5FEDA

Egfr kinase domain in complex with a covalent aminobenzimidazole inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
288
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDEMDDVVDADEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Discovery of (R,E)-N-(7-Chloro-1-(1-[4-(dimethylamino)but-2-enoyl]azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), a Novel, Potent, and WT Sparing Covalent Inhibitor of Oncogenic (L858R, ex19del) and Resistant (T790M) EGFR Mutants for the Treatment of EGFR Mutant Non-Small-Cell Lung Cancers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 288
sequence length 321
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fedA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fedA01
3EN5A 3F5XA 4JL9A 4FVQA 4TWNA 3UQCA 2G01A 2VTQA 3ZEWA 2XJ0A 3PY0A 4EWQA 3FMKA 4D2SA 3MS9A 4ZXTA 1OKWA 4MF1A 4BIDA 4OAUC 4KABA 5L3AA 4ZLYA 2W1HA 1FPUA 2GS2A 4QD6A 4ANNA 4ERWA 4ANQA 5BNJA 1U5QA 3ZLYA 3C51A 4FSRA 4XRLA 2F7XE 4M97A 3UJGA 4I5MA 4W8DA 2UW9A 3D4QA 2B4SB 1G8AA 1ZOHA 5CEQA 4OAVB 1SVEA 2JDTA 2W0JA 3BBWA 3RM6A 3ACKA 2W96B 2QOQA 2VTHA 5A4EA 3MFSA 2GNLA 5E8UA 2IW9A 3KL8A 3GGFA 3GCUA 4AGDA 3CC6A 1R39A 4DYMA 3U4UA 4QRCA 4I6BA 4U8ZA 3DXPA 3FMDA 3OROA 3UZTA 5CYIA 4JG7A 3ZFXA 4I20A 2UW4A 2YFXA 3LJ1A 3ANQA 5EQYA 5GJFA 5GNKA 4BDGA 3BGQA 3A7HA 4EJ7A 4RJ8A 5GIOE 4JDJA 4NWMA 1TKIA 4QYYA 5F9EA 5H2UA 3D2IA 2CKPA 3PTGA 3TDVA 2I40A 4HCVA 2B1PA 2ITUA 3DPKA 3OTVA 4O0WA 5HHWA 3Q96A 3NYOA 1YI3A 3VS3A 3UE4A 4CFFA 2HXQA 3DT1A 2WOTA 1J91A 3POZA 4H1JA 3DKFA 5L2QA 1EH4A 3ALNA 5FP6A 4IB5A 3UTOA 1PMEA 3DBEA 5BMSA 3QQKA 3RTPA 1XH4A 4GVJA 4EOQA 2OF2A 3I7BA 2YCQA 3W10A 5CALA 5FEEA 3KVXA 2XM8A 4QO9A 3KREA 1HCLA 2W1DA 5CI6A 2XNOA 4FG9A 3VBXA 3QYZA 5LARA 3R1YA 4ZTNA 3JPVA 5CAUA 4XH6A 1PXOA 5ANIA 4ZY4A 5A3XA 4O0VA 4IZAA 5EM8A 4FNZA 5HBHA 4RJ5A 1LEWA 2VO0A 3SW4A 4W4XA 1OIYA 3C4WA 5TE0A 4BDIA 4BGGA 5ANKA 4DN5A 4JXFA 3V8SA 2QG7A 3U51A 5C8NA 1IEPA 4LMNA 4DG3E 1LPUA 4JX7A 3WZEA 4FYOA 3ZMMA 4BDHA 1U5RA 5CSXA 2VTAA 3UP2A 3ZO1A 2W1FA 2ITWA 4AW0A 5KHXA 3D83A 2C5VA 2GSFA 2C1AA 3CPBA 4IX4A 3E5AA 2XJ2A 4P90A 1OL5A 3PFQA 4I93A 2EXMA 2YA9A 5CF6A 4IWDA 5CU0A 5FD2A 3OWLA 3IKAA 3EQHA 3RAIA 2C0IA 4ANMA 1J3HA 5ETIA 2FGIA 3SC1A 4FV4A 3GC7A 2FA2A 4M66A 3TTJA 4CMTA 4YR8A 3BEGA 1PYXA 5IQFA 3LXKA 4IM3A 4B99A 3NZ0A 4ZSEA 4EONA 4F0IA 1GZNA 4O7SA 3H9RA 2B0QA 4X3FA 2GNJA 4FNYA 3IQ7A 3R7UA 3WZUA 2WZJA 3DS6A 3E7VA 5CANA 1YKRA 3R02A 3TT0A 3N4UA 2NO3A 3BHTA 4TYHA 3I6WA 4XP2A 2Z60A 1Q61A 3SKCA 5BQ0A 4RJ6A 3T3VA 1KE5A 3FKOA 4JDIA 4EJNA 3ZXZA 2RFDA 2VTOA 2XVDA 4AFJA 5IUGA 2R5TA 1RW8A 2R3MA 4RIWA 2WMQA 4EOOA 4BZNA 2ONLA 3PJ3A 4AU8A 3FJQE 4JDHA 4BKZA 4EH2A 1XBCA 2FSOX 3F5GA 3QQFA 4FTOA 3RGFA 5JEBA 3RI1A 3AC5A 2VWZA 4ACGA 3RK5A 4G9CA 2OU7A 3PWDA 4IX3A 1YXSA 5I3RA 3PSCA 4MF0A 4WT6A 4WRGA 3AMYA 3HRCA 5ACBC 5M4IA 3N4VA 5CVHA 5E8VA 3RWPA 4KS7A 5DT0A 3R9NA 5JKGA 5E8YA 2VUWA 3HMNA 4ASDA 2WFYA 1P4OA 3UC3A 4I6FA 4LQMA 3IW7A 4WNKA 3QC4A 5TO8A 4GK3A 4XX9A 4FL1A 2W1GA 4XG8A 4XS2A 2FVDA 4ARKA 4RVTA 3ORZA 1BI8A 3R8VA 2UV2A 1VYWA 3EFKA 3RNYA 3ROYA 3B8QA 3TV4A 3HMOA 3KMWA 4ERKA 2I1MA 3GCSA 4NJ3A 4M69B 5E8ZA 5AV1A 1UU7A 4O7RA 1DAWA 3PJ2A 3SVVA 2EB2A 2Z7SA 3MA3A 4A4XA 3BELA 2C3LA 4AT4A 3PPJA 5DRDA 1WVXA 3HV7A 2YDJA 3KU2A 3FZOA 3LXNA 4DT9A 1REJA 2X9FA 2V5QA 4ONAA 5IG1A 3DJ5A 2YHVA 3FXZA 5JQ8A 3VRZA 2JDRA 4DTAA 3E3PA 4OW8A 4IFCA 3C1XA 5CAOA 2E9NA 5DR9A 4A4OA 3A7JA 4XEYA 4L46A 2OFUA 2VGPA 2VO7A 4U5JA 2WMWA 2WTIA 1B39A 1YWRA 5HX6A 4WUNA 4JG8A 4ZY6A 2HW7A 5LXMA 1UA2A 3CIKA 4G5PA 3ZM9A 3PVBA 2IZTA 4B0GA 4CG9A 3DBDA 3H9OA 3KULA 4J53A 3C4CA 3DK6A 4E6CA 4F9YA 3QQJA 1PMUA 3N51A 4FSQA 5CXHA 4B9DA 3P7AA 2OZAA 3QGYA 2CPKE 3CS9A 1OIQA 4XMOA 4GRBA 3SA0A 3COMA 3JY9A 2UW0A 5CSVA 1YWNA 1ZARA 3B2TA 2LAVA 4EK8A 4APPA 2ZJWA 4FTKA 4RIXA 3EMGA 4BVUA 2PPQA 1XBAA 3Q2MA 4BKYA 4BYJA 4CCBA 1KV1A 3Q2JA 4QQTA 4DTBA 4FTIA 5DIAA 3VQHA 4AZWA 5B2KA 2QHMA 3O7LD 4GJ2A 3TNIA 2FYSA 4QOXA 3VRYA 4W8EA 3ULIA 4DFXE 4C7TA 2IPXA 2P4IA 1DI9A 4EH4A 4EOSA 2VO6A 2XYUA 2XRUA 3FXWA 4BWPA 3QTWA 3SOCA 4QMTA 4QMUA 4PQNA 2XEZA 2A27A 2IZRA 4J8NA 4JS8A 4Q5HA 4RRVA 4MQ1A 4UWBA 4EYJA 5A4QA 5IF1A 2JDVA 3CE3A 5DHJA 3KK9A 5LJJA 3KGAA 2P33A 4G3DA 1OM1A 2C3IB 4HOKA 4DG2E 3CJGA 1Y6AA 2GU8A 3PA5A 3ZC6A 5EHLA 5L2TA 2OH4A 2RG6A 3MYGA 2C6LA 3O51A 4BCJA 4FSZA 3Q6UA 2BRNA 3NPCA 1H1RA 4TKSA 4XG9A 5LMAA 3EQFA 4NIFA 1Q97A 3WILA 4PL4A 5CNOA 3U9NA 1M2RA 2UZLA 4IVAA 2YAAA 4FKVA 3OXZA 4UZHA 3VW6A 2XEYA 4Y46A 2O63A 3KEXA 3W8LA 1M14A 3D94A 5JGAA 5IMXA 3HDNA 3FWQA 4QQJA 5LOHA 4PDYA 2R3FA 2GHGA 3MESA 2GS7A 3E3BX 4BDJA 4A9RA 1OIRA 5ICPA 3CEKA 4I94A 2AYPA 3NSZA 4GIIA 5JFSA 2CN8A 4BWKA 2DS1A 4G3GA 2QG5A 3V51A 3NNXA 3A2CA 3C13A 4JLCA 1R3CA 4NM0A 3NW5A 3WOWA 1OKZA 4EUTA 3FMJA 4YTHA 4J96A 3TIYA 3TM0A 4DC2A 5I5ZA 5AUTA 2ZMCA 3NUPA 4YHJA 3IW8A 3MH1A 4M12A 3RJCA 3V01A 1J7UA 2XIXA 4DHFA 4DEIA 3BU3A 4IX6A 3PZHA 4NT4A 4RQVA 5HNIX 1NW1A 2UW6A 2YACA 4BCQA 2ZV9A 4L9IA 2WMBA 4UZDA 4BZOA 4HYIA 3CQWA 3VF8A 4FOCA 4AW5A 4PWNA 3F2RA 3OS3A 3KXMA 4HVGA 2F4JA 5D12A 3MH2A 3W8QA 5ETFA 4EUUA 3R1NA 4OBQA 1UV5A 4RFMA 1QPEA 4JQ8A 2VTMA 2YLFA 3P0MA 4XBUA 5BVWA 4PMSA 3JVRA 3PE2A 2BPMA 4GG7A 1PKGA 3QQLA 3DTWA 4YUQA 4ZSAA 4CLJA 3BYVA 4YLLA 1JKKA 3OCTA 4R6VA 3Q4TA 3PA3A 4ZIMA 4FKLA 4CKIA 3FLZA 5EHYA 1UNGA 2RFEA 4FKGA 5IH5A 1YWVA 1NVQA 5EG3A 1MQ4A 3IO7A 3EKNA 3TACA 2QURA 2ZM1A 3LAUA 2P3GX 4FKRA 4IDVA 1QPCA 2BZJA 3ZSIA 4OUCA 3TL8A 4W4WA 4X2FA 4LFIA 2C68A 4WNOA 2BRBA 2I0YA 2OXDA 5AP6A 3H3CA 4QTDA 4DF3A 2VX3A 3HKOA 2OK1A 4IMYA 3G5DA 5J1VA 3OEFX 3ZH8A 3FAAA 5JZNA 3ZHPC 4AUAA 4O1PA 2WU6A 2X4FA 5DE2A 5JRSA 1JKLA 3R8MA 1WBNA 3NS9A 2BZHB 3QAME 4WOVA 3VWAA 4EZ7A 3FYJX 4IAZA 1OUYA 5CZIA 4HJOA 5CS6A 3ZONA 1LUFA 2C6TA 4PMMA 3R7YA 4CV9A 2PY3A 1H08A 3L8PA 1BL6A 4JAJA 4ZJVA 3QUPA 5HZNA 4O7YA 5BX0A 4ASZA 1JAMA 4K11A 5CEPA 3AD4A 2BHHA 4FSTA 3BI6A 1H25A 1ZYSA 2UZBA 2XIZA 4FOBA 1H07A 2CHLA 4S34A 2VWIA 2GDOA 2XS0A 4I23A 3IW6A 3KXNA 4X2JA 4BTMA 2QC6A 3HP2A 4QMNA 3BEAA 3ALOA 3R22A 4FTTA 3M1SA 3VS5A 3FMEA 4BC6A 4DH1A 2UZVA 4UX9A 4IJPA 4MHAA 4NSTA 4C4JA 1SZMA 4MXOA 5AP7A 2JKQA 3RMFA 5FTOA 1PJKA 3B8RA 4IANA 3U6HA 2C6KA 3O71A 4IAIA 2PE0A 4NK9A 3ZRLA 3FL4A 4QT1A 3R7OA 3D7TB 4EHZA 2G1TA 4Y8DA 5DEYA 5G1XA 4FV0A 2R3OA 4EOMA 1SNXA 5DN3A 3VUGA 3RP9A 4GW8A 4F4PA 5KO1A 2JBOA 3TNWA 3JXWA 5BYZA 4LL5A 4Z16A 5BVEA 3TV6A 4ACHA 4FEVA 2ITZA 4I5CA 3AGLA 3RPSA 5HORA 2PK9A 4IACA 2J7TA 4YGAA 3BV2A 2ZB1A 1UVRA 3NRMA 5M53A 4WG3A 5IPJA 3PSBA 3R83A 2BZKB 4W9XA 2YLEA 4BCMA 1H0WA 2WOUA 3EHAA 3KCKA 3I5ZA 1Q4LA 3MJ2A 4QTCA 4EH9A 2C6IA 4EOLA 5EDRA 2R3LA 4KKGA 5HCZA 4XLVA 4HVHA 4IAFA 4YJNA 3II5A 3GQLA 4BI0A 4EKKA 3F6XA 4IADA 1XKKA 3G0FA 5JFXA 3R1SA 3RINA 5EFQA 3L9MA 5CENA 4EH7A 4I4FA 2BFYA 4F6UA 5HTIA 4OTWA 2Y6MA 5FRIA 4FNWA 1G3NA 3POOA 4O96A 3KXZA 4OTIA 4YJUA 4IEBA 3BE2A 5DBXA 5K4IA 3BHHA 2UW5A 3MVJA 5AUWA 1YDSE 4FV8A 5CEKA 2A19B 3DAKA 3LM5A 4ITHA 4YZCA 2Y4IC 2ZMDA 2BZIB 3HAMA 4FBXA 3H30A 3QCYA 2XNMA 3FBVA 4FSUA 2W5BA 2YJSA 3FI2A 3LKMA 3DB6A 2VX0A 5EDQA 5KMJA 1SVGA 5HIEA 2BRGA 5IQCA 3I4BA 1G8SA 3S1HA 3TWJA 4R1YA 4BCNA 2NPQA 3AT2A 1KE7A 3DZOA 5J5SA 4TTHB 2J0LA 4FT0A 3BGZA 4UWCA 3LM0A 5EI8A 4BGQA 5HICA 3D2KA 3EQGA 3FLYA 2QLUA 4OTDA 5AV2A 5C8MA 3V5TA 3ODYX 3LCDA 1IAHA 3AMBA 1Q62A 3FUPA 4RVKA 3VAPA 4PPCA 3LQ3A 4J71A 5IQIA 4RT7A 3COIA 3P23A 3WE4A 5IA0A 2ETRA 2Z7RA 3QCSA 5I0BA 3F69A 4NKSA 4EH8A 5KKRB 3GC0A 5TF9A 3UVQA 4EORA 1Q8WA 3D14A 4QMSA 4C2VA 2HYYA 2X2MA 4DEAA 2BRHA 2WO6A 3QX2A 2B52A 2DYLA 1U4DA 2PZIA 4KIKB 4NW5A 4RC4A 4X3JA 4BBMA 1W84A 3E92A 4QTAA 4AT3A 1MRVA 3RAWA 4EI4A 3OCSA 4U7ZA 4CFWA 2J0MB 4CKJA 1Z57A 3FMHA 5IEVA 4FT9A 4DGGA 2VWVA 2YWVA 1F0QA 4R7HA 3FQHA 2OIQA 4MVFA 5DT3A 4CYJA 4DEGA 3Q04A 2CDZA 5IKWA 3UVPA 4E4MA 5A6NA 4V05A 3DJ6A 2E9OA 2HWOA 3I1AA 1OIUA 3IG7A 2YITA 2NRUA 3MH0A 4FTLA 4X7QA 4KSPA 4DFLA 4I24A 4LOPA 1GIHA 4DGMA 3OWKA 4YZBA 4D2WA 3UO6A 1H27A 2QO7A 4EK4A 4XG3A 3KVWA 4D2RA 4D55A 3UZPA 5IUIA 5M09A 5C26A 1YI4A 4DEBA 3EN9A 3H10A 1YOJA 3LQ5A 3P7BA 1YHSA 4IWQA 2Z7QA 2YCFA 3FI3A 4FK3A 4K2RA 5K9IA 4C4GA 4CCUA 2BAQA 5FM3A 2YIXA 5T6KA 4A07A 4V01A 4BDEA 2OZOA 5JH6A 4FIHA 4C38A 4E5WA 4YZMA 2GFCA 1URCA 4Y73A 4AW1A 4FX3A 2QKWB 4FIJA 4XBRA 3SD0A 3PXYA 1TVOA 4S31A 5GZ9A 3CGOA 3NCZA 2WU7A 2ZVAA 4B8MA 4BCPA 4MBJA 4FZ7A 4P2KA 2ZV2A 4I5HA 3C4XA 5DT4A 1XWSA 4B7TA 2GNGA 4MX9A 2C69A 4LI5A 4G31A 3SRVA 3MA6A 2ITNA 5H3QA 3TZMA 2IO6A 2XA4A 4O6LA 4G6NA 4KBAA 3FDNA 5D1JA 5D11A 4YLKA 2HZ0A 1KE6A 3OC1A 1XR1A 4S32A 2JD5A 3FSFA 4NH1A 2VD5A 4Q2AA 3RHXA 3P78A 4L01A 4PL5A 4YC8A 5A6OA 3MVMA 2J0JA 3TUBA 3F88A 2BROA 3FY2A 3LFCA 4LL0A 4YPDA 4EHVA 4YJVA 5DNRA 5LWMA 1A48A 3LFSA 3IOPA 4FODA 4QYGA 3FL5A 3RK7A 4BF2A 4F6WA 2GMXA 2R3IA 3IGGA 4WA9A 3CCNA 4K8AA 4D2PA 1J7IA 2HELA 1CKIA 1R0PA 3P86A 4F1TA 2OH0E 3DAJA 3QD4A 4M15A 5JZJA 1LP4A 2B9JA 2B9FA 2GNIA 3A8WA 3Q60A 3QRJA 5FM2A 4O7ZA 3UZRA 2WQBA 3DNEA 4IDTA 3ANRA 1YI6A 3V5WA 3EKKA 5HD4A 1HCKA 1Q5KA 2A4LA 5AX3A 5AP5A 5IUHA 4ZS0A 5IA4A 1UWHA 1XO2B 1GJOA 3D9VA 3QA0A 3AC2A 3I0OA 3AT4A 3KRRA 4RZWA 5DOSA 5K0KA 4IQ6A 1KSWA 1CKJA 2R3KA 1UNLA 3RZBA 4GUEA 3RPVA 3GC8A 3SAYA 2XP2A 3G9LX 2IVUA 3GCPA 3A7IA 2W1IA 3R63A 5LVNA 4DCAA 2XKCA 3AD5A 1SYKA 3PXZA 3NUYA 4FE2A 2WTWA 4JI9A 2J6MA 2Z7LA 5IDNA 4RJ3A 1O6LA 5M4FA 4MXAA 4S33A 1G5SA 3VW8A 4U40A 3FC2A 3NNUA 4ZTHA 3QC9A 5KMKA 3C0HA 2R7BA 4PTCA 4G3EA 3PPZA 5FBOA 3I5NA 5CAQA 3KXXA 1R78A 3U87A 1V0BA 3WZKA 4QP8A 2YIWA 3U54A 3H4JA 2UVXA 3BLHA 4FKPA 1TQMA 2XJ1A 4UWYA 4AXAA 4BBFA 3COKA 5HIDA 4LV5A 4QNAA 2ITTA 5IA5A 3UO5A 3I7CA 4CYIA 3OUKA 4OGRA 3R8UA 4GFOA 4E73A 3ORTA 3NMUF 1DAYA 3ZO4A 5A54A 2I6LA 4FV6A 4IX5A 4M84A 4AFEA 3EYHA 4NKAA 3R7GA 5EM6A 3RAKA 4KS8A 5HVKA 4X3FC 2ACXA 4RX5A 3BGPA 3LFDA 4CZUA 3F3ZA 4TW9A 1ZYDA 3P5KA 4LRKA 2RF9A 3IDCA 4RZVA 2XRWA 3TKIA 3O17A 3HZTA 5HD7A 2BIYA 2F2UA 2J90A 4F64A 3WBLA 5E4HA 2JDOA 4BBEA 3EQDA 3SHEA 2EXCX 3HA8A 4NYEA 4XG6A 4YZ9A 3SX9A 5BUIA 5LMKA 4O0YA 1OGUA 3I6UA 2WTCA 4JOAA 2ONLC 4MXXA 4Y5QA 2E9UA 4PUZA 4NU1A 1OB3A 3CXWA 1M17A 4ANLA 4ENYA 3AC3A 3PJ1A 3PJCA 1MQBA 3C9WA 4V0GA 4EBVA 4ZMEA 3QLFA 2PHKA 3BYMA 3DJ7A 3BBTB 1QPDA 4BDBA 4CRSA 2QODA 3I0QA 4FEXA 4O1OA 5AAEA 2BAJA 4PNKA 3PRIA 4ZJJA 2ITPA 3GU7A 4XG7A 4WHZA 3OEZA 4AZTA 1ATPE 1LR4A 2YM7A 3REPA 4F9CA 1XQZA 4GJ3A 2A1AB 4R5YA 4KBKA 5CU2A 4EOIA 4PX6A 5K0XA 1SNUA 4CQEA 5M07A 5AMNA 4G3CA 2WMXA 4ZAUA 3EQRA 2B9HA 4NFMA 1NXKA 5K4JA 5IQGA 2VRXA 3UPXA 4WIHA 2IN6A 2Z8CA 4XRJA 3RVGA 4L44A 3KMUA 4BI2A 2XYNA 5LCJA 1UU3A 3ORIA 1Q8UA 5FTGA 3ORKA 1H26A 3O0GA 4LUDA 2YM4A 5KZ0A 4D9UA 5KMLA 3KK8A 1PY5A 5JFVA 4RFZA 1P4FA 3MFUA 3OWPA 4XP3A 2YIRA 3Q9XA 4YURA 3GOPA 1P14A 4YU2A 4O27B 2C3JA 1WBPA 4GYGA 5KMNA 4QPMA 5EYDA 3VJOA 4IW0A 2XM9A 3AT3A 4FZAB 4D58A 4IM0A 3PVUA 3CQUA 5HCYA 2Q83A 3ZUVA 3EOCA 3LCSA 2HOGA 3A61A 2Y8OA 2CNQA 4E5BA 3C0IA 4CZYB 4USDA 2CLXA 4PRJA 4KUJA 3NW6A 1IRKA 4ZZNA 3NYXA 5AAGA 2PZYA 4DH5A 3CBLA 4BDDA 3EZVA 3VBQA 5TT7A 4FI1A 1ZWSA 2R3GA 3NLBA 2F57A 4BI1A 4EC9A 2CGXA 4M69A 3NCGA 3DCVA 3AMAA 4GG5A 3V8TA 2LGCA 4CV8A 4QQCA 4FMQA 4DH3A 1FINA 4XV9A 2HZIA 4IZ7A 1ZYLA 4YSMA 3EN7A 1FVTA 3E88A 3O2MA 3U9CA 1PW2A 1RJBA 1PXJA 4FTCA 4F63A 3PG3A 3GBZA 4FGBA 4JQ7A 4QP2A 1CSNA 3CP9A 3VS4A 2WQMA 4QP6A 5EK7A 1YDRE 1AQ1A 4CFMA 3WYXA 5CVFA 1JWHA 2FO0A 2RSVA 3VQUA 1ZMVA 4CFVA 2PMOX 2XNNA 4FYNA 3VC4A 1KOBA 3OCGA 4C58A 1ZZLA 1WVWA 4BRXA 3GFWA 4IJ9A 4IWPA 4O0RA 2PUUA 2XIYA 5I9ZA 3ENMA 3SQQA 2PSQA 5D41A 4D5HA 4ZK5A 3BHVA 3PVGA 4QQ5A 2R3PA 2BAKA 2RFSA 3C4EA 3OMVA 3QZFA 1GIIA 4DG0E 5CSHA 2BVAA 3GCVA 4FV3A 2VV9A 2BR1A 5H8BA 4FA2A 3RBWA 4FNXA 3QRTA 3QQGA 4CTBA 2H34A 4D1SA 1YVJA 1OMWA 2XNEA 3FI4A 5E1EA 5B2LA 3C4ZA 3KN5A 3F5UA 3MPAA 4I1ZA 1ZYCA 4EQUA 4X0MA 3QHRA 4AA0A 3FPQA 3ZEPA 2WMRA 1YOLA 4XG2A 4U6RA 1PYEA 5KMIA 3PLAE 2QD9A 5C9CA 3R04A 3MIYA 4U97A 4QTBA 3CJFA 4WBOA 5HO8A 3ZSGA 4GS6A 4FUXA 4K18A 2XK8A 1WZYA 3LJ2A 2UVYA 5L8LA 3VHEA 3QALE 4KIQA 2EXEA 2W1ZA 3LVPA 4XHKB 2OICA 2R0IA 3TZ7A 4WUAA 3Q3BA 3DKOA 3R21A 5FXSA 2XK7A 1GZ8A 4LOOA 5M55A 4CFNA 2YM6A 4X2GA 4RC3A 2WTKC 2W4OA 5CU6A 4RLKA 4O21A 2VTRA 1YXUA 4D28A 2PUIA 4O0TA 3DBQA 4RLLA 4HGTA 4F08A 4QP1A 2UZWE 3SOAA 5BUJA 4BCKA 2PU8A 4PTEA 1T46A 2OKRA 2IVVA 3UIBA 3ENHA 4DEDA 2EVAA 3C5IA 3RCJA 4WD5A 2ZV7A 3PE1A 2W4JA 2QO9A 2YDKA 4QMVA 5EM5A 4CFXA 4G2FA 4FV7A 3BYSA 4E6QA 5HI2A 3HV6A 5FEDA 4BIEA 2GNHA 3TNPC 3R2BA 2VTNA 5DLSA 2PULA 1YQJA 1BL7A 3QYWA 3KQ7A 2CKQA 1NY3A 3OBJA 3EQIA 4C02A 4RWIA 5HE3A 4AE6A 4F0FA 2QLQA 2RKUA 3MY1A 5FTQA 2CSNA 2R3QA 3RNIA 3FMMA 2XMYA 1YRPA 4FVPA 3VJNA 2EWAA 3BHYA 3MY0A 4YZNA 3IECA 4FVRA 5L8JA 5A14A 3FE3A 3QWKA 4ZLOA 1IAJA 3DTCA 5CZHA 5D7AA 5IEYA 4WNPA 4EOPA 4WSQA 5KE0A 4A06A 4IZYA 3SW7A 1WVYA 3ET7A 3MDYA 2X81A 2C6MA 1M2QA 4H3QA 5J9ZA 5K5NA 4DBXA 5CNNA 2VWUA 2J5EA 4PF4A 3ATSA 3W2SA 1U59A 4FTNA 3DK3A 4O0SA 4IXPA 4IE9A 2YM8A 2PVRA 4ZTSA 2IW6A 3HV5A 1ZOEA 4UV0A 4BCGA 4JQEA 5ANOA 4YTIA 4A9SA 4AF3A 4WSYA 4C57A 3P1AA 5JRQA 4BTKA 4D2VA 2E9VA 4O82A 4FTMA 4L45A 1L8TA 4Z7GA 3UG2A 4YP8A 2WQEA 1VJYA 4KRDA 2ZOQA 4BCIA 2NP8A 2ZAZA 3MBLA 5AP3A 2ERKA 4MXYA 3AQVA 2R9SA 4N6YA 1IASA 1JKTA 3GOKA 2QHNA 4HGSA 3W18A 4B6LA 1W82A 5GZAA 3ROCA 4DGLC 4OR5A 3Q6WA 5IA1A 4RMZA 2E9PA 3H9FA 5HG9A 1A9UA 4J7BA 2G9XA 3ZLXA 2F7EE 4I21A 5HKMA 4NTSA 5EM7A 4K33A 3UPZA 3HRFA 3ZSHA 3NUSA 4RIWB 5A4TA 4M68A 2F7ZE 2GQGA 3DDQA 2PZ5A 4A9UA 2WHBA 3QQHA 4KIOA 2F2CB 4DH8A 3R2YA 4AZSA 2DUVA 5HBJA 4UB7A 2J51A 3MSSA 4FG7A 2OG8A 4GU6A 3ELJA 4PNIA 2RIOA 2QR7A 4C36A 4IBMA 5HVJA 5LVMA 5J9LA 4M14A 3O7LB 2WIPA 5AADA 1W0XC 4O6EA 4H58A 4CVAA 2I7QA 1JKSA 5HE1A 1J7LA 1JVPP 1OECA 1YXTA 2B54A 2PZRA 4GT5A 2CCHA 4CD0A 2YEXA 2QOLA 3RZFA 4WO5A 2JEDA 2IW8A 3RK9A 4MNEA 3RWQA 2P55A 2JFMA 4W9WA 3C5UA 3SG8A 4ASXA 3MPTA 3EIDA 3GEQA 4U3ZA 4L53A 3MH3A 3WF8A 3ZC5A 4D4SA 1WMKA 3KFAA 2OFVA 4ACDA 4IAKA 2YWPA 1JSTA 2PUNA 3TNQB 2QCSA 4RWJA 2XK4A 2YCRA 4TWPA 4DAWA 5KBQA 1QCFA 3LQ8A 2XK9A 4JAIA 2XK6A 4B4LA 3OOMA 3UC4A 3E8CA 4GUBA 4Q9SA 4B8LA 4CKRA 3QZGA 2YAKA 4JRVA 5TKDA 3K5UA 5LQFA 3QQUA 3ETAA 1E1VA 5CQWA 2X7GA 1UKHA 4U9AA 1Z5MA 1WBOA 3JY0A 1H8FA 5C4LA 1XJDA 3NUXA 4UMQA 4BYIA 2X8EA 4FL2A 1QMZA 4FKQA 2X7FA 5FXRA 4HGLA 5C03A 5E8TA 3A4PA 4JRNA 3F9NA 3SXFA 3R01A 4YJSA 3R7EA 1L3RE 3FHIA 3FLWA 3CKXA 4ZSLA 3R8ZA 4E4NA 3CY2A 4FTQA 3PY3A 4HPTE 4FC0A 3GUBA 3KULB 3OXIA 3TUDA 3IDPA 5IISA 1MP8A 2ZYBA 5L6PA 2OZAB 5ANGA 1Q8ZA 3GB2A 2GPHA 4BDKA 3HL7A 3OG7A 4AN2A 4RIXB 4MKCA 2O5KA 3GENA 3JS2A 3PIYA 4C37A 3K5VA 4PMPA 3UOLA 2WTDA 3ZLSA 3PRFA 5C8KA 5EW9A 3QF9A 4EZ3A 3PXKA 1V0OA 1MRYA 4FIIA 4OT6A 4TNBA 5IQAA 4XG4A 2C0TA 4AAAA 2WQNA 4X6RA 1P2AA 3NNVA 3OY3A 5CU4A 4DEHA 4FZDB 4IAAA 1XH7A 2J2IB 4AP7A 2V55A 1ZYJA 3LIJA 4PP9A 4E93A 3FC1X 5AAFA 3ODZX 3G9NA 4NCTA 4DCEA 3HUCA 3PSDA 2BMCA 4O0XA 3QTUA 5CF5A 5AR2A 3DBFA 2HCKA 4MBLA 5HCXA 1VEBA 3KRLA 4AWIA 5AA9A 4IC8A 5CEIA 4JG6A 3G6HA 3OY1A 4FG8A 4C4FA 3ATTA 3DV3A 4II5A 1TQPA 2H8HA 2QOCA 4L43A 2YN8A 4MEDA 4JNWA 3L8XA 5DFPA 4XP0A 3ZO2A 3RHKA 3EB0A 2SRCA 4M0YA 4YJQA 3D5VA 4AN3A 3L8SA 4LV8A 4RIOA 4BTFA 3GU5A 1FMOE 1FVVA 4IVCA 4QYFA 5HE2A 3WZDA 3QTRA 3QBNA 1AD5A 2ZB0A 1FOTA 1JBPE 2ZDUA 4M3QA 5HNBA 4E4LA 4GKHA 3V8WA 3LMGA 3C50A 3RALA 1R0EA 3QRIA 5FDXA 3R8LA 3UO4A 3O8UA 5EYKA 3EYGA 3BWJA 3E64A 3L9NA 3LPBA 4YTFA 4DFUA 4TWCA 2UZNA 4FT5A 2WQOA 4BHZA 4OLIA 3KF7A 2A2AA 4LRJA 3VUTA 3ZBFA 4RIYB 2HZ4A 3D7ZA 4MWHA 5BVFA 3UIXA 4ZP5A 3SGCA 5FQDC 3HV3A 4Q5EA 4C4IA 3NUAA 1JSVA 2Z02A 4L3PA 2YDIA 1FMKA 3D5WA 3Q52A 3F3VA 3TN8A 1STCE 3RPRA 2Y9QA 3QRUA 2R3HA 3FMLA 4NM5A 5HOAA 4QP7A 4X21A 3QUDA 2X6DA 4J95A 5J7BA 4IVDA 4WG5A 4NM3A 1VYZA 4FZ6A 3BQCA 4O2PA 2VWXA 5HU9A 4F7LA 3QLGA 3CY3A 3BYUA 2X7OA 4D1XA 3MB7A 5C4KA 2X4ZA 4I0RA 4RJ4A 5IA3A 3G0EA 2JAMA 1B6CB 2QI8A 4N4SA 3SDJA 3OWJA 3NX8A 2JKKA 4IAYA 5CXZA 4DFNA 1MUOA 3OF0A 3QU0A 3SLSA 3W2RA 3ZUTA 2HY81 5HTBA 3PY1A 3IGOA 4TNDA 1S9IA 3ZLWA 4A4LA 3K54A 4ZTLA 4ZZOA 4DH7A 4RC2A 1W7HA 4XV3A 5EDPA 4IM2A 2BDJA 4X2NA 3WF5A 5AV0A 3V04A 3SV0A 1OKYA 1GNGA 4MQ2A 4RQKA 5FEQA 2UZEA 2XNGA 4Y83A 5ANDA 3BLQA 2P0CA 3QXPA 3AC8A 2IWIA 4ZS4A 5FGKA 3KKVA 3QKLA 1VR2A 3F2AA 5J8IA 4D5KA 5FDPA 4BDFA 2RG5A 2GNFA 4U3YA 4O7VA 5AV3A 2J0KA 3MI9A 5AUUA 5JK3A 2C0OA 1ZRZA 2Q0BA 4J8MA 3R71A 3PXRA 4TRLA 3UNKA 3BU6A 2JIIA 1ZLTA 3UG1A 2OBJA 3EFJA 2ZM3A 3DZQA 2R7IA 3O8TA 4C61A 5IA2A 2XB7A 5I3OA 3PJ8A 2WEIA 5EHOA 5JQ5A 2CNVA 4HYHA 4GT3A 2W9ZB 4TY1A 3HX4A 3KRWA 3DOGA 1BX6A 4BFMA 3CLYA 4ASEA 4R1VA 5KMOA 3L8VA 1RDQE 4AW2A 4MAOA 4QMLA 5DG5A 5I9VA 4FEQA 2R64A 1Y8GA 3IS5A 4CXAA 4Z3VA 5BVOA 4G1WA 5I4NA 4YBJA 4R5SA 4EC8A 4JDKA 5LMKC 2UW8A 2I0VA 3ZFYA 4JBQA 4EH6A 4DTKA 4E7WA 3BPRA 2OIDA 1PXPA 3PXQA 2J9MA 3EQBA 1H01A 3UYSA 3ZS5A 4LM5A 4FKUA 5I9UA 4O22A 5CX9A 2WMSA 3FKLA 4FT3A 3R9DA 1UU8A 1WBSA 4BTJA 5AP2A 4AG8A 5J7HA 1ZXEA 5F20A 4BIBA 3F3UA 5E1SA 5HE0A 3UMXA 4F9AA 5BVDA 3HECA 3BE9A 5CSWA 5C1QB 4XYFA 3OCBA 4L3LA 3FMNA 3Q9YA 3MPMA 5HU3A 4GEOA 4M67A 1WFCA 5M4UA 4CGAA 2YISA 3JYAA 4U81A 4FGRA 4RX7A 5JFWA 4GMYA 2B9IA 1Q41A 2CCIA 1U54A 2YZLA 4XV1A 4R78A 2W06A 2X6EA 4C8BA 4YC3A 1H28A 2O65A 4G34A 5GJGA 3FXXA 4FTRA 4C3RA 3PP1A 2XNBA 4KA3A 3R9OA 3BV3A 2JC6A 3Q9WA 4IIRA 5CEOA 3S2PA 2UVZA 5FLFA 3TZ9A 3DXNA 5CY3A 5E91A 1Y8YA 4NL0A 2JLDA 3DY7A 2V22A 4GFMA 1ZY5A 3QFVA 3AGMA 3MTFA 4TYJA 2VTIA 3KXGA 5CI7A 5J9YA 2FUMA 2IVSA 1GAGA 3ORPA 3QZIA 2OWBA 1WBTA 2FSTX 4N70A 1KWPA 2XBAA 3R7VA 3UIUA 4I3ZA 4AZFA 2WGJA 1UKIA 3QHWA 1JPAA 4KAOA 4EQMA 2C1BA 1AGWA 4BGHA 3CTQA 4MD9E 3R00A 4MCVA 4DE4A 1B38A 3QZHA 2WAJA 4HNFA 4NFNA 4XJ0A 1Q8YA 3FLQA 3NUNA 5KCVA 2H6DA 4IHPA 5CLPA 3QA8A 4MYGA 4XLIA 3ZM4A 3K3IA 4UMTA 5IMEA 3TZ8A 2QO2A 4S2ZA 3S3IA 3TKHA 4F7JA 4FTAA 3EZRA 3S00A 3LMIA 3ORNA 4BCHA 5HLPA 3WF7A 3IW4A 2OXYA 3D5XA 3BLRA 2UUEA 4QMQA 4I5PA 3AXWA 2VTLA 3A7FA 4BICA 4FKWA 5IQDA 2CGUA 5AIKA 5M44A 4O7LA 2PVHA 5CT7A 2B55A 5AP4A 1PXIA 4YLJA 3T9TA 1RE8A 5EQPA 2BCJA 2ZV8A 4E5AX 2QVSE 2IZSA 3NWWA 4RJ7A 3PG1A 2VN9A 3E87A 3F82A 3BRBA 3GU6A 2R2PA 5D9HA 3DK7A 1KUTA 4HW7A 2QU5A 2JITA 3R9RA 3FLSA 2PMLX 4EQCA 4CTCA 4E8AA 2UZOA 3NAXA 4OTFA 2FSLX 2WNTA 1H4LA 3ZBXA 3FHRA 3ZRKA 5A4CA 4YJPA 2R3NA 3O50A 3JUHA 4EYMA 4ANBA 1PRYA 3UOKA 2GFSA 1V1KA 4FICA 1OL2A 1PXKA 4AZEA 3NW7A 3JR1A 2F49A 3V3VA 3E7OA 4YJRA 4JBVA 4A9TA 4ZSJA 5AM6A 2GQRA 4C34A 5HG5A 4RWLA 2C6EA 2WKMA 3WI6A 4EHEA 4AE9A 1W98A 1I44A 3L1SA 4LYNA 4H36A 5EI2A 1OPJA 2AC3A 4EKLA 3LCKA 3GU4A 5AWMA 3W16A 5GINE 2W7XA 2VX1A 4QYHA 4ZOGA 4TWOA 3L9PA 4YBKA 4U80A 3LFAA 3RAHA 3UDBA 5CF4A 3AC1A 5HVYA 2IVTA 1U46A 1W8CA 2BILB 5DMZA 1ZOGA 4UMRA 5JGBA 4KB8A 5DA3A 5EW3A 4LRMA 1XH8A 5IZFA 5AP1A 4LGHA 2XKEA 4TL0A 4ZY5A 4USEA 2G2HA 3OZ6A 4AOIA 3S4QA 4C0TA 1XH9A 4C3PA 5J79A 1FGKA 3VBWA 4P7EA 2YIQA 1LEZA 3CD3A 2W5HA 2ITXA 4MNFA 3W32A 4E4XA 4FIFA 4JBOA 2BALA 4FSMA 4KINA 2PVKA 3BU5A 3QX4A 2ERZE 3NYVA 4QMXA 3U8WA 5TOZA 4PTGA 4L00A 3DKGA 2W4KA 2NRYA 3R0TA 4TZRA 5DR6A 4JIAA 5CAPA 4CLIA 4A9YA 3QGWA 1BYGA 4Y95A 3BCEA 5HTCA 4J98A 5TR6A 2HK5A 4TN6A 5F94A 2Y4IB 3M11A 3LCOA 4BY9E 5BYLA 2X1NA 3LFQA 3E8NA 4R3PA 4HCUA 3WIGA 4U79A 3PXFA 1H24A 5IQEA 4AX8A 1K9AA 3BYOA 4LGDA 2X0GA 2QU6A 3CGFA 1DM2A 1ZZ2A 3SXRA 4FIEA 4O7NA 3MW1A 2XKDA 3PZEA 3AOXA 1UWJA 3OT8A 3PP0A 2CMWA 4NJDA 2IJMA 5DEWA 3R73A 5FP5A 4CT1A 2EB3A 1H0VA 4E6AA 3UP7A 3VUKA 3HUBA 2XCKA 3F2NA 2YZAA 4R7BA 3O23A 3F3TA 3KY2A 4K0YA 1JOWB 1OI9A 5B7VA 2W9FB 1URWA 3JVSA 5DH3A 5A9UA 3ORMA 4NM7A 4YHFA 1PXMA 3KN6A 4JX3A 2WTJA 4FR4A 5EI6A 3HEGA 2GCDA 2WXVA 3KMMA 3R6XA 3Q53A 2CKEA 3Q4CA 4FKIA 3A99A 4MD7E 3UYTA 3GU8A 1H1SA 3VN9A 5GZ8A 1T45A 1WBWA 4FTJA 1GOLA 5AX9A 1CTPE 4RA4A 5EH0A 3LFEA 4PDOA 4RVLA 2XK3A 3WE8A 4GH2A 5IEXA 4FEUA 5KX8A 4AOJA 3I79A 4R77A 3FSKA 2CGVA 4CEGA 5AUZA 3DQWA 1Z9XA 3PPKA 2WB8A 2B7AA 2VWYA 4GCJA 4HVDA 3F61A 4Z7HA 2YM5A 4XOZA 4BKJA 4C59A 3BQRA 3THBA 5JN2A 2JFLA 1NA7A 2W5AA 3KF4A 2UZDA 3OW4A 1M52A 2KULA 2OSCA 2PL0A 1JNKA 2PVMA 4PPBA 4O2ZA 4Y85A 3IK3A 4CRLA 2JIUA 4BR3A 4WKQA 4ALUA 3C7QA 4V04A 3TEIA 1Y6BA 1PHKA 4L52A 4YC6A 4H1MA 3QTXA 5FWKK 4WRSA 4MWIA 5J5TA 1OBGA 1OPLA 4OT5A 3W2QA 3B2WA 1PXLA 5CEMA 3DB8A 4E6DA 5HG8A 5D10A 3HMIA 2PE2A 5AA8A 4TYIA 5I9XA 3LMHA 4WBBB 5AR3A 2BFXA 3MVLA 5HLWA 3NIEA 4CSVA 4I0SA 2V7AA 4I41A 5C01A 3OFMA 5JSMA 4QPAA 3TKUA 3LJ0A 3HGKA 5IH6A 3MGYA 4V0GB 3G2FA 4AACA 5M06A 1GY3A 5AUXA 3QCQA 4E26A 4AT5A 2BIKB 3ZYAA 1F3MC 2ETMA 3GC9A 3VS2A 3CQEA 2H96A 5B2MA 3MTLA 3FV8A 2BDFA 4J52A 3MY5A 3QTQA 3C4FA 1Q3DA 1YW2A 4HVSA 1O6YA 2VZ6A 3S95A 1PKDA 4BDCA 2HXLA 3NDMA 4Y72A 3SXSA 2VNWA 2YABA 2ETKA 4MTAA 4S30A 4U43A 2JKMA 2BTRA 2PTKA 2PVNA 3BWFA 4KD1A 2XUUA 2ITYA 3IOKA 4G17A 5J95A 3V5LA 4CMOA 3LXPA 3R1QA 2BUJA 4P4CA 5G6VA 3TJCA 2VTSA 3OP5A 2PVJA 2OJJA 3EN6A 3NIZA 2V7OA 5AR7A 5AR8A 3VUIA 3VHKA 3ZO3A 3VVHA 2W99B 4H3BA 4AS0A 4G6LA 3UOHA 3UGCA 3NR9A 5HBEA 5BYYA 3N4TA 2WEVA 3ORXA 2I0HA 3DBCA 4AN9A 2E2BA 2BKZA 3EH9A 4GK2A 4O86A 4I92A 4L7FA 4R8QA 2X39A 2OJIA 4UXQA 5EOLA 4YZDA 4QP3A 3RKBA 3LLAA 2PYWA 5GHVA 4C62A 4IH8A 4TXCA 5HEZA 3MB6A 1IA9A 4GT4A 5ANJA 2W05A 4GVAA 3BKBA 4H39A 3G15A 4KRCA 5CWZA 3ZCLA 2VNYA 4U42A 2R0UA 3V6RA 3VULA 5EYMA 4C4EA 4J1RA 4D1ZA 2GQSA 3KXHA 4FTUA 5AM7A 3R8PA 1BMKA 4F99A 2WMAA 1M7QA 4MXZA 1NT2A 3F5PA 4U45A 4O7TA 1YDTE 3ZZWA 3V5PA 2KTYA 4F0GA 4YO4A 2JIVA 5M56A 2PVYA 3ZRMA 4DITA 4ZZMA 5KHWA 3QTIA 1ERKA 1FGIA 2OJGA 3Q4UA 4TYGA 5EW8A 3VBTA 4JBPA 4YNEA 4EHGA 2OF4A 4ZTMA 5L6OA 2XKFA 3QWJA 4BHNA 2EUFB 4ACCA 3LLTA 2O8YA 2XCHA 5F4NA 4ITJA 1OZ1A 3LFNA 4GL9A 3CR0A 4P5ZA 3TG1A 4TPTA 2CJMA 2YJRA 2WTVA 4OTHA 5T68A 3R30A 1TQIA 3KRJA 5H9BA 4I0TA 1ZMWA 4O84A 3V5JA 1DS5A 2ITQA 4F70A 4RG0A 3PIZA 4BB4A 4BL1A 2F9GA 3Q32A 2OGVA 4UMUA 1OVEA 5CF8A 2NNWB 4NCTC 5CVGA 2ITVA 2UZUE 3P7CA 3PIXA 3EL7A 4GFGA 3VF9A 5A4LA 5M51A 3A60A 4ALVA 4C33A 4ZSGA 4EOKA 4EOJA 5CTPA 2J5FA 5HX8A 4PL3A 4DINA 3WF6A 3TIZA 4X3FB 4NW6A 2QOKA 5GIPE 4FK6A 5KKRC 1FVRA 3FZTA 3TXOA 2QKRA 4TYHB 4I6HA 4FSYA 2I0EA 3OD6X 5DPVA 4KKHA 4M13A 1R1WA 4RBLA 3ID6C 5JGDA 3ZOSA 4DBNA 2UW3A 1GZKA 3UIMA 2C5XA 2PMIA 3UODA 3CPCA 4O91A 4RA5A 3UOJA 2VTPA 3G90X 3E8DA 3ZUUA 3KCFA 4QP9A 3QKMA 1XH6A 3DFCB 3W2PA 5ETAA 4F1OA 4YNOA 4C3FA 5EQEA 3E62A 1KOAA 4DA5A 3T8OA 3KA0A 2DQ7X 3ERKA 5LWNA 3HLLA 3V5QA 1E1XA 4HZSA 4FKOA 4C2WA 3NYNA 5BUEA 2V0DA 2X8IA 1UNHA 4QP4A 3TDWA 4UXLA 3WARA 4NUSA 3MVHA 4ANOA 4Q9ZA 5HQ0A 3ORLA 4R7IA 2XF0A 2HWPA 1FQ1B 1Y57A 5ACKA 3HMPA 4F09A 4QYEA 4FIGA 4J99A 5FG8A 2AUHA 5CSPA 3H0ZA 4KBCA 5BMMA 3GVUA 5DVRA 2ESMA 3CTHA 4HNIA 3VUHA 4D4RA 2RFNA 2CNUA 2Y4PA 3QUEA 3SG9A 2JDSA 1ZAOA 2C30A 3I60A 3D7TA 4CMUA 5HGIA 2BTSA 4YPSA 4QPSA 3L9LA 3G6GA 5AUYA 4R3CA 4F1MA 2C6DA 4G3FA 2HY0A 3LE6A 4Y5HA 1SVHA 5KUPA 3VS1A 1QL6A 3ZDIA 4RPVA 3ACJA 4D2TA 2AC5A 4PV0A 4K77A 2X2KA 4CG8A 3FQSA 3VS7A 4D9TA 3VIDA 3TV7A 1APME 1K2PA 4IVBA 3QTZA 4BCFA 4HZRA 5KNJA 4PPAA 4GKIA 2R4BA 3P08A 1OITA 4RIYA 4L68A 3N9XA 4L42A 5HIBA 3TNHA 3BHUA 3Q5IA 4YSJA 2RGPA 5M08A 3CSVA 2G2IA 4RFYA 4DLJA 4CQGA 2XIKA 4K9YA 5IH4A 3FEGA 4QMWA 3R9HA 4KSQA 3VBYA 4H3PA 3VS0A 1VZOA 2JGZA 2WMVA 2XNPA 5DYJA 4D4YA 4WG4A 2G2FA 4G5JA 3HNGA 4FUYA 3HRBA 2UW7A 1OL1A 5AV4A 1J1CA 1IG1A 5AUVA 4N0SA 1KE8A 5EYCA 4UMPA 3DLZA 3W2CA 5K3YA 3HAVA 1YXXA 4OBPA 2IZUA 4XOYA 1NVRA 3MIAA 3FY0A 4RSSA 3D0EA 4RGJA 3K3JA 3PWYA 4W4VA 2HW6A 5D7VA 4D0WA 4ENXA 2OJFE 2BHEA 3S0OA 5J87A 4IB3A 2JBPA 1GIJA 3QTSA 2XIRA 2GTMA 3LZBA 5FBNC 5L2SA 4OTPA 5DI1A 2C5OA 3G51A 4GV1A 2HZNA 2UZTA 3LCTA 3MFRA 4LMUA 4R3RA 5H8GA 2FH9A 3W33A 4F9BA 3QL8A 3COHA 3AC4A 1PMVA 1MRUA 4UALA 3Q9ZA 4FV1A 4NTTA 1A06A 1OUKA 3DGKA 4AQCA 5IQBA 2ZM4A 3AG9A 4X6QC 4KIPA 4EL9A 2C5NA 3W2OA 3HA6A 4LG4A 3TUCA 1V0PA 3G33A 4M7IA 4C4HA 2RL5A 4EK3A 4OBOA 4N57A 3ITZA 4C35A 5DR2A 4PP7A 2PZPA 4F7NA 3UNJA 1P5EA 3QD3A 4NIFB 1ZY4A 4O38A 1WAKA 4WNMA 4BZDA 5BVNA 3NVMB 3OW3A 2OI4X 3M42A 5L4QA 4EEVA 3DKCA 3VO3A 1FBNA 2BRMA 3P9JA 4U44A 5CQUA 4O7WA 4KIKA 2VWWA 3Q5ZA 4ID7A 5M57A 1W83A 2GS6A 1JSUA 2OIBA 3A62A 2GHMA 3U6IA 2QOHA 3BZ3A 3OTUA 4UBAA 4XNEA 5ANEA 3HVCA 3GFEA 3R28A 1K3AA 4PDSA 1CDKA 2R3JA 5CU3A 5E8WA 4PDPA 3UVRA 3DDPA 1YXVA 2IG7A 3MFTA 4IB0A 4MNEB 4CT2A 5GJDA 2PUPA 5JMSA 2CN5A 4JJRA 4XUFA 4APCA 2PVFA 3I81A 2XH5A 3ZFMA 3ZU7A 3FI8A 3MN3A 2XBJA 3RPYA 4UEUA 2WD1A 3QCXA 1E9HA 3LXLA 5AR4A 4TYEA 5HO6A 2X9EA 3FQEA 3OXTA 3QRKA 1PF8A 2GHLA 3AD6A 2VTJA 1HOWA 3MJ1A 4K1BA 2GTNA 3OOGA 5BPYA 2WTKB 2QOIA 4L6QA 5LMBA 3BIZA 3EQCA 4DEEA 5HLNA 5ETCA 1H1QA 3KB7A 3WZJA 2QOOA 3GXLA 3VNTA 4L8MA 2WELA 3UMWA 3MV5A 3UNZA 4U41A 4EK5A 5EKOA 5T3QA 2OLCA 4ZJIA 4MBIA 4CFUA 3VUDA 4DGNA 4RX9A 3PA4A 4YTCA 3R7IA 4IB1A 2O3PA 4I22A 1DI8A 1YHWA 2PMNX 3QXOA 2VU3A 4OTGA 3EN4A 4QMPA 3GQIA 4QNYA 2HAKA 4IZ5A 5E7RA 4EH5A 4MD8E 4DT8A 2C3KA 2C47A 2W17A 2VGOA 4NZWB 4G6OA 4M0ZA 4XV2A 4H05A 3LW0A 2Q0NA 1X8BA 5KZIA 4UYNA 5DGZA 3GCQA 3FZ1A 2Y6OA 4UY9A 4D0XA 3TI1A 3FZSA 1XBBA 2J50A 1H1PA 3RCDA 4U0IA 3W1FA 4ANSA 3NVKI 2OW3A 4I4EA 2QR8A 4JR3A 2X2LA 4FV9A 1RQQA 3OBGA 3BX5A 2PE1A 4KWPA 2JAVA 3PYYA 1BKXA 2PVLA 3DU8A 3FZPA 4L7SA 3RPOA 2PWLA 5L8KA 4FV5A 4GK4A 2FSMX 3CD8A 3NNWA 4I6QA 4AGCA 4FF8A 4E20A 5M4CA 5K5XA 5ITAA 2CKOA 3UBDA 3P4KA 3CKWA 4EBWA 4EK6A 3F7ZA 4Z9LA 4ITIA 5E92A 2R3RA 3ULZA 1WBVA 2OXXA 2XZSA 3LFFA 1O9UA 1WCCA 1OPKA 3E63A 1O6KA 2WIHA 4J97A 4HVIA 4M8TA 3TJDA 4IC7A 3ZZEA 3VUMA 2DWBA 5AR5A 1M2PA 4DGOA 2O64A 4FEWA 5I9YA 3IONA 4FSNA 4RX8A 5L2WA 3EFLA 3FPMA 3GI3A 2FB8A 4MH7A 5FXQA 4ORKA 1REKA 1M7NA 1Q3WA 1KE9A 4BWXA 4CNHA 2X8DA 2V62A 1I09A 5L6WL 4YMJA 4DFZE 2A0CX 3CTJA 4DFBA 3UQFA 3VS6A 3KRXA 4ACMA 2C5YA 4FV2A 1BUHA 5B0XA 4JIKA 1JQHA 2YM3A 4YJOA 4O83A 4HYUA 4FKSA 1JLUE 3LHJA 5LVLA 2WMUA 3T3UA 1CKPA 3FYKX 3U4WA 4JVGA 3EFWA 1OKVA 4FL3A 4AGUA 4ALWA 5E8XA 4DLIA 3LOKA 4K6ZA 4LUEA 5C27A 5LVOA 3A4OX 3DAEA 4F65A 4G16A 4QMZA 5HNGA 4BCOA 3VBVA 5LVPA 1OBDA 1J1BA 3NUUA 4HPUE 3IW5A 3Q4ZA 5AP0A 2Y0AA 5E9EA 3A8XA 1Q99A 3W55A 2J0IA 4FKTA 4D4VA 4MK0A 4UYAA 2C6OA 1ND4A 2WPAA 4QMMA 3ZXTA 2H9VA 1YOMA 2O2UA 5F1ZA 5CT0A 2B53A 2W1CA 3FKNA 4HYSA 2WMTA 3WF9A 1OL7A 2C4GA 5DRBA 3WIKA 4A7CA 3IDBA 2QONA 3GT8A 4EH3A 3QKKA 2QQ7A 3QD0A 2VTTA 4LGGA 3F7WA 4RWKA 4OTRA 1IR3A 3WYYA 5A46A 2OO8X 4YHTA 5IQHA 5F95A 3ZDUA 3IPHA 1YHVA 3O8PA 1BI7A 4EZ5A 4ZTQA 4F6SA 4ZLZA 4GU9A 3U6JA 2YCSA 1H1WA 5H8EA 4QTEA 5LCKA 2W1EA 1SMHA 4PY1A 3F66A 4FKJA 3KC3A 5KMMA 3HMMA 5EOBA 3DQXA 3U55A 1F5QA 4LOQA 3V6SA 4HGEA 5CAVA 3GNIB 3DLSA 3D15A 3HYHA 3O96A 3PUPA 4MXCA 3PDTA 3EJ1A 1Q24A 3EQPA 4BDAA 4F9WA 2Y7JA 3DFAA 3EWHA 4AGWA 4YO6A 3PLSA 2QOFA 3M2WA 1CM8A 3TTIA 4JR7A 4ZTRA 1Q8TA 4JT3A 4NEUA 2CGWA 5AIRA 2P2IA 1S9JA 3DXQA 1IA8A 1QPJA 3T9IA 3GP0A 5CASA 4GIHA 3RM7A 3D5UA 3OVVA 1KV2A 1PXNA 4QMYA 3P79A 1XHAA 4IWOA 1NVSA 4AA5A 4GYIA 1OL6A 1UU9A 1XH5A 3E8EA 3QD2B 3ZTXA 2ZDTA 3DNDA 3HDMA 4N6ZA 1CMKE 2VO3A 4AA4A 3HV4A 1PMNA 2VWBA 3OHTA 2REIA 2YERA 3FZRA 4BN1A 4O81A 4X2KA 5IU2A 5HESA 2CLQA 4KNBA 2YIYA 5AFVA 4OTQA 5AJQA 4ZMFA 2EU9A 2OJ9A 5KBRA 4IFGA 5DWRA 2QOBA 1GZOA 3NGAA 4UN0C 3H0YA 4HCTA 3FLNC 4FT7A 1Y91A 5E8SA 3UQGA 3A7GA 2P2HA 4FZFB 5L2IA 2ITOA 4QMOA 4CZTA 4GSBA 4ZEGA 1H00A 4YJTA 4F7SA 2JKOA 2G15A 3OT3A 3K2LA 2HENA 4W4YA 4L3JA 5EKNA 5BVKA 2HIWA 4AZVA 3LFBA 2J4ZA 3NEWA 3PVWA 4G9RA 1BLXA 5HG7A 2QNJA 5HO7A 4USFA 5J1WA 3MWUA 4P5QA 4RVMA 3NAYA 5AEPA 4PMTA 5JT2A 1ZMUA 3E93A 2O0UA 3HP5A 4KKEA 3OUNB 4L67A 5FUTA 4EWHA 5I9WA 3F3WA 3TCPA 2Z2WA 3DA6A 4DFYA 4XCUA 4TT7A 4FSWA 1U54B 4E3CA 1SM2A 3EL8A 4Z55A 2BKKA 3C0GA 3SRVB 5IDPA 2VAGA 2BDWA 4E1ZA 4AOTA 5E90A 4O0UA
chains in the Genus database with same CATH superfamily
3EN5A 3F5XA 4JL9A 4FVQA 4TWNA 3UQCA 2G01A 2VTQA 3ZEWA 2XJ0A 3PY0A 4EWQA 3FMKA 4D2SA 3MS9A 4ZXTA 1OKWA 4MF1A 4BIDA 4OAUC 4KABA 5L3AA 4ZLYA 2W1HA 1FPUA 2GS2A 4QD6A 4ANNA 4ERWA 4ANQA 5BNJA 1U5QA 3ZLYA 3C51A 4FSRA 4XRLA 2F7XE 4M97A 3UJGA 4I5MA 4W8DA 2UW9A 3D4QA 2B4SB 1G8AA 1ZOHA 5CEQA 4OAVB 1SVEA 2JDTA 2W0JA 3BBWA 3RM6A 3ACKA 2W96B 2QOQA 2VTHA 5A4EA 3MFSA 2GNLA 5E8UA 2IW9A 3KL8A 3GGFA 3GCUA 4AGDA 3CC6A 1R39A 4DYMA 3U4UA 4QRCA 4I6BA 4U8ZA 3DXPA 3FMDA 3OROA 3UZTA 5CYIA 4JG7A 3ZFXA 4I20A 2UW4A 2YFXA 3LJ1A 3ANQA 5EQYA 5GJFA 5GNKA 4BDGA 3BGQA 3A7HA 4EJ7A 4RJ8A 5GIOE 4JDJA 4NWMA 1TKIA 4QYYA 5F9EA 5H2UA 3D2IA 2CKPA 3PTGA 3TDVA 2I40A 4HCVA 2B1PA 2ITUA 3DPKA 3OTVA 4O0WA 5HHWA 3Q96A 3NYOA 1YI3A 3VS3A 3UE4A 4CFFA 2HXQA 3DT1A 2WOTA 1J91A 3POZA 4H1JA 3DKFA 5L2QA 1EH4A 3ALNA 5FP6A 4IB5A 3UTOA 1PMEA 4F78A 3DBEA 5BMSA 3QQKA 3RTPA 1XH4A 4GVJA 4EOQA 3NFFB 2OF2A 3I7BA 2YCQA 3W10A 5CALA 5FEEA 3W0OA 3KVXA 2XM8A 4QO9A 3KREA 1HCLA 2W1DA 5CI6A 2XNOA 4FG9A 3VBXA 3QYZA 5LARA 3R1YA 4ZTNA 3JPVA 5CAUA 4XH6A 1PXOA 5ANIA 4ZY4A 5A3XA 4O0VA 4IZAA 5EM8A 4FNZA 5HBHA 4RJ5A 1LEWA 2VO0A 3SW4A 4W4XA 1OIYA 3C4WA 5TE0A 4BDIA 4BGGA 5ANKA 4DN5A 4JXFA 3V8SA 2QG7A 3U51A 5C8NA 1IEPA 4LMNA 4DG3E 1LPUA 4JX7A 3WZEA 4FYOA 3ZMMA 4BDHA 1U5RA 5CSXA 2VTAA 3UP2A 3ZO1A 2W1FA 2ITWA 4AW0A 5KHXA 3D83A 2C5VA 2GSFA 2C1AA 3CPBA 4IX4A 3E5AA 2IEWA 2XJ2A 4P90A 1OL5A 3PFQA 4I93A 2EXMA 2YA9A 5CF6A 4IWDA 5CU0A 5FD2A 3OWLA 3IKAA 3EQHA 3RAIA 2C0IA 4ANMA 1J3HA 5ETIA 2FGIA 3SC1A 4FV4A 3GC7A 2FA2A 4M66A 3TTJA 4CMTA 4YR8A 3BEGA 1PYXA 5IQFA 3LXKA 4IM3A 4B99A 3NZ0A 4ZSEA 4EONA 4F0IA 1GZNA 4O7SA 3H9RA 2B0QA 4X3FA 2GNJA 4FNYA 3IQ7A 3R7UA 3WZUA 2WZJA 3DS6A 3E7VA 5CANA 1YKRA 3R02A 3TT0A 3N4UA 2NO3A 3BHTA 4TYHA 3I6WA 4XP2A 2Z60A 1Q61A 3SKCA 5BQ0A 4RJ6A 3T3VA 1KE5A 3FKOA 4JDIA 4EJNA 3ZXZA 2RFDA 2VTOA 2XVDA 4AFJA 5IUGA 2R5TA 1RW8A 2R3MA 4RIWA 2WMQA 4EOOA 3UDTA 4BZNA 2ONLA 3PJ3A 4AU8A 3FJQE 4JDHA 4BKZA 4EH2A 1XBCA 2FSOX 3F5GA 3QQFA 4FTOA 3RGFA 5JEBA 3RI1A 2XAOA 3AC5A 2VWZA 4ACGA 3RK5A 4G9CA 2OU7A 3PWDA 4IX3A 1YXSA 5I3RA 3PSCA 4MF0A 4WT6A 4WRGA 3AMYA 3HRCA 5ACBC 5M4IA 3N4VA 5CVHA 5E8VA 3RWPA 4KS7A 5DT0A 1TZDA 3R9NA 5JKGA 5E8YA 2VUWA 3HMNA 4ASDA 2WFYA 1P4OA 3UC3A 4I6FA 4LQMA 3IW7A 4WNKA 3QC4A 5TO8A 4GK3A 4XX9A 4FL1A 2W1GA 4XG8A 4DDIA 4XS2A 2FVDA 4ARKA 4RVTA 3ORZA 1BI8A 3R8VA 2UV2A 1VYWA 3EFKA 3RNYA 3ROYA 3B8QA 3TV4A 3HMOA 3KMWA 4ERKA 2I1MA 3GCSA 4NJ3A 4M69B 5E8ZA 5AV1A 1UU7A 2IF8A 1DAWA 3PJ2A 3SVVA 4O7RA 2EB2A 2Z7SA 3MA3A 4A4XA 3BELA 2C3LA 4AT4A 3PPJA 5DRDA 1WVXA 3HV7A 2YDJA 3KU2A 3FZOA 3LXNA 4DT9A 1REJA 2X9FA 2V5QA 4ONAA 5IG1A 3DJ5A 3O5AA 2YHVA 3FXZA 5JQ8A 3VRZA 2JDRA 4DTAA 3E3PA 4OW8A 4IFCA 3C1XA 5CAOA 2E9NA 5DR9A 4A4OA 3A7JA 4XEYA 4L46A 2OFUA 2VGPA 2VO7A 4U5JA 2WMWA 2WTIA 1B39A 1YWRA 5HX6A 4WUNA 4JG8A 4ZY6A 2HW7A 5LXMA 1UA2A 3CIKA 4G5PA 3ZM9A 3PVBA 2IZTA 4B0GA 4CG9A 3DBDA 3H9OA 3KULA 4J53A 3C4CA 3DK6A 4E6CA 4F9YA 3QQJA 1PMUA 3N51A 4FSQA 5CXHA 4B9DA 3P7AA 2OZAA 3QGYA 2CPKE 3CS9A 1OIQA 4XMOA 4GRBA 3SA0A 3COMA 3JY9A 2UW0A 5CSVA 1YWNA 1ZARA 3B2TA 2LAVA 4EK8A 4APPA 2ZJWA 4FTKA 4RIXA 3EMGA 4BVUA 2PPQA 1XBAA 3Q2MA 4BKYA 4BYJA 4CCBA 1KV1A 3Q2JA 4QQTA 4DTBA 4FTIA 5DIAA 3VQHA 4AZWA 4AXDA 5B2KA 2QHMA 3O7LD 4GJ2A 3TNIA 2FYSA 4QOXA 3VRYA 4W8EA 3ULIA 4DFXE 4C7TA 2IPXA 2P4IA 1DI9A 4EH4A 4EOSA 2VO6A 2XYUA 2XRUA 3FXWA 4BWPA 3QTWA 3SOCA 4QMTA 4QMUA 4PQNA 2XEZA 2A27A 2IZRA 4J8NA 4JS8A 4Q5HA 4RRVA 4MQ1A 4UWBA 4EYJA 5A4QA 5IF1A 2JDVA 3CE3A 5DHJA 3KK9A 5LJJA 3KGAA 2P33A 4G3DA 1OM1A 2C3IB 4HOKA 4DG2E 3CJGA 1Y6AA 2GU8A 3PA5A 3ZC6A 5EHLA 5L2TA 2OH4A 2RG6A 3MYGA 2C6LA 3O51A 4BCJA 4FSZA 3Q6UA 2BRNA 3NPCA 1H1RA 4TKSA 4XG9A 5LMAA 3EQFA 4NIFA 1Q97A 3WILA 1XMMA 4PL4A 5CNOA 3U9NA 1M2RA 2UZLA 4IVAA 2YAAA 4FKVA 3OXZA 4UZHA 3VW6A 2XEYA 4Y46A 2O63A 3KEXA 3W8LA 1M14A 3D94A 5JGAA 5IMXA 3HDNA 3FWQA 4QQJA 5LOHA 4PDYA 2R3FA 2GHGA 3MESA 2GS7A 3E3BX 4BDJA 4MUQA 4A9RA 1OIRA 5ICPA 3CEKA 4I94A 2AYPA 3NSZA 4GIIA 5JFSA 2CN8A 4BWKA 2DS1A 4G3GA 2QG5A 3V51A 3NNXA 3A2CA 3C13A 4JLCA 1R3CA 4NM0A 3NW5A 3WOWA 1OKZA 4EUTA 3FMJA 4YTHA 4J96A 3TIYA 3TM0A 4DC2A 5I5ZA 5AUTA 2ZMCA 3NUPA 4YHJA 3IW8A 3MH1A 4M12A 3RJCA 3V01A 1J7UA 2XIXA 4DHFA 4DEIA 3BU3A 4IX6A 3PZHA 4NT4A 4RQVA 5HNIX 1NW1A 2UW6A 2YACA 4BCQA 2ZV9A 4L9IA 2WMBA 4UZDA 4BZOA 4HYIA 3CQWA 3VF8A 4FOCA 4AW5A 4PWNA 3F2RA 3OS3A 3KXMA 4HVGA 2F4JA 5D12A 3MH2A 3W8QA 5ETFA 4EUUA 3R1NA 4OBQA 1UV5A 4RFMA 1QPEA 4JQ8A 2VTMA 2YLFA 3P0MA 4XBUA 5BVWA 4PMSA 3JVRA 3PE2A 2BPMA 4GG7A 1PKGA 3QQLA 3DTWA 4YUQA 4ZSAA 4CLJA 3BYVA 4YLLA 1JKKA 3OCTA 4R6VA 3Q4TA 3PA3A 4ZIMA 4FKLA 4CKIA 3FLZA 5EHYA 1UNGA 2RFEA 4FKGA 5IH5A 1YWVA 1NVQA 5EG3A 1MQ4A 3IO7A 3EKNA 3TACA 2QURA 2ZM1A 3LAUA 2P3GX 4FKRA 4IDVA 1QPCA 2BZJA 3ZSIA 4OUCA 3TL8A 4W4WA 4X2FA 4LFIA 2C68A 4WNOA 2BRBA 2I0YA 2OXDA 5AP6A 3H3CA 4QTDA 4DF3A 2VX3A 3HKOA 2OK1A 4IMYA 3G5DA 5J1VA 3OEFX 3ZH8A 3FAAA 5JZNA 3ZHPC 4AUAA 4O1PA 2WU6A 2X4FA 5DE2A 5JRSA 1JKLA 3R8MA 1WBNA 1OGYA 3NS9A 2BZHB 3QAME 4WOVA 3VWAA 4EZ7A 3FYJX 4IAZA 1OUYA 5CZIA 4HJOA 5CS6A 3ZONA 1LUFA 2C6TA 4PMMA 3R7YA 4CV9A 2PY3A 1H08A 3L8PA 1BL6A 4JAJA 4ZJVA 3QUPA 5HZNA 4O7YA 5BX0A 4ASZA 1JAMA 4K11A 5CEPA 3AD4A 2BHHA 4FSTA 3BI6A 1H25A 1ZYSA 2UZBA 2XIZA 4FOBA 1H07A 2CHLA 4S34A 2VWIA 2GDOA 2XS0A 4I23A 4BJJA 3IW6A 2A98A 3KXNA 4X2JA 4BTMA 2QC6A 3HP2A 4QMNA 3BEAA 3ALOA 3R22A 4FTTA 3M1SA 3VS5A 3FMEA 4BC6A 4DH1A 2UZVA 4UX9A 4IJPA 4MHAA 4NSTA 4C4JA 1SZMA 4MXOA 5AP7A 2JKQA 3RMFA 5FTOA 1PJKA 3B8RA 4IANA 3U6HA 2C6KA 3O71A 4IAIA 2PE0A 4NK9A 3ZRLA 3FL4A 4QT1A 3R7OA 3D7TB 4EHZA 2G1TA 4Y8DA 5DEYA 5G1XA 4FV0A 2R3OA 4EOMA 1SNXA 5DN3A 3VUGA 3RP9A 4GW8A 4F4PA 5KO1A 2JBOA 3TNWA 3JXWA 5BYZA 4LL5A 4Z16A 5BVEA 3TV6A 4ACHA 4FEVA 2ITZA 4I5CA 3AGLA 3RPSA 5HORA 2PK9A 4IACA 2J7TA 4YGAA 3BV2A 2ZB1A 1UVRA 3NRMA 5M53A 4WG3A 5IPJA 3PSBA 3R83A 2BZKB 4W9XA 2YLEA 4BCMA 1H0WA 2WOUA 3EHAA 3KCKA 3I5ZA 1Q4LA 3MJ2A 4QTCA 4EH9A 2C6IA 4EOLA 5EDRA 2R3LA 4KKGA 5HCZA 4XLVA 4HVHA 4IAFA 4YJNA 3II5A 3GQLA 4BI0A 4EKKA 3F6XA 4IADA 1XKKA 3G0FA 5JFXA 3R1SA 3RINA 5EFQA 3L9MA 5CENA 4EH7A 4I4FA 2BFYA 4F6UA 5HTIA 4OTWA 2Y6MA 5FRIA 4FNWA 1G3NA 3POOA 4O96A 3KXZA 4OTIA 4YJUA 4IEBA 3BE2A 5DBXA 5K4IA 3BHHA 2UW5A 3MVJA 5AUWA 1YDSE 4FV8A 5CEKA 2A19B 3DAKA 3LM5A 4ITHA 4YZCA 2Y4IC 2ZMDA 2BZIB 3HAMA 4FBXA 3H30A 3QCYA 2XNMA 3FBVA 4FSUA 2W5BA 2YJSA 3FI2A 3LKMA 3DB6A 2VX0A 5EDQA 5KMJA 1SVGA 5HIEA 2BRGA 5IQCA 3I4BA 1G8SA 3S1HA 3TWJA 4R1YA 4BCNA 2AEGA 3AT2A 2NPQA 1KE7A 3DZOA 5J5SA 4TTHB 2J0LA 4FT0A 3BGZA 4UWCA 3LM0A 5EI8A 4BGQA 5HICA 3D2KA 3EQGA 3FLYA 2QLUA 4OTDA 5AV2A 5C8MA 3V5TA 3ODYX 3LCDA 1IAHA 3AMBA 1Q62A 3FUPA 4RVKA 3VAPA 4PPCA 3LQ3A 4J71A 5IQIA 4RT7A 3COIA 3P23A 3WE4A 5IA0A 2ETRA 2Z7RA 3QCSA 5I0BA 3F69A 4NKSA 4EH8A 5KKRB 3GC0A 5TF9A 3UVQA 4EORA 1Q8WA 3D14A 4QMSA 4C2VA 2HYYA 2X2MA 4DEAA 3W0MA 2BRHA 2WO6A 3QX2A 2B52A 2DYLA 1U4DA 2PZIA 4KIKB 4NW5A 4RC4A 4X3JA 4BBMA 1W84A 3E92A 4QTAA 4AT3A 1MRVA 3RAWA 4EI4A 3OCSA 4U7ZA 4CFWA 2J0MB 4CKJA 1Z57A 3FMHA 5IEVA 4FT9A 4DGGA 2VWVA 2YWVA 1F0QA 4R7HA 3FQHA 2OIQA 4MVFA 5DT3A 4CYJA 4DEGA 3Q04A 2CDZA 5IKWA 3UVPA 4E4MA 5A6NA 4V05A 3DJ6A 1G8KA 2E9OA 2HWOA 3I1AA 1OIUA 3IG7A 2YITA 2NRUA 3MH0A 4FTLA 4X7QA 4KSPA 4DFLA 4AQKA 4I24A 4LOPA 1GIHA 4DGMA 3OWKA 4YZBA 4D2WA 3UO6A 1H27A 2QO7A 4EK4A 3P5JC 4XG3A 3KVWA 4D2RA 4D55A 3UZPA 5IUIA 5M09A 5C26A 1YI4A 4DEBA 3EN9A 3H10A 1YOJA 3LQ5A 3P7BA 1YHSA 4IWQA 2Z7QA 2YCFA 3FI3A 4FK3A 4K2RA 5K9IA 2X0PA 4C4GA 4CCUA 2BAQA 5FM3A 2YIXA 5T6KA 4A07A 4V01A 4BDEA 2OZOA 5JH6A 4FIHA 4C38A 4E5WA 4YZMA 2GFCA 1URCA 4Y73A 4AW1A 4FX3A 2QKWB 4FIJA 4XBRA 3SD0A 3PXYA 1TVOA 4S31A 5GZ9A 3CGOA 3NCZA 2WU7A 2ZVAA 4B8MA 4BCPA 4MBJA 4FZ7A 4P2KA 2ZV2A 4I5HA 3C4XA 5DT4A 1XWSA 4B7TA 2GNGA 4MX9A 2C69A 4LI5A 4G31A 3SRVA 3MA6A 2ITNA 5H3QA 3TZMA 2IO6A 2XA4A 4O6LA 4G6NA 4KBAA 3FDNA 5D1JA 5D11A 4YLKA 2HZ0A 1KE6A 3OC1A 1XR1A 4S32A 2JD5A 3FSFA 4NH1A 2VD5A 4Q2AA 3RHXA 3P78A 4L01A 4PL5A 4YC8A 5A6OA 3MVMA 2J0JA 3TUBA 3F88A 2BROA 3FY2A 3LFCA 4LL0A 4YPDA 4EHVA 4YJVA 5DNRA 5LWMA 1A48A 3LFSA 3IOPA 4FODA 4QYGA 3FL5A 3RK7A 4BF2A 4F6WA 2GMXA 2R3IA 3IGGA 4WA9A 3CCNA 4K8AA 4D2PA 1J7IA 2HELA 1CKIA 1R0PA 3P86A 4F1TA 2OH0E 3DAJA 3QD4A 4M15A 5JZJA 1LP4A 2B9JA 2B9FA 2GNIA 3A8WA 3Q60A 3QRJA 5FM2A 4O7ZA 3UZRA 2WQBA 3DNEA 4IDTA 3W0RA 3ANRA 1YI6A 3V5WA 3EKKA 5HD4A 1HCKA 1Q5KA 2A4LA 5AX3A 5AP5A 5IUHA 4ZS0A 5IA4A 1UWHA 1XO2B 1GJOA 3D9VA 3QA0A 3AC2A 3I0OA 3AT4A 3KRRA 4RZWA 5DOSA 5K0KA 4IQ6A 1KSWA 1CKJA 2R3KA 1UNLA 3RZBA 4GUEA 3RPVA 3GC8A 3SAYA 2XP2A 3G9LX 2IVUA 3GCPA 3A7IA 2W1IA 3R63A 5LVNA 4DCAA 2XKCA 3AD5A 1SYKA 3PXZA 3NUYA 4FE2A 2WTWA 4JI9A 2J6MA 2Z7LA 5IDNA 4RJ3A 1O6LA 5M4FA 4MXAA 4S33A 1G5SA 3VW8A 4U40A 3FC2A 3NNUA 4ZTHA 3QC9A 5KMKA 3C0HA 2R7BA 4PTCA 4G3EA 3PPZA 5FBOA 3I5NA 5CAQA 3KXXA 1R78A 3U87A 1V0BA 3WZKA 4QP8A 2YIWA 3U54A 3H4JA 2UVXA 3BLHA 4FKPA 1TQMA 2XJ1A 4UWYA 4AXAA 4BBFA 3COKA 5HIDA 4LV5A 4QNAA 2ITTA 5IA5A 3UO5A 3I7CA 4CYIA 3OUKA 4OGRA 3R8UA 4GFOA 4E73A 3ORTA 3NMUF 1DAYA 3ZO4A 5A54A 2I6LA 4FV6A 4IX5A 4M84A 4AFEA 3EYHA 3NFGB 4NKAA 3R7GA 5EM6A 3RAKA 4KS8A 5HVKA 4X3FC 2ACXA 4RX5A 3BGPA 3LFDA 4CZUA 3F3ZA 4TW9A 1ZYDA 3P5KA 4LRKA 2RF9A 3IDCA 4RZVA 2XRWA 3TKIA 3O17A 3HZTA 5HD7A 2BIYA 2F2UA 2J90A 4F64A 3WBLA 5E4HA 2JDOA 4BBEA 3EQDA 3SHEA 2EXCX 3HA8A 4NYEA 4XG6A 4YZ9A 3SX9A 5BUIA 5LMKA 4O0YA 1OGUA 3I6UA 2WTCA 4JOAA 2ONLC 4MXXA 4Y5QA 2E9UA 4PUZA 4NU1A 1OB3A 3CXWA 1M17A 4ANLA 4ENYA 3AC3A 3PJ1A 3PJCA 1MQBA 3C9WA 4V0GA 4EBVA 4ZMEA 3QLFA 2PHKA 3BYMA 3DJ7A 3BBTB 1QPDA 4BDBA 4CRSA 2QODA 3I0QA 4FEXA 4O1OA 5AAEA 2BAJA 4PNKA 3PRIA 4ZJJA 2ITPA 3GU7A 4XG7A 4WHZA 3OEZA 4AZTA 1ATPE 1LR4A 2YM7A 3REPA 4F9CA 1ST4A 1XQZA 4GJ3A 2A1AB 4R5YA 4KBKA 5CU2A 4EOIA 4PX6A 5K0XA 1SNUA 4CQEA 5M07A 5AMNA 4G3CA 2WMXA 4ZAUA 3EQRA 2B9HA 4NFMA 1NXKA 5K4JA 5IQGA 2VRXA 3UPXA 4WIHA 2IN6A 2Z8CA 4XRJA 3RVGA 4L44A 3KMUA 4BI2A 2XYNA 5LCJA 1UU3A 3ORIA 1Q8UA 5FTGA 3ORKA 1H26A 3O0GA 4LUDA 2YM4A 5KZ0A 4D9UA 5KMLA 3KK8A 1PY5A 5JFVA 4RFZA 1P4FA 3MFUA 3OWPA 4XP3A 2YIRA 3Q9XA 4YURA 3GOPA 1P14A 4YU2A 4O27B 2C3JA 1WBPA 4GYGA 5KMNA 4QPMA 5EYDA 3VJOA 4IW0A 2XM9A 3AT3A 4FZAB 4D58A 4IM0A 3PVUA 3CQUA 5HCYA 2Q83A 3ZUVA 3EOCA 3LCSA 2HOGA 3A61A 2Y8OA 3UDSA 2CNQA 4E5BA 3C0IA 4CZYB 4USDA 2CLXA 4PRJA 4KUJA 3NW6A 1IRKA 4ZZNA 3NYXA 5AAGA 2PZYA 4DH5A 3CBLA 4BDDA 3EZVA 3VBQA 5TT7A 4FI1A 1ZWSA 2R3GA 3NLBA 2F57A 4BI1A 4EC9A 2CGXA 4M69A 3NCGA 3DCVA 3AMAA 4GG5A 3V8TA 2LGCA 4CV8A 4QQCA 4FMQA 4DH3A 1FINA 4XV9A 2HZIA 4IZ7A 1ZYLA 4YSMA 3EN7A 2X0OA 1FVTA 3E88A 3O2MA 3U9CA 1PW2A 1RJBA 1PXJA 4FTCA 4F63A 3PG3A 3GBZA 4FGBA 4JQ7A 4QP2A 1CSNA 3CP9A 3VS4A 2WQMA 4QP6A 5EK7A 1YDRE 1AQ1A 4CFMA 3WYXA 5CVFA 1JWHA 2FO0A 2RSVA 3VQUA 1ZMVA 4CFVA 2PMOX 2XNNA 4FYNA 3VC4A 1KOBA 3OCGA 4C58A 1ZZLA 1WVWA 4BRXA 3GFWA 4IJ9A 4IWPA 4O0RA 2PUUA 2XIYA 5I9ZA 3ENMA 3SQQA 2PSQA 5D41A 4D5HA 4ZK5A 3BHVA 3PVGA 4QQ5A 2R3PA 2BAKA 2RFSA 3C4EA 3OMVA 3QZFA 4O4DA 1GIIA 4DG0E 5CSHA 2BVAA 3GCVA 4FV3A 2VV9A 2BR1A 5H8BA 4FA2A 3RBWA 4FNXA 3QRTA 3QQGA 4CTBA 2H34A 4D1SA 1YVJA 1OMWA 2XNEA 3FI4A 5E1EA 5B2LA 3C4ZA 3KN5A 3F5UA 3MPAA 4I1ZA 1ZYCA 4EQUA 4X0MA 3QHRA 4AA0A 3FPQA 3ZEPA 2WMRA 1YOLA 4XG2A 4U6RA 1PYEA 5KMIA 3PLAE 2QD9A 5C9CA 3R04A 3MIYA 4U97A 4QTBA 3CJFA 4WBOA 5HO8A 3ZSGA 4GS6A 4FUXA 4K18A 2XK8A 1WZYA 3LJ2A 2UVYA 5L8LA 3AKLA 3VHEA 3QALE 4KIQA 2EXEA 2W1ZA 3LVPA 4XHKB 2OICA 2R0IA 3TZ7A 4WUAA 3Q3BA 3DKOA 3R21A 5FXSA 2XK7A 1GZ8A 4LOOA 5M55A 4CFNA 2YM6A 4X2GA 4RC3A 2WTKC 2W4OA 5CU6A 4RLKA 4O21A 2VTRA 1YXUA 4D28A 2PUIA 4O0TA 3DBQA 4RLLA 4HGTA 4F08A 4QP1A 2UZWE 3SOAA 5BUJA 4BCKA 2PU8A 4PTEA 1T46A 2OKRA 2IVVA 3UIBA 3ENHA 4DEDA 2EVAA 3C5IA 3RCJA 4WD5A 2ZV7A 3PE1A 2W4JA 2QO9A 2YDKA 4QMVA 5EM5A 4CFXA 4G2FA 4FV7A 3BYSA 4E6QA 5HI2A 3HV6A 5FEDA 4BIEA 2GNHA 3TNPC 3R2BA 2VTNA 5DLSA 2PULA 1YQJA 1BL7A 3QYWA 3KQ7A 2CKQA 1NY3A 3OBJA 3EQIA 4C02A 4RWIA 5HE3A 4AE6A 4F0FA 2QLQA 2RKUA 3MY1A 5FTQA 2CSNA 2R3QA 3RNIA 3FMMA 2XMYA 1YRPA 4FVPA 3VJNA 2EWAA 3BHYA 3MY0A 4YZNA 3IECA 4FVRA 5L8JA 5A14A 3FE3A 3QWKA 4ZLOA 1IAJA 3DTCA 5CZHA 5D7AA 5IEYA 4WNPA 4EOPA 4WSQA 5KE0A 4A06A 4IZYA 3SW7A 1WVYA 3ET7A 3MDYA 2X81A 2C6MA 1M2QA 4H3QA 5J9ZA 5K5NA 4DBXA 5CNNA 2VWUA 2J5EA 4PF4A 3ATSA 3W2SA 1U59A 4FTNA 3DK3A 4O0SA 4IXPA 4IE9A 2YM8A 2PVRA 4ZTSA 2IW6A 3HV5A 1ZOEA 1VLRA 4UV0A 4BCGA 4JQEA 5ANOA 4YTIA 4A9SA 4AF3A 4WSYA 4C57A 3P1AA 5JRQA 4BTKA 4D2VA 2E9VA 2XARA 4O82A 4FTMA 4L45A 1L8TA 4Z7GA 3UG2A 4YP8A 2WQEA 1VJYA 4KRDA 2ZOQA 4BCIA 2NP8A 2ZAZA 3MBLA 5AP3A 2ERKA 4MXYA 3AQVA 2R9SA 4N6YA 1IASA 3TMOA 1JKTA 3GOKA 2QHNA 4HGSA 3W18A 4B6LA 1W82A 5GZAA 3ROCA 4DGLC 4OR5A 3Q6WA 5IA1A 4RMZA 2E9PA 3H9FA 5HG9A 1A9UA 4J7BA 2G9XA 3ZLXA 2F7EE 4I21A 5HKMA 4NTSA 5EM7A 4K33A 3UPZA 3HRFA 3ZSHA 3NUSA 4RIWB 5A4TA 4M68A 2F7ZE 2GQGA 3DDQA 2PZ5A 4A9UA 2WHBA 3QQHA 4KIOA 2F2CB 4DH8A 3R2YA 4AZSA 2DUVA 5HBJA 4UB7A 2J51A 3MSSA 4FG7A 2OG8A 4GU6A 3ELJA 4PNIA 2RIOA 2QR7A 4C36A 4IBMA 5HVJA 5LVMA 5J9LA 4M14A 3O7LB 2WIPA 5AADA 1W0XC 4O6EA 4H58A 4CVAA 2I7QA 1JKSA 5HE1A 1J7LA 1JVPP 1OECA 1YXTA 2B54A 2PZRA 4GT5A 2CCHA 4CD0A 2YEXA 2QOLA 3RZFA 4WO5A 2JEDA 2IW8A 3RK9A 4MNEA 3RWQA 2P55A 2JFMA 4W9WA 3C5UA 3SG8A 4ASXA 3MPTA 3EIDA 3GEQA 4U3ZA 4L53A 3MH3A 3WF8A 3ZC5A 4D4SA 1WMKA 3KFAA 2OFVA 4ACDA 4IAKA 2YWPA 1JSTA 2PUNA 3TNQB 2QCSA 4RWJA 2XK4A 2YCRA 4TWPA 4DAWA 5KBQA 1QCFA 3LQ8A 2XK9A 4JAIA 2XK6A 4B4LA 3OOMA 3UC4A 3E8CA 4GUBA 4Q9SA 4B8LA 4CKRA 3QZGA 2YAKA 4JRVA 5TKDA 3K5UA 5LQFA 3QQUA 3ETAA 1E1VA 5CQWA 2X7GA 1UKHA 4U9AA 1Z5MA 1WBOA 3JY0A 1H8FA 4O4BB 5C4LA 1XJDA 3NUXA 4UMQA 4BYIA 2X8EA 4FL2A 1QMZA 3VONA 4FKQA 2X7FA 5FXRA 4HGLA 5C03A 5E8TA 3A4PA 4JRNA 3F9NA 3SXFA 3R01A 4YJSA 3R7EA 1L3RE 3FHIA 3FLWA 3CKXA 4ZSLA 3R8ZA 4E4NA 3CY2A 4FTQA 3PY3A 4HPTE 4FC0A 3GUBA 3KULB 3OXIA 3TUDA 3IDPA 5IISA 1MP8A 2ZYBA 5L6PA 2OZAB 5ANGA 1Q8ZA 3GB2A 2GPHA 4BDKA 3HL7A 3OG7A 4AN2A 4R