2QO9A

Human epha3 kinase and juxtamembrane region, phosphorylated, amp-pnp bound
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
277
Chain Sequence
TVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 277
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qo9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qo9A01
1Y6AA 2PL0A 3QRUA 1Q8WA 3NDMA 2OXDA 3GEQA 3PXYA 3QCXA 4JVGA 2F7ZE 3IO7A 4QP7A 2PVHA 1ATPE 2BHHA 3OCBA 3FQSA 3UJGA 1I44A 4O7SA 1NVSA 4ASEA 2KULA 2QCSA 3TXOA 1PMVA 4EOIA 4QTCA 4WBBB 4D9TA 2JIUA 4FMQA 4BCQA 2I0VA 3EFJA 4FYNA 3FLZA 2QR8A 3LFQA 1GIHA 4RZVA 1Q8ZA 5HG8A 2XM9A 2C0TA 2G9XA 2C69A 4DH5A 3EFWA 5HTBA 4E4XA 2QODA 4MD8E 4O7RA 3FXWA 2BKZA 2WMRA 3EIDA 3WOWA 4M14A 1ZY4A 4FKWA 2W1ZA 3OFMA 1YQJA 3PG1A 4D2TA 5IEXA 3EL8A 5DMZA 2BRHA 2ZOQA 4OBOA 4M0YA 3VW6A 3LPBA 4IAYA 3U51A 3FYJX 3IK3A 3NYNA 3OEZA 1U46A 3E64A 1VZOA 2C6LA 4DFZE 4OTGA 4IANA 5HLPA 4MVFA 5EM6A 3ROYA 4IWPA 2V62A 5ANGA 3PE2A 4BL1A 3TJCA 4EC9A 4XBUA 1OBGA 3KXXA 5HICA 5L2TA 4JG6A 4JS8A 1PYXA 2C6OA 2HWPA 2WXVA 2XIYA 2ZYBA 3QKLA 3SKCA 4AWIA 2GS7A 2C5VA 4BDEA 3LM0A 3MH2A 4IM0A 4JDHA 5IA2A 5DYJA 3VC4A 3ACKA 4UYNA 2JIIA 4ZZMA 1WBWA 1TQIA 3FZPA 3BLRA 5EHLA 3VUGA 5LMBA 2Y4PA 4IX3A 3LW0A 1XH4A 4RVMA 3NYXA 3VBXA 2VNWA 2CJMA 4J98A 4RIXB 4C62A 3ANQA 3PWDA 4RFYA 3S95A 5CZHA 2ITYA 3F5UA 3SXSA 1ZLTA 3PXQA 4RWIA 2CLQA 3G5DA 4TPTA 4HCUA 1OM1A 3G6GA 2WAJA 4B7TA 1RDQE 1XHAA 3F3WA 1UWJA 3PVGA 4WA9A 4WSYA 5HNBA 5HI2A 2FGIA 3BIZA 4FKTA 3KRJA 4LI5A 3G6HA 5G6VA 4G6NA 4FA2A 4ZXTA 3ORLA 3T9TA 4RX5A 4UZDA 1J3HA 4O0XA 3LCOA 5IG1A 3ALNA 2OXXA 3L9NA 2XMYA 4DINA 4L43A 2A0CX 2VTTA 2X4ZA 3OTVA 3SLSA 3MFSA 1QMZA 3DBFA 4E93A 4EH4A 5C1QB 3N4VA 5A6OA 3HMPA 4LUDA 5HEZA 4I93A 4MAOA 3G51A 5M53A 4IDVA 3FQHA 3QCQA 5LWNA 3PP1A 2IZRA 5L2IA 1OIUA 2GNIA 3UODA 3LFBA 4YLJA 3M1SA 4AX8A 4H05A 3EMGA 4NJDA 4YJUA 3WYXA 2W17A 2ESMA 3EFLA 4NEUA 4I6BA 2JFLA 5HE2A 1R3CA 3GU7A 4K9YA 3VUMA 5DR6A 3II5A 4KKHA 3KMWA 3DBEA 4FSMA 3WZJA 4QMXA 2QOFA 1SM2A 4I5MA 3HMNA 3TCPA 5HNIX 4O0WA 4IHPA 5CEOA 1ZY5A 4FTCA 4BHNA 1PRYA 4QMVA 2XJ1A 4IX6A 3K5UA 4JG7A 4NUSA 1OI9A 1JSTA 2PPQA 2WQBA 2XZSA 5E92A 4AXAA 4U8ZA 1Z5MA 2OH0E 4TYHA 4X6RA 5GINE 3R21A 1F0QA 3MY0A 4J8MA 3TIZA 4RFZA 4V01A 4YJVA 4AA4A 4BVUA 4UV0A 4FIFA 3QRJA 2XRUA 4XG7A 3OT3A 3HGKA 3R73A 3T8OA 1YXXA 4FC0A 3MWUA 5DEWA 3Q4ZA 3COHA 5BVDA 1H26A 5B0XA 3VS2A 4FKRA 4JR3A 2OW3A 3DLSA 1IRKA 5FGKA 3FL4A 5FP6A 4O7ZA 4O83A 2EXMA 4QRCA 5J5TA 1U5QA 3PE1A 4D0WA 2XJ2A 3HNGA 2O64A 3DB8A 4ASZA 4EJ7A 1Q24A 3BV3A 4MHAA 4MXZA 4UMQA 4EBVA 3L8PA 2PZRA 4EHVA 1JKKA 3MTLA 3I6WA 4R78A 5BPYA 3LQ3A 3IDBA 5H3QA 3DS6A 3CKXA 1IG1A 2X2MA 5CYIA 3QQKA 2WNTA 3GQLA 2ETRA 4JDIA 4FIJA 4M8TA 5JK3A 3LXNA 4BZNA 3OEFX 4FEQA 2VZ6A 2YDIA 4EI4A 4EL9A 3K2LA 5B2KA 3BKBA 1DS5A 4Y73A 2CSNA 3H0YA 1ZYDA 3LCDA 4PDOA 4D58A 2HELA 2R2PA 2SRCA 2YM6A 3QD2B 5AWMA 3FXXA 4CTBA 5C8MA 4AZWA 5AA9A 4L42A 3BQRA 4K1BA 3QD0A 4YC6A 3P7CA 4ANOA 2XRWA 2VWIA 4XEYA 3TV6A 3TZMA 2W9FB 2C1AA 3CTJA 3OC1A 4QP1A 4TKSA 4BZDA 4NM3A 3BU6A 2HIWA 2C6TA 2PK9A 3OWKA 4FSWA 4X0MA 5EQYA 2XBAA 3OHTA 4XOYA 5AV3A 2XNBA 2BZIB 3OBGA 1IEPA 4J53A 3SDJA 4ZZNA 5DNRA 1BLXA 3VBQA 5IEVA 4FEUA 4YZBA 3H0ZA 1EH4A 3PA4A 2X7GA 5ANKA 2QQ7A 2XNPA 4KINA 4M66A 4F0GA 4CFXA 3RAHA 3KU2A 2BAQA 2XK7A 5JSMA 3H3CA 4FT3A 3R8LA 3QC4A 2YM7A 3JVSA 3N4UA 1URWA 2R4BA 5AX3A 4R3PA 2WTIA 3Q9ZA 2YDKA 4FT5A 3EKKA 3EN4A 3U9NA 2GDOA 4PTCA 4D4SA 4CQGA 1MUOA 2X81A 4NW5A 2NPQA 4AN2A 3UMWA 2WMBA 4YJSA 5LVPA 4GEOA 4Z7HA 2QOHA 4AN9A 2ZV9A 4GU6A 2G2HA 2Q0NA 3QUDA 4DA5A 4PUZA 2X8EA 2VTOA 3PJ2A 1Y91A 3UNJA 2FSMX 1GNGA 4FSQA 4FV3A 2OICA 3Q3BA 2WTCA 1Q97A 1YWNA 4OR5A 3OXIA 4CZTA 2OBJA 4BGHA 5DT3A 3LLTA 4FV4A 4FZDB 4L68A 4ZMFA 5KMJA 1B6CB 1WBPA 5KMNA 2KTYA 3EZVA 3PY1A 4HPTE 4AGDA 4CMOA 5L2QA 5EKNA 4IM2A 4OTDA 3AC5A 1H4LA 2R3KA 4MD7E 3TEIA 4DG3E 1E1XA 2YN8A 2VTSA 1FPUA 2OJIA 4D9UA 3C5UA 1H27A 4AS0A 2XA4A 4HZSA 4IFGA 4RIWB 5E8WA 3MVJA 4KSPA 3MFTA 3TNPC 3R28A 1R1WA 3PY0A 5JGAA 1YDSE 1JKLA 4HCVA 4BCFA 5DIAA 1I09A 1KOAA 4FX3A 4KUJA 2OZAA 3SOAA 5K4JA 4FT0A 3C0HA 2CKPA 3MPMA 5EW8A 3UIMA 3ZXZA 5EQEA 3DV3A 4KIOA 4YNEA 3ZFMA 4CZYB 4U9AA 5HD4A 4FZ7A 4BIBA 5AIRA 3LLAA 3LFSA 1OKYA 3CIKA 1PF8A 3PJ8A 2XYUA 4DGMA 3Q4TA 2QU5A 3BEGA 4E6AA 4XP0A 3N4TA 3GU6A 4BF2A 3WIGA 3ZM9A 3E8DA 4HCTA 3O8TA 4UWBA 3RAWA 3UE4A 4NL0A 3MA3A 4TYHB 1OBDA 4RVKA 4FIHA 2XKEA 2VX1A 3UMXA 3DFAA 1OITA 3BYSA 4K2RA 3OWLA 5IF1A 4LRMA 5EI2A 5ANJA 4A4OA 5BUIA 5AP7A 4X2KA 3IG7A 5AP3A 4IVAA 5LOHA 4G3CA 3O8UA 4DCEA 3L1SA 3LCTA 4G3GA 4ZSAA 2YCSA 4FGRA 4G5PA 5EG3A 1JKSA 5CNOA 2QOCA 3O50A 1TQMA 2G15A 3D7TA 3R1QA 4J71A 2RKUA 2F2UA 3FHRA 2PVNA 3D0EA 3WBLA 3RBWA 4PNKA 4J7BA 4CFUA 3P79A 4X2FA 3QCSA 3ZBFA 2YWVA 3Q32A 1GZNA 4U42A 4ZTQA 4EH5A 4NWMA 2ERZE 1WBOA 1PXOA 5HO6A 5DI1A 3ZM4A 3TUDA 3NW7A 3EWHA 2J6MA 4BTKA 2J2IB 4JL9A 4F1MA 3HV3A 5L6PA 4YHJA 3FBVA 2E9PA 3QX2A 3QFVA 4G3EA 2F2CB 3RPSA 2WQOA 3VN9A 4GH2A 4ITIA 4FV1A 2WTWA 1LR4A 2YZAA 3M42A 3VUHA 3TKIA 2X0GA 2ZB0A 5HVJA 4O81A 3I5ZA 3MY1A 3MI9A 2W05A 2VTNA 4XUFA 5K9IA 3R0TA 4HGSA 3AGMA 4CG8A 2Z7RA 3KXGA 1KV1A 3VW8A 2F49A 3NUXA 4YO4A 3UZRA 4YNOA 2AYPA 5D10A 5M44A 3DNEA 4OGRA 2UZDA 3I79A 2VTRA 5I5ZA 5AV2A 4H58A 2LAVA 4ID7A 5LVNA 4R7BA 3OZ6A 3NW6A 2IZSA 3OVVA 4Q5HA 5D1JA 2VRXA 1YRPA 3MW1A 3VJNA 4GSBA 3R30A 4AG8A 4DFXE 2XEYA 4XP2A 4E6QA 2Z60A 3ZDIA 2VGOA 4FNYA 1OVEA 3NLBA 2C47A 2PUNA 4G5JA 4R6VA 3E92A 5EYCA 3V8SA 3F5GA 3ZS5A 3TKUA 3QRIA 2DWBA 5JQ8A 3I0OA 4G16A 5GZ8A 4DGGA 4NK9A 5J7HA 4FZ6A 2XYNA 4OAVB 4II5A 3QD3A 3ALOA 3W2RA 3ZCLA 2XIZA 2OXYA 1P5EA 3AMBA 4ZJJA 3VUIA 5DWRA 4D2RA 2R3PA 4XX9A 5FEQA 5FTQA 3R7VA 2CGVA 4CRSA 3EN6A 4E6CA 3UNZA 2CLXA 2PHKA 3UQCA 4I1ZA 3Q2JA 2CGUA 4LOOA 2AC5A 2J0JA 3HLLA 4UEUA 2C4GA 5F94A 3UDBA 4L52A 4AOJA 5A4TA 4ITJA 4YTIA 4U6RA 4V0GA 4IZ7A 3AC8A 5KCVA 4C4JA 3IGGA 3D83A 1IA8A 3O8PA 3Q9XA 1SNXA 3ENMA 3EQPA 3UZTA 3KK8A 3NCGA 4MXXA 4MF0A 3DJ7A 1M14A 4NW6A 3IECA 5D7AA 4E5WA 3DAJA 4DTBA 2B9HA 2OJGA 3KK9A 3PY3A 4QMYA 5IA4A 2J0MB 3F3UA 2E2BA 1AQ1A 4NJ3A 5AUYA 1W82A 4RZWA 5BNJA 3FDNA 2O8YA 2C0IA 3HVCA 3MY5A 4BDAA 3GU4A 3F61A 3ZUVA 3PUPA 2UZEA 3DBCA 4AF3A 5J1VA 4UXLA 5KHWA 4I0RA 4X3FB 2BUJA 5IKWA 4KNBA 2I1MA 3ORKA 3QQLA 4ZTHA 2IVUA 3ZH8A 5CX9A 2H9VA 4AFEA 3R9OA 3DJ6A 5EQPA 2B0QA 3W2CA 3ZFXA 1O6LA 4FR4A 4W8EA 2VUWA 3D5UA 4D2VA 1DI9A 2JKMA 1J91A 3OWPA 1GIJA 4NCTA 2OZAB 3WF7A 3QQGA 2WQEA 4LM5A 5M4CA 3EQHA 2IJMA 4GT4A 3P0MA 4BDCA 1YW2A 3L8XA 1YI3A 2GNJA 3AD6A 3O23A 1STCE 3QXPA 4XJ0A 5AJQA 2PMNX 4DITA 3DXQA 4CKRA 2FH9A 3GI3A 3W32A 1P4FA 1ZARA 3HV4A 5CU3A 3VQUA 2GNHA 3VS0A 1FGIA 3ORZA 3E63A 4RPVA 3EZRA 2C6MA 1PW2A 1JBPE 3ROCA 5FLFA 5JZJA 4QQ5A 3RPRA 4GIHA 4ZLOA 4HYHA 3MBLA 3AMYA 3ETAA 5H8EA 4H3QA 4XG9A 3BGZA 4E4MA 2BKKA 2BTRA 2BAJA 2ERKA 2EUFB 5LJJA 1XQZA 5KZ0A 4FUYA 5HLWA 4FK6A 2QOKA 4M13A 2XK9A 4HGEA 5E8UA 4ERKA 4RLKA 2BILB 3CC6A 3F3ZA 4O0TA 2W96B 3JXWA 4GV1A 5K5NA 5C4KA 1BI7A 3POOA 4G1WA 2W1CA 3PPJA 4HOKA 3ZFYA 2F57A 3RGFA 1CMKE 4GRBA 4LYNA 4DGLC 3F2RA 5IQDA 3NNVA 2YJRA 3IONA 4GL9A 3DQXA 4D2WA 4YPSA 2HK5A 4D0XA 4DLIA 5BQ0A 4MXYA 4MXOA 4E6DA 1NVQA 4C58A 1YOLA 1JSUA 2ITZA 2RFDA 3BYVA 3Q6WA 4FT7A 3LFAA 4XLVA 3R8PA 3ZEPA 5JKGA 4EH8A 4K0YA 5M55A 4OTPA 4RFMA 2JIVA 2VWWA 3KN6A 2W0JA 2ITQA 4EZ3A 5KO1A 2WMTA 4DG0E 2F7XE 2H8HA 4LMUA 3R8UA 3CSVA 3FKLA 2GQGA 3B8QA 3FMKA 3E8EA 2W5HA 4P2KA 3UG1A 3V5WA 3PG3A 4I94A 3U87A 3ZSHA 4YSJA 5HX6A 4QMSA 4F1OA 1ERKA 4IAZA 2W4KA 1WCCA 1ZZ2A 3IDCA 3R8MA 4ACCA 3KY2A 3BE2A 4JBQA 4BI1A 5IH6A 4HGTA 2BHEA 5CF4A 2NNWB 5DLSA 5DRBA 3GVUA 1YHVA 4LG4A 4EZ5A 4YBJA 2FA2A 4JX7A 5F1ZA 3SHEA 2R3OA 3KULA 4R5YA 4ZTLA 4LGHA 3VJOA 4RRVA 1VJYA 4BBFA 4TYEA 2VTQA 4XG8A 3ORTA 2VO6A 4H39A 1A06A 2J4ZA 3V5QA 3FMEA 3KEXA 3G33A 1SNUA 3GUBA 4C2VA 1DM2A 4FZAB 4EK8A 5CSWA 5FRIA 5LCKA 1CKIA 4GUEA 4K77A 3PIZA 3PA3A 1OL2A 4QYHA 4ERWA 1H08A 5CAVA 2R0IA 3BLQA 3IW6A 3F6XA 4QPSA 3LMGA 1ZOHA 4C4HA 4QMPA 3DZOA 4MF1A 4Y5HA 2VWXA 2Y4IB 5LMAA 2OSCA 3FMLA 4JDJA 2CKEA 3UP7A 4EOOA 4I92A 3WF5A 1YOJA 4RIXA 4ASDA 2O3PA 4ARKA 3E93A 4ZJVA 5A4LA 2C5XA 3L8SA 3IW8A 3IPHA 1XH5A 3MJ1A 4HVDA 3BV2A 4U41A 5E8XA 4BC6A 2YACA 3WZUA 4LRKA 5CZIA 4EYMA 5IISA 3D2KA 4RVTA 1HOWA 3NS9A 3O7LD 3CE3A 4EH2A 4YR8A 4YJPA 3JR1A 4CD0A 1RE8A 1WFCA 3DCVA 4AT3A 4I21A 3ULZA 5A14A 5CSVA 4EOQA 1Q99A 4FT9A 5HBHA 1WBNA 4AACA 3DZQA 3ET7A 3KGAA 1Q41A 4C34A 4UN0C 4FE2A 3RPVA 3D4QA 2X4FA 4QQCA 2UW3A 4ONAA 3HAMA 5L2SA 1H01A 4GG5A 3AC2A 4S32A 1H28A 3DQWA 2O0UA 3EFKA 5AMNA 4CLIA 5HIEA 3GU8A 2B9JA 3QTXA 2GSFA 4IMYA 4W4XA 3COMA 5AA8A 5C01A 3FEGA 4TTHB 4FNXA 3GP0A 4QMTA 5CEQA 3OP5A 2GPHA 3UIUA 4O7NA 4NKAA 3GBZA 2CGWA 4QP2A 3R7OA 4IZYA 2I0YA 3F88A 4BI2A 2X8DA 4Q9SA 3EN7A 4C3FA 4E8AA 4HPUE 1S9JA 5ANIA 2CNQA 3HYHA 3TI1A 3SW4A 4ZS4A 3E7OA 2WTKB 3FY0A 3LAUA 5M51A 2ITWA 4HVIA 3PJ3A 5EM5A 4AZEA 4DFLA 4EK5A 4RA4A 3B2WA 4TWCA 2R64A 2YAKA 1H1RA 1GZOA 4F7JA 3IQ7A 1LEWA 3HX4A 5EYMA 3R7EA 3DBDA 4FV7A 3V8TA 4S31A 4UMUA 2B9FA 4ANNA 1PJKA 3PZHA 2CKOA 4BCNA 4FOCA 1VYZA 3L9LA 4I6HA 1PY5A 5H2UA 1ZOEA 3TNIA 5L2WA 5CALA 2OGVA 5KKRC 1KE5A 5KKRB 1Q8YA 2UZVA 4JDKA 5CQWA 3WYYA 3LMIA 4JT3A 1YDRE 3P08A 2YM8A 4QYGA 4DEHA 5IQIA 3OOGA 1CTPE 4IE9A 1GJOA 4B99A 5BUEA 3NUAA 4X3JA 3MIAA 3LHJA 3B8RA 4BCMA 5AR4A 1JPAA 3ZO4A 5AP6A 1ND4A 3C5IA 3E3PA 4TN6A 4RSSA 1JOWB 1TQPA 3UVPA 4C57A 1DI8A 2PSQA 3QGYA 5HE0A 3C51A 5IA5A 3PVWA 3NVKI 3R8VA 5AAFA 2UW7A 4OTQA 1OPJA 3CS9A 3FI4A 3GOPA 4FI1A 3CJGA 2BCJA 3C4XA 4XP3A 3W2OA 4EC8A 4MQ1A 4EUTA 3FI8A 2WFYA 2PZIA 4JI9A 4ZTRA 1M2QA 4DH7A 5FP5A 4KD1A 5FTOA 2GQRA 3QTZA 4FKVA 4OLIA 3KB7A 3VS1A 3N9XA 4NH1A 1YOMA 2BDJA 3NNUA 4QPAA 4AW5A 4RC2A 4FVPA 4F1TA 4BICA 5A46A 4DH1A 3GNIB 3QXOA 3ODYX 5HTCA 1OB3A 1L3RE 3MJ2A 4IVCA 3BGQA 2E9NA 3TNWA 3R9RA 4YZMA 4U44A 3Q4CA 2QKRA 1NT2A 2XKFA 5I3OA 4DC2A 2YA9A 4QMWA 4IX5A 3PXRA 4JBPA 2QOQA 3BPRA 4F9CA 2ETKA 4TYIA 4CYIA 2BVAA 5DHJA 4N57A 3FUPA 2YISA 3KULB 5DVRA 2QD9A 4GIIA 3W18A 5CVHA 1YI4A 4AGWA 4J8NA 4ZY5A 3HV5A 4BDHA 4KIPA 3ZRLA 4A4XA 2Z02A 2X6EA 5DR9A 4XV3A 3QD4A 2R0UA 5E1SA 3S3IA 4DF3A 3P86A 4JNWA 4BCPA 2W5AA 5HO8A 4B4LA 2A2AA 4RJ7A 5CSPA 2BZHB 4RJ4A 5AIKA 3N51A 3I1AA 3VF9A 4C4EA 4QTEA 4C4FA 3NVMB 2VO7A 4WG3A 3HMOA 2BRGA 1K3AA 5A54A 4IAKA 4OUCA 4F6SA 2IZUA 2UZBA 4PP7A 5AR8A 3ULIA 4D4YA 4QPMA 2J0LA 1Q62A 3OBJA 3WE8A 3OY3A 5FQDC 4AGUA 4BDGA 5HCXA 2JEDA 4F7SA 4MEDA 4C59A 2FSLX 3GCUA 3U6IA 2PTKA 2Y6OA 4E20A 4BKZA 2UW6A 2BFYA 5IQCA 3FYKX 1IAHA 2QONA 1GOLA 2JKOA 3NR9A 3ZRKA 4I5CA 3CCNA 3UQFA 4PL3A 2J7TA 2UW9A 3FLWA 4CFNA 4DFYA 3UO4A 4Z16A 4RC4A 4GK4A 4FSZA 3R9HA 3F82A 3Q04A 4J95A 4D1ZA 3KXNA 5HHWA 2I40A 2W1FA 2F9GA 1LPUA 2BMCA 4IWDA 4FG9A 5HIDA 3RWQA 2R7BA 2V5QA 4XBRA 4F9WA 4O7VA 5A9UA 4EUUA 4DFUA 3GU5A 3SV0A 2Q0BA 4RIWA 3ERKA 4L3JA 5CEIA 2XNMA 2R3LA 3HV6A 5JFSA 1OPLA 4U79A 2Q83A 5IH5A 3CGFA 1UWHA 5FEEA 4FTLA 2HXLA 3PTGA 3NSZA 3BYUA 4LL5A 4QOXA 2WMAA 4HNFA 2C0OA 4O7TA 3H4JA 4YC8A 5E91A 5CENA 3ZLXA 5L4QA 4M67A 3D9VA 3AT4A 3Q9YA 3R7GA 4L01A 4K6ZA 4YLKA 4RC3A 1XH7A 1PMUA 2W06A 3COKA 3E7VA 3LFCA 5I9VA 2W9ZB 4CZUA 5CI7A 5DA3A 4MH7A 5FXSA 1W0XC 1H25A 2WEVA 5TR6A 4DEDA 4NIFA 4C2WA 1ZWSA 5KBQA 3OW4A 3PXZA 2E9VA 2IVVA 4YZCA 4NFMA 2RL5A 3UC3A 5HG5A 2C5NA 2EB2A 2JKQA 1YXVA 3ZUUA 3ORMA 5BYYA 4A9RA 3K3IA 3RK7A 2W1HA 3S4QA 2PVLA 1YWRA 4EOLA 2XIRA 5LXMA 4A4LA 2W1DA 4FTAA 2RG6A 2C6EA 3QTIA 2XKDA 3HA6A 4XS2A 1IR3A 1YVJA 2YEXA 3QTWA 3IS5A 5ANOA 2QHMA 3D5VA 3EYGA 2WKMA 5L8KA 3FLNC 4EOMA 2ITTA 2I0HA 2UZLA 2GFSA 3KVWA 2GTNA 2J0KA 4DEAA 4GYGA 1JQHA 1XO2B 5ANEA 2ITXA 2G2FA 2DS1A 3AC4A 4D4RA 4ZTMA 2UW5A 4S33A 5CAOA 4PNIA 2R9SA 3ZYAA 4H3BA 3S0OA 2HZ0A 2X1NA 5IUHA 4C36A 1XBAA 4EEVA 4R3RA 1J7UA 2GHMA 4FV9A 5IQEA 4EH6A 4R3CA 2P0CA 2B9IA 2QI8A 4P5ZA 3R8ZA 5J79A 4WD5A 4O1OA 1ZXEA 4PTGA 3UO6A 4K18A 4CFVA 5KNJA 3ZLYA 3TTIA 4QO9A 4F70A 5T3QA 3NRMA 4HVSA 4O22A 4G34A 3UVRA 4AE9A 4RIOA 4E7WA 2BROA 3CGOA 3RNIA 2W4JA 4W4VA 5I3RA 1OIQA 4EOKA 3K3JA 3EQCA 4GKIA 1OGUA 2ZB1A 3UIBA 3ZXTA 1H07A 4ZIMA 3AT3A 2WIPA 2P3GX 2XH5A 3VO3A 3A60A 3NZ0A 5C9CA 1OL6A 4EKKA 4F7NA 3NMUF 5AUTA 1FINA 4YMJA 2QOOA 2JGZA 5DGZA 2YDJA 3RK5A 4D4VA 3UPZA 2YCQA 3ORPA 3GFEA 5AR7A 3V01A 3GQIA 4BFMA 4F09A 4A9SA 4PDYA 4M7IA 2ITPA 1AGWA 1H8FA 1KE7A 2R3JA 4IQ6A 4BRXA 3A4PA 4G17A 1ZYJA 3LFNA 2OO8X 3DU8A 3R1YA 5AP4A 4BWPA 3CP9A 5JZNA 3RPYA 5BVNA 5F9EA 4TNBA 4YJRA 1IA9A 4O6EA 4Z9LA 5CEMA 4XLIA 4KKEA 4XCUA 1WAKA 5J9LA 3I81A 5CXHA 5HVYA 4RWJA 2HXQA 3HL7A 4KBCA 5L6OA 3MDYA 3QZFA 4FTNA 2VNYA 3QUPA 4E4NA 1JSVA 3TKHA 3HP5A 4GK2A 5CS6A 4CV8A 4UBAA 3VF8A 2JDTA 4KA3A 4BTMA 3ZO1A 3TTJA 4CRLA 3R1NA 2XNNA 3QA8A 3U55A 4P4CA 4YZDA 3R2YA 3PPKA 4LGGA 3GCPA 3PA5A 4NT4A 4F9AA 3RNYA 4PV0A 4JIKA 4YC3A 5TKDA 1E9HA 5L8LA 4YTCA 3R00A 2E9UA 3L8VA 5AADA 2Z7LA 1PXMA 2C6IA 4X3FA 3I4BA 1LP4A 1M7QA 3LE6A 4RT7A 2IWIA 1H1WA 4UMTA 4EH9A 1J7IA 4UWYA 2ZM4A 5BUJA 4BBEA 3P9JA 4M69A 3WILA 3U54A 3KKVA 4C4IA 5D11A 4CSVA 4HJOA 3C13A 2DYLA 1XH9A 2JAMA 2HW6A 5F20A 4R8QA 4PY1A 2JD5A 4MXAA 4L67A 2EXCX 1CKPA 4D2SA 3KRWA 3ODZX 5AFVA 3WIKA 4JRVA 3AMAA 3FKNA 3I6UA 2J5FA 2VTJA 5LWMA 3BELA 1JLUE 2EWAA 3E87A 4D55A 2OH4A 3AOXA 3V04A 4WBOA 4EOPA 5F4NA 3VUDA 2ITNA 4AFJA 3V51A 2B55A 4O1PA 4PTEA 3QGWA 3F2NA 4Y72A 5BVEA 2PUUA 2Y0AA 4FL3A 3SAYA 5CU0A 4U3ZA 4NIFB 1YWVA 4IXPA 5E90A 3PVBA 3PJCA 5EDPA 3TDWA 3ANRA 1YI6A 4FTUA 4TWOA 3QYZA 2CCIA 5EHOA 2IG7A 1REJA 1ZZLA 4J99A 4PMSA 4RQKA 2PZYA 3CXWA 4FKJA 5CY3A 5AP1A 1OUYA 4A06A 4K11A 1NXKA 1OIYA 5K5XA 5KZIA 3FAAA 4ZP5A 5AX9A 1T46A 5EM7A 1OMWA 5E8YA 3D94A 3ZZWA 4EK4A 4I4FA 1PHKA 3PJ1A 5GIPE 3OROA 4UY9A 5JMSA 3KQ7A 3RK9A 5FBOA 4I24A 1H1PA 4YHTA 1O6YA 1A48A 4QMZA 4M68A 4IZ5A 3CTQA 2YIXA 2OK1A 2XS0A 3NIZA 2OLCA 3EQRA 1VYWA 2QO9A 4O0YA 4YU2A 2JDOA 5EDRA 2XK8A 3LFFA 3D7ZA 2OZOA 5E8ZA 1E1VA 2JC6A 2QG5A 4JR7A 3A2CA 2B54A 4FOBA 4NSTA 2XK4A 3A7FA 4BCJA 2YIWA 5G1XA 3R02A 4TWNA 4O6LA 3MH1A 1K9AA 4FF8A 4OTWA 4RX9A 3VUKA 4DBNA 3F9NA 3HRCA 5JFXA 2NRYA 3BHTA 2FVDA 3V6SA 4BBMA 4Z7GA 5BVWA 4G6LA 4L8MA 2XIKA 4CGAA 3AD4A 5ICPA 5KBRA 3IGOA 3SX9A 2OIQA 5M08A 3QLFA 4PMPA 3VS5A 3O0GA 5M4IA 2YM3A 5M56A 5DT0A 2HZNA 3ACJA 4GT3A 3VQHA 3IDPA 5I9WA 4JBVA 3RM6A 5JH6A 3BE9A 2PUIA 4IX4A 4MK0A 4CFFA 3NYVA 2XCHA 2YIQA 2VTPA 2FB8A 4V04A 3UBDA 3G15A 2IZTA 4X21A 1OIRA 4EOSA 1BX6A 4DFNA 2J0IA 4E73A 4GU9A 3UYTA 3BYMA 3KFAA 2E9OA 3EQGA 4Y8DA 1W98A 4MKCA 3RWPA 3MVMA 3EN5A 5JEBA 3SW7A 3VWAA 4B0GA 4OTRA 3NUPA 2QOIA 3BLHA 5EFQA 5HU9A 1R39A 5KMIA 1L8TA 2R3GA 3EN9A 3Q96A 3Q9WA 2V0DA 4O21A 4S34A 5H9BA 3BYOA 5KMMA 4DE4A 3HUCA 3QZGA 2PVYA 2ZV8A 3ITZA 4ANBA 1U59A 4FTRA 2WIHA 4Q2AA 1TKIA 3MB7A 1XBCA 4GVJA 4O38A 4YTFA 3AC1A 2B1PA 3FLSA 2IVSA 3MH3A 4PL4A 3QLGA 4RWKA 1HCLA 1OKWA 3BRBA 5JT2A 4HYIA 5EI8A 3ELJA 2B52A 2XNOA 2J90A 4PDSA 3UZPA 1JKTA 5GHVA 4LGDA 5E1EA 1MQBA 5LQFA 1KE6A 4W9WA 3RVGA 2FSTX 1M17A 4ENXA 4P5QA 5HG7A 2PMIA 4FKSA 3S00A 4OTHA 3ZLWA 3AC3A 4CTCA 3KCFA 4IJPA 4O91A 3QQFA 3R6XA 4QD6A 3T3UA 4L00A 4BCKA 2WD1A 3W2SA 2WPAA 4L6QA 4LUEA 4CCBA 4EQMA 3F7WA 3C50A 4TRLA 4ZMEA 3PSCA 4FTQA 1TVOA 3BCEA 4I5HA 4C35A 4FKGA 3O17A 2PVMA 1H24A 4QP9A 3QWKA 4U43A 4IJ9A 4X3FC 3A7JA 3WI6A 3HECA 3TUBA 3FI2A 5CF8A 4FSNA 4XV1A 2XF0A 2YABA 3LMHA 4ANSA 3VVHA 4ACGA 2BALA 4M69B 3FKOA 2P2IA 4W8DA 2ZM3A 4M97A 2GHLA 3LCSA 4WRGA 4FKOA 4PX6A 4XV2A 3W2QA 1BL6A 4R5SA 3R9DA 1KV2A 3FXZA 4YJNA 2X6DA 2YLEA 3Q60A 1U54B 5B7VA 3DK6A 4J1RA 2JKKA 1Y8GA 5AR3A 3UC4A 4PF4A 2C1BA 5AUWA 4FIIA 1V0OA 3RM7A 2C6KA 1Z57A 2XB7A 4QYYA 3S2PA 3KXZA 2ZAZA 2BTSA 3PWYA 2P33A 1SVHA 3AD5A 3U4UA 3UOLA 2WEIA 4FV0A 3IOKA 5F95A 3FZSA 4BCGA 2XUUA 4DEBA 4JJRA 4E5AX 3VBVA 3BEAA 3PSDA 3CQEA 3LQ5A 5EK7A 5A3XA 5T68A 3U9CA 1JVPP 4GFGA 4PRJA 4WKQA 3BHYA 5BYLA 3PFQA 4CG9A 1XKKA 2HCKA 2JDSA 4O7YA 4GG7A 3A4OX 2BR1A 2B53A 3DK7A 3PRFA 3R22A 3QX4A 3SQQA 3VRZA 5JGBA 5HD7A 4TT7A 4KB8A 2UW4A 1W7HA 1QL6A 4QTAA 5CVGA 4FYOA 3R2BA 5CT0A 5DH3A 3CR0A 4QMNA 5CVFA 3POZA 5BVOA 2QC6A 4EQUA 3KA0A 3UNKA 2R5TA 3JYAA 4RLLA 2XNGA 2C3JA 4YPDA 3I5NA 3T3VA 4D5HA 4L7SA 4BDBA 3QZHA 4KS7A 4I0SA 4BDDA 4EHZA 2PU8A 4FSRA 2CKQA 2QLUA 2ITVA 3GCQA 3E88A 3KMMA 5FXQA 3FHIA 4A7CA 2WMWA 5E8SA 4USFA 1Q61A 3QZIA 3RALA 4B9DA 1R0EA 1UU7A 2R3MA 2YITA 3OD6X 4FEXA 4BHZA 4CV9A 4WG5A 4F63A 1QPJA 4PPCA 1H1QA 3GGFA 2NRUA 4L3PA 4XHKB 4CYJA 2V55A 3E8CA 2X39A 4YZNA 4BR3A 3BI6A 5FDXA 4FIEA 5HU3A 4IB3A 3G0EA 4Y95A 4P7EA 1NY3A 3ZC6A 1PKGA 2C3LA 2NO3A 2HW7A 5M4FA 4A9UA 4FEWA 1BUHA 3L9PA 3MN3A 5EDQA 4RJ3A 1G8SA 4QNAA 5L8JA 5JFWA 2B4SB 2PE0A 4WNOA 5DN3A 1WVXA 3HMMA 3PPZA 4LMNA 4M12A 2X9EA 2PZPA 3QKMA 4AA5A 1V1KA 1UNGA 3OTUA 2OU7A 3NUYA 3FMJA 3RCDA 1YHSA 3VULA 2RFEA 2PVKA 5C27A 2HWOA 2O63A 2VTLA 1UNLA 2VTAA 4G9RA 2CN5A 5ANDA 4D28A 4GT5A 4DTAA 4OAUC 4LOQA 2GNGA 2RG5A 3OMVA 5GJFA 4CEGA 4O0RA 1DAWA 5A4QA 3WZEA 2V7AA 4IDTA 5IA3A 3LJ1A 3C4WA 3ZC5A 2Y4IC 2IW9A 1Y6BA 3C4FA 1YXTA 4PL5A 1YDTE 4KKGA 1WVWA 2GQSA 3ZDUA 4MQ2A 1J7LA 2OIDA 4APPA 3FPQA 3I7BA 3IOPA 3A99A 4RBLA 3Q5IA 2QURA 4F7LA 1O6KA 2X2LA 3IW7A 2VWZA 4ZSGA 1ZRZA 3QHRA 4PMMA 4U7ZA 2C30A 1M7NA 3FL5A 5EYDA 5HKMA 2XCKA 3REPA 2YHVA 4YBKA 1BI8A 1UKIA 3A7IA 2G1TA 3LJ0A 3P23A 4F9YA 4FODA 3ATSA 4KIQA 1B39A 1UKHA 5CWZA 3E62A 4FKIA 4EBWA 4I6QA 4DAWA 4EWHA 4RX8A 3GCSA 3DFCB 4R1YA 2JAVA 4IC8A 4F0IA 2W1IA 3FY2A 2ETMA 2GS2A 2PUPA 4R77A 3Q6UA 4O7LA 5CASA 1UU8A 1MRUA 3TM0A 2RIOA 4U5JA 4FTMA 3GC0A 4I3ZA 1PXKA 3DLZA 4USDA 4ITHA 3F5PA 1T45A 5IUGA 1H0VA 3BHUA 4JIAA 1QPDA 4RJ6A 1K2PA 3DXPA 2WOTA 3TT0A 1QPCA 4NCTC 4B6LA 2WB8A 3JUHA 2P55A 2IVTA 2WTKC 4FVRA 3FMDA 4XOZA 4CVAA 5IQFA 3HDMA 3DK3A 1PXPA 5GZ9A 5FD2A 5CI6A 4G3FA 4W4YA 4ZY6A 3MIYA 3LKMA 3VBTA 2WTJA 4CXAA 4FSYA 1XR1A 4I22A 2UVYA 1OL7A 1OKVA 4IEBA 4ZLZA 3G9NA 2QR7A 3M2WA 1V0PA 4DEGA 1GZKA 2A1AB 2I0EA 4ACHA 2OJ9A 4ENYA 4GS6A 3ID6C 4KRCA 2JBOA 1FGKA 1PYEA 2QKWB 1Q3DA 2WELA 3PP0A 4PQNA 2OFVA 3CBLA 3W33A 2BDWA 2Z7QA 3LXLA 3H30A 3PVUA 2DQ7X 4JOAA 5AV1A 4GFMA 4B8MA 3OS3A 2XJ0A 4AZVA 4H36A 3OT8A 4IB0A 4L46A 3CPBA 4UB7A 3NPCA 4MBJA 3UOHA 4ZAUA 1XH6A 3AQVA 3TZ9A 4PMTA 4BKYA 3TUCA 3EYHA 3KL8A 4G31A 3ENHA 4HNIA 2QG7A 3KF4A 4XRLA 2GTMA 3WZDA 5B2MA 3CD8A 4PPAA 4DH3A 1V0BA 1UV5A 1PXLA 5ACBC 2Z8CA 3ZZEA 2Y7JA 4O0SA 2H34A 4PWNA 1MQ4A 1OKZA 2OG8A 2WO6A 3DNDA 4JBOA 1YXUA 3DKGA 4BCIA 2XIXA 3QF9A 4OT5A 2QLQA 3GFWA 4BWXA 5JRSA 4ZLYA 1WBSA 3LXPA 3H9OA 3UQGA 3KRRA 3GT8A 4IACA 4FGBA 3SC1A 4MWIA 4N6YA 3AGLA 4KIKB 3DY7A 4AZSA 4H3PA 5CXZA 4CLJA 3LFDA 5EH0A 5FUTA 1KSWA 4BGGA 2O2UA 5LVMA 4LQMA 4U97A 5IMEA 4YLLA 3COIA 5AV0A 5IDNA 1RQQA 4TXCA 3WZKA 3FZTA 3CD3A 3RJCA 4C37A 2O65A 5CTPA 4TZRA 3P5KA 5KMOA 2ZVAA 4O2ZA 2IW6A 1FMOE 5IQGA 3UVQA 4LV8A 4ZSJA 4BCHA 4WHZA 4NM0A 3U4WA 2RFSA 3FQEA 3PSBA 4FKPA 4AQCA 2G01A 2HOGA 3TZ7A 5HOAA 3VHKA 5CF5A 4F99A 3LQ8A 3MYGA 2G2IA 2HZIA 4FBXA 1FVTA 4EZ7A 4MTAA 5IQHA 3UTOA 5IMXA 1B38A 4F6UA 4GFOA 4MNEB 2IO6A 1YKRA 2FSOX 3FLYA 4FKQA 4FL2A 1M2PA 5JN2A 2WTDA 5CU6A 2ITUA 5CU2A 5TO8A 2CMWA 3G0FA 3MPTA 2RFNA 2VU3A 5D9HA 3QTSA 4AT4A 1MRYA 4CT1A 4WO5A 3JS2A 4O2PA 3ZBXA 2UZOA 4I23A 3F66A 4M15A 3R7UA 4L9IA 4Y5QA 4AA0A 4X2GA 3W10A 2VWUA 4ANQA 2BIYA 2Z7SA 4GJ2A 1Q4LA 2PE2A 4KAOA 5H8BA 4WNMA 5AP5A 3CQUA 3NUUA 4FV2A 3CY3A 1ZYSA 3IW4A 2PZ5A 2WOUA 4FTTA 4RIYA 4BIEA 1APME 4KBKA 4OBPA 3OY1A 3ZMMA 3BQCA 3ZUTA 2ZMCA 3AT2A 2O5KA 3BWFA 3R71A 3R04A 3RZFA 4EK6A 3FZ1A 2OIBA 5FWKK 1ZOGA 1GY3A 4FL1A 4OBQA 3RAIA 2V22A 4XMOA 4QMLA 4ALVA 1OPKA 4ALWA 1NA7A 4Z55A 1SYKA 4YGAA 2ITOA 2BDFA 4WOVA 2IW8A 4UALA 3TZ8A 3A8XA 3MVLA 4ZK5A 3R9NA 4BDJA 5HBJA 5E9EA 2H96A 3LJ2A 4MNFA 2JDVA 2C3IB 3NYOA 4FTOA 5K0XA 2PULA 3TV4A 1OUKA 2QOBA 4XV9A 3KCKA 1RJBA 4LV5A 4F6WA 1W83A 3KN5A 5AUXA 3MPAA 5CU4A 3VS6A 2XP2A 3JY0A 5D12A 5TF9A 2HENA 2REIA 5DT4A 3TV7A 2WZJA 3ORIA 4FKUA 3DT1A 4BTJA 3KXMA 2X7FA 3A7GA 4BB4A 2PMOX 4IAFA 3QRTA 4NKSA 4NZWB 4WUAA 4Y83A 3KXHA 1W84A 3RP9A 4WG4A 5AAEA 1CKJA 3V5PA 4E1ZA 3ZHPC 4UYAA 2BRMA 2X7OA 5I0BA 2RGPA 3MVHA 3RHXA 4C8BA 3QL8A 3ZSGA 2FO0A 1OECA 2QO2A 1P2AA 3A62A 4DYMA 4OT6A 4AT5A 3GCVA 2WMUA 2YIYA 3MV5A 3QU0A 3MFRA 4I6FA 3GENA 5FEDA 4YZ9A 3RTPA 4NYEA 1REKA 1MP8A 2R3RA 2JLDA 4KS8A 5BVKA 3R63A 3R83A 4JRNA 4FV5A 3CKWA 4XH6A 3W2PA 1S9IA 3CJFA 3VHEA 3ZSIA 4AUAA 2BZKB 1OL5A 2R3HA 4HGLA 3SXFA 2C6DA 2Y9QA 3FZOA 4Y85A 2HYYA 3DTCA 3V6RA 4C0TA 4E26A 4CKIA 4AZFA 4DN5A 2UZWE 1FBNA 5D41A 2WQNA 3SG9A 4RG0A 2UZTA 3EOCA 3WARA 2CDZA 3QWJA 4LOPA 3HAVA 2PVFA 4FV8A 2J50A 3HZTA 5M57A 1R78A 3HRBA 4U40A 2A27A 5JGDA 3P4KA 5ETCA 5C4LA 3FC1X 3FMHA 4DFBA 2WHBA 3F5XA 4I20A 5AR2A 5AR5A 2BIKB 4C33A 1SVGA 4ORKA 3FI3A 3QTUA 1JWHA 2JITA 3JPVA 4IIRA 5DEYA 5J7BA 2XM8A 4RA5A 2CHLA 4MCVA 3FWQA 3NEWA 5DPVA 3VBWA 2NP8A 4OW8A 1WZYA 2ONLA 1H1SA 3UG2A 4C3PA 3QKKA 5AUZA 4IADA 3V8WA 4CKJA 4EKLA 5EOBA 4JAJA 3MS9A 1R0PA 3QC9A 5DFPA 5M07A 3EQBA 4CCUA 5IH4A 3QRKA 3RCJA 4FVQA 4GMYA 5LARA 4EONA 2VV9A 3RMFA 3V5TA 1GIIA 1Y57A 4GW8A 2QNJA 3UGCA 2YJSA 4U0IA 4FTKA 1KE8A 2J5EA 5CEKA 3BX5A 4A9TA 3UYSA 3AXWA 1XWSA 4QMQA 3PIXA 5BX0A 4IBMA 3NX8A 2BPMA 2OFUA 4FV6A 1FVRA 2F7EE 2R7IA 4G9CA 3WE4A 2ZV2A 4BKJA 4DCAA 4LL0A 3ZOSA 4KSQA 5IZFA 5HO7A 4QTBA 3H9RA 4QYFA 5BMSA 4BCOA 1BKXA 4C7TA 4M3QA 2EVAA 3DDQA 3EL7A 3R7IA 1WVYA 3DKFA 5IA0A 3FMNA 1UU3A 4FK3A 1G3NA 4FUXA 3BHVA 3WF8A 5FTGA 4I5PA 1LUFA 4JQEA 1WBTA 5L3AA 3FSKA 2H6DA 3OCGA 4Q9ZA 3JY9A 2RSVA 2UZUE 3SG8A 2X2KA 3NNWA 3R7YA 2OF4A 2X8IA 3E5AA 5LMKA 4NM5A 4S2ZA 1XBBA 4V05A 3CLYA 2IN6A 3HMIA 2OF2A 4TL0A 3PYYA 4BTFA 3P1AA 5M06A 1DAYA 1U4DA 4CNHA 4EOJA 3KVXA 4M0ZA 3RAKA 4DTKA 3QQJA 4RIYB 3IW5A 3BZ3A 1VR2A 4RQVA 5FM3A 3W55A 1J1CA 3FC2A 4BDKA 2GU8A 3OOMA 4F08A 2WMSA 3PIYA 4C02A 4BYIA 4D2PA 3KRXA 4AE6A 3B2TA 4MYGA 5EM8A 3HDNA 3MA6A 3UOJA 4UXQA 4FTIA 3CEKA 4WUNA 3V5LA 4BDIA 3GOKA 4L44A 4QYEA 4WNKA 3H10A 3Q4UA 4GK3A 3QQHA 3BGPA 2C3KA 3HP2A 4H1MA 2V7OA 3P7AA 3TDVA 4C61A 3DGKA 4QP3A 2UV2A 1CSNA 2XEZA 5CEPA 3THBA 5IDPA 2OJJA 2CNVA 2XBJA 4QT1A 1UVRA 2VO3A 4D1XA 2HAKA 1U54A 4EWQA 4GJ3A 5KMLA 2BRBA 3P78A 4K33A 4RJ5A 2W1EA 4CT2A 4FG7A 1PKDA 4AP7A 2YAAA 5FBNC 3UIXA 5IPJA 5DBXA 5K0KA 4L3LA 4DEIA 2HY0A 3QHWA 3UOKA 1Q3WA 2RF9A 2VX0A 5D7VA 3TNQB 3V3VA 3D2IA 4YUQA 3LXKA 5HTIA 3ZRMA 4W4WA 4U45A 5EKOA 2OWBA 4ZOGA 4FNZA 1XH8A 4R7IA 4KABA 3A8WA 4I0TA 4GCJA 4PPBA 4IFCA 3HRFA 1PMEA 2FYSA 4NFNA 1IAJA 2OI4X 2YM4A 4FG8A 2XK6A 3BU3A 5ETAA 3DAKA 1G5SA 4X2JA 1M2RA 3L9MA 4ANLA 4LRJA 2ZJWA 5EW3A 5FDPA 5J9ZA 4YTHA 4ZJIA 3SGCA 1KWPA 4OTFA 1UNHA 4QMMA 5CSHA 2WGJA 5M4UA 4BI0A 5CT7A 4XRJA 3O51A 2AC3A 4O82A 5KE0A 4FZFB 3HKOA 4IWOA 1J1BA 4Y46A 2GNLA 2JFMA 3MSSA 4B8LA 5AEPA 4FICA 5LVLA 1UA2A 2CCHA 3ZTXA 4M84A 4CFMA 4F4PA 4LFIA 4YJTA 3VNTA 1Q5KA 3GC8A 4FTJA 4JAIA 1WBVA 3VBYA 4AZTA 4W9XA 2YLFA 5T6KA 2HY81 1JAMA 3ZO2A 4BYJA 4C38A 4RWLA 5ETFA 5E8TA 5JQ5A 2R3QA 4ZS0A 3R01A 4PP9A 3KREA 3F2AA 3DB6A 3EB0A 3QQUA 4NTSA 3DJ5A 3FPMA 4EYJA 5IEYA 2LGCA 4L7FA 3NGAA 4FIGA 2VAGA 3FLQA 3C7QA 3NNXA 3SD0A 5KX8A 4GKHA 4O7WA 1Y8YA 1PXNA 1SZMA 2X9FA 4EJNA 5JRQA 2PE1A 4PDPA 3BU5A 1YHWA 4U3YA 3VAPA 3F7ZA 2ONLC 2WU7A 2BFXA 3QA0A 4OTIA 5E8VA 4GYIA 4UMRA 5FG8A 5GJDA 3CTHA 3C1XA 4BN1A 2FUMA 5TT7A 5IQAA 4AN3A 2I7QA 1SMHA 2VX3A 4TW9A 5KUPA 5C03A 4A9YA 5DOSA 4YP8A 3V5JA 5J9YA 3EQIA 3OF0A 5L6WL 3PDTA 4F65A 3O2MA 3ORXA 4ZY4A 3VS4A 5HE1A 1Z9XA 3G90X 3MH0A 4QNYA 4YSMA 4BWKA 3MB6A 3TL8A 1ZMWA 4EH3A 3D15A 5FM2A 1XJDA 5A6NA 3C9WA 4BZOA 4K8AA 4MBLA 2Z2WA 4EORA 3NAYA 3TWJA 4CMUA 2W4OA 2YM5A 3TN8A 1SVEA 2C5OA 4IB1A 2PY3A 3K5VA 4MXCA 2J9MA 2ZM1A 3QALE 5CSXA 5AUUA 1WMKA 4O0UA 5I9UA 2CNUA 2P4IA 2VWVA 4UX9A 3C0GA 4HVGA 5K4IA 5LMKC 3RPOA 5I9ZA 3SA0A 1BL7A 2B7AA 3QTRA 4WSQA 1CDKA 4Z3VA 2A19B 4JQ7A 2WU6A 4JLCA 1ZYCA 3OXZA 4FEVA 4N70A 3SRVA 4XG6A 3VUTA 3W8QA 4ACDA 5BMMA 5CF6A 1YXSA 3OCSA 3OG7A 3FV8A 4HYSA 3GC9A 3DAEA 3D5WA 1PXIA 4GUBA 3G9LX 3HEGA 4AW2A 3OUKA 2W99B 4HZRA 1U5RA 3F3TA 2UUEA 2YFXA 5IQBA 4F9BA 2UVXA 1HCKA 3O96A 3GB2A 2W5BA 1OL1A 5GJGA 4J97A 3UO5A 2Y6MA 3FE3A 4E3CA 5HCZA 2J51A 1FVVA 4AW0A 5EOLA 4TY1A 5C8KA 5HORA 1NW1A 2BRNA 4Q5EA 4AGCA 5IUIA 4AW1A 3NW5A 4BGQA 3TG1A 5A4CA 3TIYA 3W16A 5HNGA 1Q8UA 4GVAA 1GAGA 1O9UA 3OWJA 4WIHA 4DG2E 5FXRA 4USEA 3SOCA 1FQ1B 3LOKA 3BBWA 2BAKA 4S30A 4XYFA 3BBTB 4UWCA 4DGOA 2UZNA 2PYWA 4APCA 3H9FA 3KMUA 1ZYLA 3ZONA 5A4EA 3QTQA 3UP2A 4MD9E 4EHEA 5I9XA 4QP8A 2HZ4A 3Q52A 1CM8A 3LM5A 5I9YA 4RGJA 4UMPA 2YWPA 3DTWA 3WF9A 4DH8A 3PLAE 3G2FA 5JFVA 3HA8A 3EQDA 1LEZA 4DBXA 3T9IA 2QU6A 3KC3A 3DKCA 5J87A 3QBNA 1F3MC 4XG2A 4AOIA 2W7XA 2VO0A 3M11A 3QAME 4D1SA 2XKCA 5CQUA 2JBPA 1F5QA 4AOTA 2GNFA 4H1JA 2ZV7A 4XG3A 5K3YA 3IKAA 2VGPA 3HV7A 3E8NA 4YJQA 1IASA 4EK3A 3MGYA 3DPKA 4YURA 2UW8A 4IVDA 5HVKA 3MESA 4QMUA 2CGXA 4HW7A 4AU8A 2W1GA 5DE2A 3NWWA 4J96A 3VIDA 3MTFA 1URCA 4QP4A 2WTVA 3ZO3A 4U81A 1GZ8A 4O27B 4IWQA 2VWYA 1VEBA 5CANA 3DDPA 2OKRA 3PXKA 3LCKA 4HVHA 5J5SA 4EHGA 3RZBA 4KIKA 1P4OA 3NIEA 3MFUA 1G8AA 4YHFA 4N4SA 5CAPA 5HG9A 3D7TB 5HQ0A 5EI6A 4A07A 5EW9A 2PVJA 2QHNA 2XK3A 2YERA 1M52A 3DBQA 4MX9A 1KE9A 2QO7A 3NUNA 5EYKA 5HGIA 3ZLSA 3QYWA 4ALUA 4HYUA 4FSTA 3FSFA 4JX3A 5DRDA 4YO6A 5C26A 5AAGA 3EKNA 5HE3A 2GFCA 3QCYA 5DG5A 1BMKA 4MWHA 4ZSEA 2I6LA 4UZHA 4NU1A 2VTHA 3PXFA 1FMKA 4ZSLA 3P7BA 3PLSA 4WRSA 1BYGA 2CN8A 3CQWA 5J1WA 3KRLA 4RMZA 4CMTA 5ACKA 4DT8A 2IPXA 3O7LB 4C3RA 1OZ1A 3F69A 4IC7A 3PRIA 4MNEA 5HBEA 4TNDA 5LCJA 4ANMA 4IAAA 3JVRA 4NTTA 2PVRA 3ZU7A 1X8BA 2WMXA 1MRVA 2AUHA 4FSUA 1ZAOA 3D14A 3VRYA 3K54A 4P90A 4D5KA 5TE0A 2A4LA 4MBIA 4E4LA 2YIRA 5IU2A 5CAUA 2PWLA 2VWBA 4IM3A 2VD5A 5HIBA 5TOZA 2VTMA 4EQCA 2ACXA 2R3IA 4ZTSA 3AG9A 3OXTA 4JXFA 5J95A 4DEEA 2VTIA 5GZAA 3KF7A 1FOTA 5I4NA 3DKOA 3ATTA 1H0WA 4L53A 1ZMUA 3Q53A 3C0IA 3RKBA 2GMXA 5DR2A 3ZEWA 1QPEA 1Q8TA 2C68A 4O84A 2P2HA 4E5BA 2CPKE 4IAIA 4WT6A 1AD5A 3SRVB 3TJDA 3C4ZA 3DXNA 1NVRA 1KUTA 4RJ8A 4IVBA 4R7HA 4KBAA 5IA1A 4G3DA 4QMOA 5B2LA 2YCRA 3W8LA 5H8GA 1P14A 4U80A 2YZLA 4QQJA 3S1HA 3LVPA 4I4EA 1ZMVA 4V0GB 4NM7A 5C8NA 2GCDA 3UPXA 3I0QA 4F64A 2R3NA 3CPCA 4QP6A 3GXLA 3NCZA 2PMLX 5E7RA 5EHYA 1KOBA 3HUBA 5HX8A 3DOGA 3C4EA 3DA6A 4X2NA 2ZDTA 3EHAA 4QTDA 1W8CA 3E3BX 2JDRA 3ORNA 4XNEA 5AM7A 3TNHA 3U8WA 4F0FA 2QOLA 5GIOE 4ASXA 4JQ8A 2GS6A 4CFWA 2YCFA 4O86A 3LFEA 4RX7A 3PZEA 3EJ1A 5HESA 3U6JA 3QUEA 4ZZOA 4QQTA 5AV4A 3W1FA 4WNPA 1H00A 3OW3A 5E4HA 3NAXA 4IW0A 4JG8A 3WF6A 2R3FA 3OCTA 4RVLA 4FNWA 3A61A 4DHFA 4CQEA 5LVOA 2Y8OA 5AP0A 5GNKA 5CLPA 5HLNA 2F4JA 3I7CA 5BVFA 4ZTNA 2OJFE 5CNNA 5KHXA 4DLJA 3LZBA 3R1SA 4IH8A 2WQMA 4N6ZA 5AUVA 4DGNA 4R1VA 2EXEA 4ZEGA 4FKLA 5ETIA 1PXJA 3GC7A 4TYGA 2UW0A 3C4CA 2ZDUA 1PMNA 3Q5ZA 2WMVA 4X6QC 5CAQA 1QCFA 5ITAA 5HZNA 3EQFA 4C4GA 3F3VA 3NUSA 4I41A 4DT9A 3CY2A 5J8IA 3U6HA 2VN9A 2QVSE 2EB3A 4L45A 4N0SA 4TWPA 3SXRA 4KWPA 5BYZA 3OUNB 3VS7A 3RI1A 4BY9E 1RW8A 4O96A 2WMQA 4G6OA 5AM6A 2EU9A 4IB5A 3RHKA 3RINA 3SVVA 3O71A 1A9UA 2C5YA 4ACMA 4G2FA 2XVDA 5HCYA 5KMKA 5AP2A 2ZMDA 4TYJA 3D5XA 4O0VA 4KRDA 5M09A 4AAAA 3EH9A 3Q2MA 3VS3A 3FMMA 1UU9A 4X7QA 3TACA 2DUVA 3LIJA 2XNEA 2BZJA 4YJOA 2UVZA 4EH7A 3FZRA 1JNKA 4BIDA 3A7HA 4XG4A 3FJQE 4BDFA 2GHGA 3BHHA 4J52A 3BWJA 3I60A 4IZAA
chains in the Genus database with same CATH superfamily
1Y6AA 2PL0A 3QRUA 1Q8WA 3NDMA 2OXDA 3GEQA 3PXYA 3QCXA 4JVGA 2F7ZE 3IO7A 4QP7A 2PVHA 1ATPE 2BHHA 3OCBA 3FQSA 3UJGA 1I44A 4O7SA 3UDTA 1NVSA 4ASEA 2KULA 2QCSA 3TXOA 1PMVA 4EOIA 4QTCA 4WBBB 4D9TA 2JIUA 4FMQA 4BCQA 2I0VA 3EFJA 4FYNA 3FLZA 2QR8A 3LFQA 1GIHA 4RZVA 1Q8ZA 5HG8A 2XM9A 2C0TA 2G9XA 2C69A 4DH5A 3EFWA 5HTBA 4E4XA 2QODA 4MD8E 4O7RA 3FXWA 2BKZA 2WMRA 3EIDA 3WOWA 4M14A 1ZY4A 4FKWA 2W1ZA 3OFMA 1YQJA 3PG1A 4D2TA 5IEXA 3EL8A 5DMZA 2BRHA 2ZOQA 1W2CA 4OBOA 4M0YA 3VW6A 3LPBA 4IAYA 3U51A 3FYJX 3IK3A 3NYNA 3OEZA 1U46A 3E64A 1VZOA 2C6LA 4DFZE 4OTGA 4IANA 5HLPA 4MVFA 5EM6A 3ROYA 4IWPA 2V62A 5ANGA 3PE2A 4BL1A 3TJCA 4EC9A 4XBUA 1OBGA 3KXXA 5HICA 5L2TA 4JG6A 4JS8A 1PYXA 2C6OA 2HWPA 2WXVA 2XIYA 2ZYBA 3QKLA 3SKCA 4AWIA 2GS7A 2C5VA 4BDEA 3LM0A 3MH2A 4IM0A 4JDHA 5IA2A 5DYJA 3VC4A 3ACKA 4UYNA 2JIIA 4ZZMA 1WBWA 1TQIA 3FZPA 3BLRA 5EHLA 3VUGA 5LMBA 2Y4PA 4IX3A 3LW0A 1XH4A 4RVMA 3NYXA 3VBXA 2VNWA 2CJMA 4J98A 4RIXB 4C62A 3ANQA 3PWDA 4RFYA 3S95A 5CZHA 2ITYA 3F5UA 3SXSA 1ZLTA 3PXQA 4RWIA 2CLQA 3G5DA 4TPTA 4HCUA 1OM1A 3G6GA 2WAJA 4B7TA 1RDQE 1XHAA 3F3WA 1UWJA 3PVGA 4WA9A 4WSYA 5HNBA 5HI2A 2FGIA 3BIZA 4FKTA 3KRJA 4LI5A 3G6HA 5G6VA 4G6NA 4FA2A 4ZXTA 3ORLA 3T9TA 4RX5A 4UZDA 1J3HA 4O0XA 3LCOA 5IG1A 3ALNA 2OXXA 3L9NA 2XMYA 4DINA 4L43A 2A0CX 2VTTA 2X4ZA 3OTVA 3SLSA 3MFSA 1QMZA 3DBFA 4E93A 4EH4A 5C1QB 3N4VA 5A6OA 3HMPA 4LUDA 5HEZA 4I93A 4MAOA 3G51A 5M53A 4IDVA 3FQHA 3QCQA 5LWNA 3PP1A 2IZRA 5L2IA 1OIUA 2GNIA 3UODA 3LFBA 4YLJA 3M1SA 4AX8A 4H05A 3EMGA 4NJDA 4YJUA 3WYXA 2W17A 2ESMA 3EFLA 4NEUA 4I6BA 2JFLA 5HE2A 1R3CA 3GU7A 4K9YA 3VUMA 5DR6A 3II5A 4KKHA 3KMWA 3DBEA 4FSMA 3WZJA 4QMXA 2QOFA 1SM2A 4I5MA 3HMNA 3TCPA 5HNIX 4O0WA 4IHPA 5CEOA 1ZY5A 4FTCA 4BHNA 1PRYA 4QMVA 2XJ1A 4IX6A 3K5UA 4JG7A 4NUSA 1OI9A 1JSTA 2PPQA 2WQBA 2XZSA 5E92A 4AXAA 4U8ZA 1Z5MA 2OH0E 4TYHA 4X6RA 5GINE 3R21A 1F0QA 3MY0A 4J8MA 3TIZA 4RFZA 4V01A 4YJVA 4AA4A 4BVUA 4UV0A 4FIFA 3QRJA 2XRUA 4XG7A 3OT3A 3HGKA 3R73A 3T8OA 1YXXA 4FC0A 3MWUA 5DEWA 3Q4ZA 3COHA 5BVDA 1H26A 5B0XA 3VS2A 4FKRA 4JR3A 2OW3A 3DLSA 1IRKA 5FGKA 3FL4A 5FP6A 4O7ZA 4O83A 2EXMA 4QRCA 5J5TA 1U5QA 3PE1A 4D0WA 2XJ2A 3HNGA 2O64A 3DB8A 4ASZA 4EJ7A 1Q24A 3BV3A 4MHAA 4MXZA 4UMQA 4EBVA 3L8PA 2PZRA 4EHVA 1JKKA 3MTLA 2XALA 3I6WA 4R78A 5BPYA 4QDEA 3LQ3A 3IDBA 5H3QA 3DS6A 3CKXA 1IG1A 2X2MA 3W0SA 5CYIA 3QQKA 2WNTA 3GQLA 2ETRA 4JDIA 4FIJA 4M8TA 5JK3A 3LXNA 4BZNA 3OEFX 4FEQA 2VZ6A 2YDIA 4EI4A 4EL9A 3K2LA 5B2KA 3BKBA 1DS5A 4Y73A 2CSNA 3H0YA 1ZYDA 3LCDA 4PDOA 4D58A 2HELA 2R2PA 2SRCA 2YM6A 3QD2B 5AWMA 3FXXA 4CTBA 5C8MA 4AZWA 5AA9A 4L42A 3BQRA 4K1BA 3QD0A 4YC6A 3P7CA 4ANOA 2XRWA 2VWIA 4XEYA 3TV6A 3TZMA 4DHJA 2W9FB 2C1AA 3CTJA 3OC1A 4QP1A 4TKSA 4BZDA 4NM3A 3BU6A 2HIWA 2C6TA 2PK9A 3OWKA 4FSWA 4X0MA 5EQYA 2XBAA 3OHTA 4XOYA 5AV3A 2XNBA 2BZIB 3OBGA 1IEPA 4J53A 3SDJA 4ZZNA 2IEWA 5DNRA 1BLXA 3VBQA 5IEVA 4FEUA 4YZBA 3H0ZA 1EH4A 3TYKA 3PA4A 2X7GA 5ANKA 2QQ7A 2XNPA 4KINA 4M66A 4F0GA 4CFXA 3RAHA 3KU2A 2BAQA 2XK7A 5JSMA 3H3CA 4FT3A 3R8LA 3QC4A 2YM7A 3JVSA 3N4UA 1URWA 2R4BA 5AX3A 4R3PA 2WTIA 3Q9ZA 2YDKA 4FT5A 3EKKA 3EN4A 3U9NA 2GDOA 4PTCA 4D4SA 4CQGA 1MUOA 2X81A 4NW5A 2NPQA 4AN2A 3UMWA 2WMBA 4YJSA 5LVPA 4GEOA 4Z7HA 2QOHA 4AN9A 2ZV9A 4GU6A 2G2HA 2Q0NA 3QUDA 4DA5A 4PUZA 2X8EA 2VTOA 3PJ2A 4FRFA 1Y91A 3UNJA 2FSMX 1GNGA 4FSQA 4FV3A 2OICA 3Q3BA 2WTCA 1Q97A 1YWNA 4OR5A 3OXIA 4CZTA 2OBJA 4BGHA 5DT3A 3LLTA 4FV4A 4FZDB 4L68A 4ZMFA 5KMJA 1B6CB 1WBPA 5KMNA 2KTYA 3EZVA 3PY1A 4HPTE 4AGDA 4CMOA 5L2QA 5EKNA 4IM2A 4OTDA 3AC5A 1H4LA 2R3KA 4MD7E 3TEIA 4DG3E 1E1XA 2YN8A 2VTSA 3NFGB 1FPUA 2OJIA 4D9UA 3C5UA 1H27A 4AS0A 2XA4A 4HZSA 4IFGA 4RIWB 5E8WA 3MVJA 4KSPA 3MFTA 3TNPC 3R28A 1R1WA 3PY0A 5JGAA 1YDSE 1JKLA 4HCVA 4BCFA 5DIAA 1I09A 1KOAA 4FX3A 4KUJA 2OZAA 3SOAA 5K4JA 4FT0A 3C0HA 2CKPA 3MPMA 5EW8A 3UIMA 3ZXZA 5EQEA 3DV3A 4KIOA 4YNEA 3ZFMA 4CZYB 4U9AA 5HD4A 4FZ7A 4BIBA 5AIRA 3LLAA 3LFSA 1OKYA 3CIKA 1PF8A 3PJ8A 2XYUA 4DGMA 3Q4TA 2QU5A 3BEGA 4E6AA 4XP0A 3N4TA 3UDZA 3GU6A 4BF2A 3WIGA 3ZM9A 3E8DA 4HCTA 3O8TA 4UWBA 3RAWA 3UE4A 4NL0A 3MA3A 4TYHB 1OBDA 4RVKA 4FIHA 4FJVA 2XKEA 2VX1A 3UMXA 3DFAA 1OITA 3BYSA 4K2RA 3OWLA 5IF1A 4LRMA 5EI2A 5ANJA 4A4OA 5BUIA 5AP7A 4X2KA 3IG7A 5AP3A 4IVAA 5LOHA 4G3CA 3O8UA 4DCEA 3L1SA 3LCTA 4G3GA 4ZSAA 2YCSA 4FGRA 4G5PA 5EG3A 1JKSA 5CNOA 2QOCA 3O50A 1TQMA 2G15A 3D7TA 3R1QA 4J71A 2RKUA 2F2UA 3FHRA 2PVNA 3D0EA 3WBLA 3RBWA 4PNKA 4J7BA 4CFUA 3P79A 4X2FA 3QCSA 3ZBFA 2YWVA 3Q32A 1GZNA 4U42A 4ZTQA 4EH5A 4NWMA 2ERZE 1WBOA 1PXOA 5HO6A 5DI1A 3ZM4A 3TUDA 3NW7A 3EWHA 2J6MA 4BTKA 2J2IB 4JL9A 4F1MA 3HV3A 5L6PA 4YHJA 3FBVA 2E9PA 3QX2A 3QFVA 4G3EA 2F2CB 3RPSA 2WQOA 3VN9A 4GH2A 4ITIA 4FV1A 2WTWA 1LR4A 2YZAA 3M42A 3VUHA 3TKIA 2X0GA 2ZB0A 5HVJA 4O81A 3I5ZA 3MY1A 3MI9A 3VONA 2W05A 2VTNA 4XUFA 5K9IA 3R0TA 4HGSA 3AGMA 4CG8A 2Z7RA 3KXGA 1KV1A 3VW8A 2F49A 3NUXA 4YO4A 3UZRA 4YNOA 2AYPA 5D10A 5M44A 3DNEA 4OGRA 2UZDA 3I79A 2VTRA 5I5ZA 5AV2A 4H58A 2LAVA 4ID7A 5LVNA 1TZDA 3OZ6A 4R7BA 3NW6A 2IZSA 3OVVA 4Q5HA 5D1JA 2VRXA 1YRPA 3MW1A 3VJNA 4GSBA 3R30A 4AG8A 4DFXE 2XEYA 4XP2A 4E6QA 2Z60A 3ZDIA 2VGOA 4FNYA 1OVEA 3NLBA 2C47A 2PUNA 4G5JA 4R6VA 3E92A 5EYCA 3V8SA 3F5GA 3ZS5A 3TKUA 3QRIA 2DWBA 5JQ8A 3I0OA 4G16A 5GZ8A 4DGGA 4NK9A 5J7HA 4FZ6A 2XYNA 4OAVB 4II5A 3QD3A 3ALOA 3W2RA 3ZCLA 2XIZA 2OXYA 1P5EA 3AMBA 4ZJJA 3VUIA 5DWRA 4D2RA 2R3PA 4XX9A 5FEQA 5FTQA 3R7VA 2CGVA 4CRSA 3EN6A 4E6CA 3UNZA 2CLXA 2PHKA 3UQCA 4I1ZA 3Q2JA 2CGUA 4LOOA 2AC5A 2J0JA 3HLLA 4UEUA 2C4GA 5F94A 3UDBA 4L52A 4AOJA 5A4TA 4ITJA 4YTIA 4U6RA 4V0GA 4IZ7A 3AC8A 5KCVA 4C4JA 3IGGA 3D83A 1IA8A 3O8PA 3Q9XA 1SNXA 3ENMA 3EQPA 3UZTA 3KK8A 3NCGA 4MXXA 4MF0A 3DJ7A 1M14A 4NW6A 3IECA 5D7AA 4E5WA 2XAOA 3DAJA 4O4EA 2B9HA 4DTBA 2OJGA 3KK9A 3PY3A 4QMYA 5IA4A 2J0MB 3F3UA 2E2BA 1AQ1A 4NJ3A 5AUYA 1W82A 4RZWA 5BNJA 3FDNA 2O8YA 2C0IA 3HVCA 3MY5A 4BDAA 3GU4A 3F61A 3ZUVA 3PUPA 2UZEA 3DBCA 4AF3A 5J1VA 4UXLA 5KHWA 4I0RA 4X3FB 2BUJA 5IKWA 4KNBA 2I1MA 3ORKA 3QQLA 4ZTHA 2IVUA 3ZH8A 5CX9A 2H9VA 4AFEA 3R9OA 3DJ6A 5EQPA 2B0QA 3W2CA 3ZFXA 1O6LA 4FR4A 4W8EA 2VUWA 3D5UA 4D2VA 1DI9A 2JKMA 1J91A 3OWPA 1GIJA 4NCTA 2OZAB 3WF7A 3QQGA 2WQEA 4LM5A 5M4CA 3EQHA 2IJMA 4GT4A 3P0MA 4BDCA 1YW2A 3L8XA 1YI3A 2GNJA 3AD6A 3O23A 1STCE 3QXPA 4XJ0A 5AJQA 2PMNX 4DITA 3DXQA 4CKRA 2FH9A 3GI3A 3W32A 1P4FA 1ZARA 3HV4A 5CU3A 3VQUA 2GNHA 3VS0A 1FGIA 3ORZA 3E63A 4RPVA 3EZRA 2C6MA 1PW2A 1JBPE 3ROCA 5FLFA 5JZJA 4QQ5A 3RPRA 4GIHA 4ZLOA 4HYHA 3MBLA 3AMYA 3ETAA 5H8EA 4H3QA 4XG9A 3BGZA 4E4MA 2BKKA 2BTRA 2BAJA 2ERKA 2EUFB 5LJJA 1XQZA 5KZ0A 4FUYA 5HLWA 4FK6A 2QOKA 4M13A 2XK9A 4HGEA 5E8UA 4ERKA 4RLKA 2BILB 3CC6A 3F3ZA 4O0TA 2W96B 3JXWA 4GV1A 5K5NA 5C4KA 1BI7A 3POOA 4G1WA 2W1CA 3PPJA 4HOKA 3ZFYA 2F57A 3RGFA 4BJJA 1CMKE 4GRBA 4LYNA 4DGLC 3F2RA 5IQDA 3NNVA 2YJRA 3IONA 4GL9A 3DQXA 4D2WA 4YPSA 2HK5A 4D0XA 4DLIA 5BQ0A 4MXYA 4MXOA 4E6DA 1NVQA 4C58A 1YOLA 1JSUA 2ITZA 2RFDA 3BYVA 3Q6WA 4FT7A 3LFAA 4XLVA 3R8PA 3ZEPA 5JKGA 4EH8A 4K0YA 5M55A 4OTPA 4RFMA 2JIVA 2VWWA 3KN6A 2W0JA 2ITQA 4EZ3A 5KO1A 4DHIB 2WMTA 4DG0E 2F7XE 2H8HA 4LMUA 3R8UA 3CSVA 3FKLA 2GQGA 3B8QA 3FMKA 3E8EA 2W5HA 4P2KA 3UG1A 3V5WA 3PG3A 4I94A 3U87A 3ZSHA 4YSJA 5HX6A 3W0QA 4QMSA 4F1OA 1ERKA 4IAZA 2W4KA 1WCCA 1ZZ2A 3IDCA 3R8MA 1W2FA 4ACCA 3KY2A 3BE2A 4JBQA 4BI1A 5IH6A 4HGTA 2BHEA 5CF4A 2NNWB 5DLSA 5DRBA 3GVUA 1YHVA 4LG4A 4EZ5A 4YBJA 2FA2A 4JX7A 5F1ZA 3SHEA 2R3OA 3KULA 4R5YA 4ZTLA 4LGHA 3VJOA 4RRVA 1VJYA 4BBFA 4TYEA 2VTQA 4XG8A 3ORTA 2VO6A 4H39A 1A06A 2J4ZA 3V5QA 3KIOC 3FMEA 3KEXA 3G33A 1SNUA 3GUBA 4C2VA 1DM2A 4FZAB 4EK8A 3W0NA 5CSWA 5FRIA 5LCKA 1CKIA 4GUEA 4K77A 3PIZA 3PA3A 1OL2A 4QYHA 4ERWA 1H08A 5CAVA 2R0IA 3BLQA 3IW6A 3F6XA 4QPSA 3LMGA 1ZOHA 4C4HA 4QMPA 3DZOA 4MF1A 4Y5HA 2VWXA 2Y4IB 5LMAA 2OSCA 3FMLA 4JDJA 2CKEA 3UP7A 4EOOA 4I92A 3WF5A 1YOJA 4RIXA 4ASDA 2O3PA 4ARKA 3E93A 4ZJVA 5A4LA 2C5XA 3L8SA 3IW8A 3IPHA 1XH5A 3MJ1A 4HVDA 3BV2A 4U41A 5E8XA 4BC6A 1G8KA 2YACA 3WZUA 4LRKA 5CZIA 4EYMA 5IISA 3D2KA 4RVTA 1HOWA 3NS9A 3O7LD 3CE3A 4EH2A 4YR8A 4YJPA 3JR1A 4CD0A 1RE8A 1WFCA 3DCVA 4AT3A 4I21A 3ULZA 5A14A 5CSVA 4EOQA 1Q99A 4FT9A 5HBHA 1WBNA 4AACA 3DZQA 3ET7A 3KGAA 1Q41A 4C34A 4UN0C 4FE2A 3RPVA 3D4QA 2X4FA 4QQCA 2UW3A 4ONAA 3HAMA 5L2SA 1H01A 4GG5A 3AC2A 4S32A 1H28A 3DQWA 2O0UA 3EFKA 5AMNA 4CLIA 5HIEA 3GU8A 2B9JA 3QTXA 2GSFA 4IMYA 4W4XA 3COMA 5AA8A 5C01A 3FEGA 4TTHB 4FNXA 3GP0A 4QMTA 5CEQA 3OP5A 2GPHA 3UIUA 4O7NA 4NKAA 3GBZA 2CGWA 4QP2A 3R7OA 4IZYA 2I0YA 3F88A 4BI2A 2X8DA 4Q9SA 3EN7A 4C3FA 4E8AA 4HPUE 1S9JA 5ANIA 2CNQA 3HYHA 3TI1A 3SW4A 4ZS4A 3E7OA 2WTKB 3FY0A 3LAUA 5M51A 2ITWA 4HVIA 3PJ3A 5EM5A 4AZEA 4DFLA 4EK5A 4RA4A 3B2WA 4TWCA 2R64A 2YAKA 1H1RA 1GZOA 4F7JA 3IQ7A 1LEWA 3HX4A 5EYMA 3R7EA 3DBDA 4FV7A 3V8TA 4S31A 4UMUA 2B9FA 4ANNA 1PJKA 3PZHA 2CKOA 4BCNA 4FOCA 1VYZA 3L9LA 4I6HA 1PY5A 5H2UA 1ZOEA 3TNIA 5L2WA 5CALA 2OGVA 5KKRC 1KE5A 5KKRB 1Q8YA 2UZVA 4JDKA 5CQWA 3WYYA 3LMIA 4JT3A 1YDRE 3P08A 2YM8A 4QYGA 4DEHA 5IQIA 3OOGA 1CTPE 4IE9A 1GJOA 4B99A 5BUEA 3NUAA 4X3JA 3MIAA 3LHJA 3B8RA 4BCMA 5AR4A 1JPAA 3ZO4A 5AP6A 1ND4A 3C5IA 3E3PA 4TN6A 4RSSA 1JOWB 1TQPA 3UVPA 4C57A 1DI8A 2PSQA 3QGYA 5HE0A 3C51A 5IA5A 3PVWA 3NVKI 3R8VA 5AAFA 2UW7A 4OTQA 1OPJA 3CS9A 3FI4A 3GOPA 4FI1A 3CJGA 2BCJA 3C4XA 4XP3A 3W2OA 4EC8A 4MQ1A 4EUTA 3FI8A 2WFYA 2PZIA 4JI9A 4ZTRA 1M2QA 4DH7A 5FP5A 4KD1A 5FTOA 2GQRA 3QTZA 4FKVA 4OLIA 3KB7A 3VS1A 3N9XA 4NH1A 1YOMA 2BDJA 3NNUA 4QPAA 4AW5A 4RC2A 4FVPA 4F1TA 4BICA 5A46A 4DH1A 3GNIB 3QXOA 3ODYX 5HTCA 1OB3A 1L3RE 3MJ2A 4IVCA 3BGQA 2E9NA 3TNWA 3R9RA 4YZMA 4U44A 3Q4CA 2QKRA 1NT2A 2XKFA 5I3OA 4DC2A 2YA9A 4QMWA 4IX5A 3PXRA 4JBPA 2QOQA 3BPRA 4F9CA 2ETKA 4TYIA 4CYIA 2BVAA 5DHJA 4N57A 3FUPA 2YISA 3KULB 5DVRA 2QD9A 4GIIA 3W18A 5CVHA 1YI4A 4AGWA 4J8NA 4ZY5A 3HV5A 4BDHA 4KIPA 3ZRLA 4A4XA 2Z02A 2X6EA 5DR9A 4XV3A 3QD4A 2R0UA 5E1SA 3S3IA 4DF3A 3P86A 4JNWA 4BCPA 2W5AA 5HO8A 4B4LA 2A2AA 4RJ7A 5CSPA 2BZHB 4RJ4A 5AIKA 3N51A 3I1AA 3VF9A 4C4EA 4QTEA 4C4FA 3NVMB 2VO7A 4WG3A 3HMOA 2BRGA 1K3AA 5A54A 4IAKA 4OUCA 4F6SA 2IZUA 2UZBA 4PP7A 5AR8A 3ULIA 4D4YA 4QPMA 2J0LA 1Q62A 3OBJA 3WE8A 3OY3A 5FQDC 4AGUA 4BDGA 5HCXA 2JEDA 4F7SA 4MEDA 4C59A 2FSLX 3GCUA 3U6IA 2PTKA 2Y6OA 4E20A 4BKZA 2UW6A 2BFYA 5IQCA 3FYKX 1IAHA 2QONA 1GOLA 2JKOA 3NR9A 3ZRKA 4I5CA 3CCNA 3UQFA 4PL3A 2J7TA 4DHZA 2UW9A 3FLWA 4CFNA 4DFYA 3UO4A 4Z16A 4RC4A 4GK4A 4FSZA 3R9HA 3F82A 3Q04A 4J95A 4D1ZA 3KXNA 5HHWA 2I40A 2W1FA 2F9GA 1LPUA 2BMCA 4IWDA 4FG9A 5HIDA 3RWQA 2R7BA 2V5QA 4XBRA 4F9WA 4O7VA 5A9UA 4EUUA 4DFUA 3GU5A 3SV0A 2Q0BA 4RIWA 3ERKA 4L3JA 5CEIA 2XNMA 2R3LA 3HV6A 5JFSA 1OPLA 4U79A 2Q83A 5IH5A 3CGFA 1UWHA 5FEEA 4FTLA 2HXLA 3PTGA 3NSZA 3BYUA 4LL5A 4QOXA 2WMAA 4HNFA 2C0OA 4O7TA 3H4JA 4YC8A 5E91A 5CENA 3ZLXA 5L4QA 4M67A 3D9VA 3AT4A 3Q9YA 3R7GA 3O5AA 4L01A 4K6ZA 4YLKA 4RC3A 1XH7A 1PMUA 2W06A 3COKA 3E7VA 3LFCA 5I9VA 2W9ZB 4CZUA 5CI7A 5DA3A 4MH7A 5FXSA 1W0XC 1H25A 2WEVA 5TR6A 4DEDA 4NIFA 4C2WA 1ZWSA 5KBQA 3OW4A 4QEBA 3PXZA 2E9VA 2IVVA 4YZCA 4NFMA 2RL5A 3UC3A 5HG5A 2C5NA 2EB2A 2JKQA 1YXVA 3ZUUA 3ORMA 5BYYA 4A9RA 3K3IA 3RK7A 2W1HA 3S4QA 2PVLA 1YWRA 4EOLA 2XIRA 5LXMA 4A4LA 2W1DA 4FTAA 2RG6A 2C6EA 3QTIA 2XKDA 3HA6A 4XS2A 1IR3A 1YVJA 2YEXA 3QTWA 3IS5A 5ANOA 2QHMA 3D5VA 3EYGA 2WKMA 5L8KA 3FLNC 4EOMA 2ITTA 2I0HA 2UZLA 2GFSA 3KVWA 2GTNA 2J0KA 4DEAA 4GYGA 1JQHA 1XO2B 5ANEA 2ITXA 2NYAA 2G2FA 2DS1A 3AC4A 4D4RA 4ZTMA 2UW5A 4S33A 5CAOA 4PNIA 2R9SA 3ZYAA 4H3BA 3S0OA 1OGYA 4AXFA 2HZ0A 2X1NA 5IUHA 4C36A 1XBAA 4EEVA 4R3RA 1J7UA 2GHMA 4FV9A 5IQEA 4EH6A 4R3CA 2P0CA 2B9IA 2QI8A 4P5ZA 3R8ZA 5J79A 4WD5A 4O1OA 1ZXEA 4PTGA 3UO6A 4K18A 4CFVA 5KNJA 3ZLYA 3TTIA 4QO9A 4F70A 5T3QA 4MUQA 3NRMA 4HVSA 4O22A 4G34A 3UVRA 4AE9A 4RIOA 4E7WA 2BROA 3CGOA 3RNIA 2W4JA 4DDIA 4W4VA 5I3RA 1OIQA 4EOKA 3K3JA 3EQCA 4GKIA 1OGUA 2ZB1A 3UIBA 3ZXTA 1H07A 4ZIMA 3AT3A 2WIPA 2P3GX 2XH5A 3VO3A 3A60A 3NZ0A 5C9CA 1OL6A 4O4DA 4EKKA 4F7NA 5AUTA 3NMUF 1FINA 4YMJA 2QOOA 2JGZA 5DGZA 2YDJA 3RK5A 4D4VA 3UPZA 2YCQA 3ORPA 3GFEA 5AR7A 3V01A 3PFYA 3GQIA 4BFMA 4F09A 4A9SA 4PDYA 4M7IA 2ITPA 1AGWA 1H8FA 1KE7A 2R3JA 4IQ6A 4BRXA 3A4PA 4G17A 1ZYJA 3LFNA 2OO8X 3DU8A 3R1YA 5AP4A 4BWPA 3CP9A 5JZNA 3RPYA 5BVNA 5F9EA 4TNBA 4YJRA 1IA9A 4O6EA 4Z9LA 5CEMA 4XLIA 4KKEA 4XCUA 1WAKA 5J9LA 3I81A 5CXHA 5HVYA 4RWJA 2HXQA 3HL7A 4KBCA 5L6OA 3MDYA 3QZFA 4FTNA 2VNYA 3QUPA 4E4NA 1JSVA 3TKHA 3HP5A 4GK2A 5CS6A 4CV8A 4UBAA 3VF8A 2JDTA 4KA3A 4BTMA 3ZO1A 3TTJA 4CRLA 3R1NA 2XNNA 3QA8A 3U55A 4P4CA 4YZDA 3R2YA 3PPKA 4LGGA 3GCPA 3PA5A 4NT4A 4F9AA 3RNYA 4PV0A 4JIKA 4YC3A 5TKDA 1E9HA 5L8LA 4YTCA 3R00A 2E9UA 3L8VA 5AADA 2Z7LA 1PXMA 2C6IA 4X3FA 3I4BA 1LP4A 1M7QA 3LE6A 4RT7A 2IWIA 1H1WA 4UMTA 4EH9A 1J7IA 4UWYA 2XANA 2ZM4A 5BUJA 4BBEA 3P9JA 4M69A 3WILA 3U54A 3KKVA 4C4IA 5D11A 4CSVA 4HJOA 3C13A 2DYLA 1XH9A 2JAMA 2HW6A 5F20A 4R8QA 4PY1A 2JD5A 4MXAA 4L67A 2EXCX 1CKPA 4D2SA 1ST4A 3KRWA 3ODZX 5AFVA 3WIKA 4JRVA 3AMAA 3FKNA 3I6UA 2J5FA 2VTJA 5LWMA 3BELA 1JLUE 2EWAA 3E87A 4D55A 2OH4A 3ML1A 3AOXA 3V04A 4WBOA 4EOPA 5F4NA 3VUDA 2ITNA 4AFJA 3V51A 2B55A 4O1PA 4PTEA 3QGWA 3F2NA 4Y72A 5BVEA 2PUUA 2Y0AA 4FL3A 3SAYA 5CU0A 4U3ZA 4NIFB 1YWVA 4IXPA 5E90A 3PVBA 3PJCA 5EDPA 3TDWA 3ANRA 1YI6A 4FTUA 4TWOA 3QYZA 2CCIA 5EHOA 2IG7A 1REJA 1ZZLA 4J99A 4PMSA 4RQKA 2PZYA 3CXWA 4FKJA 5CY3A 5AP1A 1OUYA 4A06A 4K11A 1NXKA 1OIYA 5K5XA 5KZIA 3FAAA 4ZP5A 5AX9A 1T46A 5EM7A 1OMWA 5E8YA 3D94A 3ZZWA 4EK4A 4I4FA 1PHKA 3PJ1A 5GIPE 3OROA 4UY9A 5JMSA 3KQ7A 3RK9A 5FBOA 4I24A 1H1PA 4YHTA 1O6YA 1A48A 4QMZA 4M68A 4IZ5A 3CTQA 2YIXA 2OK1A 2XS0A 3NIZA 2OLCA 3EQRA 1VYWA 2QO9A 4O0YA 4YU2A 2JDOA 5EDRA 2XK8A 3LFFA 3D7ZA 2OZOA 5E8ZA 1E1VA 2JC6A 2QG5A 4JR7A 3A2CA 2B54A 4FOBA 4NSTA 2XK4A 3A7FA 4BCJA 2YIWA 5G1XA 3R02A 4TWNA 4O6LA 3MH1A 1K9AA 4FF8A 4OTWA 4RX9A 3VUKA 4DBNA 3F9NA 3HRCA 5JFXA 2NRYA 3BHTA 2FVDA 3V6SA 4BBMA 4Z7GA 5BVWA 4G6LA 4L8MA 2XIKA 4CGAA 3AD4A 5ICPA 5KBRA