2QO9A

Human epha3 kinase and juxtamembrane region, phosphorylated, amp-pnp bound
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
277
Chain Sequence
TVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 277
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qo9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qo9A01
4L67A 1YI4A 5E92A 5AAFA 4HYSA 4I22A 4IC7A 5JQ5A 2XJ1A 5LWNA 2W5BA 4FSRA 2C6MA 2J0IA 4IM2A 4CLIA 3TV4A 3ZZEA 1YVJA 3KXNA 4PTGA 4CCBA 4KSPA 4YBKA 2XKDA 3QQKA 1J3HA 5BMMA 5JGBA 2IZSA 4M69B 4DH7A 1V1KA 5D10A 4RZVA 3DPKA 5FBOA 4NTTA 5A4QA 2VWZA 1J1CA 2XK9A 3FKLA 3H3CA 4IB0A 2BCJA 4IXPA 3LVPA 3PJ8A 2QQ7A 2WGJA 1SNUA 3RK7A 3MYGA 4DH3A 3A7HA 2V7AA 4ZZOA 4I6QA 1OIRA 3OW4A 4DEEA 3TNIA 3F69A 2XUUA 3CPBA 4DEDA 3A8WA 5DEWA 4E26A 1Q24A 4ASDA 1UWHA 3DJ5A 3JVRA 5DRBA 3R9DA 3CQWA 4GJ3A 2FGIA 2P2IA 3OTVA 3Q6WA 1RQQA 3PP1A 4XRLA 2WTKB 1WFCA 3CS9A 4MBLA 4NSTA 4QYEA 4XUFA 3TWJA 4FTQA 3DS6A 5JGDA 5C8MA 4JQEA 3UNZA 1URCA 4HGEA 4WBBB 2RG6A 2REIA 4WSQA 2YHVA 2GFCA 4CMUA 4WG4A 4ACMA 4FKLA 1OMWA 2ERZE 3KL8A 3UGCA 3EL8A 2B4SB 2R3LA 3V5QA 4BKZA 2PUUA 3SXRA 1KV2A 1X8BA 2BPMA 3QRIA 5C8NA 2PVRA 4AF3A 4ID7A 4L9IA 3E63A 5HG8A 3QTZA 4ZSGA 3RPSA 4K33A 3ORPA 1Q62A 3ATTA 3TT0A 3OOMA 4L46A 4W4WA 2CKQA 1KE9A 3EFLA 4AT3A 1J1BA 3FL4A 4MF1A 5LARA 4QYFA 3ZC6A 2FH9A 5HNIX 4J96A 4EOLA 5HBJA 3QZGA 2R3HA 4AT5A 4XP2A 4EZ5A 5AX9A 3IOKA 1H8FA 2OJ9A 3E8NA 5CTPA 2ZMDA 3M2WA 3IG7A 3WIGA 2VTHA 4EEVA 3BLQA 3NW5A 4BKYA 1IAHA 4IB3A 4YC6A 2UVYA 3A8XA 3MPTA 4AA0A 3FJQE 4RIYB 4QQ5A 4ANNA 3EL7A 4Y8DA 4EC9A 5AP2A 2YISA 4NYEA 2GNHA 3C13A 4ZXTA 5HU3A 4MTAA 1FVRA 2E2BA 2F7ZE 3O50A 3MGYA 3PRIA 3QXPA 2IZRA 1GNGA 4FKJA 1IAJA 2PULA 3WF9A 4RIOA 3SV0A 5KMKA 1H1SA 3JY0A 4N6YA 2PVKA 2GHGA 3FLYA 3HP2A 4FVPA 1IA8A 2B1PA 3BZ3A 3CTJA 4O6EA 3PWDA 4RJ7A 4KNBA 4PL3A 4WOVA 2Y4PA 3RM7A 3WILA 3P79A 4E6AA 5HLNA 2UW5A 4ZP5A 4YLJA 2XCKA 1UNGA 5KMIA 3TXOA 5CZIA 2QOOA 3D7ZA 5AJQA 2HELA 5EM6A 4FICA 5CQWA 3QWKA 3TCPA 1AQ1A 4XV1A 4EORA 3QTQA 4X3JA 2X7GA 5ANGA 5EI6A 3ZEPA 4HVDA 1W8CA 5AV4A 3MVHA 4H3QA 3ZUVA 3SXFA 2O65A 2BUJA 2GSFA 2WIHA 5HVKA 3MA3A 5I9VA 1FOTA 4FEUA 4JDKA 4A4OA 3G15A 3C1XA 3GU5A 2WMWA 5M4CA 1U5RA 3M1SA 3V3VA 2RIOA 3HMPA 2WTJA 5KKRB 3DFAA 5DFPA 3VBQA 3PJ3A 1WVYA 4H39A 3Q9XA 2OO8X 3HUCA 3R8UA 5LVNA 4EOKA 3D14A 4FIJA 5DI1A 2OICA 2WTCA 2W96B 1PRYA 1XBAA 4IAYA 4APCA 3TNHA 4A4LA 2Z8CA 4BCIA 4O7ZA 4X6RA 1K3AA 2W4OA 3PA5A 2BAQA 4C37A 3ORMA 3Q96A 4O27B 4RWLA 5KMMA 2BHEA 4QQJA 3R22A 2ZV7A 1P4OA 3VS1A 1URWA 4M84A 5KUPA 5FEEA 1UV5A 4F70A 2J0LA 5KNJA 2J90A 3KKVA 2WMRA 5KHXA 4EI4A 2UZWE 3T9IA 1LEWA 5CYIA 1Q3WA 4B8MA 5ACKA 3UC4A 2YIYA 3MIYA 2YLFA 5HESA 2PE2A 1YQJA 4NKSA 2PPQA 3SD0A 5GJFA 4QMXA 5IQHA 4YPSA 2J0JA 3QGWA 2QU5A 2XB7A 4QYHA 4C02A 2CNVA 4NK9A 3VJOA 3DCVA 3MB7A 4IZ7A 4RLLA 3R83A 5EKNA 3FC2A 3VBWA 4DEHA 4QTBA 4ZZNA 3VRZA 2VNYA 1S9IA 3GU8A 3QRTA 4LOQA 4WIHA 4LV5A 5E8SA 3CE3A 4MD8E 1OKYA 2GS2A 4NU1A 2R3FA 1F0QA 4HPUE 1XH8A 2PU8A 4F9YA 4JBQA 4YHTA 1UKHA 2QKWB 3ETAA 4WHZA 5EHYA 2VAGA 5L2QA 4W8DA 3K3IA 4DH1A 2V5QA 2W5HA 4BCJA 3PZHA 3R30A 4OBOA 1Q8YA 4Y46A 1R0EA 3LIJA 1WBPA 2V62A 3QGYA 1GIHA 2XM9A 3QQJA 3VUIA 5H8BA 4BCFA 4I5HA 4YJSA 3DJ7A 2QOHA 4GSBA 2ETKA 3ALOA 3EWHA 3LXKA 4TYJA 4QP1A 3C4ZA 3NEWA 3ZFMA 2JGZA 2VV9A 3E7VA 4BZNA 3GC7A 2JIIA 5IZFA 4WA9A 3HP5A 3FEGA 3TDWA 3R9RA 4O0UA 5HX6A 3KMMA 3WBLA 4RVTA 5CU2A 4H05A 2YCFA 3OXTA 4D9UA 2UZTA 2VU3A 4OTFA 2C5OA 3BQCA 1MQBA 3OUNB 1UNLA 4AGWA 3D15A 5CSPA 3O51A 3AMAA 1VEBA 1JKTA 3PVGA 3AC4A 1H1RA 3CQUA 1A9UA 3QWJA 3RJCA 2YERA 3MI9A 4CFUA 3IPHA 4O22A 3TUBA 5D9HA 4YURA 3AC2A 3MB6A 4F99A 4HYHA 2QKRA 3EQBA 4GVJA 4GW8A 1GZ8A 4DN5A 3DQXA 3VC4A 1NY3A 3VWAA 3A7JA 1BI7A 3E3BX 4DGNA 4XP3A 2WXVA 4AGDA 4BGGA 4F6SA 5KX8A 1ZOEA 2OK1A 3JUHA 4FGBA 4XP0A 2QOCA 4QP3A 5CT7A 2C1BA 3R28A 4GT4A 1O6KA 4L00A 1KUTA 5HHWA 3LJ1A 3H10A 2R5TA 1OPLA 4JNWA 1V0OA 3EFJA 2EU9A 2IW6A 1OECA 1JLUE 3N9XA 4YZ9A 4ZSLA 2OH0E 1E9HA 4IFCA 1R39A 5HTCA 3UZPA 3MFTA 3OWPA 1H01A 2PE1A 2XYUA 5LVMA 3TDVA 3UIBA 3RNIA 2YCRA 1BMKA 1H28A 3E93A 4FSUA 4OTWA 3FY2A 4UEUA 3CC6A 2QCSA 1QPJA 4KD1A 2C30A 4MQ1A 3U6IA 4LRKA 2NO3A 4Y85A 5E8VA 5FD2A 1F3MC 2VWYA 3EQPA 4PDOA 5KE0A 3HX4A 4BWKA 4CMOA 4FTNA 5EQEA 3KXMA 3LPBA 2XKFA 3UMXA 3AC1A 1Q8TA 3V8SA 1UU9A 1G5SA 5DOSA 3BGPA 4LG4A 4D4RA 1HCKA 4X21A 4Z55A 3HEGA 4RIXA 5BVKA 4KKEA 4XNEA 2X2KA 5FUTA 3A99A 2R3IA 3RP9A 3G5DA 2PY3A 4OTPA 4WRGA 5ANJA 3VULA 4CKIA 5FGKA 3ERKA 2GS6A 3OT8A 3PVWA 4IMYA 4QP7A 4R8QA 3UVPA 4QP9A 3L8SA 3OHTA 5I9ZA 4ZSEA 4U5JA 3KFAA 4RJ3A 4OBQA 3OC1A 3E64A 2OU7A 3F3UA 4MKCA 3Q9YA 4RA4A 5A6NA 4JX7A 3FQHA 4CFXA 2Y4IC 2CGVA 3AT3A 5M57A 3EQFA 5ANOA 2YACA 4O1PA 4U40A 3UYSA 5KCVA 4QNAA 3R04A 3RTPA 4CSVA 3FLZA 3LHJA 3Q9WA 3LLAA 4KIKA 4I5PA 5J1VA 1H08A 3ORNA 4CLJA 3ODZX 3RCJA 1ZOHA 3R71A 5M4FA 4V01A 2WQOA 4CNHA 3GCSA 3UC3A 2C0OA 3FMKA 3ZM4A 4C34A 3WYXA 4BDCA 4QMPA 4RIWB 3ZSGA 2QNJA 2X4FA 3BHTA 1M17A 4IAZA 3O8PA 3MTLA 1ZRZA 4O0XA 3OTUA 3RAKA 2X9EA 5AAGA 5EI8A 5HNBA 2X8IA 4DG3E 1KV1A 2PK9A 3MJ1A 4ITHA 5HG7A 1ZY4A 2C3LA 5H8GA 3TJDA 2VX1A 5J9ZA 4CTBA 4A07A 1GOLA 4HZRA 1ZOGA 3AT4A 2CHLA 3GP0A 4IVAA 4O91A 3T3VA 4EH7A 5HCYA 4UWCA 1YHVA 3VHKA 1JNKA 4D5HA 2OI4X 3R0TA 2UW8A 4BCKA 5GJDA 2BKKA 1Y6BA 4KKGA 2C3KA 4H3PA 2VTLA 4MAOA 2FSMX 4YZMA 4FKRA 3IDPA 1M2QA 2XKCA 3ZFXA 4D4SA 2XNGA 5E1EA 3QALE 3ZEWA 3FSFA 5IPJA 4NW5A 4M3QA 3G6HA 4ACHA 2WQEA 2IZTA 4H1JA 3DBEA 2QO2A 3BU5A 4YP8A 3EHAA 3L9MA 2XIKA 4ZJVA 3P7CA 2W1DA 3UG2A 2GMXA 2WB8A 3NUAA 3D7TB 4U8ZA 1U46A 4FG9A 4GKIA 2QI8A 2YM8A 1U5QA 4W4YA 3DKCA 4NL0A 3KXGA 5KMJA 2OXXA 1MQ4A 2UW7A 3VBYA 3I79A 1JKLA 5EHLA 4CYJA 5HQ0A 5FQDC 2X2LA 4FIFA 4FTRA 3VS0A 2ITXA 3HDMA 5C8KA 3W10A 1TKIA 3F2AA 4IQ6A 5CF6A 4RVMA 2PZYA 5HG5A 4E4NA 4RMZA 2OW3A 3MVLA 5FXQA 3CQEA 3G9LX 2X6DA 3MPAA 3A7FA 1BLXA 3GU7A 3EQCA 2DYLA 2ITVA 2X9FA 1GIIA 2QG7A 2W1GA 3R9OA 3COIA 1XQZA 2B7AA 3K3JA 3KULB 3WF6A 2VTNA 4DGGA 4IAAA 5AIRA 5AP6A 3GI3A 2YWVA 3I7BA 3N4UA 4ZTLA 1XH6A 3HRBA 1W83A 1MP8A 4K2RA 3NW6A 4HPTE 1YDRE 4AACA 2JAVA 1O9UA 4YO6A 5BNJA 4HZSA 1ZLTA 4RVKA 3OEZA 4ARKA 4AN2A 4ALWA 2Y4IB 3TNWA 3RPVA 4CKJA 5KBQA 1JKSA 3E88A 3IGGA 5EQPA 5IA5A 4YNEA 5HO8A 1H0WA 3NAXA 4CQEA 2RFEA 3FHIA 4H58A 4RJ5A 3R8MA 4XH6A 3DZOA 3FY0A 3NW7A 2X8DA 2YJSA 4X3FA 2QOBA 3KF4A 4R78A 3R7OA 5CI7A 4I0SA 5CSWA 4I6HA 1VZOA 4DEIA 4IC8A 4HW7A 2UW4A 5I3RA 1B6CB 4KS8A 1OIYA 2W4KA 4TKSA 5JRSA 5T68A 3S1HA 4IB5A 2GNFA 2Y9QA 2HENA 2QOIA 2W05A 3Q4UA 5L8JA 4YZCA 3BU3A 3BYMA 2B53A 4DEBA 2JIVA 4F65A 4MBJA 3BHVA 5AUXA 1OL6A 3Q5IA 3IW7A 3OXZA 2VO0A 3D9VA 3HV4A 3QXOA 3Q3BA 3QX4A 4KABA 4L45A 3CP9A 4DFXE 3VVHA 5HIBA 3U55A 2YEXA 3TTJA 5I4NA 4FR4A 1MUOA 4YHFA 2CLQA 3P7BA 3MFSA 5A14A 2XNEA 2B9FA 2PZ5A 3BRBA 1NT2A 4WO5A 4GCJA 1YDSE 2XIXA 5FG8A 4R1YA 1R1WA 3NRMA 3NYXA 2F9GA 2JAMA 3V5LA 3DNEA 1ZWSA 3NCZA 5IKWA 4F64A 2C1AA 4FG8A 2C47A 5FBNC 3FUPA 3FMJA 3GQIA 3LLTA 2B9HA 3G51A 3EYHA 2W1CA 3L8XA 3PSDA 3FLSA 1GAGA 2QO9A 4PF4A 1O6YA 3OUKA 4XV3A 4YMJA 5AAEA 4PNKA 3RAIA 2UUEA 2OJGA 5ITAA 4KIPA 3ITZA 3PG3A 3T3UA 1PXMA 1UU3A 4FZFB 3PWYA 4AW0A 4K8AA 2GTMA 5AUUA 2Z7QA 4O82A 3BU6A 5TF9A 2W5AA 3IO7A 4FIHA 3R1QA 2VWXA 4L6QA 4C7TA 3L8VA 1QPCA 5AP5A 4L7FA 2X0GA 1M7NA 3IKAA 2XH5A 5HE1A 4Q5EA 5LJJA 3QTIA 4O7LA 2RFNA 4FTCA 4QMWA 5F20A 4ASZA 1Q5KA 1PMUA 5FM2A 2YCQA 3I4BA 3DXNA 2HY0A 3CJFA 3GCQA 4QMZA 3ULIA 4EQMA 1YKRA 5L2SA 4IE9A 4DFNA 3Q52A 3PLSA 3C50A 3GT8A 3KCKA 3UP7A 4ENXA 4ENYA 3WF7A 4AZEA 4NJ3A 2WFYA 4F7LA 2ZOQA 5F1ZA 2BRBA 3VS3A 3QUEA 4EYMA 2XM8A 4FEQA 3UQFA 3H9FA 4ZSAA 1H1PA 5ETIA 3PDTA 3UE4A 3GENA 5CNOA 1WAKA 2A2AA 3U4WA 5I5ZA 3UQCA 4X2KA 3UO5A 3D4QA 4C3RA 2WQBA 3V5JA 4WT6A 2YAKA 1JQHA 3UG1A 4RGJA 1IG1A 4F7NA 4AP7A 3EIDA 3FMEA 4PMTA 3RM6A 2OG8A 5E8XA 4DCEA 2VGOA 2F2CB 2W1ZA 3RCDA 3I0OA 1FVTA 4O21A 4TYHB 4EHEA 4DF3A 3EYGA 5M4UA 2RFDA 5EW8A 2GPHA 3FLWA 5E91A 3ZSHA 4II5A 2RFSA 4WBOA 4Q2AA 3EFKA 3QU0A 4IWPA 5AUZA 3NMUF 4KINA 1RDQE 4ZTRA 2EB2A 1Q97A 3QCYA 3BWJA 3R2YA 3I81A 2UZBA 5KMOA 5J87A 4KUJA 1ZYSA 2ZV8A 4RJ8A 5AP7A 3WZUA 2ZB1A 4MVFA 1GIJA 4ZAUA 4ZZMA 5IA1A 4O7WA 3NUNA 2ITQA 3C4XA 2C3IB 3CBLA 4M66A 4QOXA 4DA5A 1Y57A 3DJ6A 5CZHA 2BDWA 5HG9A 3F82A 3KREA 4FV1A 4QPSA 4JXFA 3RWPA 2XK7A 1U59A 3LCKA 4FTAA 5EK7A 1OITA 3BELA 2WU7A 4IZ5A 5CSXA 2PWLA 3FL5A 4JS8A 5BX0A 5KBRA 4HCUA 2I0HA 2OIDA 3PXQA 3F3TA 4JAJA 2Z7SA 3I7CA 5CEMA 3C7QA 3PVBA 5C03A 3PY1A 4FSMA 3QQUA 3B8RA 3H9RA 3EJ1A 4AWIA 4YLLA 4BBMA 3QZFA 4C3FA 5LWMA 4UB7A 4WRSA 3R8LA 5HBEA 5M44A 4BDBA 3NNVA 1CM8A 3KRWA 2UW6A 3EN9A 1O6LA 4IEBA 4RFZA 3T8OA 4EKKA 2C5NA 1NVSA 1Y91A 4I4EA 4I92A 2VWBA 2ONLC 4R7HA 3REPA 4XG3A 4QTEA 3F88A 5IQAA 5JFWA 4RPVA 4E8AA 1OI9A 3F9NA 4R7IA 1UVRA 3BLHA 3WYYA 2BRHA 4OT6A 4O0TA 2J7TA 5LMBA 2ONLA 5JRQA 4NEUA 1XH5A 2ZAZA 3COKA 2DS1A 3ANQA 4GU6A 3WZKA 5CLPA 3PIYA 2GTNA 2VO6A 3FYKX 3VF9A 2GNLA 3DK7A 4MXAA 4JQ8A 5FLFA 5A54A 4PP7A 2ITWA 3ACJA 2Q0NA 2QVSE 1Z57A 4KRCA 3BGQA 3DLSA 3F5XA 4M68A 4YJOA 4F9BA 3WOWA 3DV3A 4MF0A 4DG2E 1WMKA 1SVGA 1SYKA 4NWMA 5EM8A 3P7AA 4OTHA 5IMXA 3AGMA 4FOCA 3U9CA 5ANEA 4APPA 2QHNA 3LW0A 4FKVA 4QTDA 2Y0AA 1PKGA 5GZAA 1Q8ZA 3V5PA 4LL0A 4RWIA 3D5WA 2O8YA 4FVQA 4L42A 4YJQA 3KMWA 4ASXA 3LJ2A 5DT4A 5AR4A 3LCSA 3ATSA 2ZV9A 1YW2A 4RIYA 4ALUA 3F2NA 4DFZE 3D0EA 4NTSA 2WTWA 4GKHA 3I1AA 2YCSA 4D4YA 1LUFA 1NA7A 3OT3A 4EZ7A 4YJVA 3BE2A 3UIXA 5JZNA 4LOOA 1B38A 3Q4CA 2XNBA 4XBUA 3RZFA 3G2FA 4UYNA 4AW5A 4N4SA 2PUPA 5C1QB 4E4LA 1ZYLA 2WOUA 5F9EA 2AUHA 2WQMA 2BROA 2VO7A 3HRCA 3PFQA 4PMMA 4B0GA 3EQGA 4I23A 3R8PA 3L1SA 4UXLA 2OZAA 3FPMA 2EUFB 3FZRA 4D0WA 3FHRA 4EH5A 3COHA 3D94A 3IONA 4NKAA 4TYGA 4BIDA 4DLIA 3LAUA 1OGUA 1FVVA 2B54A 2ACXA 4HCTA 4PWNA 3JS2A 5DR9A 5AV1A 4P4CA 4WNKA 4UWYA 1W0XC 3D5UA 3LFSA 4DTBA 3VUMA 4D5KA 2R3JA 3KRXA 3VUDA 4BC6A 5LXMA 4M8TA 4G2FA 1Q41A 4I41A 2DQ7X 2W9ZB 4MK0A 2YITA 3MVMA 2DUVA 4U0IA 5ICPA 4IFGA 4KSQA 3UDBA 3R2BA 4W8EA 4G3FA 5LCKA 1ZYJA 2WMTA 1NVQA 3QA0A 5CVFA 4L43A 2XRWA 5DGZA 3W8QA 5CAVA 4I5MA 5GIPE 3BV3A 3R1SA 5HNGA 4C4FA 3QCQA 2OIBA 2BZKB 3ID6C 4FUXA 3SRVB 3VW8A 4WNPA 3W2CA 3JR1A 3K54A 4BIBA 4C3PA 2XBJA 3ZDUA 5KO1A 2EVAA 4ZMFA 3Q5ZA 3TZ8A 4C62A 4CZTA 5IQIA 4KWPA 4C57A 5FXSA 4D2PA 4JBOA 1YOJA 2X2MA 3OWLA 2XRUA 3ZU7A 4TTHB 5BQ0A 2X6EA 3GU4A 4ZK5A 4A9TA 4CV8A 3QTWA 4QTCA 4XOYA 4ANBA 2CKPA 4JG6A 5BVNA 5CALA 4O96A 4XG7A 5HVJA 5F94A 4DEGA 2FYSA 5M08A 3GGFA 4IDVA 2BTSA 3JY9A 3QC9A 2CNQA 4C35A 4NFMA 5C4LA 5CASA 3NYNA 5CT0A 4MD9E 4AUAA 5K5NA 4XG9A 5EOBA 2HY81 4LL5A 3RALA 4BTJA 2HWOA 4XBRA 3ZO2A 5T6KA 5IG1A 2FO0A 2I1MA 4IB1A 4JG8A 4LI5A 3C51A 2WD1A 3EN7A 5F95A 3V8TA 3NSZA 3TV7A 4L3JA 3QFVA 5E1SA 1W98A 1CDKA 4TYEA 4KRDA 3OOGA 5HX8A 4X2FA 3F3VA 5HD4A 3HV7A 1UNHA 3GUBA 4RA5A 4U42A 3ZDIA 4O7SA 2VWIA 3K2LA 4D2TA 4L68A 4BCQA 5TOZA 1G3NA 5J7BA 4OAUC 1WBVA 1M14A 4CVAA 5E8YA 2XVDA 3DTCA 2VRXA 4DINA 5EFQA 4C8BA 4KBKA 4GUBA 4PTCA 3BIZA 3W1FA 4EL9A 2QU6A 3BEGA 2C0TA 2YAAA 1NVRA 2IWIA 2V7OA 2WQNA 3ELJA 3Q9ZA 2ETRA 4O7TA 4B8LA 2E9UA 3UIUA 5HO7A 3P0MA 3VBXA 1YHWA 2J6MA 2UZNA 4CT1A 5I9YA 4LV8A 2KULA 4J71A 2HOGA 3BX5A 3NYVA 3VJNA 3E8DA 3NPCA 4HVGA 5A9UA 4XOZA 4EK8A 2I7QA 3PRFA 4ZTQA 5KMLA 4HJOA 4ZTNA 4BZDA 4B9DA 1OL2A 5AP1A 4FV0A 2WMQA 3JYAA 3VHEA 4U80A 1JPAA 1BL7A 4MQ2A 5DBXA 3PUPA 2XIYA 1K9AA 5M55A 4DFBA 1PXNA 3BLRA 3PE1A 2PZPA 2FSLX 5K5XA 3DDQA 3IGOA 4IX5A 4S33A 1JVPP 2V22A 4G6OA 4MEDA 4EWQA 3AOXA 3QZIA 4BI2A 4BI0A 3WZDA 3ZRMA 4GL9A 2QHMA 1IA9A 3DKGA 3Q2MA 3ORZA 4GRBA 3QYZA 3QKKA 5CEKA 4EOSA 5JGAA 2UVXA 4UWBA 2ITUA 2WELA 3AG9A 3DTWA 4TW9A 5CXHA 5LCJA 2VNWA 3F66A 2AC5A 3RPRA 4MBIA 5HICA 5JFXA 4CRSA 5C26A 2I0EA 2GU8A 2ESMA 4QMUA 1J7IA 4TRLA 3ZHPC 3O7LD 2ERKA 2QOKA 1SNXA 2VTPA 2G01A 4PQNA 3R7UA 3S95A 4BTFA 3HAMA 4NCTA 3TN8A 3PJCA 3C0GA 3LZBA 3IECA 4OTGA 4O38A 2I6LA 4YLKA 5I9UA 5JFSA 3DA6A 3G0EA 3OVVA 3HMOA 2G2IA 5DPVA 3KA0A 5BUJA 2B55A 3OZ6A 1H24A 2NP8A 4F0FA 3UVQA 4BDDA 3SG8A 4BR3A 4HVIA 5DIAA 4MHAA 3V5TA 1CMKE 3G9NA 3BBTB 4EH3A 4RQVA 4CFVA 3HMMA 4RBLA 2IN6A 1VR2A 1YI3A 1ZYDA 3FLQA 2BZJA 3KK8A 3NLBA 3QKMA 2BIKB 5TE0A 3A4PA 2IW9A 3COMA 3QAME 4ANSA 5CVGA 2YIWA 1H26A 1PXOA 4L01A 3QUPA 3VS6A 4EBVA 5AEPA 4FV5A 3BEAA 2CSNA 2PVFA 4X6QC 5CEOA 3LFNA 4QP8A 2YIRA 4FIGA 3Q32A 4FMQA 5HVYA 5HE3A 3K5VA 3ZLYA 2VTRA 3HKOA 3JPVA 5HCZA 1P4FA 3FMMA 4AFJA 2C6IA 2PVMA 3L9PA 4FNZA 3DB6A 4UV0A 3W32A 4AS0A 4DFYA 3RI1A 4CMTA 4AQCA 2BDFA 2QC6A 4BHZA 3QBNA 4CYIA 2WOTA 3FI8A 5JT2A 4IM0A 3UPZA 3NNUA 4FODA 3FI3A 4S32A 2BFYA 2B9JA 2QONA 5CX9A 1AGWA 3PPZA 4FNXA 3HGKA 4IVCA 4OLIA 5K0KA 3TKIA 3KXXA 4XHKB 4RWKA 4IZAA 4X7QA 4CZUA 2PE0A 2ZJWA 3MN3A 4F9AA 5JQ8A 4O84A 5E8WA 1QCFA 3ZLSA 1R78A 4JLCA 1XHAA 5LVPA 3RINA 4CG9A 1GZNA 4GVAA 3RGFA 4DG0E 5DR2A 3ZMMA 4BCOA 5B0XA 2JDOA 2YDIA 1SM2A 4K77A 4E73A 1W84A 1ATPE 2G2HA 1LP4A 3DGKA 5AMNA 3DNDA 2CKOA 5IDNA 3AC3A 2XJ0A 4JT3A 4I6BA 5IA4A 4PY1A 4ASEA 4CZYB 3WARA 5BVWA 1IRKA 1H1QA 1PXJA 2QOLA 4P5ZA 4A9UA 2OF2A 4QQCA 2VTQA 4IVBA 3SXSA 3JVSA 4C4JA 3P23A 2Y6MA 4RC3A 3NIEA 2IZUA 3ZH8A 3FQEA 2O5KA 1OM1A 4FKOA 5EM5A 3MWUA 3HAVA 5DVRA 2BHHA 4DBXA 3V6RA 5DE2A 4FSNA 4UYAA 2GS7A 2P4IA 2EXMA 5K0XA 2XIZA 4O83A 4P5QA 3UTOA 3ZO3A 1JSVA 3I0QA 3DFCB 2GNJA 3NDMA 2CCIA 5IEXA 4FV3A 3VQUA 4DHFA 4D4VA 4R3PA 1OVEA 3DLZA 3GCVA 2GNGA 1GZKA 3P5KA 1ZXEA 5IU2A 3N4VA 2BVAA 1OL5A 2XNPA 3R7EA 3OCGA 1I44A 5ACBC 3S2PA 3AT2A 3AD5A 2HZIA 2HIWA 1I09A 3BHYA 5FP5A 4I94A 3NVKI 4GS6A 3LMIA 4IWOA 3W2RA 3TEIA 4OTDA 3SVVA 2BZIB 3GVUA 3FAAA 1ZARA 2V55A 3E8CA 4FKWA 4QNYA 3RNYA 2LAVA 5HD7A 4K6ZA 5IUIA 1WVWA 2HZ0A 4KIOA 4TWCA 5B2MA 3CTQA 2GNIA 4EQCA 3L9NA 2IVUA 3IOPA 1YHSA 4TT7A 1TQPA 5CVHA 3O23A 2WMXA 4EUTA 3ZTXA 4BI1A 4U81A 1CTPE 3KRJA 3MY5A 2Y7JA 5IDPA 3UOJA 2QD9A 2GQRA 4UZHA 4CCUA 4CTCA 5CEPA 3A2CA 3SC1A 4USEA 4AZWA 4CRLA 2P3GX 2JKOA 3CD3A 2C6EA 5EI2A 4KIQA 3MFRA 3HL7A 1J7UA 3QQGA 5J1WA 4GU9A 2CN8A 3D2KA 4RWJA 5DEYA 2OWBA 4QYGA 3KULA 3WF8A 5DMZA 5IMEA 1ZYCA 4AZTA 4BDAA 2WU6A 3Q53A 4U3YA 3HV5A 5BYLA 4ZTSA 4B6LA 3HVCA 3LMGA 3BYSA 4F6UA 3FMLA 4JDJA 4TWNA 5FXRA 1GY3A 3HV3A 3ZUTA 1SMHA 3SDJA 4AG8A 2XK6A 5M56A 5L2TA 4ZLOA 5CQUA 2VTIA 4MCVA 2DWBA 4RX8A 4C36A 3I6WA 4OTIA 1FGIA 3ZONA 3AMYA 3QD4A 4EH8A 3PA4A 4FKPA 5EDPA 2WEVA 4UALA 5DR6A 2HWPA 4MXOA 4XCUA 3LXLA 1OKZA 3PYYA 4RX9A 4E20A 2CLXA 3VNTA 4WNMA 1E1VA 4J97A 3TL8A 2XYNA 1FMKA 3KY2A 4QTAA 1YXUA 5CU3A 1WCCA 4YC3A 3R7YA 4R3CA 3NWWA 5IEYA 5CS6A 3LFFA 5GZ8A 2FSTX 4H3BA 2R0IA 5TO8A 2HK5A 3GCPA 3MV5A 4R5YA 1P5EA 3KCFA 4EH9A 1OIQA 4U6RA 3TZMA 2UVZA 5KHWA 4CG8A 4GFMA 5EYCA 4BVUA 4HGSA 4Y5QA 3MY1A 3H30A 4FZ7A 1OBDA 1ZZ2A 1PXPA 3AC5A 3VIDA 2VD5A 5ANDA 4YGAA 3D5VA 4KBAA 4TY1A 2PVLA 4MNEA 4DGMA 2F7EE 2QOQA 4AAAA 4B7TA 4GK3A 1B39A 3KEXA 3MDYA 4FTLA 4L7SA 3TM0A 5EOLA 4UXQA 3FMNA 2YZLA 4O0RA 5M06A 2XK8A 4I93A 4RQKA 1UKIA 5DRDA 2Q0BA 4RIXB 5BPYA 3ZO4A 2BR1A 4XV9A 3TIZA 4Z9LA 3GB2A 2PMLX 1OBGA 2R3GA 3SOAA 3NUXA 1DI9A 3IW8A 2OXYA 4BTMA 3BKBA 4EHVA 4RC2A 3A7GA 3ZO1A 4ONAA 1JSTA 3KXHA 1U54A 3UNKA 4GK4A 4C4IA 2BMCA 3I60A 3WI6A 3R1NA 1YI6A 5J79A 4CT2A 4HCVA 2QG5A 1YXSA 3NUPA 3WE8A 2VTSA 1KE5A 4BDHA 1GZOA 2SRCA 4X2JA 5J9LA 4CGAA 2VTOA 3V51A 2HZNA 4YR8A 2NNWB 4IWDA 4V0GA 3UPXA 1WBNA 1OIUA 5JSMA 4KIKB 1DI8A 4YTFA 4X3FC 3GU6A 1KE6A 2B0QA 1PHKA 3R8ZA 4D9TA 3HMNA 1J7LA 4ALVA 2VWWA 5A4CA 4AN9A 1WZYA 3MH1A 2X4ZA 4XX9A 3UMWA 2VO3A 4YBJA 4FT7A 5AR3A 2PZIA 5AV2A 4NM7A 3ZBXA 4AFEA 5EYMA 3Q04A 3TUCA 3O96A 4RSSA 4DGLC 3QX2A 1W7HA 4IZYA 1YXVA 3OFMA 4TXCA 3MS9A 3DU8A 2R3QA 2OSCA 4O81A 2EWAA 4IIRA 5LVOA 3DAKA 2C6OA 4USFA 3LCOA 3W16A 3UVRA 3TKHA 2CCHA 5A3XA 4PV0A 3AD4A 2QR8A 4U44A 4RFYA 4F7SA 5TR6A 5A4TA 2YM4A 3W2OA 4EZ3A 5FP6A 3F61A 4OBPA 3QL8A 2JBPA 4TYHA 5CSVA 2OIQA 5HE2A 4E5BA 4ZY5A 3DKOA 2CN5A 4ZY4A 2OFUA 3DKFA 1H0VA 3QRUA 4FZDB 4NH1A 5BUEA 4IANA 4PPAA 2XEZA 2WAJA 3H0ZA 2HXQA 3ANRA 4EWHA 2Z02A 1PY5A 2OJIA 3O17A 4RG0A 3R73A 2Z2WA 4BDJA 4A06A 2HCKA 1M7QA 2OZOA 5DT0A 5KZIA 1OUYA 5JFVA 3PXZA 2VTAA 2PTKA 2CKEA 3ZXTA 3HECA 3VUGA 1M2RA 4YJPA 1JAMA 5EG3A 5FTQA 4N0SA 2OLCA 2O2UA 4DT9A 3NZ0A 2HW6A 3UOKA 5TKDA 4OTQA 3GBZA 1EH4A 4FSQA 2J5EA 4NIFA 1DAWA 3AQVA 2W99B 4GYGA 3U6HA 4DH5A 4ITIA 1OUKA 3B2WA 4DT8A 3RHKA 4LRJA 3S3IA 4PDYA 1DAYA 2RGPA 4IBMA 3SAYA 3S00A 2HYYA 4A4XA 1P14A 2IO6A 1HOWA 3CXWA 4M12A 5IF1A 2WMAA 4HNFA 3DK3A 2CGXA 4EK6A 3MSSA 3C9WA 3QRJA 3QD3A 4FZ6A 4J98A 2C4GA 3FI4A 3IDBA 2A27A 4LGGA 3VS7A 3ZRLA 3ORTA 4C38A 4F1MA 1PYXA 5D11A 2PVHA 2OJFE 3ORKA 2NPQA 4HVSA 5AP4A 4RFMA 3G6GA 4ACDA 4IAFA 2PUNA 5EQYA 4Z7GA 2XBAA 4HYIA 4IJ9A 5HORA 1UWJA 4O1OA 4FEVA 3LQ8A 4FK6A 3NNWA 5IA2A 4BCNA 3CCNA 4M14A 2W7XA 3PIZA 3BGZA 3DXPA 4OR5A 3FDNA 3SGCA 2BFXA 1OZ1A 2VGPA 2X7FA 2YM3A 4HNIA 5AUYA 3RZBA 2IVTA 4BWPA 4QMNA 1NXKA 2J0KA 3QKLA 3HYHA 3TTIA 3BBWA 4FSTA 5FWKK 3PPKA 3OROA 5J5TA 1UU8A 2E9VA 3ZC5A 3CTHA 3OY3A 5IQFA 3ZOSA 4LMUA 2I0YA 3ACKA 5AADA 2CGUA 3OMVA 4UBAA 2Z7RA 3MH0A 4B4LA 4D58A 2F4JA 2JFMA 2O63A 4FL3A 4TYIA 4BCHA 4R7BA 5C27A 3OS3A 3CPCA 4JBPA 2QOFA 4FKTA 4M69A 5BMSA 1QPDA 5AFVA 3D2IA 2LGCA 2WZJA 4F1TA 4QMYA 4G3CA 4MXZA 5AV3A 2WTDA 4GG7A 1FBNA 2BAKA 4C58A 4WKQA 4BF2A 1TVOA 4MNFA 3TKUA 3PXYA 2VTJA 4G6LA 1YXTA 4K1BA 2JLDA 3R9NA 2QO7A 4M7IA 4K18A 2JDSA 4BYIA 2H6DA 2X1NA 3B8QA 3DY7A 3GFEA 3OW3A 1YWRA 2YM7A 1PMVA 4XG4A 3WZEA 1E1XA 2JKQA 3H4JA 4YJNA 4QQTA 2JKMA 3RHXA 4PL5A 1YXXA 2G9XA 5B7VA 3N4TA 5FTOA 4F9CA 5HLPA 1ND4A 4R1VA 3NUUA 3W2SA 4JDIA 3SX9A 3VBTA 1WBSA 4FA2A 4PMSA 4BDKA 4TNBA 4GFOA 4B99A 3MW1A 2C6LA 5IQDA 3O2MA 1A06A 1G8SA 2A1AB 3U51A 3NVMB 1DS5A 4G9RA 4OAVB 4JJRA 2VTTA 3RWQA 3NIZA 4LGDA 4AE9A 3DDPA 5E8TA 4Q9SA 3DBQA 3TIYA 1BYGA 3C4EA 4CD0A 4FVRA 4YTCA 5EW9A 3DAEA 3BPRA 4C0TA 5IUGA 3LCDA 5IQEA 2W1EA 3THBA 5C4KA 5KZ0A 4AZSA 1FQ1B 2F2UA 3PPJA 3LFQA 4FSYA 4LFIA 4DLJA 4HYUA 2J5FA 4J1RA 1APME 3EZRA 3CSVA 1Q99A 2YIQA 4BB4A 5JZJA 5IH5A 3F5UA 4R77A 3VW6A 2H96A 4LRMA 1H4LA 2C0IA 3T9TA 3GOKA 3MBLA 4F7JA 3DAJA 1PW2A 5JH6A 5GIOE 5KMNA 3GCUA 1XJDA 2GQGA 2X8EA 3BYVA 1KWPA 4BYJA 4V05A 4M0ZA 2CMWA 2WMSA 3RAHA 3U8WA 2BILB 3QQHA 4IX3A 2OGVA 5DHJA 4PTEA 5H9BA 4S31A 5FDXA 4AU8A 5FDPA 3HNGA 1ZZLA 4EJNA 4FKGA 4IDTA 5JMSA 1WBTA 1OB3A 2BZHB 4G16A 2WKMA 3H0YA 3ZYAA 4FTKA 4RLKA 4CFMA 3QCSA 5B2LA 3FQSA 3R63A 3LFEA 3QYWA 3NX8A 1LPUA 3ZBFA 1MRYA 4PDSA 1CKJA 3LKMA 3MPMA 4ZOGA 4YNOA 4E4MA 2P33A 4BBEA 4O0VA 4UMTA 3NR9A 3DQWA 2PVYA 4FZAB 5EM7A 4A9YA 1R3CA 2A0CX 3W55A 3FZTA 4NZWB 5M07A 2W0JA 4F6WA 1M2PA 2YJRA 3VUHA 4JR7A 3FMDA 4K0YA 4RC4A 4H1MA 4AGCA 4WD5A 1PF8A 1KE7A 1JWHA 2YWPA 3LFAA 2BRNA 4BCPA 4CXAA 5J95A 4DAWA 2VWVA 4XMOA 3ZFYA 1RE8A 4FT9A 5KKRC 4MXYA 4UN0C 4J53A 2E9PA 3MA6A 4Y5HA 5L3AA 4IH8A 5ETCA 3ALNA 3CJGA 4GH2A 4LOPA 2R64A 3FKOA 2RKUA 3IW6A 5CI6A 2AC3A 3C5UA 4FC0A 5FEQA 2QURA 3P9JA 1QL6A 4ZSJA 4XYFA 3PP0A 3PXFA 4IAIA 4NFNA 4KS7A 4W4VA 5CSHA 4C61A 2OF4A 5AV0A 5M09A 2WTIA 3VN9A 1Z9XA 5L8LA 5M4IA 2H34A 4FBXA 4ORKA 4RJ4A 4BDIA 1FINA 3LOKA 3OBJA 2GDOA 4G31A 4YSJA 2PUIA 4OUCA 1TQIA 2WMUA 3KC3A 4W9WA 4UX9A 5GINE 1A48A 1OKVA 5CAUA 3LJ0A 3P4KA 1PYEA 1Q61A 4M15A 2UZDA 3HLLA 4ZY6A 3ROCA 1L3RE 2NRYA 5I9XA 3GC9A 4DTKA 4KB8A 4GYIA 3E87A 2PVNA 2O64A 5BVEA 4C4GA 3EQDA 4IM3A 3QTSA 2C6TA 5A4LA 5E9EA 4RX5A 2BTRA 4DBNA 2EXEA 1WBWA 3U4UA 1ZMUA 4J8NA 2OKRA 2XJ2A 4XLVA 4ZS0A 5CEIA 4D1ZA 2GFSA 4O7YA 4Y73A 3EN4A 4MYGA 3IW4A 5HLWA 3TACA 4YTHA 5HO6A 5J9YA 1JBPE 1H1WA 2I0VA 3EMGA 4GT5A 5ETFA 4C33A 2QLUA 3R7VA 3TJCA 4I5CA 1H25A 4FF8A 4L3PA 3VS5A 2C5VA 4L53A 2V0DA 5BYZA 4EC8A 3GEQA 3CKWA 4JX3A 3PE2A 3VS4A 1GJOA 2ZDTA 4I3ZA 3VAPA 3BE9A 2C5YA 3CD8A 3ORIA 2YN8A 4J52A 3QD2B 5G1XA 2R3NA 4ANOA 3FZOA 3KRRA 3F7WA 5EKOA 4FV9A 4YPDA 2IVSA 3K5UA 4XLIA 2JC6A 3F3WA 5HBHA 4AZVA 3OBGA 5K4JA 4BY9E 4DFLA 3HUBA 4EK4A 2JD5A 3DBFA 5EDQA 3VS2A 1BL6A 4U45A 1S9JA 5AUVA 4W9XA 2P55A 3POOA 4P2KA 4U79A 4E7WA 1P2AA 5DYJA 4YUQA 3UQGA 1SVHA 4I0RA 4D0XA 2AYPA 2JDRA 2OZAB 1YOLA 3SQQA 3CKXA 3R21A 5D12A 4XG8A 3UYTA 4S34A 1BKXA 3QZHA 3BWFA 4FI1A 4M13A 2HAKA 4DH8A 3FE3A 4EJ7A 3OEFX 3QTUA 4O0WA 5AR5A 4I20A 3E62A 3PJ2A 4DITA 3ODYX 5A46A 5H2UA 1BX6A 4OTRA 4EK5A 3RBWA 3VUTA 1KOBA 2RF9A 3R02A 4JG7A 4D1SA 3D5XA 3RPOA 5AP3A 1OKWA 3GFWA 4HGLA 3PY3A 3Q6UA 3NNXA 3O71A 3U9NA 4QMQA 2JBOA 5D1JA 3Q2JA 2R3PA 4FEXA 3V5WA 3FXXA 2J51A 4D1XA 3GOPA 3IDCA 4QMTA 3O8TA 3EQRA 3L9LA 3OWKA 3FSKA 3TV6A 3RK9A 2E9OA 5AA8A 4G3DA 2WNTA 3R00A 3VBVA 5HTIA 3ZXZA 3B2TA 5FM3A 3RPYA 3ORXA 2UV2A 4FEWA 4G9CA 4AX8A 2FSOX 2UZVA 4IX4A 1KSWA 3CR0A 1T46A 4FNWA 5D7AA 3NS9A 3FI2A 3FPQA 2CPKE 2ZVAA 2G1TA 4BCMA 4YJTA 4NCTC 4NT4A 4FT3A 3S4QA 5I9WA 5J7HA 4G17A 1VJYA 4MXCA 4PNIA 2PL0A 2J4ZA 3UNJA 4C2WA 5D7VA 4Z7HA 1Y8YA 1PMEA 2PSQA 1JKKA 3UJGA 4JQ7A 2E9NA 4S2ZA 3F3ZA 3F5GA 1XO2B 2J50A 5C9CA 4BZOA 4DCAA 2H8HA 4K9YA 4QPAA 4LM5A 5FEDA 2G15A 3OG7A 3KRLA 4C59A 4CEGA 5L2IA 3E8EA 5LQFA 3C4FA 4C2VA 2X7OA 4JIKA 3PY0A 4FX3A 4EONA 5HI2A 4F0GA 4HVHA 4Z16A 2BIYA 3DK6A 2QODA 3PJ1A 4AXAA 3ZUUA 4BFMA 3LFCA 5CWZA 4FIIA 2YDKA 1RW8A 2RG5A 4YHJA 4OGRA 3C0IA 3G0FA 4GV1A 1Z5MA 2WHBA 4L3LA 3KXZA 4FSZA 1OL1A 4OT5A 3O0GA 4XV2A 4PDPA 4Y95A 3ZM9A 1HCLA 2R4BA 3AGLA 2PMNX 2F7XE 5CU4A 4D2WA 4A9RA 4AE6A 4NW6A 2UW9A 2XS0A 4I24A 3FZ1A 4K11A 3MH2A 4TNDA 3ZZWA 4ZS4A 5CXZA 4BIEA 3AC8A 3BI6A 3KMUA 3OY1A 2VUWA 2NRUA 2VX3A 2W9FB 4BL1A 1ZMVA 2RSVA 1W82A 3CLYA 4O0SA 1BUHA 5AR7A 5LVLA 4E6CA 2XNNA 3KU2A 3NUSA 4BKJA 1TQMA 3EB0A 5GNKA 2P0CA 4FSWA 4FV6A 4MH7A 4PP9A 4WG3A 5DLSA 4GJ2A 4GEOA 3AMBA 5AP0A 5JEBA 3F2RA 3AXWA 2BKZA 3QC4A 1STCE 2IJMA 5E7RA 3FBVA 2WTVA 3FWQA 4GFGA 4USDA 3POZA 4EOPA 4JIAA 3C5IA 3OWJA 5I0BA 2G2FA 2R7BA 4PUZA 4PMPA 3VF8A 4P90A 3A4OX 2BRMA 4BTKA 4QRCA 5CU0A 4LUDA 2B9IA 2PMOX 4F1OA 1XH4A 4QT1A 3PSCA 5HZNA 3PLAE 1ERKA 5FTGA 1XH7A 3NYOA 3VUKA 3PA3A 5AA9A 4G5PA 3M11A 4GT3A 4JRNA 4UMPA 3SW7A 2PYWA 2X39A 2GQSA 2GCDA 5H8EA 4E5AX 4RIWA 5HIDA 5BVFA 3LQ5A 4UZDA 5C01A 3UBDA 4BWXA 3UOHA 5JKGA 4E6QA 4DTAA 3L8PA 2W17A 2Y8OA 3KN5A 4Q5HA 4ANQA 4E5WA 3MJ2A 3QTXA 5CENA 4ERWA 4LUEA 2VTMA 5FRIA 4KKHA 1G8AA 1CSNA 3C4CA 3GC0A 4Y83A 4JBVA 2O3PA 3LXNA 3FLNC 4LMNA 4YC8A 5H3QA 4EK3A 2XF0A 4RRVA 3S0OA 1LEZA 4GUEA 3LFBA 4PL4A 3F6XA 3I5NA 3SW4A 3HRFA 4FUYA 3DOGA 3VQHA 2A4LA 3C4WA 5DH3A 3EQIA 2F49A 4DFUA 5AUWA 5K3YA 5BVDA 5EHOA 2W1IA 3MESA 2C68A 4QD6A 4KAOA 3OCBA 4A7CA 1LR4A 1PJKA 2R7IA 3P1AA 3HDNA 3KVXA 3W2QA 2Z60A 4AW2A 3U6JA 2YM6A 4NJDA 3EFWA 3TZ7A 4R5SA 4BDEA 2RL5A 4BCGA 2YLEA 5EYKA 4P7EA 3H9OA 4C4HA 3BCEA 1XWSA 1XBBA 3CGFA 3D7TA 4FT0A 5AIKA 4E4XA 3QF9A 4ACGA 4J95A 5AM7A 2ITYA 4FV8A 4XG2A 4O7RA 1QPEA 2W1FA 2UZOA 3QLFA 1YWNA 3M42A 2C69A 4FKSA 1IR3A 4RJ6A 4BDFA 2XK3A 4DE4A 5E8ZA 3PSBA 4LQMA 5IQCA 5DNRA 1PXLA 3SKCA 4E6DA 4F4PA 3I6UA 2JDTA 3TUDA 3MY0A 4RVLA 1BI8A 2IVVA 5K4IA 5IEVA 4G3GA 2OFVA 4O86A 4YJUA 4BN1A 4RT7A 1Q4LA 3CY3A 4E1ZA 4EOOA 4BBFA 3FMHA 3EKKA 3OCTA 5ANIA 2ITPA 4GIHA 4XS2A 4EOIA 4BICA 1VYZA 3F7ZA 3DB8A 4HGTA 4BRXA 4D2RA 2R9SA 4QMMA 5B2KA 3WE4A 1RJBA 3A62A 4UMRA 2OH4A 5A4EA 3R7GA 3G33A 4I0TA 2EB3A 3PXRA 1FGKA 1MRUA 4QP4A 1PKDA 2XMYA 2H9VA 2WMBA 3NGAA 3R01A 2UZUE 5F4NA 3QTRA 4G5JA 4HOKA 3ZRKA 3ZSIA 4M0YA 3UODA 3DBCA 1PXKA 4PPCA 1ZY5A 5AX3A 4XEYA 3ZLWA 4E3CA 1CKPA 3HV6A 2XKEA 5EYDA 1MRVA 1YDTE 4LGHA 1J91A 5AR2A 2P2HA 1SZMA 3KGAA 4IHPA 3RMFA 2R0UA 4ACCA 4JVGA 3ENHA 5DG5A 4XJ0A 1REJA 2R3KA 4MXXA 3TNPC 5A6OA 3HZTA 4RZWA 3VRYA 1FMOE 4U41A 5GJGA 3R7IA 4F0IA 2JEDA 3KVWA 2R3RA 4EUUA 3OP5A 4H36A 4EH2A 4AA5A 4RX7A 4TPTA 2IW8A 4L8MA 4O2PA 4FGRA 1Y8GA 4M97A 4O7NA 3ULZA 4UY9A 5L8KA 2VWUA 2PHKA 1ZMWA 4IADA 3QLGA 2FUMA 2HXLA 4XRJA 4EOQA 3ZS5A 4WG5A 4ZTMA 4ZJJA 2BAJA 4FYOA 2F57A 5M53A 4I4FA 4U7ZA 5CAPA 5CF8A 3KQ7A 4FTIA 3W8LA 3V01A 3ROYA 5K9IA 4AOJA 3LQ3A 5DN3A 3PVUA 1YRPA 4M67A 4W4XA 4EH6A 3SA0A 3II5A 3LXPA 3MFUA 3ZCLA 5TT7A 5L4QA 4IACA 4EQUA 2YABA 1QMZA 3LCTA 3CY2A 3NUYA 3CGOA 3QRKA 4ZEGA 3FYJX 3PG1A 3ZLXA 4U9AA 4NM5A 4F09A 3KK9A 4ZLYA 5IH4A 4IW0A 4FV4A 3KB7A 3DBDA 4EOMA 1NW1A 1YWVA 4G34A 2C3JA 2CNUA 2ZM3A 1OL7A 3R6XA 4L52A 4QP6A 1H07A 5DT3A 4FV2A 3PZEA 3ET7A 3PIXA 4N6ZA 1REKA 2UW0A 2YZAA 4YZNA 4YSMA 2OBJA 4D28A 3O8UA 2B52A 1YOMA 4ZTHA 5HTBA 2WEIA 4QMSA 4WUAA 5IUHA 3RVGA 2W1HA 3DXQA 4AOIA 3LM5A 2GHLA 3UZTA 2J9MA 2ETMA 2XNOA 4ANLA 2C6KA 3WF5A 5E8UA 5HU9A 4D2SA 4AW1A 4FT5A 3WZJA 3KF7A 5J5SA 2OJJA 5EW3A 2R3MA 2QR7A 4TZRA 4BGHA 2X81A 5AWMA 2JIUA 3G90X 4ITJA 2YA9A 4IWQA 4S30A 2CDZA 3UO6A 3GQLA 3E3PA 2BALA 5L6OA 4G3EA 3IW5A 1Y6AA 5GZ9A 4XG6A 3UOLA 4GG5A 3VO3A 4I21A 1FPUA 4ERKA 3Q4ZA 5CF5A 4JRVA 5JK3A 2UZLA 3IK3A 3A60A 4A9SA 4L44A 2JFLA 4GIIA 2KTYA 4MWIA 3SLSA 3FZSA 1WBOA 1Q3DA 2ITZA 4FTJA 5HEZA 4E93A 5E4HA 3MIAA 3JXWA 3U54A 1WVXA 2HW7A 2J2IB 4AOTA 2YFXA 2ZM4A 3EH9A 3EN5A 2O0UA 4EYJA 4MNEB 1Q8UA 3BHHA 1V0PA 3DZQA 4MX9A 5GHVA 3OF0A 5DA3A 2A19B 5T3QA 4J99A 1L8TA 2ITNA 2YIXA 3TG1A 4EOJA 3O7LB 4FTTA 2IPXA 1U4DA 1XR1A 1T45A 4N70A 4DGOA 3FKNA 3SOCA 5CAQA 4N57A 4FOBA 4KBCA 2J0MB 1XH9A 4U97A 3Q60A 3FV8A 4FK3A 4ZJIA 5HCXA 3BHUA 1R0PA 3OCSA 1DM2A 2Y6OA 4FTUA 4V04A 5AM6A 3TNQB 4R6VA 3UP2A 1K2PA 1JSUA 2BRGA 1CKIA 2UW3A 2ZV2A 3A7IA 3BQRA 3GNIB 4IVDA 1KE8A 3RK5A 4F63A 4O0YA 3BYUA 4QMLA 1U54B 3KN6A 4DYMA 2JDVA 3MH3A 2XZSA 4Z3VA 4EBWA 4D55A 3EZVA 3I5ZA 3PTGA 4FKUA 4QMOA 4NUSA 3V6SA 4DEAA 3R9HA 1Q8WA 4YO4A 3C0HA 3OXIA 3N51A 1XKKA 1M52A 2GHMA 4U3ZA 4F9WA 4CKRA 2UZEA 4CFNA 4YZBA 2R3OA 3V04A 1OPKA 4V0GB 5L6PA 2C5XA 5M51A 4QYYA 2CGWA 4FNYA 5CF4A 3D83A 5HE0A 2EXCX 2YDJA 1KOAA 4PPBA 5AR8A 2W4JA 4BGQA 1ZAOA 4AZFA 4YJRA 3GC8A 4QMVA 2ITTA 3EN6A 4TWPA 3P78A 4I6FA 4CFFA 3UO4A 1PMNA 2WPAA 1JOWB 5IA0A 5IQBA 2W06A 3NAYA 2WMVA 2FVDA 4FTOA 5L6WL 4TN6A 5AUTA 2ZDUA 3QHWA 4UMUA 4X3FB 3QQFA 2FA2A 5LMKC 5CAOA 3E7OA 4X0MA 5J8IA 4AT4A 4JR3A 1H27A 3IQ7A 3RKBA 4JDHA 1AD5A 5CU6A 5HGIA 2Z7LA 4O2ZA 4AA4A 5LMAA 3ENMA 2ZMCA 3MVJA 4YTIA 4X2NA 2WO6A 4MD7E 4LYNA 4YU2A 2XNMA 4U43A 5LMKA 3LFDA 2XCHA 3U87A 4NM0A 2XK4A 3FZPA 2XA4A 4FYNA 1SVEA 4QPMA 4BDGA 4WUNA 4O7VA 4R3RA 1PXIA 2ITOA 3QD0A 5L2WA 4AN3A 4I1ZA 3TI1A 2PMIA 5HIEA 4O6LA 4PRJA 3ORLA 1F5QA 3NCGA 3Q4TA 5ETAA 4Q9ZA 3P08A 3SG9A 3UZRA 5CNNA 4FIEA 4JAIA 2HZ4A 2ZYBA 3QA8A 3SHEA 3BYOA 5EH0A 3WIKA 4PX6A 5BUIA 1XBCA 5D41A 3R1YA 4F08A 3V8WA 5BYYA 4QP2A 5JN2A 3AD6A 5HOAA 4IJPA 2WTKC 3GXLA 2VN9A 3W18A 4BHNA 2BDJA 4WSYA 4JL9A 2VZ6A 2Q83A 3E92A 4J8MA 3F5PA 3PXKA 4FL2A 3IS5A 4WNOA 4FE2A 4JOAA 4FV7A 4CV9A 4ZIMA 2I40A 2CJMA 4JI9A 3QUDA 4D2VA 2C6DA 2PZRA 4G6NA 3CIKA 2QLQA 3TZ9A 4C4EA 5LOHA 5IH6A 3EKNA 2PVJA 2XIRA 3P86A 3QCXA 4GMYA 4NIFB 5CEQA 2XEYA 5IISA 1IASA 3W2PA 4OW8A 2ZM1A 4FL1A 1IEPA 1V0BA 5E90A 4CFWA 3OD6X 3EOCA 4YZDA 5EDRA 2WIPA 1UA2A 3E5AA 4ZLZA 4FKQA 5BVOA 4EHZA 5I3OA 2JITA 3W33A 4FKIA 2JKKA 4TWOA 5HKMA 4AGUA 3HMIA 3MTFA 2IG7A 5CY3A 2VX0A 4GK2A 4ZMEA 1H00A 4EH4A 3LE6A 3R8VA 4NM3A 3CEKA 3SRVA 4EHGA 3EQHA 3HA8A 4FTMA 1OPJA 4IAKA 4DC2A 5ANKA 5G6VA 3LM0A 1UU7A 4G1WA 4Y72A 4ANMA 4J7BA 4CQGA 2R2PA 4IX6A 2YM5A 4FG7A 3QQLA 4KA3A 4X2GA 3UIMA 2XP2A 3QHRA 5CANA 5IA3A 3FC1X 3FXZA 3HA6A 4EKLA 4UMQA 5DWRA 5IQGA 3BV2A 4MWHA 2FB8A 3DT1A 4TL0A 1VYWA 2OXDA 3A61A 2ZB0A 3FXWA 3RAWA 4QO9A 3LMHA
chains in the Genus database with same CATH superfamily
4L67A 1YI4A 5E92A 5AAFA 4HYSA 4I22A 4IC7A 5JQ5A 2XJ1A 5LWNA 2W5BA 4FSRA 4F78A 2C6MA 2J0IA 4IM2A 4CLIA 3TV4A 3ZZEA 1YVJA 3KXNA 4PTGA 4CCBA 4KSPA 4YBKA 2XKDA 3QQKA 1J3HA 5BMMA 5JGBA 2IZSA 4M69B 4DH7A 4BJJA 1V1KA 5D10A 4RZVA 3DPKA 5FBOA 4NTTA 5A4QA 2VWZA 1J1CA 2XK9A 3FKLA 3H3CA 4IB0A 4AXEA 2BCJA 4IXPA 3LVPA 3PJ8A 2QQ7A 2WGJA 1SNUA 3RK7A 3MYGA 4DH3A 3A7HA 2V7AA 4ZZOA 4I6QA 1OIRA 3OW4A 4DEEA 3TNIA 3F69A 2XUUA 3CPBA 4DEDA 3A8WA 5DEWA 4E26A 1Q24A 4ASDA 1UWHA 3DJ5A 3JVRA 5DRBA 3R9DA 3CQWA 4GJ3A 2FGIA 2P2IA 3OTVA 3Q6WA 1RQQA 3PP1A 4XRLA 2WTKB 1WFCA 3CS9A 4MBLA 4NSTA 4QYEA 4XUFA 3TWJA 4FTQA 3DS6A 5JGDA 5C8MA 4JQEA 3UNZA 1URCA 4HGEA 4WBBB 2RG6A 2REIA 4WSQA 2YHVA 2GFCA 4CMUA 4WG4A 4ACMA 4FKLA 1OMWA 2ERZE 3KL8A 3UGCA 3EL8A 2B4SB 2R3LA 3V5QA 4BKZA 2PUUA 3SXRA 1KV2A 1X8BA 2BPMA 3QRIA 4O4CA 5C8NA 2PVRA 4AF3A 4ID7A 4L9IA 3E63A 5HG8A 3QTZA 4ZSGA 3RPSA 3TYKA 4K33A 3ORPA 1Q62A 3ATTA 3TT0A 3OOMA 4L46A 4W4WA 2CKQA 1KE9A 3EFLA 4AT3A 1J1BA 3FL4A 4MF1A 5LARA 4QYFA 3ZC6A 2FH9A 5HNIX 4O4FA 4J96A 4EOLA 5HBJA 3QZGA 3UDZA 2R3HA 4AT5A 4XP2A 4EZ5A 5AX9A 3IOKA 1H8FA 2OJ9A 3E8NA 5CTPA 2ZMDA 3M2WA 3IG7A 3WIGA 2VTHA 4EEVA 3BLQA 3NW5A 4BKYA 1IAHA 4IB3A 4YC6A 2UVYA 3A8XA 3MPTA 4AA0A 3FJQE 4RIYB 4QQ5A 4ANNA 3EL7A 4Y8DA 4EC9A 5AP2A 2YISA 4NYEA 2GNHA 3C13A 4ZXTA 5HU3A 4MTAA 1FVRA 2E2BA 2F7ZE 3O50A 3MGYA 3PRIA 3QXPA 2IZRA 1GNGA 4FKJA 1IAJA 2PULA 3WF9A 3NFFB 4RIOA 3SV0A 5KMKA 1H1SA 3JY0A 4N6YA 2PVKA 2GHGA 3FLYA 3HP2A 4FVPA 1IA8A 2B1PA 3BZ3A 3CTJA 4O6EA 3PWDA 4RJ7A 4KNBA 4PL3A 4WOVA 2Y4PA 3RM7A 3WILA 3P79A 4E6AA 5HLNA 2UW5A 4ZP5A 2XAOA 4YLJA 2XCKA 1UNGA 5KMIA 3TXOA 5CZIA 2QOOA 3D7ZA 5AJQA 2HELA 5EM6A 4FICA 5CQWA 3QWKA 3TCPA 1AQ1A 4XV1A 4EORA 3QTQA 4X3JA 2X7GA 5ANGA 5EI6A 3ZEPA 4HVDA 1W8CA 5AV4A 3MVHA 4H3QA 3ZUVA 3SXFA 2O65A 2BUJA 2GSFA 2WIHA 5HVKA 3MA3A 5I9VA 1FOTA 4FEUA 4JDKA 4A4OA 3G15A 3C1XA 3GU5A 2WMWA 5M4CA 1U5RA 3M1SA 3V3VA 2RIOA 3HMPA 2WTJA 5KKRB 3DFAA 5DFPA 3VBQA 3PJ3A 1WVYA 4H39A 3Q9XA 2OO8X 3HUCA 3R8UA 5LVNA 4EOKA 3D14A 4FIJA 5DI1A 2OICA 2WTCA 2W96B 1PRYA 1XBAA 4IAYA 4APCA 3TNHA 4A4LA 2Z8CA 4BCIA 4O7ZA 4X6RA 1K3AA 2W4OA 3PA5A 2BAQA 4C37A 3ORMA 3Q96A 4O27B 4RWLA 5KMMA 2BHEA 4QQJA 3R22A 2ZV7A 1P4OA 3VS1A 1URWA 4M84A 5KUPA 5FEEA 1UV5A 4F70A 2J0LA 5KNJA 2J90A 3KKVA 2WMRA 5KHXA 4EI4A 2UZWE 3T9IA 3UDTA 1LEWA 5CYIA 1Q3WA 4B8MA 5ACKA 3UC4A 2YIYA 3MIYA 2YLFA 5HESA 2PE2A 1YQJA 4NKSA 2PPQA 3SD0A 5GJFA 4QMXA 5IQHA 4YPSA 2J0JA 3QGWA 2QU5A 2XB7A 4QYHA 4C02A 2CNVA 4NK9A 3VJOA 3DCVA 3MB7A 4IZ7A 4RLLA 3R83A 5EKNA 3FC2A 3VBWA 4DEHA 4QTBA 4ZZNA 3VRZA 2VNYA 1S9IA 3GU8A 3QRTA 4LOQA 4WIHA 4LV5A 5E8SA 3CE3A 4MD8E 1OKYA 2GS2A 4NU1A 2R3FA 1F0QA 4HPUE 1XH8A 2PU8A 4F9YA 4JBQA 4YHTA 1UKHA 2QKWB 3ETAA 4WHZA 5EHYA 2VAGA 5L2QA 4W8DA 3K3IA 4DH1A 2V5QA 2W5HA 4BCJA 3PZHA 3R30A 4OBOA 1Q8YA 4Y46A 1R0EA 3LIJA 2A98A 1WBPA 2V62A 3QGYA 1GIHA 2XM9A 3QQJA 3VUIA 5H8BA 4BCFA 4I5HA 4YJSA 3DJ7A 2QOHA 4GSBA 2ETKA 3ALOA 3EWHA 3LXKA 4TYJA 4QP1A 3C4ZA 3NEWA 3ZFMA 2JGZA 2VV9A 3E7VA 4BZNA 3GC7A 2JIIA 5IZFA 4WA9A 3HP5A 3FEGA 3TDWA 3R9RA 4O0UA 5HX6A 3KMMA 3WBLA 4RVTA 5CU2A 4H05A 2YCFA 3OXTA 4D9UA 2UZTA 2VU3A 4OTFA 2C5OA 3BQCA 1MQBA 3OUNB 1UNLA 4AGWA 3D15A 5CSPA 3O51A 3AMAA 1VEBA 1JKTA 3PVGA 4DDIA 3AC4A 1H1RA 3CQUA 1A9UA 3QWJA 3PUFC 3RJCA 2YERA 3MI9A 4CFUA 3IPHA 4O22A 3TUBA 5D9HA 4YURA 3AC2A 3MB6A 4F99A 4HYHA 2QKRA 3EQBA 3KIOC 4GVJA 4GW8A 1GZ8A 4DN5A 3DQXA 3VC4A 1NY3A 3VWAA 3A7JA 1BI7A 3E3BX 4DGNA 3AKLA 4XP3A 2WXVA 4AGDA 4BGGA 4F6SA 5KX8A 1ZOEA 2OK1A 3JUHA 4FGBA 4XP0A 2QOCA 4QP3A 5CT7A 3W0PA 2C1BA 3R28A 4GT4A 1O6KA 4L00A 1KUTA 5HHWA 3LJ1A 3H10A 2R5TA 1OPLA 4JNWA 1V0OA 3EFJA 2EU9A 2IW6A 1OECA 1JLUE 3N9XA 4YZ9A 4ZSLA 2OH0E 1E9HA 4IFCA 1R39A 5HTCA 3UZPA 3MFTA 3OWPA 1H01A 2PE1A 2XYUA 5LVMA 3TDVA 3UIBA 3RNIA 2YCRA 1BMKA 1H28A 3E93A 4FSUA 4OTWA 3FY2A 1G8JA 4UEUA 3CC6A 2QCSA 1QPJA 4KD1A 2C30A 4MQ1A 3U6IA 4LRKA 2NO3A 4Y85A 5E8VA 5FD2A 1F3MC 2VWYA 3EQPA 4PDOA 5KE0A 3HX4A 3W0MA 4BWKA 4CMOA 4FTNA 5EQEA 3KXMA 3LPBA 2XKFA 3UMXA 3AC1A 1Q8TA 3V8SA 1UU9A 1G5SA 5DOSA 3BGPA 4LG4A 4D4RA 1HCKA 4X21A 4Z55A 3HEGA 4RIXA 5BVKA 4KKEA 4XNEA 2X2KA 5FUTA 3A99A 2R3IA 3RP9A 3G5DA 2PY3A 4OTPA 4WRGA 5ANJA 3VULA 4CKIA 5FGKA 3ERKA 2GS6A 3OT8A 3PVWA 4IMYA 4QP7A 4R8QA 3UVPA 4QP9A 1XMMA 3L8SA 3OHTA 5I9ZA 4ZSEA 4U5JA 3KFAA 4RJ3A 4OBQA 3OC1A 3E64A 2OU7A 3F3UA 4MKCA 3Q9YA 4RA4A 5A6NA 4JX7A 3FQHA 4CFXA 2Y4IC 2CGVA 3AT3A 5M57A 1XMLA 3EQFA 5ANOA 2YACA 4O1PA 4U40A 3UYSA 5KCVA 4QNAA 3R04A 3RTPA 4CSVA 3FLZA 3LHJA 3Q9WA 3LLAA 4KIKA 4I5PA 5J1VA 1H08A 3ORNA 4CLJA 3ODZX 3RCJA 1ZOHA 3R71A 5M4FA 4V01A 2WQOA 4CNHA 3GCSA 3UC3A 2C0OA 3FMKA 3ZM4A 4C34A 3WYXA 4BDCA 4QMPA 4RIWB 3UDSA 3ZSGA 2QNJA 2X4FA 3BHTA 1M17A 4IAZA 3O8PA 3MTLA 1ZRZA 4O0XA 3OTUA 3RAKA 2X9EA 5AAGA 5EI8A 5HNBA 4AAYA 2X8IA 4DG3E 1KV1A 2PK9A 3MJ1A 4ITHA 5HG7A 1ZY4A 2C3LA 5H8GA 3TJDA 2VX1A 5J9ZA 4CTBA 4A07A 1GOLA 4HZRA 1ZOGA 3AT4A 2CHLA 3GP0A 4IVAA 4O91A 3T3VA 4EH7A 5HCYA 4UWCA 1YHVA 3VHKA 1JNKA 4D5HA 2OI4X 3R0TA 2UW8A 4BCKA 5GJDA 2BKKA 1Y6BA 4KKGA 2C3KA 4H3PA 2VTLA 4MAOA 2FSMX 4YZMA 4FKRA 3IDPA 1M2QA 2XKCA 3ZFXA 4D4SA 2XNGA 5E1EA 3QALE 3ZEWA 3FSFA 5IPJA 4NW5A 4M3QA 3G6HA 4ACHA 2WQEA 2IZTA 4H1JA 3DBEA 2QO2A 3BU5A 4YP8A 3EHAA 3L9MA 2XIKA 4ZJVA 3P7CA 2W1DA 3UG2A 2GMXA 2WB8A 3NUAA 3D7TB 4U8ZA 1U46A 4FG9A 4GKIA 2QI8A 2YM8A 1U5QA 4W4YA 3DKCA 4NL0A 3KXGA 5KMJA 2OXXA 1MQ4A 2UW7A 3VBYA 3I79A 1JKLA 5EHLA 4CYJA 5HQ0A 5FQDC 2X2LA 3P5JC 4FIFA 4FTRA 3VS0A 2ITXA 3HDMA 5C8KA 3W10A 1TKIA 3F2AA 4IQ6A 5CF6A 4QEBA 4RVMA 2PZYA 5HG5A 4E4NA 4RMZA 2OW3A 3MVLA 5FXQA 3CQEA 3G9LX 2X6DA 3MPAA 3A7FA 1BLXA 3GU7A 3EQCA 2DYLA 2ITVA 2X9FA 1GIIA 2QG7A 2W1GA 3R9OA 3COIA 1XQZA 2B7AA 3K3JA 3KULB 3WF6A 2VTNA 4DGGA 4IAAA 5AIRA 5AP6A 3GI3A 2YWVA 3I7BA 3N4UA 4ZTLA 1XH6A 3HRBA 1W83A 1MP8A 4K2RA 3NW6A 4HPTE 1YDRE 4AACA 2JAVA 1O9UA 4YO6A 5BNJA 4HZSA 1ZLTA 4RVKA 3OEZA 4ARKA 4AN2A 4ALWA 2Y4IB 3TNWA 4FRFA 3RPVA 4CKJA 5KBQA 1JKSA 3E88A 3IGGA 5EQPA 5IA5A 4YNEA 5HO8A 1H0WA 3NAXA 4CQEA 2RFEA 3FHIA 4H58A 4RJ5A 3R8MA 4XH6A 3DZOA 3FY0A 3NW7A 2X8DA 2YJSA 4X3FA 2QOBA 3KF4A 4R78A 3R7OA 5CI7A 4I0SA 5CSWA 4I6HA 1VZOA 4DEIA 4IC8A 4HW7A 2UW4A 5I3RA 3W0RA 1B6CB 4KS8A 1OIYA 2W4KA 4TKSA 5JRSA 5T68A 3S1HA 4IB5A 2GNFA 2Y9QA 2HENA 2QOIA 2W05A 3Q4UA 5L8JA 4YZCA 3BU3A 3BYMA 2B53A 4DEBA 2JIVA 4F65A 4MBJA 3BHVA 5AUXA 1OL6A 3Q5IA 3IW7A 3OXZA 2VO0A 3D9VA 3HV4A 3QXOA 3Q3BA 3QX4A 4KABA 4L45A 3CP9A 4DFXE 3VVHA 5HIBA 3U55A 2YEXA 3TTJA 5I4NA 4FR4A 1MUOA 4YHFA 2CLQA 3P7BA 3MFSA 5A14A 2XNEA 2B9FA 2PZ5A 3BRBA 1NT2A 4WO5A 4GCJA 1YDSE 2XIXA 5FG8A 4R1YA 1R1WA 3NRMA 3NYXA 2F9GA 2JAMA 3V5LA 3DNEA 1ZWSA 3NCZA 5IKWA 4F64A 2C1AA 4FG8A 2C47A 5FBNC 3FUPA 3FMJA 3GQIA 3LLTA 2B9HA 3G51A 3EYHA 2W1CA 3L8XA 3PSDA 3FLSA 1GAGA 2QO9A 4PF4A 1O6YA 3OUKA 4XV3A 4YMJA 5AAEA 4PNKA 3RAIA 2UUEA 2OJGA 5ITAA 4KIPA 3ITZA 3PG3A 3T3UA 1PXMA 1UU3A 4FZFB 3PWYA 4AW0A 4K8AA 2GTMA 5AUUA 2Z7QA 4O82A 3BU6A 5TF9A 2W5AA 3IO7A 4FIHA 3R1QA 2VWXA 4L6QA 4C7TA 3L8VA 1QPCA 5AP5A 4L7FA 2X0GA 1M7NA 3IKAA 2XH5A 5HE1A 4Q5EA 5LJJA 3QTIA 4O7LA 2RFNA 4FTCA 4QMWA 5F20A 4ASZA 1Q5KA 1PMUA 5FM2A 2YCQA 3I4BA 3DXNA 2HY0A 3CJFA 3GCQA 4QMZA 3ULIA 4EQMA 1YKRA 5L2SA 4IE9A 4DFNA 3Q52A 3PLSA 2XANA 3C50A 3GT8A 3KCKA 2X0OA 3UP7A 4ENXA 4ENYA 3WF7A 4AZEA 4NJ3A 2WFYA 4F7LA 2ZOQA 5F1ZA 2BRBA 3VS3A 3QUEA 4EYMA 2XM8A 4FEQA 3UQFA 3H9FA 4ZSAA 1H1PA 5ETIA 3PDTA 3UE4A 3GENA 5CNOA 1WAKA 2A2AA 3U4WA 5I5ZA 3UQCA 4X2KA 3UO5A 4LV7A 3D4QA 4C3RA 2WQBA 3V5JA 4WT6A 2YAKA 1JQHA 3UG1A 4RGJA 1IG1A 4F7NA 4AP7A 3W0QA 3EIDA 3FMEA 4PMTA 3RM6A 2OG8A 5E8XA 4DCEA 2VGOA 2F2CB 2W1ZA 3RCDA 3I0OA 1FVTA 4O21A 4TYHB 4EHEA 4DF3A 3EYGA 5M4UA 2RFDA 5EW8A 2GPHA 3FLWA 5E91A 3ZSHA 4II5A 2RFSA 4WBOA 4Q2AA 3EFKA 3QU0A 4IWPA 5AUZA 3NMUF 4KINA 1RDQE 4ZTRA 2EB2A 1Q97A 3QCYA 3BWJA 3R2YA 3I81A 2UZBA 5KMOA 5J87A 4KUJA 1ZYSA 2ZV8A 4RJ8A 5AP7A 3WZUA 2ZB1A 4MVFA 1GIJA 4ZAUA 4ZZMA 5IA1A 4O7WA 3NUNA 2ITQA 3C4XA 2C3IB 3CBLA 4M66A 4QOXA 4DA5A 1Y57A 3DJ6A 5CZHA 2BDWA 5HG9A 3F82A 3KREA 4FV1A 4QPSA 4JXFA 3RWPA 2XK7A 1U59A 3LCKA 4FTAA 5EK7A 1OITA 3BELA 2WU7A 4IZ5A 5CSXA 2PWLA 3FL5A 4JS8A 5BX0A 5KBRA 4HCUA 2I0HA 2OIDA 3PXQA 4FJVA 3F3TA 4JAJA 2Z7SA 3I7CA 5CEMA 3C7QA 3PVBA 5C03A 3PY1A 4FSMA 3QQUA 3B8RA 3H9RA 3EJ1A 4AWIA 4YLLA 4BBMA 3QZFA 4C3FA 5LWMA 4UB7A 4WRSA 3R8LA 5HBEA 5M44A 4BDBA 3NNVA 1CM8A 4JMQA 3KRWA 2UW6A 3EN9A 1O6LA 4IEBA 4RFZA 3T8OA 4EKKA 2C5NA 1NVSA 1Y91A 4I4EA 4I92A 2VWBA 2ONLC 4R7HA 3REPA 4XG3A 4QTEA 3F88A 5IQAA 5JFWA 4RPVA 4E8AA 1OI9A 3F9NA 4R7IA 1UVRA 3BLHA 3WYYA 2BRHA 4OT6A 4O0TA 2J7TA 5LMBA 3TMOA 2ONLA 5JRQA 4NEUA 1XH5A 2ZAZA 3COKA 1TZDA 2DS1A 3ANQA 4GU6A 3WZKA 5CLPA 3PIYA 2GTNA 2VO6A 3FYKX 3VF9A 2GNLA 3DK7A 4AXFA 4MXAA 4JQ8A 5FLFA 5A54A 4PP7A 2ITWA 3ACJA 2Q0NA 2QVSE 1Z57A 4KRCA 3BGQA 3DLSA 3F5XA 4M68A 4YJOA 4F9BA 3WOWA 3DV3A 4MF0A 4DG2E 1WMKA 1SVGA 1SYKA 4NWMA 5EM8A 3P7AA 4OTHA 5IMXA 3AGMA 3VONA 4FOCA 3U9CA 5ANEA 4APPA 2QHNA 3LW0A 4FKVA 4QTDA 2Y0AA 1PKGA 5GZAA 1Q8ZA 3V5PA 3BL7A 4LL0A 4RWIA 3D5WA 2O8YA 4FVQA 4L42A 4YJQA 3KMWA 4ASXA 3LJ2A 4O4BB 5DT4A 5AR4A 3LCSA 3ATSA 2ZV9A 1YW2A 4RIYA 4ALUA 3F2NA 4DFZE 3D0EA 4NTSA 2WTWA 4GKHA 3I1AA 2YCSA 4D4YA 1LUFA 1NA7A 3OT3A 4EZ7A 4YJVA 3BE2A 3UIXA 5JZNA 4LOOA 1B38A 3Q4CA 2XNBA 4XBUA 3RZFA 3G2FA 4UYNA 4AW5A 4N4SA 2PUPA 5C1QB 4E4LA 1ZYLA 2WOUA 5F9EA 2AUHA 2WQMA 2BROA 2VO7A 3HRCA 3PFQA 4PMMA 4B0GA 3EQGA 4I23A 3R8PA 3L1SA 4UXLA 2OZAA 3FPMA 2EUFB 3FZRA 4D0WA 3FHRA 4EH5A 3COHA 3D94A 3IONA 4NKAA 4TYGA 2AQXA 4BIDA 4DLIA 3LAUA 1OGUA 1FVVA 2B54A 2ACXA 4HCTA 4PWNA 3JS2A 5DR9A 5AV1A 4P4CA 4WNKA 4UWYA 1W0XC 3D5UA 3LFSA 4DTBA 3VUMA 4D5KA 2R3JA 3KRXA 3VUDA 4BC6A 5LXMA 4M8TA 4G2FA 1Q41A 4I41A 2DQ7X 2W9ZB 4MK0A 2YITA 3MVMA 2DUVA 4U0IA 5ICPA 4IFGA 4KSQA 3UDBA 3R2BA 4W8EA 4G3FA 5LCKA 1ZYJA 2WMTA 1NVQA 3QA0A 5CVFA 4L43A 2XRWA 5DGZA 3W8QA 5CAVA 4I5MA 5GIPE 3BV3A 3R1SA 5HNGA 4C4FA 3QCQA 2OIBA 2BZKB 3ID6C 4FUXA 3SRVB 3VW8A 4WNPA 3W2CA 3JR1A 3K54A 4BIBA 4C3PA 2XBJA 3ZDUA 5KO1A 2EVAA 4ZMFA 3Q5ZA 3TZ8A 4C62A 4CZTA 5IQIA 4KWPA 4C57A 5FXSA 4D2PA 4JBOA 1ST0A 1YOJA 2X2MA 3OWLA 2XRUA 3ZU7A 4TTHB 5BQ0A 2X6EA 3GU4A 4ZK5A 4A9TA 4CV8A 3QTWA 4QTCA 4XOYA 4ANBA 2CKPA 4JG6A 5BVNA 5CALA 4O96A 4XG7A 5HVJA 5F94A 4DEGA 2FYSA 5M08A 3GGFA 4IDVA 2BTSA 3JY9A 3QC9A 2CNQA 4C35A 4NFMA 5C4LA 5CASA 3NYNA 5CT0A 4MD9E 4AUAA 5K5NA 4XG9A 5EOBA 2HY81 4LL5A 3RALA 4BTJA 2HWOA 4XBRA 3ZO2A 5T6KA 5IG1A 2FO0A 2I1MA 4IB1A 4JG8A 4LI5A 3C51A 2WD1A 3EN7A 5F95A 3V8TA 4BJJB 3NSZA 3TV7A 4L3JA 3QFVA 5E1SA 1W98A 1CDKA 4TYEA 4KRDA 3OOGA 5HX8A 4X2FA 3F3VA 5HD4A 3HV7A 1UNHA 3GUBA 4RA5A 4U42A 3ZDIA 4O7SA 2VWIA 3K2LA 4D2TA 4L68A 4BCQA 5TOZA 1G3NA 5J7BA 4OAUC 1WBVA 1M14A 4CVAA 5E8YA 2XVDA 3DTCA 2VRXA 4DINA 5EFQA 4C8BA 4KBKA 4GUBA 4PTCA 3BIZA 3W1FA 4EL9A 2QU6A 3ML1A 3BEGA 2C0TA 2YAAA 1NVRA 2IWIA 2V7OA 2WQNA 3ELJA 3Q9ZA 2ETRA 4O7TA 4AQKA 4B8LA 2E9UA 3UIUA 5HO7A 3P0MA 3VBXA 1YHWA 2J6MA 2UZNA 4CT1A 5I9YA 4LV8A 2KULA 4J71A 2HOGA 3BX5A 3NYVA 3VJNA 3E8DA 3NPCA 4HVGA 5A9UA 4XOZA 4EK8A 2I7QA 3PRFA 4ZTQA 5KMLA 4HJOA 4ZTNA 4BZDA 4B9DA 1OL2A 5AP1A 4FV0A 2WMQA 3JYAA 3VHEA 4U80A 1JPAA 1BL7A 4MQ2A 5DBXA 3PUPA 2XIYA 1K9AA 5M55A 4DFBA 1PXNA 3BLRA 3PE1A 2PZPA 2FSLX 2IEWA 3DDQA 3IGOA 4IX5A 4S33A 5K5XA 1JVPP 2V22A 4G6OA 4MEDA 4EWQA 3AOXA 3QZIA 4BI2A 4BI0A 3WZDA 3ZRMA 4GL9A 2QHMA 4O4EA 1IA9A 3DKGA 3NFGB 3Q2MA 3ORZA 4GRBA 3QYZA 3QKKA 5CEKA 4EOSA 5JGAA 2UVXA 4UWBA 2ITUA 2WELA 3AG9A 3DTWA 4TW9A 5CXHA 5LCJA 2VNWA 3F66A 2AC5A 3RPRA 4MBIA 5HICA 5JFXA 4CRSA 5C26A 2I0EA 2GU8A 2ESMA 4QMUA 4MUQA 1J7IA 4TRLA 3ZHPC 3O7LD 2ERKA 2QOKA 1SNXA 2VTPA 2G01A 4PQNA 3R7UA 3S95A 4BTFA 3HAMA 4NCTA 3TN8A 3PJCA 3C0GA 3LZBA 3IECA 4OTGA 4O38A 2I6LA 4YLKA 5I9UA 5JFSA 3DA6A 3G0EA 3OVVA 3HMOA 2G2IA 5DPVA 3KA0A 5BUJA 2B55A 3OZ6A 1H24A 2NP8A 4F0FA 3UVQA 4BDDA 3SG8A 4BR3A 4HVIA 5DIAA 4MHAA 3V5TA 1CMKE 3G9NA 3BBTB 4EH3A 4RQVA 4CFVA 3HMMA 4RBLA 2IN6A 1VR2A 3W0OA 1YI3A 1ZYDA 3FLQA 2BZJA 3KK8A 3NLBA 3QKMA 2BIKB 4AXCA 5TE0A 3A4PA 2IW9A 3COMA 3QAME 4ANSA 5CVGA 2YIWA 1H26A 1PXOA 4L01A 3QUPA 3VS6A 4EBVA 5AEPA 4FV5A 3BEAA 2CSNA 2PVFA 4X6QC 5CEOA 3LFNA 4QP8A 2YIRA 4FIGA 3Q32A 4FMQA 5HVYA 5HE3A 3K5VA 3ZLYA 2VTRA 3HKOA 3JPVA 5HCZA 1P4FA 3FMMA 4AFJA 2C6IA 2PVMA 3L9PA 4FNZA 3DB6A 4UV0A 3W32A 4AS0A 4DFYA 3RI1A 4CMTA 4AQCA 2BDFA 2QC6A 4BHZA 3QBNA 4CYIA 2WOTA 3FI8A 5JT2A 4IM0A 3UPZA 3NNUA 4FODA 3FI3A 4S32A 2BFYA 2B9JA 2QONA 5CX9A 1AGWA 3PPZA 4FNXA 3HGKA 4IVCA 4OLIA 2IF8A 5K0KA 3KXXA 3TKIA 4XHKB 4RWKA 4IZAA 4X7QA 4CZUA 2PE0A 2ZJWA 3MN3A 4F9AA 5JQ8A 4O84A 5E8WA 1QCFA 3ZLSA 1R78A 4JLCA 1XHAA 5LVPA 3RINA 4CG9A 1GZNA 4GVAA 3RGFA 4DG0E 5DR2A 3ZMMA 4BCOA 5B0XA 2JDOA 2YDIA 1SM2A 4K77A 4E73A 1W84A 1ATPE 2G2HA 1LP4A 3DGKA 5AMNA 3DNDA 2CKOA 5IDNA 3AC3A 2XJ0A 4JT3A 4I6BA 5IA4A 4PY1A 4ASEA 4CZYB 3WARA 5BVWA 1IRKA 1H1QA 1PXJA 2QOLA 4P5ZA 4A9UA 2OF2A 4QQCA 2VTQA 4IVBA 3SXSA 3JVSA 4C4JA 3P23A 2Y6MA 4RC3A 3NIEA 2IZUA 3ZH8A 3FQEA 2O5KA 1OM1A 4FKOA 5EM5A 3MWUA 3HAVA 5DVRA 2BHHA 4DBXA 3V6RA 5DE2A 4FSNA 4UYAA 2GS7A 2P4IA 2EXMA 5K0XA 2XIZA 4O83A 4P5QA 3UTOA 3O5AA 3ZO3A 1JSVA 3I0QA 3DFCB 2GNJA 3NDMA 2CCIA 5IEXA 4FV3A 3VQUA 4DHFA 4D4VA 4R3PA 1OVEA 3DLZA 3GCVA 2GNGA 1GZKA 3P5KA 1ZXEA 5IU2A 3N4VA 2BVAA 1OL5A 2XNPA 3R7EA 3OCGA 1I44A 5ACBC 3S2PA 3AT2A 3AD5A 2HZIA 2HIWA 1I09A 3BHYA 5FP5A 1G8KA 4I94A 3NVKI 4GS6A 3LMIA 4IWOA 3W2RA 3TEIA 4OTDA 3SVVA 4QDVA 2XAMA 2BZIB 3GVUA 3FAAA 1ZARA 2V55A 3E8CA 4FKWA 4QNYA 3RNYA 2LAVA 5HD7A 4K6ZA 5IUIA 1WVWA 2HZ0A 4KIOA 4TWCA 5B2MA 3W0SA 3CTQA 2GNIA 4EQCA 3L9NA 2IVUA 3IOPA 1YHSA 4TT7A 1TQPA 5CVHA 3O23A 2WMXA 4EUTA 3ZTXA 4BI1A 4U81A 1CTPE 3KRJA 3MY5A 2Y7JA 5IDPA 3UOJA 2QD9A 2GQRA 4UZHA 4CCUA 4CTCA 5CEPA 3A2CA 3SC1A 4USEA 4AZWA 4CRLA 2P3GX 2JKOA 3CD3A 2C6EA 5EI2A 4KIQA 3MFRA 3HL7A 1J7UA 3QQGA 5J1WA 4GU9A 2CN8A 3D2KA 4RWJA 5DEYA 2OWBA 4QYGA 3KULA 3WF8A 5DMZA 5IMEA