5FEDA

Egfr kinase domain in complex with a covalent aminobenzimidazole inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
288
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDEMDDVVDADEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Discovery of (R,E)-N-(7-Chloro-1-(1-[4-(dimethylamino)but-2-enoyl]azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), a Novel, Potent, and WT Sparing Covalent Inhibitor of Oncogenic (L858R, ex19del) and Resistant (T790M) EGFR Mutants for the Treatment of EGFR Mutant Non-Small-Cell Lung Cancers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 288
sequence length 321
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fedA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fedA01
3UZRA 1R39A 5JFWA 4ANQA 5J1WA 2W9ZB 2UW0A 4PF4A 2BRNA 4DEGA 3EMGA 4ACCA 3UODA 2WB8A 4H3QA 4DEBA 2W4JA 3HRBA 4I94A 2R0IA 5CXHA 2HWPA 3GI3A 1G8AA 4YJTA 4E4XA 2OK1A 2ETRA 4RJ8A 4KKHA 3GCPA 3CGFA 3HV6A 4ACGA 1YI6A 4FV3A 3QL8A 4HYIA 4I4FA 3W2QA 1BX6A 5F95A 4GT4A 2W1CA 3RK9A 4EH5A 4ZTNA 3VUTA 4D4SA 1P14A 2QOIA 4IZAA 3Q96A 5E8ZA 3U6HA 2YZLA 3F2NA 3RAIA 4TW9A 5CWZA 3FV8A 4EC9A 2R4BA 5FBNC 5DGZA 3PDTA 5M4UA 4H3PA 4M68A 4OT5A 3LQ8A 4ZLZA 1J7IA 4S33A 5AFVA 2YDJA 5A3XA 4CEGA 2JIVA 4NYEA 4YC3A 5AAEA 2P0CA 4YZBA 4ZTLA 1CKPA 2ZB1A 3FLZA 3TT0A 1J91A 4LRJA 4FG8A 1XH4A 2UV2A 3NNXA 5GJFA 4AACA 1XH5A 4JAJA 1ZAOA 4IAZA 1NY3A 2ITNA 2P2HA 1M2PA 3EHAA 5HCZA 5BNJA 4WT6A 3VIDA 4N4SA 4EH7A 3UVPA 1YQJA 4XG4A 5FGKA 3C7QA 4PPAA 3II5A 3DZOA 3KRJA 1UV5A 4ZJVA 4XOYA 4N6ZA 3QLGA 5D41A 4E3CA 5IH4A 1B39A 5B7VA 4YLKA 4BBEA 3THBA 3V01A 4G2FA 2W1GA 2QLQA 4MBIA 3ZO2A 3Q2MA 2GNJA 2X8IA 4G16A 2OJ9A 3OT3A 4HCTA 4BDCA 3O8TA 4BVUA 4K6ZA 4G9RA 3DGKA 5G6VA 4EBVA 4TWCA 1GZOA 3ZLYA 2H9VA 4JG6A 2OIDA 3ENHA 4C35A 3W16A 4ZSEA 4CLIA 2A0CX 5FM3A 4J1RA 4W9WA 5H2UA 2BALA 3OXZA 3UNJA 4DEHA 3C0IA 1U5RA 5TO8A 4EHGA 3CQUA 1Q8ZA 3DY7A 4GV1A 3TACA 5CANA 5CU0A 3BYVA 2XVDA 1Q4LA 5HIBA 3DDPA 4II5A 4IAIA 3F3UA 3K5VA 4M12A 3WILA 5KBQA 2R3HA 4EH6A 4DH5A 3KULB 4ONAA 1OUYA 5ETFA 1REJA 4TXCA 5CAPA 4USDA 1YWVA 4XRJA 5EDPA 3ODZX 2W96B 3A7IA 3MPAA 4HGSA 4HVSA 3VW6A 3P7AA 3UVRA 3ZFXA 5BVOA 1YHSA 5DHJA 4JG7A 3EKNA 3PLSA 4EYMA 4DLIA 4R1YA 5M44A 1H4LA 2ACXA 1ZYLA 4MX9A 5LVLA 3VJNA 4DTKA 3SVVA 4D0WA 5CAVA 2QR7A 3C13A 4QP1A 4ANOA 5M53A 4AGWA 2I0YA 3P08A 1OPKA 5L2WA 3BE9A 4QPAA 2OIQA 2UUEA 3R7OA 5LMAA 3UJGA 3SRVB 4FKLA 5HIEA 1BLXA 5IQGA 5AM7A 4U43A 3ZSIA 5C8NA 5GINE 5IEXA 4YHTA 2O64A 2PMLX 4FTTA 4IEBA 5CLPA 3NUUA 3LFNA 4RGJA 2ZV2A 3F3VA 1H8FA 3EWHA 3T9IA 3NPCA 5H8BA 5AWMA 2R3MA 3HMMA 4ERKA 4FTJA 2WGJA 4OTRA 2QO2A 3DDQA 4JR7A 3MY5A 5EYCA 2R3RA 3I1AA 3LJ0A 4I0RA 3ZDUA 2IVVA 3GQIA 5HLPA 3O71A 3WIGA 1WAKA 2XP2A 4B99A 2VNYA 5KMMA 4E4LA 4UZHA 4UYAA 3P5KA 1LR4A 4L68A 1OUKA 2Y7JA 2HXLA 1UU3A 2G2FA 3ZRKA 5JRQA 4AZVA 4H1JA 4EOQA 3BHHA 5AUWA 4FKGA 4NW5A 4A4XA 1R0PA 4QT1A 4FKWA 5ETAA 5I9WA 3LM0A 2G9XA 4LL5A 3KVXA 4EORA 2WTKB 3PXFA 3DBQA 2WNTA 5J7BA 2UW3A 3ZSHA 2WMWA 1R0EA 3CPCA 4QMQA 3MTFA 2PVKA 3WOWA 3CD8A 4KNBA 3UP2A 3ATTA 3OWLA 4BKYA 3NSZA 4ID7A 1OM1A 3BQCA 3EYHA 2XK9A 3BZ3A 4TYIA 4U8ZA 4JS8A 5IF1A 3R1QA 3FC2A 3CC6A 3TL8A 3PA5A 3Q4ZA 1KV1A 2NP8A 5AX9A 2Y0AA 3QBNA 4FOCA 4J98A 4ZLOA 2F7EE 4G6NA 4W9XA 2GNFA 2BROA 3R2BA 4YSJA 1PJKA 2P3GX 2VWBA 3CTJA 4FSMA 2WTVA 4GU9A 4L7FA 3SA0A 4PL4A 4NWMA 4HOKA 2OXXA 3N9XA 4O96A 3DXQA 3UOHA 1ZZ2A 4I5HA 3KRXA 5AUVA 5A4EA 3FI2A 1SVEA 3FZTA 3ORKA 3TNIA 4DE4A 1IRKA 4IWDA 2VRXA 3R73A 2OG8A 3FZRA 4IX5A 4NJ3A 4RIWB 4QP3A 2JDTA 3DQWA 3P7CA 1OL2A 2C3IB 2XA4A 4AE6A 3ZRMA 4GU6A 4F9CA 5AV1A 2V62A 4F9AA 2J4ZA 5IQDA 3LVPA 1M52A 4QMOA 4RWIA 5CSXA 2Z7RA 4AFEA 1ZYDA 5EI8A 3UO4A 5JGAA 3FMKA 5CYIA 4XMOA 4WIHA 3BGZA 4HVDA 2PVHA 4JDIA 3R9NA 3UPZA 4ZEGA 4YUQA 4MWHA 2I7QA 1YXUA 3L8XA 3W1FA 4FKUA 2XNBA 3VHKA 3QHWA 4S32A 3M2WA 1J7LA 3V04A 3OXIA 2JDRA 2HELA 1P2AA 5D10A 4FT9A 5AAFA 2VV9A 4CFMA 5DA3A 4QRCA 4EOIA 1EH4A 2E9PA 3R8PA 4BI0A 1H08A 2VX1A 5FTQA 2XS0A 4FIGA 3PSDA 4C3PA 4EKKA 1NW1A 3FLNC 4RVTA 4EOLA 4DCEA 4LOPA 3MVJA 4BCMA 1H01A 1AD5A 3PY1A 3LMIA 3D7TB 3PJCA 2QOQA 4XX9A 3V5PA 5DNRA 1Q8UA 5E4HA 1SVGA 4RC2A 2VAGA 4ZSGA 2ZM4A 3WF8A 3DXNA 1XKKA 4MH7A 3HP5A 1JLUE 3UDBA 3ZC6A 3ZH8A 4BKZA 4E6CA 1ZRZA 1XBBA 2IVSA 5JZJA 3ZM9A 3FMHA 4O0YA 2BKZA 4IIRA 3PA4A 4EEVA 3G33A 3HRFA 3QHRA 3PXQA 4GVAA 5AA9A 4FI1A 3OMVA 3AGLA 5HE3A 3RKBA 4ACMA 1OPLA 4DITA 4M14A 1AQ1A 3UMXA 3RCDA 2J0JA 2YZAA 1PYXA 3F9NA 4L6QA 4B4LA 3R8MA 5I9ZA 3V5LA 3R7EA 3ZO4A 4C59A 3GQLA 5AM6A 2C6OA 2OJJA 1MQBA 3EQPA 4R5SA 1GIHA 2W4OA 4FSRA 4XV1A 2EXEA 3TNPC 5D9HA 4D4VA 2YIRA 5DEWA 2WEVA 3QRKA 4EOKA 4G3DA 5JN2A 4I6HA 1Z57A 4YNEA 4AW0A 4BZDA 4C4IA 4EJ7A 3GNIB 2NRYA 3G5DA 4ZIMA 3DNDA 2HZ4A 5HG8A 3U4UA 5IQHA 5CI6A 4X2NA 5EM7A 4F99A 3A7FA 4IADA 5IA5A 1S9JA 3V5JA 3I7BA 3BU6A 5E91A 4AW5A 4ITJA 2WQNA 4TT7A 1FQ1B 2CLXA 3L8SA 4UMRA 4NL0A 1CKIA 4G5JA 4JDHA 1XH9A 4FV6A 4HW7A 4H39A 3UOJA 3G9LX 1FMKA 4PWNA 3OEZA 4NM7A 4FKPA 3QQHA 5IA3A 2EXCX 3AC8A 2A1AB 2X4ZA 2V55A 2YCFA 1U4DA 4YGAA 3KF4A 4CKJA 1P4OA 3PSBA 4D2WA 2BIYA 4EQUA 5A6OA 1XHAA 3ALOA 3W2RA 4EOJA 2BHHA 4EK8A 3KL8A 4R7IA 3L1SA 3ACJA 2F7XE 4FKOA 1R1WA 3OFMA 2KULA 3ORXA 3N51A 5E8SA 3HVCA 4GSBA 4WOVA 3WF7A 5J5SA 4XUFA 4I4EA 4HVHA 1H1PA 3NNVA 4W8DA 2XCHA 2V7AA 2QOKA 4FL2A 4C37A 1J7UA 2UW7A 4DBNA 2GTMA 4BWXA 4LGGA 5E9EA 3RI1A 4M0YA 5HG7A 2XIKA 4MXCA 3TDWA 5GZAA 2PUPA 4CFVA 4NK9A 4CYJA 5J5TA 5HD4A 3LFAA 5M06A 3ORTA 5BPYA 3EH9A 3DCVA 4WA9A 3UIMA 3RPRA 3FYKX 4I93A 2BFYA 3I4BA 4CKIA 1PKGA 4WSQA 4FIEA 3DK6A 4RG0A 4UMTA 4FSWA 3CY2A 3O23A 3Q9YA 3V5WA 1Q61A 3HNGA 4MQ2A 4QYHA 2GHMA 2X39A 2VD5A 4RIOA 4X3FC 1H1RA 1J1BA 3GU7A 1HOWA 4AN9A 1KOBA 4BBMA 3FLQA 2BZHB 2PVFA 5C03A 5FXRA 4R3CA 4KS8A 2XEZA 3DLSA 3OUNB 4KKEA 1JKSA 4N0SA 5HBHA 2XNMA 3FUPA 5CEOA 5HX8A 4UY9A 2CNVA 2QC6A 2HOGA 1WBSA 2X7OA 3L8VA 3SD0A 5CEIA 2XKDA 2R3GA 5FEDA 2UW6A 2OJIA 3MH1A 1OBDA 4MXYA 2JLDA 1JAMA 2YWVA 4F63A 4C58A 1GZNA 1G5SA 3PJ2A 4HGTA 4QMTA 4C2WA 3F5PA 5IU2A 3SG8A 3L8PA 4A07A 2XIRA 2F4JA 1CSNA 2BVAA 5DR6A 1V1KA 4FVRA 4KS7A 3TN8A 4I0TA 4R3PA 5J95A 4S30A 5CVFA 3P4KA 4ZK5A 2O3PA 2HYYA 3CS9A 4PP7A 4F9YA 3FYJX 4J52A 4QTEA 2CGXA 3ZBFA 3E8DA 4LI5A 3PIZA 4FTLA 2WQEA 4O7LA 4I0SA 4JRVA 4EOOA 5JFSA 5CASA 4EOPA 2CNQA 4HGLA 3NNUA 2Q83A 3LMHA 1ZOEA 2CN5A 3R00A 2YWPA 3KXZA 3ZTXA 3EN4A 1Q3DA 4EHZA 3E88A 4XG8A 3UOLA 5B2MA 4MNFA 1H28A 5E1SA 4CQEA 3U6IA 5BVKA 2QURA 3POZA 3QXOA 4BL1A 5I9XA 1YVJA 2PULA 4LGDA 5ANEA 4E73A 3WE4A 4FTIA 4L00A 5EOBA 5EYMA 3TZ8A 2P2IA 2X8EA 3RCJA 1GIIA 4QQ5A 3D5XA 4U7ZA 5JZNA 1Q24A 2VO6A 3Q5IA 4FKVA 3QX2A 3QU0A 4TL0A 1QL6A 4YZDA 3FMDA 4AS0A 5BUJA 4K33A 4ASXA 3DBFA 1U54B 3R2YA 5EW9A 4FEXA 2J50A 3TCPA 4JI9A 4LG4A 1X8BA 5E1EA 5T3QA 2PMIA 3TEIA 4M66A 3R8VA 4U42A 4YJQA 1PKDA 1BL7A 3IQ7A 3V51A 4JT3A 2RG6A 2E9OA 4QMYA 5EQPA 5IMEA 4BDFA 4F4PA 1O6LA 1TQPA 5BYYA 3FLYA 3R9HA 2IWIA 3PE2A 1JKTA 2C6TA 3HP2A 3Q60A 4FV4A 4RRVA 3TNQB 4JIAA 4IM2A 4KSQA 3WZJA 4FVQA 4BTKA 4C4EA 1Z9XA 2F9GA 2YIYA 4FC0A 4O84A 4BHNA 4OR5A 3OY1A 3RAWA 1SVHA 3LFFA 4GEOA 4QOXA 4BTMA 5I3RA 3JYAA 4J97A 4XBRA 5K4IA 3GGFA 3VN9A 4PNIA 5JK3A 4LYNA 3R8LA 3QF9A 1TQMA 3TUDA 3NWWA 3F3WA 4PY1A 2VTSA 2IZTA 4WD5A 3HKOA 3CJGA 5HE0A 2ITYA 4LFIA 5HGIA 3RWPA 3DKGA 2JBPA 4GMYA 3NUNA 5AP2A 5CS6A 2OI4X 3RK7A 4BDGA 3R8UA 4AE9A 3BHTA 2FSOX 2GHGA 4BCNA 4QP9A 5J9YA 4QMZA 3POOA 3ZXTA 4FE2A 4USEA 2PL0A 2WU6A 2BTRA 5BYZA 3VBWA 1H00A 3GU8A 4YJSA 4ZJJA 3QTZA 4J8MA 3SX9A 4F9WA 3ANRA 4BY9E 3TKUA 4PTCA 5KMJA 2XM9A 5LVMA 1TKIA 1WBOA 3C4EA 3GENA 3G6HA 3QUPA 5AR4A 5T6KA 2WMVA 1H1WA 4RVKA 1Z5MA 5E8XA 2C5OA 3A4PA 3Q4CA 4NFNA 5EDQA 4BKJA 4CD0A 4PMPA 2GS7A 2HZNA 3K54A 4CZTA 4G6OA 4K11A 4MNEA 2C5NA 4RC3A 4CG8A 4CFWA 2RGPA 4XOZA 4BDKA 2C30A 3D9VA 2UW5A 3IS5A 1WBPA 4DEEA 1BYGA 2FO0A 3W18A 1XH7A 3GOPA 4ASEA 4D1SA 5IH5A 4DGNA 1V0BA 4EI4A 4ZAUA 4RJ7A 5JKGA 3NCGA 3TV6A 3FMJA 4ZZMA 4QMWA 3QQFA 2Z2WA 3F7ZA 3IECA 3D94A 2YHVA 5FG8A 5HVYA 3WYYA 2G2HA 2I6LA 3IW8A 1OIUA 4U0IA 5FTGA 3WZUA 4AX8A 2E9NA 4F7LA 2HK5A 1KSWA 4WRSA 2BDFA 4LMNA 4AU8A 2ITQA 2W99B 3MW1A 1Q62A 2PUUA 4HVGA 3OF0A 3W2PA 2ESMA 5EKNA 4TYHA 4HVIA 2O65A 4BGQA 3QC4A 4WG3A 4F65A 2A19B 2QG5A 5KMLA 3EFLA 4H36A 3UG2A 1CMKE 2JDOA 4XV9A 4FA2A 5HTIA 3COIA 2XH5A 2FSLX 3T3VA 4HCVA 4ANMA 4F6SA 3P23A 1XBAA 3FI3A 4Z7HA 2OH4A 3LXPA 3GCQA 3PLAE 2V0DA 3FAAA 2UZDA 3MV5A 5IA0A 3LCSA 4NM0A 4Q9SA 4RX5A 1U46A 2X2KA 4G9CA 3G15A 3I6WA 2W06A 4ZY6A 3IK3A 4MK0A 4D2VA 4K8AA 4XRLA 2JKMA 4IBMA 2YCRA 3PRFA 4UXQA 2PZRA 3KKVA 4UXLA 2PE2A 3QUEA 4FV5A 4G3CA 4B8LA 3V8SA 4RLKA 3LFBA 4XV3A 2YAAA 5L2SA 1F5QA 3BV2A 2E9VA 4Z9LA 1YHVA 3BU5A 3SG9A 4ZS4A 5HD7A 2OZOA 3EN6A 3MSSA 2F2UA 3I0QA 3ZRLA 4AZWA 2ITOA 4K0YA 4IZYA 2B1PA 3FSKA 4LGHA 3DNEA 1FVRA 5I9YA 3NNWA 4G31A 1PMUA 1QMZA 3F69A 3RAHA 1KE5A 2ITPA 3L9NA 4IZ5A 3LFEA 5DI1A 4E4NA 2XEYA 2Z60A 3R1YA 5HNIX 4OUCA 3DK3A 4PMTA 4BFMA 1PW2A 5HX6A 2XJ0A 4L52A 1H24A 4FTRA 5AUXA 4DG2E 3LFDA 5IQAA 4A9UA 3FC1X 1OKYA 3D83A 4W4XA 4EWHA 4C4HA 2RFSA 1IA8A 2VX3A 3C9WA 3MIAA 3QRJA 4GRBA 3WF6A 4E26A 2R7IA 5CEMA 1MUOA 3ZFYA 2B9JA 1YI4A 3MB7A 3OWPA 3PVBA 4IFGA 4PTEA 5HHWA 1UA2A 1YXTA 4FVPA 2VGOA 3F5XA 4DBXA 3O17A 3VWAA 1WBVA 2FVDA 5HQ0A 3BBWA 5BYLA 4I21A 5C9CA 4CFNA 5TOZA 2I1MA 4BCFA 2BAJA 3RHKA 2B7AA 4MXAA 2NNWB 1M7QA 4TRLA 4RFMA 3VBVA 3Q4UA 5J9ZA 1Y8GA 4AOIA 4R7BA 3EQFA 3FMMA 3ZBXA 1KE6A 4L42A 4OTDA 4RQVA 4UN0C 4YLLA 3NS9A 5ACBC 3WZEA 2VWWA 3Q52A 5HEZA 3DAKA 4D2PA 2ZDTA 3EJ1A 4IJ9A 3LLTA 4P90A 3N4VA 2CKPA 3AMBA 2OLCA 2HXQA 2J6MA 3P79A 4E8AA 5BUEA 3UTOA 3MFTA 3Q9XA 4GK2A 2PZIA 5E90A 4DFZE 4NZWB 4L44A 3CEKA 3R71A 4FKQA 1RW8A 4PPBA 3NYNA 3H4JA 3S4QA 4RJ4A 1Q99A 2I0EA 1ATPE 2BCJA 3PVUA 3R6XA 5B2LA 2XKCA 1PMVA 1UNHA 1UNGA 3E92A 4ZMEA 4ERWA 1R78A 4NEUA 4AW1A 4Y95A 4FK3A 4ZTMA 3SGCA 3E93A 4QPMA 5DR2A 4H05A 4DFBA 3NW6A 1LEWA 4PMSA 1FMOE 3NUPA 5FXSA 3BLQA 5HTCA 1E9HA 3FXZA 2PY3A 4PPCA 5GJGA 3NW5A 2JIUA 4WNOA 5KZ0A 2YM7A 3LFCA 5H9BA 4BCQA 4C3RA 4C4FA 4BWKA 5CAOA 2UW9A 2XK4A 4D5HA 4FGRA 2Z7QA 3MWUA 3D15A 4G6LA 5H8EA 3HA8A 2Y4IC 2VTPA 4MD9E 4BRXA 2HY81 4S34A 3RTPA 3T3UA 4IFCA 3BHVA 3E8NA 1OIRA 3PWYA 5D1JA 2WMRA 2JKKA 3B2WA 3DZQA 4P7EA 3LQ5A 2JITA 5CALA 5CENA 5EW8A 4F1OA 3NZ0A 1XH8A 3UOKA 5A4LA 5CT0A 2CSNA 3P7BA 3EN5A 3FZPA 2R2PA 4AOTA 2OSCA 2YN8A 4FSZA 4X7QA 3V3VA 2CKEA 2QONA 4MD8E 4UB7A 4XLIA 4U5JA 5AR8A 2GNGA 2QU6A 4O81A 5JSMA 1QPEA 3DV3A 5LCJA 1XR1A 3GU6A 4JDJA 3H10A 4YZCA 4EYJA 5IEYA 3SV0A 3OS3A 1SZMA 4F70A 5CSPA 2X7FA 1XJDA 4XH6A 4C4GA 5CSVA 3WF5A 4IWOA 3U54A 4JG8A 4DA5A 4LUEA 3GT8A 4RVLA 2C6EA 3FPQA 1YW2A 5KMNA 2AC3A 4JBQA 1YOLA 5FDXA 3VW8A 3QWKA 4QMVA 3L9PA 4F1TA 3LIJA 4MEDA 3TXOA 2OU7A 3PPZA 4O2ZA 3DB6A 4QP4A 1WVXA 3I0OA 4QTAA 4Y5HA 1NA7A 4X21A 3SXFA 5JGBA 4ZTSA 3HMNA 1YOMA 3KB7A 4JL9A 5AEPA 3GCSA 4OT6A 2VTRA 2YM5A 3BBTB 2Y6OA 2VWUA 3E64A 4YJVA 3VS6A 4AZFA 4R7HA 4Y8DA 2GHLA 3OCSA 1BUHA 3JVRA 3OROA 3PXKA 4PQNA 3A2CA 1OKZA 3AGMA 3DLZA 5LMKC 5AP1A 3GBZA 1S9IA 2VUWA 3C4WA 3UC3A 5C27A 1WZYA 1KWPA 2I0VA 3H3CA 3ZSGA 1ERKA 4C62A 2G15A 2VTMA 4PRJA 2WTJA 5GJDA 3REPA 4I22A 3M42A 5BVFA 3VAPA 5FEQA 2A4LA 2DS1A 2PWLA 4MTAA 3VBXA 1BI8A 2CDZA 4P5ZA 3DFCB 4JX3A 3RVGA 4C02A 5IUHA 4IHPA 4D1ZA 3QQUA 3QQLA 1XWSA 3AT2A 4M0ZA 3H30A 4FBXA 1CKJA 3CJFA 4Y46A 5FEEA 4LUDA 4OTIA 2GDOA 4YBKA 3GEQA 4U3ZA 3UGCA 3G51A 2OW3A 3EFKA 3ETAA 4BC6A 3S95A 3LAUA 1PMNA 1U54A 3HRCA 2YACA 2IVTA 4JOAA 4C8BA 2P55A 4ITHA 4Y83A 4DT8A 4BCHA 3NUXA 4FTNA 3IGOA 1XO2B 1QPJA 3MN3A 3QA8A 3LCKA 2ITVA 4D2TA 2JAMA 3NYXA 3JY9A 2PVYA 3JS2A 4U3YA 4I41A 2JD5A 5DEYA 4R78A 4RVMA 4QMUA 2BZIB 4K1BA 5BVEA 4W8EA 3JPVA 4U9AA 2XYNA 2V5QA 4L9IA 5CF8A 1GAGA 4V05A 4HPTE 1WFCA 3TTJA 3COHA 3MGYA 5IDNA 1H1QA 3ROCA 5K4JA 4R6VA 3FHIA 4DHFA 3HDNA 4RIYB 4MNEB 2X9EA 2ETKA 5CQWA 3WE8A 5DMZA 1UWHA 3R9RA 3DT1A 3F5UA 3EQIA 2QOHA 4FKRA 4FL1A 4CXAA 5KHXA 4C61A 3DBEA 4D2RA 3V5TA 3SXSA 5LARA 3TJCA 5ANKA 1KE7A 5FWKK 3O7LB 2CNUA 3ZDIA 3QQGA 2VZ6A 1QCFA 4KD1A 2E9UA 4F08A 3D7ZA 3FY0A 3AC2A 2OFVA 4JRNA 4QNYA 4IJPA 2WMSA 3OW3A 2EB3A 2FUMA 4U44A 3DTCA 3H0YA 1H0WA 4O0RA 3MA6A 5D12A 2QCSA 3FKOA 3GCVA 4BDJA 4C34A 4FL3A 4U97A 3FDNA 4IC8A 1XH6A 4FTOA 3HDMA 3KN5A 4IZ7A 4GUBA 3BWJA 3R21A 2OF4A 4PX6A 5D7VA 3DJ5A 2XRUA 3LM5A 4YJNA 4IVCA 3UYTA 4AN2A 4IX3A 4TYHB 4YU2A 3ZONA 4YLJA 2VX0A 3QZGA 3TUCA 4YO6A 5IQEA 1YXVA 4RC4A 1L3RE 4YPDA 4BDAA 4CZYB 4NCTC 3DPKA 3VS4A 5AR7A 1Q97A 3JY0A 3P0MA 4FG7A 3GXLA 4CFUA 2XIYA 5HI2A 3Q2JA 3AOXA 3TKIA 1Q41A 2HW7A 3KMMA 3AT3A 5DPVA 2C5XA 2PE0A 4I3ZA 4CMOA 3CD3A 3M11A 4YC8A 2BDWA 4KIQA 5A4TA 3QGWA 3ORMA 3OUKA 4TY1A 3ZCLA 3FXXA 2R0UA 4AGCA 5L3AA 5IQIA 1Q8YA 4JQ8A 5HO7A 4DGOA 5IG1A 4O2PA 4RZWA 1WBNA 5I4NA 5IQBA 2WMAA 4PTGA 1HCKA 2OJGA 2WTWA 3DU8A 2YIXA 5ANOA 3UMWA 4BDDA 2H8HA 2QOBA 4NJDA 4FX3A 3U6JA 4G17A 4UMUA 3PE1A 4LM5A 3GCUA 4BZNA 3LCOA 4XEYA 4DH3A 3TG1A 2FH9A 4FEWA 4QTDA 3FHRA 3ZXZA 3QCQA 4IANA 1U59A 5A6NA 2J7TA 5CXZA 2OICA 4MXOA 2VO7A 4M84A 4J99A 4O1PA 2OXYA 4EH2A 1OMWA 3TV7A 3AT4A 2CKOA 4CG9A 3KXHA 4NTSA 4XG7A 4J96A 2UZBA 3PXYA 3NDMA 3ZM4A 1K3AA 1KOAA 2WTKC 2AC5A 3O8UA 4DF3A 4FKIA 4MYGA 4RBLA 3VUMA 4FEUA 3COKA 3TZ7A 5ACKA 5FP5A 4YMJA 5I9VA 1OVEA 2GCDA 4FKJA 3NUSA 3QRIA 1T46A 3NX8A 4ZOGA 3VBYA 4ANSA 1Q8TA 2CGUA 4YC6A 2QNJA 3FPMA 3RP9A 3QKLA 3WZDA 2OJFE 5BVWA 3MS9A 1TQIA 4E1ZA 4O7WA 4TTHB 3RINA 2PVLA 3K3JA 3W8LA 2XNGA 4AN3A 2VWYA 4TWPA 5KKRB 2PYWA 2PVNA 4N57A 1GOLA 4YJRA 4AGDA 4DGMA 3IPHA 2IPXA 2PTKA 1PY5A 1SYKA 2GNLA 3QCYA 3R04A 4DAWA 5KMIA 3KK9A 1FVTA 3KF7A 2VTAA 5E92A 4PDSA 5FRIA 5HBEA 5J87A 3RPOA 4MXXA 4WUNA 4IAKA 4EHEA 4F7NA 4DGGA 2O8YA 5DE2A 1JVPP 4GVJA 3ZZWA 5CZHA 4LOOA 3ZS5A 4EH4A 1PYEA 2WU7A 5M4CA 3BGQA 3BCEA 4YJPA 3CY3A 4I23A 2W1DA 1VZOA 3DBDA 3ORIA 5ETIA 3MI9A 2QHMA 3LE6A 5LVNA 1OGUA 2X1NA 4DCAA 4YTIA 3QD0A 3T8OA 2XIXA 4HJOA 4UWBA 5DOSA 5BVDA 2P33A 4DH1A 4ALVA 4O83A 4GW8A 1PXLA 5B0XA 3QZIA 3WIKA 4Z3VA 2YDIA 2YITA 4BTJA 1FVVA 4DTAA 3SHEA 4DEAA 5A54A 4O6EA 3GVUA 4ACDA 4F9BA 2ERZE 1YDTE 5AIRA 3HUBA 3OBJA 3OCBA 5IPJA 3RBWA 4AA4A 3PXRA 3F2RA 2W05A 2X6EA 2XMYA 4O0WA 5LMBA 2X6DA 4A06A 4EK3A 4RJ6A 4XS2A 4O0TA 5E8VA 5HNGA 4ZTRA 3NGAA 2BRGA 3ERKA 4DEIA 4JIKA 2R64A 4RJ3A 5GZ9A 3VQHA 2Q0NA 1YRPA 5HIDA 3B8RA 1DM2A 2H96A 3MYGA 1ZMWA 3PVWA 3S3IA 3K3IA 1DAWA 3FEGA 1H0VA 4FUYA 4S2ZA 3SDJA 2GTNA 3WZKA 4FSQA 4MHAA 3KCKA 5JQ5A 3R28A 4JAIA 4JBPA 4JLCA 4P2KA 3VUHA 2RKUA 3C4XA 2B54A 4QMPA 3U51A 3NRMA 4F09A 2R7BA 5LWMA 3NLBA 1LPUA 3KREA 1K9AA 3EL8A 2C68A 4BYIA 1ND4A 3ZUTA 3MBLA 1HCLA 2XNOA 4IACA 4IAAA 4O0XA 5J8IA 3QWJA 2WTCA 3PUPA 4E5WA 2XKFA 1WMKA 2WHBA 5DBXA 3JVSA 2PSQA 1VJYA 4M7IA 3PPJA 1YXXA 5IMXA 3BLHA 3VS7A 5EG3A 3OD6X 2DUVA 4IVDA 3HV3A 3TWJA 4YHJA 5C1QB 2FYSA 4QQJA 5JEBA 2G2IA 3U55A 3C0HA 5DFPA 2VTQA 2C6MA 2YIWA 3A7GA 3L9LA 4AUAA 4BDHA 2B55A 4EC8A 4RJ5A 3BRBA 3QLFA 4IW0A 2B9FA 5L4QA 1H1SA 1PXOA 4UEUA 2C6IA 3D5WA 4D28A 2VO3A 3AC4A 2BFXA 4O7TA 3HZTA 5GIPE 4TNDA 5IISA 5M4IA 4FYNA 1UU9A 2JC6A 4YBJA 1M7NA 4ARKA 5DRBA 2QO9A 3MPMA 3IOPA 4RPVA 5FBOA 3CQEA 2IZRA 4UMQA 2YM8A 3CR0A 3AXWA 2QI8A 4GG5A 2QOCA 3ULIA 2CGWA 2PMOX 4IX6A 3ZOSA 2YDKA 1W8CA 3SAYA 3G2FA 1DAYA 3PJ1A 2XUUA 3LXLA 2GNIA 1JSTA 1I09A 5AV0A 3PVGA 4UWYA 4D58A 4PV0A 3KFAA 4I6FA 2Z7SA 2EB2A 3H9OA 3BGPA 2R3FA 3LPBA 2XNNA 4K2RA 4M13A 2YIQA 4BCOA 4RFZA 5L8KA 3UO6A 4O7YA 3BX5A 2RIOA 4D2SA 3BLRA 2JKOA 1M17A 4AT5A 1UU7A 3OTUA 4RX7A 3BYOA 3FSFA 5JRSA 1W98A 4B6LA 4QO9A 3HAVA 5M09A 5TF9A 5CVGA 2Q0BA 1ZZLA 3Q6WA 2OBJA 4PDOA 2HENA 3PG3A 1Q8WA 3TUBA 4X2KA 1ZXEA 3G90X 2C69A 1DI8A 1YXSA 2WO6A 3A60A 3EQDA 4X3JA 4EH9A 4LV8A 2Y8OA 4O6LA 4UBAA 3OY3A 4BGHA 2Y9QA 3R1NA 3ENMA 4KAOA 3TIYA 5D7AA 4FTKA 3B8QA 2PMNX 3ZLWA 4OGRA 3W33A 1A9UA 2NRUA 4NTTA 5KCVA 5AR2A 4KIOA 3DJ6A 3D14A 5K5NA 3FLSA 4EK6A 4FTCA 3QD4A 2BKKA 4O0VA 4M3QA 1WBWA 2IW9A 4C2VA 4EOMA 4AT3A 3RHXA 3EQGA 2VO0A 4IWQA 1M2RA 1IAHA 3Q32A 2HY0A 4Q5EA 3I6UA 2UW8A 3Q5ZA 3RPVA 5AV3A 3NUYA 3ORPA 2OH0E 1ZMVA 5EHYA 4TYJA 2XIZA 4EBWA 2HCKA 4FKSA 3CP9A 2CHLA 4YZNA 4L3JA 4WO5A 5FLFA 5TR6A 3AD4A 3MB6A 2VU3A 3AQVA 4XNEA 3KMUA 4BF2A 4E6AA 2B9HA 4FK6A 3NCZA 2W5BA 2HWOA 2VGPA 4FV9A 4FOBA 2IG7A 2W5HA 2RL5A 2QHNA 4ZY4A 2PUNA 3C5IA 4D4YA 2OF2A 5HESA 3HV7A 1YI3A 4BDBA 5CVHA 5AUTA 4CQGA 3GC9A 4QP8A 5M56A 2YABA 2GS6A 4ZP5A 3BE2A 4O7RA 1H26A 2XM8A 4CFFA 3D2KA 3L9MA 4IVAA 2ERKA 4NW6A 3O2MA 1MQ4A 2C4GA 4FR4A 1PXIA 4BDEA 1XBCA 4RIXB 4FV0A 4O91A 3C4ZA 5LQFA 4CT2A 4OAUC 5ANDA 4E4MA 3ELJA 4X0MA 3UQGA 3JR1A 3DXPA 2XKEA 4EK4A 4KIKA 4CNHA 5LVPA 4RIYA 5HU9A 5BQ0A 3UE4A 4Q9ZA 4E93A 5FXQA 5J9LA 1W82A 4FIFA 4IB0A 4IWPA 4RZVA 2YERA 3GU4A 2G01A 4JXFA 2R3QA 2R3LA 3MDYA 4YTFA 5AJQA 5ANJA 5L2IA 4EQMA 2DWBA 4GUEA 3GC7A 4C57A 4L3PA 3NMUF 4M69A 5AUZA 5FDPA 2QOLA 4UALA 4FV2A 1IAJA 2C6LA 4APPA 3RJCA 2G1TA 3MVLA 4A9TA 4EL9A 3KRLA 4MKCA 3LQ3A 4KB8A 3IDCA 4A9SA 1P4FA 2RFEA 1Y6BA 4I24A 2XBJA 4TN6A 4HZSA 4S31A 1IASA 2C1AA 1SNXA 2QLUA 2YFXA 2C5VA 2EUFB 3FJQE 4KBKA 5CT7A 2V22A 4AQCA 1WCCA 3GFEA 4NU1A 4L8MA 4O86A 4CCBA 4BR3A 2YAKA 3CQWA 4TZRA 4F0GA 4KUJA 3EQRA 4EOSA 2RSVA 3PG1A 4MWIA 4E5BA 4AA0A 4JBOA 4RWKA 4JQ7A 3MESA 2JAVA 5L2QA 3ZYAA 3IKAA 4WBOA 4DGLC 2RF9A 2BHEA 3CCNA 1FGIA 3BHYA 2ZYBA 2YM6A 3ZU7A 5DT3A 2WQBA 1VYWA 3EZVA 3OTVA 3QQKA 5M57A 3DBCA 2O63A 4YPSA 2C3KA 2WD1A 3VS3A 5ITAA 2VTNA 5AV4A 4V04A 3ANQA 5HO6A 2YA9A 3RPSA 4BIBA 4C38A 3Q4TA 4V01A 4ZTQA 4O0SA 5HLNA 4Y72A 4HYUA 3ET7A 2OO8X 4XG9A 5KMKA 3IW4A 3UPXA 5KZIA 5AP6A 2W17A 4QYEA 3E63A 4C0TA 4CFXA 3DS6A 3C1XA 3MFRA 4BDIA 5C4LA 4LV5A 4IDTA 5AUUA 4OTWA 4QMSA 2WOUA 1MRYA 4QNAA 3F5GA 4O7ZA 4EZ5A 5KBRA 2EXMA 5DYJA 5IEVA 2X7GA 4MAOA 3QZHA 4B8MA 3MJ1A 2BTSA 5LJJA 3S0OA 2ZV8A 3NAXA 4MQ1A 3DK7A 1GNGA 4CMUA 2B9IA 2QVSE 3LCTA 4F7JA 3LXNA 5BX0A 5C8KA 1UKHA 3HA6A 4F64A 2ZV9A 4Z16A 4QMLA 3Q9WA 3FMLA 4D4RA 4ASDA 2B4SB 3KRRA 2RFDA 1H07A 4WBBB 4X3FA 3IOKA 3MFUA 3OWJA 4KSPA 4FG9A 1P5EA 3A61A 3FBVA 3PZEA 1DS5A 1PXPA 5GHVA 3IONA 3GU5A 4IQ6A 3E62A 3LFQA 4FTQA 4AT4A 4DFLA 1NVRA 2QOOA 3VO3A 2H6DA 3KC3A 2BIKB 1CM8A 4IMYA 5HLWA 1J1CA 2B52A 5FQDC 3V6SA 1MRUA 3VVHA 3VHEA 5CEKA 1VR2A 4FF8A 3LHJA 5EH0A 3QX4A 2ZB0A 3RNIA 4PNKA 5A4CA 4U40A 3ZHPC 4DC2A 4A4OA 3C4FA 4KKGA 2YISA 5CU4A 3UZPA 4F6UA 3P1AA 1PXJA 3TNWA 5K9IA 3W2OA 3W32A 1B6CB 3EZRA 4HYHA 4BIEA 1V0PA 1PF8A 2BZJA 1OB3A 2CCHA 2BILB 3OOGA 1MRVA 3QTIA 3SQQA 4IE9A 3NVMB 5A9UA 4AGUA 4AP7A 4BIDA 4IAFA 1YWNA 5FUTA 5F1ZA 5AMNA 3RZFA 3UNZA 3NW7A 3O96A 5HICA 3OP5A 3UYSA 4IVBA 4ENYA 3PYYA 4F0FA 4IX4A 3HUCA 3CSVA 4YZMA 2XF0A 5ETCA 5BMMA 4XHKB 3H0ZA 4WSYA 5EHOA 4GFOA 3SOAA 4FTAA 4O1OA 3VULA 1W84A 2XK8A 1LUFA 3C4CA 3COMA 4OTGA 5CU2A 3QAME 3EQHA 1QPCA 4C3FA 5CAQA 4YJUA 5E8WA 4E6DA 2FA2A 3IO7A 3IG7A 1ZOGA 3MH3A 4WKQA 2J0MB 1V0OA 3DKOA 2UZUE 5GNKA 4NH1A 2H34A 5EM8A 5DT0A 4BGGA 3OWKA 4EKLA 1PXNA 2F2CB 2XK3A 5HORA 5A4QA 3KA0A 2C5YA 4IAYA 5ICPA 3Q3BA 3E5AA 4IH8A 4CRSA 2QU5A 3EB0A 2WMTA 2Y6MA 4FSYA 4FMQA 4NM5A 5IA1A 2I40A 1W0XC 4L43A 3R7IA 3VRYA 4LRKA 4RWJA 1I44A 4I92A 4XLVA 2C47A 3TIZA 4D9UA 2OFUA 3DAJA 3F2AA 3AG9A 4GT5A 3EFJA 3R02A 2OZAB 4QP6A 5L8JA 2IVUA 2JEDA 5CEQA 4DFXE 4X2FA 2OGVA 3PY3A 4GH2A 3OW4A 3V6RA 4XJ0A 4FIJA 4CMTA 2W1IA 5DR9A 3AMYA 3PIYA 4B9DA 4OAVB 3I5NA 4A7CA 2BRMA 4FTMA 2PU8A 3NYOA 4FSNA 3FQHA 3FWQA 3G0FA 4FODA 4K9YA 3PXZA 2IO6A 5CQUA 4UWCA 5CY3A 3QCSA 4WG4A 4KIPA 3LLAA 2YM3A 2QKWB 4C33A 3KXNA 2XCKA 4UYNA 3OEFX 1GJOA 4L7SA 4KINA 4O7VA 4XG2A 4KA3A 3RM7A 4RLLA 4GYGA 2X4FA 2ZVAA 5DWRA 4H3BA 4XP2A 4RX9A 4FIHA 4XP3A 4CTCA 5AA8A 4WRGA 3SLSA 1PHKA 4GIIA 3FKNA 2VWXA 5TT7A 3ATSA 2R3NA 4L01A 4OBPA 3R30A 3OXTA 3UO5A 3F3TA 3H9RA 5CNOA 4WHZA 2PVMA 5CX9A 4B0GA 2W0JA 4QQCA 5K0KA 5C4KA 3F61A 3MH2A 2EU9A 2CKQA 1OL6A 4IC7A 2A27A 4L45A 3QTXA 2IZUA 3VRZA 3G9NA 5BVNA 3CBLA 3KXXA 1IA9A 1LEZA 2UZTA 3PWDA 2GQRA 3UP7A 4LMUA 3AMAA 1UWJA 2VN9A 4YTCA 2CJMA 2WMXA 3GC0A 3IDPA 2FGIA 1O9UA 4WNKA 3FQSA 4DH8A 3BKBA 3T9TA 4MCVA 5I5ZA 5IZFA 4BCIA 1WVYA 2C3JA 2HIWA 3DTWA 1BL6A 2J90A 3Q6UA 4EH8A 4V0GA 4Z55A 4GYIA 2BDJA 4EQCA 4FIIA 3N4UA 3C0GA 4FSUA 4W4VA 4LOQA 4XG6A 3R0TA 3ULZA 4D5KA 1JWHA 2C0OA 2JGZA 1R3CA 5JGDA 3OOMA 2WQMA 3BV3A 4GCJA 3FY2A 3DOGA 3KRWA 1M2QA 1G8SA 2XZSA 4O21A 3GB2A 5HKMA 4YR8A 2BRBA 2C0IA 1ZLTA 5CTPA 4U6RA 1UU8A 4GL9A 2XYUA 2J0LA 1BMKA 1M14A 4WUAA 2GS2A 4ITIA 4C4JA 5GZ8A 2GQGA 4H1MA 3KU2A 3DB8A 1H25A 2J2IB 3GOKA 4GK3A 4KBAA 3PJ8A 2J51A 3C5UA 3CIKA 3Q9ZA 4YJOA 3V8WA 2R3PA 3RALA 3QKMA 5IA2A 3VS5A 3DKFA 4FT0A 4MBLA 2VWIA 2VNWA 3NUAA 5L6WL 2WXVA 4F6WA 2FSMX 3NAYA 4G34A 4I5PA 3ZEWA 1Y57A 5IA4A 4HNIA 4ANLA 2UZWE 5L6PA 4YURA 3F66A 2XJ1A 3HV5A 4EHVA 4ZXTA 3G6GA 2LGCA 4QP2A 4YZ9A 4APCA 2WFYA 4JBVA 4ZTHA 4AW2A 2R3OA 3FZSA 4IDVA 4GIHA 4J71A 5IQFA 2QR8A 3RNYA 2ZM1A 4KIKB 4TWNA 4XBUA 3DAEA 2RFNA 4I5MA 5DH3A 4CTBA 5JH6A 1MP8A 3IGGA 1PXKA 2Z8CA 4CV9A 2QG7A 3P78A 2XNPA 4FNXA 5HVKA 3EN9A 5DVRA 4M69B 1KUTA 2YJSA 3I7CA 3ZLXA 4FZ6A 4FEVA 5EYDA 3VF9A 3R01A 2ZV7A 4U45A 2W4KA 1VYZA 5L2TA 4X2JA 3SW7A 4Y85A 2ONLA 3FLWA 3QKKA 2CMWA 2VTHA 4GG7A 4KRDA 1OBGA 3KN6A 4I6QA 4MXZA 3M1SA 3EKKA 5EW3A 4A4LA 4IB5A 3BU3A 4CCUA 4ENXA 2J5FA 3ORZA 1YDSE 5EI6A 3VBTA 3ZUUA 5M51A 2VWVA 4M97A 1JKKA 4YTHA 5H8GA 3PA3A 4WNMA 5FD2A 3OHTA 2WMQA 3FQEA 4FT3A 4O22A 1KE9A 2JDSA 5JMSA 3W10A 4R77A 3NIZA 2REIA 3WBLA 4RIXA 2ITZA 2X2MA 4NKSA 1E1VA 3QGYA 2PE1A 3V8TA 3U9CA 3AC5A 4QD6A 2ITXA 4XYFA 1W83A 1NXKA 3LOKA 4BYJA 4CV8A 3SC1A 1A06A 5M07A 2WIPA 2Z02A 4NIFA 3MVMA 1ZOHA 3KMWA 1FINA 4Q2AA 5HU3A 4BICA 2J5EA 2ZAZA 3F7WA 2OKRA 1UVRA 3MY1A 2V7OA 2SRCA 2BAKA 3KXGA 4Y73A 4Z7GA 4UV0A 3UZTA 2W1FA 2ITTA 4QPSA 5E7RA 4AA5A 2VWZA 3E3PA 3HV4A 3ZO1A 4EK5A 2GPHA 5KE0A 3KY2A 3UIBA 1YDRE 2XNEA 5CF6A 5K0XA 3QUDA 1F3MC 2W1EA 3ODYX 3DKCA 3AC1A 3QRTA 4U79A 3VUKA 3KXMA 1APME 5F94A 4BI1A 1XQZA 1IG1A 3PSCA 2UZVA 3MH0A 2BAQA 5CZIA 4MF1A 5FM2A 4DFNA 1OL7A 4FZ7A 1OIQA 4EWQA 4OBOA 4USFA 1JOWB 1OL5A 4RT7A 3P9JA 3VNTA 3RWQA 5CF5A 5ANGA 3UVQA 2WOTA 4BCKA 5CAUA 3F82A 1ZMUA 4O82A 3UC4A 2B53A 3ACKA 2VTOA 3D5UA 3HL7A 2HZ0A 1SNUA 4GJ3A 3C51A 4X3FB 5FP6A 3W2SA 4AZSA 4IB3A 1NVQA 3PFQA 1GY3A 2GFCA 4BCGA 4BWPA 4FV1A 3D2IA 5HZNA 4ASZA 1URWA 3FMEA 1QPDA 2BPMA 4MVFA 1FPUA 5AR3A 4OTPA 1T45A 2X81A 3C50A 5CNNA 3VJOA 4RX8A 4EONA 4ORKA 2B0QA 5HCYA 4BBFA 5J79A 1RJBA 5AV2A 3EIDA 4BB4A 4HCUA 2YCQA 3KK8A 2QKRA 4GKIA 2X2LA 2R3IA 3G0EA 4Q5HA 3AD5A 2W7XA 3KEXA 4TYGA 3W8QA 1ZYCA 2GFSA 4NSTA 4XCUA 3QTRA 3A8WA 4EJNA 4BTFA 3BEAA 5AX3A 4R3RA 4NFMA 3S00A 5AP4A 4KABA 3CPBA 3W55A 3O7LD 4O0UA 2VTLA 5EYKA 4G3GA 3CTQA 3VS2A 4RFYA 1K2PA 5D11A 5KO1A 4GS6A 5LWNA 4UX9A 1OPJA 3D0EA 3UQFA 1OKVA 3DJ7A 1OIYA 1U5QA 2W9FB 1ZY5A 5IDPA 3R1SA 4X2GA 4TWOA 4XP0A 4RA5A 3KCFA 5HE2A 2XBAA 4H58A 5EI2A 2PZ5A 3HMOA 4WG5A 5AP5A 4E6QA 4F7SA 5EM5A 2Z7LA 4RA4A 4BZOA 4MF0A 3EFWA 2I0HA 3O51A 2WEIA 4E20A 2Y4PA 2CLQA 5L8LA 4DFUA 1JNKA 2F49A 2WPAA 4CLJA 5CI7A 5ANIA 1UKIA 2UZOA 2X0GA 5HG5A 5TE0A 2BZKB 3QQJA 4GT3A 4KBCA 4FZAB 3TV4A 4BCPA 1FGKA 3A62A 3ITZA 1REKA 4RWLA 4L46A 4ZLYA 1WVWA 2PK9A 4D9TA 2R3JA 4FTUA 2HAKA 4HGEA 3TKHA 3KQ7A 2JFMA 3RM6A 1G3NA 1JSVA 3ZLSA 2WMBA 3MTLA 4FICA 3R7UA 4O38A 2OXDA 3VC4A 4IB1A 3WARA 3E7VA 3TZ9A 4U81A 4ZSJA 4ACHA 5DRDA 3FI4A 2F57A 3QA0A 3R22A 4P5QA 1A48A 3F6XA 4D1XA 5IKWA 4C7TA 5KMOA 3FL5A 3IW6A 1E1XA 4G3EA 1STCE 2IJMA 3IW7A 1H27A 1J3HA 5LOHA 3EL7A 3MIYA 4EUUA 5HTBA 3PRIA 3FE3A 3VS0A 3VUGA 2OWBA 5EK7A 3K5UA 5F4NA 3JXWA 3R7VA 5HO8A 4FT7A 2PVJA 3BEGA 4FV7A 3UIXA 4AFJA 2PVRA 1JPAA 5DG5A 5A46A 3AD6A 1YOJA 4DINA 5HVJA 5DT4A 2BRHA 2C6DA 4IM0A 4OTHA 2JIIA 2O2UA 4OTQA 4U41A 4D55A 5AP3A 1UNLA 4IM3A 4MD7E 5LMKA 3V5QA 4CGAA 2JKQA 3QZFA 2VTJA 4GJ2A 5GIOE 5K5XA 5KUPA 5LCKA 3TNHA 3EQBA 3QFVA 4HZRA 4I5CA 5DIAA 2WIHA 3ZMMA 5CSWA 1FBNA 3QD3A 4AXAA 3LZBA 3UBDA 3FZOA 3R9DA 5M08A 3VF8A 1ZYSA 2QQ7A 5CF4A 4ZZNA 5KKRC 4DFYA 4GKHA 5EM6A 1RDQE 4O27B 4O7SA 1VEBA 2FSTX 3I5ZA 3R9OA 3O8PA 5AAGA 5EDRA 5HOAA 3NEWA 5KNJA 3ORNA 3VUIA 3BHUA 2UZLA 3FZ1A 5IUIA 4BHZA 2KTYA 2GQSA 4JVGA 5E8TA 3OCTA 3E87A 5HG9A 4PDPA 1WBTA 3CGOA 3IDBA 5EHLA 2OZAA 5JFXA 1DI9A 4QMMA 4LRMA 3U8WA 4DG3E 4ZMFA 3QXPA 2W5AA 3LW0A 2WZJA 3I79A 4G5PA 4PP9A 4V0GB 5K3YA 4QYFA 2LAVA 3N4TA 4DH7A 2CGVA 4J53A 4O7NA 5EFQA 3W2CA 1YKRA 3U87A 5HCXA 4C36A 2JFLA 2ZOQA 4NUSA 3ROYA 1GZKA 2BUJA 3DQXA 3NR9A 3RZBA 4U80A 4FYOA 5EQYA 4A9RA 4ANBA 2GMXA 3QD2B 3FMNA 3R8ZA 2BR1A 2ITWA 3SKCA 2YLFA 3KGAA 3LCDA 3ZZEA 1LP4A 3MA3A 4GFMA 5DLSA 4ANNA 1Q3WA 3PP0A 5AADA 2W1HA 3IW5A 5JT2A 2R5TA 3MFSA 1Y8YA 4KWPA 2GSFA 2R9SA 3HMPA 5L6OA 4E7WA 4B7TA 3BPRA 2PZPA 5IUGA 4CKRA 2J0IA 5CU3A 3EN7A 3CLYA 4CVAA 3CE3A 2DQ7X 4NM3A 5I9UA 3O50A 1ZWSA 1JSUA 3TTIA 2O0UA 3WYXA 3HECA 3BYMA 4YNOA 4ZJIA 3KULA 3UQCA 3HMIA 3A4OX 4WNPA 5H3QA 3I81A 4TKSA 3KVWA 1JQHA 2W1ZA 3LJ1A 4QYGA 1ZARA 3CKXA 4D0XA 5LXMA 4FNZA 2XJ2A 1BI7A 4QMXA 4QP7A 4QYYA 3U4WA 4EUTA 4AZTA 3I60A 4FZFB 2YJRA 5HE1A 3BELA 4NKAA 2IZSA 3EOCA 3TI1A 1PMEA 4EZ3A 2UVZA 3WF9A 1YWRA 5E8UA 1YHWA 3UG1A 3S1HA 2XRWA 4NCTA 3R83A 3BYSA 3Q04A 4PDYA 5AP7A 4YSMA 2GNHA 4M8TA 2QODA 3UNKA 4W4WA 3SRVA 1O6KA 2CN8A 2JBOA 4UZDA 2QOFA 2ZMCA 1Y6AA 2X9FA 3LJ2A 3PIXA 3R63A 5AP0A 1KV2A 3TJDA 4J95A 3RGFA 4AAAA 1RE8A 3QYWA 4DTBA 5AR5A 2VTIA 1ZY4A 4FZDB 2CPKE 3D4QA 3H9FA 3LMGA 4JX7A 1W7HA 4R5YA 3A7HA 3SW4A 4ALWA 2WELA 4BN1A 2XK6A 4P4CA 4PL5A 5M4FA 4FV8A 2PPQA 4RMZA 3JUHA 4BCJA 5BUIA 3CTHA 2UVXA 2IN6A 3NVKI 2C3LA 3BYUA 2WKMA 5I0BA 2C6KA 3TM0A 3QTQA 4M15A 4ZY5A 4BI2A 4FGBA 3F88A 2WQOA 4QMNA 5A14A 2EWAA 3S2PA 4AF3A 3OVVA 3E7OA 5C26A 3RK5A 1RQQA 3FL4A 4OW8A 5CU6A 3UIUA 4NIFB 3VQUA 3QTUA 1Q5KA 3VS1A 4J8NA 3U9NA 4EZ7A 2PZYA 5EOLA 4CYIA 3FKLA 4L3LA 3OCGA 3LXKA 4JDKA 4UMPA 3QTWA 4JJRA 4FKTA 1SMHA 4DT9A 1IR3A 2GU8A 4I6BA 3PZHA 2C1BA 3OG7A 4L53A 4DN5A 3TDVA 2JDVA 3DA6A 3VBQA 2AYPA 5CEPA 2YLEA 3GP0A 4K18A 5KX8A 5F9EA 5IQCA 4W4YA 3QRUA 3MY0A 4CSVA 1SM2A 3D5VA 1BKXA 5I3OA 2DYLA 3QCXA 5B2KA 2J0KA 1OI9A 2NPQA 2VTTA 3DFAA 3QTSA 4DEDA 5KHWA 4XV2A 4ZSAA 4TNBA 2A2AA 1CTPE 5J1VA 4N70A 3LKMA 4L67A 3QYZA 4K77A 3P86A 5J7HA 1IEPA 3BIZA 4PUZA 3CKWA 3OT8A 3HLLA 4GK4A 5BMSA 4MBJA 5AIKA 4ZS0A 1OL1A 5AUYA 2AUHA 3QALE 4HYSA 3PPKA 1URCA 2NO3A 2F7ZE 3MVHA 4R1VA 2FB8A 3OZ6A 2O5KA 3PJ3A 4OTFA 5C01A 1CDKA 3BWFA 2WAJA 2CCIA 4LL0A 2ZJWA 3ALNA 2QD9A 4IXPA 4KRCA 1AGWA 5M55A 1JBPE 1GIJA 3MJ2A 4RIWA 3B2TA 3Q53A 4J7BA 3NIEA 4I1ZA 4N6YA 1OZ1A 5E8YA 4FNWA 3PTGA 5G1XA 4CZUA 5JQ8A 2ZM3A 3ZUVA 3GC8A 3ORLA 3QC9A 4FT5A 3ID6C 4FUXA 2PUIA 3HYHA 4DYMA 4X6QC 4F1MA 3GUBA 3NYVA 1L8TA 4G3FA 2UVYA 3E8CA 5C8MA 2ETMA 4FSTA 4PMMA 4XG3A 4YHFA 4QTCA 3R7GA 2ONLC 1FOTA 2P4IA 3A99A 4Y5QA 4E5AX 4LQMA 1NVSA 3ZFMA 4CT1A 4RQKA 3F3ZA 3HGKA 4YP8A 5TKDA 3O0GA 2IW6A 2OIBA 4OBQA 5T68A 1KE8A 1PXMA 3EYGA 4I20A 3PP1A 2BMCA 5JFVA 4HNFA 2Y4IB 3RMFA 2R3KA 4JR3A 3K2LA 1OITA 3SXRA 2XK7A 2WTDA 4OLIA 2IW8A 2RG5A 4A9YA 5IH6A 2ZDUA 2ITUA 2QO7A 2WTIA 4DG0E 3ZEPA 1GZ8A 1F0QA 3D7TA 3A8XA 3ZC5A 1OECA 2XB7A 2YM4A 3HX4A 4AWIA 1O6YA 1Y91A 1TVOA 1OKWA 3OC1A 4FNYA 3ZO3A 4M67A 2WMUA 3MPTA 1NT2A 3HEGA 5CSHA 4QTBA 2J9MA 4ZSLA 2YCSA 5HNBA 3RPYA 3WI6A 2YEXA 4ALUA 2C0TA 3A7JA 4G1WA 3TZMA 3FI8A 2HZIA 3E3BX 2E2BA 2EVAA 2UW4A 5EQEA 3RAKA 3GFWA 3AC3A 4YO4A 3PY0A 4JNWA 4PL3A 4F0IA 2ZMDA 3CXWA 3E8EA 2UZNA 3R7YA 4GFGA 4AZEA 4QQTA 4ZZOA 3HAMA 4AG8A 4AOJA 5HBJA 3SOCA 4X6RA 5EKOA 3VUDA 4RSSA 5F20A 1ZYJA 5LVOA 4EH3A 4NT4A 1PRYA 4FEQA 5DN3A 2X8DA 3BQRA 3LFSA 3FXWA 5FTOA 4DLJA 3OBGA 1B38A 4TYEA 2UZEA 4HPUE 3BI6A 1JKLA 4JQEA 2PHKA 4R8QA 2HW6A 3EQCA 4TPTA 4CRLA
chains in the Genus database with same CATH superfamily
3UZRA 1R39A 5JFWA 4ANQA 1XMMA 5J1WA 2W9ZB 2UW0A 4PF4A 2BRNA 4DEGA 3EMGA 4ACCA 3UODA 2WB8A 4H3QA 4DEBA 2W4JA 3HRBA 4I94A 2R0IA 5CXHA 2HWPA 3GI3A 1G8AA 4YJTA 4E4XA 2OK1A 2ETRA 4RJ8A 4KKHA 3GCPA 3CGFA 3HV6A 4ACGA 1YI6A 4FV3A 3QL8A 4HYIA 4I4FA 3W2QA 4LV7A 1BX6A 5F95A 4GT4A 2W1CA 3RK9A 4EH5A 4ZTNA 1G8JA 3VUTA 4D4SA 1P14A 2QOIA 4IZAA 3Q96A 5E8ZA 3U6HA 2YZLA 3F2NA 3RAIA 4TW9A 5CWZA 3FV8A 4EC9A 2R4BA 5FBNC 5DGZA 3PDTA 5M4UA 4H3PA 4M68A 4OT5A 3LQ8A 4ZLZA 1J7IA 4S33A 5AFVA 2YDJA 5A3XA 4CEGA 2JIVA 4NYEA 4YC3A 5AAEA 2P0CA 4YZBA 4ZTLA 1CKPA 2ZB1A 3FLZA 3TT0A 1J91A 3VONA 4LRJA 4FG8A 1XH4A 2UV2A 3NNXA 5GJFA 4AACA 1XH5A 4JAJA 1ZAOA 4IAZA 1NY3A 2ITNA 2P2HA 1M2PA 3EHAA 5HCZA 5BNJA 4WT6A 3VIDA 4N4SA 4EH7A 3UVPA 1YQJA 4XG4A 5FGKA 3C7QA 4PPAA 3II5A 3DZOA 3KRJA 5BV3A 1UV5A 4ZJVA 4XOYA 4N6ZA 3QLGA 5D41A 4E3CA 5IH4A 1B39A 5B7VA 4YLKA 4BBEA 3THBA 3V01A 4G2FA 2W1GA 2QLQA 4MBIA 3ZO2A 3Q2MA 2GNJA 2X8IA 4G16A 2OJ9A 3OT3A 4HCTA 4BDCA 3O8TA 4BVUA 4K6ZA 4G9RA 3DGKA 4O4EA 5G6VA 4EBVA 4TWCA 1GZOA 3ZLYA 2H9VA 4JG6A 2OIDA 3ENHA 4C35A 3W16A 4ZSEA 4CLIA 2A0CX 5FM3A 4J1RA 4W9WA 5H2UA 2BALA 3OXZA 3UNJA 4DEHA 3C0IA 1U5RA 5TO8A 4EHGA 1Q8ZA 3CQUA 3DY7A 4GV1A 3TACA 5CANA 5CU0A 3BYVA 2XVDA 1Q4LA 5HIBA 3DDPA 4II5A 4IAIA 3F3UA 3K5VA 4M12A 4O4FA 3WILA 5KBQA 1W2DA 2R3HA 4EH6A 4DH5A 3KULB 4ONAA 1OUYA 5ETFA 1REJA 4TXCA 5CAPA 4USDA 1YWVA 4XRJA 5EDPA 3ODZX 2W96B 3A7IA 3MPAA 4HGSA 4HVSA 3VW6A 3P7AA 3UVRA 3ZFXA 5BVOA 1YHSA 5DHJA 4JG7A 3EKNA 3PLSA 4EYMA 4DLIA 4R1YA 5M44A 1H4LA 2ACXA 1ZYLA 4MX9A 5LVLA 3VJNA 4DTKA 3SVVA 4D0WA 5CAVA 2QR7A 3C13A 4QP1A 4ANOA 5M53A 4AGWA 2I0YA 3P08A 1OPKA 5L2WA 1G8KA 3BE9A 4QPAA 2OIQA 2UUEA 3R7OA 5LMAA 3UJGA 3SRVB 4FKLA 5HIEA 1BLXA 5IQGA 5AM7A 4U43A 3ZSIA 5C8NA 4QEBA 5GINE 5IEXA 4YHTA 2O64A 2PMLX 4FTTA 4IEBA 5CLPA 3NUUA 3LFNA 4RGJA 2ZV2A 3F3VA 1H8FA 3EWHA 3T9IA 3NPCA 5H8BA 5AWMA 2R3MA 3HMMA 4ERKA 4FTJA 2WGJA 4OTRA 2QO2A 3DDQA 4JR7A 3MY5A 5EYCA 2R3RA 3I1AA 3LJ0A 4I0RA 3ZDUA 2IVVA 3GQIA 5HLPA 3O71A 3WIGA 1WAKA 2XP2A 4B99A 2VNYA 5KMMA 4E4LA 4UZHA 4UYAA 3P5KA 1LR4A 4L68A 1OUKA 2Y7JA 2HXLA 1UU3A 2G2FA 3ZRKA 5JRQA 4AZVA 4H1JA 4EOQA 3BHHA 5AUWA 4FKGA 4NW5A 4A4XA 1R0PA 4QT1A 4FKWA 5ETAA 5I9WA 3LM0A 2G9XA 4LL5A 3KVXA 4EORA 2WTKB 3PXFA 3DBQA 3AKJA 2WNTA 5J7BA 2UW3A 3ZSHA 2WMWA 1R0EA 3CPCA 4QMQA 3MTFA 2PVKA 3WOWA 3CD8A 4KNBA 3UP2A 3ATTA 3OWLA 4BKYA 3NSZA 4ID7A 1OM1A 3BQCA 3EYHA 2XK9A 3BZ3A 4TYIA 4U8ZA 4JS8A 5IF1A 3R1QA 3FC2A 3CC6A 3TL8A 3PA5A 3Q4ZA 1KV1A 2NP8A 5AX9A 2Y0AA 3QBNA 4FOCA 4J98A 4ZLOA 2F7EE 4G6NA 4W9XA 2GNFA 2BROA 3R2BA 4YSJA 1PJKA 2P3GX 2VWBA 3CTJA 4FSMA 2WTVA 4GU9A 4L7FA 3SA0A 4PL4A 4NWMA 4HOKA 2OXXA 3N9XA 4O96A 3DXQA 3UOHA 1ZZ2A 4I5HA 3KRXA 5AUVA 5A4EA 3FI2A 1SVEA 3FZTA 3ORKA 3TNIA 4DE4A 1IRKA 4IWDA 2VRXA 3R73A 2OG8A 3FZRA 4IX5A 4NJ3A 4RIWB 4QP3A 2JDTA 3DQWA 3P7CA 1OL2A 2C3IB 2XA4A 4AE6A 4O4DA 3ZRMA 4GU6A 4F9CA 5AV1A 2V62A 4F9AA 2J4ZA 5IQDA 3LVPA 1M52A 4QMOA 4RWIA 5CSXA 2Z7RA 4AFEA 1ZYDA 5EI8A 3UO4A 5JGAA 3FMKA 5CYIA 4XMOA 4WIHA 3BGZA 4HVDA 2PVHA 4JDIA 3R9NA 3UPZA 4ZEGA 4YUQA 4MWHA 2I7QA 1YXUA 3L8XA 3W1FA 4FKUA 2XNBA 3VHKA 3QHWA 4S32A 3M2WA 1J7LA 4BJJA 3V04A 3OXIA 2JDRA 2HELA 1P2AA 5D10A 4FT9A 5AAFA 2VV9A 4CFMA 5DA3A 4QRCA 4EOIA 1EH4A 2E9PA 3R8PA 4BI0A 1H08A 2VX1A 5FTQA 2XS0A 4FIGA 3PSDA 4C3PA 4EKKA 1NW1A 3FLNC 4RVTA 4EOLA 4DCEA 4LOPA 3MVJA 4BCMA 1H01A 1AD5A 3PY1A 3LMIA 3D7TB 3PJCA 2QOQA 4XX9A 3V5PA 5DNRA 1Q8UA 5E4HA 1SVGA 4RC2A 2VAGA 4ZSGA 3AKKA 2ZM4A 3WF8A 3DXNA 1XKKA 4MH7A 3HP5A 1JLUE 3UDBA 3ZC6A 3ZH8A 4BKZA 4E6CA 1ZRZA 1XBBA 2IVSA 5JZJA 3ZM9A 3FMHA 4O0YA 2BKZA 4IIRA 3PA4A 4EEVA 3G33A 3HRFA 3QHRA 3PXQA 4GVAA 5AA9A 4FI1A 3OMVA 3AGLA 5HE3A 3RKBA 4ACMA 1OPLA 4DITA 4M14A 1AQ1A 3UMXA 3RCDA 2J0JA 2YZAA 1PYXA 3F9NA 4L6QA 4B4LA 3R8MA 5I9ZA 3V5LA 3R7EA 3ZO4A 4C59A 3GQLA 5AM6A 2C6OA 2OJJA 1MQBA 3EQPA 4R5SA 1GIHA 2W4OA 4FSRA 4XV1A 2EXEA 3TNPC 5D9HA 4D4VA 2YIRA 5DEWA 2WEVA 3QRKA 4EOKA 4G3DA 5JN2A 4I6HA 1Z57A 4YNEA 4AW0A 4BZDA 4C4IA 4EJ7A 3GNIB 2NRYA 3G5DA 4ZIMA 3DNDA 2HZ4A 5HG8A 3U4UA 3W0PA 5IQHA 5CI6A 4X2NA 5EM7A 4F99A 3A7FA 4IADA 5IA5A 1S9JA 3V5JA 3I7BA 3BU6A 5E91A 4AW5A 4ITJA 2WQNA 4TT7A 1FQ1B 2CLXA 3L8SA 4UMRA 4NL0A 1CKIA 4G5JA 4JDHA 1XH9A 4FV6A 4HW7A 4H39A 3UOJA 3G9LX 1FMKA 4PWNA 3OEZA 4NM7A 4FKPA 3QQHA 5IA3A 2EXCX 3AC8A 2A1AB 2X4ZA 2V55A 2YCFA 1U4DA 4YGAA 3KF4A 4CKJA 1P4OA 3PSBA 4D2WA 2BIYA 4EQUA 5A6OA 1XHAA 3ALOA 3W2RA 4EOJA 2BHHA 4EK8A 3KL8A 4R7IA 3L1SA 3ACJA 2F7XE 4FKOA 1R1WA 3OFMA 2KULA 3ORXA 3N51A 5E8SA 3HVCA 4GSBA 4WOVA 3WF7A 5J5SA 4XUFA 4I4EA 4HVHA 1H1PA 3NNVA 4W8DA 3O5AA 2XCHA 2V7AA 2QOKA 4FL2A 4C37A 1J7UA 2UW7A 4DBNA 2GTMA 4BWXA 4LGGA 5E9EA 3RI1A 4M0YA 5HG7A 2XIKA 4MXCA 3TDWA 5GZAA 2PUPA 4CFVA 4NK9A 4CYJA 5J5TA 5HD4A 3W0NA 3LFAA 5M06A 3ORTA 5BPYA 3EH9A 3DCVA 4WA9A 3UIMA 3RPRA 3FYKX 4I93A 2BFYA 3I4BA 4CKIA 1PKGA 4WSQA 4FIEA 3DK6A 4RG0A 4UMTA 4FSWA 3CY2A 3O23A 3Q9YA 3V5WA 1Q61A 3HNGA 4MQ2A 4QYHA 2GHMA 2X39A 2VD5A 4RIOA 4X3FC 1H1RA 1J1BA 3GU7A 1HOWA 4AN9A 1KOBA 4BBMA 3FLQA 2BZHB 2PVFA 5C03A 5FXRA 4R3CA 4KS8A 2XEZA 3DLSA 3OUNB 4KKEA 1JKSA 4N0SA 5HBHA 2XNMA 3FUPA 5CEOA 5HX8A 4UY9A 2CNVA 2QC6A 2HOGA 1WBSA 2X7OA 3L8VA 3SD0A 5CEIA 2XKDA 2R3GA 5FEDA 2UW6A 2OJIA 3MH1A 1OBDA 4MXYA 2JLDA 1JAMA 2YWVA 4F63A 4C58A 1GZNA 1G5SA 3PJ2A 4HGTA 4QMTA 4C2WA 3F5PA 5IU2A 3SG8A 3L8PA 4A07A 2XIRA 2F4JA 1CSNA 2BVAA 5DR6A 1V1KA 4FVRA 4KS7A 3TN8A 4I0TA 4DHJA 4R3PA 5J95A 4S30A 5CVFA 3P4KA 4ZK5A 2O3PA 2HYYA 3CS9A 4PP7A 4F9YA 3FYJX 4J52A 4QTEA 2CGXA 3ZBFA 3E8DA 4LI5A 3PIZA 4FTLA 2WQEA 4O7LA 4I0SA 4JRVA 4EOOA 5JFSA 5CASA 4EOPA 2CNQA 4HGLA 3NNUA 2Q83A 3LMHA 1ZOEA 2CN5A 3R00A 2YWPA 3KXZA 3ZTXA 4DHZA 3EN4A 1Q3DA 4EHZA 3E88A 4XG8A 3UOLA 5B2MA 4MNFA 1H28A 5E1SA 4CQEA 3U6IA 5BVKA 2QURA 3POZA 3QXOA 4BL1A 5I9XA 1YVJA 2PULA 4LGDA 5ANEA 4E73A 3WE4A 4FTIA 4L00A 5EOBA 5EYMA 4O4CA 3TZ8A 2P2IA 2X8EA 3RCJA 2X0OA 3W0OA 1GIIA 4QQ5A 3D5XA 4U7ZA 5JZNA 1Q24A 2VO6A 3Q5IA 4FKVA 3QX2A 3QU0A 4TL0A 1QL6A 4YZDA 3FMDA 4AS0A 5BUJA 4K33A 2AQXA 4ASXA 3DBFA 1U54B 3R2YA 5EW9A 4FEXA 2J50A 3TCPA 4JI9A 4LG4A 1X8BA 5E1EA 5T3QA 2PMIA 3TEIA 4M66A 3R8VA 4U42A 4YJQA 1PKDA 1BL7A 3IQ7A 3V51A 4JT3A 2RG6A 2E9OA 4QMYA 5EQPA 5IMEA 4BDFA 4F4PA 1O6LA 1TQPA 5BYYA 3FLYA 3R9HA 2IWIA 3PE2A 1JKTA 2C6TA 3HP2A 3Q60A 4FV4A 4RRVA 3TNQB 4JIAA 4IM2A 4KSQA 3WZJA 4FVQA 4BTKA 4C4EA 1Z9XA 2F9GA 2YIYA 4FC0A 4O84A 4BHNA 4OR5A 3OY1A 3RAWA 1SVHA 3LFFA 4GEOA 4QOXA 4BTMA 5I3RA 3JYAA 4J97A 4XBRA 5K4IA 3GGFA 3VN9A 4PNIA 5JK3A 4LYNA 3R8LA 3QF9A 1TQMA 3TUDA 3NWWA 3F3WA 4PY1A 2VTSA 2IZTA 4WD5A 3HKOA 3CJGA 5HE0A 2ITYA 4LFIA 5HGIA 3RWPA 3DKGA 2JBPA 4GMYA 3NUNA 5AP2A 5CS6A 2OI4X 3RK7A 4BDGA 3R8UA 4AE9A 3BHTA 2FSOX 2GHGA 4BCNA 4QP9A 5J9YA 4QMZA 3POOA 3ZXTA 4FE2A 4USEA 2PL0A 2WU6A 2BTRA 5BYZA 3VBWA 1H00A 3GU8A 4YJSA 4ZJJA 3QTZA 4J8MA 3SX9A 4F9WA 3ANRA 4BY9E 3TKUA 4PTCA 5KMJA 2XM9A 5LVMA 1TKIA 1WBOA 3C4EA 3GENA 3G6HA 3QUPA 5AR4A 5T6KA 2WMVA 1H1WA 4RVKA 1Z5MA 5E8XA 2C5OA 3A4PA 3Q4CA 4NFNA 5EDQA 4BKJA 4CD0A 4PMPA 2GS7A 2HZNA 3K54A 4CZTA 4G6OA 4BJJB 4K11A 4MNEA 2C5NA 4RC3A 4CG8A 4CFWA 2RGPA 4XOZA 4BDKA 2C30A 3D9VA 2UW5A 3IS5A 1WBPA 4DEEA 1BYGA 2FO0A 3W18A 1XH7A 3GOPA 4ASEA 4D1SA 5IH5A 4DGNA 1V0BA 4EI4A 4ZAUA 4RJ7A 5JKGA 3NCGA 3TV6A 3FMJA 4ZZMA 4QMWA 3QQFA 2Z2WA 3F7ZA 3IECA 3D94A 2YHVA 5FG8A 5HVYA 3WYYA 2G2HA 2I6LA 3IW8A 1OIUA 4U0IA 5FTGA 3WZUA 4AX8A 2E9NA 4F7LA 2HK5A 1KSWA 4WRSA 2BDFA 4LMNA 4AU8A 2ITQA 2W99B 3MW1A 1Q62A 2PUUA 4HVGA 3OF0A 3W2PA 2ESMA 5EKNA 4TYHA 4HVIA 2O65A 4BGQA 3QC4A 4WG3A 4F65A 2A19B 2QG5A 5KMLA 3EFLA 4H36A 3UG2A 1CMKE 2JDOA 4XV9A 4FA2A 5HTIA 3COIA 2XH5A 2FSLX 3T3VA 4HCVA 4ANMA 4F6SA 3P23A 1XBAA 3FI3A 4Z7HA 2OH4A 3LXPA 3GCQA 3PLAE 2V0DA 3FAAA 2UZDA 3MV5A 5IA0A 3LCSA 4NM0A 4Q9SA 4RX5A 1U46A 2X2KA 4G9CA 3G15A 3I6WA 2W06A 4ZY6A 3IK3A 4MK0A 4D2VA 4K8AA 4XRLA 2JKMA 4IBMA 2YCRA 3PRFA 4UXQA 2PZRA 3KKVA 4UXLA 2PE2A 3QUEA 4FV5A 4G3CA 4B8LA 3V8SA 4RLKA 3LFBA 4XV3A 2YAAA 5L2SA 1F5QA 3BV2A 2E9VA 4Z9LA 3W0RA 1YHVA 3BU5A 3SG9A 4ZS4A 5HD7A 2OZOA 3EN6A 3MSSA 2F2UA 3I0QA 3ZRLA 4AZWA 1VLRA 2ITOA 4K0YA 4IZYA 2B1PA 3FSKA 4LGHA 3DNEA 1FVRA 5I9YA 3NNWA 4G31A 1PMUA 1TZDA 1QMZA 3F69A 3RAHA 1KE5A 2ITPA 3L9NA 4IZ5A 3LFEA 4FRFA 5DI1A 2XEYA 2Z60A 4E4NA 3R1YA 5HNIX 4OUCA 3DK3A 4PMTA 4BFMA 1PW2A 5HX6A 2XJ0A 4L52A 1H24A 4FTRA 5AUXA 4DG2E 3LFDA 3PFYA 4A9UA 5IQAA 3FC1X 1OKYA 3D83A 4W4XA 4EWHA 4C4HA 2RFSA 1IA8A 2VX3A 3C9WA 3MIAA 3QRJA 4GRBA 3WF6A 4E26A 2R7IA 5CEMA 1MUOA 3ZFYA 2B9JA 1YI4A 3MB7A 3OWPA 3PVBA 4IFGA 4PTEA 5HHWA 1UA2A 1YXTA 4FVPA 2VGOA 2X0PA 3F5XA 4DBXA 3O17A 3VWAA 3ML1A 1WBVA 2FVDA 5HQ0A 1W2FA 3BBWA 4I21A 5C9CA 5BYLA 4CFNA 5TOZA 2I1MA 4BCFA 2BAJA 3RHKA 2B7AA 4MXAA 2NNWB 1M7QA 4TRLA 4RFMA 3VBVA 3Q4UA 5J9ZA 1Y8GA 4AOIA 4R7BA 3EQFA 3FMMA 3ZBXA 1KE6A 4L42A 4OTDA 4RQVA 4UN0C 4YLLA 3NS9A 5ACBC 3WZEA 2VWWA 3Q52A 5HEZA 3DAKA 4D2PA 4MUQA 2ZDTA 3EJ1A 4IJ9A 3LLTA 4P90A 3N4VA 2CKPA 3AMBA 2OLCA 2HXQA 2J6MA 3P79A 4E8AA 5BUEA 3UTOA 3MFTA 3Q9XA 4GK2A 2PZIA 5E90A 4DFZE 4NZWB 4L44A 3CEKA 3R71A 4FKQA 1RW8A 4PPBA 3NYNA 3H4JA 3S4QA 4RJ4A 1Q99A 2I0EA 1ATPE 2BCJA 3PVUA 3R6XA 5B2LA 2XKCA 1PMVA 1UNHA 1UNGA 3E92A 4ZMEA 4ERWA 1R78A 4NEUA 4AW1A 4Y95A 4FK3A 4ZTMA 3SGCA 3E93A 4QPMA 5DR2A 4H05A 4DFBA 3NW6A 1LEWA 4PMSA 1FMOE 3NUPA 5FXSA 3BLQA 5HTCA 1E9HA 3FXZA 2PY3A 4PPCA 5GJGA 3NW5A 2JIUA 4WNOA 5KZ0A 2YM7A 3LFCA 5H9BA 4BCQA 4C3RA 4C4FA 4BWKA 5CAOA 2UW9A 2XK4A 4D5HA 4FGRA 2Z7QA 3MWUA 3D15A 4G6LA 5H8EA 3HA8A 2Y4IC 2VTPA 4MD9E 4BRXA 2HY81 4S34A 3RTPA 3T3UA 4IFCA 3BHVA 3E8NA 1OIRA 3PWYA 5D1JA 2WMRA 2JKKA 3B2WA 3DZQA 4P7EA 3LQ5A 2JITA 5CALA 5CENA 5EW8A 4F1OA 3NZ0A 1XH8A 3UOKA 5A4LA 5CT0A 2CSNA 3P7BA 3EN5A 3FZPA 2R2PA 4AOTA 2OSCA 2YN8A 4FSZA 4X7QA 3V3VA 2CKEA 2QONA 4MD8E 4UB7A 4XLIA 4U5JA 5AR8A 2GNGA 2QU6A 4O81A 5JSMA 1QPEA 3DV3A 5LCJA 1XR1A 3GU6A 4JDJA 3H10A 4YZCA 4EYJA 5IEYA 3SV0A 3OS3A 1SZMA 4F70A 5CSPA 2X7FA 1XJDA 4XH6A 4C4GA 5CSVA 3WF5A 4IWOA 3U54A 4JG8A 4DA5A 4LUEA 3GT8A 4RVLA 2C6EA 3FPQA 1YW2A 5KMNA 2AC3A 4JBQA 1YOLA 5FDXA 3VW8A 3NFFB 3QWKA 4QMVA 1XMLA 3L9PA 4F1TA 3LIJA 4MEDA 3TXOA 2OU7A 3PPZA 4O2ZA 3DB6A 4QP4A 1WVXA 3I0OA 4QTAA 4Y5HA 1NA7A 4X21A 3SXFA 5JGBA 4ZTSA 3HMNA 1YOMA 3KB7A 4JL9A 4DDGA 5AEPA 3GCSA 4OT6A 2VTRA 2YM5A 3BBTB 2Y6OA 2VWUA 3E64A 4YJVA 3VS6A 4AZFA 4R7HA 4Y8DA 2GHLA 3OCSA 1BUHA 3JVRA 3OROA 3PXKA 4PQNA 3A2CA 1OKZA 3AGMA 3DLZA 5LMKC 5AP1A 3GBZA 1S9IA 2VUWA 3C4WA 3UC3A 5C27A 1WZYA 1KWPA 2I0VA 3H3CA 3ZSGA 1ERKA 4C62A 3UDTA 2G15A 2VTMA 4PRJA 2WTJA 5GJDA 3REPA 4I22A 3M42A 5BVFA 3VAPA 5FEQA 2A4LA 2DS1A 2PWLA 4MTAA 3VBXA 1BI8A 2CDZA 4P5ZA 3DFCB 4JX3A 3RVGA 4C02A 5IUHA 4IHPA 4D1ZA 3QQUA 3QQLA 1XWSA 3AT2A 4M0ZA 3H30A 4FBXA 1CKJA 3CJFA 4Y46A 5FEEA 4LUDA 4OTIA 2GDOA 4YBKA 3GEQA 4U3ZA 3UGCA 3G51A 2OW3A 3EFKA 3ETAA 4BC6A 3S95A 3LAUA 1PMNA 1U54A 3HRCA 2YACA 2IVTA 4JOAA 4C8BA 2P55A 4ITHA 4Y83A 4DT8A 4BCHA 3NUXA 4FTNA 3IGOA 1XO2B 1QPJA 3MN3A 3QA8A 3LCKA 2ITVA 4D2TA 2JAMA 3NYXA 3JY9A 2PVYA 3JS2A 4U3YA 4I41A 2JD5A 5DEYA 4R78A 4RVMA 4QMUA 2BZIB 4K1BA 5BVEA 4W8EA 3JPVA 4U9AA 1TFFA 2XYNA 2V5QA 4L9IA 5CF8A 1GAGA 4V05A 4HPTE 1WFCA 3TTJA 3COHA 3MGYA 5IDNA 1H1QA 3ROCA 5K4JA 4R6VA 3FHIA 4DHFA 3HDNA 4RIYB 4MNEB 2X9EA 2ETKA 5CQWA 3WE8A 5DMZA 1UWHA 3R9RA 3DT1A 3F5UA 3EQIA 2QOHA 4FKRA 4FL1A 4CXAA 5KHXA 4C61A 3DBEA 4D2RA 3V5TA 3SXSA 5LARA 3TJCA 5ANKA 1KE7A 5FWKK 3O7LB 2CNUA 3ZDIA 3QQGA 2VZ6A 1QCFA 4KD1A 2E9UA 4F08A 3D7ZA 3FY0A 3AC2A 2OFVA 4JRNA 4QNYA 4IJPA 2WMSA 3OW3A 2EB3A 2FUMA 4U44A 3DTCA 3H0YA 1H0WA 4O0RA 3MA6A 5D12A 2QCSA 3FKOA 3GCVA 4BDJA 4C34A 4FL3A 4U97A 3FDNA 4IC8A 1XH6A 4FTOA 3HDMA 3KN5A 4IZ7A 4GUBA 3BWJA 3R21A 2OF4A 4PX6A 5D7VA 3DJ5A 2XRUA 3LM5A 4YJNA 4IVCA 3UYTA 4AN2A 4IX3A 4TYHB 4YU2A 3ZONA 4YLJA 2VX0A 3QZGA 3TUCA 4YO6A 5IQEA 1YXVA 4RC4A 1L3RE 4YPDA 4BDAA 4CZYB 4NCTC 3DPKA 3VS4A 5AR7A 1Q97A 3JY0A 3P0MA 4FG7A 3GXLA 4CFUA 2XIYA 5HI2A 3Q2JA 3AOXA 3TKIA 1Q41A 2HW7A 3KMMA 3AT3A 5DPVA 2C5XA 2PE0A 3W0MA 4I3ZA 4CMOA 3CD3A 3M11A 4YC8A 2BDWA 2XAOA 4KIQA 5A4TA 3QGWA 3ORMA 3OUKA 4TY1A 3ZCLA 3FXXA 2R0UA 4AGCA 5L3AA 5IQIA 1Q8YA 4JQ8A 5HO7A 4DGOA 5IG1A 4O2PA 4RZWA 1WBNA 5I4NA 5IQBA 2WMAA 4PTGA 1HCKA 2OJGA 2WTWA 3DU8A 2YIXA 5ANOA 3UMWA 4BDDA 2H8HA 2QOBA 4NJDA 4FX3A 2IF8A 3U6JA 4G17A 4UMUA 3PE1A 4LM5A 3GCUA 4BZNA 3LCOA 4XEYA 4DH3A 3TG1A 2FH9A 4FEWA 4QTDA 3FHRA 3ZXZA 3QCQA 4IANA 1U59A 5A6NA 2J7TA 5CXZA 2OICA 4MXOA 2VO7A 4M84A 4J99A 4O1PA 2OXYA 4EH2A 1OMWA 3TV7A 3AT4A 2CKOA 4CG9A 3KXHA 4NTSA 4XG7A 4J96A 2UZBA 3PXYA 3NDMA 3ZM4A 1K3AA 1KOAA 2WTKC 2AC5A 3O8UA 4DF3A 4FKIA 4MYGA 4RBLA 3VUMA 4FEUA 3COKA 3TZ7A 5ACKA 5FP5A 4YMJA 5I9VA 1OVEA 2GCDA 4FKJA 3NUSA 3QRIA 1T46A 3NX8A 4ZOGA 3VBYA 4ANSA 1Q8TA 2CGUA 4YC6A 2QNJA 3FPMA 3RP9A 3QKLA 3WZDA 2OJFE 5BVWA 3MS9A 1TQIA 4E1ZA 4O7WA 4TTHB 3RINA 4AQKA 2PVLA 3P5JC 3K3JA 3W8LA 2XNGA 4AN3A 2VWYA 4TWPA 5KKRB 2PYWA 2PVNA 4N57A 1GOLA 4YJRA 4AGDA 4DGMA 3IPHA 2IPXA 2PTKA 1PY5A 1SYKA 2GNLA 3QCYA 3R04A 4DAWA 5KMIA 3KK9A 1FVTA 3KF7A 2VTAA 5E92A 4PDSA 5FRIA 5HBEA 5J87A 3RPOA 4MXXA 4WUNA 4IAKA 4EHEA 4F7NA 4DGGA 2O8YA 5DE2A 1JVPP 4GVJA 3ZZWA 5CZHA 4LOOA 3ZS5A 4EH4A 1PYEA 2WU7A 5M4CA 3BGQA 3BCEA 4YJPA 3CY3A 4I23A 2W1DA 1VZOA 3DBDA 3ORIA 5ETIA 3MI9A 2QHMA 3LE6A 5LVNA 1OGUA 2X1NA 4DCAA 4QDEA 4YTIA 3QD0A 3T8OA 2XIXA 4HJOA 4UWBA 5DOSA 5BVDA 2P33A 4DH1A 4ALVA 4O83A 4GW8A 1PXLA 5B0XA 3QZIA 3WIKA 4Z3VA 2YDIA 2YITA 4BTJA 1FVVA 4DTAA 3SHEA 4DEAA 5A54A 4O6EA 3GVUA 4ACDA 4F9BA 2ERZE 1YDTE 5AIRA 3HUBA 3OBJA 3OCBA 5IPJA 3RBWA 4AA4A 3PXRA 3F2RA 2W05A 2X6EA 2XMYA 4O0WA 5LMBA 2X6DA 4A06A 4EK3A 4AXCA 4RJ6A 4XS2A 4O0TA 5E8VA 5HNGA 4ZTRA 3NGAA 2BRGA 3ERKA 4DEIA 4JIKA 2R64A 4RJ3A 5GZ9A 3VQHA 2Q0NA 1YRPA 5HIDA 3B8RA 1DM2A 2H96A 3MYGA 1ZMWA 3PVWA 3S3IA 3K3IA 1DAWA 3FEGA 4I6LA 1H0VA 4FUYA 4S2ZA 3SDJA 2GTNA 3WZKA 4FSQA 4MHAA 3KCKA 5JQ5A 3R28A 4JAIA 4JBPA 4JLCA 4P2KA 3V