5FEDA

Egfr kinase domain in complex with a covalent aminobenzimidazole inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
288
Chain Sequence
b'EAPNQALLRILKETEFKKIKVLGSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDEMDDVVDADEYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Discovery of (R,E)-N-(7-Chloro-1-(1-[4-(dimethylamino)but-2-enoyl]azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), a Novel, Potent, and WT Sparing Covalent Inhibitor of Oncogenic (L858R, ex19del) and Resistant (T790M) EGFR Mutants for the Treatment of EGFR Mutant Non-Small-Cell Lung Cancers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 288
sequence length 321
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fedA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fedA01
2WQBA 3DA6A 3ZFYA 4R5YA 4CD0A 4JXFA 4TXCA 4RX5A 4HW7A 5CF6A 3L8SA 1MRVA 3OFMA 4R1YA 4GG7A 3VUKA 4AA4A 3HAVA 1HCLA 3C7QA 4ONAA 3L1SA 5EYKA 2RFNA 1SVGA 3NAYA 3WZEA 3AC4A 5CXZA 3L8PA 2GNHA 4G3DA 2IPXA 4JOAA 1K3AA 4EH9A 3IDPA 4EWQA 3AT4A 2ZV8A 4FNZA 4HGLA 3P08A 2JKOA 3KY2A 1CSNA 3MIAA 1OKVA 3I79A 2WQEA 4LGGA 3FMHA 1HOWA 2V22A 4ERWA 3FY0A 3QQLA 2GS6A 4XOZA 4BCQA 3Q60A 4BGQA 5M57A 4FC0A 1FQ1B 3D14A 2WMQA 3DNDA 3DXPA 2XJ2A 3V6SA 4FKTA 4KKEA 3WF9A 1OL7A 2P2HA 4PRJA 5AV1A 5GIOE 4RVKA 1YDSE 2IG7A 5HVJA 3IQ7A 4AA5A 4BVUA 1YWNA 4KINA 2HW7A 4GH2A 5D1JA 5CWZA 4XG4A 3W8LA 5HOAA 3ENHA 3IS5A 1K9AA 4P4CA 2X6EA 5AX3A 3KULB 4IADA 4AN2A 4CSVA 1MRYA 4C61A 4RA5A 4BWKA 3TTIA 4CZUA 2WOTA 3RINA 4PV0A 4DEHA 5I4NA 5HZNA 4ZLYA 4FZDB 4DCEA 3GCSA 2QO7A 3CY3A 3L9NA 4L46A 4AGWA 3PVGA 4O27B 2QODA 3EN7A 2X8IA 5KNJA 5GINE 3NEWA 3QAME 3VAPA 3A4OX 2ITWA 5IEVA 3EKKA 3MVHA 4A9SA 3MW1A 3QRTA 3LXKA 2REIA 1GY3A 4I20A 4YTHA 4F6SA 3LCDA 3IW7A 4RIOA 3WF8A 4GKIA 3R1YA 3H3CA 5E7RA 2UZBA 3FUPA 2VX1A 4MXOA 3UNKA 3W1FA 5I0BA 3FBVA 2RFDA 3QQJA 3MTLA 2UW3A 1VZOA 2QOKA 2I40A 3LFAA 4MBLA 3W16A 3GC7A 3DZOA 5C4LA 1U5QA 3FLWA 4E4LA 3KCKA 5J79A 2BDFA 2XBJA 4FVRA 4J96A 5IA0A 4QYHA 1STCE 2BIKB 2JAVA 2BFXA 3CJGA 4FV6A 5K9IA 1H08A 2G15A 2VTJA 3PXRA 4PDPA 4BCIA 2XM9A 2B9IA 3SLSA 4YJRA 4DT8A 5LXMA 3QQUA 2WMWA 3DQWA 3DTWA 1PW2A 3ZO2A 3VNTA 5CAPA 3SW7A 3GQIA 2J5EA 3ROYA 4LGDA 2XKEA 2BDJA 4IWDA 2HZNA 4ENXA 4YMJA 3FMLA 4D58A 4EZ7A 4QYEA 3BWJA 4FV4A 4AACA 1QMZA 3RP9A 4XP3A 5M4FA 4BL1A 4YLLA 4KIKA 3NMUF 5IDNA 3QZHA 4OBQA 5KX8A 2Z7RA 2PE0A 3PJ2A 3RPRA 3LQ8A 3COHA 4X3FA 5L2WA 2OH0E 3QQKA 1PXKA 5KMKA 3OT3A 2OLCA 1H25A 4YBJA 5FEEA 3PY0A 3RPYA 2YM6A 1WZYA 4FSQA 4UWBA 4QMTA 1IAHA 4DEGA 1KE6A 1WBNA 2C47A 1OVEA 2XB7A 1H1SA 3ZLSA 5J1VA 5C4KA 2PULA 1G5SA 3UQFA 5IPJA 2O3PA 4DFBA 5FDXA 2HK5A 5JEBA 4JVGA 4N70A 2H9VA 4FR4A 3C9WA 1TKIA 5C26A 3S0OA 2OJIA 4P2KA 2YN8A 2ITTA 3EB0A 5BVNA 3ZEWA 4D2PA 1WVWA 3RNYA 2BZKB 2R7BA 3IOPA 4QMMA 4XG6A 4MYGA 1QPDA 3G2FA 1WBSA 3BI6A 4S30A 4TYHA 3HKOA 4HVIA 4USEA 1UVRA 3DFCB 3PWYA 2IN6A 4YJNA 4JT3A 4RWKA 3F3VA 3TNHA 2XIRA 3CKWA 4FK3A 4QP3A 1R3CA 3CXWA 4RX7A 3KXGA 4YHTA 5CX9A 4F9BA 1BKXA 4FYOA 5CXHA 2WIHA 4CV8A 1PYXA 2QOIA 3BX5A 3IKAA 2O65A 5HLPA 4BC6A 3O8TA 1ZY4A 3QHRA 2VO6A 1H1QA 3DS6A 3DY7A 4UEUA 3IONA 3O71A 4N4SA 2R3KA 4ZZMA 4FIGA 3TUDA 3I0OA 1M2RA 3QLGA 4I94A 3R9OA 4BCJA 2BR1A 2PVJA 3A7IA 3DBQA 1R1WA 3G6HA 4E6AA 5CVHA 3CD8A 3WYXA 3KA0A 4BCKA 3COKA 3HEGA 4YLKA 1KV2A 2J0IA 3NW6A 4MWHA 5M56A 3O8UA 2AC5A 2GNGA 3ACKA 3C4ZA 4FKRA 3MVLA 1UV5A 3N51A 4JBQA 4C0TA 3I4BA 5LVOA 3H10A 4DITA 3VS3A 2ZVAA 4FNYA 4NFMA 4Z9LA 3R7EA 2H8HA 2VZ6A 4BI0A 3FL4A 3R9HA 4MXYA 2BIYA 2PUNA 1XH5A 3G9NA 4FTRA 1G8SA 3DXNA 1OBGA 2F2UA 5IQGA 4N6YA 5CU2A 3DBCA 2YZAA 4K0YA 5M44A 2Z2WA 5LWMA 3QTZA 3K3JA 4G16A 4KAOA 3G9LX 4IXPA 4JG6A 4MX9A 3RMFA 2UVYA 2YAAA 4KKGA 4UMRA 5JFSA 2OK1A 3QHWA 5EDRA 4GK2A 3TKHA 2HENA 4BCMA 3Q9WA 4Q5HA 5GHVA 1H1PA 1IEPA 2JEDA 3MA6A 5K3YA 4JR3A 2R2PA 5CI6A 4DFUA 3QWKA 4XJ0A 3LFSA 3TKUA 2I7QA 4EH2A 2DYLA 3EN5A 4FIJA 4O7YA 5FP6A 5KMMA 4G2FA 5HG7A 1U5RA 1ZRZA 2OH4A 2XKFA 3F7ZA 5JQ5A 3NIEA 2ITXA 3NNUA 4MCVA 4CVAA 1YVJA 2BRBA 2V0DA 3ZZEA 3RHXA 3QLFA 3RM7A 2V62A 2QD9A 3QA0A 3P0MA 2YIRA 3TCPA 3UO4A 2QG5A 3N9XA 4JS8A 3V5LA 2UVZA 4EKKA 3H4JA 2XJ0A 4OTHA 3HV6A 4U6RA 4D9UA 3R22A 2Y7JA 3BLHA 3UOLA 5EM6A 3KRWA 4DH1A 3IK3A 3BZ3A 2VX3A 4C8BA 1H01A 3NUUA 3ZEPA 3GQLA 1ZMVA 3FQSA 4E5WA 4FV2A 4HYHA 2WNTA 4LRJA 1WCCA 4YZCA 2PMLX 2WMRA 2XNOA 5AIKA 3MY1A 4U40A 5GJFA 5H9BA 1DAYA 3RAIA 3WARA 4EI4A 2HY0A 1PXNA 3OWJA 3R1QA 3FPQA 4LOPA 3CC6A 3QZIA 4D5KA 4Y73A 1VYWA 3TWJA 2ZYBA 5DE2A 2XNMA 3SRVB 4NWMA 1XO2B 5HE0A 1H4LA 3LJ0A 2J2IB 4M3QA 3V5PA 4CZTA 4QMWA 2JDSA 1REJA 4F1OA 4FSTA 3BYVA 4CFVA 3FPMA 3IGOA 4MBJA 3TACA 3ORZA 2R64A 2QOOA 5L6WL 2JDTA 5J5TA 5ANOA 4DC2A 5FDPA 3Q53A 4G6OA 1BL6A 3HLLA 3ACJA 5HO8A 2J50A 4YZ9A 2G1TA 5M4IA 4JDIA 2R5TA 1Q5KA 3QTXA 4RLLA 2JC6A 3GU7A 2BZJA 3LCOA 4F70A 3VO3A 3O0GA 3C50A 2GS2A 1H24A 2GQRA 5EQPA 1Q61A 3SXRA 3SC1A 4L43A 2X81A 3QRJA 4IX4A 3QCSA 4FKUA 3I5NA 4RQKA 3P79A 4MF0A 5EDPA 4DG0E 4I5PA 4IEBA 5DR2A 4CFWA 3CD3A 3FYKX 4B8LA 5BYYA 4YJPA 3FHRA 1YWVA 3NX8A 4IQ6A 5CASA 4UZHA 3VBWA 5LCKA 4WNOA 3TZMA 4ZTSA 4A07A 2FSTX 2R7IA 1XQZA 2UZNA 3RVGA 4CRSA 4DGLC 4BFMA 2A1AB 4DFZE 1OIUA 2UZOA 4FL1A 2I1MA 4N6ZA 4WUAA 5I9WA 2I0VA 2XH5A 4NFNA 1M14A 4H3QA 1ERKA 4QTEA 2UZEA 5HE2A 4UMUA 4MF1A 3JPVA 2ZV7A 4B0GA 4O84A 3D5XA 4CQEA 4DBXA 1KE9A 1XR1A 3DBFA 2ACXA 3HV7A 1OB3A 1BLXA 2ERKA 2VGOA 3FQEA 2E9NA 1Y8GA 4E4XA 4O1PA 3NNWA 2AYPA 5BX0A 5AM7A 4FTTA 5AFVA 2HY81 4GYIA 5TKDA 3VBVA 2CKOA 3W2QA 2CNUA 1UU3A 2VAGA 3D7TB 4QP1A 3EOCA 1YW2A 5HESA 1JSTA 4IZAA 4FT9A 3R7VA 4ACGA 5AV4A 3CTQA 3QQFA 4I0TA 4D4YA 5KUPA 4ZZNA 3L9LA 2P3GX 3UO6A 1H26A 2VO7A 1G3NA 5GIPE 2SRCA 2UZDA 3GGFA 3OROA 4MWIA 3UMXA 4F4PA 4KSPA 4MTAA 1U4DA 3RZFA 4I24A 4CTCA 3EJ1A 4DFNA 2I0YA 4XBUA 4JNWA 5DOSA 3NUYA 4YZDA 1EH4A 3ATSA 3V6RA 2WOUA 4ZIMA 5DRDA 4O7LA 3AC3A 4FSUA 2UW4A 3OZ6A 3GB2A 3VS7A 5DEYA 3QC4A 4WUNA 5IA5A 1IR3A 3QKKA 4ACCA 4PMSA 1ZMUA 3M2WA 4CV9A 5FP5A 2YCSA 4V05A 3UIXA 3QU0A 4F99A 4YC3A 5E90A 5KMOA 4WNPA 3SGCA 4FT3A 5DA3A 4ZLOA 4F7JA 5FXQA 2OSCA 5K5NA 4ZSLA 4IFCA 3F2AA 5IA4A 3KREA 2IVTA 3HV3A 3E87A 4LG4A 5IQAA 2H34A 5KBRA 4TKSA 4RRVA 4FEXA 2PVMA 4O7ZA 3DCVA 3TG1A 4L45A 4OTGA 3JVRA 4O96A 4Y95A 2I6LA 3PPZA 3CQUA 1KV1A 2OICA 4HGSA 4ASXA 5L8JA 4XV1A 5ETIA 2HXLA 4TNBA 3FMJA 5LMKC 2FVDA 3OHTA 1GNGA 2PE1A 5BNJA 4P7EA 3BU5A 5E8SA 5KMNA 4U97A 4BDFA 3QXOA 4GKHA 4EHZA 2XP2A 4L42A 5EOBA 3FZOA 4HCUA 4DN5A 1LUFA 5TF9A 4WG4A 3FZTA 3T9TA 4C4HA 4TL0A 1R0PA 4D1SA 4ASEA 3P4KA 3PWDA 3NUNA 4AT3A 2XYNA 3WF7A 4WD5A 5KMLA 3ID6C 5EM7A 4F63A 3MA3A 2VTIA 4EJNA 2JDRA 3PDTA 3ZLYA 4FUYA 4FL3A 3A8XA 4AWIA 4M7IA 4Q9SA 4JBOA 3OWPA 4E1ZA 2WXVA 2V7AA 4RC3A 4FT0A 4EOLA 4Z3VA 3QC9A 1FBNA 1Y91A 3CR0A 2WTIA 4O7RA 4HNIA 4L6QA 3Q5ZA 2XNGA 2CLQA 2CGUA 3HYHA 5CT7A 4ZTHA 2OGVA 2X1NA 3MH3A 5J9YA 1GOLA 2W4KA 3FLQA 4EHVA 4YZBA 4ZSEA 3RWPA 5FD2A 2Y4IC 3BBWA 4EQCA 1OBDA 1RE8A 4L9IA 4QPAA 2DUVA 4IC7A 3GVUA 3TT0A 4HVHA 2XK4A 3PG1A 3CE3A 1XH8A 5JMSA 3WZJA 3OOGA 2Y4IB 3SRVA 3ZOSA 4UY9A 2P0CA 4FYNA 3D4QA 4UV0A 1JQHA 2IW6A 4II5A 1WVXA 4AOJA 5GNKA 5E92A 1R78A 4FV8A 3U6IA 1PXLA 3VJOA 3F66A 2WGJA 1AGWA 2BHHA 5M06A 3JY0A 1KSWA 5ETAA 2B7AA 3MH2A 5GJGA 2RG5A 4U42A 2RG6A 1UU9A 3EN9A 4JX7A 3NUAA 5A4LA 5HCZA 3QCYA 4ZJJA 4DGNA 2WTCA 4AGDA 3DU8A 4YNOA 3PP0A 1FGKA 2ITPA 3BEGA 4A4OA 5BUIA 3JXWA 1AD5A 2WQNA 2C6DA 3OD6X 3QFVA 3SAYA 4BDCA 4EQMA 4YTCA 1LR4A 4H05A 2WD1A 4QMOA 1IG1A 3W8QA 4IW0A 4O7SA 2PZPA 4Z7HA 1GZKA 2PVNA 2Q0BA 5D11A 1ZZ2A 3PYYA 1KOAA 3IPHA 4IAIA 4D4VA 3VN9A 4ANMA 1ZYDA 2G2FA 4I6BA 4RFMA 5FEQA 3RCJA 4TN6A 4MXCA 3A7HA 3F3TA 5M09A 5CYIA 4CGAA 3EMGA 3R7IA 4BDGA 4FEVA 5B2LA 3UMWA 4BBFA 3OXIA 4AFJA 3H9FA 4L3JA 3PLAE 3C5IA 2VTSA 1OL5A 1JAMA 4AU8A 3OCGA 5HG5A 4AF3A 2PHKA 4F1MA 3ZBFA 4IB1A 2C6MA 3QL8A 3NLBA 2PZIA 4NCTA 4UXLA 3ZRKA 4DEBA 3KF4A 4GYGA 4TWOA 5EHLA 3VUDA 2QI8A 5AJQA 3VUIA 4L7FA 3T3UA 3SA0A 2ZDUA 1YQJA 3FJQE 4IZYA 4BCPA 5BVKA 1Q99A 2VN9A 4J97A 5JSMA 1Z57A 3OMVA 4RZWA 4DLJA 1XWSA 1Q8YA 4PX6A 2XK8A 4BCNA 5LMBA 3VULA 2W4JA 3SW4A 4TWNA 4C02A 2O8YA 3D2IA 2B9JA 3D7TA 5BYZA 5LMAA 3RPVA 5BUJA 3AT2A 2YIXA 4EC8A 2PE2A 2V55A 3EYGA 5CVGA 4YU2A 3TTJA 5AP4A 3DJ7A 3MVJA 5B0XA 5CEIA 4Z16A 2GHLA 1YKRA 4GVAA 3ZXZA 5M4UA 1PYEA 4AQCA 3DXQA 2X9EA 2ETKA 4WSQA 2IZUA 3C5UA 5JT2A 4XBRA 5EYDA 3UVPA 4D4RA 2Y9QA 4EWHA 3UQGA 3QWJA 4PL4A 5CU0A 4D1ZA 3JUHA 4EK4A 2OW3A 3Q6UA 5HLWA 5IMEA 4FT5A 5CTPA 4O7VA 3SXSA 2GCDA 5AIRA 4M69A 5GJDA 5BUEA 5CSHA 4W4XA 4X2FA 1GJOA 3IG7A 2CKEA 3E92A 4RT7A 3VBQA 3V3VA 3ZH8A 4BZOA 4YURA 2UZUE 5F1ZA 4TWPA 3BU3A 3H0YA 5JFXA 3GCVA 4EH4A 1M7QA 3FKNA 3AD5A 4WNMA 2BRHA 1FOTA 4OUCA 4F0IA 3CCNA 2ITUA 3MBLA 3WOWA 1XH4A 2UW6A 4PMMA 2PZYA 1OM1A 2YLFA 4QOXA 5CNNA 4NJDA 3HMOA 4G3GA 3PJCA 5CZHA 5HBEA 2EXMA 2OWBA 2DQ7X 3QTRA 1SNUA 4L3PA 3F3UA 4OT5A 3ZO1A 2B55A 3TUCA 1O6KA 5LVPA 4I93A 1SNXA 2JAMA 1Z5MA 4KIKB 2W1FA 3AGMA 3BHUA 5AP5A 4R3PA 2FSLX 3LZBA 3ZLXA 3AQVA 3HVCA 2QONA 3KCFA 4HCTA 4MNFA 2C5NA 5CEMA 3EQGA 2CCHA 3SXFA 5LMKA 4RVLA 4UWCA 4H1JA 4XLVA 5AA8A 3QA8A 4GRBA 2B52A 1NVQA 3BHTA 4FV1A 5BPYA 4RZVA 3R71A 3TNWA 4ANSA 4A4LA 4JRVA 3RAKA 4AP7A 2OIQA 3EQCA 2QR7A 3RM6A 3GOPA 4IWPA 1T46A 2OI4X 3FI2A 3QUEA 1GAGA 4J95A 1OPJA 3FMKA 3NIZA 4FSMA 4FTKA 3DDQA 4IBMA 4LYNA 4PDSA 2CGWA 5DEWA 1TQPA 1YOMA 3ZSHA 5DMZA 2WMUA 3HNGA 2GNLA 3LFCA 4W8DA 5AUWA 4CFMA 5IQCA 4W4WA 1BYGA 4FODA 4HYSA 3F2NA 4IH8A 3D2KA 1UWHA 3MJ1A 4FTIA 4O91A 4AW5A 2Z8CA 3TIYA 5L2SA 3EQFA 4PP9A 5C27A 4IX3A 2X8EA 3UGCA 2YM5A 3HX4A 2QKRA 4PTEA 4IAKA 5HQ0A 1ZYJA 3OT8A 4XEYA 4ANQA 3BYOA 1M2QA 4I1ZA 4U81A 1R39A 1OIYA 4IIRA 3IECA 3BQCA 3LQ3A 4YBKA 1UU7A 2XK6A 4EKLA 3H9RA 2JDVA 1XKKA 4IACA 5I9VA 3UZPA 3R28A 5A6OA 1S9IA 4BI1A 4YTIA 2X4ZA 2F49A 3BE9A 4GFOA 4RWLA 3S95A 4CKRA 3ET7A 3GENA 4FGRA 3UG1A 3VS1A 3FSFA 3K2LA 4BDAA 4E3CA 2WFYA 1RW8A 3DNEA 3EHAA 5FXRA 3A7GA 4S2ZA 3EFWA 2GPHA 4YZNA 4BDDA 2VWIA 4Y72A 1JSUA 2J51A 3A4PA 3U9NA 4BKYA 2BTSA 1JLUE 3G90X 4U0IA 3R7UA 4IWOA 4FKLA 3ZONA 4DGMA 3LPBA 5KE0A 4G6LA 3AD4A 3LM0A 5EW8A 3MFRA 4BTFA 2WEIA 3HRBA 2XZSA 5F9EA 4LQMA 2XEZA 4JBVA 2XNEA 2YCRA 4ZOGA 4OW8A 2OU7A 3NS9A 4KS7A 5HO6A 5HX8A 2RL5A 3HRFA 4GG5A 4Q9ZA 3Q6WA 1JNKA 2XMYA 4O0TA 3WE4A 4C4GA 3MYGA 4RIXB 5HBHA 4NIFB 4E6DA 3VW8A 1LEWA 4BI2A 5BVDA 5KHXA 1WAKA 4I23A 4WBOA 4K77A 4GUEA 2XA4A 3OOMA 1B6CB 3NYOA 4EZ3A 4I0RA 5DGZA 3MESA 3V8TA 4GIIA 2O64A 2X9FA 3DJ6A 3VC4A 5K5XA 5CZIA 4GFMA 3Q4CA 4W9XA 4HGEA 4IJPA 5E8XA 2ZDTA 3O7LD 3O8PA 1JOWB 2XNNA 3M1SA 4U44A 2PUIA 1OPKA 4DT9A 2XBAA 3RNIA 4ALWA 3BELA 3OW4A 1OGUA 4OTIA 3G0FA 4FV7A 4R1VA 5CY3A 4EK6A 1PKGA 5TO8A 3SQQA 4KIQA 1XBCA 3R9DA 2IW9A 3ODZX 2W1HA 4S33A 2KULA 2F9GA 4U3ZA 3EQHA 1YHVA 3UYSA 4NM0A 4X3JA 2Q0NA 4C37A 4E73A 4QTAA 1W84A 4JRNA 1NY3A 3A7JA 3CEKA 1B39A 4I5MA 5TR6A 4A9UA 4ALUA 1OKWA 2YCQA 3HDNA 4OTFA 4NEUA 4QYYA 4PL5A 1FVRA 2Z7SA 5D12A 1P4FA 3IDCA 3ROCA 4FV9A 4EUTA 4ZAUA 4CLJA 5KMJA 4D2VA 4EH5A 4EOKA 5J87A 3EFKA 4O2PA 4BCGA 1YI3A 3HV5A 2EUFB 2R3MA 3KEXA 3KMWA 4EH3A 1ZOHA 5TE0A 3UNJA 2PY3A 3FC2A 1Q41A 3MFUA 5HE3A 3VS5A 2X8DA 4F0FA 3BGZA 3KL8A 2R3LA 2YM8A 3PIYA 3W2RA 2XUUA 2VTMA 2OIBA 3E63A 2BZHB 4E20A 4OAUC 4EJ7A 1L3RE 2WMXA 4A9YA 4FE2A 5DFPA 4XUFA 3ZZWA 5LJJA 1ZYSA 4CYJA 3UJGA 1RJBA 4O6LA 4DAWA 2VUWA 2W7XA 5J9ZA 2Q83A 3ZUTA 4MXXA 4YJSA 2VWZA 3AOXA 3HL7A 4BZNA 2W1ZA 2Z60A 4KNBA 4ZTMA 3HUBA 5AAFA 2AC3A 4XG9A 4X2GA 4OTRA 2XCKA 5CVFA 4ZS4A 1GIJA 3QTIA 2X39A 4J1RA 3ORLA 4RGJA 4U45A 4AUAA 4CYIA 5JGDA 4QMXA 2W9ZB 1REKA 4J99A 5CALA 4FKQA 1KOBA 2G01A 3EQRA 3PSBA 3KRLA 3KVXA 3P7AA 2R3IA 3R01A 3V5QA 2P4IA 4AZEA 3GC9A 3KMMA 3MTFA 3R2BA 1PXJA 2VWBA 3ETAA 3IW5A 3LFQA 3SV0A 5I3RA 4XV2A 3Q52A 3I6WA 4XP0A 4P90A 2GSFA 3NDMA 4V01A 1JKSA 1QCFA 5LOHA 1V0BA 5AR4A 3FMNA 2W1IA 4X2KA 3IW4A 5CAUA 1J3HA 4M13A 3VUTA 2NO3A 4QNAA 1PF8A 3BV2A 4F7LA 2Z02A 3TNIA 1DI8A 5JN2A 4X6QC 3FC1X 4DTBA 5G1XA 3FI3A 2UUEA 5DT3A 3VUGA 5BMMA 2OJ9A 3TJCA 4FT7A 4C62A 3LFFA 4ENYA 5JGBA 2VO3A 4FKPA 3G5DA 2QU6A 3MGYA 3PZEA 2VWYA 3ZDUA 4EONA 3QTUA 4NT4A 4M12A 5EQEA 4LRKA 2QOCA 2YDIA 2E2BA 4CFXA 1JVPP 1ATPE 2E9UA 3IDBA 2QO9A 4FG7A 4MEDA 4U41A 5HNIX 4RIYB 4XH6A 5EYMA 5CENA 1SVEA 4QP4A 3KU2A 4F9AA 5FM2A 1M17A 1E1VA 2CGXA 4C3FA 4CTBA 3E3PA 2FO0A 3R7GA 4B6LA 5L2QA 1Q4LA 5EYCA 4FTCA 5CEOA 1OL2A 2A2AA 1IA8A 3E7VA 5ETCA 5HEZA 5T6KA 4F09A 5AX9A 2R3QA 4LOQA 4PY1A 4ZMEA 5A4QA 4NW6A 2PTKA 3V04A 5HHWA 5M08A 2UZTA 2NP8A 2BTRA 3OG7A 5CU4A 3V5WA 3C0HA 3BIZA 2YM4A 3UIMA 3QZFA 2VTRA 4MK0A 2X7GA 4I5CA 4DH8A 2WTKC 2CLXA 2YA9A 4K18A 3C4XA 3FZ1A 2VTQA 3VS6A 3V01A 3LMHA 3GBZA 4NM5A 4KBCA 4X6RA 5G6VA 2C1AA 4J7BA 3TIZA 3Q5IA 3H9OA 3ZM9A 3SHEA 4WO5A 4P5ZA 4EOSA 2WELA 3EN6A 3UPZA 4C58A 4WNKA 3WBLA 3BRBA 3LCSA 3POZA 4TYIA 3EL7A 1YXUA 2HWPA 3FZRA 4FKIA 4OR5A 3KMUA 4G5JA 3UOKA 4C7TA 5I5ZA 4C34A 4RPVA 3FI8A 4FG9A 2RKUA 3FZPA 3QUPA 4QYGA 4RIXA 4IC8A 5CSXA 4NIFA 4UX9A 5D7VA 3FLZA 3O96A 4MNEB 2PVFA 3G51A 1ZOGA 3PXYA 1XJDA 4IAZA 3VW6A 3REPA 3FXWA 4KBAA 4DH5A 4IDVA 2QLUA 4RJ5A 3IOKA 3FAAA 1KE7A 3AMAA 3B2WA 4LV5A 2XRWA 3N4VA 4CG9A 2H6DA 3R0TA 1ND4A 3RTPA 4GU6A 3C0IA 4KBKA 3GC8A 1P4OA 4BB4A 4BCHA 4C4EA 2XYUA 5GZ9A 2FUMA 5AP1A 4UYNA 5E4HA 2YIQA 2WMSA 5KZIA 2CSNA 5IEYA 2QHMA 3MJ2A 3ELJA 3ZDIA 2C69A 3U4WA 4BKJA 4D0XA 1ZZLA 3CQWA 3C4CA 4OTPA 4U79A 4EHEA 3LFNA 3NRMA 4FIEA 5DRBA 2BZIB 5AUYA 3TZ9A 1W82A 1XBAA 2CHLA 4EEVA 3H30A 5FBNC 3VUHA 4CLIA 3RWQA 1WBVA 4AXAA 2RGPA 3G0EA 5IA1A 3ZO3A 4HJOA 3BBTB 1P2AA 1Y57A 4DEAA 5E1SA 5KKRC 5EKNA 4BRXA 2WKMA 3A62A 3QYZA 4FV0A 5AR7A 4DGOA 3FL5A 3QD0A 4UXQA 4C33A 2ITOA 2X0GA 3POOA 3GUBA 2GMXA 3TDWA 3SOAA 5KKRB 5H8GA 4BDBA 4AG8A 3FLNC 2QQ7A 4MH7A 4FTJA 3GP0A 4C4FA 2WU6A 2WPAA 4ZK5A 2OJJA 2X6DA 5B7VA 1NVRA 1ZARA 2C6KA 4ACMA 4F9CA 4K8AA 4X2JA 4DE4A 4WG5A 3OY3A 3FDNA 3LXPA 3QTSA 4J8NA 1E9HA 4XG3A 5AP6A 4NUSA 4QT1A 3W33A 4G6NA 5CU6A 3WE8A 3ZFXA 3C4EA 3OUNB 3PY3A 4GMYA 3RI1A 5TOZA 1KE5A 5AV2A 2JGZA 3F5GA 4YZMA 2VO0A 3QQGA 4FICA 3QRKA 4AW0A 4I22A 4F1TA 3PXZA 4QMPA 4ZSGA 5AUTA 3KGAA 3E5AA 3KN5A 4M66A 1P14A 5DR6A 4FV5A 2C6TA 3PJ8A 4BN1A 2X7FA 4YC6A 3BKBA 4JR7A 5J1WA 5HU9A 4KRCA 2BRNA 5AUXA 3QZGA 3Q9XA 4EOPA 2QG7A 4Y83A 4O7WA 4FZ6A 4GT3A 2HCKA 2W5BA 4KRDA 2OXYA 3HRCA 5HNGA 4EQUA 4ARKA 2LGCA 3NUSA 4IX5A 4EBVA 3NCZA 1H0WA 5IF1A 2IVSA 4HCVA 3NWWA 3JYAA 3CGFA 4M0YA 4RA4A 4YO4A 3PRFA 4BGGA 3RKBA 2J7TA 5LQFA 2UVXA 5FUTA 5AEPA 3E93A 1YXSA 3HGKA 4RFYA 1OUKA 4JLCA 3A8WA 3CIKA 2GNJA 2PL0A 2G2HA 4MHAA 3PSCA 2B4SB 4MQ1A 3K5VA 4CT1A 5FBOA 3L9MA 1WVYA 4O0WA 1PXIA 3F5XA 3QYWA 2CKQA 3PE1A 4RIYA 5LWNA 3R6XA 4FIHA 2VTLA 4G34A 4UWYA 1H27A 4O0VA 3UP7A 3N4UA 3KF7A 4R8QA 3B8QA 2JFMA 4MXZA 4DBNA 1BMKA 1RDQE 4HYUA 1KE8A 1M7NA 3KRXA 2JKMA 5AM6A 4H3PA 4IJ9A 4BWPA 1H00A 1CM8A 1W98A 2WMTA 4M69B 4RIWB 4YPSA 3AC5A 5H8EA 5A4CA 2YJSA 3ZUUA 3U54A 2W9FB 3PVWA 2VTPA 4PPCA 5CEKA 2R0UA 3ZM4A 2FGIA 2R4BA 3A7FA 1IA9A 4RBLA 2PMIA 4IM0A 5HLNA 2PK9A 4HVDA 4UMPA 4IWQA 3ULIA 3KK9A 2A0CX 3EYHA 5EI6A 1BX6A 4FIIA 5E8YA 3OCBA 4CMOA 3DOGA 4QP7A 4PP7A 5B2MA 3NCGA 4TT7A 5IQFA 4BY9E 2LAVA 1NW1A 3NZ0A 2OXDA 4K33A 3G33A 4JIAA 4M67A 3UC4A 4C4JA 4E6CA 4JQEA 4WHZA 3GU5A 4JI9A 2YJRA 3R7YA 3NW5A 4GFGA 4JQ7A 3VWAA 4JIKA 1IASA 2ETMA 3VS0A 4XRLA 3ULZA 3WZDA 3ZSIA 1WMKA 4HZSA 4JAJA 4ASZA 4AE6A 4BWXA 5HIDA 2C6EA 5J7HA 3KXZA 4U9AA 2O2UA 4FG8A 4D5HA 4GT5A 3TJDA 4QPMA 2R3PA 5IU2A 4NTTA 3TZ8A 3ZFMA 4ZJVA 5JZJA 2UW0A 2RFEA 3NYXA 1ZLTA 4FV3A 3R04A 4MNEA 4F9YA 4C2WA 4HYIA 5HTBA 3R8MA 4CCUA 4RJ3A 4BIDA 5L6OA 5ANIA 4XHKB 3R8UA 3VHEA 5AP7A 2CPKE 5EW9A 1OECA 2YISA 4OBPA 3E7OA 3TI1A 4QRCA 4G3EA 4O0UA 4TRLA 4LI5A 3PZHA 4FTOA 4NTSA 4TYGA 2GTNA 5DNRA 1OMWA 5DPVA 5F94A 4AZVA 4FSYA 5JQ8A 3D15A 4IDTA 4FMQA 4CZYB 5C8MA 5IEXA 3PPJA 5AUVA 2HW6A 5HG8A 4EUUA 4F08A 3D9VA 2JDOA 2XK3A 3QBNA 4MD8E 4TNDA 3QKMA 3LLAA 1YOLA 4RJ7A 2JIVA 2XNPA 2OF4A 3QX2A 1CKJA 3OEFX 1SVHA 4FEQA 5HIBA 3ORPA 4EOQA 1OITA 3UVRA 5CF8A 5EDQA 1OKZA 2CKPA 3DLZA 4R78A 2FH9A 5AP0A 2J0LA 4C57A 3NSZA 1Q8UA 1PXMA 2BRMA 2WU7A 4NZWB 3F88A 4JDKA 4J71A 5DI1A 5EHYA 1YDTE 3ZMMA 3ZTXA 3MY0A 5C03A 4DTAA 5C1QB 2P55A 3AGLA 2BDWA 3UODA 2IWIA 3MSSA 4RJ4A 1XH7A 3ATTA 2ESMA 2IJMA 1H28A 1RQQA 3QTWA 3FI4A 3R8PA 3RGFA 3OWKA 3O2MA 4FKOA 3HA8A 2C1BA 4JAIA 3FMEA 3EZRA 3DFAA 2OO8X 4QP8A 3ZCLA 3MB7A 4G5PA 3BYMA 5AR5A 4FNXA 4MKCA 4EC9A 3VQHA 3P86A 4EH7A 5ICPA 2GTMA 3FXXA 1UKIA 4BYJA 3B8RA 4B8MA 3DJ5A 2YWVA 5E9EA 2UW8A 2O63A 3S00A 4GU9A 4XYFA 1Q8ZA 2YABA 3R02A 4TY1A 1FGIA 4ZZOA 1YXTA 4P5QA 3QQHA 2UW5A 3F3ZA 4XOYA 3U87A 3A99A 4F7SA 4C59A 2YIWA 5HTIA 3V5TA 3W2OA 2QU5A 4L3LA 2BAQA 5H3QA 1LPUA 3VBXA 4OTWA 3SKCA 4XRJA 1H07A 3RZBA 4XV9A 3OXTA 2X2LA 4GT4A 3NPCA 5A4EA 1IAJA 3NNVA 3GOKA 3ORXA 5BVWA 3UOHA 4C4IA 4KWPA 4AN9A 5HGIA 1JKTA 1XBBA 5AADA 2IW8A 4YGAA 3Q3BA 4HVGA 4O86A 2JBPA 3H0ZA 3CSVA 4DF3A 5HCXA 4X0MA 4PDOA 4M0ZA 2ZMDA 3QD3A 3R8VA 3I81A 4U43A 4H1MA 4XG7A 4E4MA 4QQCA 3GU4A 3NAXA 3BQRA 3WF5A 5GZAA 1P5EA 5FEDA 3EQBA 3U6JA 4FUXA 5HG9A 3LMIA 2E9VA 4CNHA 4EK8A 3RPSA 4RMZA 3G6GA 3QALE 5HTCA 3C4FA 3ODYX 3PSDA 4YO6A 2PUUA 3DAJA 2R9SA 1J1CA 5HVKA 3VHKA 5A3XA 1W83A 3TDVA 3G15A 3HP2A 2Y8OA 1CKPA 2W06A 2BALA 2PVHA 4FTNA 5H2UA 3VBYA 4RIWA 3PTGA 2GNFA 4FEUA 2F2CB 1U46A 4BTMA 3CP9A 4TPTA 1GZ8A 4E7WA 4L53A 5KMIA 3THBA 4XX9A 3TV7A 3FMDA 2PUPA 3ZSGA 4APCA 1I09A 3WIGA 3HDMA 3TV4A 4AZWA 3DLSA 5I9XA 5JH6A 1A48A 3IW6A 3UPXA 5LCJA 2BRGA 3ZRLA 3E8CA 4LV8A 4AAAA 5HBJA 2PVYA 4EZ5A 5AP2A 1L8TA 1MRUA 1O6LA 1ZYLA 3LLTA 1T45A 1Y8YA 4ITIA 1NVSA 3NYNA 4EL9A 2BVAA 4QTDA 4L67A 4CG8A 3I0QA 4IFGA 4EYMA 2HOGA 4UN0C 5I9YA 5EHOA 3CTJA 4ZSAA 4U8ZA 2B53A 3S3IA 4F64A 5ANKA 3SD0A 1SM2A 2R3FA 3R1NA 4NSTA 4ZTNA 3PP1A 2XF0A 2ZAZA 2QOHA 2WMVA 1YWRA 3MFSA 4HOKA 2PU8A 4FEWA 3S2PA 2ZJWA 2JBOA 3MDYA 5E91A 2EU9A 5L4QA 3QF9A 2C5OA 4L8MA 2XK9A 4MBIA 2G9XA 5DN3A 5HE1A 2OJGA 4BBMA 4QO9A 4B99A 5EG3A 3PVUA 4BF2A 4D0WA 3KQ7A 2JLDA 5EFQA 2CGVA 4RC2A 1U59A 3B2TA 4S34A 4V0GB 5L8KA 3DZQA 2QOLA 3CY2A 3UC3A 1H1WA 2J6MA 3NGAA 4N57A 3I7CA 1OI9A 4ZY5A 4XP2A 3Q4ZA 4H3BA 3VVHA 5IMXA 2XKDA 4ITJA 4KS8A 5KHWA 5D9HA 4XNEA 1DS5A 2YHVA 2JD5A 1U54B 3FLSA 5J5SA 4DFYA 4RLKA 1SMHA 2W1DA 2P33A 3ENMA 4A7CA 2YIYA 5J8IA 4LL5A 1FMKA 4CKJA 4AOTA 3E88A 2Z7QA 2ZMCA 2BAKA 3FXZA 1J1BA 2YFXA 3ZHPC 3DAEA 3OW3A 4WIHA 5HNBA 2PZRA 4YUQA 5FTOA 3BYSA 1ZOEA 2R3JA 2W99B 3DB6A 3FE3A 3RCDA 3R83A 2DWBA 2C5VA 4ANNA 5J7BA 4F65A 3PXKA 4RJ6A 2CJMA 1PY5A 3LXLA 1B38A 1Y6AA 3LAUA 3SG8A 3ZUVA 5AMNA 2XVDA 1WBWA 4OGRA 4KB8A 1URWA 5CQUA 1ZAOA 3EN4A 2ETRA 3QTQA 3QX4A 1UKHA 5K0KA 3LM5A 2OJFE 4M14A 3QD2B 2VWXA 1A9UA 1OKYA 1YHWA 4FF8A 4QTBA 4JDJA 5EI2A 4OLIA 1UWJA 5AR3A 3E8EA 2F7EE 3TEIA 2XCHA 2V5QA 3FKOA 1UNGA 3BWFA 4AFEA 5JK3A 4UMQA 3UP2A 3HMPA 3BCEA 4FX3A 4KIPA 4K6ZA 3DBEA 4ORKA 3S1HA 1HCKA 2QOFA 5BVFA 2WMBA 4ZTRA 2F7ZE 4RX9A 5AAGA 1M52A 1VEBA 1VR2A 4HPTE 4YLJA 2WAJA 5C9CA 1QPJA 1YI4A 4DYMA 4EK5A 5CAQA 4U7ZA 3FMMA 4GV1A 4QMZA 3UIBA 2HWOA 2JKQA 3BLRA 4A06A 4KA3A 4Z55A 2HELA 2YM7A 1PXPA 4R3CA 3VS4A 1BL7A 2BFYA 1V0PA 2BKZA 2VGPA 4FTQA 4R77A 2ITYA 4DHFA 3HMIA 5DT4A 2CNVA 1BI8A 2ZM3A 1QL6A 4DEIA 3QGWA 2WMAA 4U3YA 4FTAA 2BILB 1CKIA 2QO2A 4JG8A 4FTUA 4ZS0A 1YHSA 4CMUA 5M51A 1YI6A 3OVVA 3MPTA 2R3HA 1J7LA 3VF9A 4WA9A 2OFVA 1GIHA 3PLSA 3VRZA 3O50A 5CT0A 3U8WA 3BGQA 2OKRA 5D10A 2C3IB 4ZSJA 4ACDA 3E8NA 4QMUA 3ZYAA 4JBPA 1OIRA 3GC0A 3OY1A 1Q3DA 3PRIA 4TYJA 1Q62A 4AZTA 2GQGA 5E1EA 3KRRA 5DBXA 3UZTA 3LHJA 3ITZA 5AV3A 3WYYA 3ZBXA 5EKOA 1PMVA 4GS6A 5E8ZA 4DFXE 3DBDA 3IGGA 3LCTA 2WZJA 3LE6A 4PQNA 3GEQA 4GJ3A 3JVSA 3Q9ZA 1W8CA 4WRSA 5E8VA 2C0IA 2CN8A 4FOBA 3UE4A 3W10A 5FTGA 1PMNA 3AD6A 3TKIA 4DGGA 3RALA 1M2PA 2Y6MA 1FPUA 4FSZA 3AMYA 4U5JA 4LL0A 4Y5HA 2ZV2A 4FVQA 4G1WA 2WO6A 3BU6A 5KBQA 4YJVA 2EXEA 4QP6A 5J95A 3T3VA 1YDRE 2VD5A 1WBOA 3UBDA 4ZXTA 5L6PA 3EQIA 4L01A 2C0TA 4LFIA 3E64A 4A9TA 4CQGA 3ALOA 4WRGA 3R00A 2GS7A 3HMMA 2DS1A 3LFEA 2IZRA 3TM0A 4IE9A 3UTOA 3KXMA 3QRIA 3FQHA 4H39A 2XM8A 4I41A 4LMNA 5HX6A 5KZ0A 3COIA 4GVJA 4YSJA 3GFEA 3DV3A 5CNOA 4PTCA 4JQ8A 2X4FA 3Q4TA 4E5BA 3D94A 1PRYA 3BPRA 5CU3A 5B2KA 3RAHA 1UNHA 2Y4PA 1XHAA 3W2CA 2X7OA 3IW8A 2VV9A 4XG2A 4Y85A 5HO7A 2P2IA 4DEDA 4O38A 1WFCA 3OWLA 4JJRA 2JIIA 4JX3A 3R63A 4RX8A 5FXSA 3W2PA 3MFTA 2Y0AA 3KC3A 4XMOA 4ANLA 3NVMB 5FQDC 4NL0A 1MQ4A 4IM2A 2ITQA 1OPLA 4XLIA 2OG8A 3BV3A 4FTMA 2J5FA 4LUEA 5A14A 3TXOA 5CAOA 3BHVA 3LJ1A 1LP4A 4FKGA 5HIEA 3O23A 4D2TA 1NT2A 3VS2A 4V0GA 4AS0A 4FI1A 4RQVA 3UQCA 5HCYA 4G9CA 3HUCA 4RWIA 4YJQA 4C38A 2QHNA 5AV0A 4TYEA 2RIOA 2YZLA 2NRUA 5M07A 4ZLZA 3TN8A 1YXXA 2C4GA 2PMNX 3HZTA 3BEAA 3F5PA 3LVPA 3HECA 3AG9A 4WSYA 5FG8A 4QQTA 2PMOX 5IA3A 4TTHB 1FMOE 4QD6A 3TNPC 4CCBA 3DQXA 4FSRA 5DH3A 3F3WA 3QUDA 4PNIA 5CSPA 1U54A 4O0SA 3KVWA 4F0GA 3D7ZA 2QC6A 5EOLA 4A4XA 1WBTA 5FRIA 2XNBA 3JS2A 3MH1A 3OCSA 3QGYA 4NKSA 5CI7A 3V8SA 3UZRA 5IDPA 4DG2E 3VBTA 4MD7E 4Y8DA 1AQ1A 2ITNA 3DTCA 4KSQA 5HORA 3AMBA 4R3RA 1GIIA 3N4TA 1K2PA 3LFDA 3WZUA 3OUKA 4CKIA 3C4WA 5AR8A 3WILA 2ZOQA 4B7TA 3FYJX 5I9ZA 4HNFA 5L2IA 3KN6A 4NU1A 4YTFA 3LCKA 1FVVA 4K1BA 4QP9A 5IQDA 3Q2JA 3C51A 4APPA 2VWWA 3ORTA 2Z7LA 4Q5EA 5CEQA 4BYIA 3EFJA 1QPEA 4F7NA 5ANJA 2RF9A 5ACKA 1UU8A 2BROA 5ACBC 2YITA 4O0YA 4ACHA 2C3LA 2A27A 2VU3A 5ANEA 4V04A 4IAYA 5AA9A 5K4IA 2C6IA 4AX8A 4PL3A 2EB3A 4UMTA 4XG8A 2B54A 5TT7A 1FVTA 2C68A 3U4UA 4ZJIA 3FV8A 5LVMA 4FBXA 2F57A 4DG3E 2X2KA 5I9UA 5T3QA 3ALNA 1GZOA 2C6LA 1VYZA 4AN3A 2WTKB 5EI8A 2VTHA 4O1OA 4I6QA 5L2TA 4RWJA 3KXNA 3Q32A 4I6HA 1DAWA 4OTDA 4R7IA 4Z7GA 5CQWA 3P78A 4QMSA 4BDJA 5IKWA 3EH9A 4BCFA 3DAKA 4CFFA 3ORKA 3HP5A 4FNWA 5CF5A 2C3KA 4EOIA 3I7BA 5E8WA 3PY1A 2YAKA 5C8KA 4YHJA 4PMTA 4FVPA 3GFWA 4M97A 1XH6A 4IB0A 4QP2A 5IH6A 3NW7A 2OF2A 5JRQA 3LFBA 4YJUA 4MXAA 4OBOA 3ZC5A 4YC8A 2C6OA 4AA0A 1JWHA 3D0EA 3AXWA 5IG1A 3SG9A 4AZFA 3FEGA 4I4EA 4LGHA 5BQ0A 4QYFA 3KXXA 3GCQA 4R7BA 4LUDA 4K11A 4DH3A 4FZFB 4RVMA 4M15A 4C35A 2W5AA 1F0QA 2XS0A 4I3ZA 5L8LA 3NVKI 2FSMX 3BYUA 3QRUA 4UALA 1G8AA 4S32A 4QMQA 3FLYA 4DA5A 4ANOA 1V1KA 2XEYA 3C13A 4K2RA 5A54A 4NK9A 4J53A 4MQ2A 4R6VA 4D2SA 5DYJA 4ZTLA 3F6XA 2KTYA 4WKQA 3TL8A 1YOJA 3ORIA 3KULA 3QCQA 4FKSA 4IAFA 5IQEA 3K5UA 4KABA 4QMLA 5LARA 2IZTA 4IANA 4IM3A 4N0SA 4O0XA 3CGOA 1BI7A 2W1EA 3OTUA 3ZU7A 4BIEA 2W1GA 5E8TA 4BHNA 2XJ1A 5A46A 2IVUA 4O82A 2B9FA 2BAJA 3T8OA 3GNIB 5AP3A 3COMA 2OIDA 1MP8A 4YHFA 4BDHA 5IUGA 3R30A 3O17A 3SDJA 2NNWB 3VRYA 3CBLA 4GJ2A 4IAAA 3O51A 2EXCX 4PWNA 4FA2A 4D4SA 3SVVA 2YM3A 2F7XE 3EQDA 4Y46A 3BHYA 2W05A 5IH5A 5ANGA 4I6FA 4UBAA 3PJ3A 1JSVA 2ZB0A 4DH7A 5IA2A 3CPCA 3ZO4A 2OFUA 3CQEA 4OTQA 3RK9A 3EL8A 3T9IA 3AT3A 3UVQA 3MV5A 5JFVA 4J98A 5DWRA 4YP8A 5F20A 2JFLA 3FHIA 2W96B 4QNYA 2XIYA 3II5A 5BVEA 4BHZA 5DG5A 2BCJA 4D9TA 2GFSA 4FOCA 4BDIA 1PJKA 3PG3A 3GXLA 2B1PA 4L7SA 2BHEA 3V8WA 4O83A 3SX9A 4LRMA 2R3OA 1DI9A 2OZAB 4HGTA 4MVFA 1E1XA 3WF6A 3AC8A 4ZY4A 2WTDA 4IVDA 4PUZA 2VTTA 2J90A 4Q2AA 1SZMA 3GI3A 3L8VA 3RPOA 5ANDA 4EOJA 3UG2A 4E5AX 2FB8A 4FSWA 4W8EA 2ONLC 2WIPA 4ALVA 4UZDA 2C0OA 2WB8A 2OBJA 2QLQA 3NUXA 3NNXA 4IB3A 3ZLWA 2VWUA 3M11A 1LEZA 4D28A 1MQBA 1TQIA 3L9PA 3PA3A 4L52A 3LJ2A 2GHGA 2UZWE 3E62A 4BR3A 3UO5A 4NCTC 2VRXA 4YPDA 5IUIA 1O6YA 3PA4A 1W0XC 3NYVA 2VNWA 5AUZA 2WTJA 3MI9A 3BGPA 1F3MC 5JKGA 2JIUA 4FSNA 5JGAA 3DT1A 3UDBA 4DLIA 2QR8A 3PUPA 1F5QA 4NKAA 4O0RA 4AGUA 2ITZA 2FA2A 3CKXA 3VJNA 4E8AA 3BHHA 2BPMA 4H36A 2RSVA 4FZ7A 2R0IA 1ZXEA 3KFAA 4KKHA 4RVTA 3R7OA 4AW2A 4CT2A 5AUUA 1FINA 4FGBA 2WQOA 3GCUA 3TUBA 4FL2A 3AC2A 4RJ8A 3FKLA 4D2RA 4EOMA 3I1AA 2YERA 4AE9A 2C5XA 3GU6A 3EQPA 5GZ8A 4CRLA 1O9UA 2W5HA 3DK3A 3LQ5A 1PKDA 4J52A 4BTJA 3P23A 5KCVA 4IMYA 4BCOA 1QPCA 4GCJA 3DKCA 1J7UA 3Q2MA 4FKWA 4GK4A 2CN5A 3V5JA 5A9UA 4D55A 1CTPE 2PVKA 3DPKA 2J4ZA 2PZ5A 3CS9A 2R3NA 3MN3A 4YJTA 4YNEA 2IZSA 2GU8A 3CPBA 4IZ5A 1NXKA 2J0JA 5A6NA 3F2RA 4XS2A 4XCUA 1YRPA 4NYEA 2YCFA 2FSOX 1JKKA 4BBEA 4O2ZA 2YACA 3WI6A 4O7TA 3I60A 2CNQA 4AZSA 3MY5A 4QQ5A 4ANBA 2VNYA 3LW0A 4AOIA 4JG7A 3TV6A 5IH4A 3P1AA 3FY2A 2PPQA 5DIAA 3MIYA 4W4YA 4H58A 4LOOA 4GUBA 4YSMA 2AUHA 2HZIA 4BTKA 4KUJA 2PSQA 1JBPE 4F6WA 2UW7A 2XKCA 2C3JA 3ZXTA 5FM3A 5EM5A 3R21A 4RSSA 5BMSA 4FKVA 4TWCA 5CEPA 5HD7A 1Z9XA 3NR9A 4FK6A 2X2MA 3KK8A 4O7NA 3TZ7A 4CFUA 3QKLA 3ANQA 2O5KA 5DLSA 5D41A 5DR9A 4X21A 4MD9E 4TZRA 5IQIA 1H8FA 3ANRA 3CTHA 3PVBA 3LMGA 4IX6A 2WEVA 4EH8A 3UOJA 4C36A 3I5ZA 2OXXA 3Q04A 4K9YA 5LVLA 3KB7A 3DKOA 4IVAA 1Q3WA 4TW9A 4W4VA 3MB6A 5T68A 3JY9A 3S4QA 2HZ4A 5DVRA 2J9MA 4R7HA 3NUPA 4D2WA 3OTVA 3U9CA 4G31A 5H8BA 2I0EA 2QKWB 4ZMFA 1KUTA 5KO1A 3DK6A 4I4FA 5EK7A 3EZVA 4ERKA 4LM5A 3OBGA 2QURA 3D5VA 4PPBA 1R0EA 5ITAA 2PYWA 5K0XA 2I0HA 5AAEA 4EHGA 1ZY5A 2ZB1A 3DGKA 3OXZA 3Q4UA 1URCA 3PE2A 3O7LB 4BKZA 2F4JA 3UNZA 1PXOA 4B4LA 3HMNA 1OL1A 3F9NA 3LXNA 4O6EA 4CFNA 3PIXA 4CXAA 4ID7A 4UB7A 3PFQA 1PMEA 4BICA 2GHMA 3F82A 2XIKA 2HZ0A 1W7HA 5HKMA 4CEGA 4WOVA 2XK7A 3TNQB 5BYLA 1TQMA 4E93A 4EOOA 2E9PA 2EWAA 3D5WA 4AW1A 5A4TA 5AWMA 1ZYCA 2O0UA 4QMYA 5HD4A 2OZOA 3A61A 4F9WA 2W17A 3DB8A 3PIZA 4G9RA 4Y5QA 3MWUA 2OZAA 3F69A 3LIJA 1OZ1A 1APME 2HIWA 4UYAA 3HV4A 3U51A 3OCTA 3VQUA 3IO7A 2ITVA 2VWVA 1ZWSA 5CLPA 4BZDA 4R5SA 4ZY6A 3RK5A 3BLQA 5K4JA 2EB2A 5HU3A 4QMNA 2VTNA 1H1RA 4M8TA 2A4LA 5M4CA 2J0MB 4OAVB 4U80A 2YDJA 2R3RA 2CCIA 1I44A 3P7CA 5FGKA 1A06A 4DFLA 4RFZA 2HYYA 3RK7A 4A9RA 2XIXA 1GZNA 3OBJA 3R2YA 2GNIA 2IVVA 2ONLA 4IZ7A 3MPMA 4EORA 2HXQA 2BMCA 3HA6A 4ZP5A 1Q8TA 4MAOA 3PJ1A 4ASDA 4CMTA 4EYJA 2B9HA 5DHJA 3W18A 3P9JA 5L3AA 4G3FA 1YXVA 3R9RA 2C5YA 3LOKA 4ZTQA 2RFSA 4QQJA 2PVLA 2UZLA 2GFCA 3F5UA 3F7WA 4I21A 2VX0A 5IZFA 3JR1A 3LKMA 4I0SA 4GL9A 2B0QA 3E3BX 4LMUA 3QCXA 1J91A 2EVAA 2W1CA 2BUJA 2HAKA 3QD4A 3A60A 3PPKA 4NJ3A 2WTWA 1UNLA 2CDZA 3Q9YA 4RC4A 2VTOA 3WZKA 5IQBA 5EH0A 2H96A 3CJFA 3M42A 2PWLA 3L8XA 4GEOA 1Q97A 2QOQA 2C30A 4KD1A 2UW9A 5FTQA 4BGHA 5IUHA 3D83A 4M84A 2FYSA 2NRYA 2CMWA 2W0JA 3MPAA 4DINA 3RBWA 5LVNA 3ZC6A 3F61A 3CLYA 1X8BA 1SYKA 2R3GA 2YDKA 3ORNA 4G17A 3I6UA 4S31A 5C8NA 5D7AA 4PMPA 4PTGA 5CAVA 4EBWA 3P5KA 4HVSA 4W9WA 4E26A 5AR2A 5IISA 4JL9A 3FWQA 4HPUE 4JDHA 5FWKK 1S9JA 4GSBA 5E8UA 2PVRA 3EWHA 3RAWA 1Q24A 5M55A 4E4NA 2BKKA 4USDA 5CSVA 1JPAA 3D5UA 3UYTA 2A19B 5EM8A 5CF4A 4IHPA 1OIQA 3R1SA 3R73A 4DCAA 4E6QA 2YWPA 3A2CA 2YLEA 2WTVA 4AT4A 4GW8A 5JRSA 5CS6A 4FIFA 2QNJA 2ZM4A 5JZNA 2ERZE 5JFWA 3PA5A 3MS9A 4YJOA 3PXQA 4USFA 4IB5A 5CSWA 5C01A 4NM3A 4M68A 5HICA 4OT6A 1ZMWA 2QVSE 1WBPA 3W55A 5F95A 3ORMA 5J9LA 2GQSA 2VTAA 2QOBA 1CDKA 2Y6OA 3DDPA 4NM7A 3EKNA 3ZRMA 4F6UA 1CMKE 3GU8A 3DKFA 1OL6A 3MH0A 3OEZA 3OF0A 4EK3A 3U55A 1KWPA 3K54A 4BDEA 4X3FC 2UZVA 2UV2A 3AC1A 4KIOA 4C2VA 4NW5A 4YR8A 5BVOA 4XV3A 3V51A 3VIDA 2E9OA 2G2IA 4O21A 5HVYA 3HAMA 3SOCA 3GT8A 2QCSA 2W4OA 5DT0A 3ERKA 1IRKA 4X3FB 4X7QA 4G3CA 4C3PA 4NH1A 5EW3A 3EFLA 4WG3A 2WQMA 4D1XA 4DTKA 5EQYA 4IVBA 2ZM1A 4WT6A 2IO6A 2J0KA 3VF8A 5CANA 3KXHA 1BUHA 1OUYA 3OC1A 4L68A 4O22A 3K3IA 4FTLA 1PMUA 4QMVA 1XH9A 1VJYA 3R9NA 1NA7A 1Q8WA 2GDOA 5F4NA 5HI2A 3E8DA 3VUMA 3PXFA 3MVMA 3FZSA 4QTCA 3C0GA 4ZEGA 3R8ZA 1Y6BA 4BDKA 3OP5A 3EIDA 3KRJA 2ZV9A 3DKGA 5FLFA 5IQHA 4I92A 4B9DA 3OS3A 2XRUA 4I5HA 4HZRA 4FZAB 4J8MA 4L44A 4FKJA 1J7IA 3FSKA 4PPAA 5I3OA 4BIBA 1MUOA 4GIHA 4TYHB 4AT5A 3W2SA 3W32A 2V7OA 3Q96A 4AGCA 3U6HA 4ITHA 4L00A 3P7BA 3R8LA 3C1XA 3RHKA 3QXPA 2YEXA 3UIUA 1DM2A 2JITA 1PHKA 4PNKA 1V0OA 3ZS5A 4PF4A 4RG0A 4WBBB 4QPSA 4EH6A 5M53A 3RJCA 4GK3A 4O81A 2XIZA 4PDYA 3DK7A 4IVCA 3KKVA 3BE2A 1JKLA 4DEEA 2WHBA 4X2NA 4C3RA 1UA2A 2JKKA 3WIKA 2NPQA 5ETFA 1TVOA 3GCPA 1H0VA
chains in the Genus database with same CATH superfamily
2WQBA 3DA6A 3ZFYA 4R5YA 4CD0A 4JXFA 4TXCA 4RX5A 4HW7A 5CF6A 3L8SA 1MRVA 3OFMA 4R1YA 4GG7A 3VUKA 4AA4A 3HAVA 1HCLA 3C7QA 4ONAA 3L1SA 5EYKA 2RFNA 1SVGA 3NAYA 3WZEA 3AC4A 5CXZA 3L8PA 2GNHA 4G3DA 2IPXA 4JOAA 1K3AA 4EH9A 3IDPA 4EWQA 3AT4A 2ZV8A 4FNZA 4HGLA 3P08A 2JKOA 3KY2A 1CSNA 3MIAA 1OKVA 3I79A 2WQEA 4LGGA 3FMHA 1HOWA 2V22A 4ERWA 3FY0A 3QQLA 2GS6A 4XOZA 4BCQA 1XMLA 3Q60A 4BGQA 5M57A 4FC0A 4DHJA 1FQ1B 3D14A 2WMQA 3DNDA 3DXPA 2XJ2A 4LV7A 3V6SA 4FKTA 4KKEA 3WF9A 1OL7A 2P2HA 4PRJA 5AV1A 5GIOE 3W0MA 4RVKA 1YDSE 2IG7A 5HVJA 3IQ7A 4AA5A 4BVUA 1YWNA 4KINA 2HW7A 4GH2A 5D1JA 5CWZA 4XG4A 3W8LA 5HOAA 3ENHA 3IS5A 1K9AA 4P4CA 2X6EA 5AX3A 3KULB 4IADA 4AN2A 4CSVA 1MRYA 2X0QA 4C61A 4RA5A 4BWKA 3TTIA 4CZUA 2WOTA 3RINA 4PV0A 4DEHA 5I4NA 5HZNA 4ZLYA 4FZDB 4DCEA 3GCSA 2QO7A 3CY3A 3L9NA 4L46A 4AGWA 3PVGA 4O27B 2QODA 3EN7A 2X8IA 5KNJA 5GINE 3NEWA 3QAME 3VAPA 3A4OX 2ITWA 5IEVA 3EKKA 3MVHA 4A9SA 3MW1A 3QRTA 3LXKA 2REIA 1GY3A 4I20A 4YTHA 4F6SA 3LCDA 3IW7A 4RIOA 3TYKA 3WF8A 4GKIA 3R1YA 3H3CA 5E7RA 2UZBA 3FUPA 3NFFB 2VX1A 4MXOA 3UNKA 3W1FA 5I0BA 3FBVA 2RFDA 3QQJA 3MTLA 2UW3A 1VZOA 2QOKA 2I40A 3LFAA 4MBLA 3W16A 1TFFA 3GC7A 3DZOA 5C4LA 1U5QA 3FLWA 4E4LA 3KCKA 5J79A 2BDFA 2XBJA 4FVRA 4J96A 5IA0A 2IF8A 4QYHA 1STCE 2BIKB 2JAVA 2BFXA 3CJGA 4FV6A 5K9IA 1H08A 2G15A 2VTJA 3PXRA 4PDPA 4BCIA 2XM9A 2B9IA 3SLSA 4YJRA 4DT8A 5LXMA 3QQUA 2WMWA 3DQWA 3DTWA 1PW2A 3ZO2A 3VNTA 5CAPA 3SW7A 3GQIA 2J5EA 3ROYA 4LGDA 2XKEA 2BDJA 4IWDA 2HZNA 4ENXA 4YMJA 3FMLA 4D58A 4EZ7A 4QYEA 3BWJA 4FV4A 4AACA 1QMZA 3RP9A 4XP3A 5M4FA 4BL1A 4YLLA 4KIKA 3NMUF 5IDNA 3QZHA 4OBQA 5KX8A 2Z7RA 2PE0A 3PJ2A 3RPRA 3LQ8A 3COHA 4X3FA 5L2WA 2OH0E 3QQKA 1PXKA 5KMKA 3OT3A 2OLCA 1H25A 4YBJA 5FEEA 3PY0A 3RPYA 2YM6A 1WZYA 4FSQA 4UWBA 4QMTA 1IAHA 4O4DA 4DEGA 1KE6A 1WBNA 2C47A 1OVEA 2XB7A 1H1SA 3ZLSA 5J1VA 5C4KA 2PULA 1G5SA 3UQFA 5IPJA 2O3PA 4DFBA 5FDXA 2HK5A 5JEBA 4JVGA 4N70A 2H9VA 4FR4A 3C9WA 1TKIA 5C26A 3S0OA 2OJIA 4P2KA 2YN8A 2ITTA 3EB0A 5BVNA 3ZEWA 4DDIA 4D2PA 1WVWA 3RNYA 2BZKB 2R7BA 3IOPA 4QMMA 4XG6A 4MYGA 1QPDA 3G2FA 1WBSA 3BI6A 4S30A 4TYHA 3HKOA 4HVIA 4USEA 1UVRA 3DFCB 3PWYA 2IN6A 4YJNA 4JT3A 4RWKA 3F3VA 3TNHA 2XIRA 3CKWA 4FK3A 4QP3A 1R3CA 3CXWA 4RX7A 3KXGA 4YHTA 5CX9A 4F9BA 1BKXA 4FYOA 5CXHA 1VLRA 2WIHA 4CV8A 1PYXA 2QOIA 3BX5A 3IKAA 2O65A 5HLPA 4BC6A 3O8TA 1ZY4A 3QHRA 2VO6A 1H1QA 3DS6A 3DY7A 4UEUA 3IONA 3O71A 4N4SA 2R3KA 4ZZMA 4FIGA 3TUDA 3I0OA 1M2RA 3QLGA 4I94A 3R9OA 4BCJA 2BR1A 2PVJA 3A7IA 3DBQA 1R1WA 3G6HA 4E6AA 5CVHA 3CD8A 3WYXA 3KA0A 4BCKA 3COKA 3HEGA 4YLKA 1KV2A 2J0IA 3NW6A 4MWHA 5M56A 3O8UA 2AC5A 2GNGA 3ACKA 3C4ZA 4FKRA 3MVLA 1UV5A 3N51A 4JBQA 4C0TA 3I4BA 5LVOA 3H10A 4DITA 3VS3A 2ZVAA 4FNYA 4NFMA 4Z9LA 3R7EA 2H8HA 2VZ6A 4BI0A 3FL4A 3R9HA 4MXYA 2BIYA 2PUNA 1XH5A 3G9NA 4FTRA 1G8SA 3DXNA 1OBGA 2F2UA 5IQGA 4N6YA 5CU2A 3DBCA 2YZAA 4K0YA 5M44A 2Z2WA 5LWMA 3QTZA 3K3JA 4G16A 4KAOA 3G9LX 4IXPA 4JG6A 4MX9A 3RMFA 2UVYA 2YAAA 4KKGA 4UMRA 5JFSA 2OK1A 3QHWA 5EDRA 4GK2A 3TKHA 2HENA 4BCMA 3Q9WA 2XAMA 4Q5HA 5GHVA 1H1PA 1IEPA 2JEDA 3MA6A 5K3YA 4JR3A 2R2PA 5CI6A 4DFUA 3QWKA 4XJ0A 3LFSA 3TKUA 2I7QA 4EH2A 2DYLA 3EN5A 4FIJA 4O7YA 5FP6A 5KMMA 4G2FA 5HG7A 1U5RA 1ZRZA 2OH4A 2XKFA 4AAYA 4DDGA 3F7ZA 5JQ5A 3NIEA 2ITXA 3NNUA 4MCVA 4CVAA 1YVJA 2BRBA 2V0DA 3ZZEA 3RHXA 3UDTA 3QLFA 3RM7A 2V62A 2QD9A 3QA0A 3P0MA 2YIRA 3TCPA 3UO4A 2QG5A 3N9XA 4JS8A 3V5LA 2UVZA 4EKKA 3H4JA 2XJ0A 4OTHA 3HV6A 4U6RA 4D9UA 3R22A 2Y7JA 3BLHA 3UOLA 5EM6A 3KRWA 4DH1A 3IK3A 3BZ3A 2VX3A 4C8BA 1H01A 3NUUA 3ZEPA 3GQLA 1ZMVA 3FQSA 4E5WA 4FV2A 4HYHA 2WNTA 4LRJA 1WCCA 4YZCA 2PMLX 2WMRA 2XNOA 5AIKA 3MY1A 4U40A 5GJFA 5H9BA 1DAYA 3RAIA 3WARA 4EI4A 2HY0A 1PXNA 3OWJA 3R1QA 3FPQA 4LOPA 3CC6A 3QZIA 4D5KA 4Y73A 1VYWA 3TWJA 2ZYBA 5DE2A 4AXCA 2XNMA 3SRVB 4NWMA 1XO2B 5HE0A 1H4LA 3LJ0A 2J2IB 4M3QA 3V5PA 4CZTA 4QMWA 2JDSA 1REJA 4F1OA 4FSTA 3BYVA 4CFVA 3FPMA 3IGOA 4MBJA 3TACA 3ORZA 2R64A 2QOOA 5L6WL 2JDTA 5J5TA 5ANOA 4DC2A 5FDPA 3Q53A 4G6OA 1BL6A 3HLLA 3ACJA 5HO8A 3AKLA 2J50A 4YZ9A 2G1TA 5M4IA 4JDIA 2R5TA 1Q5KA 3QTXA 4RLLA 2JC6A 3GU7A 2BZJA 3LCOA 4F70A 3VO3A 3O0GA 3C50A 2GS2A 3W0QA 1H24A 2GQRA 2XANA 5EQPA 1Q61A 3SXRA 3SC1A 4L43A 2X81A 3QRJA 4IX4A 3QCSA 4FKUA 3I5NA 4RQKA 3P79A 4MF0A 5EDPA 4DG0E 3PUFC 4I5PA 4IEBA 5DR2A 4CFWA 3CD3A 3FYKX 4B8LA 5BYYA 4YJPA 3FHRA 1YWVA 3NX8A 4IQ6A 5CASA 4UZHA 3VBWA 5LCKA 4WNOA 3TZMA 4ZTSA 4A07A 2FSTX 2R7IA 1XQZA 2UZNA 3RVGA 4CRSA 4DGLC 4BFMA 2A1AB 4DFZE 1OIUA 2UZOA 4FL1A 2I1MA 4N6ZA 4WUAA 5I9WA 2I0VA 2XH5A 4NFNA 1M14A 4H3QA 1ERKA 4QTEA 2UZEA 5HE2A 4UMUA 4MF1A 3JPVA 2ZV7A 4B0GA 4O84A 3D5XA 4CQEA 4DBXA 1KE9A 1XR1A 3DBFA 2ACXA 3HV7A 1OB3A 1BLXA 2ERKA 2VGOA 3FQEA 2E9NA 1Y8GA 4E4XA 4O1PA 3NNWA 2AYPA 5BX0A 5AM7A 4FTTA 5AFVA 2HY81 4GYIA 5TKDA 3VBVA 2CKOA 3W2QA 2CNUA 1UU3A 2VAGA 4O4CA 3D7TB 4QP1A 3AKKA 3EOCA 1YW2A 5HESA 1JSTA 4IZAA 4FT9A 3R7VA 4ACGA 5AV4A 3CTQA 3QQFA 4I0TA 4D4YA 5KUPA 4ZZNA 3L9LA 2P3GX 3UO6A 1H26A 2VO7A 1G3NA 5GIPE 2SRCA 2UZDA 3GGFA 3OROA 4MWIA 3UMXA 4F4PA 4KSPA 4MTAA 1U4DA 3RZFA 4I24A 4CTCA 3EJ1A 4DFNA 2I0YA 4XBUA 4JNWA 5DOSA 3W0RA 3NUYA 4YZDA 1EH4A 3ATSA 3V6RA 2WOUA 4ZIMA 5DRDA 4O7LA 3AC3A 4FSUA 2UW4A 1G8KA 3OZ6A 3GB2A 3VS7A 5DEYA 3QC4A 4WUNA 5IA5A 1IR3A 3QKKA 4ACCA 4PMSA 1ZMUA 3M2WA 4CV9A 5FP5A 2YCSA 4V05A 3UIXA 3QU0A 4F99A 4YC3A 5E90A 5KMOA 4WNPA 3SGCA 4FT3A 5DA3A 4ZLOA 4F7JA 5FXQA 2OSCA 5K5NA 4ZSLA 4IFCA 3F2AA 5IA4A 3KREA 2IVTA 3HV3A 3E87A 4LG4A 5IQAA 2H34A 5KBRA 4TKSA 4RRVA 4FEXA 2PVMA 4O7ZA 3DCVA 4QDEA 3TG1A 4L45A 4OTGA 3JVRA 4O96A 4Y95A 2I6LA 3PPZA 3CQUA 1KV1A 2OICA 4HGSA 4ASXA 5L8JA 4XV1A 5ETIA 2HXLA 4TNBA 3FMJA 5LMKC 2FVDA 3OHTA 1GNGA 2PE1A 5BNJA 4P7EA 3BU5A 5E8SA 5KMNA 4U97A 4BDFA 3QXOA 4GKHA 4EHZA 2XP2A 4L42A 5EOBA 3FZOA 4HCUA 4DN5A 1LUFA 5TF9A 4WG4A 3FZTA 3T9TA 4C4HA 4TL0A 1R0PA 4D1SA 4ASEA 3P4KA 3PWDA 3NUNA 4AT3A 2XYNA 3WF7A 4WD5A 5KMLA 3ID6C 5EM7A 4F63A 3MA3A 2VTIA 4EJNA 2JDRA 3PDTA 3ZLYA 4FUYA 4FL3A 3A8XA 4AWIA 4M7IA 4Q9SA 4JBOA 3OWPA 4E1ZA 4QDVA 4MUQA 2WXVA 2V7AA 4RC3A 4FT0A 4EOLA 4Z3VA 3QC9A 1FBNA 1Y91A 3CR0A 2WTIA 4O7RA 4HNIA 4L6QA 3Q5ZA 2XNGA 2CLQA 2CGUA 3HYHA 5CT7A 4ZTHA 2OGVA 2X1NA 3MH3A 5J9YA 1GOLA 2W4KA 3FLQA 4EHVA 2XAOA 4YZBA 4ZSEA 3RWPA 5FD2A 2Y4IC 3BBWA 4EQCA 1OBDA 1RE8A 4L9IA 4QPAA 2DUVA 4IC7A 3GVUA 3TT0A 4HVHA 2XK4A 3PG1A 3CE3A 1XH8A 5JMSA 3WZJA 3OOGA 2Y4IB 3SRVA 3ZOSA 4UY9A 2P0CA 4FYNA 3D4QA 4UV0A 1JQHA 2IW6A 4II5A 1WVXA 4AOJA 5GNKA 5E92A 1R78A 4FV8A 3U6IA 1PXLA 3VJOA 3F66A 2WGJA 1AGWA 2BHHA 5M06A 3JY0A 1KSWA 5ETAA 2B7AA 3MH2A 5GJGA 2RG5A 4U42A 2RG6A 1UU9A 3EN9A 4JX7A 3NUAA 5A4LA 5HCZA 3QCYA 4ZJJA 4DGNA 2WTCA 4AGDA 3DU8A 4YNOA 3PP0A 1FGKA 2ITPA 3BEGA 4A4OA 5BUIA 3W0NA 3JXWA 1AD5A 2WQNA 2C6DA 3OD6X 3QFVA 3SAYA 4BDCA 4EQMA 4YTCA 3KIOC 1LR4A 4H05A 2WD1A 4QMOA 1IG1A 3W8QA 4IW0A 4O7SA 2PZPA 4Z7HA 1GZKA 2PVNA 2Q0BA 5D11A 1ZZ2A 3PYYA 1KOAA 3IPHA 4IAIA 4D4VA 3VN9A 4ANMA 1ZYDA 2G2FA 4I6BA 4RFMA 5FEQA 3RCJA 4TN6A 2XALA 4MXCA 3A7HA 3F3TA 5M09A 5CYIA 4CGAA 3EMGA 3R7IA 4BDGA 4FEVA 5B2LA 3ML1A 3UMWA 4BBFA 3OXIA 4AFJA 3H9FA 4L3JA 3BL7A 3C5IA 2VTSA 1OL5A 3PLAE 1JAMA 4AU8A 4I6LA 3OCGA 5HG5A 4AF3A 2PHKA 4F1MA 3ZBFA 4IB1A 2C6MA 3QL8A 3NLBA 2PZIA 4NCTA 4UXLA 3ZRKA 4DEBA 3KF4A 4GYGA 4TWOA 5EHLA 3VUDA 2QI8A 5AJQA 3VUIA 4L7FA 3T3UA 3SA0A 2ZDUA 1YQJA 3FJQE 4IZYA 4BCPA 5BVKA 1Q99A 2VN9A 4J97A 5JSMA 1Z57A 3OMVA 4RZWA 4DLJA 1XWSA 1Q8YA 4PX6A 2XK8A 4BCNA 5LMBA 3VULA 2W4JA 3SW4A 4TWNA 4C02A 2O8YA 3D2IA 2B9JA 3D7TA 5BYZA 5LMAA 3RPVA 5BUJA 3AT2A 2YIXA 4EC8A 2PE2A 2V55A 3EYGA 5CVGA 4YU2A 3TTJA 5AP4A 3DJ7A 3MVJA 5B0XA 5CEIA 4Z16A 2GHLA 1YKRA 4GVAA 3ZXZA 5M4UA 1PYEA 4AQCA 3DXQA 2X9EA 2ETKA 4WSQA 2IZUA 3C5UA 5JT2A 4XBRA 5EYDA 3UVPA 4D4RA 2Y9QA 4EWHA 3UQGA 3QWJA 4PL4A 5CU0A 4D1ZA 3JUHA 4EK4A 2OW3A 3Q6UA 5HLWA 5IMEA 4FT5A 5CTPA 4O7VA 3SXSA 2GCDA 5AIRA 4M69A 5GJDA 5BUEA 5CSHA 4W4XA 4X2FA 1GJOA 3IG7A 2CKEA 3E92A 4RT7A 3VBQA 3V3VA 3ZH8A 4BZOA 4YURA 2UZUE 5F1ZA 4TWPA 3BU3A 3H0YA 5JFXA 3GCVA 4EH4A 1M7QA 3FKNA 3AD5A 4WNMA 2BRHA 1FOTA 4OUCA 4F0IA 3CCNA 2ITUA 3MBLA 3WOWA 1XH4A 2UW6A 4PMMA 2PZYA 1OM1A 2YLFA 4QOXA 5CNNA 4NJDA 3HMOA 4G3GA 3W0PA 3PJCA 5CZHA 5HBEA 2EXMA 2OWBA 2DQ7X 3QTRA 1SNUA 4L3PA 3F3UA 4OT5A 3ZO1A 2B55A 3TUCA 1O6KA 5LVPA 4I93A 1SNXA 2JAMA 1Z5MA 4KIKB 2W1FA 3AGMA 3BHUA 5AP5A 4R3PA 2FSLX 3LZBA 3ZLXA 3AQVA 3HVCA 2QONA 3KCFA 4HCTA 4MNFA 2C5NA 5CEMA 3EQGA 2CCHA 3SXFA 5LMKA 4RVLA 4UWCA 4H1JA 4XLVA 5AA8A 3QA8A 2IEWA 4GRBA 2B52A 1NVQA 3BHTA 4FV1A 5BPYA 4RZVA 3R71A 3TNWA 4ANSA 4A4LA 4JRVA 3RAKA 4AP7A 2OIQA 3EQCA 2QR7A 3RM6A 3GOPA 4IWPA 1T46A 2OI4X 3FI2A 3QUEA 1GAGA 4J95A 1OPJA 3FMKA 3NIZA 4FSMA 4FTKA 3DDQA 4IBMA 4LYNA 4PDSA 2CGWA 5DEWA 1TQPA 1YOMA 3ZSHA 5DMZA 2WMUA 3HNGA 2GNLA 3LFCA 4W8DA 5AUWA 4CFMA 5IQCA 4W4WA 1BYGA 4AQKA 4FODA 4HYSA 3F2NA 4IH8A 3D2KA 1UWHA 3MJ1A 4FTIA 4O91A 4AW5A 2Z8CA 3TIYA 5L2SA 3EQFA 4PP9A 5C27A 4IX3A 2X8EA 3UGCA 2YM5A 3HX4A 2QKRA 2X0PA 4PTEA 4IAKA 5HQ0A 1ZYJA 3OT8A 4XEYA 4ANQA 3BYOA 1M2QA 4I1ZA 4U81A 1R39A 1OIYA 4IIRA 3IECA 3BQCA 3LQ3A 4YBKA 1UU7A 2XK6A 4EKLA 3H9RA 2JDVA 1XKKA 4IACA 5I9VA 3UZPA 3R28A 5A6OA 1S9IA 4BI1A 4YTIA 2X4ZA 2F49A 3BE9A 4GFOA 4RWLA 3S95A 4CKRA 3ET7A 3GENA 4FGRA 3UG1A 3VS1A 3FSFA 3K2LA 4BDAA 4E3CA 2WFYA 1RW8A 3DNEA 3EHAA 2ZFYA 5FXRA 3A7GA 4S2ZA 3EFWA 2GPHA 4YZNA 4BDDA 2VWIA 4Y72A 1JSUA 2J51A 3A4PA 3U9NA 4BKYA 2BTSA 1JLUE 3G90X 4U0IA 3R7UA 4IWOA 4FKLA 3ZONA 4DGMA 3LPBA 5KE0A 4G6LA 3AD4A 3LM0A 3P5JC 5EW8A 3MFRA 4BTFA 2WEIA 3HRBA 2XZSA 5F9EA 4LQMA 2XEZA 4JBVA 2XNEA 2YCRA 4ZOGA 4OW8A 2OU7A 3NS9A 4KS7A 5HO6A 5HX8A 2RL5A 3HRFA 4GG5A 4Q9ZA 3Q6WA 1JNKA 2XMYA 4O0TA 3WE4A 4C4GA 3MYGA 4RIXB 5HBHA 4NIFB 4E6DA 3VW8A 1LEWA 4BI2A 5BVDA 5KHXA 1WAKA 4I23A 4WBOA 4K77A 4GUEA 2XA4A 3OOMA 1B6CB 3NYOA 4EZ3A 4I0RA 5DGZA 3MESA 3V8TA 4GIIA 2O64A 2X9FA 3DJ6A 3VC4A 5K5XA 5CZIA 4GFMA 3Q4CA 4W9XA 3NFGB 4HGEA 4IJPA 5E8XA 2ZDTA 3O7LD 3O8PA 1JOWB 2XNNA 3M1SA 4U44A 2PUIA 1OPKA 4DT9A 2XBAA 1OGYA 3RNIA 4ALWA 3BELA 3OW4A 1OGUA 4OTIA 1ST0A 3G0FA 4FV7A 4R1VA 5CY3A 4EK6A 1PKGA 5TO8A 3SQQA 4KIQA 1XBCA 3R9DA 2IW9A 3ODZX 2W1HA 4S33A 2KULA 2F9GA 4U3ZA 3EQHA 1YHVA 3UYSA 4NM0A 4X3JA 2Q0NA 4C37A 4E73A 4QTAA 1W84A 4JRNA 1NY3A 3A7JA 3CEKA 1B39A 4I5MA 5TR6A 4A9UA 4ALUA 1OKWA 2YCQA 3HDNA 4OTFA 4NEUA 4QYYA 4PL5A 1FVRA 2Z7SA 5D12A 1P4FA 3IDCA 3ROCA 4FV9A 4EUTA 4ZAUA 4CLJA 5KMJA 4D2VA 4EH5A 4EOKA 5J87A 3EFKA 4O2PA 4BCGA 1YI3A 3HV5A 2EUFB 2R3MA 3KEXA 3KMWA 4EH3A 1ZOHA 5TE0A 3UNJA 2PY3A 3FC2A 1Q41A 3MFUA 5HE3A 3VS5A 2X8DA 4F0FA 3BGZA 3KL8A 2R3LA 2YM8A 3PIYA 3W2RA 2XUUA 2VTMA 2OIBA 3E63A 2BZHB 4E20A 4OAUC 4EJ7A 1L3RE 2WMXA 4A9YA 4FE2A 5DFPA 4XUFA 3ZZWA 5LJJA 1ZYSA 4CYJA 3UJGA 1RJBA 4O6LA 4DAWA 2VUWA 2W7XA 5J9ZA 2Q83A 3ZUTA 4MXXA 4YJSA 2VWZA 3AOXA 3HL7A 4BZNA 2W1ZA 2Z60A 4KNBA 4ZTMA 3HUBA 5AAFA 2AC3A 4XG9A 4X2GA 4OTRA 2XCKA 5CVFA 4ZS4A 2AQXA 1GIJA 3QTIA 2X39A 4J1RA 3ORLA 4RGJA 4U45A 4AUAA 4CYIA 5JGDA 4QMXA 2W9ZB 1REKA 4J99A 5CALA 4FKQA 1KOBA 2G01A 3EQRA 3PSBA 3KRLA 3KVXA 3P7AA 2R3IA 3R01A 3V5QA 2P4IA 4AZEA 3GC9A 3KMMA 3MTFA 3R2BA 1PXJA 2VWBA 3ETAA 3IW5A 3LFQA 3SV0A 5I3RA 4XV2A 3Q52A 3I6WA 4XP0A 4P90A 2GSFA 3NDMA 4V01A 4DHIB 1JKSA 1QCFA 5LOHA 1V0BA 5AR4A 3FMNA 2W1IA 4X2KA 4JMQA 3IW4A 5CAUA 1J3HA 4M13A 3VUTA 2NO3A 4QNAA 1PF8A 3BV2A 4F7LA 2Z02A 3TNIA 1DI8A 5JN2A 4X6QC 3FC1X 4DTBA 5G1XA 3FI3A 2UUEA 5DT3A 3VUGA 5BMMA 2OJ9A 3TJCA 4FT7A 4C62A 3LFFA 4ENYA 5JGBA 2VO3A 4FKPA 3G5DA 2QU6A 3MGYA 3PZEA 2VWYA 3ZDUA 4EONA 3QTUA 4NT4A 4M12A 5EQEA 4LRKA 2QOCA 2YDIA 2E2BA 4CFXA 1JVPP 1ATPE 2E9UA 3IDBA 2QO9A 4FG7A 4MEDA 4U41A 5HNIX 4RIYB 4XH6A 5EYMA 5CENA 1SVEA 4QP4A 3KU2A 4F9AA 5FM2A 1M17A 1E1VA 2CGXA 4C3FA 4CTBA 3E3PA 2FO0A 3R7GA 4B6LA 5L2QA 1Q4LA 5EYCA 4FTCA 5CEOA 1OL2A 2A2AA 1IA8A 3E7VA 5ETCA 5HEZA 5T6KA 4F09A 5AX9A 2R3QA 4LOQA 4PY1A 4ZMEA 5A4QA 4NW6A 2PTKA 3V04A 5HHWA 5M08A 2UZTA 2NP8A 2BTRA 3OG7A 5CU4A 3V5WA 3C0HA 3BIZA 2YM4A 3UIMA 3QZFA 2VTRA 4MK0A 2X7GA 4I5CA 4DH8A 2WTKC 2CLXA 2YA9A 4K18A 3C4XA 3FZ1A 2VTQA 3VS6A 3V01A 3LMHA 3GBZA 4NM5A 4KBCA 4X6RA 5G6VA 2C1AA 4J7BA 3TIZA 3Q5IA 3H9OA 3ZM9A 3SHEA 4WO5A 4P5ZA 4EOSA 2WELA 3EN6A 3UPZA 4C58A 4WNKA 3WBLA 3BRBA 3LCSA 3POZA 4TYIA 3EL7A 1YXUA 2HWPA 3FZRA 4FKIA 4OR5A 3KMUA 4G5JA 3UOKA 4C7TA 5I5ZA 4C34A 4RPVA 3FI8A 4FG9A 2RKUA 3FZPA 1W2CA 3QUPA 4QYGA 4RIXA 4IC8A 5CSXA 4NIFA 4UX9A 5D7VA 3FLZA 3O96A 4MNEB 2PVFA 3G51A 1ZOGA 3PXYA 1XJDA 4IAZA 3VW6A 3REPA 3FXWA 4KBAA 4DH5A 4IDVA 2QLUA 4RJ5A 3IOKA 3FAAA 1KE7A 3AMAA 1W2DA 3B2WA 4LV5A 2XRWA 3N4VA 4CG9A 2H6DA 3R0TA 1ND4A 3RTPA 4GU6A 3C0IA 4KBKA 3GC8A 1P4OA 4BB4A 4BCHA 4C4EA 2XYUA 5GZ9A 2FUMA 5AP1A 4UYNA 5E4HA 2YIQA 2WMSA 5KZIA 2CSNA 5IEYA 2QHMA 3MJ2A 3ELJA 3ZDIA 2C69A 3U4WA 4BKJA 4D0XA 1ZZLA 3CQWA 3C4CA 4OTPA 4U79A 4EHEA 3LFNA 3NRMA 4FIEA 5DRBA 3UDZA 2BZIB 5AUYA 3TZ9A 1W82A 1XBAA 2CHLA 4EEVA 3H30A 5FBNC 3VUHA 4CLIA 3RWQA 1WBVA 4AXAA 2RGPA 3G0EA 5IA1A 3ZO3A 4HJOA 3BBTB 1P2AA 1Y57A 4DEAA 5E1SA 5KKRC 5EKNA 4BRXA 2WKMA 3A62A 3QYZA 4FV0A 5AR7A 4DGOA 3FL5A 3QD0A 4UXQA 2X0OA 4C33A 2ITOA 2X0GA 3POOA 3GUBA 2GMXA 3TDWA 3SOAA 5KKRB 5H8GA 4BDBA 4AG8A 3FLNC 2QQ7A 4MH7A 4FTJA 3GP0A 4C4FA 2WU6A 2WPAA 4ZK5A 2OJJA 2X6DA 5B7VA 1NVRA 1ZARA 2C6KA 4ACMA 4F9CA 4K8AA 4X2JA 4DE4A 4WG5A 3OY3A 3FDNA 3LXPA 3QTSA 4J8NA 1E9HA 4XG3A 5AP6A 4NUSA 4QT1A 3W33A 4G6NA 5CU6A 3WE8A 3ZFXA 3C4EA 3OUNB 3PY3A 4GMYA 3RI1A 5TOZA 1KE5A 5AV2A 2JGZA 3F5GA 4YZMA 2VO0A 3QQGA 4FICA 3QRKA 4AW0A 4I22A 4F1TA 3PXZA 4QMPA 4ZSGA 5AUTA 3KGAA 3E5AA 3KN5A 4M66A 1P14A 5DR6A 4FV5A 2C6TA 3PJ8A 4BN1A 2X7FA 4YC6A 3BKBA 4JR7A 5J1WA 5HU9A 4KRCA 2BRNA 5AUXA 3QZGA 3Q9XA 4EOPA 2QG7A 4Y83A 4O7WA 4FZ6A 4GT3A 2HCKA 2W5BA 4KRDA 2OXYA 3HRCA 5HNGA 4EQUA 4ARKA 3TMOA 2LGCA 3NUSA 4IX5A 4EBVA 3NCZA 1H0WA 5IF1A 2IVSA 4HCVA 3NWWA 3JYAA 3CGFA 4M0YA 4RA4A 4YO4A 3PRFA 4BGGA 3RKBA 2J7TA 5LQFA 2UVXA 5FUTA 5AEPA 3E93A 1YXSA 3HGKA