDA 3RJCA 5C27A 3KU2A 3LFFA 5HICA 2HIWA 1YI6A 4AUAA 3UOLA 2HY0A 4L3LA 2ZVAA 4EZ7A 4DG2E 4Z16A 4X2KA 4USEA 4E4NA 1M2PA 2VTAA 4FT7A 3QTQA 3WI6A 5D7AA 4D28A 2C4GA 1XMLA 4NKAA 1JVPP 2ZV8A 4WG3A 2OZAB 5GJFA 1UV5A 3QWKA 3BELA 3ZUTA 3GT8A 4QP3A 5KE0A 4IZAA 2RFDA 5EW3A 5GIOE 3QTIA 3VIDA 1FMOE 3IW4A 3QBNA 3VC4A 5DEYA 4EK4A 4B99A 2ZB1A 4FKLA 2WAJA 4N70A 2XYUA 5KMJA 5AMNA 5EKOA 4F9WA 5CWZA 5JFVA 5HESA 3T3VA 5A4CA 4U40A 3CTJA 4E5BA 2Y6MA 3D2IA 3F3UA 3MW1A 4TXCA 5FG8A 1Y8GA 4RVKA 2YZAA 1Q8TA 1KE9A 4GW8A 4WNKA 2OF2A 2QG5A 2VO0A 3QLGA 2HXLA 2PVHA 2CKOA 4EORA 4BHNA 4ZIMA 4CZYB 4IWOA 2C69A 2ONLA 5D12A 3TZ8A 3DDQA 1A48A 3KN6A 4BIBA 5CF5A 3HV4A 4LGHA 4ZTHA 1LR4A 1IA8A 1OL6A 4AN2A 5DLSA 4XLIA 4PTCA 2OICA 3VO3A 3WZKA 3VJOA 1H26A 4USFA 4U80A 2XAOA 3SOCA 4UMTA 5I9XA 5IKWA 3RAIA 4A9YA 4DEGA 4PL5A 5CU3A 3QCXA 4L3JA 5IA0A 4FF8A 3GC0A 5AR7A 3MIYA 5GNKA 4XRJA 4I6LA 5L6WL 3QD0A 5AUVA 4U5JA 5AEPA 3F61A 3QTSA 1G8SA 1YDTE 4BJJA 4YLLA 3AXWA 5DR6A 4TNDA 2YDJA 4OGRA 2B9FA 4YZ9A 5IA2A 4JVGA 3UO4A 3PP0A 3DTCA 4YMJA 4DFUA 4EBWA 3QCSA 3HDNA 5AX3A 1W83A 3U6JA 1J91A 5HGIA 5A4EA 4O4FA 4O84A 3DNEA 5F94A 5I9UA 4XP2A 1V1KA 2VWYA 2CCIA 4Q2AA 4FNXA 4XS2A 1E1VA 4DITA 2O8YA 2VTSA 5E8SA 5K5NA 4JDKA 4ACCA 1JSVA 4BTKA 3MTLA 4AGCA 4D2WA 5AM7A 3R9RA 2WTJA 4D1SA 4BR3A 1XBCA 4BGGA 4XG8A 2EUFB 2W9ZB 2PZ5A 5DT4A 3NFFB 3DFCB 4QMLA 3RKBA 3QKMA 4BCQA 3VHKA 2XYNA 2UVZA 2WZJA 2XK8A 3H3CA 3KVXA 5DWRA 5AUZA 2VD5A 4CD0A 2ETRA 1WBPA 3CTHA 4CZUA 2BZIB 4J8MA 3BYSA 1T46A 2OG8A 1U5RA 2OI4X 4FV9A 5CNOA 5HE3A 4DT9A 1YDSE 4EOJA 4KIOA 4MCVA 5TO8A 4H1JA 1FPUA 4PP7A 1JKKA 3ZSGA 3PG3A 3AD4A 3KXNA 3NNXA 3CKXA 2JDTA 3FLZA 4FTJA 3R7YA 1H4LA 4CYIA 5BMMA 5AUTA 1JKTA 1IRKA 4GFOA 2YHVA 1ZWSA 4J52A 3AG9A 3UOKA 4XBRA 3WF8A 4APCA 1YXVA 3IECA 5LWMA 2WELA 3P7AA 4JDJA 4MUQA 5FTQA 4G17A 5IQFA 4QPAA 2R3NA 4DYMA 1ZY5A 2PTKA 2OZOA 1XR1A 1PYEA 4W8DA 2QOFA 5DNRA 3FY0A 4YURA 1J1BA 2E9PA 1UWJA 3TDVA 3MH0A 1YXUA 3A7GA 3QKLA 5EHLA 4IXPA 4V0GA 3R71A 4C61A 3C0HA 3OCTA 4FRFA 4CG8A 3Q4UA 4U9AA