4UXLA

Structure of human ros1 kinase domain in complex with pf-06463922
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
288
Chain Sequence
IENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSIYKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ROS
publication title Pf-06463922 is a Potent and Selective Next-Generation Ros1/Alk Inhibitor Capable of Blocking Crizotinib-Resistant Ros1 Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 288
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4uxlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4uxlA01
2F57A 1OPLA 2VTMA 4EJNA 5DHJA 5IA0A 3RWQA 4D5KA 3KFAA 1KUTA 5CSVA 5A4TA 3T9IA 3DCVA 2EB2A 4I24A 2PHKA 1URCA 3CC6A 3PXRA 3MFUA 4AW2A 3RMFA 3FLSA 5BVFA 5M4FA 3MH3A 4XH6A 4GH2A 5IU2A 2ZB0A 4BGGA 4BGHA 4OT5A 3CD3A 4GRBA 4YZBA 3TNPC 3VBXA 5C1QB 5I9WA 3HLLA 2QR7A 4F9WA 3MVMA 1OUYA 3PA4A 3R73A 3OP5A 3VNTA 4UYNA 2GU8A 2HW6A 4EOIA 4MYGA 5HBHA 4G3GA 3HV7A 4O21A 4QOXA 4XRJA 4QTEA 5AUUA 4AN3A 4DFNA 4O7ZA 1OVEA 1XJDA 1FBNA 2JEDA 2WZJA 5C26A 2BRNA 3GCVA 5M07A 2JDOA 4MNEB 2ITTA 2WTWA 2VO3A 5M55A 3F3ZA 5FM2A 3FPQA 4QMYA 4FA2A 2R7IA 2FH9A 3Q9ZA 5CXHA 3IK3A 5EM7A 3O8PA 2YWVA 4ZMEA 3SOCA 3SA0A 5ETIA 2WMUA 2XNMA 4RIWB 4D58A 4MWIA 1J91A 3AD4A 2QNJA 2VU3A 3LFSA 4HNFA 4L67A 3QX2A 5KKRC 4U42A 3KCFA 4BC6A 3ORTA 2QOQA 3EIDA 5M44A 4QYFA 2F7EE 3QCSA 3GCSA 1YRPA 2VTRA 3SKCA 4AQCA 3C1XA 4ID7A 3TJCA 5CAOA 4YJNA 3LFQA 3M1SA 5F20A 4EL9A 4BICA 1STCE 5IMXA 3WZJA 3EB0A 3V5WA 3JUHA 2A1AB 4ZTLA 4WNKA 3SG9A 3R83A 4GUBA 4DEGA 4W9XA 3DBFA 3A7HA 4U97A 3QCQA 4G3DA 2XM8A 3ROCA 3TV6A 4OUCA 5EK7A 3CR0A 3FY0A 2UW4A 5CEIA 2QURA 5AP6A 5IH6A 2PMIA 1IG1A 4U80A 4CMOA 2RF9A 3RK5A 3F3UA 1QPEA 3NCZA 3ZM4A 4CFMA 2X2LA 3TUDA 1H4LA 4AA5A 3I79A 2BPMA 2PZIA 3F2RA 2WMSA 3KF4A 3PJ8A 4C58A 5IF1A 3HX4A 3GB2A 3SW4A 4U7ZA 3DNDA 4XV1A 2B1PA 3OTUA 5DE2A 4ITJA 4FSRA 2OFVA 3H30A 4FSMA 3FZSA 3SXFA 5JT2A 3A7GA 4BDJA 3BQRA 3FUPA 1B38A 4OBQA 5KMLA 3TDVA 1BUHA 1YWNA 3GVUA 3OW3A 4I5PA 4O0YA 1OKWA 1GZKA 1W8CA 1NY3A 3QKLA 4RC3A 4ZK5A 1Q8ZA 4DH7A 5HEZA 1XR1A 5LCKA 3D9VA 4FT7A 4YURA 5KNJA 2DQ7X 2B54A 5HKMA 3QQUA 3QTWA 2BILB 1JOWB 2JFLA 4UALA 3HA6A 3TZ8A 3ZFYA 2F7ZE 4I6HA 4F08A 4JLCA 1R3CA 2XNEA 5JGAA 3A8XA 4XV3A 1H0VA 1JKKA 1YW2A 3DKCA 5B2KA 3KMUA 4FG8A 3FL5A 4BRXA 1ZYCA 2R3FA 2WKMA 4FICA 4B99A 2YAAA 2CGXA 4YNOA 3WF6A 1XH7A 4NH1A 2W1HA 2JDRA 2QR8A 5KHXA 5HBEA 2ZM3A 4RJ5A 5BVWA 4F63A 5CQUA 3R63A 2FYSA 3FPMA 4ASXA 3WOWA 3AD5A 2F2UA 2AC5A 1U46A 1YXVA 4J1RA 4DH1A 3ZS5A 3TNHA 2IZTA 3UNKA 4AT4A 3CLYA 2XBAA 4I0SA 4AOJA 1XBAA 3V5QA 3OOGA 1GAGA 2YA9A 3T8OA 3DXPA 2GNIA 5LARA 4L45A 3NIZA 5ETFA 4E4NA 2XYNA 3QTUA 2XK8A 3VF9A 2C5YA 2XKCA 4MNEA 2ITUA 2C3IB 4UZHA 4C4EA 2ZM1A 3FZPA 1WBOA 4LUEA 4FNXA 4RZVA 3BGZA 3R1QA 4JVGA 4CTBA 4BCPA 3ZO3A 5LQFA 4PNIA 1HOWA 4ASEA 4RIWA 4K18A 5J9YA 5LMKA 5CT7A 3VS1A 2VX0A 5T68A 5CNNA 1F0QA 3AQVA 3G6GA 3CD8A 4BI0A 3JVSA 1XBCA 4O83A 4O38A 2O64A 5D1JA 3L1SA 4K2RA 5BMMA 3ZEPA 4YNEA 4LGDA 2BRHA 5JZJA 4C36A 5J8IA 2C30A 4LGHA 2RG5A 3B2WA 4JJRA 1PMEA 2BMCA 4H1MA 4GVJA 3GXLA 4M14A 1YVJA 1H1PA 4CFUA 1SMHA 4XJ0A 5HGIA 5L2IA 2H34A 1WCCA 1KOBA 2XK4A 4YZDA 3EHAA 2Y8OA 4H39A 2E9UA 2XNOA 2QCSA 3W2QA 4HCTA 4MCVA 4TPTA 4YGAA 5IUGA 5DEYA 3E93A 3BV2A 5DRBA 5IEXA 5DEWA 3F5UA 3ETAA 1H07A 4IWOA 3W2PA 3S4QA 1OIRA 3R8UA 3L8VA 4YJUA 4GJ2A 4X7QA 1YI6A 3FMLA 3PE2A 3OG7A 5EHLA 5E8ZA 3CIKA 3POZA 4L68A 4AOTA 5AUXA 4QO9A 2VUWA 3QHRA 4PPCA 4GV1A 4U5JA 4FYNA 2CPKE 2IZSA 5M51A 5EM8A 3BHYA 2R3KA 4AZVA 1YXXA 3E64A 5E8TA 5EKOA 2UVXA 4QMQA 4DFBA 2NNWB 3OOMA 5IDNA 3NUPA 1JKTA 4YLJA 3P7AA 3BU3A 3R01A 4I4FA 3W8LA 4EH2A 1YXSA 2IVSA 2JIUA 2REIA 5LOHA 4BKJA 3L9LA 3F66A 4ACDA 4K8AA 1NVQA 4FSUA 3VBTA 3ALOA 5DIAA 3K2LA 3WF7A 3W1FA 4ZS0A 5HLWA 3NS9A 2CLQA 3EZVA 1K2PA 3HMOA 3O2MA 1P2AA 3R8MA 5L8LA 4C57A 3I6WA 2FSOX 2WQMA 4JL9A 4RIYA 4BCGA 1R0PA 3C13A 3HMPA 3S3IA 4YBKA 3G90X 3R9OA 2C6TA 3MFTA 2PULA 4NFMA 3TG1A 3EQRA 5ITAA 3VUKA 1G8SA 4H3BA 4H05A 4E73A 4ZZNA 1YKRA 1J7UA 1CDKA 2ZOQA 4EWHA 4YR8A 2W1IA 3OEZA 4U79A 5I9YA 3E88A 3IKAA 2DWBA 4JQ8A 3WZEA 2OFUA 5CNOA 4EZ7A 5CU6A 3UQGA 4BZNA 4IC7A 4AE9A 4BHNA 1F5QA 1Q8TA 5FEDA 4E6CA 2GHGA 4IIRA 2R3QA 3UVPA 3VBWA 4EH8A 3AT3A 3ZRMA 3ORXA 4O0VA 4S2ZA 3OROA 4ZSJA 4AGDA 3SQQA 4F6SA 4EZ5A 4FV5A 3CY2A 3W16A 4DFXE 3G33A 4ANLA 2F9GA 4DCEA 4XNEA 2PY3A 5EH0A 4DT8A 3EQIA 5AWMA 3FMNA 3SX9A 5LJJA 4FEXA 3FZ1A 5M08A 4QP8A 1FINA 5CS6A 3FBVA 4ASZA 4D2TA 3A7FA 4F09A 3DJ5A 1M7NA 4FV2A 4AGCA 2VWBA 3MW1A 1S9IA 5D7VA 5IQCA 5FLFA 3S0OA 4IWPA 1WBPA 4XBRA 4A06A 3VIDA 4HPTE 5FXSA 4MXYA 3C4XA 4O6EA 4DH3A 5M06A 4BI1A 3IG7A 4XUFA 4NFNA 4CFXA 4ZTQA 4YSJA 3EN4A 4J96A 3QD3A 4L3PA 1Y57A 1H00A 2UVZA 4BF2A 5AR5A 4LL5A 2B9JA 5CAQA 3HMNA 4ZJIA 4PL4A 2W9ZB 1UU3A 3CXWA 4IADA 4E6AA 1U4DA 3U9CA 3D5XA 2XIRA 5HIDA 4GJ3A 4CNHA 4BWXA 5KBRA 2C0TA 4R3CA 4EOQA 3PYYA 1H27A 5L6WL 5BUEA 4O1PA 4A9UA 1Q3WA 3GGFA 3OHTA 5HO8A 2PVHA 2VTOA 5KBQA 2R4BA 2UZTA 4HPUE 3QTSA 4W4YA 3TIZA 3VUGA 4XX9A 2Y6MA 2QOCA 4I0RA 3CEKA 5IUIA 3PJCA 4FTOA 3OXZA 3ZLYA 5EKNA 3M11A 3N4UA 3FXXA 3W2SA 4WOVA 2I1MA 2YZAA 2UZEA 5I9UA 4DG3E 3GQIA 4IVDA 2XNBA 2WB8A 4EYMA 4BR3A 4FGBA 2WEIA 4FV4A 3THBA 3ZO2A 3ZYAA 4BCHA 3Q96A 3V8TA 1GZNA 2ZDUA 1YOJA 3RJCA 4G31A 4D1ZA 4DGNA 5HVKA 1ERKA 5M4CA 2W96B 3NYNA 3RALA 1UWJA 5AFVA 2GS6A 3EJ1A 2BDFA 4G3FA 3ELJA 4TWOA 2R3RA 4TY1A 4X6RA 5E92A 3VVHA 5CASA 3FAAA 2QHNA 1OL6A 3KMMA 3RP9A 2PVJA 2QC6A 2VTAA 2BZIB 1R0EA 3D5WA 3IECA 3EQHA 4JQ7A 1GZOA 4N70A 1YWVA 4O22A 4RSSA 4YHFA 5EHYA 3POOA 3QRTA 3O8UA 3OZ6A 4UMQA 4DTKA 5TF9A 3MFRA 3NR9A 2W0JA 3KL8A 3PWDA 4K9YA 1KWPA 2X6DA 1TQIA 5DT0A 5LVMA 2QQ7A 5LXMA 3Q5IA 3PY3A 3MA6A 5CSPA 4BL1A 5GJGA 4IAYA 3CJGA 2CN8A 2J7TA 4RJ4A 4DFUA 4K77A 3R7YA 4M8TA 3GI3A 4BTMA 4C4GA 3P23A 3KB7A 1H1WA 4NW6A 4Q9SA 3H9FA 3QWKA 2OJFE 4AS0A 2W9FB 2HZ4A 3OW4A 4Z7HA 2I40A 4J95A 2XRUA 5F9EA 4F6UA 2Y9QA 1PKGA 3BGPA 3DY7A 3FI3A 4EC8A 2R3LA 4EHVA 5L8KA 2RFDA 2HW7A 2YCSA 2PZRA 5GJFA 4TYEA 3NNUA 1PW2A 3NW5A 3RM6A 1OECA 3CGOA 1VYZA 3N9XA 3DB6A 3OC1A 1G5SA 4FV6A 4JBQA 4OT6A 5AR2A 4BCJA 4ITIA 3KXMA 2UZLA 2PZYA 3PJ1A 5J1WA 4R3RA 1OL1A 1WVYA 3NGAA 2WQEA 2VWZA 3K3JA 1Z57A 3PE1A 4EOLA 4J52A 3NUXA 5ANOA 3PPKA 3G15A 4HCUA 4ZJJA 3ORZA 4F70A 5CI7A 5IQBA 4TNBA 3PP0A 5FWKK 1LEZA 2YM6A 2O65A 3EZRA 3Q2JA 4OTWA 3R02A 5CWZA 5DLSA 1XBBA 4OTGA 4YJOA 2BAKA 1V1KA 2JBOA 3I6UA 4YJTA 4XG3A 3UOHA 3ZLXA 1M2QA 1OL7A 5KX8A 2QO9A 4CEGA 3G9LX 4DGGA 3HKOA 2CSNA 5HCXA 1RJBA 1SVGA 2YIWA 5G1XA 3IS5A 2XK9A 2YM3A 3KN6A 4EHGA 4BDEA 1H26A 4BWKA 4EK3A 4U45A 3IQ7A 3TT0A 3P78A 4QMVA 4CKJA 2X9EA 3OXTA 2OH4A 5HG7A 4BDGA 4PMTA 2H9VA 1NT2A 5BPYA 4FGRA 3TN8A 5AP7A 4Y83A 5AP1A 2CJMA 4EJ7A 5GNKA 2C0IA 4UWYA 1H24A 4PQNA 4BTFA 1NW1A 3RGFA 3KEXA 3WIKA 2WTDA 2CKQA 3PIYA 3L8PA 3PIXA 2WQOA 3ZTXA 4A9SA 2ACXA 1E1XA 3NNWA 5HORA 3FMKA 2OZOA 3PPZA 4O7WA 4IM3A 1I09A 1QMZA 5M57A 4EH4A 4FC0A 3FLYA 1W83A 5LWMA 2UW5A 2Z7LA 3DFAA 4MXOA 3QUPA 5LVNA 2VTNA 4JDHA 4C02A 4CTCA 3ORLA 4MXXA 1ATPE 2XK3A 4YJVA 4RG0A 5L3AA 2I7QA 2JKKA 4B8LA 2Z60A 1SVEA 2P4IA 1F3MC 3R0TA 4GU6A 2WMWA 2C5OA 3FV8A 4WUAA 4MWHA 5FBOA 5AIRA 2HZIA 2PVYA 3RWPA 2BTSA 4O84A 2XH5A 5DGZA 3FE3A 5E4HA 2C6DA 3OT3A 4I20A 2VTHA 5DI1A 2QHMA 3MPMA 1P4OA 3OWPA 2WTIA 1W98A 2CNUA 2XCKA 4IFCA 3ENMA 3NUAA 2G2IA 4KBCA 4M0YA 3QWJA 4ZLYA 4XOZA 4F7NA 3HNGA 4GFGA 3RHXA 2P2IA 2OI4X 4FIEA 3BWJA 2XNNA 2UW8A 2B55A 1Q99A 3DDPA 4H36A 4I6FA 3KVXA 2IG7A 1Q24A 4UMRA 5D10A 1JQHA 1XH9A 5GIOE 1CMKE 3FQSA 4X21A 4XYFA 4DE4A 4GS6A 4RJ7A 3AOXA 4QP9A 4LV5A 4W8EA 3MVHA 2ZMCA 5HX8A 2X7GA 3F6XA 4UMTA 1WBWA 5CTPA 4ENYA 3U6HA 4JBOA 2VD5A 4JIKA 4TWCA 2CGWA 3CP9A 4KINA 4QTBA 4G9RA 3LXKA 3NYVA 3HDNA 3Q9XA 5D7AA 3W2OA 2OZAB 4O7RA 3VS3A 4FIFA 2XVDA 3BPRA 3HMMA 3PXKA 4ALUA 4QTAA 5HD7A 5J95A 4BCIA 3DA6A 2NRYA 3ENHA 5CEQA 4FIJA 5FEEA 2F2CB 1KE6A 4QMPA 3R30A 3CGFA 1OMWA 4FIIA 4BCKA 2WTVA 2OJGA 2P55A 2JLDA 3KRXA 4MXCA 4B4LA 3R7IA 2WTKB 4RPVA 2X39A 3ZZWA 4ENXA 2W5BA 4MK0A 3BEGA 3QTQA 2GSFA 3AC1A 4PRJA 5HBJA 4BCMA 5BX0A 3VUDA 3O7LB 4L52A 3M42A 3LM5A 3Q4ZA 5AR7A 2EVAA 2CKOA 2GS2A 2E9NA 2VWVA 2LGCA 5L2SA 4G34A 2WU7A 4NWMA 1WBNA 1AQ1A 4C61A 5J5SA 3FQHA 4ZTHA 2XIXA 4AX8A 4LOOA 3SD0A 4AZFA 4PTEA 4R5YA 4YJPA 5I0BA 4A4OA 1XO2B 2YM4A 1PXNA 2B52A 2JGZA 4FEQA 4XG2A 4AXAA 3LQ3A 1VYWA 1BMKA 1ZRZA 4U9AA 3TI1A 4F9CA 5FXRA 2C4GA 4IJPA 5J87A 2JIIA 5ACBC 1V0BA 2GQGA 3GU5A 2XBJA 3K54A 2EWAA 1UV5A 3COMA 2XJ0A 2YWPA 5L8JA 5C27A 4FL1A 4X3FB 2OW3A 4KIQA 2GHMA 4NYEA 4D2PA 2A19B 3F5PA 3RVGA 4AA4A 3JY9A 5I3RA 3HRBA 3K5UA 3UOJA 2P3GX 5CT0A 3NVKI 5K9IA 4FOCA 4FTUA 3VS7A 4QQCA 3HRCA 3ZFMA 4DFYA 5BMSA 1IA9A 1FGKA 3KY2A 3UMXA 2UZDA 4D0XA 4WRSA 5EQEA 4JIAA 2UVYA 4GG5A 3PDTA 2HWPA 3ZOSA 2C1BA 2VWUA 1TKIA 3RZFA 1PYEA 5AEPA 1B6CB 1Q8WA 3C0GA 4EEVA 5FQDC 5JN2A 3KRWA 3R2BA 4YO4A 3TUBA 3C0IA 1MUOA 3PSBA 4Z55A 3R8ZA 3VW8A 3FKLA 4NM7A 3ALNA 4QMOA 1OBDA 4HGTA 1ZYSA 2PL0A 4KD1A 4FUYA 3L9PA 1CKIA 3ZXZA 5DH3A 2B4SB 5K4JA 3PZEA 3ZMMA 2ZM4A 1H0WA 2R3OA 4IAZA 4B9DA 4RX5A 5CEKA 5K0XA 4DITA 3EFLA 3LZBA 3VBVA 4AE6A 3KRJA 1R78A 4RWJA 3CTHA 3QQLA 5FDXA 3A62A 4G1WA 5EI2A 3ZRKA 3GQLA 4IWQA 2PUNA 2WPAA 4FT3A 4YJSA 1ZWSA 4H1JA 3KU2A 4KB8A 3FYKX 4J97A 4FZ6A 4GT3A 4LRMA 4FKWA 4BIBA 4C2WA 4EHEA 4IB3A 2R3NA 2R64A 2OZAA 4D2RA 4QQTA 4O6LA 4PMMA 3TV4A 5T6KA 2WEVA 2EXCX 3LMHA 3RCJA 2R3JA 2X0GA 2HY0A 4L6QA 5CAPA 5HX6A 4TW9A 2GHLA 3PA5A 2VWIA 1AD5A 4H3PA 4NCTC 5BVNA 4GK2A 3AC5A 3Q4CA 4HCVA 3W10A 2EU9A 1IASA 3QTRA 4IQ6A 4BKYA 5HTBA 5CQWA 1ZMUA 1IAJA 1W82A 4TRLA 2FUMA 5HOAA 3SXRA 3R04A 3KA0A 3LVPA 3FZRA 4GCJA 4YLKA 4GT4A 4D28A 3V6SA 2OK1A 5KMMA 4AW1A 4ZMFA 5AUYA 4ZZMA 2DYLA 4J8MA 1Y6BA 4FT0A 4FT9A 2X7FA 3PJ2A 1PYXA 1RQQA 2J5EA 2GNHA 2OKRA 3C4CA 4JG7A 4U0IA 1TVOA 5AMNA 4DG2E 3ID6C 2XM9A 3DV3A 1GIJA 1TQPA 4RJ8A 2R7BA 2Y4IC 3UYTA 3G9NA 2OIBA 3F5GA 3FL4A 2GCDA 4WKQA 5H3QA 2PE2A 3PWYA 1FVTA 3E63A 2VX1A 3P79A 4YSMA 3OUNB 4WIHA 4HGEA 4BBEA 4LOQA 4RWLA 5JMSA 4BDAA 5JZNA 4W9WA 4X3FA 4FV3A 1M7QA 4CFWA 5FXQA 3UO6A 4BYIA 4QYGA 4XS2A 1KE8A 2YDJA 4E5AX 3OTVA 4M67A 4RX8A 4ZOGA 2BFYA 4QP6A 3RK7A 1S9JA 3BBTB 4L44A 2NRUA 4F9AA 1CTPE 3QRJA 3UOLA 5T3QA 2C0OA 3MI9A 1LP4A 5A9UA 2UW7A 4YBJA 3OWKA 4Y72A 4RFYA 4Z16A 3CTQA 1JSTA 4QNYA 4BBMA 3UJGA 3GC7A 1PF8A 4O0RA 4U81A 4YJQA 1BYGA 1IRKA 2BHEA 3R9DA 1J7IA 2R3PA 5CF5A 2YABA 2FSLX 4NEUA 4DH8A 5FP6A 3RAWA 2IVUA 5K4IA 4O0XA 4G5JA 5ANDA 3DK6A 3Q9YA 3C7QA 4TNDA 2G2HA 3EFWA 3COIA 5EDQA 4CFNA 5IKWA 3C0HA 4YTCA 4PDPA 1U59A 2QLUA 3LE6A 3MY0A 3QQHA 3VJNA 3R71A 5FP5A 5AX9A 5GINE 4G6OA 5DRDA 2HELA 1QCFA 5AIKA 3VUHA 1MP8A 1O6LA 4UN0C 4AZTA 1Q4LA 5J9LA 4CGAA 2C5XA 2WMAA 2HWOA 4I6BA 4AGUA 5HD4A 4FG7A 3UVRA 4YTFA 2HCKA 2LAVA 5AAGA 5KKRB 1JBPE 4IX3A 1CSNA 2X9FA 5AP2A 5IQGA 3QL8A 2VGOA 2GNJA 2WTJA 3F69A 3H3CA 4I22A 4IM0A 4DHFA 4YZMA 2HXLA 5A6NA 2OGVA 5EW3A 3WF5A 5TOZA 2QU5A 3AMBA 4BCFA 1UA2A 3TZ9A 4ZSAA 3PXZA 4CMUA 3WYYA 2GFCA 2O2UA 3EQGA 4O2PA 2IWIA 4LM5A 4ZTSA 5BVKA 3TIYA 1TQMA 2UUEA 4HJOA 3TXOA 4P90A 4DINA 4FUXA 5CX9A 2IO6A 3ZH8A 3VAPA 3OBJA 3HVCA 3UTOA 1T45A 1M2PA 2VTSA 4OBOA 4WNPA 2V7OA 5F95A 3VC4A 3HV6A 5M53A 3LMGA 2W1FA 4FSNA 1PMUA 4W4WA 4FKSA 2B53A 2PSQA 4FIHA 4PP9A 3ZU7A 3MB7A 2UW9A 3EKKA 3BX5A 4FOBA 2VNYA 4MD9E 4FEVA 4DA5A 3BYUA 5HVJA 5LVOA 4C35A 2OXXA 3VJOA 2X4ZA 3U6IA 3EQFA 3IOPA 5E7RA 5AP4A 4BZOA 5HIBA 4KIPA 1JSUA 3HAVA 3ZDUA 3QAME 5D11A 4UZDA 2PUIA 4FBXA 1O9UA 3A4PA 4KSQA 3UO4A 3ZUTA 3UE4A 4QMUA 4RIYB 3VULA 4OTRA 4ZJVA 2YM7A 1P4FA 3FHIA 4FZDB 5CF8A 4XCUA 1JPAA 5EYDA 3MJ2A 2QVSE 1PXKA 4GT5A 4EH6A 1PXJA 4D4RA 5A4CA 4EK6A 3BV3A 4GUEA 1ZARA 5FTGA 3U4WA 4DLIA 4PTCA 1MQ4A 3IW6A 3OT8A 4JI9A 2KTYA 4QPAA 3PXYA 5FRIA 5BNJA 2NP8A 4DEAA 3ZBFA 4FZAB 3UIBA 4AOIA 3MPAA 4X0MA 5CANA 3KCKA 2IN6A 4M84A 2XP2A 5HCYA 1SNXA 1XH8A 3NEWA 1UKIA 4XP0A 3ZLWA 4P2KA 2YIRA 3I5ZA 5J5TA 5EQPA 4F7JA 2Z8CA 1OITA 4QPSA 3LJ0A 3KMWA 4RBLA 3GNIB 2A2AA 4G6NA 3AT2A 1P5EA 1PXMA 2YLFA 5C8NA 3IGGA 3LFAA 2GPHA 5J7HA 3DNEA 4KIKA 3R7GA 4O7VA 5KO1A 3I1AA 4G17A 2QLQA 3DQXA 4TYHB 3ZDIA 5KMJA 4TYIA 3SW7A 4OTHA 3R7EA 4HVGA 4ALWA 4I1ZA 3LFFA 4JG8A 1JKSA 4P4CA 3MS9A 2IJMA 3DBDA 4GL9A 3DGKA 4UMUA 1YHWA 5J9ZA 4D9UA 3LFDA 2BVAA 4NIFB 2JKQA 4H3QA 4ZXTA 3BLQA 3ZUUA 4MTAA 3SC1A 3BRBA 3QUDA 1M52A 5C8MA 4WA9A 3CSVA 1PXOA 4AN9A 3ULIA 4IZAA 5DR9A 3ZHPC 3I60A 2VTIA 4WNMA 3DBCA 4NM5A 3F5XA 4OTPA 3WF8A 5CU0A 3A4OX 4X2JA 1UNHA 3WI6A 4UXLA 3DZQA 2X4FA 4L00A 1YI4A 2OSCA 4FTTA 2I0EA 3O23A 5JK3A 4BDFA 4XRLA 2J6MA 3CCNA 3ZEWA 4KKGA 3P0MA 4R1YA 2GQSA 4RLKA 2GNFA 3LAUA 3LXLA 3DJ6A 1WMKA 4IZYA 3TKUA 3QRIA 1YI3A 5DFPA 5JH6A 5AA8A 4BDDA 4D4YA 4CXAA 3F82A 3MYGA 4LRKA 4HVIA 2O0UA 4NSTA 3C5IA 4CG9A 2B0QA 5AM6A 5JGDA 3DB8A 3ORPA 1O6KA 1SZMA 5F1ZA 5HO6A 4JS8A 3W2CA 1OPJA 3WIGA 4PDSA 3RKBA 2ERKA 3Q5ZA 3ZSGA 3NYXA 2X8EA 1QPCA 1UWHA 5EM5A 4A07A 4I6QA 2RGPA 4EQUA 1Q97A 2V22A 3OVVA 3S95A 4FG9A 5JRSA 1BL6A 1O6YA 2R0IA 4FKJA 4C4HA 4KWPA 3TTJA 1IR3A 3P7CA 3Q9WA 4GKHA 3BHUA 1YOLA 3E8DA 4ANQA 4CSVA 2E9VA 4YJRA 3BE9A 4DGLC 3MV5A 4EI4A 5H8BA 4F99A 1DAYA 5EW9A 3GCUA 3U4UA 3RAHA 3WF9A 5JFWA 3P08A 5EW8A 1WBVA 4L7FA 2BTRA 3EQDA 4I5HA 3TTIA 4IXPA 5TT7A 1H1RA 2ZJWA 4QQ5A 2HZNA 2W7XA 3E8EA 3QTZA 3LCDA 3DZOA 3KK8A 5ANJA 3MJ1A 3E62A 3KK9A 4E1ZA 2O5KA 3HYHA 3V5TA 2PVNA 2Y4PA 2WXVA 5E8UA 3R2YA 2X8DA 3JY0A 4YMJA 2WMRA 4D0WA 3GC8A 1KE5A 2OWBA 4PWNA 4EHZA 4AP7A 4RVKA 3SDJA 3DTWA 3HZTA 2X2KA 3VRZA 3QA8A 3ZC6A 3EYGA 3LCSA 3UIUA 4QQJA 4CLJA 2ONLC 4FL2A 3U54A 2VTPA 2BRMA 4TYHA 4AGWA 4X2GA 2EUFB 3ZSHA 3T3VA 1ZYDA 1ZOGA 3PRFA 4QTDA 1KOAA 4RFMA 3CJFA 4F0IA 2QOLA 2OH0E 5HE3A 4ACCA 4NZWB 1ZMWA 3A8WA 4F65A 1XKKA 2ZV7A 3PY0A 4N6ZA 5CY3A 3TEIA 4NIFA 2BRGA 3ODYX 4EH9A 3EYHA 4ZAUA 2P33A 3OY1A 4RIXB 4P7EA 1YHSA 3PZHA 2UW0A 3F2AA 5BVEA 4ASDA 4FZFB 3OF0A 3C4FA 3C50A 4FR4A 1PMVA 4QMMA 3LPBA 2OJ9A 4PUZA 4YC6A 4FTIA 4GFMA 4JRVA 4PPAA 2PVKA 4IW0A 4C3RA 3KC3A 5FEQA 3ORNA 1ZMVA 5ETAA 4ZY5A 4RA4A 4QMTA 2Q0NA 4IWDA 2ITNA 4IVCA 3WE8A 4P5ZA 4UX9A 4JAJA 3PVWA 3LXNA 5I9VA 2X81A 2BZHB 3QFVA 4GYIA 3SGCA 4QP3A 2H6DA 3NUSA 4FTMA 4V04A 4ACMA 5C4LA 1T46A 1JAMA 2IVTA 3VBQA 3NWWA 5LMBA 3MIAA 1H01A 3CQEA 1WAKA 4FTKA 5CYIA 2QONA 2X1NA 2C6IA 2ZYBA 4FKPA 3H0YA 3VHEA 2VX3A 2W1CA 3E7VA 1HCKA 5E8SA 5DR6A 4I93A 4GIHA 3C51A 3WARA 4U43A 3FI2A 4IANA 5LVPA 5KE0A 4QTCA 2R2PA 4HZSA 4RQVA 4BVUA 2EXEA 1XQZA 2QOOA 4OLIA 4PL5A 4BCNA 5HNIX 4X2NA 3G51A 4A4XA 2VO7A 3ITZA 3OFMA 1ZOHA 5IPJA 1Q8YA 4NTTA 3FDNA 3UC3A 3F2NA 5GIPE 2ITWA 2RG6A 3MVJA 2WTCA 4K6ZA 4Q5EA 2C6EA 4A9RA 4RX9A 5EQYA 4N6YA 3RK9A 5BVOA 3JYAA 1M14A 3O50A 1XWSA 3UYSA 4L53A 3VS4A 4JT3A 3FLWA 4ZTNA 5FTQA 3RHKA 3BWFA 4XV9A 4O2ZA 3UGCA 3W2RA 2R0UA 3SXSA 3ORKA 5J79A 1Y8YA 1A48A 1GIHA 4FV7A 4Y85A 2R3IA 4PNKA 3KULA 1MRYA 3A61A 2X7OA 4M15A 4CYJA 3RAKA 2V55A 4HYSA 3V51A 3GU4A 3C4EA 3BYVA 5H8GA 4CV8A 3L8SA 4QP4A 4I5MA 2FGIA 3OCGA 3LXPA 4KKEA 1QPDA 5EDRA 3BYSA 3QZFA 2HZ0A 2QKWB 4R5SA 2BZKB 5JKGA 4L7SA 3QC4A 3BU6A 4YHTA 5IISA 4ACGA 3DPKA 3EQBA 4FKUA 4QMSA 4QYYA 2XF0A 2HY81 5EHOA 4BCOA 3HUCA 1URWA 4KS8A 5ANGA 2A4LA 3T3UA 3I5NA 2WFYA 3G5DA 4KRDA 2IVVA 2PE1A 3MH1A 3UQFA 2I0VA 5J1VA 4ZLOA 4S32A 3FY2A 3V5LA 4L01A 4DN5A 4XMOA 4TYJA 4G9CA 5BYZA 3ZONA 5F4NA 2OBJA 2HAKA 4FTJA 4EOSA 4G3EA 4DBNA 1OL5A 4TXCA 4ZEGA 3ROYA 2O8YA 3ANRA 5E8WA 2ETRA 4NTSA 3LQ8A 1GIIA 4TTHB 2QU6A 4EH3A 4RIXA 4FV8A 4F0FA 5E91A 4RRVA 4EKLA 1L8TA 2XJ1A 3U6JA 4I23A 5AV3A 2C5NA 2YCFA 3C4ZA 4ZY6A 2Q0BA 3ZUVA 3R21A 4HGLA 2RL5A 3FMDA 4I0TA 4K33A 3BELA 5DG5A 3HDMA 4FSQA 4IM2A 4MAOA 4E6QA 5CEMA 4PDYA 1IAHA 3FMHA 3CBLA 3ZRLA 3BEAA 3RINA 3HMIA 2J5FA 3UVQA 4UMPA 4QT1A 4L8MA 4R7IA 3BYOA 2E9OA 3HV5A 2XYUA 3QX4A 4QP2A 5EOBA 3UDBA 4U8ZA 3PJ3A 3ZSIA 4K11A 5L2QA 3V5PA 2R3GA 1M17A 4RZWA 4LFIA 1Q3DA 4C4JA 5HU3A 4OGRA 5IQIA 3ET7A 4O7YA 1CKPA 2I0HA 3F88A 4FNWA 3FC2A 1GJOA 4N4SA 3TJDA 5CEOA 3GBZA 3RBWA 3WBLA 4IEBA 4RMZA 3ATTA 4O86A 5IQDA 5CAUA 2E9PA 4B0GA 4MQ2A 3H0ZA 5AUTA 2YJRA 3TZMA 5AX3A 3UZPA 4D55A 3QA0A 4KKHA 1DAWA 4CRSA 3UIXA 4JDIA 3HECA 3OWJA 3TUCA 4GYGA 3OEFX 4RA5A 4EUTA 4BZDA 2V5QA 4HYHA 4WD5A 5IA5A 3B8RA 5BVDA 3GU7A 5KZIA 2VNWA 1PXIA 3UODA 3D5UA 3NNXA 4TKSA 3QXOA 4ZIMA 2BDJA 3R1NA 1G3NA 2VWWA 4L43A 2CDZA 3QRKA 3I0QA 1R39A 2A27A 2DUVA 2UW3A 3C9WA 3GEQA 5AP0A 4EBWA 4UEUA 1Y91A 2Z7RA 4DG0E 3RAIA 2ESMA 3DS6A 3FWQA 2W06A 3NAXA 4AG8A 4O0UA 3V04A 1E1VA 3QU0A 4KRCA 4R78A 4ZY4A 4Y5HA 3LIJA 5K5XA 2G15A 3JXWA 3V01A 2VWYA 1OKYA 4J99A 2YFXA 3R9NA 2V62A 4EKKA 5ETCA 1NVRA 1A06A 2PK9A 5L6PA 2PVFA 2UW6A 4QYEA 5EG3A 3H9RA 5H9BA 3KREA 3DKOA 4WT6A 4Y95A 4ERKA 1KV2A 4XOYA 3MA3A 3R1YA 2PMOX 3QLFA 4OAUC 4IJ9A 3P5KA 1OIUA 4S34A 3UPXA 3GUBA 2JKMA 2PUUA 4C7TA 4FSWA 1ZXEA 3V8WA 1H28A 2C69A 2ETKA 4B8MA 4GG7A 3LW0A 3II5A 3IGOA 4XG4A 4AN2A 5B7VA 2XJ2A 3E3PA 3B8QA 4NW5A 2IZUA 3F7ZA 3BCEA 3QGYA 3NPCA 3U9NA 4JRNA 3DJ7A 3Q60A 5D12A 2WIPA 5JGBA 2YDKA 3QD0A 4QP1A 3ZO1A 1ZOEA 1B39A 1JVPP 3UBDA 3QCXA 1YXUA 3NUUA 4Z3VA 3PRIA 4DH5A 4G5PA 3MWUA 2WMVA 3RPYA 2JD5A 2PWLA 4EC9A 5CSHA 4L46A 5AADA 2QOBA 4HVSA 2JITA 2R9SA 5CALA 3I7CA 2G9XA 5FG8A 3R22A 4J7BA 4PL3A 2OIQA 2WAJA 1V0PA 3CQWA 3MB6A 4AACA 3IDCA 1PJKA 3LJ2A 4FEWA 3KKVA 4G6LA 4KAOA 3HUBA 4FF8A 3IOKA 3PG3A 3S2PA 3FMEA 4LRJA 2CGVA 5DMZA 4I94A 4APCA 3AGMA 3F3WA 3LLTA 4W4VA 4AFJA 4XEYA 5TKDA 4FSTA 3NX8A 2C1AA 1PXLA 3LJ1A 4LMNA 2QKRA 3G2FA 5D41A 3RPSA 4RX7A 3R8PA 4R7BA 1FOTA 1YQJA 3HL7A 5HNGA 2E2BA 3TNWA 2IZRA 1JNKA 3GOPA 5J7BA 2GS7A 3MY1A 4EK8A 4XG9A 2HOGA 2XZSA 4EK4A 3H9OA 4FKIA 3ZXTA 3MSSA 3EN9A 4KBAA 4XLIA 2F4JA 2QOKA 3N4VA 1VR2A 2XMYA 4P5QA 3COHA 2RFSA 3IPHA 4X2KA 5EI8A 4CRLA 3ZM9A 1K3AA 2WD1A 4I41A 3G6HA 5IH5A 3NUNA 4EORA 5A54A 3BHHA 3OS3A 5JQ5A 3FSFA 2V0DA 4QMNA 4C8BA 4YZ9A 2BAJA 2FA2A 4X6QC 3FKNA 3NUYA 1OL2A 3DK7A 2DS1A 2JC6A 4ANSA 2WOTA 4DEBA 2PYWA 4DTBA 4EOKA 5H2UA 2QOIA 4UWCA 4AWIA 3GP0A 4O82A 2W1ZA 2W4OA 3MFSA 5C9CA 5IZFA 4CKRA 4Y8DA 2PPQA 4MD7E 3E8CA 4APPA 4W4XA 4KABA 5M56A 2C47A 2QD9A 3P7BA 4NM0A 5IMEA 2YAKA 4NT4A 1SYKA 3OMVA 3RPVA 3L8XA 2W5HA 3IDBA 5ACKA 3QQFA 5GZAA 2SRCA 3QYWA 2VRXA 3SHEA 2C6KA 1GY3A 3ULZA 3VW6A 4CYIA 4EOOA 5IA2A 1FMOE 4IX5A 4XP2A 4D4VA 4O1OA 1CM8A 2YJSA 4RWIA 4H58A 4GEOA 3QLGA 3HP2A 3DQWA 4C0TA 4B6LA 4GK4A 4PMPA 4DF3A 5M4IA 3EQPA 4LG4A 5FM3A 2ZMDA 3I81A 3VRYA 4BCQA 2BALA 5HNBA 1OGUA 5EI6A 4OW8A 4CZYB 2PVMA 4IMYA 1GZ8A 2PMLX 4LMUA 4CT2A 3MVLA 4WBBB 1OIYA 4C38A 5AR3A 4FTLA 4LL0A 2F7XE 3DBQA 4MXZA 3UC4A 3ZCLA 5KUPA 2YHVA 4RFZA 4IHPA 3SV0A 3ZBXA 2XEZA 3I4BA 3QD4A 3RI1A 2QODA 4FNYA 3AC2A 2Z02A 4KS7A 2C6LA 3VS2A 2C6MA 2HYYA 5CLPA 4M13A 2V7AA 4R77A 4CQGA 5GJDA 3ORMA 5A46A 1LPUA 2QI8A 2Y7JA 3VUMA 1ZZLA 2A0CX 1SNUA 5A3XA 4ZZOA 3A99A 4EONA 1KSWA 2ITPA 4BFMA 2JIVA 4WO5A 3KGAA 3TWJA 2OO8X 1U5QA 2VTJA 4JXFA 3LFBA 4FTAA 5ICPA 4EK5A 5IDPA 3AMYA 4C34A 4F1TA 2FB8A 2W4JA 3IW7A 3SVVA 5EYKA 4MF1A 4RJ3A 2PU8A 4FV1A 3FMMA 3KF7A 3LOKA 3UP2A 3BGQA 2JKOA 3EOCA 3MTFA 4RC4A 3WZUA 3FI4A 1E9HA 4AZWA 5A6OA 5LWNA 5HI2A 5EYMA 4AW0A 4CMTA 4YU2A 3GC9A 4XG6A 3ZO4A 3QKMA 4DTAA 2CN5A 3TKIA 2C68A 2W5AA 3R8LA 4U3YA 2X6EA 2O63A 4BY9E 2UZUE 1H08A 2YLEA 3UZTA 4IACA 4PTGA 4YTIA 3CQUA 4JX3A 4L9IA 5CI6A 1L3RE 3NYOA 4L3JA 1H1QA 2PZPA 4EOPA 3R7VA 4IX6A 4KIKB 1UNLA 2B7AA 3WZKA 3DAKA 5JFSA 4QMZA 5EFQA 5AUVA 2OLCA 3WILA 4DT9A 1UU7A 2RIOA 3L9MA 5HCZA 5LMKC 4ARKA 3CE3A 4FTNA 3SOAA 3NVMB 4DGMA 4G3CA 1PMNA 2PE0A 3TCPA 1G8AA 4QYHA 5EYCA 2VV9A 5IQAA 4I3ZA 2X8IA 2JDVA 2YCQA 2CMWA 4Y73A 5IA1A 4FSZA 5C4KA 4EQMA 5ANIA 2ZAZA 3AXWA 2J0MB 2R3HA 2XS0A 4RWKA 5CXZA 5IEYA 4F1OA 1P14A 2Q83A 4I21A 2WOUA 3V5JA 5KMNA 1KV1A 3AG9A 4FNZA 3D7TA 4Q9ZA 4DEEA 4HNIA 2BFXA 1H25A 4GFOA 2R5TA 2VTLA 3NW7A 3UIMA 4J98A 5D9HA 3O96A 4GU9A 4FVRA 1IA8A 1JSVA 4NJDA 2WMQA 4OR5A 4WBOA 3V6RA 5IQHA 3QCYA 3UG2A 5AM7A 3F7WA 4E7WA 3ODZX 2FSTX 1Q61A 5DVRA 4I5CA 2ITQA 3W33A 3HP5A 2W05A 3FKOA 4RJ6A 5HHWA 3OWLA 4PX6A 4O7TA 4FTQA 4O81A 3NCGA 5GHVA 3NAYA 4U44A 4E3CA 3LKMA 3P9JA 3Q4TA 3PFQA 4MXAA 1Q5KA 3FZTA 4BHZA 4IDTA 5JRQA 3DAEA 3H10A 2KULA 2VAGA 3PA3A 2WQNA 1UKHA 2ERZE 1FVVA 3DKFA 4JR3A 3TL8A 5AV4A 4IBMA 4IB0A 3TZ7A 5HE0A 3I7BA 4V0GB 2ETMA 3C5UA 2VO6A 1GNGA 4FKQA 4TT7A 4NU1A 4NCTA 4GK3A 3QZGA 3KRRA 4YPSA 3DDQA 5FTOA 5DNRA 4JR7A 4CZTA 4KA3A 4XG7A 4OTIA 1JWHA 2J9MA 3A2CA 3QZHA 4TN6A 2OF4A 4QMLA 4AF3A 4V01A 4MX9A 3QUEA 4MKCA 3QF9A 4WG5A 4BBFA 3VS6A 4KNBA 1XHAA 1FGIA 5HE2A 3RCDA 5C8KA 3U87A 3MH2A 4KUJA 3FSKA 3L9NA 2Z2WA 3NZ0A 3HV3A 4E4LA 2C3KA 2IW8A 5JSMA 3O71A 1WBSA 3F3VA 3QQGA 3PVBA 4FKRA 4MH7A 1AGWA 2UZOA 5H8EA 3LHJA 5DT4A 3FHRA 4GKIA 3DKGA 3K3IA 3EL8A 3R00A 4YO6A 4C4FA 3RNYA 2ZV2A 5HICA 4CCBA 1Y8GA 1IEPA 1SM2A 5CU2A 4JG6A 3RZBA 4UWBA 3SAYA 4YHJA 4YP8A 4F6WA 2XK6A 4X2FA 1LEWA 3ACJA 4YLLA 5HLPA 1U54B 1Z5MA 2YISA 2YACA 3NNVA 3QGWA 4FK3A 2W4KA 3QQKA 4CLIA 5CVFA 3FMJA 3FJQE 3TNQB 3FXWA 2YCRA 5HQ0A 1OUKA 2B9FA 1ZZ2A 2XRWA 4JNWA 4IAAA 4R1VA 3VN9A 4C59A 1WFCA 4UB7A 4YZNA 2GTNA 4PP7A 2XKEA 4WNOA 1Q8UA 2YDIA 2YERA 4BGQA 3O0GA 4F4PA 2XKFA 2XEYA 3IO7A 4EQCA 4E4XA 3JS2A 1BI8A 3CKXA 4ONAA 3BHVA 3KXNA 2XIKA 5IQFA 3HAMA 4EUUA 4BYJA 3FI8A 2XUUA 4E5WA 4MBJA 4BTKA 3K5VA 4C2VA 3AC3A 3Q6WA 3BLHA 3D2KA 3UNZA 4FKLA 4PY1A 3FLZA 3DK3A 5DN3A 3MIYA 2IW9A 3JVRA 4RVMA 2ZDTA 3BLRA 4EBVA 3D15A 3AMAA 5CF6A 4WHZA 3NDMA 5CEPA 4D2WA 4FKOA 4LUDA 4QNAA 4IZ7A 2BAQA 2ITXA 2ITZA 3BI6A 4CFFA 3OCSA 2VN9A 3C4WA 4BN1A 2QG5A 3ACKA 4Q5HA 1CKJA 5LVLA 3UMWA 5JFXA 4FKGA 4J71A 5B0XA 4F64A 4O0WA 4Q2AA 5BQ0A 5AR8A 2XKDA 2WU6A 2YN8A 4DEHA 1PXPA 4ANOA 5LCJA 1BL7A 4FMQA 3ZFXA 4C62A 1M2RA 3E87A 4C37A 3KXXA 3W18A 2ITYA 3LLAA 4N57A 2YZLA 4O27B 1APME 3HA8A 4FI1A 4IVAA 4XV2A 3TV7A 4V0GA 3MBLA 4IZ5A 4D5HA 3TM0A 5CU3A 3QHWA 4IAKA 4A9YA 5HE1A 4EZ3A 4E8AA 4U6RA 3BE2A 4G2FA 3EMGA 4A9TA 2HK5A 3PVGA 3UPZA 4ORKA 5CZHA 3DLSA 3QQJA 5IG1A 3QALE 3P1AA 4HZRA 4AT5A 3AGLA 4ZP5A 2G01A 4D1XA 2B9IA 3HGKA 2J51A 1VJYA 4LYNA 1WVWA 2VO0A 3R7UA 5L6OA 1ZY5A 2WMXA 2J90A 3MN3A 3Q52A 3NLBA 4OBPA 3SRVB 4AAAA 3GT8A 4B7TA 4BDKA 3LMIA 4MF0A 1NA7A 5KMOA 3D2IA 3O51A 3HV4A 4AW5A 2UZBA 4O96A 3D14A 4D1SA 2ZV9A 2OG8A 3KULB 5DYJA 3R9RA 4CG8A 5K3YA 4BTJA 2WMTA 3D7ZA 3PXQA 4NKSA 4FVPA 5BYLA 2OF2A 2C5VA 1K9AA 3LCKA 4R6VA 1V0OA 4IX4A 4WSYA 5DOSA 4GW8A 1OB3A 2HENA 5E8XA 2BIKB 3QTIA 3PUPA 5I9XA 5FGKA 3P4KA 4K0YA 4USFA 5GZ8A 3F61A 4QRCA 4HVHA 2BZJA 4IAFA 3EN5A 4IE9A 5AV2A 1RE8A 4ALVA 1FVRA 5HTIA 1U54A 2W99B 3FZOA 4EH7A 3G0FA 1Z9XA 1UNGA 2ITVA 1BI7A 2PVRA 3G0EA 4MVFA 2XNPA 2XB7A 3E7OA 3MTLA 3DBEA 1H1SA 3DU8A 3Q3BA 4USDA 4WRGA 3LCTA 4Z7GA 5BUJA 3RTPA 1W84A 3QC9A 5CVGA 2OJJA 3F9NA 4HYUA 5HZNA 4L3LA 4BI2A 2C3JA 1NXKA 2AYPA 5HG5A 4PDOA 2WMBA 1NVSA 3H4JA 4W8DA 3V8SA 4UV0A 4HW7A 5IQEA 4MNFA 1W7HA 1ZY4A 3AC4A 2VTQA 1OKVA 3CKWA 2PZ5A 1JLUE 2XIYA 4M97A 1QL6A 3LFNA 4FV9A 4AUAA 5CVHA 3FEGA 4TWPA 3MESA 2P2HA 4O7NA 2H96A 2BHHA 4CCUA 2FSMX 4EH5A 1DI8A 4JBPA 4QMWA 4C3PA 4AZEA 1YDTE 2JFMA 1RDQE 3E3BX 4S31A 1SVHA 2UZWE 2YIYA 2J2IB 2AUHA 3LFEA 3MDYA 3W55A 3OCBA 4R8QA 1R1WA 3T9TA 4DLJA 1ZYLA 4DFLA 4ERWA 5DBXA 5IUHA 4CT1A 4M12A 3UO5A 2JAMA 1DS5A 1QPJA 3VUIA 3F3TA 4AU8A 3O7LD 1PRYA 2UZNA 5CF4A 1YHVA 2B9HA 5I5ZA 5HO7A 3QKKA 4XHKB 2CNVA 2YM5A 4FVQA 2YITA 1J3HA 5ANEA 5IA4A 3OUKA 4IH8A 5IEVA 3JR1A 4FEUA 3Q04A 4RQKA 3A7IA 2YEXA 3FLNC 3D83A 3WZDA 3UNJA 4CV9A 1MRVA 3I0OA 3MY5A 2VGPA 4JX7A 1KE7A 4HOKA 3LM0A 4JOAA 4M7IA 5AUWA 2GMXA 2NPQA 2XIZA 5E8VA 5FD2A 1YWRA 4JBVA 4UXQA 5HLNA 4RVTA 3Q53A 2WHBA 3MH0A 4AFEA 3SRVA 4IB5A 4FIGA 5CSXA 5DA3A 1XH5A 5AP5A 4BDHA 5CAVA 3W8QA 3DAJA 5FBNC 3REPA 5AAEA 4FTRA 3A60A 1ZAOA 4BDIA 5DPVA 5KZ0A 4PF4A 3QBNA 3U8WA 3EH9A 3N51A 5IA3A 4E93A 4DCAA 2ZB1A 4IAIA 2QOHA 4M3QA 4KSPA 4N0SA 3LCOA 3PY1A 5A4EA 2QOFA 3FXZA 3DOGA 2X2MA 4MBIA 4FL3A 4OAVB 5K0KA 2P0CA 5M09A 3ZC5A 4D4SA 2OXYA 5K5NA 3HEGA 2OJIA 2Y6OA 4NJ3A 2I0YA 4D9TA 4DYMA 5M4UA 1LUFA 4O7LA 2BR1A 1GOLA 3KXHA 2O3PA 4MHAA 2OU7A 3WE4A 3D94A 4F7LA 2Z7SA 4CVAA 2BIYA 4GVAA 3NW6A 2C6OA 3D5VA 5BYYA 3PG1A 2I6LA 2UV2A 2ONLA 3CY3A 3JPVA 4D2VA 4ACHA 5I4NA 1XH4A 2JDTA 5AV0A 4BWPA 3O17A 2H8HA 4HVDA 1I44A 1PKDA 2VWXA 3GFEA 4KBKA 4EWQA 2FO0A 5CZIA 3R8VA 2F49A 2GNGA 3QTXA 1BX6A 3NRMA 2BUJA 4WUNA 4II5A 4UYAA 4OTDA 4ZLZA 2WNTA 5LMAA 1REKA 5CENA 3PTGA 4E4MA 1WBTA 4IDVA 3VQHA 3HRFA 3QRUA 4FYOA 5DT3A 4E26A 1MRUA 3VUTA 4DBXA 3UQCA 4DFZE 2PTKA 1EH4A 1W0XC 5CSWA 3EKNA 1OZ1A 3EL7A 1FMKA 3CTJA 5I9ZA 3RPRA 3PXFA 3DLZA 2ZVAA 5AJQA 2CKPA 3VQUA 2PMNX 4F0GA 3M2WA 1OBGA 3BU5A 3U51A 3N4TA 4AT3A 5AUZA 4UBAA 1YOMA 3IW5A 2G1TA 3DT1A 3GU8A 4M68A 4O0SA 4QMXA 3SLSA 4DGOA 5A4LA 3W32A 5KMKA 3E5AA 1KE9A 3ERKA 4IFGA 4O7SA 3GOKA 1J1CA 2EXMA 4JDJA 4KIOA 1PY5A 3ORIA 5KHWA 4WG3A 1UU8A 5E8YA 5L4QA 3PVUA 2QO7A 1J1BA 4E5BA 3EFKA 3PSCA 4WG4A 3A7JA 2RKUA 3KN5A 2XA4A 2Z7QA 2YIQA 5CU4A 4ZSLA 4AZSA 3OD6X 2VTTA 3ATSA 3UP7A 4L42A 2BDWA 3KXZA 5JQ8A 2WQBA 2J0IA 5L2TA 2YIXA 2J50A 1REJA 3QXPA 5A4QA 4NL0A 5E90A 4BIDA 4FV0A 1OKZA 3O8TA 3GCPA 4Y5QA 3BQCA 4F1MA 4MBLA 4UY9A 4A7CA 4OTFA 3RPOA 4F7SA 5EDPA 3OY3A 4ZSEA 4BB4A 3TKHA 3NIEA 3LFCA 2VZ6A 3DXNA 3FLQA 5DWRA 4D2SA 1FPUA 3P86A 3CPCA 4IC8A 3TDWA 2XNGA 1VZOA 3SG8A 2YM8A 4TZRA 1OI9A 1VEBA 1YDRE 1Y6AA 4YUQA 1BKXA 3PP1A 4GSBA 3QYZA 4ANNA 2ITOA 4OTQA 2XCHA 4U40A 4CKIA 3LQ5A 3Q2MA 3GCQA 3CS9A 2PUPA 2WTKC 1YXTA 4IB1A 2GQRA 4JDKA 3VF8A 3NSZA 3PLAE 4CFVA 4NK9A 2GTMA 5FDPA 4TWNA 5KMIA 3BZ3A 2RFEA 3OCTA 4M66A 2OIDA 3COKA 2HIWA 4M0ZA 4RIOA 4LOPA 4CD0A 4R3PA 4BKZA 4XBUA 4ZTMA 4JQEA 2WO6A 1Q41A 5KCVA 3QD2B 4YPDA 3R9HA 1X8BA 3GENA 1UU9A 2CKEA 4LQMA 4ZTRA 3TACA 2CCIA 3EN6A 1WVXA 4RT7A 4Y46A 1OM1A 3KRLA 2BKKA 4ZS4A 4RC2A 5C03A 3UG1A 5E9EA 3FYJX 5EOLA 5AAFA 3R6XA 4FTCA 3EN7A 2OXDA 4YTHA 4O0TA 4PPBA 2JBPA 4LV8A 4XP3A 2PVLA 2GFSA 2WIHA 3UOKA 5B2LA 3IDPA 4X3FC 3DTCA 1Q62A 4M69B 3DXQA 4S33A 5F94A 2JDSA 2J0JA 3IW4A 4K1BA 1XH6A 2IW6A 2R3MA 4GIIA 4DC2A 4J8NA 4S30A 3GFWA 5E1SA 3VS5A 5GZ9A 3E92A 4QP7A 2RSVA 5DR2A 3ZLSA 2EB3A 1WZYA 4PMSA 4AA0A 4GMYA 3IONA 2GDOA 4X3JA 3BHTA 2FVDA 3KVWA 2BKZA 4NUSA 3S00A 2G2FA 4R7HA 5AA9A 1OIQA 2QG7A 2BCJA 3AC8A 5AR4A 5L2WA 3DFCB 1YDSE 4NKAA 4HGSA 5IH4A 4RLLA 1JKLA 3Q4UA 5E1EA 1DI9A 1H8FA 3VS0A 3VHKA 5B2MA 5I3OA 4PV0A 5JFVA 4EYJA 3VO3A 3D0EA 1ZLTA 4E6DA 4TL0A 2J4ZA 3KQ7A 5HTCA 4FZ7A 2BRBA 3ANQA 2CNQA 1MQBA 4FE2A 3E8NA 4DEIA 2W1GA 4BDCA 5A14A 1DM2A 4FX3A 5TR6A 3KXGA 4YC3A 3RM7A 4DEDA 5EM6A 5FUTA 2CHLA 3BYMA 2UZVA 4XG8A 4HYIA 1BLXA 4I4EA 2CLXA 4BIEA 4C33A 1J7LA 5C01A 3R1SA 4G16A 3R28A 3AT4A 4ZSGA 1ZYJA 3TNIA 3D7TB 4J53A 4ANBA 3D4QA 2HXQA 4QD6A 3AD6A 3EWHA 2CCHA 4FK6A 5AP3A 4A4LA 4MQ1A 4TYGA 3BBWA 3EFJA 5TE0A 4E20A 3PSDA 2AC3A 2W1EA 4RGJA 4Z9LA 4IVBA 4USEA 1A9UA 1UVRA 3FC1X 4NM3A 4YZCA 3VBYA 4CZUA 5AV1A 3EQCA 4C3FA 3OXIA 3BKBA 4RVLA 4FKVA 4CQEA 4F9BA 2JAVA 2W1DA 3UZRA 5HIEA 2NO3A 2Y0AA 3CPBA 2XK7A 4MEDA 3VWAA 4V05A 2CGUA 3IW8A 3WYXA 2GNLA 3PPJA 4FKTA 4MD8E 2WGJA 4XLVA 2BROA 3GC0A 5HG8A 4C4IA 4I92A 2OICA 5HG9A 3ZZEA 4EOMA 3MPTA 4BDBA 2W17A 5TO8A 4DAWA 1OPKA 2QO2A 4FODA 4U3ZA 3U55A 2ZV8A 3R7OA 2WELA 4LGGA 3PIZA 3Q6UA 1ND4A 3S1HA 3OBGA 5ANKA 2RFNA 5HU9A 3FQEA 3GU6A 3Q32A 4EOJA 4JAIA 2J0LA 4FT5A 3B2TA 3BIZA 5JEBA 2IPXA 5BUIA 4ANMA 4WSQA 5G6VA 1HCLA 4ITHA 4O91A 4F9YA 3MGYA 2J0KA 4U41A 4FSYA 1LR4A 4LI5A 1RW8A 5HESA 1PHKA 3RNIA 3V3VA 2C3LA 3QZIA 4M69A 4QPMA 2Y4IB 3PLSA 3NMUF 5HVYA 1FQ1B 4YC8A 1U5RA
chains in the Genus database with same CATH superfamily
2F57A 1OPLA 2VTMA 4EJNA 5DHJA 5IA0A 3RWQA 4D5KA 3KFAA 1KUTA 5CSVA 5A4TA 3T9IA 3DCVA 2EB2A 4I24A 2PHKA 1URCA 3W0NA 3CC6A 3PXRA 3MFUA 4AW2A 3RMFA 3FLSA 5BVFA 5M4FA 3MH3A 4XH6A 4GH2A 5IU2A 2ZB0A 4BGGA 4BGHA 4OT5A 3CD3A 4GRBA 4YZBA 3TNPC 3VBXA 5C1QB 5I9WA 3HLLA 2QR7A 4F9WA 3MVMA 1OUYA 3PA4A 3R73A 3OP5A 3AKKA 3VNTA 4UYNA 2GU8A 2HW6A 4EOIA 4MYGA 5HBHA 4G3GA 3HV7A 4O21A 4QOXA 4XRJA 4QTEA 5AUUA 4AN3A 4DFNA 3AKJA 4O7ZA 1OVEA 1XJDA 1FBNA 2JEDA 2WZJA 5C26A 2BRNA 3GCVA 4DHJA 2JDOA 5M07A 4MNEB 2ITTA 2WTWA 2VO3A 5M55A 3F3ZA 5FM2A 3FPQA 4QMYA 4FA2A 2R7IA 2FH9A 3Q9ZA 5CXHA 3IK3A 5EM7A 3O8PA 2YWVA 4ZMEA 3SOCA 3SA0A 5ETIA 2WMUA 2XNMA 4RIWB 4D58A 4MWIA 1J91A 3AD4A 2QNJA 2VU3A 3LFSA 4HNFA 4L67A 3QX2A 5KKRC 3W0SA 4U42A 3KCFA 4BC6A 3ORTA 2QOQA 3EIDA 5M44A 4QYFA 2F7EE 3QCSA 3GCSA 1YRPA 2VTRA 3SKCA 4AQCA 3C1XA 4ID7A 3TJCA 5CAOA 4YJNA 3LFQA 3M1SA 5F20A 4EL9A 4BICA 1STCE 5IMXA 3WZJA 3EB0A 3V5WA 3JUHA 2A1AB 4ZTLA 4WNKA 3SG9A 3R83A 4GUBA 4DEGA 4W9XA 3DBFA 3A7HA 4U97A 3QCQA 4G3DA 2XM8A 3ROCA 3TV6A 4OUCA 5EK7A 3CR0A 3FY0A 2UW4A 5CEIA 2QURA 5AP6A 5IH6A 2PMIA 1IG1A 4U80A 4CMOA 2RF9A 3RK5A 3F3UA 3W0OA 1QPEA 3NCZA 3ZM4A 4CFMA 2X2LA 3TUDA 1H4LA 4AA5A 3I79A 2BPMA 2PZIA 3F2RA 2WMSA 3KF4A 3PJ8A 4C58A 5IF1A 3HX4A 3GB2A 3UDTA 3SW4A 4U7ZA 3DNDA 4XV1A 2B1PA 3OTUA 5DE2A 4ITJA 4FSRA 2OFVA 4AXDA 3H30A 4FSMA 3FZSA 3SXFA 5JT2A 3A7GA 4BDJA 3BQRA 3FUPA 1B38A 4OBQA 5KMLA 3TDVA 1BUHA 1YWNA 3GVUA 3OW3A 4I5PA 4O0YA 1OKWA 1GZKA 1W8CA 1NY3A 3QKLA 4RC3A 4ZK5A 1Q8ZA 4DH7A 5HEZA 1XR1A 5LCKA 3D9VA 4FT7A 4YURA 5KNJA 2DQ7X 2B54A 5HKMA 3QQUA 3QTWA 2BILB 1JOWB 2JFLA 4UALA 3HA6A 3TZ8A 3ZFYA 2F7ZE 4I6HA 4F08A 4JLCA 1R3CA 2XNEA 5JGAA 3A8XA 4XV3A 1H0VA 1JKKA 1YW2A 3DKCA 5B2KA 3KMUA 4FG8A 3FL5A 4BRXA 1ZYCA 2R3FA 2WKMA 4FICA 4B99A 2YAAA 2CGXA 4YNOA 3WF6A 1XH7A 4NH1A 2W1HA 2JDRA 2IF8A 2QR8A 5HBEA 5KHXA 2ZM3A 4RJ5A 5BVWA 4F63A 5CQUA 3R63A 2FYSA 3FPMA 4ASXA 3WOWA 3AD5A 2F2UA 2AC5A 1U46A 1YXVA 4J1RA 4DH1A 3ZS5A 3TNHA 2IZTA 3UNKA 4AT4A 3CLYA 1W2DA 2XBAA 4I0SA 4AOJA 1XBAA 3V5QA 3OOGA 1GAGA 2YA9A 3T8OA 3DXPA 2GNIA 5LARA 4L45A 3NIZA 5ETFA 4E4NA 2XYNA 3QTUA 2XK8A 3VF9A 2C5YA 2XKCA 4MNEA 2ITUA 2C3IB 4UZHA 4C4EA 2ZM1A 3FZPA 1WBOA 4LUEA 4FNXA 4RZVA 3BGZA 3R1QA 4JVGA 4CTBA 4BCPA 3ZO3A 5LQFA 4LV7A 4PNIA 3TMOA 1HOWA 4ASEA 4RIWA 4K18A 5J9YA 5LMKA 5CT7A 3VS1A 2VX0A 5T68A 5CNNA 1F0QA 3AQVA 3G6GA 3CD8A 4BI0A 3JVSA 1XBCA 4O83A 4O38A 2O64A 5D1JA 3L1SA 4K2RA 5BMMA 3ZEPA 4YNEA 4LGDA 2BRHA 5JZJA 4C36A 5J8IA 2C30A 4LGHA 2RG5A 3B2WA 4JJRA 1PMEA 2BMCA 4H1MA 4GVJA 3GXLA 4M14A 1YVJA 1H1PA 4CFUA 1SMHA 4XJ0A 5HGIA 5L2IA 2H34A 1WCCA 1KOBA 2XK4A 4YZDA 3EHAA 2Y8OA 4H39A 2E9UA 2XNOA 2QCSA 3W2QA 4HCTA 4MCVA 4TPTA 4YGAA 5IUGA 5DEYA 3E93A 3BV2A 5DRBA 5IEXA 5DEWA 3F5UA 3ETAA 1H07A 4IWOA 3W2PA 3S4QA 1OIRA 3R8UA 3L8VA 4YJUA 4GJ2A 4X7QA 1YI6A 3FMLA 3PE2A 3OG7A 5EHLA 5E8ZA 3CIKA 3POZA 4L68A 4AOTA 5AUXA 4QO9A 2VUWA 3QHRA 4PPCA 4GV1A 4U5JA 4FYNA 2CPKE 2IZSA 5M51A 5EM8A 3BHYA 2R3KA 4AZVA 1YXXA 3E64A 5E8TA 5EKOA 4BJJB 2UVXA 4QMQA 4DFBA 2NNWB 3OOMA 5IDNA 3NUPA 1JKTA 4YLJA 3P7AA 3BU3A 3R01A 4I4FA 3W8LA 4EH2A 1YXSA 2IVSA 2JIUA 2REIA 5LOHA 4BKJA 3L9LA 3F66A 4ACDA 4K8AA 1NVQA 4FSUA 3VBTA 3ALOA 5DIAA 2X0PA 3K2LA 3W1FA 4ZS0A 3WF7A 5HLWA 3NS9A 2CLQA 3EZVA 1K2PA 3HMOA 3O2MA 1P2AA 3R8MA 5L8LA 4C57A 3I6WA 2FSOX 2WQMA 4JL9A 4RIYA 4BCGA 1R0PA 3C13A 3HMPA 3S3IA 4YBKA 3G90X 3R9OA 2C6TA 3MFTA 2PULA 4NFMA 3TG1A 3EQRA 5ITAA 3VUKA 1G8SA 4H3BA 4H05A 4E73A 4ZZNA 1YKRA 1J7UA 1CDKA 2ZOQA 4EWHA 4YR8A 2W1IA 3OEZA 3KIOC 4U79A 5I9YA 3E88A 3IKAA 2DWBA 4JQ8A 3WZEA 2OFUA 5CNOA 4EZ7A 5CU6A 3UQGA 4BZNA 4IC7A 4AE9A 4BHNA 1F5QA 1Q8TA 5FEDA 4E6CA 2GHGA 4IIRA 2R3QA 3UVPA 3VBWA 4EH8A 3AT3A 3ZRMA 3ORXA 4O0VA 4S2ZA 3OROA 4ZSJA 4AGDA 3SQQA 4F6SA 4EZ5A 4FV5A 3CY2A 3W16A 4DFXE 3G33A 4ANLA 2F9GA 4DCEA 4XNEA 2PY3A 5EH0A 4DT8A 3EQIA 5AWMA 3FMNA 3SX9A 5LJJA 4FEXA 3FZ1A 5M08A 4QP8A 1FINA 5CS6A 3FBVA 4ASZA 4D2TA 3A7FA 4F09A 3DJ5A 1M7NA 4FV2A 4AGCA 2VWBA 3MW1A 1S9IA 5D7VA 5IQCA 5FLFA 3S0OA 4IWPA 1WBPA 4XBRA 4A06A 3VIDA 4HPTE 5FXSA 4MXYA 3C4XA 4O6EA 4DH3A 3UDSA 4BI1A 3IG7A 4XUFA 5M06A 4NFNA 4CFXA 4ZTQA 4YSJA 3EN4A 4J96A 3QD3A 4L3PA 1Y57A 1H00A 2UVZA 4BF2A 5AR5A 4LL5A 2B9JA 5CAQA 3HMNA 4ZJIA 4PL4A 2W9ZB 1UU3A 3CXWA 4IADA 4E6AA 1U4DA 3U9CA 3D5XA 2XIRA 5HIDA 4GJ3A 4CNHA 4BWXA 5KBRA 2C0TA 4R3CA 4EOQA 3PYYA 1H27A 5L6WL 5BUEA 4O1PA 4A9UA 1Q3WA 3GGFA 3OHTA 5HO8A 2PVHA 2VTOA 5KBQA 2R4BA 2UZTA 4HPUE 3QTSA 4W4YA 3TIZA 3VUGA 4XX9A 2Y6MA 2QOCA 4I0RA 3CEKA 5IUIA 3PJCA 4FTOA 3OXZA 3ZLYA 5EKNA 3M11A 3N4UA 3FXXA 3W2SA 4WOVA 2I1MA 2YZAA 2UZEA 5I9UA 4DG3E 3GQIA 4IVDA 2XNBA 2WB8A 4EYMA 4BR3A 4FGBA 2WEIA 4FV4A 3THBA 3ZO2A 3ZYAA 4BCHA 3Q96A 3V8TA 1GZNA 2ZDUA 1YOJA 3RJCA 4G31A 4D1ZA 4DGNA 5HVKA 1ERKA 5M4CA 2W96B 3NYNA 3RALA 1UWJA 5AFVA 2GS6A 3EJ1A 4BJJA 2BDFA 4G3FA 3ELJA 4TWOA 2R3RA 4TY1A 4X6RA 5E92A 3VVHA 5CASA 3FAAA 2QHNA 1OL6A 3KMMA 3RP9A 2PVJA 2QC6A 2VTAA 2BZIB 1R0EA 3D5WA 3IECA 3EQHA 4JQ7A 1GZOA 4N70A 1YWVA 4O22A 4RSSA 4YHFA 5EHYA 3POOA 3QRTA 3O8UA 3OZ6A 4UMQA 4DTKA 5TF9A 3MFRA 3NR9A 2W0JA 3NFGB 3KL8A 3PWDA 4K9YA 1KWPA 2X6DA 1TQIA 5DT0A 5LVMA 2QQ7A 5LXMA 3Q5IA 3PY3A 3MA6A 5CSPA 4BL1A 5GJGA 4IAYA 3CJGA 2CN8A 2J7TA 4RJ4A 4DFUA 4K77A 3R7YA 4M8TA 3GI3A 4BTMA 4C4GA 3P23A 3KB7A 1H1WA 4NW6A 4Q9SA 3H9FA 3QWKA 4DDGA 2OJFE 4AS0A 2W9FB 2HZ4A 3OW4A 4Z7HA 2I40A 4J95A 2XRUA 5F9EA 4F6UA 2Y9QA 1PKGA 3BGPA 3DY7A 3FI3A 4EC8A 2R3LA 4EHVA 5L8KA 2RFDA 2HW7A 2YCSA 2PZRA 5GJFA 4TYEA 3NNUA 1PW2A 3NW5A 3RM6A 1OECA 3CGOA 1VYZA 3N9XA 3DB6A 3OC1A 1G5SA 4FV6A 4JBQA 4OT6A 5AR2A 4BCJA 4ITIA 3KXMA 2UZLA 1W2FA 2PZYA 3PJ1A 4R3RA 5J1WA 1OL1A 1WVYA 3NGAA 2WQEA 2VWZA 3K3JA 1Z57A 3PE1A 4EOLA 4J52A 3NUXA 5ANOA 3PPKA 3G15A 4HCUA 4ZJJA 3ORZA 4F70A 5CI7A 5IQBA 4TNBA 3PP0A 5FWKK 1LEZA 2YM6A 2O65A 3EZRA 3Q2JA 4OTWA 3R02A 5CWZA 5DLSA 1XBBA 4OTGA 4YJOA 2BAKA 1V1KA 2JBOA 3I6UA 4YJTA 4XG3A 3UOHA 3ZLXA 1M2QA 1OL7A 5KX8A 2QO9A 4CEGA 3G9LX 4DGGA 3HKOA 2CSNA 5HCXA 1RJBA 1SVGA 2YIWA 5G1XA 3IS5A 2XK9A 2YM3A 3KN6A 4EHGA 4BDEA 1H26A 4BWKA 4EK3A 4U45A 3IQ7A 3TT0A 3P78A 4QMVA 4CKJA 2X9EA 3OXTA 2OH4A 5HG7A 4BDGA 4PMTA 2H9VA 1NT2A 5BPYA 4FGRA 3TN8A 5AP7A 4Y83A 5AP1A 2CJMA 4FJVA 4EJ7A 5GNKA 2C0IA 1VLRA 4UWYA 1H24A 4PQNA 4YC8A 4BTFA 1NW1A 3RGFA 3KEXA 3WIKA 2WTDA 2CKQA 3PIYA 3L8PA 3PIXA 2WQOA 3ZTXA 4A9SA 2ACXA 1E1XA 3NNWA 5HORA 3FMKA 2OZOA 3PPZA 4O7WA 4IM3A 1I09A 1QMZA 5M57A 4EH4A 4FC0A 3FLYA 1W83A 5LWMA 2UW5A 2Z7LA 3DFAA 4MXOA 3QUPA 5LVNA 2VTNA 4JDHA 4C02A 4CTCA 3ORLA 4MXXA 1ATPE 2XK3A 4YJVA 4F78A 4RG0A 5L3AA 2I7QA 4LDTA 2JKKA 4B8LA 2Z60A 1SVEA 2P4IA 1F3MC 3R0TA 4GU6A 2WMWA 2C5OA 3FV8A 4WUAA 4MWHA 5FBOA 5AIRA 2HZIA 2PVYA 3RWPA 2BTSA 4O84A 2XH5A 5DGZA 3FE3A 5E4HA 2C6DA 3OT3A 4I20A 2VTHA 5DI1A 2QHMA 3MPMA 1P4OA 3OWPA 2WTIA 1W98A 2CNUA 2XCKA 4IFCA 3ENMA 3NUAA 2G2IA 4KBCA 4M0YA 3QWJA 4ZLYA 4XOZA 2X0OA 3HNGA 4GFGA 4F7NA 3RHXA 2P2IA 2OI4X 4FIEA 3BWJA 2XNNA 2UW8A 2B55A 1Q99A 3DDPA 4H36A 4I6FA 3KVXA 2IG7A 1Q24A 4UMRA 5D10A 1JQHA 1XH9A 5GIOE 1CMKE 3FQSA 4X21A 4XYFA 4DE4A 4GS6A 4RJ7A 3AOXA 4QP9A 4LV5A 4W8EA 3MVHA 2ZMCA 5HX8A 2X7GA 3F6XA 4UMTA 1WBWA 5CTPA 4ENYA 3U6HA 4JBOA 2VD5A 4JIKA 4TWCA 2CGWA 3CP9A 4KINA 4QTBA 4G9RA 3LXKA 3NYVA 3HDNA 3Q9XA 5D7AA 3W2OA 2OZAB 4O7RA 3VS3A 4FIFA 1G8KA 2XVDA 3BPRA 3HMMA 3PXKA 4ALUA 4QTAA 5HD7A 5J95A 4BCIA 3DA6A 3AKLA 2NRYA 3ENHA 5CEQA 4FIJA 5FEEA 2F2CB 1KE6A 4QMPA 3R30A 3CGFA 1OMWA 4FIIA 4BCKA 2WTVA 2OJGA 2P55A 2JLDA 3KRXA 4MXCA 4B4LA 3R7IA 2WTKB 4RPVA 2X39A 3ZZWA 4ENXA 2W5BA 4MK0A 3BEGA 3QTQA 2GSFA 3AC1A 4PRJA 5HBJA 4BCMA 5BX0A 3VUDA 3O7LB 4L52A 3M42A 3LM5A 3Q4ZA 5AR7A 2EVAA 2CKOA 2GS2A 2E9NA 2VWVA 2LGCA 5L2SA 4G34A 2WU7A 4NWMA 1WBNA 1AQ1A 4C61A 5J5SA 3FQHA 4ZTHA 2XIXA 4AX8A 4LOOA 3SD0A 4AZFA 4PTEA 4R5YA 4YJPA 5I0BA 4A4OA 1XO2B 2YM4A 1PXNA 2B52A 2JGZA 4FEQA 4XG2A 4AXAA 3LQ3A 1VYWA 1BMKA 1ZRZA 4U9AA 3TI1A 4F9CA 5FXRA 2C4GA 4IJPA 5J87A 2JIIA 5ACBC 1V0BA 2GQGA 3GU5A 2XBJA 3K54A 2EWAA 1UV5A 3COMA 2XJ0A 2YWPA 5L8JA 5C27A 4FL1A 4X3FB 2OW3A 4KIQA 2GHMA 4NYEA 4D2PA 1ST0A 2A19B 3F5PA 3RVGA 4AA4A 3JY9A 5I3RA 3HRBA 3K5UA 3UOJA 2P3GX 5CT0A 3NVKI 5K9IA 4FOCA 4AQKA 4FTUA 3VS7A 4QQCA 3HRCA 3ZFMA 4DFYA 5BMSA 1IA9A 1FGKA 3KY2A 3UMXA 2UZDA 4D0XA 4WRSA 5EQEA 4JIAA 2UVYA 4GG5A 3PDTA 2HWPA 3ZOSA 2C1BA 2VWUA 1TKIA 3RZFA 1PYEA 5AEPA 1B6CB 1Q8WA 3C0GA 4EEVA 5FQDC 5JN2A 3KRWA 3R2BA 4YO4A 3TUBA 3C0IA 1MUOA 3PSBA 4Z55A 3R8ZA 3VW8A 3FKLA 4NM7A 3ALNA 4QMOA 1OBDA 4HGTA 1ZYSA 2PL0A 4KD1A 4FUYA 3L9PA 1CKIA 3ZXZA 5DH3A 2B4SB 5K4JA 3PZEA 3ZMMA 2ZM4A 1H0WA 2R3OA 4IAZA 4B9DA 4RX5A 5CEKA 5K0XA 4DITA 3EFLA 3LZBA 3VBVA 4AE6A 3KRJA 1R78A 4RWJA 3CTHA 3QQLA 5FDXA 3A62A 4G1WA 5EI2A 3ZRKA 3O5AA 3GQLA 4IWQA 2PUNA 2WPAA 4FT3A 4YJSA 1ZWSA 4H1JA 3KU2A 4KB8A 3FYKX 4J97A 4FZ6A 4GT3A 4LRMA 4FKWA 4BIBA 4C2WA 4EHEA 4IB3A 2R3NA 4AXFA 2R64A 2OZAA 4O4BB 4D2RA 4O6LA 4PMMA 4QQTA 3TV4A 5T6KA 2WEVA 2EXCX 3LMHA 3RCJA 2R3JA 2X0GA 2HY0A 4L6QA 5CAPA 5HX6A 4TW9A 2GHLA 3PA5A 2VWIA 1AD5A 4H3PA 4NCTC 5BVNA 4GK2A 3AC5A 3Q4CA 4HCVA 3W10A 2EU9A 1IASA 3QTRA 4IQ6A 4BKYA 5HTBA 5CQWA 1ZMUA 1IAJA 1W82A 4TRLA 2FUMA 5HOAA 3SXRA 3R04A 3KA0A 3LVPA 3FZRA 4GCJA 4YLKA 4GT4A 4D28A 3V6SA 2OK1A 5KMMA 4AW1A 4ZMFA 5AUYA 4ZZMA 2DYLA 4J8MA 3TYKA 1Y6BA 4FT0A 4FT9A 2X7FA 3PJ2A 1PYXA 1RQQA 2J5EA 2GNHA 2OKRA 3C4CA 4JG7A 4U0IA 1TVOA 5AMNA 4DG2E 3ID6C 2XM9A 3DV3A 1GIJA 1TQPA 4RJ8A 2R7BA 2Y4IC 3UYTA 3G9NA 2OIBA 3F5GA 3FL4A 2GCDA 4WKQA 5H3QA 3PFYA 2PE2A 3PWYA 1FVTA 3E63A 2VX1A 3P79A 4YSMA 3OUNB 4WIHA 4HGEA 4BBEA 4LOQA 4RWLA 5JMSA 4BDAA 5JZNA 4W9WA 4X3FA 4FV3A 1M7QA 4CFWA 5FXQA 3UO6A 4BYIA 4DDIA 4QYGA 4XS2A 1KE8A 2YDJA 4E5AX 3OTVA 4M67A 4RX8A 4ZOGA 2BFYA 4QP6A 3RK7A 1S9JA 3BBTB 4L44A 2NRUA 4F9AA 1CTPE 3QRJA 3UOLA 5T3QA 2C0OA 3MI9A 1LP4A 5A9UA 4QDEA 2UW7A 4YBJA 3OWKA 4Y72A 4RFYA 4Z16A 3CTQA 1JSTA 4QNYA 4BBMA 3UJGA 3GC7A 1PF8A 4O0RA 4U81A 4YJQA 1BYGA 1IRKA 2BHEA 3R9DA 1J7IA 2R3PA 5CF5A 2YABA 2FSLX 4NEUA 4DH8A 5FP6A 3RAWA 2IVUA 5K4IA 4O0XA 4G5JA 5ANDA 3DK6A 3Q9YA 3C7QA 4TNDA 2G2HA 3EFWA 3COIA 5EDQA 4CFNA 5IKWA 3C0HA 4YTCA 4PDPA 1U59A 2QLUA 3LE6A 3MY0A 3QQHA 3VJNA 3R71A 5FP5A 5AX9A 5GINE 4G6OA 5DRDA 2HELA 1QCFA 2A98A 5AIKA 3VUHA 1MP8A 1O6LA 4UN0C 4AZTA 1Q4LA 5J9LA 4CGAA 2C5XA 2WMAA 2HWOA 4I6BA 4AGUA 5HD4A 4FG7A 3UVRA 4YTFA 2HCKA 2LAVA 5AAGA 5KKRB 1JBPE 4IX3A 1CSNA 2X9FA 5AP2A 5IQGA 3QL8A 2VGOA 2GNJA 2WTJA 3F69A 3H3CA 4I22A 4IM0A 4DHFA 4YZMA 2HXLA 5A6NA 2OGVA 5EW3A 3WF5A 5TOZA 2QU5A 3AMBA 4BCFA 1UA2A 3TZ9A 4ZSAA 3PXZA 4CMUA 3WYYA 2GFCA 2O2UA 3EQGA 4O2PA 2IWIA 4LM5A 4ZTSA 5BVKA 3TIYA 1TQMA 2UUEA 4HJOA 3TXOA 4P90A 4DINA 4FUXA 5CX9A 2IO6A 3ZH8A 3VAPA 3OBJA 3HVCA 3UTOA 1T45A 1M2PA 2VTSA 4OBOA 4WNPA 2V7OA 5F95A 3VC4A 3HV6A 5M53A 3LMGA 2W1FA 4FSNA 1PMUA 4W4WA 4FKSA 2B53A 2PSQA 4FIHA 4PP9A 3ZU7A 3MB7A 2UW9A 3EKKA 3BX5A 4FOBA 2VNYA 4MD9E 4FEVA 4DA5A 3BYUA 5HVJA 5LVOA 4C35A 2OXXA 3VJOA 2X4ZA 3U6IA 3EQFA 3IOPA 5E7RA 5AP4A 4BZOA 5HIBA 4KIPA 1JSUA 3HAVA 3ZDUA 3QAME 5D11A 4UZDA 2PUIA 4FBXA 1O9UA 3A4PA 4KSQA 3UO4A 3ZUTA 3UE4A 4QMUA 4RIYB 3VULA 4OTRA 4ZJVA 2YM7A 1P4FA 3FHIA 4FZDB 5CF8A 4XCUA 1JPAA 5EYDA 3MJ2A 2QVSE 1PXKA 4GT5A 4EH6A 1PXJA 4D4RA 4FRFA 5A4CA 4EK6A 3BV3A 4GUEA 1ZARA 5FTGA 3U4WA 4DLIA 4PTCA 1MQ4A 3IW6A 3OT8A 4JI9A 2KTYA 4QPAA 3PXYA 5FRIA 5BNJA 2NP8A 3W0PA 4DEAA 3ZBFA 4FZAB 3UIBA 4AOIA 3MPAA 4X0MA 5CANA 3KCKA 2IN6A 4M84A 2XP2A 5HCYA 1SNXA 1XH8A 3NEWA 1UKIA 4XP0A 3ZLWA 4P2KA 2YIRA 3I5ZA 5J5TA 5EQPA 4F7JA 2Z8CA 1OITA 4QPSA 3LJ0A 3KMWA 4RBLA 3GNIB 2A2AA 4G6NA 3AT2A 1P5EA 1PXMA 2YLFA 5C8NA 3IGGA 3LFAA 2GPHA 5J7HA 3DNEA 4KIKA 3R7GA 4O7VA 5KO1A 3I1AA 4G17A 2QLQA 3DQXA 4TYHB 3ZDIA 5KMJA 4TYIA 3SW7A 4OTHA 3R7EA 4HVGA 4ALWA 4I1ZA 3LFFA 4JG8A 3BL7A 1JKSA 4P4CA 3MS9A 2IJMA 3DBDA 4GL9A 4QEBA 3DGKA 4UMUA 1YHWA 5J9ZA 4D9UA 3LFDA 2BVAA 4NIFB 1ST4A 2JKQA 4H3QA 4ZXTA 3BLQA 3ZUUA 4MTAA 3SC1A 3BRBA 3QUDA 1M52A 5C8MA 4WA9A 3CSVA 1PXOA 4AN9A 3ULIA 4IZAA 5DR9A 3ZHPC 3I60A 2VTIA 4WNMA 3DBCA 4NM5A 3F5XA 4OTPA 3WF8A 5CU0A 3A4OX 4X2JA 1UNHA 3WI6A 4UXLA 1TZDA 3DZQA 2X4FA 4L00A 1YI4A 2OSCA 4FTTA 2I0EA 3O23A 5JK3A 4BDFA 4XRLA 2J6MA 3CCNA 3ZEWA 4KKGA 3P0MA 4R1YA 2GQSA 4RLKA 2GNFA 3LAUA 3LXLA 3DJ6A 1WMKA 4IZYA 3TKUA 3QRIA 1YI3A 5DFPA 5JH6A 5AA8A 4BDDA 4D4YA 4CXAA 3F82A 3MYGA 4LRKA 4HVIA 2O0UA 4NSTA 3C5IA 4CG9A 2B0QA 5AM6A 5JGDA 3DB8A 3ORPA 1O6KA 1SZMA 5F1ZA 5HO6A 4JS8A 3W2CA 1OPJA 3WIGA 4PDSA 3RKBA 2ERKA 3Q5ZA 3ZSGA 3NYXA 2X8EA 1QPCA 1UWHA 5EM5A 4A07A 4I6QA 2RGPA 4EQUA 1Q97A 2V22A 3OVVA 3S95A 4FG9A 5JRSA 1BL6A 1O6YA 2R0IA 4FKJA 4C4HA 4KWPA 3TTJA 1IR3A 3P7CA 3Q9WA 4GKHA 3BHUA 1YOLA 3E8DA 4ANQA 4CSVA 2E9VA 4YJRA 3BE9A 4DGLC 3MV5A 4EI4A 5H8BA 4F99A 1DAYA 5EW9A 3GCUA 3U4UA 3RAHA 3WF9A 5JFWA 3P08A 5EW8A 1WBVA 4L7FA 2BTRA 3EQDA 4I5HA 3TTIA 4IXPA 5TT7A 1H1RA 2ZJWA 4QQ5A 2HZNA 2W7XA 3E8EA 3QTZA 3LCDA 3DZOA 3KK8A 5ANJA 3MJ1A 3E62A 3KK9A 4E1ZA 2O5KA 3HYHA 3V5TA 2PVNA 2Y4PA 2WXVA 5E8UA 3R2YA 2X8DA 3JY0A 4YMJA 2WMRA 4D0WA 3GC8A 1KE5A 2OWBA 4PWNA 4EHZA 4AP7A 4RVKA 3SDJA 3DTWA 3HZTA 2X2KA 3VRZA 3QA8A 3ZC6A 3EYGA 3LCSA 3UIUA 4QQJA 4CLJA 2ONLC 4FL2A 3U54A 2VTPA 2BRMA 4TYHA 4AGWA 4O4FA 4X2GA 2EUFB 3ZSHA 3T3VA 1ZYDA 1ZOGA 3PRFA 4QTDA 1KOAA 4RFMA 3CJFA 4F0IA 2QOLA 2OH0E 5HE3A 4ACCA 4NZWB 1ZMWA 3A8WA 4F65A 1XKKA 2ZV7A 1TFFA 3PY0A 4N6ZA 5CY3A 3TEIA 4NIFA 2BRGA 3ODYX 4EH9A 3EYHA 4ZAUA 2P33A 3OY1A 4RIXB 4P7EA 1YHSA 3PZHA 2UW0A 3F2AA 5BVEA 4ASDA 4FZFB 3OF0A 3C4FA 3C50A 4FR4A 1PMVA 4QMMA 3LPBA 2OJ9A 4PUZA 4YC6A 4FTIA 4GFMA 4JRVA 4PPAA 2PVKA 4IW0A 4C3RA 3KC3A 5FEQA 3ORNA 1ZMVA 5ETAA 4ZY5A 4RA4A 4QMTA 2Q0NA 4IWDA 2ITNA 4IVCA 3WE8A 4P5ZA 4UX9A 4JAJA 3PVWA 3LXNA 5I9VA 2X81A 2BZHB 3QFVA 4GYIA 3SGCA 4QP3A 2H6DA 3NUSA 4FTMA 4V04A 4ACMA 5C4LA 1T46A 1JAMA 2IVTA 3VBQA 3NWWA 5LMBA 3MIAA 1H01A 3CQEA 1WAKA 4FTKA 5CYIA 2QONA 2X1NA 2C6IA 2ZYBA 4FKPA 3H0YA 3VHEA 2VX3A 2W1CA 3E7VA