5FEDA

Egfr kinase domain in complex with a covalent aminobenzimidazole inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
288
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDEMDDVVDADEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Discovery of (R,E)-N-(7-Chloro-1-(1-[4-(dimethylamino)but-2-enoyl]azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), a Novel, Potent, and WT Sparing Covalent Inhibitor of Oncogenic (L858R, ex19del) and Resistant (T790M) EGFR Mutants for the Treatment of EGFR Mutant Non-Small-Cell Lung Cancers.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 288
sequence length 321
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fedA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fedA01
2GU8A 4MK0A 3V5WA 4CTCA 2VTRA 3CTHA 4O1OA 3C1XA 4BIEA 4TW9A 2J51A 4DF3A 2QODA 4IWOA 3R8LA 2V62A 3RWQA 2OBJA 5AV0A 2YWPA 4YGAA 3DDPA 3QRJA 4MEDA 2I0HA 1WBVA 4J8MA 4U7ZA 3WARA 4CGAA 3QUEA 4QPMA 4C02A 1ZMUA 3IK3A 1U5RA 4RFMA 5L2SA 4CFFA 2I6LA 3DKOA 5L6PA 4OAVB 2Z2WA 3HX4A 2J4ZA 3EWHA 1Z5MA 5H2UA 2XYNA 1V0OA 2W99B 3UODA 1ZARA 3T3VA 3VHEA 5I9YA 2OW3A 4EQMA 4J98A 4X2JA 2C3JA 2CKOA 4I4EA 4CRSA 4MCVA 3AG9A 2A0CX 2CGUA 3JS2A 4G5JA 4O7RA 5I0BA 2UW9A 2YCFA 3QQJA 3EN9A 3V5JA 3I0QA 3NZ0A 5CVGA 5C27A 4F9BA 5G6VA 3RINA 4D4RA 5AADA 5CY3A 3TN8A 3E8CA 4ITHA 4M97A 3F2RA 4A7CA 2GDOA 1KE5A 3DTWA 3LCTA 3OWPA 5DH3A 5EM7A 4M0YA 3BHTA 3VBVA 1W98A 3HV7A 4NFNA 2F4JA 3VUHA 3QTZA 2ZV2A 5IF1A 2JDTA 2R7IA 4QMNA 2XNNA 2F9GA 3QLFA 4U41A 2G1TA 2DQ7X 4UX9A 3FPQA 4E20A 3TNIA 2YIRA 5EM6A 3ZLWA 4EZ5A 3FXXA 3FE3A 3H9FA 4IB3A 3RM7A 5HTIA 3TUDA 2P3GX 2C5VA 1PY5A 3O8PA 4QP3A 4V01A 5JK3A 2XNPA 3Q52A 3HP5A 3BHYA 3MVJA 5EHYA 4A9TA 4FV2A 1B6CB 1WFCA 4AZTA 4FKRA 1LR4A 2X4FA 3VUGA 1LP4A 4QTCA 2WIHA 4GEOA 3LM0A 3JXWA 4IZAA 5LCJA 2C69A 5M55A 1H8FA 3HRBA 5HO8A 4X2FA 4UMPA 2R9SA 2R3FA 4NKAA 3VRZA 5HBJA 4L46A 3IOKA 4GMYA 3V5TA 5GZAA 5M56A 3AC4A 2J0LA 2C6KA 4CVAA 2GQGA 3B8QA 4KA3A 3POOA 1SZMA 4ZP5A 4UMRA 3NNVA 3GFWA 4WNPA 5CYIA 5FP6A 3HP2A 4JAIA 4MXCA 4M12A 3CBLA 4EHVA 3A8WA 2XIKA 4RIWA 3KFAA 3PY1A 4TWOA 4Z3VA 3MFTA 5J7HA 5BUEA 3U55A 5M08A 3D4QA 4IWQA 1V0PA 3T9TA 3V6SA 4JIAA 2O5KA 3OXIA 3VIDA 3CLYA 2R4BA 4IANA 2WOUA 3NGAA 3IW6A 5EKOA 2JFMA 5CAPA 3O23A 2ERKA 3TI1A 5HQ0A 1YI3A 4ZLOA 2YDKA 3UPZA 3O8TA 2WQNA 2OF2A 2VWIA 3ET7A 3GOKA 3O71A 4EBVA 4EOKA 3NX8A 2PUPA 3DLSA 5IMEA 4O7ZA 2JGZA 4B8MA 4XYFA 3U87A 3SOAA 4D4VA 3GUBA 3ZXTA 4DHFA 2BIYA 4DAWA 4PWNA 3ANRA 2V5QA 2RFSA 3MPAA 3QA8A 3RAWA 2IN6A 1FBNA 2XP2A 1FVRA 2XEYA 3LJ1A 4TNDA 3UJGA 4FGBA 4UZDA 3KCFA 4BKZA 3GC9A 3E8NA 5IA3A 4KIKB 4PP9A 4X2NA 4HCTA 4BTJA 4FIIA 1IAJA 3A62A 3KVWA 3F82A 2R3MA 1PXKA 1YKRA 3QRUA 3H3CA 4O96A 1J91A 4D55A 3RKBA 2CNUA 4EHGA 2VN9A 1YWRA 2LAVA 3ZFYA 5BUIA 3CEKA 4PNIA 4XUFA 5A9UA 5H9BA 4GVAA 2PK9A 4FTTA 3F5PA 1NA7A 5L2TA 3A4OX 3E88A 4IB5A 2Z60A 1AD5A 4QMWA 5AV1A 4HPTE 3QBNA 4AW1A 5HCXA 4BDCA 4CV9A 4FV0A 1PKDA 2AYPA 4HPUE 4L45A 4EH2A 5E90A 3UNKA 4FIGA 2XMYA 3WBLA 4WRGA 2R3OA 4FV1A 4YJSA 4I94A 3TKUA 4JOAA 3ZLYA 3DB8A 3QGYA 4R1YA 5CSHA 3R73A 4DCAA 5DWRA 4ZTQA 4QNAA 3GP0A 3TV4A 2JDOA 4A9YA 4I1ZA 2BAJA 3PXQA 5AUTA 3JR1A 3LCDA 3QQKA 3ZCLA 3NNXA 4D2PA 1PJKA 3VW6A 1O6LA 2B9JA 3DOGA 4FTCA 4U80A 5HKMA 2VWBA 4YC6A 2PZ5A 3BEGA 4Y8DA 2WTCA 2BHEA 3Q4TA 4FSWA 3FEGA 4R1VA 2GNFA 4FVPA 2OJ9A 2IVSA 3NPCA 4L43A 4EH9A 5IZFA 3G15A 1KE9A 1F5QA 4O84A 4G5PA 5M53A 3UP2A 3DB6A 3U6IA 3R8PA 4FSQA 4E4NA 2VO3A 5DT3A 1BI8A 3FPMA 4FMQA 3R9OA 3RK5A 5A4TA 2ZVAA 3QTRA 3EYHA 3OOMA 4IAYA 4RWLA 3P7CA 4CFVA 4U0IA 1ZAOA 3NVKI 2Z7SA 5TO8A 3ZM4A 2X39A 3EQPA 4WNKA 4YC3A 3CE3A 3MA3A 3W8QA 1GJOA 5BNJA 3S3IA 1XHAA 3H0YA 3LXLA 2WEVA 3LCKA 4GK2A 4MXYA 2PVFA 3GCQA 4NIFB 5DHJA 3O96A 4BHZA 4D4YA 4NWMA 1NVSA 4D9UA 5BVOA 4XG6A 5CNNA 4O82A 3MVMA 4I6QA 3L8SA 5AUXA 4D9TA 5DYJA 3IG7A 2C47A 4KIPA 3R8UA 3Q60A 4EQUA 3ORNA 4RVTA 3A7FA 1WBWA 4BC6A 4M3QA 4YHFA 5EYDA 4DYMA 4I3ZA 5DFPA 4NKSA 2FH9A 4IE9A 2UZEA 2PMOX 1R78A 3NW5A 3NYOA 4FOBA 4IC7A 2PHKA 5HG7A 1WAKA 3WF7A 4AZVA 5KKRC 3C4FA 3HVCA 1V1KA 1W84A 2BALA 3QD2B 5EDQA 1UNGA 2OICA 2YCSA 4ANMA 4JL9A 3TKHA 5FXSA 4ZY4A 3PZEA 5BUJA 2ONLA 3COHA 3QKLA 4USFA 4QD6A 5E91A 3FQSA 2WMWA 3EFLA 3Q32A 4IFCA 5DRDA 5EOLA 4BCHA 4EUUA 3LPBA 4DLIA 2C1BA 2ITOA 5IQBA 3SXRA 5LVMA 4NJDA 1QPEA 3CKXA 4F9AA 3QX4A 3IGGA 5BMMA 2BHHA 3SVVA 4YPSA 3UIUA 3PRIA 4CNHA 4FTNA 4OUCA 4W8EA 5H3QA 1ZYLA 5AMNA 4RJ3A 5B2KA 3MH3A 2YLEA 4C4IA 4EEVA 4M7IA 4Y95A 5DBXA 4ZMEA 4MNFA 4F7JA 3KK9A 2XRUA 3FXWA 4J52A 4IVCA 4C3FA 1H1SA 4MNEB 3PPJA 3UO6A 3HZTA 3C4WA 5JKGA 3R2YA 4GIHA 4JG7A 4FG9A 5FWKK 4BTMA 2IZSA 3KXZA 5J1VA 2HW7A 2BDJA 1Q4LA 3DNDA 2V22A 1PF8A 3FY2A 3CQEA 4EOMA 4L3LA 5CASA 2JDSA 4GYGA 4A06A 2GHLA 5I3RA 2GNGA 4JVGA 5JZJA 2PPQA 1H07A 4WBBB 2NRYA 3C0IA 4FICA 4RPVA 4W4XA 1ZXEA 5F1ZA 3VJNA 2JAVA 2CNQA 3QD3A 2HXLA 3FL4A 4EONA 2OKRA 2VTJA 3MFRA 3KY2A 4AE6A 4TNBA 4FV8A 1OIUA 3JVRA 1E1XA 5IKWA 4OTQA 2O3PA 3FI2A 4FBXA 4MH7A 5HD7A 4NW5A 4Q9ZA 3FY0A 3HECA 1XKKA 4EH5A 5DR2A 3RPSA 2WTKC 2VTOA 5CXZA 3GCUA 4H3QA 4ANBA 4NYEA 2WFYA 3M1SA 3A7JA 1PW2A 3QD0A 3QTSA 4W4VA 2YWVA 4EK4A 3ETAA 4IAIA 4AGDA 3AT4A 4ANNA 4E3CA 5I9ZA 1ZYJA 3E87A 3LCSA 4JDIA 2DYLA 3RK7A 4FV6A 3I79A 4CTBA 4PPBA 3VBXA 2W5HA 3VUDA 3VS3A 4CCUA 3R7VA 5B7VA 3I5ZA 3TXOA 3PY0A 3OTUA 4L01A 5ANIA 5B0XA 4E6CA 3BYMA 2C30A 3FHIA 2ZB1A 2J9MA 5AAFA 4EC8A 4LV5A 3F6XA 3ZUTA 2QVSE 4QQJA 4E5AX 5HZNA 1IA8A 3CD3A 2BAKA 3F61A 3W2RA 1YHSA 3OC1A 4DFZE 1UV5A 5LVNA 3O17A 3EL7A 4EH3A 3DK6A 3RBWA 2CPKE 3PWDA 3HDMA 4LUDA 4IC8A 1CTPE 3EQFA 5LVLA 5TR6A 4DH5A 5LARA 3GBZA 5JGAA 5LWMA 3V51A 3ANQA 2WMRA 3GQLA 4FG8A 4FNWA 2HELA 3SLSA 5EM5A 4X6RA 2Z02A 3HV4A 4FNZA 1BI7A 1PMVA 4BRXA 4AXAA 4G3EA 3G2FA 3TZ7A 3FC2A 1FOTA 3VUKA 5HTCA 1YOMA 2WTDA 4WBOA 4ZLZA 4X3FB 4IWPA 2PVMA 5AP3A 4EOLA 4TY1A 2Y6MA 4TPTA 1ERKA 4TXCA 1JVPP 3VS5A 3KGAA 4NSTA 5KCVA 2B9IA 4BDIA 1OKZA 2VTQA 3PA4A 5FD2A 1XBBA 2R3GA 4RX7A 2R0IA 1Q8ZA 4E5BA 4K6ZA 5ANOA 1XBCA 1U46A 4U81A 3QHRA 3D83A 3HMNA 3TEIA 2WNTA 4GJ2A 5M06A 3VHKA 4JNWA 1UVRA 3C4EA 5M07A 2Y4IB 2FSOX 5EI6A 2ERZE 4MQ1A 4C8BA 5C4KA 2UZDA 4RC2A 1Z57A 3TNPC 1XH4A 4RSSA 1DI8A 2X8EA 5E1EA 3PIZA 1P2AA 1Q61A 3TNWA 4A4XA 2VTTA 3PP1A 1GIIA 1IA9A 5HVJA 1XH6A 3TUBA 3MPTA 2W1GA 3RHXA 4PTEA 3BYSA 5L2WA 4NTTA 2C6EA 5FQDC 3P78A 4AW5A 3COMA 4H36A 3DJ6A 3QQFA 3Q3BA 4U3ZA 4EOSA 2CSNA 2XA4A 4YP8A 3P7BA 4NW6A 4F1TA 5KMNA 5FTOA 1R39A 3V04A 3TUCA 3R22A 4NZWB 3DXPA 3UOJA 3PG1A 4BDAA 4EL9A 1P4OA 4MD8E 3FBVA 2J0IA 3FC1X 4Y72A 5GJFA 3CPCA 1G3NA 5DPVA 1BL6A 1JAMA 5FEDA 5HO6A 3ZYAA 4WT6A 3PJ1A 3S00A 3LXKA 2BZIB 3SD0A 5FTGA 2Q0BA 3FL5A 1ZWSA 4UMUA 2PE0A 2X7OA 4W9WA 4ZJIA 4KUJA 2ZMCA 2HXQA 2PUUA 4BWPA 2XBJA 4AOIA 5DI1A 4XV9A 2VWVA 4L7FA 4YJOA 2VNYA 2X8IA 1Y91A 4IACA 2QG5A 1GZNA 3FKLA 3KU2A 2C6LA 3CC6A 4FSTA 3BHUA 4APPA 5K0XA 2RL5A 4MXXA 4JDHA 3HYHA 4E26A 4WG4A 5IH6A 3A7IA 3I6UA 2PY3A 3RCDA 3UNZA 4D28A 5FLFA 4F0GA 1J3HA 3U51A 2JKQA 4YSJA 4GFOA 3A8XA 3WYXA 5KUPA 4L8MA 5ACBC 3UGCA 1Y8GA 3FI8A 4S30A 4RWIA 4MXOA 4GRBA 3DBCA 1Q8UA 4F64A 5HLPA 5HU9A 5BVFA 3G9NA 4GK4A 4OTHA 3PXRA 3ROYA 3PXYA 1WBNA 4AW0A 1RDQE 5IA2A 4RX8A 2P0CA 2DS1A 3C9WA 4JBPA 4MQ2A 4O91A 4OW8A 3KCKA 5AR3A 2VWZA 4FKUA 1SVGA 1PXNA 3SQQA 3UMXA 4CRLA 2JBPA 4N4SA 3HUCA 1ZYDA 4KIKA 3K3IA 2IW6A 3QAME 3L9LA 3W2SA 3BYOA 2F2UA 5HESA 3QKKA 3MN3A 3VBQA 4F6WA 4FIEA 3OBJA 2B55A 3FHRA 1YDSE 1KUTA 3VJOA 4PPAA 4XG4A 3HA6A 5LXMA 3EOCA 2YN8A 1OB3A 2WTWA 4S32A 1YHWA 2R3KA 3AMBA 3U8WA 4XOYA 1NW1A 2I0VA 1A06A 3OROA 2XK6A 1YW2A 2X2KA 3PVWA 3QUDA 4I5HA 2VTSA 4UXQA 1QPJA 3C0GA 5CVHA 3ATTA 3NW7A 3C4XA 3UIXA 4EORA 4O7SA 2HZIA 2VWXA 2QNJA 5ICPA 4CXAA 2Y7JA 2NO3A 4XJ0A 3AGLA 2E2BA 3AT3A 3ZLSA 2VD5A 3ZUUA 4FZDB 2QD9A 3AGMA 3IS5A 4K2RA 5IQCA 1TQPA 3GQIA 4FTRA 4PRJA 2QOBA 4U5JA 4I23A 5E8ZA 1G8AA 4DG3E 4YZ9A 4ZMFA 4FV9A 2R64A 4MKCA 3SW7A 3SW4A 2WMXA 4J71A 5FBNC 4WRSA 3FMNA 5A46A 5GIOE 4S33A 5JZNA 4AQCA 3QGWA 3QWJA 4BCQA 2EUFB 2WMBA 3C4CA 3BWFA 4E5WA 3U9NA 3BLHA 4BWXA 1YQJA 4NCTA 4JJRA 3EH9A 4EUTA 3Q2MA 3UP7A 5E9EA 5CT7A 4H1MA 4IZ7A 4C34A 5J95A 1DAWA 4I6HA 4FSYA 4AA0A 4BYJA 3L9NA 2J5EA 3WF6A 5A6OA 3POZA 3V8WA 5FXRA 1JPAA 5K4JA 3SXSA 5HI2A 4Z7HA 4RT7A 4DGLC 1HCKA 3LKMA 4R3RA 2OH4A 1CKIA 3E92A 4PQNA 3GC0A 5D7AA 4DEDA 5JT2A 2E9PA 3PFQA 4F99A 5HX6A 2XNGA 3C4ZA 2RG6A 4ZSAA 4NIFA 5I3OA 4LL5A 4RLKA 3DK7A 4D4SA 5CEMA 3PPZA 1JKTA 3LFQA 4LL0A 3F5GA 3KA0A 4EWHA 5IQHA 5DEYA 5C9CA 1PMUA 3NS9A 2PVKA 1KE6A 3NVMB 5BYLA 3ZSGA 3GI3A 2ITXA 4UWCA 1IRKA 2VTLA 3ATSA 4BDEA 2WB8A 1JOWB 5CEOA 4FKGA 5CQWA 4YURA 3DAJA 2ITZA 2WMUA 4ASEA 4BBEA 3HAVA 2BAQA 2PVRA 4MWIA 3BLRA 3ZC6A 3PDTA 2C0IA 2OG8A 1LEZA 4B6LA 4BDKA 2W4KA 2QOCA 2XJ2A 2GHGA 3PTGA 3FYKX 1OITA 3EIDA 4QQCA 5J87A 1KE7A 3P86A 2WO6A 3GU7A 2UZBA 4IAZA 3ZBXA 4C2VA 4PL5A 4MBIA 4DFLA 4O0YA 3CQWA 1TVOA 3R7UA 3L9PA 1WVXA 3MV5A 2V55A 2UVZA 4HJOA 1BKXA 3AC2A 5DR6A 4D5HA 4EH8A 3VUIA 2X2MA 3TIYA 3ZLXA 5HNIX 1OL7A 1GZKA 3OW3A 3ORKA 1KSWA 3GCPA 5IQAA 5JFVA 3F2AA 5JN2A 2OSCA 4F6UA 4RWKA 4QMZA 3SG9A 4MNEA 5T6KA 1YOJA 2DUVA 3AD4A 2ZM3A 3EQGA 3D14A 2ZM1A 5J9ZA 4BBMA 1FMOE 3RJCA 1H1QA 2X8DA 3RK9A 4BIDA 4HNIA 3LQ8A 2ZM4A 3KRRA 4JLCA 1WMKA 3WE8A 4OAUC 1U54A 3KN6A 2A19B 1FMKA 2W1DA 4Z55A 3E8EA 3GFEA 3H0ZA 2QG7A 3AD6A 5EHOA 5C01A 4JT3A 1BL7A 2WTIA 1W83A 3ZC5A 4C57A 2QOKA 2WGJA 3L8XA 2WELA 2WTJA 3KN5A 1FPUA 4G31A 1J7LA 3VS1A 4DGOA 2A2AA 3HGKA 3GT8A 3MH0A 3OCTA 4BCGA 4QPSA 1H1RA 1VJYA 4ACHA 3LXPA 3B8RA 2PSQA 3C7QA 3D94A 3HUBA 4TTHB 4F9WA 3OEFX 4MAOA 5M44A 3G0FA 3F3TA 3MTLA 4KS7A 1JSUA 3MFUA 5HGIA 2QI8A 3LFBA 4FKTA 3VBWA 1X8BA 2C68A 4R5YA 3BU6A 2XEZA 1A9UA 4OGRA 4MVFA 2OJIA 1XH5A 5K5XA 4E6DA 5K9IA 3QWKA 4HYIA 4F7NA 5CWZA 1YWVA 1OUYA 5HG5A 1J1BA 2X4ZA 2UZVA 5EYMA 4E1ZA 5IQIA 3Q6UA 3TDVA 3THBA 3IW7A 3EJ1A 3F5XA 4QMSA 5GZ8A 3A61A 3CR0A 2Y9QA 5FBOA 2VUWA 3HKOA 3DBEA 5CZHA 5E8XA 4EOOA 2HZNA 3HV5A 3PZHA 2HZ4A 4MD9E 1VZOA 5CU4A 3TZMA 4I21A 4DFBA 4N6YA 2GNHA 4I5MA 5LMKC 2CLXA 3WIKA 2XIZA 2IW9A 4IM3A 4O86A 4ZTHA 4U3YA 4FSUA 3RALA 3UOKA 2B53A 3PYYA 3OW4A 3SKCA 5CLPA 4ZSJA 2BILB 5F94A 4MWHA 2CJMA 4ZK5A 2X9FA 4Z9LA 5CAQA 1CSNA 2ZV8A 2OFVA 1JSTA 1GZ8A 2CMWA 1OUKA 4DEEA 3PJ3A 4LFIA 3FI3A 4IDTA 1VEBA 3IDCA 3ZBFA 5I9XA 1YDRE 5HCZA 2YAKA 1M17A 2GQSA 4HYSA 3B2TA 3R9DA 3QTUA 5CI6A 3E3BX 4QTEA 4G34A 3UZRA 4M69A 5CEKA 3NUSA 5LQFA 1O6KA 2GNIA 1H4LA 4TT7A 2WHBA 3EN7A 4X3FA 4KBCA 3D5VA 3G6GA 1JKLA 2YCRA 2EWAA 5E8WA 3II5A 3MY0A 4RA4A 2UVYA 2HK5A 3R28A 3VS6A 5E8SA 3BGZA 2WD1A 3P0MA 4E73A 4QMQA 3FAAA 5BMSA 2RG5A 4S2ZA 3F2NA 1OVEA 3F9NA 5E8YA 3VF8A 1PXMA 4RVLA 3CJGA 4F70A 4BZDA 1ATPE 2P55A 4CG8A 2R3PA 5FM2A 5EI8A 1FGKA 3EKNA 1U5QA 2B9FA 3D2IA 3ZHPC 1H27A 3WF8A 3FYJX 3ID6C 4ASDA 3HMMA 4J1RA 1MUOA 2P2IA 4BIBA 4OTDA 2OFUA 4C4GA 3NNWA 4HZRA 3FMKA 3NAXA 4OBPA 4BDBA 4JAJA 2WQBA 4E6AA 3P79A 5HE2A 4AT3A 1Q3DA 3HV6A 3IW8A 4FT7A 3K5VA 4JRNA 4RX9A 3N4TA 1T45A 3NYNA 4Q5HA 4JX7A 3PXZA 1SNXA 4L7SA 4ZSEA 2ZJWA 4IWDA 4EQCA 2YZLA 3ZSIA 4RFYA 4BCPA 1LUFA 1RJBA 2GTMA 3NRMA 4KNBA 4ENXA 3SG8A 4ZS4A 4R7BA 3OG7A 4JIKA 3T9IA 1R0PA 2O2UA 3QCXA 2BR1A 4EOJA 5CF5A 1APME 4GU6A 4FTLA 2PL0A 2GHMA 4IBMA 3SHEA 4FEWA 3ZM9A 1OKYA 4D2TA 3EN4A 3OCBA 1WBTA 3CIKA 4FKJA 4HNFA 3AC5A 3RWPA 3TV6A 2JAMA 5CF4A 4ALVA 4QP6A 4YZCA 4L6QA 4DTKA 2WU7A 5KMJA 3R1YA 5A4EA 4G6NA 2UZUE 2QHMA 5DEWA 3R1NA 4NH1A 3LW0A 1H1PA 5CALA 3P08A 4DT9A 2FYSA 4O0SA 2CGWA 4MF0A 1Q99A 2O63A 3A4PA 4XV3A 5FTQA 4O7TA 1VYWA 4O22A 4DLJA 3UQFA 4CMTA 3AC8A 5IEYA 4AT5A 3AMAA 5HVYA 5E4HA 1PXLA 4I0TA 2JIVA 3OBGA 4C33A 5IH4A 2HCKA 3WYYA 5CTPA 5DNRA 3RM6A 4QT1A 2PMIA 4PNKA 2R5TA 3R00A 2H9VA 5AWMA 4IDVA 4I5CA 2WQMA 3EL8A 1KE8A 1RE8A 1JWHA 1HCLA 2NRUA 3I5NA 2OJFE 3QTIA 3R7EA 1YRPA 4PX6A 3CPBA 3LFCA 5CF6A 4RZWA 3TG1A 4D1SA 5CI7A 1SNUA 4YJPA 4HGSA 3WILA 2W1CA 2W06A 4IX4A 1URCA 3QXOA 4XS2A 2RGPA 4L9IA 4NL0A 3FLNC 4X3FC 3NUPA 2XVDA 2QR8A 3ORIA 4QP9A 2EXCX 4XH6A 4PDYA 2H96A 3SV0A 3UZTA 5IQFA 3ZSHA 1YXTA 4ZY6A 1MQBA 3RPYA 2IW8A 4FSMA 2PUNA 4YZBA 4I6FA 4PMPA 3JYAA 3G33A 2OWBA 5A14A 5HNGA 4OR5A 3GC8A 5D10A 3L1SA 2P2HA 3AC3A 4EKLA 4G6LA 5ETIA 4MBJA 4YUQA 4U45A 3BWJA 2Y4IC 3EB0A 4K8AA 4Y73A 3NLBA 5EYKA 4BKJA 5CAVA 2YJSA 3PIYA 2HAKA 4HZSA 4R8QA 5GJDA 3W55A 4FF8A 4IM2A 4KIOA 4DH7A 1RQQA 4QTBA 2VWUA 4RX5A 5CF8A 2PVNA 3LFDA 4H1JA 3DBFA 5K0KA 3R9RA 3ENHA 4RGJA 3PWYA 3RMFA 5CX9A 4X7QA 3V01A 1OPLA 3M11A 4BDFA 5EQPA 4DEBA 3G9LX 2CKQA 5DGZA 3HL7A 2YM7A 4O6EA 4IM0A 4R7IA 3RZBA 4GV1A 3VNTA 2YM8A 4OT5A 4BGQA 4KS8A 4O38A 1XO2B 5DR9A 3SDJA 4L52A 3QZFA 3LOKA 2G2HA 4ASXA 2VX1A 3F7WA 3ORMA 1MRYA 1WBOA 3QQUA 3MJ2A 3V3VA 3PJ8A 1OPJA 5DT0A 1BX6A 3OZ6A 3DZQA 4KRDA 4AW2A 3OS3A 5HO7A 5J1WA 3RGFA 1L3RE 2C6OA 4F7LA 1B39A 2W1EA 5HG9A 2JITA 4YSMA 3GCVA 4M66A 5EH0A 4NTSA 2F7ZE 3BIZA 4DEIA 4O2PA 4E4LA 5DVRA 3L8VA 1M52A 3ENMA 3QUPA 3D15A 2CN8A 2Z8CA 4PY1A 1CM8A 3O2MA 4D0WA 3DKCA 3GCSA 1REJA 2BZJA 4M67A 3JY9A 2E9NA 1UWJA 5FGKA 3WI6A 4BWKA 3Q5IA 2CLQA 3DQWA 3SGCA 3O7LB 2FA2A 2VRXA 3K2LA 3TZ8A 1YXXA 2QKRA 3CQUA 5IPJA 4DFUA 2VTIA 2BRNA 4A4OA 4H3BA 4O7NA 4GK3A 1DS5A 2UZTA 4FG7A 2BUJA 2XK9A 4QMPA 4GS6A 1H1WA 5GJGA 2WQOA 1JSVA 4AZWA 3MY5A 4Z7GA 4JI9A 2B9HA 4X21A 3SRVB 3UIBA 2QU5A 4RJ4A 1GZOA 1YI4A 2OZAB 3R2BA 4YJVA 5F95A 4C2WA 1QPDA 3I7CA 5C03A 4BTKA 5K5NA 2E9OA 3QA0A 4L68A 3WOWA 4C59A 3D2KA 4QO9A 3BYUA 4FR4A 1IG1A 4IZ5A 4FIFA 4R3PA 4E7WA 2BFYA 4GH2A 4X3JA 1L8TA 5M51A 1UNHA 4GW8A 1NVRA 2IVVA 3ULIA 3VULA 1Y6BA 4OTGA 4S31A 3ROCA 5CXHA 5AV4A 1WCCA 1U54B 2AC5A 3CTQA 5FM3A 5B2MA 5JGDA 2J2IB 3ITZA 3HRCA 2ITWA 1XH9A 2OGVA 3BGPA 3FLYA 3R01A 3LLTA 4BBFA 4BCJA 5IEXA 1Y8YA 2W1ZA 3RPOA 4BTFA 4V0GB 5GHVA 1M2QA 4DC2A 2B0QA 2UUEA 3HRFA 4ZSLA 3QXPA 4G9RA 5L8LA 4AACA 3SX9A 2WMTA 1ZOEA 3PXFA 4XRJA 3E62A 4MXAA 4EH6A 4JX3A 4DTAA 3VUMA 4C4JA 4GCJA 4FKWA 5HHWA 3KMMA 3BE2A 3UYSA 3QQHA 2UW7A 4JG6A 4DFNA 3V6RA 3V8SA 5LVPA 5LWNA 3LFEA 2H8HA 5AIRA 3ZONA 4FTJA 2CHLA 3NNUA 5BVWA 4CQGA 4O7LA 4HCUA 3OOGA 4KKHA 4O27B 3EYGA 2R3NA 1FINA 2YCQA 4IFGA 4NM7A 1NT2A 2XKEA 5AR2A 1QPCA 1JKSA 3C50A 2EB2A 3AD5A 3U4UA 4D1XA 2NNWB 3Q96A 1XH7A 1ZMWA 3GU8A 4CMUA 3ULZA 4X2KA 4Q2AA 3PVBA 4QYGA 2IVTA 3F7ZA 3LJ0A 3HLLA 4WUNA 5ETAA 3W16A 2W4OA 3I60A 4JDJA 3RVGA 3FQHA 4JS8A 4G17A 4OBQA 3TTJA 1ZMVA 4LYNA 4D2VA 4KB8A 5C8KA 4ONAA 3C51A 2XZSA 2A1AB 3UQGA 1Q97A 2QO7A 3ACJA 1EH4A 4G2FA 5BVKA 5CENA 5M4IA 2J6MA 2ITYA 5J9LA 3RAKA 1I44A 2AC3A 4GJ3A 1WZYA 2ONLC 3DBQA 3H4JA 2JKKA 1M2RA 2HWOA 4RVKA 2ETRA 3NMUF 2DWBA 4YTCA 2KTYA 1PRYA 1NXKA 4RMZA 4QNYA 3NYVA 5CSWA 3UVPA 3PA3A 4KBAA 4AGUA 3BBWA 2XJ1A 5E8VA 2E9UA 2XCKA 4M69B 4QP7A 5AP5A 4FK3A 2OXYA 5ETCA 4CMOA 3OCGA 4PDOA 4C3RA 2VNWA 3QTQA 4ANSA 3HDNA 3LMGA 4KAOA 4BF2A 2YDJA 5E7RA 2YFXA 3FSFA 4WNOA 3KRWA 2YJRA 3VS7A 1OIYA 3UOHA 2WZJA 2BMCA 4F9YA 4FKLA 2R0UA 4D2WA 1WVWA 2OXXA 3NEWA 4RIYA 4W4WA 4A9SA 3DAEA 4XHKB 2QU6A 1KOAA 3CP9A 3SOCA 3TJDA 3VBTA 4BCNA 4O7VA 2ZAZA 3VRYA 1G8SA 3LQ3A 3Q2JA 4EKKA 3CCNA 3LFFA 2GQRA 4FEVA 1TQMA 2YHVA 4HYUA 5AP2A 5IEVA 2BZKB 4XX9A 5A4CA 2X81A 2WU6A 4BL1A 1W8CA 2VO0A 4FKIA 3WZJA 2PVLA 4QMMA 3ZXZA 2XM8A 4BZOA 2OI4X 3NCGA 2W9ZB 2BCJA 4QTAA 4FZFB 5CZIA 2I0EA 4ZEGA 4AA5A 4K33A 3S1HA 1OM1A 1BLXA 4S34A 3R21A 2VTPA 5L2QA 3W8LA 4BDJA 2PU8A 3S95A 3QFVA 3KULA 2GTNA 2BZHB 2J0MB 3EQIA 5EW3A 3P1AA 2RFNA 4KKGA 3FMHA 4AN9A 2QOHA 4FT9A 2JEDA 2C5NA 5HBEA 4EJNA 5TF9A 4L53A 2XRWA 4HVIA 1Y57A 4RG0A 4F1OA 4CEGA 3WZUA 4BI2A 4LG4A 3NUXA 5EYCA 4FTIA 1G5SA 1AGWA 2UW0A 3UNJA 1JNKA 4EZ7A 4F9CA 4ZTSA 2QOIA 2C0TA 3DAKA 3UQCA 2CDZA 3FZOA 1CDKA 3GU4A 1JLUE 1H01A 2UW6A 4X6QC 5CU0A 4GT3A 1Z9XA 4AZFA 3UBDA 3DGKA 1M2PA 4ZAUA 5IA4A 3R63A 5AUVA 3DQXA 3FZSA 5IDPA 2C4GA 3U9CA 5L6WL 3UG1A 2RFDA 2W7XA 2Q0NA 3TTIA 2YIQA 3LFNA 4IMYA 4UALA 5JEBA 4J97A 2W1HA 3QRKA 4LUEA 4F6SA 4FSZA 2GNJA 2QHNA 2YITA 3CXWA 5J8IA 4PF4A 4FGRA 4O0VA 5KE0A 4ZJVA 4XV1A 3BLQA 3HAMA 3TT0A 4EK6A 3HNGA 2R7BA 5CVFA 4BZNA 2QONA 3VS4A 3E7OA 4BKYA 3P9JA 2V0DA 3BCEA 4P5ZA 1PXPA 4EZ3A 5DIAA 3F3VA 4HCVA 4WA9A 4JQEA 4EK3A 2W1FA 2X9EA 2VX0A 5AP4A 3EZRA 4TN6A 2W5AA 2IZRA 2OIBA 3HMOA 2HIWA 4JXFA 4MTAA 4U44A 3SXFA 2EU9A 4RVMA 3C5IA 5AP7A 3C0HA 5ACKA 2B7AA 4FVQA 4FV3A 1M7QA 5AAEA 5IG1A 5AR7A 3OWLA 2OJGA 4RZVA 3ZMMA 4C35A 4BB4A 2X1NA 3Q53A 1PKGA 5ANKA 4B8LA 2XB7A 4M13A 2EXMA 5IUHA 3QYWA 4IX3A 4CCBA 3OY1A 4YU2A 2VTHA 3BV3A 3Q9WA 2NPQA 2R3HA 1ZYCA 1M14A 5KZ0A 3BV2A 1KV2A 2C5XA 1PMEA 3EFJA 3EN5A 5D1JA 5DE2A 2RKUA 5IA1A 3I7BA 4ENYA 5IUIA 2EXEA 4PV0A 4L42A 4DE4A 2JIIA 4TWCA 3OUKA 4NT4A 5KMLA 3FMLA 3BQRA 4M0ZA 3MGYA 4C62A 3DLZA 4E6QA 5CEPA 4HGTA 3LCOA 3QD4A 3F5UA 1F3MC 4QP1A 3PE1A 5CEQA 3LE6A 4TKSA 3NIEA 4BDGA 4R77A 1YHVA 5EFQA 4F4PA 3EFWA 4DH3A 1OBDA 3IDPA 2W17A 5I4NA 2XIXA 3AXWA 4K11A 2XM9A 1XQZA 5IDNA 4ORKA 3E63A 3MA6A 5M57A 2CKPA 3OD6X 4FVRA 4BDHA 5EDPA 3MS9A 4DH8A 3KXMA 1W7HA 2W4JA 2E9VA 4EH7A 4LOOA 5HTBA 3TNQB 3QQGA 4M14A 5D41A 4YBJA 2PE1A 2V7OA 3F69A 4FKPA 2OJJA 4TYJA 4BI0A 4FKVA 5HIEA 4KIQA 5HG8A 2UW8A 4OTIA 3OCSA 3QRIA 2O65A 1UWHA 4ZZMA 3OFMA 4ACCA 3BQCA 2YM6A 2QURA 2R3RA 5CNOA 2BIKB 5AX3A 3W18A 4EYJA 4IJ9A 5BVEA 2RSVA 2IWIA 3TM0A 3NSZA 5FG8A 2ZDTA 3D9VA 4AN3A 4RBLA 5AUUA 4CYJA 4BYIA 4FUXA 3COKA 3UIMA 1H24A 4PMMA 1ZZLA 4ITIA 2ZV7A 1URWA 4G6OA 1RW8A 5C8NA 3ZOSA 5TE0A 1H26A 3MTFA 4TL0A 2R2PA 4BVUA 1V0BA 2YEXA 3F3WA 4LGGA 3OXZA 3I1AA 3LXNA 4YO4A 3EQDA 4AF3A 2J0JA 5J9YA 3WZEA 2FUMA 3MH1A 3ZZWA 1BYGA 2QC6A 5HE1A 4YBKA 3CTJA 4C36A 4FODA 4RC4A 4HVGA 5LOHA 3NUYA 4WOVA 3AC1A 3ORZA 4J99A 3BE9A 4Y83A 2YA9A 3RI1A 2C6DA 3DBDA 1KV1A 4DG2E 2X6DA 2Y8OA 1WBSA 3D5WA 5AV3A 4OTFA 1OL5A 4O0TA 1JKKA 3KXHA 4K1BA 3DY7A 4O0RA 3QHWA 4PUZA 5GZ9A 4W9XA 2WQEA 2FVDA 1UU8A 4MF1A 4FTKA 4QYEA 4F63A 2UZWE 4LMNA 2XCHA 2XIYA 4D58A 3GXLA 3KB7A 5M4FA 2R3LA 3NIZA 3PLSA 2VAGA 3A60A 2UW5A 3OT8A 5AM6A 2YM4A 4B7TA 1OKWA 2IG7A 1VR2A 3BBTB 2ZOQA 3GVUA 1MRVA 2PVJA 4HGEA 4FT5A 5GIPE 4XLVA 3MDYA 5AR5A 3P4KA 3IKAA 3KF7A 4GUBA 4ZTLA 5HBHA 2Z7LA 1W0XC 1ZY4A 1H08A 2YISA 2OZAA 4KBKA 3RZFA 3SRVA 1KOBA 4IVAA 4BFMA 4TWNA 4GKIA 5T68A 4D5KA 3W2PA 5KMOA 5CAUA 2O64A 5AA9A 4I22A 4Q9SA 5DG5A 2P33A 3DFCB 3ZO4A 4FTOA 4MD7E 4CG9A 2REIA 4EWQA 3Q4ZA 5LCKA 3G6HA 4BCKA 4ALWA 1WVYA 2YIWA 3FLZA 3QLGA 4APCA 4QMXA 2QOQA 3FZPA 3VVHA 4YTFA 1STCE 4UXLA 4ITJA 3KRLA 4CKIA 4DGMA 3GOPA 5J79A 2GFCA 2GNLA 4V0GA 4C38A 3TCPA 5C4LA 3N4VA 1JBPE 3RCJA 5AV2A 2C3LA 4G3FA 1DM2A 3HMPA 2PVYA 4FNXA 4UMTA 4NCTC 4CFNA 4CKJA 1YDTE 3LMIA 3VWAA 3RP9A 4Y5HA 2RF9A 2XK3A 3O51A 4I93A 2QOFA 3OWKA 4EHZA 3UOLA 3TZ9A 4OBOA 3V5QA 3MH2A 4ZTMA 5FXQA 4AAAA 4O0UA 4BHNA 2HY0A 4FV5A 1UU3A 3UVRA 4PPCA 3WIGA 4AG8A 4QYYA 5AP1A 4C37A 2PZPA 5HX8A 3BX5A 4AOTA 1H00A 4IX6A 2CN5A 3QKMA 4NUSA 3BPRA 4HW7A 2BDFA 2WMAA 5CU3A 3ORLA 4B9DA 3NW6A 1U59A 2XK7A 5H8GA 4HYHA 4PDPA 4DFXE 4QOXA 4TYEA 1OIRA 2H34A 4RQVA 3DXNA 3IONA 2J7TA 5J7BA 4CV8A 2BPMA 3QZGA 4FT0A 4IX5A 4O0XA 4BCIA 2WEIA 5CSVA 2XNEA 4OTRA 4FA2A 4AT4A 2R3IA 4P90A 3Q4UA 3NAYA 5L8KA 5IUGA 5CSPA 5CS6A 5EW9A 4F0IA 2JC6A 4XG2A 2QOLA 2UV2A 5HIBA 1YXUA 2CKEA 1ZYSA 5CU2A 3AT2A 5E92A 2AUHA 5ANDA 4FKQA 4PL3A 4RIYB 1OIQA 2HY81 3GU5A 4CZTA 2IVUA 2Y0AA 5BQ0A 3UDBA 3I4BA 5ETFA 4HOKA 3ACKA 2OK1A 3KK8A 5AM7A 1Q8YA 5KZIA 3TNHA 1S9IA 5IA0A 1K9AA 2CCIA 3BI6A 2JBOA 3MJ1A 5IA5A 4RJ5A 3W32A 2F7EE 2PMLX 2ETKA 4I92A 3LMHA 4DITA 4FL2A 2XH5A 3R8VA 3LM5A 4TRLA 4AOJA 3DTCA 5LJJA 3EQRA 4ALUA 4J7BA 5ANJA 3ZU7A 4GIIA 4WG3A 4I24A 4LOPA 4O1PA 2ZB0A 3F3ZA 3VUTA 4EC9A 3LAUA 3DU8A 3GEQA 4YHJA 4EOIA 4Q5EA 2JDRA 3KULB 1QMZA 2WMQA 4FOCA 4JDKA 3PLAE 2UZOA 2CNVA 3L9MA 4B99A 5CU6A 3NUAA 3R30A 4GL9A 4WO5A 4B0GA 4EJ7A 2QOOA 5GINE 3FZ1A 4YZNA 3COIA 4P7EA 1Q24A 2BVAA 3FMEA 3UO4A 2J5FA 3ZFXA 2I40A 3ODYX 4QQTA 4IH8A 3IO7A 3GENA 4LQMA 4C0TA 4ACDA 4QMTA 4EI4A 4I4FA 1XR1A 4IAFA 2R3JA 3CD8A 1XH8A 4J8NA 1JQHA 2YM5A 1XJDA 3G51A 4GSBA 4QMOA 4YJTA 5HE0A 3ZZEA 3MY1A 4AP7A 2XBAA 4E4XA 5J5TA 4F09A 1YXSA 1K2PA 2F57A 4G9CA 3Q04A 2IZTA 2W9FB 4RA5A 4BI1A 4CQEA 3BRBA 3PSDA 4ACMA 5LVOA 4AGWA 4DFYA 5KMMA 4DT8A 3QCYA 4CT2A 2XKFA 3W2CA 3V5PA 1Q8WA 2F49A 4CFUA 5BX0A 3C13A 1UA2A 4FKSA 4DINA 3KC3A 4FTUA 2WAJA 3S0OA 5EKNA 4JQ7A 4M84A 3I6WA 3KQ7A 1DAYA 2ITQA 4DH1A 4AWIA 2WXVA 3QL8A 4QP8A 3AQVA 3QC4A 2PYWA 1HOWA 2ZYBA 5AAGA 4O7WA 5TT7A 3IOPA 2HWPA 2VX3A 4CZUA 2JLDA 1PYEA 3VQUA 1YXVA 1LPUA 3VN9A 1FVVA 5JFWA 3MVLA 3R04A 1OL2A 1M7NA 2VGOA 4K9YA 4DBNA 4F08A 3CY3A 3A99A 4QMUA 4ZTRA 1J7UA 3DJ7A 4R3CA 4RQKA 1TKIA 5F9EA 3K5UA 4GG7A 2QO9A 3DFAA 3JUHA 4AE9A 5AP6A 1AQ1A 1IASA 4O0WA 3SA0A 3M42A 4RIXB 1FVTA 4XBRA 4FZ6A 5A6NA 3OEZA 4QP2A 4PMSA 5ANEA 1P14A 3P23A 4FTQA 4YJQA 2ITNA 5CQUA 4XP3A 4A9RA 4XLIA 4EH4A 4IEBA 3UE4A 2GCDA 2HZ0A 3D7TB 5EM8A 1LEWA 3PE2A 4D2SA 5IH5A 5KMIA 3S4QA 4K0YA 4H05A 4JBVA 4U79A 4D0XA 1GAGA 3U4WA 5A54A 2HENA 2VGPA 2X0GA 3MBLA 5HLWA 5HEZA 3G5DA 1OL1A 2Y4PA 5KHWA 4CFMA 2F2CB 1REKA 4CSVA 4F0FA 2OIQA 4WHZA 5JRQA 4GYIA 1OPKA 2ITUA 3CGFA 2IZUA 4GG5A 2X7GA 4KRCA 3F3UA 4X0MA 2QKWB 2PVHA 2BDWA 4ERWA 3R0TA 3A7HA 3O0GA 3R1QA 3M2WA 1WBPA 3VQHA 3E7VA 3IW4A 3PA5A 3PXKA 4IZYA 3UYTA 4RC3A 2WTVA 5IQEA 5BPYA 4JBOA 2X2LA 2RFEA 1KWPA 4BN1A 2BKZA 2Y6OA 5DN3A 2OU7A 2YIYA 4FTMA 5HNBA 2WPAA 3RPRA 1P4FA 3EMGA 4UYNA 2XYUA 3WE4A 3VF9A 4TWPA 5DA3A 3W10A 3KREA 3PRFA 1Q41A 3ZRMA 5FEEA 4BICA 3PSBA 3MIYA 4NEUA 3UO5A 5EI2A 5KNJA 3TDWA 2XK8A 4FKOA 2BRBA 4XG9A 2ZMDA 4TYGA 2R3QA 3TL8A 3GGFA 1K3AA 3CS9A 3B2WA 4YZMA 2C6TA 4OTPA 3ZS5A 4E93A 5GNKA 4HVDA 5L2IA 4Z16A 1YVJA 3IQ7A 3V8TA 3OY3A 5BYYA 4O81A 4UEUA 5DOSA 4NM5A 2ACXA 2W1IA 4U6RA 4ERKA 2FSTX 1ZRZA 5L3AA 4XP2A 3UC3A 3I81A 3KXNA 4ACGA 4W4YA 3ZRKA 2VZ6A 3FKNA 3DPKA 4RWJA 3R7GA 1BMKA 4BCMA 4XG3A 4NU1A 3PIXA 3E3PA 2C5YA 3PJCA 3R1SA 4FK6A 2UVXA 4IW0A 3ZEPA 4EK5A 3A7GA 3BHVA 2XJ0A 3PPKA 4GU9A 4IB0A 3ZFMA 4PP7A 2B54A 3W2QA 4MBLA 1J1CA 4KSQA 5JMSA 4G3GA 5A3XA 3KVXA 3MIAA 3DNEA 3FV8A 1Y6AA 4XV2A 3IECA 4ANQA 4QYFA 4BGGA 2HYYA 1XBAA 4XEYA 1DI9A 2A4LA 5HE3A 1GNGA 4JG8A 4LMUA 1ZLTA 4XBUA 5AIKA 4BGHA 3LQ5A 4F7SA 1XWSA 2XKDA 4V04A 4AFJA 2QCSA 2XS0A 4FNYA 3O8UA 3QTXA 3EHAA 4Y85A 5AUZA 2VV9A 4ANLA 3PUPA 4XG8A 5HICA 4G3DA 4U97A 3MWUA 4MX9A 1SVHA 2OIDA 4KKEA 4NJ3A 1SMHA 4NK9A 1GOLA 4WIHA 4O83A 4NM3A 1R0EA 2GPHA 4CT1A 4O7YA 5HD4A 4G3CA 3S2PA 2GSFA 4FYNA 4JQ8A 3BELA 5HVKA 4EK8A 4PDSA 5F20A 5F4NA 1PXOA 4R6VA 4YR8A 2GS2A 3FSKA 3QU0A 4L00A 4C4EA 4R78A 3MB7A 3NDMA 5C8MA 3BGQA 3ZDIA 3NYXA 1T46A 3ZO1A 2F7XE 5KBQA 3RTPA 5H8EA 5D7VA 3UPXA 5CT0A 3ZUVA 4ZLYA 1ZOGA 3R83A 5M4CA 3VS2A 3SC1A 3KRJA 5IQGA 3R8MA 5IQDA 3LLAA 1UKHA 2EB3A 2ZDUA 3UMWA 3W2OA 4R5SA 1H28A 4TYIA 4DA5A 1NVQA 4ZS0A 4BCOA 1CKPA 4UN0C 2YAAA 3K3JA 4A07A 4FL3A 2O8YA 5BVDA 3H30A 4ZJJA 5LMBA 2YM3A 4LI5A 5KO1A 2XKCA 3DDQA 4I41A 4UB7A 4TYHB 1O9UA 5JSMA 3TACA 2PULA 1QCFA 2FGIA 5A4QA 4GT5A 3E5AA 5TOZA 4PMTA 5DT4A 5AUYA 3TV7A 3WZDA 5IMXA 4B4LA 3HV3A 3JY0A 4IAAA 3FLSA 2ITTA 5AX9A 3AOXA 4O2ZA 3R7YA 5M4UA 4FZ7A 5TKDA 2YACA 3R8ZA 4U43A 4BY9E 5IU2A 1H25A 4Y5QA 3FMDA 3NWWA 3OXTA 3VW8A 3DXQA 3QC9A 3MESA 2ITPA 4IAKA 4QMYA 3WF9A 2BTSA 1YI6A 4II5A 2BKKA 3QZIA 2LGCA 4ZXTA 2VO6A 3F66A 3RPVA 3RHKA 2QR7A 2VO7A 4N6ZA 4ZSGA 2OZOA 2CCHA 3OHTA 4YLJA 4CD0A 2BRMA 3W1FA 3ZRLA 3Q5ZA 4JR3A 1O6YA 5FEQA 5I9UA 2JDVA 1IEPA 3NUUA 5EOBA 2X6EA 4AN2A 3T3UA 4GVJA 4ZZNA 3BKBA 4UBAA 3T8OA 2PWLA 3VAPA 4AZEA 1W82A 4A9UA 3MVHA 3WF5A 2YLFA 4GT4A 1F0QA 4AFEA 2W96B 1H0WA 3ELJA 4FIJA 4V05A 4ZIMA 5D12A 3PG3A 4ID7A 3V5LA 3N9XA 3RNYA 3EQHA 4FZAB 3CGOA 1PXIA 2C6MA 3HEGA 4YLKA 2YZAA 2QO2A 4WSQA 4KSPA 3Q9XA 3LHJA 3O50A 2ETMA 4EOQA 3QZHA 4FIHA 2G01A 4CKRA 2BTRA 4DBXA 4ASZA 3EFKA 2PZIA 2C6IA 4G16A 4IB1A 4O6LA 4QTDA 2YDIA 2C0OA 2UZLA 4UMQA 5FP5A 4KABA 2WMVA 4J53A 3NCZA 3PVUA 2A27A 5JGBA 2PZRA 3CJFA 3RAIA 1IR3A 4KINA 4DCEA 4FV7A 5EQYA 4N70A 4PTCA 2I1MA 3FZRA 4WSYA 3BU5A 3TIZA 3FMMA 2UW3A 2B1PA 1MQ4A 3GU6A 3QRTA 4AZSA 3IGOA 2EVAA 4GFGA 4C4FA 4XP0A 2ITVA 2YIXA 3FDNA 1H0VA 2G15A 4HVHA 3FLQA 4AUAA 2Z7RA 3OUNB 4K77A 4CYIA 5JQ8A 2GS6A 4AX8A 2WMSA 2H6DA 3OT3A 4IHPA 4QQ5A 3U54A 2WOTA 5AP0A 3FI4A 1S9JA 4DEHA 3QYZA 3EKKA 3OWJA 5HOAA 2FO0A 2OH0E 3D7ZA 3K54A 4QYHA 2W5BA 4BDDA 3DT1A 3R9HA 4DEAA 4HVSA 3BU3A 3MW1A 2GS7A 4IQ6A 3FWQA 4GKHA 4OTWA 3CY2A 2VWWA 5G1XA 5KBRA 3UTOA 4RRVA 4RIWB 1OBGA 4I5PA 4RJ7A 1ZZ2A 4FT3A 3ZO2A 3LFAA 4QPAA 5H8BA 5EQEA 1OECA 4ZY5A 2FSLX 4IADA 4DGNA 5C1QB 2G9XA 3D0EA 4FL1A 2O0UA 5B2LA 3QALE 2WIPA 4W8DA 4IIRA 4LM5A 4YMJA 4K18A 1SYKA 3Q6WA 2UZNA 4JRVA 4E8AA 4U40A 4UV0A 3HA8A 2IPXA 1FQ1B 1VYZA 4YPDA 3U6JA 2FSMX 3GC7A 2W05A 4FEQA 4I6BA 1UKIA 3OMVA 3IPHA 1OL6A 2BRHA 4ANOA 4DG0E 4RJ8A 5HCYA 1OGUA 4FYOA 3PJ2A 5HLNA 3ALNA 1P5EA 3JPVA 4HGLA 2X7FA 3F88A 5CANA 2NP8A 3REPA 4UY9A 1Q62A 4XG7A 4XNEA 5ANGA 3ZDUA 4FI1A 3HMIA 4I20A 5KKRB 3CKWA 4DTBA 2C1AA 5JFXA 5BYZA 4LGHA 3GB2A 4C4HA 4I0SA 3P7AA 5K4IA 2G2FA 3KMWA 4IXPA 2IJMA 4QRCA 4XRLA 4YHTA 3FUPA 4KD1A 3EQBA 5AEPA 2PTKA 4CFWA 4M8TA 2IO6A 4LOQA 5BVNA 1U4DA 4FUYA 3N51A 4FSNA 4EBWA 3R9NA 4NFMA 3CSVA 1I09A 4L44A 4MHAA 3R7OA 2HW6A 1E9HA 4RIXA 2KULA 3ODZX 5JFSA 4FV4A 4C61A 2SRCA 2J90A 3DA6A 4NM0A 5LMAA 4L67A 1R1WA 2XUUA 3FKOA 3EZVA 1TQIA 2CGXA 3D7TA 5D9HA 3D5UA 5AR4A 3ALOA 5T3QA 2Q83A 2B4SB 3DS6A 2OO8X 1UU7A 3Q9ZA 4LRJA 1A48A 1UU9A 4FSRA 4J96A 5DLSA 4H3PA 2QQ7A 3SAYA 4TZRA 3EN6A 1QL6A 4XMOA 1SM2A 4PTGA 1OZ1A 3U6HA 4YC8A 4C58A 4UZHA 2OXDA 3OVVA 4FEXA 2VU3A 2HOGA 2GFSA 4LRMA 3OTVA 3BYVA 3R7IA 4N57A 4EOPA 1CMKE 3PP0A 2JKMA 3TWJA 3H9OA 1GY3A 2P4IA 4QMVA 3ZH8A 3N4UA 4YLLA 1OI9A 5I5ZA 3Q9YA 5J5SA 5DRBA 3DCVA 3QCSA 4A4LA 2VTMA 4M15A 3UZPA 5EK7A 2YABA 4LV8A 4U9AA 3Q4CA 1PMNA 5EDRA 2W0JA 4DN5A 2WTKB 3KEXA 3VC4A 2PZYA 1BUHA 1FGIA 5D11A 4FE2A 4GFMA 4Y46A 5E8TA 2QLUA 3FJQE 3JVSA 5A4LA 4X2GA 2XF0A 3R71A 5KX8A 2XNMA 3ZEWA 3EQCA 2UW4A 4JBQA 4P4CA 2Z7QA 1Q8TA 4YTHA 5KHXA 4WUAA 4MYGA 4USDA 3L8PA 4H39A 2J0KA 5FDXA 5AA8A 3QQLA 3H9RA 5HORA 2XK4A 3QTWA 4QP4A 3RNIA 3ZO3A 2VWYA 3LFSA 5CSXA 4IVBA 3TKIA 1E1VA 5L8JA 3LIJA 3KF4A 4ZTNA 3BHHA 2PE2A 3KMUA 5JQ5A 2BROA 4J95A 3KRXA 4YJNA 3DK3A 1PYXA 3PVGA 2QLQA 4AA4A 3PSCA 4CZYB 2ZV9A 2I0YA 3G90X 4WNMA 3MFSA 3H10A 3PY3A 2JFLA 3WZKA 3FZTA 3IDBA 2BFXA 3FMJA 3KL8A 4I0RA 4IJPA 2JKOA 4EYMA 4R7HA 4AU8A 5L6OA 2C5OA 3I0OA 4YJUA 3GNIB 3LJ2A 3DZOA 4ZOGA 1CKJA 1GIJA 5EG3A 4F1MA 4L3JA 5I9WA 4RIOA 3KXGA 4G1WA 2C3KA 4BCFA 3MI9A 4YTIA 3ORPA 2B52A 5AR8A 5M09A 4RJ6A 4ZZOA 5AFVA 5I9VA 4O21A 2CGVA 5EW8A 2OF4A 4WKQA 5JRSA 2J50A 4EHEA 1GIHA 4QMLA 2RIOA 1IAHA 5E8UA 3LVPA 3LZBA 4KWPA 3RAHA 4OT6A 3OP5A 4E4MA 4YO6A 1UNLA 4H58A 5LMKA 3D5XA 4MXZA 4C3PA 4YNEA 4YJRA 3MSSA 3E8DA 1YWNA 2WKMA 4AS0A 2G2IA 4CLJA 3E64A 3AMYA 3UC4A 4BR3A 1MP8A 3OF0A 5HIDA 4RFZA 3QF9A 5E1SA 4UWBA 3C5UA 5L4QA 5AJQA 4C7TA 4WG5A 3R02A 2OLCA 1ZOHA 3A2CA 2VTNA 3ZTXA 3VS0A 2BRGA 4UYAA 4CFXA 4FEUA 4YNOA 5DMZA 3MB6A 4N0SA 3UG2A 3FLWA 4U8ZA 3MYGA 3QX2A 2V7AA 4XCUA 4L3PA 5FDPA 1Q3WA 4DGGA 5KMKA 4FTAA 5EHLA 3VO3A 5CAOA 2JD5A 1PXJA 1NY3A 3E93A 4LGDA 3IW5A 4OLIA 3FXZA 2GMXA 3QCQA 1ND4A 4M68A 5ITAA 1OMWA 2ESMA 2XNBA 3KXXA 5CEIA 5IISA 4JR7A 1Q5KA 4CLIA 3BZ3A 4AGCA 2FB8A 3KKVA 3G0EA 3P5KA 3BEAA 4P2KA 1YOLA 2VTAA 4IVDA 3DJ5A 4F65A 5HU3A 2XIRA 4DEGA 4USEA 4XOZA 4TYHA 4ARKA 5JH6A 2JIUA 4YZDA 3ORXA 5K3YA 3UVQA 4FX3A 3ORTA 5FUTA 3DV3A 4U42A 4PL4A 5AUWA 3W33A 1SVEA 4LRKA 1MRUA 3O7LD 4D2RA 1B38A 1PHKA 3NUNA 4GUEA 1OKVA 5C26A 2PUIA 4WD5A 2PMNX 3DKGA 1ZY5A 3DKFA 4UWYA 5FRIA 2YERA 4FC0A 1R3CA 4RLLA 3MPMA 4P5QA 2XNOA 2C3IB 3ERKA 1J7IA 4D1ZA 2I7QA 3TJCA 3NR9A 3R6XA 3FQEA 3VBYA
chains in the Genus database with same CATH superfamily
2GU8A 4MK0A 3V5WA 4CTCA 2VTRA 3CTHA 4O1OA 3C1XA 4BIEA 4TW9A 2J51A 4DF3A 2QODA 4IWOA 3R8LA 2V62A 3RWQA 2OBJA 5AV0A 2YWPA 4YGAA 3DDPA 3QRJA 4MEDA 2I0HA 1WBVA 4J8MA 4U7ZA 3WARA 4CGAA 3QUEA 4QPMA 4C02A 1ZMUA 3IK3A 1U5RA 4RFMA 5L2SA 4CFFA 2I6LA 3DKOA 5L6PA 4OAVB 2Z2WA 3HX4A 2J4ZA 3EWHA 4AXEA 1Z5MA 5H2UA 2XYNA 1V0OA 2W99B 3UODA 1ZARA 3T3VA 3VHEA 5I9YA 2OW3A 4EQMA 4J98A 4FRFA 4X2JA 2C3JA 2CKOA 4I4EA 4CRSA 4MCVA 3AG9A 2A0CX 2CGUA 3JS2A 4G5JA 4O7RA 5I0BA 2UW9A 2YCFA 3QQJA 3EN9A 3V5JA 3I0QA 3NZ0A 5CVGA 5C27A 4F9BA 5G6VA 3RINA 4D4RA 5AADA 5CY3A 3TN8A 3E8CA 4ITHA 4M97A 3F2RA 4A7CA 2GDOA 1KE5A 3DTWA 3LCTA 3OWPA 5DH3A 5EM7A 4M0YA 3BHTA 3VBVA 1W98A 3HV7A 4NFNA 2F4JA 3VUHA 3QTZA 2ZV2A 5IF1A 2JDTA 2R7IA 4QMNA 2XNNA 2F9GA 3QLFA 4U41A 2G1TA 2DQ7X 4UX9A 3FPQA 4E20A 3TNIA 2YIRA 5EM6A 3ZLWA 4EZ5A 3FXXA 3FE3A 3H9FA 4IB3A 3RM7A 5HTIA 3TUDA 2P3GX 2C5VA 1PY5A 1W2FA 3O8PA 4QP3A 4V01A 2XNPA 3Q52A 3HP5A 5JK3A 3BHYA 3MVJA 5EHYA 4A9TA 4FV2A 1B6CB 1WFCA 4AZTA 4FKRA 1LR4A 2X4FA 4AXDA 3VUGA 1LP4A 4QTCA 2WIHA 4GEOA 3LM0A 3JXWA 4IZAA 5LCJA 2C69A 5M55A 1H8FA 3HRBA 5HO8A 4X2FA 4UMPA 2R9SA 2R3FA 4NKAA 3VRZA 5HBJA 4L46A 3IOKA 4GMYA 3V5TA 5GZAA 5M56A 3AC4A 2J0LA 2C6KA 4CVAA 2GQGA 3B8QA 4KA3A 3POOA 1SZMA 4ZP5A 4UMRA 3NNVA 3GFWA 4WNPA 5CYIA 5FP6A 3HP2A 4JAIA 4MXCA 4M12A 3CBLA 4EHVA 3A8WA 2XIKA 4RIWA 3KFAA 3PY1A 4TWOA 4Z3VA 3MFTA 5J7HA 5BUEA 3U55A 5M08A 3D4QA 4IWQA 1V0PA 3T9TA 3V6SA 4JIAA 2O5KA 3OXIA 3VIDA 3CLYA 2R4BA 4IANA 2WOUA 3NGAA 3IW6A 5EKOA 2JFMA 5CAPA 1ST4A 3O23A 2ERKA 3TI1A 3NFFB 5HQ0A 1YI3A 4ZLOA 2YDKA 3UPZA 3O8TA 2WQNA 2OF2A 2VWIA 3ET7A 3GOKA 3O71A 4EBVA 4EOKA 3NX8A 2PUPA 2XANA 3DLSA 5IMEA 4O7ZA 2JGZA 4B8MA 4XYFA 3U87A 3SOAA 4D4VA 3GUBA 3ZXTA 4DHFA 2BIYA 4DAWA 4PWNA 3ANRA 2V5QA 2RFSA 3MPAA 3QA8A 3RAWA 2IN6A 1FBNA 2XP2A 1FVRA 2XEYA 3LJ1A 4TNDA 3UJGA 4FGBA 4UZDA 3KCFA 4BKZA 3GC9A 3E8NA 5IA3A 4KIKB 4PP9A 4X2NA 4HCTA 4BTJA 4FIIA 1IAJA 3A62A 3KVWA 3F82A 2R3MA 1PXKA 1YKRA 3QRUA 4DHJA 3H3CA 4O96A 1J91A 4D55A 3RKBA 2CNUA 4EHGA 2VN9A 1YWRA 2LAVA 3ZFYA 5BUIA 3CEKA 4PNIA 4XUFA 5A9UA 5H9BA 4GVAA 4QDVA 2PK9A 4FTTA 3F5PA 1NA7A 5L2TA 3A4OX 3E88A 4IB5A 2Z60A 1AD5A 4QMWA 5AV1A 4HPTE 3QBNA 4AW1A 5HCXA 4BDCA 4CV9A 4FV0A 1PKDA 2AYPA 4HPUE 4L45A 4EH2A 5E90A 3UNKA 4FIGA 2XMYA 3WBLA 4WRGA 2R3OA 1VLRA 4FV1A 4YJSA 4I94A 3TKUA 4JOAA 3ZLYA 3DB8A 3QGYA 4R1YA 5CSHA 4DDGA 3R73A 4DCAA 5DWRA 4ZTQA 4QNAA 3GP0A 3TV4A 2JDOA 4A9YA 4I1ZA 2BAJA 3PXQA 5AUTA 3JR1A 3LCDA 3QQKA 3ZCLA 3NNXA 4D2PA 1PJKA 3VW6A 1O6LA 2B9JA 3DOGA 4FTCA 4U80A 5HKMA 2VWBA 4YC6A 2PZ5A 3BEGA 4Y8DA 2WTCA 2ZFYA 2BHEA 3Q4TA 4FSWA 3FEGA 4R1VA 2GNFA 4FVPA 2OJ9A 2IVSA 3NPCA 4L43A 4EH9A 5IZFA 3G15A 1KE9A 1F5QA 4O84A 4G5PA 5M53A 3UP2A 3DB6A 3U6IA 3R8PA 4FSQA 4E4NA 2VO3A 5DT3A 1BI8A 3FPMA 4FMQA 3R9OA 3RK5A 5A4TA 2ZVAA 3QTRA 3EYHA 3OOMA 4IAYA 4RWLA 3P7CA 4CFVA 4U0IA 1ZAOA 3NVKI 2Z7SA 5TO8A 3ZM4A 2X39A 3EQPA 4WNKA 4YC3A 3CE3A 3MA3A 3W8QA 1GJOA 5BNJA 3S3IA 1XHAA 3H0YA 3LXLA 2WEVA 3LCKA 4GK2A 4MXYA 2PVFA 3GCQA 4NIFB 5DHJA 3O96A 4BHZA 4D4YA 4NWMA 1NVSA 4D9UA 5BVOA 4XG6A 5CNNA 4O82A 3MVMA 4I6QA 3L8SA 5AUXA 4D9TA 5DYJA 3IG7A 2C47A 4KIPA 3R8UA 3Q60A 4EQUA 3ORNA 4RVTA 4I6LA 3A7FA 1WBWA 4BC6A 4M3QA 4YHFA 5EYDA 4DYMA 4I3ZA 5DFPA 4NKSA 2FH9A 4IE9A 2UZEA 2PMOX 1R78A 3NW5A 3NYOA 4FOBA 4IC7A 2PHKA 5HG7A 1WAKA 3WF7A 4AZVA 5KKRC 3C4FA 3HVCA 1V1KA 1W84A 2BALA 3QD2B 5EDQA 1UNGA 2OICA 2YCSA 4ANMA 4JL9A 3TKHA 5FXSA 4ZY4A 3PZEA 5BUJA 2ONLA 3COHA 3QKLA 4USFA 4QD6A 5E91A 3FQSA 2WMWA 3EFLA 3Q32A 4IFCA 5DRDA 5EOLA 4BCHA 4EUUA 3LPBA 4DLIA 2C1BA 2ITOA 5IQBA 3SXRA 5LVMA 4NJDA 1QPEA 3CKXA 4F9AA 3QX4A 3IGGA 5BMMA 2BHHA 3SVVA 4YPSA 3UIUA 3PRIA 4CNHA 4FTNA 4OUCA 4W8EA 5H3QA 1ZYLA 5AMNA 4RJ3A 5B2KA 3MH3A 2YLEA 4C4IA 4EEVA 4M7IA 4Y95A 5DBXA 4ZMEA 4MNFA 4F7JA 3KK9A 2XRUA 3FXWA 4J52A 4IVCA 4C3FA 1H1SA 4MNEB 3PPJA 3UO6A 3HZTA 3C4WA 5JKGA 3R2YA 4GIHA 4JG7A 4FG9A 5FWKK 4BTMA 2IZSA 3KXZA 5J1VA 2HW7A 2BDJA 1Q4LA 3DNDA 2V22A 1PF8A 3FY2A 3CQEA 4EOMA 4L3LA 5CASA 2JDSA 4GYGA 4A06A 2GHLA 5I3RA 2GNGA 4JVGA 5JZJA 2PPQA 1H07A 4WBBB 2NRYA 3C0IA 4FICA 4RPVA 4W4XA 1ZXEA 5F1ZA 3VJNA 2JAVA 2CNQA 3QD3A 2HXLA 3FL4A 4EONA 2OKRA 2VTJA 3MFRA 3P5JC 3KY2A 4AE6A 4TNBA 4FV8A 1OIUA 3JVRA 1E1XA 5IKWA 3UDTA 4OTQA 2O3PA 3FI2A 4FBXA 4MH7A 5HD7A 4NW5A 4Q9ZA 3FY0A 3HECA 2X0PA 1XKKA 4EH5A 5DR2A 3RPSA 2WTKC 2VTOA 5CXZA 3GCUA 4H3QA 4ANBA 4NYEA 2WFYA 3M1SA 3A7JA 1PW2A 3QD0A 4AAYA 3QTSA 4W4VA 2YWVA 4EK4A 3ETAA 4IAIA 4AGDA 3AT4A 4ANNA 4E3CA 5I9ZA 1ZYJA 3E87A 3LCSA 4JDIA 2DYLA 3RK7A 4FV6A 3I79A 4CTBA 4PPBA 3VBXA 2W5HA 3VUDA 3VS3A 4CCUA 3R7VA 5B7VA 3I5ZA 3TXOA 3PY0A 3OTUA 4L01A 5ANIA 5B0XA 4E6CA 3BYMA 2C30A 3FHIA 2ZB1A 2J9MA 5AAFA 4EC8A 4LV5A 3F6XA 3ZUTA 2QVSE 4QQJA 4E5AX 5HZNA 1IA8A 3CD3A 2BAKA 3F61A 3W2RA 1YHSA 3OC1A 4DFZE 1UV5A 4AXCA 5LVNA 3O17A 3EL7A 4EH3A 3DK6A 3RBWA 2CPKE 3PWDA 3HDMA 4LUDA 1G8KA 4IC8A 1CTPE 3EQFA 5LVLA 5TR6A 4DH5A 5LARA 3GBZA 5JGAA 5LWMA 3V51A 3ANQA 2WMRA 3GQLA 4FG8A 4FNWA 2HELA 3SLSA 5EM5A 4X6RA 2Z02A 3HV4A 4FNZA 1BI7A 1PMVA 4O4CA 4BRXA 4AXAA 2IEWA 4G3EA 3G2FA 3TZ7A 3FC2A 1FOTA 3VUKA 5HTCA 1YOMA 2WTDA 4WBOA 4ZLZA 4X3FB 4IWPA 2PVMA 5AP3A 4EOLA 4TY1A 2Y6MA 4TPTA 1ERKA 4TXCA 1JVPP 3VS5A 3KGAA 4NSTA 5KCVA 2B9IA 4BDIA 1OKZA 2VTQA 3PA4A 5FD2A 1XBBA 2R3GA 4RX7A 2R0IA 1Q8ZA 4E5BA 4K6ZA 5ANOA 1XBCA 1U46A 4U81A 3QHRA 3D83A 3HMNA 3TEIA 2WNTA 4GJ2A 5M06A 3VHKA 4JNWA 1UVRA 3C4EA 5M07A 2Y4IB 2FSOX 5EI6A 2ERZE 4MQ1A 4C8BA 5C4KA 2UZDA 4RC2A 1Z57A 3TNPC 1XH4A 4RSSA 1DI8A 2X8EA 5E1EA 3PIZA 1P2AA 1Q61A 3TNWA 4A4XA 2VTTA 3PP1A 1GIIA 1IA9A 5HVJA 1XH6A 3TUBA 3MPTA 2W1GA 3RHXA 4PTEA 3BYSA 5L2WA 4NTTA 2C6EA 5FQDC 3P78A 4AW5A 3COMA 4H36A 3DJ6A 3QQFA 3Q3BA 4U3ZA 4EOSA 2CSNA 2XA4A 4YP8A 3P7BA 4NW6A 4F1TA 5KMNA 5FTOA 1R39A 3V04A 3TUCA 3R22A 4NZWB 3DXPA 3UOJA 3PG1A 4BDAA 4EL9A 1P4OA 4MD8E 3FBVA 2J0IA 3FC1X 4Y72A 5GJFA 3CPCA 1G3NA 5DPVA 1BL6A 1JAMA 5FEDA 5HO6A 3ZYAA 4WT6A 3PJ1A 3S00A 3LXKA 2BZIB 3SD0A 5FTGA 2Q0BA 3FL5A 1ZWSA 4UMUA 2PE0A 2X7OA 4W9WA 4ZJIA 4KUJA 2ZMCA 2HXQA 2PUUA 4BWPA 2XBJA 4AOIA 5DI1A 4XV9A 2VWVA 4L7FA 4YJOA 2VNYA 2X8IA 1Y91A 4IACA 2QG5A 1GZNA 3FKLA 3KU2A 2C6LA 3CC6A 4FSTA 3BHUA 4APPA 5K0XA 2RL5A 4MXXA 4JDHA 3HYHA 4E26A 4WG4A 5IH6A 3A7IA 3I6UA 2PY3A 3RCDA 3UNZA 4D28A 5FLFA 4F0GA 1J3HA 3U51A 2JKQA 4YSJA 4GFOA 3A8XA 3WYXA 5KUPA 4L8MA 5ACBC 3UGCA 1Y8GA 3FI8A 4S30A 4RWIA 4MXOA 4GRBA 3DBCA 1Q8UA 4F64A 5HLPA 5HU9A 5BVFA 3G9NA 4GK4A 4OTHA 3PXRA 3ROYA 3PXYA 1WBNA 4AW0A 1RDQE 5IA2A 4RX8A 2P0CA 2DS1A 3C9WA 4JBPA 4MQ2A 4O91A 4OW8A 3KCKA 5AR3A 2VWZA 4FKUA 1SVGA 1PXNA 3SQQA 3UMXA 4CRLA 2JBPA 4N4SA 3HUCA 1ZYDA 4KIKA 3K3IA 2IW6A 3QAME 3L9LA 3W2SA 3BYOA 2F2UA 5HESA 3QKKA 3MN3A 3VBQA 4F6WA 4FIEA 3OBJA 2B55A 3FHRA 1YDSE 1KUTA 3VJOA 4PPAA 4XG4A 3HA6A 5LXMA 3EOCA 2YN8A 1OB3A 2WTWA 4S32A 1YHWA 2R3KA 3AMBA 3U8WA 4XOYA 1NW1A 2I0VA 1A06A 3OROA 2XK6A 1YW2A 2X2KA 3PVWA 3QUDA 4I5HA 2VTSA 4UXQA 1XMMA 1QPJA 3C0GA 2XARA 5CVHA 3ATTA 3NW7A 3C4XA 3UIXA 4EORA 4O7SA 2HZIA 2VWXA 2QNJA 5ICPA 2IF8A 4CXAA 2Y7JA 2NO3A 4XJ0A 3AGLA 2E2BA 3AT3A 3ZLSA 2VD5A 3ZUUA 4FZDB 2QD9A 3AGMA 3IS5A 4K2RA 5IQCA 1TQPA 3GQIA 4FTRA 4PRJA 2QOBA 4U5JA 4I23A 5E8ZA 1G8AA 4DG3E 4YZ9A 4ZMFA 4FV9A 2R64A 4MKCA 3SW7A 3SW4A 2WMXA 4J71A 5FBNC 4WRSA 3FMNA 5A46A 5GIOE 4S33A 5JZNA 4AQCA 3QGWA 3QWJA 4BCQA 2EUFB 2WMBA 3C4CA 3BWFA 4E5WA 3U9NA 3BLHA 4BWXA 1YQJA 4NCTA 4JJRA 3EH9A 4EUTA 3Q2MA 3UP7A 5E9EA 5CT7A 4H1MA 4IZ7A 4C34A 5J95A 1DAWA 4I6HA 4FSYA 4AA0A 4BYJA 3L9NA 2J5EA 3WF6A 5A6OA 3W0MA 3POZA 3V8WA 5FXRA 1JPAA 5K4JA 3SXSA 5HI2A 4Z7HA 4RT7A 4DGLC 1HCKA 3LKMA 4R3RA 2OH4A 1CKIA 3E92A 4PQNA 3GC0A 5D7AA 4DEDA 5JT2A 2E9PA 3PFQA 4F99A 5HX6A 2XNGA 3C4ZA 2RG6A 4ZSAA 4NIFA 5I3OA 4LL5A 4RLKA 3DK7A 4D4SA 5CEMA 3PPZA 1JKTA 3LFQA 4LL0A 3F5GA 3KA0A 4EWHA 5IQHA 5DEYA 5C9CA 1PMUA 3NS9A 2PVKA 1KE6A 3NVMB 5BYLA 3ZSGA 3GI3A 2ITXA 4UWCA 1IRKA 2VTLA 3ATSA 4BDEA 2WB8A 1JOWB 5CEOA 4FKGA 5CQWA 4YURA 3DAJA 2ITZA 2WMUA 4ASEA 4BBEA 3HAVA 2BAQA 2PVRA 4MWIA 3BLRA 3ZC6A 3PDTA 2C0IA 2OG8A 1LEZA 4B6LA 4BDKA 2W4KA 2QOCA 2XJ2A 2GHGA 3PTGA 3FYKX 1OITA 3EIDA 4QQCA 5J87A 1KE7A 3P86A 2WO6A 3GU7A 2UZBA 4IAZA 3ZBXA 4C2VA 3W0PA 4PL5A 4MBIA 4DFLA 4O0YA 3CQWA 1TVOA 3R7UA 3L9PA 1OGYA 1WVXA 3MV5A 2V55A 2UVZA 4HJOA 1BKXA 3AC2A 5DR6A 3PFYA 4D5HA 4EH8A 3VUIA 2X2MA 3TIYA 3ZLXA 5HNIX 1OL7A 1GZKA 3OW3A 3ORKA 1KSWA 3GCPA 5IQAA 5JFVA 3F2AA 5JN2A 2OSCA 4F6UA 1G8JA 4RWKA 4QMZA 3SG9A 4MNEA 4AQKA 5T6KA 1YOJA 2DUVA 3AD4A 2ZM3A 3EQGA 4JMQA 3D14A 2ZM1A 5J9ZA 4BBMA 1FMOE 3RJCA 1H1QA 2X8DA 3RK9A 4BIDA 4HNIA 3LQ8A 2ZM4A 3KRRA 4JLCA 1WMKA 3WE8A 4OAUC 1U54A 3KN6A 2A19B 1FMKA 2W1DA 4Z55A 3E8EA 3GFEA 3H0ZA 2QG7A 3AD6A 5EHOA 5C01A 4JT3A 1BL7A 2WTIA 1W83A 3ZC5A 4C57A 2QOKA 2WGJA 3L8XA 2WELA 2WTJA 3KN5A 1FPUA 4G31A 1J7LA 3VS1A 4DGOA 2A2AA 3HGKA 3GT8A 3MH0A 4LV7A 3OCTA 4BCGA 4QPSA 1H1RA 1VJYA 4ACHA 3LXPA 3B8RA 2PSQA 3C7QA 3D94A 3HUBA 4TTHB 4F9WA 3OEFX 4MAOA 5M44A 3G0FA 3F3TA 3MTLA 4KS7A 1JSUA 3MFUA 5HGIA 2QI8A 3LFBA 4FKTA 3VBWA 1X8BA 2C68A 4R5YA 3BU6A 2XEZA 1A9UA 4OGRA 4MVFA 2OJIA 1XH5A 5K5XA 4E6DA 5K9IA 3QWKA 4HYIA 4F7NA 5CWZA 1YWVA 1OUYA 5HG5A 1J1BA 2X4ZA 2UZVA 5EYMA 4E1ZA 5IQIA 3Q6UA 3TDVA 3THBA 3IW7A 3EJ1A 3O5AA 3F5XA 4QMSA 5GZ8A 3A61A 3CR0A 2Y9QA 5FBOA 2VUWA 3HKOA 3DBEA 5CZHA 5E8XA 4EOOA 2HZNA 3HV5A 3PZHA 2HZ4A 4MD9E 1VZOA 5CU4A 3TZMA 4I21A 4DFBA 4N6YA 2GNHA 4I5MA 5LMKC 2CLXA 3WIKA 2XIZA 2IW9A 4IM3A 4O86A 4ZTHA 4U3YA 4FSUA 3RALA 3UOKA 2B53A 3PYYA 3OW4A 3SKCA 5CLPA 4ZSJA 2BILB 5F94A 4MWHA 2CJMA 4ZK5A 2X9FA 4Z9LA 5CAQA 1CSNA 2ZV8A 2OFVA 1JSTA 1GZ8A 2CMWA 1OUKA 4DEEA 3PJ3A 4LFIA 3FI3A 4IDTA 1VEBA 3IDCA 3ZBFA 5I9XA 1YDRE 5HCZA 2YAKA 1M17A 2GQSA 4HYSA 3B2TA 3R9DA 3QTUA 5CI6A 3E3BX 4QTEA 4G34A 3UZRA 4M69A 5CEKA 3NUSA 5LQFA 1O6KA 2GNIA 1H4LA 4TT7A 2WHBA 3EN7A 4X3FA 4KBCA 3D5VA 3G6GA 1JKLA 2YCRA 2EWAA 4O4EA 3II5A 3MY0A 4RA4A 2UVYA 5E8WA 2HK5A 3R28A 3VS6A 5E8SA 3BGZA 2WD1A 3P0MA 4E73A 4QMQA 3FAAA 5BMSA 2RG5A 4S2ZA 3F2NA 1OVEA 3F9NA 1W2CA 5E8YA 3VF8A 1PXMA 4RVLA 3CJGA 4F70A 4BZDA 1ATPE 2P55A 4CG8A 2R3PA 5FM2A 5EI8A 1FGKA 3ML1A 3EKNA 1U5QA 2B9FA 3D2IA 3ZHPC 1H27A 3WF8A 3FYJX 3ID6C 4ASDA 3HMMA 4J1RA 1MUOA 2P2IA 4BIBA 4OTDA 2OFUA 4C4GA 3NNWA 4HZRA 3FMKA 3NAXA 4OBPA 4BDBA 4JAJA 2WQBA 4E6AA 3P79A 5HE2A 4AT3A 2XAMA 1Q3DA 3HV6A 3IW8A 4FT7A 3K5VA 4JRNA 4RX9A 3N4TA 1T45A 3NYNA 4Q5HA 4JX7A 3PXZA 1SNXA 4L7SA 4ZSEA 2ZJWA 4IWDA 4EQCA 2YZLA 3ZSIA 4RFYA 4BCPA 1LUFA 1RJBA 2GTMA 3NRMA 4KNBA 4ENXA 3SG8A 4ZS4A 4R7BA 3OG7A 4JIKA 3T9IA 1R0PA 2O2UA 3QCXA 2BR1A 4EOJA 5CF5A 3UDZA 1APME 4GU6A 4FTLA 2PL0A 2GHMA 4IBMA 3SHEA 4FEWA 3ZM9A 1OKYA 4D2TA 3EN4A 3OCBA 1WBTA 3CIKA 4FKJA 4HNFA 3AC5A 3RWPA 3TV6A 2JAMA 5CF4A 4ALVA 4QP6A 4YZCA 4L6QA 4DTKA 2WU7A 5KMJA 3R1YA 5A4EA 4G6NA 2UZUE 2QHMA 5DEWA 3R1NA 4NH1A 3LW0A 1H1PA 5CALA 3P08A 4DT9A 2FYSA 4O0SA 2CGWA 4MF0A 1Q99A 2O63A 3A4PA 4XV3A 5FTQA 4O7TA 1VYWA 4O22A 4DLJA 3UQFA 4CMTA 3AC8A 5IEYA 4AT5A 3AMAA 5HVYA 5E4HA 1PXLA 4I0TA 2JIVA 3OBGA 1TFFA 4C33A 5IH4A 2HCKA 3WYYA 5CTPA 5DNRA 3RM6A 4QT1A 2PMIA 4PNKA 2R5TA 3R00A 2H9VA 5AWMA 4IDVA 4I5CA 2WQMA 3EL8A 1KE8A 1RE8A 1JWHA 1HCLA 2NRUA 3I5NA 2OJFE 3QTIA 3R7EA 1YRPA 4PX6A 3CPBA 3LFCA 5CF6A 3W0RA 4RZWA 3TG1A 4D1SA 5CI7A 1SNUA 4YJPA 4HGSA 3WILA 2W1CA 2W06A 4IX4A 1URCA 3QXOA 4XS2A 2RGPA 4L9IA 4NL0A 3FLNC 4X3FC 3NUPA 2XVDA 2QR8A 3ORIA 4QP9A 2EXCX 4XH6A 4PDYA 2H96A 3SV0A 3UZTA 5IQFA 3ZSHA 1YXTA 4ZY6A 1MQBA 3RPYA 2IW8A 4FSMA 2PUNA 4YZBA 4I6FA 4PMPA 3JYAA 3G33A 2OWBA 5A14A 5HNGA 4OR5A 3GC8A 5D10A 3L1SA 2P2HA 3AC3A 4EKLA 4G6LA 5ETIA 4MBJA 4YUQA 4U45A 3BWJA 2Y4IC 3EB0A 4K8AA 4Y73A 3NLBA 5EYKA 4BKJA 5CAVA 2YJSA 3PIYA 2HAKA 4HZSA 4R8QA 5GJDA 3W55A 4FF8A 4IM2A 4KIOA 4DH7A 1RQQA 4QTBA 2VWUA 4RX5A 5CF8A 2PVNA 3LFDA 4H1JA 3DBFA 5K0KA 3R9RA 3ENHA 4RGJA 3PWYA 3RMFA 5CX9A 4X7QA 3V01A 1OPLA 3M11A 4BDFA 5EQPA 4DEBA 3G9LX 2CKQA 5DGZA 3HL7A 2YM7A 4O6EA 4IM0A 4R7IA 3RZBA 4GV1A 3VNTA 2YM8A 4OT5A 4BGQA 4KS8A 4O38A 1XO2B 5DR9A 4O4DA 3SDJA 4L52A 3QZFA 3LOKA 2G2HA 4ASXA 2VX1A 3F7WA 3ORMA 1MRYA 1WBOA 3QQUA 3MJ2A 3V3VA 3PJ8A 1OPJA 5DT0A 1BX6A 3OZ6A 3DZQA 4KRDA 4AW2A 3OS3A 5HO7A 5J1WA 3RGFA 1L3RE 2C6OA 4F7LA 1B39A 2W1EA 5HG9A 2JITA 4YSMA 3GCVA 4M66A 5EH0A 4NTSA 2F7ZE 3BIZA 4DEIA 4O2PA 4E4LA 5DVRA 3L8VA 1M52A 3ENMA 3QUPA 3D15A 2CN8A 2Z8CA 4PY1A 1CM8A 3O2MA 3BL9A 4D0WA 3DKCA 3GCSA 1REJA 2BZJA 2A98A 3JY9A 4M67A 2E9NA 1UWJA 5FGKA 3WI6A 4BWKA 3Q5IA 2CLQA 3DQWA 3SGCA 3O7LB 2FA2A 2VRXA 3K2LA 3TZ8A 1YXXA 2QKRA 3CQUA 5IPJA 4DFUA 2VTIA 2BRNA 4A4OA 4H3BA 4O7NA 4GK3A 1DS5A 2UZTA 4FG7A 2BUJA 2XK9A 3NFGB 4QMPA 4GS6A 1H1WA 5GJGA 2WQOA 1JSVA 4AZWA 3MY5A 4Z7GA 4JI9A 2B9HA 4X21A 3SRVB 3UIBA 2QU5A 4RJ4A 1GZOA 1YI4A 2OZAB 3R2BA 4YJVA 5F95A 4C2WA 1QPDA 3I7CA 5C03A 4BTKA 5K5NA 2E9OA 3QA0A 4L68A 3WOWA 4C59A 3D2KA 4QO9A 3BYUA 4FR4A 1IG1A 4IZ5A 4FIFA 4R3PA 4E7WA 2BFYA 4GH2A 2X0QA 4X3JA 5M51A 1UNHA 4GW8A 1L8TA 1NVRA 2IVVA 2X0OA 3ULIA 3VULA 1Y6BA 4OTGA 4S31A 3ROCA 5CXHA 5AV4A 1WCCA 1U54B 2AC5A 3CTQA 5FM3A 5B2MA 5JGDA 2J2IB 3ITZA 3HRCA 2ITWA 1XH9A 2OGVA 3BGPA 3FLYA 3R01A 3LLTA 4BBFA 4BCJA 5IEXA 1Y8YA 2W1ZA 3RPOA 4BTFA 4V0GB 5GHVA 1M2QA 4DC2A 2B0QA 2UUEA 3HRFA 4ZSLA 3QXPA 4G9RA 5L8LA 4AACA 3SX9A 2WMTA 1ZOEA 3AKJA 3PXFA 4XRJA 3E62A 4MXAA 4EH6A 4JX3A 4DTAA 3VUMA 4C4JA 4GCJA 4FKWA 5HHWA 3KMMA 2AEGA 3BE2A 3UYSA 3QQHA 2UW7A 4JG6A 4DFNA 3V6RA 3V8SA 5LVPA 5LWNA 3LFEA 2H8HA 5AIRA 3ZONA 4FTJA 2CHLA 3NNUA 5BVWA 4CQGA 4O7LA 4HCUA 3OOGA 4KKHA 4O27B 3EYGA 2R3NA 1FINA 2YCQA 4IFGA 4NM7A 1NT2A 2XKEA 4F78A 5AR2A 1QPCA 1JKSA 3C50A 2EB2A 3AD5A 3U4UA 4D1XA 2NNWB 3Q96A 1XH7A 1ZMWA 3GU8A 4CMUA 3ULZA 4X2KA 4Q2AA 3PVBA 4QYGA 2IVTA 3F7ZA 3LJ0A 3HLLA 4WUNA 5ETAA 3W16A 2W4OA 3I60A 4JDJA 3RVGA 3FQHA 4JS8A 4G17A 4OBQA 3TTJA 1ZMVA 4LYNA 4D2VA 4KB8A 5C8KA 4ONAA 3C51A 2XZSA 2A1AB 3UQGA 1Q97A 2QO7A 3ACJA 1EH4A 4G2FA 5BVKA 5CENA 5M4IA