2VNWA

Structure of pka-pkb chimera complexed with (1-(9h-purin-6-yl) piperidin-4-yl)methanamine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
total genus 106
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vnwA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vnwA02
3EFJA 2XK7A 1KE7A 3N4TA 2ERZE 2WTWA 3OCGA 3D7TA 2XK9A 4BR3A 5FWKK 5CNNA 1YI3A 2W1GA 4WKQA 3VJNA 4EK5A 2HY81 1OIUA 4EOLA 3C9WA 2I1MA 2CGWA 2O3PA 2XVDA 4AZVA 2R3HA 3UG2A 4C59A 3MIYA 5CEMA 5IH4A 3MESA 2ACXA 5LJJA 1P14A 2BDFA 4YZCA 1OUYA 1J91A 4XLIA 3PDTA 4A9TA 5FEEA 2YCFA 3CPCA 2JKKA 4JNWA 1YOMA 5AAEA 4C4EA 4AFEA 4V04A 3BELA 5BVFA 3I60A 5HLPA 3BHTA 3EOCA 4RPVA 3E93A 2CKPA 4WSYA 5KKRB 4QMSA 2IVTA 3L9NA 4YZMA 3IGOA 3ETAA 3QTRA 5FXSA 3SHEA 3A7GA 2W4OA 2G2FA 3IK3A 5AP0A 4ZY4A 4DHFA 4F9CA 1WVYA 1NW1A 1BUHA 4NT4A 4IWOA 4BCHA 2XNEA 2JBPA 1VZOA 3KF7A 3LXLA 5FBNC 3U4UA 2ETRA 1OM1A 3FYJX 3OTUA 4MNFA 2JITA 4JDIA 4I3ZA 3B2WA 5CF6A 3ZFMA 4EHZA 4CGAA 1PXKA 2OSCA 2R3GA 3DJ5A 4BN1A 4DG2E 4ZZNA 5M53A 4FNWA 4G3DA 1U4DA 1Q8UA 5AP4A 5FD2A 3R9NA 2UZOA 3DLSA 1YHVA 5A6NA 1XBAA 4CG8A 5JFWA 1WZYA 4C4GA 5BVNA 2OJIA 1YRPA 2WTDA 1GZKA 4N70A 5HVJA 4BI2A 5IQEA 3ZXTA 2OIDA 3ZMMA 1JLUE 2W96B 4X3FB 4EKLA 2RL5A 3ENHA 4X3FA 4EH9A 4PL4A 2YDKA 2QG7A 2CN8A 4OBPA 4ASXA 4EQMA 4YJVA 3LMGA 3LMHA 4KIKA 4FV9A 4GU6A 3TNHA 4GJ2A 3CIKA 3VUDA 4KIQA 4DEAA 4E4NA 2XRUA 3EKNA 3P9JA 4I20A 1UKHA 3GU5A 4UWBA 3UC4A 3A62A 2ITXA 3BZ3A 3W2SA 4USDA 5KHWA 3FY2A 2B4SB 4EEVA 3D94A 3LFNA 3RAHA 3V8TA 3UE4A 3R22A 4R7IA 2GQGA 4Q5HA 2PZ5A 4MF1A 4OGRA 4GT5A 3GOKA 4OTQA 2PMNX 1H08A 2YIRA 2OJ9A 2C5OA 3POOA 5FTQA 4EK8A 3DZOA 4LOQA 4OTWA 5DG5A 2ZMDA 3MS9A 1RE8A 4GSBA 3F6XA 2GFCA 4AGWA 1SMHA 4F9BA 4X3JA 5I4NA 2YZAA 4FSZA 2VO0A 5DR2A 3MVMA 2QU6A 2X81A 4QMMA 3PA5A 1PXNA 3RCDA 4AS0A 2F2CB 1XH5A 4TTHB 3SQQA 3SVVA 2I40A 3NUYA 2X8EA 3L8SA 4WG5A 3VBTA 3Q4UA 3II5A 2VX3A 2XIXA 3PY3A 1H1SA 2YCQA 2GNHA 5HO8A 4ANMA 2QOOA 4FKJA 4MX9A 4CZYB 4QP9A 3HGKA 2G15A 1H25A 2IVVA 3D5XA 1V0PA 2UZUE 3UGCA 5HTIA 3MVJA 1ZYSA 2ZM4A 4DG0E 3FLNC 4DH5A 1XH8A 1M7QA 3CY3A 3UO6A 4OTFA 4XV3A 2ESMA 3D9VA 1YWRA 5CI7A 3EYGA 2X9FA 3BLRA 2GDOA 4OTHA 3ATTA 3ZDUA 5A54A 3ZZEA 2QOQA 3CJFA 3QQKA 4ZSJA 2Q83A 3HAMA 5LVNA 4DT9A 3NGAA 5FDPA 5K3YA 2X7OA 4C37A 5CY3A 3HUBA 5C26A 4NIFB 3R9RA 2C5XA 2CMWA 5JMSA 3FWQA 5IQBA 1OL6A 2EVAA 3MYGA 5JQ5A 1YOJA 3MY5A 3HZTA 4B7TA 2J0KA 4OBQA 1W0XC 3DJ7A 3SDJA 1R1WA 5HX6A 4Y95A 5HU9A 2ZJWA 3HV7A 3RK5A 2VTAA 4YHJA 3FSKA 2YFXA 3PZEA 3PIXA 4RWLA 3TEIA 3W2RA 5DRBA 3WZJA 2YISA 2RF9A 3Q9WA 1U59A 2I7QA 3JYAA 4IJPA 4PP9A 5CASA 4P5QA 4BTJA 1SZMA 4BDDA 4XJ0A 2EXEA 2XYNA 4DFNA 5HZNA 3PJ2A 4YURA 1H8FA 2BRNA 4EOPA 3C51A 4GK2A 4NH1A 4O91A 3HMOA 4QQ5A 2BVAA 4XOZA 4OT6A 4RT7A 3WE4A 4F6SA 3NUPA 3PUPA 4PPBA 3RVGA 5J5SA 4GS6A 4A7CA 4FTNA 1AD5A 2BDJA 5LMAA 3R7EA 3VUTA 2HW7A 5CAPA 3W2OA 1H26A 4XP2A 3NRMA 4AZFA 2YDIA 3VQUA 1OKYA 4D2SA 5DH3A 4F64A 5AA9A 2WQBA 3QKKA 5I3OA 1DS5A 3DXNA 4KWPA 2UVZA 4RFZA 3VW6A 3WIKA 1EH4A 2BPMA 2XK6A 3TKHA 1VJYA 4L3LA 3O7LB 1OUKA 3QTSA 5BYYA 4DT8A 2Y4IC 2ZMCA 4EORA 5AUTA 4R7BA 5CVFA 3R63A 4D1XA 5KKRC 3P1AA 4PQNA 4O0TA 4Z7HA 4N6YA 4BCIA 3O8UA 1UV5A 3G9LX 3JUHA 5L4QA 3ROYA 2BKKA 3F5XA 5ACBC 3R83A 3UMWA 5FEQA 2XYUA 4F63A 5HCXA 1XH9A 2OWBA 1PRYA 3O23A 4HCTA 1OECA 3FZTA 4FEQA 3UG1A 1VR2A 3QRTA 5GHVA 3MSSA 3R02A 4MBLA 2WU6A 2P0CA 3KCFA 4J8NA 4AGCA 4C02A 1P4FA 4BI0A 4QQJA 3UVPA 4ACHA 3L8XA 3IDBA 5CYIA 4EYMA 5IMEA 4R3CA 3KXGA 5AV2A 4CMOA 2BR1A 4IADA 2X2LA 4ZSLA 2R3FA 5HI2A 3NDMA 3NW6A 1PHKA 5M4UA 4RVLA 4M8TA 3V5WA 3FI8A 4IMYA 4PDSA 4L68A 5JZJA 1WCCA 1UU8A 4P90A 2W9FB 4D4VA 4PP7A 4GYGA 4NK9A 4IVDA 2LAVA 4FNYA 2WTVA 3VBXA 3ZYAA 2NO3A 4S34A 1JSUA 4CRSA 2ONLA 4OTRA 1VYZA 4FIFA 3TTIA 5EI2A 1NXKA 4YHFA 3R9HA 2YWPA 5HO7A 4M69A 2V62A 4JS8A 3O96A 4LYNA 3VJOA 3B8QA 5ANEA 3K5UA 3BGZA 4JG7A 3NEWA 3BV2A 4I21A 2WMQA 2BIKB 4XG6A 1UNLA 3SGCA 4IFCA 5I9YA 4PL5A 4O1PA 4J97A 4E93A 1OKWA 3GNIB 3R28A 5CXZA 3IO7A 2J6MA 3BKBA 1PXJA 4EOQA 3A60A 3ZO1A 1KE5A 2PMIA 2HELA 4L67A 4EH2A 4USFA 4AN9A 4M84A 2CNVA 1YI4A 1K3AA 5EW3A 2SRCA 3LFAA 3QYWA 4J8MA 4LOPA 4BTKA 2NPQA 2XP2A 5HIEA 1W98A 5IUGA 5EM6A 3VC4A 3CTHA 3KFAA 4YTFA 4CFXA 3I7CA 4DEIA 3U6HA 4DEEA 4R6VA 4AACA 3DJ6A 4FTUA 3HMMA 5KMMA 3NUUA 3QC4A 4B8MA 4TWPA 3Q5IA 4IB3A 4HW7A 4TYJA 4ACCA 3QTXA 4IM3A 2JKOA 3LCDA 3KXNA 2UW5A 4RMZA 3ZBXA 2B7AA 3IW7A 3LVPA 5E8UA 4CNHA 1SM2A 2BCJA 4FKUA 1J7IA 3QUPA 3QKMA 3WF6A 4FGRA 3NUXA 3BYOA 4ZTMA 4UX9A 4LGGA 4FOBA 2C6MA 3KY2A 4CFUA 3OROA 4FIHA 3DT1A 3FI4A 4QMVA 4FIIA 5JRSA 4C61A 1IASA 1Q8YA 4FSNA 4NFMA 3MI9A 5DPVA 4CT1A 3DA6A 4FV5A 3S3IA 4PNKA 4GKIA 4E8AA 3FQEA 3PG3A 2BRHA 4IHPA 4WUNA 5ETAA 4B8LA 5FXRA 3NVMB 2X7FA 2GCDA 1URCA 4A4XA 3GU4A 3O0GA 2V55A 4U6RA 2OZAB 3TACA 4FZ7A 3UNZA 4W9XA 4TXCA 3ZSIA 5IA3A 3W16A 2WZJA 5CZHA 3PLSA 2W5BA 3W18A 3ROCA 2X8IA 3BIZA 4NIFA 4RIXA 3W8QA 5ETCA 2ITQA 4PMTA 4YJNA 1A48A 3ZSHA 4XEYA 1PMNA 1KV1A 3F5GA 4M68A 4FI1A 3TL8A 4DYMA 2W99B 3D2KA 5LVMA 5H8BA 1O9UA 2ZOQA 3QTUA 3BGQA 2G9XA 3L8VA 3A8WA 4BGQA 2WXVA 1HCLA 5LMKA 4QQTA 4FV2A 4AA4A 3SRVB 2WIHA 4IZAA 2ITZA 3LFQA 5BMMA 4JIAA 5JQ8A 1SVEA 5IF1A 5JRQA 4ITJA 4PUZA 4M3QA 2I0HA 1KWPA 4UALA 4MNEA 1JOWB 3KULB 4UY9A 5FXQA 5IEYA 4DEBA 4G9RA 3N4VA 5H8EA 1J3HA 2V5QA 1OKZA 4OT5A 1JKLA 4ZJIA 4A4OA 3NVKI 2O8YA 4MBIA 2I0YA 4QD6A 1QPDA 3BYVA 4AA5A 4HVDA 4IE9A 5B0XA 4IC7A 4DCEA 4RX8A 5KO1A 4N6ZA 4AT4A 4QP6A 5ETIA 3V5TA 4AGDA 1NY3A 3ORTA 4HYHA 3QWKA 4FTCA 3REPA 2IO6A 3PP0A 4BDCA 2HXQA 3EQCA 4OAVB 2PVLA 2EWAA 1CTPE 4K2RA 2V0DA 2OU7A 2OO8X 3BU6A 1WBPA 1OPLA 4DBNA 5B2LA 2GFSA 3DDQA 1BL6A 3FXZA 3GC9A 4LRJA 3WYXA 4CLIA 3D5VA 3PVWA 3SOAA 4BCPA 3ORXA 4CV9A 2UW7A 4DA5A 3RM7A 4FKGA 2LGCA 4GT3A 4KRCA 4FTMA 5FRIA 2RSVA 3GOPA 2H6DA 5CSWA 2HCKA 2OFUA 4CCBA 4IB5A 4UV0A 4RA4A 4OTDA 2A1AB 2PVKA 2XNBA 3AGMA 3C4CA 2IWIA 3TJCA 4TYHB 2CCIA 5K0KA 1GY3A 4ZTHA 1YDSE 3EKKA 3F2AA 4IZ7A 5KE0A 4AWIA 5J1VA 2EXCX 4IAFA 3OY3A 3PY1A 4TKSA 4FV6A 5D7AA 4E73A 1O6KA 2F7XE 1E1VA 4KBCA 1Y6AA 4D5HA 1OB3A 3FLZA 3G51A 4ZS4A 4M67A 3DV3A 2HK5A 4NM7A 4PMPA 5AAGA 4BB4A 4I0RA 5M09A 4P2KA 4IWPA 2XIZA 4C4HA 5TF9A 3RAIA 3VF9A 3QRKA 4EH5A 2VZ6A 3FHIA 3EQRA 3LPBA 4JRNA 5CANA 4FE2A 4CSVA 3ZLWA 4ID7A 2YM3A 5ANGA 3CGOA 2F7EE 4GL9A 1F5QA 5A4EA 4NU1A 2YIQA 4QMZA 4EI4A 3R7VA 2JDSA 2OKRA 4O6LA 1OKVA 2W4KA 5HBHA 5IISA 3COIA 3F5UA 2C3IB 3SAYA 5LVLA 4ZTRA 4AAAA 3F3ZA 5AP6A 2Y4IB 4AW2A 3GT8A 3PRIA 4GFOA 3CLYA 1UNHA 4APPA 5E8TA 4FTLA 3UO5A 3V8SA 3KA0A 2WQOA 5KMLA 5EW8A 2QKWB 5LOHA 2WHBA 3Q9YA 3ZLXA 3TKUA 2ITYA 3ZUTA 5HX8A 5HD7A 3WZKA 1GZ8A 1UWHA 4PDYA 4BIDA 2R7IA 2QONA 4RBLA 1ZXEA 1CMKE 3C1XA 5DGZA 3QCQA 4KSPA 3DKFA 3QQLA 3SW4A 1DM2A 4BCKA 3WBLA 4U3YA 3V5JA 5E92A 4HCVA 4RC3A 2C47A 3OHTA 4TPTA 3FYKX 5AWMA 3AMBA 3UC3A 3OXTA 4JBQA 1X8BA 2R9SA 4U5JA 4BIEA 4JIKA 3R1NA 4DC2A 1V0OA 1H0WA 5AUYA 1MP8A 2IVUA 2WTKC 4C4IA 5C8KA 4DFYA 4DN5A 4WHZA 1PMUA 1IEPA 4OTPA 3AC8A 4Y85A 5EOBA 3FZPA 5E91A 4O0UA 3MW1A 1QL6A 1ZOHA 3DTWA 5IDPA 4I5MA 3VULA 1K9AA 3LFSA 1UWJA 4HCUA 5HNIX 4C33A 4W9WA 4WT6A 3E88A 2JDOA 3G9NA 4QOXA 5I9XA 3VBQA 3E3PA 1B39A 1U54B 1GAGA 5HG9A 4GV1A 2ZDTA 3ORZA 3EQDA 4L45A 5IQCA 2YIWA 1IAJA 1IAHA 1FVRA 3RK7A 4LQMA 5JFSA 2KTYA 3L1SA 3A7HA 2PVRA 2WMSA 4FYNA 4I23A 3PRFA 3PXRA 4JRVA 4L44A 5EH0A 5FLFA 3CR0A 4BZNA 5M4FA 3JY0A 3BE9A 5HTBA 3DCVA 1P4OA 3UPZA 5E8ZA 4NYEA 4ITIA 2DWBA 2B9HA 1AGWA 3QALE 4XNEA 3RKBA 2IZRA 4DFZE 2XNNA 3OF0A 3GFEA 3IECA 3QA8A 3FXXA 2ZDUA 4K11A 3QZHA 4JDJA 3RAWA 2Z60A 3QHWA 4NJDA 4YTCA 4CT2A 2R3PA 2JD5A 2UZVA 1R39A 2X9EA 5CQWA 5CWZA 4M0YA 4RJ6A 4BVUA 4U8ZA 4IDTA 2G2HA 5J7HA 4BDFA 5HLNA 1SYKA 4XV2A 1OMWA 4ASEA 3KULA 5HLWA 3E62A 2C4GA 3COMA 3C4ZA 5E9EA 3R0TA 3UIMA 4XCUA 4EC9A 2RIOA 3GUBA 3ALNA 4LRKA 4S32A 5CU6A 5LXMA 3GCUA 4FT5A 2R3LA 4M97A 1O6YA 2OIQA 3FY0A 2YLEA 4G1WA 1STCE 4WNOA 3S00A 4FL1A 4IAKA 4QPSA 4KKHA 3IW8A 4FOCA 4OLIA 4MXAA 4X3FC 3P0MA 4R3RA 3I0QA 3OC1A 4RIYB 5KBQA 1Q8TA 3U9CA 2CCHA 2OJJA 3ZO3A 2XM9A 3QTWA 2C6DA 3OBJA 5GZ9A 4IBMA 4GK3A 3FKLA 3WZEA 4DH1A 5JGAA 2BFYA 4PMMA 4XH6A 2CHLA 2R5TA 3H3CA 4CYIA 3FPMA 2QO9A 5CF4A 5DFPA 5FM2A 3HRBA 3KN6A 4HYIA 5DOSA 4FEUA 2JDTA 4JG6A 4WBOA 4E6CA 2X1NA 5JGDA 5KMKA 4FV0A 1Q41A 3VUGA 4CG9A 4UYNA 4ASZA 2Y4PA 3TKIA 3O2MA 1WBOA 3UOHA 2R3JA 4IEBA 4NM3A 2A19B 3IDCA 3TNQB 4D2VA 4L42A 3HVCA 1SNXA 4MD8E 4RC2A 3FC1X 4M15A 5IZFA 1ATPE 4OUCA 2C6OA 3BBWA 1BI8A 4HVSA 4TL0A 4QMNA 4RJ3A 1H1PA 4Z16A 4APCA 3DKOA 3BHYA 2I6LA 4EBVA 3FLQA 4CXAA 3K2LA 2XNGA 4UXLA 3CP9A 2Y6MA 3QAME 3CTQA 2NP8A 5DNRA 5HIDA 1DAYA 3TZ7A 4NZWB 5BVEA 2ZM1A 3IQ7A 3COHA 3K54A 5DIAA 4KB8A 3VVHA 3I81A 1OBDA 2I0EA 3KRJA 2ITOA 4G3CA 3WE8A 2R3QA 2JDRA 4JAIA 5ACKA 1WVWA 1GOLA 2PSQA 3E3BX 3CXWA 2J2IB 4C3RA 2JKMA 4KAOA 4UMUA 3GU7A 5ANJA 3LMIA 4ZK5A 1ZYJA 2CNQA 3CSVA 3A7FA 2WMTA 3E7VA 3FLWA 3OTVA 4JAJA 4NM0A 3TV7A 4YLLA 3F9NA 4D0WA 4M7IA 2VRXA 4PWNA 2NNWB 1XH4A 4RQVA 3FI3A 5EKOA 4FV8A 5C4LA 4X2JA 2VX0A 4O7LA 3O17A 3ORKA 5D11A 3TM0A 3NX8A 2Z7SA 3QQGA 3QQHA 3COKA 3SC1A 4KRDA 5L8LA 3U8WA 4L43A 3F3UA 4WA9A 3I5NA 4YBJA 4W4VA 3LQ8A 2R2PA 1MUOA 2CLQA 4QRCA 3WF7A 5C9CA 1E9HA 2OZAA 4YZ9A 4A07A 4FZDB 4FA2A 3HAVA 5H8GA 3BHHA 3OXZA 3V8WA 2C1BA 4NM5A 5CQUA 3PLAE 3EYHA 2YZLA 3HP5A 2XJ2A 2ZB0A 4XP0A 5EHOA 3QRUA 3MVLA 1Z5MA 4CLJA 2XZSA 4FZ6A 4QPMA 2DUVA 5KBRA 3G90X 2C6EA 2IZUA 4L7SA 5EG3A 3ZO2A 3PJCA 1ZARA 3IW4A 4U0IA 2FH9A 1Q5KA 3UPXA 3LFCA 4BWXA 1U5RA 4OR5A 5HE0A 1H4LA 4ORKA 3M2WA 4I94A 3W10A 4GT4A 3IW5A 2VWVA 4W8DA 3PYYA 1H07A 4KABA 4IAAA 3F66A 5HORA 4FT7A 2BAJA 2BAKA 4EJ7A 4QTAA 1YDTE 2W1EA 3QA0A 4WIHA 4FR4A 4ACDA 5AR4A 3W2QA 4G17A 3AXWA 4I6BA 4D28A 4F7NA 1O6LA 4R1VA 1CSNA 1UVRA 3MGYA 5I5ZA 3MBLA 5K0XA 1Y57A 1B6CB 3FXWA 4EH3A 3VS1A 3DFAA 2F2UA 1VYWA 2YCSA 4U9AA 3OEFX 4FT3A 3PPKA 4EH4A 4AZTA 5AR5A 5CI6A 4J99A 5HNBA 3JXWA 1ZLTA 4HYSA 3LOKA 4FKQA 5HU3A 4BHNA 4FC0A 4JG8A 4F4PA 4FV1A 3RGFA 3LCTA 2X6DA 3ZCLA 4YZDA 4I92A 4DBXA 2C5YA 3BBTB 4EOKA 1NT2A 1PXIA 2Z8CA 3EN6A 3F2NA 4H39A 4R1YA 5EHLA 3POZA 3QZGA 2X4ZA 1JPAA 2PVNA 3OOMA 3RAKA 3KN5A 5EDPA 4KSQA 2QOIA 5BVOA 4BGGA 2VTPA 1FGKA 1IR3A 2JEDA 3SW7A 4IVBA 2B54A 3ZM9A 5IKWA 3ELJA 3M42A 4D1ZA 5IU2A 4D55A 2PUPA 2GNLA 3FSFA 3OFMA 4DF3A 1ERKA 2EB2A 2XIYA 1I44A 4H58A 5TKDA 3N4UA 2QI8A 4EOIA 4QMLA 3DGKA 2WFYA 3CD8A 3BYSA 4IX3A 3FL4A 3BYUA 3P7AA 4NW6A 1Q61A 4F1TA 4FMQA 4YNOA 2W1FA 1RDQE 4UXQA 1H27A 4PL3A 2YM4A 4P4CA 5EYMA 1Q4LA 5BVWA 5DRDA 3KCKA 4MD7E 4P7EA 4FSRA 2ITNA 3AC4A 3FC2A 3LFBA 5A4CA 3KB7A 4FBXA 4C57A 3PIZA 3SG9A 3EN4A 3RK9A 2UW3A 4O38A 3F3VA 2XEYA 3RPVA 2VTIA 3E64A 3HYHA 2ZAZA 4GK4A 4XRJA 3LXPA 4HPUE 4C38A 3QX4A 4BCJA 3E63A 2GQRA 2PU8A 4C62A 4EUUA 4M12A 4R5YA 4WD5A 4AZWA 4TN6A 4V0GA 2W7XA 4CD0A 2OI4X 4Y5HA 4QYEA 4RFYA 3O51A 4C0TA 5J9LA 4LRMA 3TDVA 3VRYA 3AMAA 2GNJA 4C4JA 4FTRA 3ITZA 4IVAA 4UEUA 4TNDA 2GNGA 2XCKA 2UW0A 5D10A 4PPCA 2GS2A 4E26A 4CFWA 1JKSA 3R1QA 4FSTA 3PPJA 1ZYDA 3R8MA 5L2WA 4H3BA 3GCSA 3UBDA 3DAJA 4DLJA 4U43A 3GGFA 3GBZA 4Y72A 4FNZA 3LQ5A 3I1AA 1U54A 3V51A 2A4LA 3Q60A 2DS1A 2PZIA 2QOHA 2CGXA 1WMKA 3ZM4A 2JGZA 4MWIA 4O86A 3LW0A 5AP7A 2J0IA 2QC6A 2W17A 1Q99A 4LMUA 3ANRA 4NSTA 3IOPA 4AZEA 3QRJA 1CKPA 5A46A 4GVJA 1W7HA 4I1ZA 2DQ7X 3JY9A 3MFTA 4TWNA 3UQGA 4F9AA 5AP2A 5HO6A 4TWOA 3MIAA 5HOAA 3ZFXA 4XX9A 4I0TA 3MPTA 4TNBA 3M1SA 4I5CA 3G15A 1UKIA 3D2IA 2WMXA 2O65A 3KXZA 3DLZA 3BU3A 5H2UA 5AA8A 4FEXA 4HVGA 1XBBA 4S30A 3WF5A 3A99A 2GS6A 4D2PA 3Q5ZA 2PL0A 4CZUA 2IW6A 2VD5A 4FIJA 2X2KA 4TYHA 1PXMA 4JVGA 2ZVAA 5CALA 2GMXA 2IZTA 2J0LA 4EHEA 3HRFA 3F61A 3FDNA 4XS2A 2HY0A 3KKVA 4E20A 4Z7GA 4FSQA 5JH6A 4RVTA 3TXOA 5GIPE 3T3VA 2GHGA 4ZTNA 4CFFA 2C3JA 4BHZA 2QR7A 1PYEA 2W06A 5DR9A 3AOXA 4AZSA 1OL5A 4QMTA 1OGUA 4GCJA 4XOYA 3DY7A 3L9LA 4M0ZA 3TNIA 4O7WA 4U7ZA 2PUIA 5HBJA 4RG0A 4C2WA 4B0GA 2HIWA 2WMUA 4F08A 3QUEA 4HGSA 1NVRA 4PNIA 5BUEA 4MD9E 4C3PA 4DGNA 3TNPC 5DI1A 1FGIA 5M44A 4X2GA 1GJOA 2WMWA 2YM7A 3Q9XA 4YC8A 3EN5A 4G2FA 3EJ1A 4NJ3A 2ITPA 3LLTA 4AOTA 4HOKA 4AOIA 4BGHA 5AUVA 4EYJA 4K6ZA 5M57A 3TN8A 3I6WA 4ZMFA 4FZAB 3QZFA 3PPZA 4O0RA 5HIBA 3OZ6A 3LM0A 3OWLA 2AC5A 3DTCA 3C0HA 4LUEA 4WO5A 2QO2A 3KMMA 2P33A 3NS9A 1G3NA 4YUQA 2Y9QA 2C6TA 1QPEA 2XIRA 3DOGA 3KRRA 3EHAA 1JVPP 5CS6A 3F3WA 5BVDA 4QYYA 3GP0A 3CKWA 4BRXA 5EFQA 3UQCA 2WIPA 2PE0A 2CKQA 4F0FA 4IQ6A 5J87A 5EYKA 1IG1A 4ERKA 2Y6OA 3R7IA 5KNJA 2CKEA 3IGGA 1S9IA 3HUCA 3LJ2A 1LEWA 3PXKA 4FVQA 4QP3A 4QMQA 3HMIA 1FINA 4BC6A 4BKJA 3EQIA 2GSFA 2QHMA 3HP2A 4HNIA 3ZEPA 4BYIA 3WZDA 4CFVA 4YTIA 4G3EA 3FHRA 3DBEA 4MTAA 5FEDA 3PSDA 5HHWA 5L8JA 3W32A 3DKCA 4AX8A 1PXPA 5CSHA 3UODA 4RIOA 3MN3A 2WNTA 4ZTLA 4BDHA 2BTSA 4ANQA 5CF5A 4IZ5A 4EH6A 3TV4A 2IW9A 3FZRA 4CMUA 3ET7A 5ANDA 4YJPA 3U55A 3KREA 5BQ0A 3EL7A 3MPAA 3FJQE 4XUFA 3QX2A 1KE8A 3ZLYA 1OVEA 2FUMA 3LM5A 1U5QA 2VTHA 4CQGA 3VS2A 1APME 4R8QA 3BHVA 3NAXA 3OT8A 3Q4TA 3TZMA 4GG7A 3BGPA 2GTNA 2UUEA 4JR3A 4LG4A 4MBJA 4XP3A 4F7SA 1MRYA 3C50A 4PV0A 2Y0AA 4CFMA 4FTTA 5CEPA 4YJTA 3QD2B 4XG2A 3HV4A 4G5JA 1JNKA 3LLAA 4YJSA 2GHLA 2W9ZB 3FL5A 2O63A 4ZJVA 4O81A 2Z7RA 4ZOGA 5DLSA 2Z7LA 4H3QA 5E1SA 5E8YA 3LCOA 4FG8A 3QQUA 4CFNA 3PG1A 4ZZMA 1IA9A 4FKVA 5I9UA 3HX4A 2OLCA 4CRLA 2XNOA 4JI9A 3C4FA 3LJ0A 4CEGA 3EFKA 5AX3A 2VNWA 3B8RA 1WBSA 4YJQA 4C58A 5KCVA 2C30A 4K77A 3P08A 4B99A 1CM8A 2W05A 2X7GA 3NCGA 3RNIA 2OH0E 5JSMA 3GQLA 1OL1A 3LAUA 3HNGA 5HG5A 3R7OA 3WF9A 4EWQA 4D2WA 3R71A 2IZSA 3QF9A 4NWMA 3MV5A 3SA0A 4F1MA 1L8TA 1WVXA 1JQHA 1Y91A 4Y8DA 2BZIB 3DNDA 4YJRA 2ZM3A 4EC8A 2F9GA 4RC4A 2HXLA 4AT5A 4TYIA 4UWCA 5JZNA 5L2QA 4ZP5A 5HICA 3HV5A 5A9UA 2JLDA 3I6UA 3KRLA 4FKIA 4EK6A 4XG7A 4ZEGA 2UZBA 5IMXA 1XJDA 2XNPA 4KIKB 1R0EA 5EOLA 1PMEA 4IAYA 5FDXA 2YA9A 3TWJA 4MXOA 4DH7A 5LMKC 4HGTA 4TZRA 4XG3A 4EKKA 2RFSA 2PZYA 3JPVA 5EI6A 5J79A 1URWA 1XBCA 1ZZ2A 3ZUVA 4BDBA 3FKOA 4J52A 3Q52A 4LV8A 3R00A 3VS5A 1T46A 4DGMA 1RW8A 4RX7A 5GJDA 2XCHA 4U45A 5IEVA 5E8WA 5J95A 4G6OA 4U41A 3DAKA 4IB1A 1XQZA 4AN3A 3CEKA 1W83A 5ANKA 4X2NA 4ZY5A 3WF8A 3MB6A 4GU9A 2C68A 2YHVA 3VHEA 4A4LA 1G8AA 4I6HA 5EDQA 3H0ZA 3QXPA 2R3NA 2RKUA 3G6GA 3MH2A 3MH3A 3ORLA 3TZ8A 3UVQA 5LWNA 4AW5A 2QO7A 2H96A 1OPKA 2AC3A 4QMOA 1Q24A 3OBGA 4YPSA 2O2UA 3L9MA 2HYYA 3TUDA 5AUWA 4U44A 3LXNA 4EK3A 2HAKA 2B0QA 4H1JA 4M14A 2W1IA 3C5IA 2XKCA 3PWYA 4BKYA 3ULIA 5AP1A 5BYZA 3TJDA 3KVXA 2JIUA 4V01A 1ZOEA 2EXMA 3GC8A 2RFEA 5A14A 5CVGA 5CU2A 3ZONA 3H9FA 4R77A 4D4YA 4LGHA 2J9MA 3R7GA 4IVCA 1QPCA 4BBMA 2BALA 3OCBA 2VUWA 2PYWA 4O7NA 5EQEA 5DT3A 3NPCA 2HENA 2XUUA 4UYAA 4KNBA 3KMUA 4NTSA 3BCEA 4CKRA 2ZV8A 4G16A 3VAPA 5LCJA 2IN6A 4GVAA 3S2PA 3A4PA 4E5AX 4F1OA 4NUSA 5F20A 3NCZA 2YJRA 3T9TA 4QO9A 1GIJA 1PKGA 3E8NA 4FSUA 3UVRA 5IQFA 4O0XA 4Q9ZA 4BDAA 4KIOA 1DI9A 5M4IA 2BZJA 4DEHA 4EL9A 5CAUA 3E8EA 3GB2A 4AW0A 2HW6A 3ID6C 3EQGA 4IFGA 3RHKA 4FK3A 2HWPA 3RTPA 3MJ2A 5CXHA 4HYUA 4O21A 1K2PA 2B53A 2XKDA 5HNGA 4CQEA 4NEUA 4XV1A 5E90A 4FG7A 3AT2A 2UVXA 2VTJA 4DGLC 4ENYA 4F70A 4K8AA 3ZRLA 2YCRA 3DBQA 4EHGA 5C27A 2UZWE 4NW5A 3DB8A 3K3IA 2OK1A 3QCXA 4G9CA 3MVHA 3U51A 4B6LA 3PP1A 2VWBA 4YLKA 5CAQA 5J8IA 3DBFA 4AOJA 1BLXA 3FQHA 4CMTA 1OI9A 4XBRA 1TQIA 1Q8WA 5AP5A 5CEQA 4EK4A 5HKMA 3GCQA 3LCKA 3V5QA 1J1BA 4UMQA 5AR3A 3O8TA 5J7BA 2C69A 4E4MA 4OW8A 4ALUA 2J90A 3D7ZA 2X4FA 3L9PA 3W55A 5KX8A 4UMTA 4JL9A 5H3QA 3NIEA 4J95A 3VQHA 4GEOA 4KKEA 4UZDA 3VRZA 3HEGA 3DBDA 2BHEA 3A7IA 3G6HA 4RSSA 5EYDA 5AV0A 3SV0A 1BKXA 1XR1A 3THBA 3QU0A 2C0IA 3CJGA 4W4XA 3NNXA 3OW3A 5KZ0A 4Q5EA 3W1FA 3ORMA 4FYOA 3VF8A 5KMIA 3HV3A 3WILA 4DEDA 2WELA 4GKHA 3QC9A 2Z02A 2JIVA 1Y6BA 4RX9A 4DEGA 5KMNA 3D5UA 3DKGA 3QUDA 4YGAA 4YTHA 2VN9A 2QOCA 3OWKA 5IA5A 3UP2A 3FMKA 3QXOA 3RBWA 3UTOA 3ORIA 4N4SA 4CV8A 4DAWA 4BDEA 5L6OA 1OIQA 3FLSA 2QLUA 4XRLA 3BI6A 2BMCA 5E1EA 4BWKA 4B9DA 3NYNA 4WUAA 3VWAA 2QOFA 4K1BA 2WMRA 4HZSA 2BROA 4QQCA 1JKKA 4R7HA 5IA1A 4ZSAA 4L00A 2Z2WA 3BX5A 5AUUA 5AR7A 4QP2A 1UNGA 4TWCA 3OEZA 3UMXA 5EDRA 4JR7A 3M11A 4U81A 1OPJA 3EMGA 4AA0A 2XK8A 5JEBA 5LVPA 3BHUA 4CKIA 2BFXA 3F82A 2XJ0A 3VUHA 3EQHA 3OY1A 5CT0A 5LARA 4PX6A 1KE9A 3MJ1A 3LQ3A 3UNJA 1SNUA 3D0EA 3E92A 4S31A 4NKAA 4YJUA 4E7WA 4O0SA 2A27A 2H9VA 3OS3A 4MCVA 3FZOA 1GZNA 2GQSA 3G5DA 3P86A 3H9RA 4QTBA 4X6QC 4XG9A 5DT4A 3V6RA 2PUUA 2CJMA 2WU7A 2X0GA 4RWKA 2W5AA 4E5BA 3Q6UA 5A4QA 1LR4A 2QHNA 4I41A 5FGKA 2C6KA 5CZIA 3RM6A 4AE9A 5KUPA 2V7AA 3WOWA 1ZYLA 3P4KA 3AD4A 4F99A 3O8PA 1TQPA 5TT7A 4EJNA 3CD3A 2OGVA 3D83A 3OW4A 3GC0A 2CN5A 3MFUA 4ANLA 3PFQA 5GJFA 3RZBA 4A9UA 2C3LA 4PTCA 2FA2A 5E4HA 2WPAA 4IM2A 2VAGA 2W5HA 4F6UA 5I9WA 1M2RA 3K5VA 4FICA 5FTGA 2W1ZA 3LFFA 5CSPA 3R8ZA 4O2ZA 1YXXA 2GNIA 4G6LA 2UZLA 3BEAA 1KE6A 2VO6A 3MH1A 3IONA 5AP3A 2OFVA 1ZY4A 4E4XA 1FVVA 1ZRZA 5E7RA 1M7NA 1YKRA 4JBVA 3TG1A 1YOLA 2P4IA 2IPXA 3KRXA 3ODYX 4GIHA 2C5VA 2F57A 3DS6A 5HQ0A 5AADA 4ERWA 2HZIA 5CTPA 5HG7A 4FKWA 5CU3A 3RWPA 4F65A 4WNMA 2OICA 4O0YA 2YITA 5M51A 5D9HA 2XBAA 2XIKA 4D2TA 4II5A 1VEBA 3UOLA 3TDWA 3NUNA 2UW9A 3P7CA 3PA3A 5EK7A 1YDRE 3RP9A 4F0GA 3A61A 4FSWA 4RVMA 3GU6A 2VO3A 5FM3A 5JFXA 2ITWA 3CS9A 3QTZA 4FTJA 3KVWA 3KMWA 4HNFA 4QP4A 4YZNA 4ARKA 4BCFA 5J1WA 3O50A 4GMYA 2RFNA 4EZ3A 3ZZWA 4Y73A 5HVKA 4BKZA 2R3IA 3BEGA 3S0OA 4BCGA 5GINE 2OBJA 1ZMVA 3E7OA 3RJCA 4P5ZA 2WTJA 4HJOA 1Q62A 3AC2A 4GJ3A 1PW2A 2FSLX 2G2IA 3BV3A 3PSBA 4ZSEA 5HE1A 4WNPA 2XBJA 2YIYA 2UW8A 3P7BA 1TQMA 2FO0A 2V7OA 2C6IA 3EB0A 2VTLA 4IXPA 4USEA 2BIYA 2YM6A 3TNWA 3DDPA 3AGLA 4MK0A 3RI1A 2VTNA 2CDZA 2VWIA 2UW6A 2UZTA 4L9IA 3RPSA 5A4TA 1KUTA 2BTRA 2ITTA 2ZV9A 2Y7JA 4Y5QA 3UJGA 3QKLA 1FMOE 2GHMA 2YN8A 4G6NA 1HCKA 2YEXA 3KGAA 5IA4A 3O7LD 2UW4A 2AUHA 4WOVA 2F4JA 3EN7A 3ZHPC 5K5NA 2Y8OA 1FQ1B 3GCPA 3ULZA 4BL1A 4FVPA 3EFLA 4I5PA 4O7ZA 4W4YA 2FYSA 2QQ7A 5H9BA 3I5ZA 5BPYA 2XRWA 2WTIA 1DAWA 1WFCA 2YM8A 3C7QA 3Q4ZA 5M55A 3TUCA 4A9RA 5AV4A 2VU3A 1ZWSA 1PY5A 1ZZLA 3N9XA 1V1KA 3EN9A 5EHYA 5L2IA 4ZMEA 1IRKA 4ZXTA 2H8HA 4JX7A 4YP8A 4JDKA 3FV8A 1W8CA 4GUBA 4FF8A 4I0SA 4FIEA 5AX9A 2WTCA 3ANQA 1XWSA 4OTIA 4X6RA 3R2BA 2VWWA 4A06A 3DB6A 5CU4A 4EZ7A 5DHJA 3ZEWA 3ZXZA 4H05A 4UMRA 2ETKA 2WO6A 5AFVA 2X2MA 1UU7A 4JXFA 3R01A 4L53A 1NA7A 5I0BA 3PVGA 3QFVA 3MFRA 4IACA 3R6XA 3GXLA 4FT9A 3RCJA 2PMLX 4Z3VA 2WKMA 2YWVA 4G31A 4U79A 5IH6A 3GU8A 3RZFA 1ND4A 2OH4A 5K5XA 1PF8A 4ANSA 1ZOGA 1HOWA 4L01A 3QL8A 4EWHA 1MRUA 2ZV7A 2CSNA 4KIPA 4ASDA 4OAUC 4HVHA 1XH7A 4FSMA 1SVGA 4AQCA 4YLJA 1YW2A 3D4QA 3DQXA 3ZRMA 4FGBA 4FSYA 3QQFA 4M66A 4E5WA 3KK8A 3JVRA 5BVKA 5GNKA 5KZIA 3PVUA 3C5UA 4YC3A 3HA8A 2QG5A 3R73A 3R8UA 3ZC5A 2RG5A 2OJGA 4GFGA 4N0SA 2OG8A 4QP7A 4B4LA 5L8KA 4I93A 3SX9A 5IEXA 3GQIA 4RZVA 3UDBA 3ZLSA 4DFUA 3R1SA 5IDNA 3H10A 5K4IA 5B2MA 5IUIA 4Z55A 1M52A 4X2FA 4O83A 5EQPA 3F3TA 3MWUA 4QYFA 4L52A 3UZRA 2E9VA 4TYEA 1F3MC 4LUDA 3WYYA 2VTOA 3EL8A 4PTEA 3U87A 4U80A 2WMVA 5T68A 4XMOA 3VBWA 3VS7A 3ZS5A 4AUAA 5A4LA 3FUPA 3VUKA 3DK6A 1GZOA 2B9IA 2QOKA 4WRGA 4IDVA 1QMZA 2OZOA 3MB7A 3QGYA 4O6EA 3G33A 4O7TA 2CGUA 4Q9SA 2UZNA 3ZDIA 3G2FA 3HMPA 4MEDA 2J5EA 4YBKA 3VNTA 3H9OA 3ZU7A 4ANBA 1Q3DA 3MA3A 4FUYA 3SRVA 3CPBA 5ICPA 2XM8A 3QCSA 3PXQA 4S2ZA 2P2IA 2J50A 3U54A 3P23A 2J4ZA 3BLHA 1W84A 2OIBA 4L8MA 4FODA 4BZOA 3GEQA 3I79A 4DH8A 4O27B 3DU8A 1MQ4A 5EKNA 3SD0A 1OZ1A 4RGJA 2OXYA 3FMMA 4BDGA 3Q3BA 5EM7A 3GCVA 3Q2MA 2E9NA 1P5EA 2ERKA 3T9IA 3VS0A 4YSJA 4EH8A 4IWDA 4MH7A 1OIYA 4GUEA 2GS7A 2QCSA 4IJ9A 4KBAA 4U3ZA 3Q53A 2P2HA 4D9TA 1LP4A 4DFBA 3NW5A 4RZWA 4JDHA 2PVJA 4FL3A 4O0WA 5C8NA 4JJRA 4O7SA 5BUJA 1PMVA 2E9OA 4R5SA 5JGBA 2B9JA 2B52A 2UZEA 2EB3A 5AM6A 4WNKA 3EQFA 3ORPA 4QMPA 1KV2A 3NAYA 4FV7A 2A0CX 3SXRA 4LFIA 3FI2A 4FKSA 4FUXA 2YIXA 5FP6A 3P79A 3ZTXA 5DE2A 4EQUA 2YJSA 4ALVA 1OIRA 2BUJA 2OF2A 2R3KA 3BE2A 4U40A 3TCPA 3ZC6A 4F7LA 3EFWA 3ZBFA 5HBEA 3TI1A 4PY1A 3R7UA 4RFMA 3IW6A 4DGOA 3NWWA 2HZ4A 4UN0C 4KUJA 3FMHA 3RPYA 1H1QA 3R9OA 3WZUA 4BY9E 4KS7A 4IX4A 3V3VA 1XKKA 3K3JA 1FOTA 3OOGA 4KKGA 2QNJA 4MXCA 4FVRA 4PPAA 4ZLYA 2PE2A 4AE6A 3SG8A 5GIOE 5FQDC 5FUTA 1B38A 4HVIA 2VX1A 2PK9A 5A6OA 3U6IA 1YXTA 2PHKA 4C36A 2PULA 3VS6A 1WAKA 3FKNA 5F9EA 5ITAA 3D15A 3HV6A 5B2KA 5T3QA 4AG8A 3D5WA 4O7RA 3C4EA 4MQ2A 4OBOA 1XH6A 1UA2A 5M4CA 4BDJA 2B9FA 4BFMA 3QGWA 3H0YA 5T6KA 2NRUA 4EOJA 5FBOA 4FL2A 5AMNA 3H4JA 4BYJA 3DQWA 2ONLC 4D4SA 3S95A 5LWMA 2YAKA 1M17A 3QLFA 3LKMA 3F7WA 2PTKA 4DH3A 3VBYA 4BCNA 4E6QA 4QTEA 3EWHA 2OJFE 2UZDA 4FV3A 3V6SA 4FKTA 4HZRA 4NTTA 3FZSA 5DWRA 2XEZA 2JFMA 1JSVA 3QD4A 3FMJA 4GIIA 3AQVA 5I9ZA 5IG1A 4UBAA 4PMSA 1WBVA 4OTGA 5CF8A 3A2CA 4QNYA 2WEVA 4YJOA 3E8CA 5C8MA 1SVHA 3AT4A 5K4JA 4F9WA 1Q97A 5BYLA 3R30A 1S9JA 3SXFA 4RLLA 4QNAA 5J9YA 3ACKA 3U9NA 2XMYA 2XS0A 2CLXA 5EW9A 3FZ1A 4E3CA 5LVOA 3FQSA 3H30A 3Q96A 4G3GA 4YMJA 4GW8A 3IDPA 4H36A 1BX6A 3R21A 3BPRA 2BHHA 3NNUA 4GRBA 3P78A 2QVSE 2XF0A 1M14A 2R3OA 3PXZA 5ANIA 4Z9LA 3C0IA 4FIGA 1R0PA 4C2VA 2O0UA 5CEOA 1Q8ZA 1YWVA 3DNEA 3QTQA 4JBPA 1UU3A 4O7VA 3D7TB 3UOKA 4R78A 4BF2A 4WSQA 3ALOA 4MNEB 5IQDA 1YVJA 2R3MA 2XK4A 2YLFA 4O84A 3NYVA 4CTCA 2B55A 4QPAA 1A9UA 3RHXA 5I9VA 1BI7A 2OF4A 4RX5A 1Q3WA 3R2YA 4MAOA 3PY0A 5CNOA 5J5TA 3FPQA 4EOOA 5FG8A 4EONA 1REJA 2WTKB 3MY0A 3QTIA 2VGOA 4JOAA 4U97A 4YZBA 5JFVA 3KU2A 3FE3A 4FTQA 3VO3A 3ZO4A 3HL7A 2J0JA 1PYXA 3SOCA 1ZYCA 2O64A 4RIXB 1FBNA 3AC5A 3LIJA 2YABA 1OITA 4FTAA 5A3XA 4YO6A 3LE6A 3VN9A 4RIWA 2YDJA 3RINA 3LXKA 4YC6A 5GJGA 4R3PA 4BWPA 2QOLA 1G5SA 2Q0BA 2BRGA 4K33A 4BI1A 5L2TA 1YXVA 3HECA 1W82A 3RALA 5AJQA 4RJ8A 3R8PA 3AMYA 4PDPA 4NL0A 2PPQA 3VHKA 2QLQA 2VNYA 2HZNA 4O0VA 3SLSA 3RMFA 3VUMA 1I09A 2GPHA 4DINA 3N51A 3OCTA 4FTIA 3FLYA 4WRSA 5AR2A 1RJBA 2HOGA 5DYJA 2H34A 2PMOX 1LPUA 1J7UA 3S4QA 1AQ1A 3TTJA 2JDVA 3DK7A 3OT3A 4Y46A 2VV9A 2QODA 2CGVA 5F94A 5JK3A 3OVVA 3GI3A 3PJ1A 5HVYA 4BTFA 2J0MB 4BBFA 4ANOA 2C0TA 5CVHA 4L3JA 4UWYA 3TV6A 1G8SA 2WB8A 4DLIA 2W1DA 3VIDA 5IA2A 5IA0A 4F0IA 5IH5A 2CKOA 4S33A 4CKJA 2JBOA 5CAVA 2CPKE 5F95A 2P3GX 5CU0A 5M07A 3KXHA 3R7YA 3ZRKA 1UU9A 2EUFB 3A7JA 3VS3A 3F88A 5E8SA 3CY2A 4MKCA 4FKLA 1L3RE 3OUKA 4D5KA 3HA6A 1H1RA 3G0EA 4YO4A 4IX5A 1BYGA 4EQCA 3UNKA 3EZRA 1JBPE 1YHSA 1YXSA 3QD0A 3PTGA 1KOAA 3OCSA 2VTRA 1ZMUA 4KA3A 1R78A 2J5FA 4I4EA 5KMJA 4RRVA 1XO2B 3E87A 3T8OA 4MXZA 4V05A 5FP5A 3GFWA 3CBLA 3KK9A 2C5NA 2FVDA 3OUNB 3UZPA 3R9DA 2XNMA 5KHXA 3PJ8A 4ZSGA 2C0OA 4BCQA 3OG7A 4QP1A 5JN2A 4JT3A 2XH5A 2WAJA 2X6EA 3JS2A 2QR8A 4JQ7A 2IJMA 4AN2A 5AR8A 4C8BA 3DXPA 1FMKA 3UO4A 3PVBA 4ONAA 1JAMA 3Q4CA 4MWHA 3KQ7A 4XG4A 1GNGA 5CEKA 3ATSA 1YHWA 5DN3A 2BRBA 4C35A 4IAIA 1Y8YA 5E8XA 4BCOA 3R8LA 5IQIA 5LQFA 2WGJA 3QYZA 4ZTQA 2E2BA 4NCTA 1T45A 4FEWA 3HMNA 3BYMA 4EBWA 1H01A 4I22A 4ZTSA 3MPMA 2PZRA 2REIA 3UIXA 3PXFA 2JKQA 4M69B 2KULA 4ZJJA 4LV5A 3F69A 4WBBB 5LMBA 3NNVA 4AP7A 4QT1A 3BU5A 5CSVA 4EOSA 4DTAA 3NNWA 2E9PA 5EYCA 3BWFA 4AFJA 2A2AA 4QMXA 3NSZA 3EH9A 5ETFA 4ZLOA 3CCNA 3VBVA 2DYLA 3C0GA 5CT7A 4H3PA 2OXDA 2ZYBA 4YHTA 5JT2A 3HDNA 2QD9A 5FTOA 3AT3A 3O71A 4EOMA 2Z7QA 2BILB 4BICA 4IZYA 5EQYA 5HE2A 2R64A 4LM5A 4J53A 4J71A 4LL5A 4IAZA 3TT0A 3TIZA 4ALWA 3Q2JA 5IQAA 4FK6A 4J1RA 2WQEA 4RIWB 3UOJA 4GFMA 3HLLA 4F6WA 5HTCA 3OMVA 3MH0A 4KBKA 2X39A 5L6PA 3MTFA 5AIKA 3RNYA 4GYIA 2BAQA 4A9YA 4X0MA 4L7FA 5AUZA 1YXUA 2NRYA 2QKRA 4XLVA 4Q2AA 1H28A 2XKFA 1MQBA 1WBNA 4J7BA 4JQEA 5C03A 3FMEA 3PZHA 5CENA 1JKTA 4DG3E 4JQ8A 4DCAA 4RLKA 2GNFA 3ZUUA 1YI6A 3QWJA 3AD6A 5M06A 4L6QA 2V22A 4X21A 3D14A 5GZ8A 4LGDA 4FNXA 4IC8A 4LOOA 2PWLA 4K0YA 3V04A 2PY3A 3I0OA 4ITHA 4MQ1A 3TUBA 4LL0A 2RFDA 5BMSA 2EU9A 1CKIA 3HKOA 4FT0A 3QHRA 4L3PA 4RVKA 3DZQA 2QOBA 3KL8A 4G5PA 2GU8A 3LFDA 3DPKA 4KD1A 4NFNA 1Z9XA 5D7VA 5TOZA 2FB8A 5K9IA 3E5AA 1QCFA 2R7BA 4E6DA 2UV2A 3F2RA 3PA4A 3RPRA 1A06A 3NW7A 3FMDA 3NLBA 3UYTA 5TR6A 4TYGA 2G1TA 4LI5A 5D1JA 4W8EA 5B7VA 3KEXA 4PTGA 4AGUA 4XHKB 5L2SA 3VW8A 2JAVA 5JKGA 2E9UA 4RWJA 3C13A 5CLPA 5I3RA 5DEWA 2WMAA 1M2PA 3BLQA 3JVSA 3MFSA 4BDIA 3W8LA 5IPJA 1PXLA 5TE0A 5CAOA 4TT7A 4IANA 1KOBA 4MXYA 2C3KA 3LJ1A 2QU5A 4I6QA 4WG4A 4QMWA 4EH7A 4O2PA 4TW9A 3ZFYA 2PVYA 4IWQA 3Q04A 3NZ0A 5C4KA 3OWJA 3KXMA 3BRBA 3QD3A 3R8VA 5HCZA 1YQJA 4TY1A 1NVSA 4JBOA 3ZOSA 1RQQA 5M56A 3BQRA 4BIBA 3ORNA 5IUHA 2WQNA 3CQWA 2HWOA 4E4LA 2G01A 1JSTA 4IIRA 3ERKA 3V5PA 3IKAA 4DGGA 3PXYA 1PJKA 5KMOA 4D4RA 2CNUA 2ZB1A 3W2PA 3QRIA 4YSMA 4KS8A 1P2AA 3OXIA 4ZZOA 3NIZA 4XV9A 4D1SA 4RJ4A 4A9SA 3RPOA 3RWQA 4PRJA 4RJ7A 5HEZA 4D2RA 2Q0NA 3OP5A 1Y8GA 4HGEA 3NUAA 1XHAA 4XBUA 4UMPA 4FTOA 1YWNA 4CYJA 2HZ0A 4C34A 3CE3A 4ENXA 4C3FA 5CX9A 4QTDA 4GH2A 4IX6A 3VUIA 5AIRA 2IG7A 4QP8A 3CC6A 3Q32A 3C4WA 3VS4A 4EZ5A 4F9YA 2FGIA 3IG7A 1J7LA 2RGPA 4DTBA 2F49A 3F5PA 4G34A 2XK3A 4MF0A 5E8VA 3SKCA 2WMBA 2VGPA 5G1XA 1WBTA 2O5KA 2VTQA 1IA8A 4JLCA 4IW0A 2FSOX 4BBEA 2PZPA 2C1AA 3CQEA 3WARA 4FKRA 3DFCB 3LZBA 4ZIMA 5DR6A 4BZDA 2VWYA 4K18A 4CVAA 4E6AA 3UQFA 3PE1A 1ZY5A 1H0VA 2YM5A 3MA6A 2R4BA 2J7TA 5TO8A 3KXXA 4O96A 3S1HA 4ANNA 1TVOA 3ENMA 5EM5A 3B2TA 5LCKA 2QURA 3R1YA 1FPUA 3IPHA 4C4FA 4QYGA 1ZMWA 4I4FA 4LMNA 4GG5A 2YAAA 2C6LA 5DMZA 3NYOA 3L8PA 4I24A 1BL7A 2IVSA 5D12A 2ITUA 1H24A 1LUFA 2W1CA 3G0FA 4CZTA 4DTKA 4YU2A 2P55A 3PJ3A 2BRMA 3OD6X 1J1CA 1LEZA 5HE3A 2JC6A 5AEPA 3LCSA 5IQHA 4O7YA 4ACMA 3ACJA 3FBVA 5CSXA 1OBGA 2F7ZE 2VWXA 3AC3A 5AAFA 3QQJA 4DE4A 4FKPA 3FEGA 1E1XA 3SXSA 3KF4A 1U46A 5F1ZA 2PVFA 1WBWA 4UB7A 4YPDA 3QBNA 4L46A 3EQBA 3NR9A 1JWHA 2VWZA 4BCMA 5IQGA 3V5LA 4BTMA 2WOUA 1REKA 2PVMA 3DK3A 1V0BA 3Q6WA 4RJ5A 3OWPA 4ZAUA 5AUXA 1GIIA 2WQMA 5D41A 5DEYA 4AXAA 3U6JA 4NKSA 4HGLA 4D0XA 3MDYA 3KC3A 4FG9A 4FZFB 4RA5A 2BKZA 2R0UA 4N57A 2JFLA 2BZKB 3FAAA 4O82A 5HG8A 3IOKA 5DBXA 4I6FA 5DA3A 5EI8A 3F7ZA 4ZY6A 4U42A 3ZH8A 4DITA 4QYHA 3UYSA 3UIBA 5BUIA 5GZAA 3CQUA 3EZVA 3QCYA 1CKJA 3FMNA 4Y83A 2R0IA 2VTMA 1H00A 3I7BA 3W33A 2W0JA 3GVUA 2FSMX 2BDWA 2XKEA 4FV4A 2XJ1A 4K9YA 4MVFA 4NCTC 3U4WA 2R3RA 2XA4A 4X7QA 3UP7A 3CGFA 2YACA 3CTJA 3MY1A 3NMUF 5G6VA 5CEIA 3PSCA 4PDOA 2JAMA 3E8DA 5HCYA 4AW1A 3A8XA 1OL7A 5HESA 3LHJA 2WD1A 4J98A 4UZHA 3TZ9A 3QLGA 3V01A 2GTMA 5HD4A 5EM8A 2RG6A 3NUSA 3UIUA 3DXQA 3EQPA 5M08A 4FTKA 5AV3A 1H1WA 4M13A 1CDKA 4AT3A 5BNJA 3FMLA 1GIHA 1F0QA 2YERA 2ITVA 2VTSA 5HGIA 4AF3A 5C01A 1BMKA 3PWDA 4RQKA 3R04A 4D9UA 3AC1A 4EUTA 2XB7A 3TIYA 2B1PA 3CKXA 4IB0A 2X8DA 3AD5A 4F7JA 3JR1A 4G3FA 5BX0A 4CCUA 1PKDA 1NVQA 4ACGA 2JIIA 1QPJA 2OXXA 3ODZX 2W4JA 1PXOA 4KINA 2VO7A 4JX3A 3MTLA 1OL2A 3EIDA 3ZSGA 4XG8A 3A4OX 4QMUA 4AU8A 5L3AA 1DI8A 3GC7A 1TKIA 3PE2A 1ZAOA 4RWIA 2ZV2A 3BWJA 4E1ZA 2BZHB 3KRWA 2PUNA 3LFEA 3T3UA 3WI6A 4F09A 1R3CA 3DAEA 4WG3A 2J51A 4J96A 4I5HA 4CTBA 3C4XA 1M2QA 2I0VA 2AYPA 4QTCA 5DT0A 5C1QB 4QMYA 3W2CA 4FX3A 4TRLA 4IM0A 2VWUA 2WEIA 4DFXE 2WOTA 4XYFA 2FSTX 3Q9ZA 2PVHA 4FKOA 4X2KA 4V0GB 2UVYA 3PIYA 4W4WA 4MHAA 3BQCA 3DBCA 3QZIA 4FEVA 3NYXA 4D58A 3GENA 5AV1A 3I4BA 4PF4A 2VTTA 3HRCA 3P5KA 5J9ZA 4H1MA 1MRVA 4YNEA 4RIYA 5F4NA 4HPTE 5DVRA 2PE1A 3HDMA 5ANOA 4YR8A 2ETMA 3IS5A 2IW8A 1FVTA 4BDKA 4EHVA 4IH8A 3UZTA 4ZS0A 2OW3A 3AG9A 4O22A 4O1OA 5AM7A 4MXXA 4ZLZA 2W1HA 1Z57A 1KSWA 4C7TA 3WIGA 5L6WL 4MYGA 4DFLA
chains in the Genus database with same CATH superfamily
3EFJA 2XK7A 1KE7A 3N4TA 2ERZE 2WTWA 3OCGA 3D7TA 2XK9A 4BR3A 3W0QA 5FWKK 5CNNA 1YI3A 2W1GA 4WKQA 3VJNA 4EK5A 2HY81 1OIUA 4EOLA 4JMQA 3C9WA 2I1MA 2CGWA 2O3PA 2XVDA 4AZVA 2R3HA 3UG2A 4C59A 3MIYA 5CEMA 5IH4A 3MESA 2ACXA 5LJJA 1P14A 2BDFA 4YZCA 1OUYA 1J91A 4XLIA 3PDTA 4A9TA 5FEEA 2YCFA 3CPCA 2JKKA 4JNWA 1YOMA 5AAEA 4C4EA 4AFEA 4V04A 3BELA 5BVFA 3I60A 5HLPA 3BHTA 3EOCA 4RPVA 3E93A 2CKPA 3UDZA 4WSYA 5KKRB 4QMSA 2IVTA 3L9NA 4YZMA 3IGOA 3ETAA 3QTRA 5FXSA 3SHEA 3A7GA 2W4OA 2G2FA 3IK3A 5AP0A 4ZY4A 4DHFA 4F9CA 1WVYA 1NW1A 1BUHA 4NT4A 4IWOA 4BCHA 2XNEA 2JBPA 1VZOA 3KF7A 3LXLA 5FBNC 3U4UA 2ETRA 1OM1A 3FYJX 3PFYA 3OTUA 4MNFA 2JITA 4JDIA 4I3ZA 3B2WA 5CF6A 3ZFMA 4EHZA 1TFFA 4CGAA 1PXKA 2OSCA 2R3GA 3DJ5A 4BN1A 4DG2E 4ZZNA 5M53A 4FNWA 3UDTA 4G3DA 1U4DA 1Q8UA 5AP4A 5FD2A 3R9NA 2UZOA 3DLSA 1YHVA 5A6NA 1XBAA 4CG8A 5JFWA 1WZYA 4C4GA 5BVNA 2OJIA 1YRPA 2WTDA 1GZKA 4N70A 5HVJA 4BI2A 5IQEA 3ZXTA 2OIDA 3ZMMA 1JLUE 2W96B 4X3FB 4EKLA 2RL5A 3ENHA 4X3FA 4EH9A 4PL4A 2YDKA 2QG7A 2CN8A 4OBPA 4ASXA 1ST4A 4EQMA 4YJVA 3LMGA 3LMHA 4KIKA 4FV9A 4GU6A 3TNHA 4GJ2A 3CIKA 3VUDA 4KIQA 4DEAA 4E4NA 2XRUA 3EKNA 3P9JA 4I20A 1UKHA 3GU5A 4UWBA 3UC4A 3A62A 2ITXA 3BZ3A 3W2SA 4USDA 5KHWA 3FY2A 2B4SB 4EEVA 3D94A 3LFNA 3RAHA 3V8TA 3UE4A 3R22A 4R7IA 2GQGA 4Q5HA 2PZ5A 4MF1A 4OGRA 4GT5A 3GOKA 4OTQA 2PMNX 1H08A 2YIRA 2OJ9A 2C5OA 3POOA 5FTQA 4EK8A 3DZOA 4LOQA 4OTWA 5DG5A 2ZMDA 3MS9A 1RE8A 4GSBA 3F6XA 2GFCA 4AGWA 1SMHA 4F9BA 4X3JA 5I4NA 2YZAA 4FSZA 2VO0A 5DR2A 3MVMA 2QU6A 2X81A 4QMMA 3PA5A 1PXNA 3RCDA 4AS0A 2F2CB 1XH5A 4TTHB 3SQQA 3SVVA 2I40A 3NUYA 2X8EA 3L8SA 4WG5A 3VBTA 3Q4UA 3II5A 2VX3A 2XIXA 3PY3A 1H1SA 2YCQA 2GNHA 5HO8A 4ANMA 2QOOA 4FKJA 4MX9A 4CZYB 4QP9A 3HGKA 2G15A 1H25A 2IVVA 3D5XA 1V0PA 2UZUE 3UGCA 5HTIA 3MVJA 1ZYSA 2ZM4A 4DG0E 3FLNC 4DH5A 1XH8A 1M7QA 3CY3A 3UO6A 4OTFA 4XV3A 2ESMA 3D9VA 1YWRA 5CI7A 5BV3A 3EYGA 2X9FA 3BLRA 2GDOA 4OTHA 3ATTA 3ZDUA 5A54A 3ZZEA 2QOQA 3CJFA 3QQKA 4ZSJA 2Q83A 3HAMA 5LVNA 4DT9A 3NGAA 5FDPA 5K3YA 2X7OA 4C37A 5CY3A 3HUBA 5C26A 4NIFB 3R9RA 2C5XA 2CMWA 5JMSA 3FWQA 5IQBA 4Z3VA 1OL6A 2EVAA 3MYGA 5JQ5A 1YOJA 3MY5A 3HZTA 4B7TA 2J0KA 4OBQA 1W0XC 3DJ7A 3SDJA 1R1WA 5HX6A 4Y95A 5HU9A 2ZJWA 3HV7A 3RK5A 2VTAA 4YHJA 3FSKA 2YFXA 3PZEA 3PIXA 4RWLA 3TEIA 3W2RA 5DRBA 3WZJA 2YISA 2RF9A 3Q9WA 1U59A 2I7QA 3JYAA 4IJPA 4PP9A 4AXDA 5CASA 4P5QA 4BTJA 1SZMA 4BDDA 4XJ0A 2EXEA 2XYNA 4DFNA 5HZNA 3PJ2A 4YURA 1H8FA 2BRNA 4EOPA 3C51A 4GK2A 4NH1A 4O91A 3HMOA 4QQ5A 2BVAA 4XOZA 4OT6A 4RT7A 3WE4A 4F6SA 3NUPA 3PUPA 4PPBA 3RVGA 5J5SA 4GS6A 4A7CA 4FTNA 1AD5A 2BDJA 5LMAA 3R7EA 3VUTA 2HW7A 5CAPA 3W2OA 1H26A 4O4DA 3NRMA 4XP2A 2YDIA 3VQUA 4AZFA 1OKYA 4D2SA 5DH3A 4F64A 5AA9A 2WQBA 3QKKA 5I3OA 1DS5A 3DXNA 4KWPA 2UVZA 4RFZA 3VW6A 3WIKA 1EH4A 2BPMA 2XK6A 3TKHA 1VJYA 4L3LA 3O7LB 1OUKA 3QTSA 5BYYA 4DT8A 2Y4IC 2ZMCA 4EORA 5AUTA 4R7BA 5CVFA 3R63A 4D1XA 5KKRC 3P1AA 4PQNA 4O0TA 4Z7HA 4N6YA 4BCIA 3O8UA 1UV5A 3G9LX 3JUHA 5L4QA 3ROYA 2BKKA 3F5XA 5ACBC 3R83A 3UMWA 5FEQA 2XYUA 4F63A 5HCXA 1XH9A 2OWBA 1PRYA 3O23A 4HCTA 1OECA 3FZTA 4FEQA 3UG1A 1VR2A 3QRTA 5GHVA 3MSSA 3R02A 4MBLA 2WU6A 2P0CA 3KCFA 4J8NA 4AGCA 4C02A 1P4FA 4BI0A 4QQJA 3UVPA 4ACHA 3L8XA 3IDBA 5CYIA 4EYMA 5IMEA 4R3CA 3KXGA 5AV2A 4CMOA 2BR1A 4IADA 2X2LA 4ZSLA 1TZDA 2R3FA 5HI2A 3NDMA 3NW6A 1PHKA 5M4UA 4RVLA 4M8TA 3V5WA 3FI8A 4IMYA 4PDSA 3AKKA 4L68A 5JZJA 1WCCA 1UU8A 4P90A 2W9FB 4D4VA 4PP7A 4GYGA 4NK9A 4IVDA 2LAVA 4FNYA 2WTVA 3VBXA 3ZYAA 2NO3A 4S34A 2IF8A 1JSUA 4CRSA 2ONLA 4OTRA 1VYZA 4FIFA 3TTIA 5EI2A 1NXKA 4YHFA 3R9HA 2YWPA 5HO7A 4M69A 2V62A 4JS8A 3O96A 4LYNA 3VJOA 3B8QA 5ANEA 3K5UA 3BGZA 1VLRA 4JG7A 3NEWA 3BV2A 4I21A 2WMQA 2BIKB 4XG6A 1UNLA 3SGCA 4IFCA 5I9YA 4PL5A 4O1PA 4J97A 4E93A 4AXFA 1OKWA 3GNIB 3R28A 5CXZA 3IO7A 2J6MA 3BKBA 1PXJA 4EOQA 2IEWA 3A60A 3ZO1A 1KE5A 2PMIA 2HELA 4L67A 4EH2A 4USFA 4AN9A 4M84A 2CNVA 1YI4A 1K3AA 5EW3A 2SRCA 3LFAA 3QYWA 4J8MA 4LOPA 4BTKA 2NPQA 2XP2A 5HIEA 1W98A 5IUGA 5EM6A 3VC4A 3CTHA 3KFAA 4YTFA 3W0OA 4CFXA 3I7CA 4DEIA 3U6HA 4DEEA 4R6VA 4AACA 3DJ6A 4FTUA 3HMMA 5KMMA 3NUUA 3QC4A 4B8MA 4TWPA 3Q5IA 4IB3A 4HW7A 4TYJA 4ACCA 3QTXA 4IM3A 2JKOA 3LCDA 3KXNA 2UW5A 4RMZA 3ZBXA 2B7AA 3IW7A 3LVPA 5E8UA 4CNHA 1SM2A 2BCJA 4FKUA 1J7IA 3QUPA 3QKMA 3WF6A 4FGRA 3NUXA 3BYOA 4ZTMA 4UX9A 4LGGA 4FOBA 2C6MA 3KY2A 4CFUA 3OROA 4FIHA 3DT1A 3FI4A 4QMVA 4FIIA 5JRSA 4C61A 1IASA 1Q8YA 4FSNA 4NFMA 3MI9A 5DPVA 4CT1A 3DA6A 4FV5A 3S3IA 4PNKA 4GKIA 4E8AA 3FQEA 3PG3A 2BRHA 4IHPA 4WUNA 5ETAA 4B8LA 5FXRA 3NVMB 2X7FA 2GCDA 1URCA 4A4XA 3GU4A 3O0GA 2V55A 4U6RA 2OZAB 3TACA 4FZ7A 3UNZA 4W9XA 4TXCA 3ZSIA 5IA3A 3W16A 2WZJA 5CZHA 3PLSA 2W5BA 3W18A 3ROCA 2X8IA 3BIZA 4NIFA 4RIXA 3W8QA 5ETCA 2ITQA 4PMTA 4YJNA 1A48A 3ZSHA 4XEYA 1PMNA 1KV1A 3F5GA 4M68A 4FI1A 3TL8A 4DYMA 2W99B 3D2KA 5LVMA 5H8BA 1O9UA 2ZOQA 3QTUA 3BGQA 2G9XA 3L8VA 3A8WA 4BGQA 2WXVA 1HCLA 5LMKA 4QQTA 4FV2A 4AA4A 3SRVB 2WIHA 4IZAA 2ITZA 3LFQA 5BMMA 4JIAA 5JQ8A 1SVEA 5IF1A 5JRQA 4ITJA 4PUZA 4M3QA 2I0HA 1KWPA 4UALA 4MNEA 1JOWB 3KULB 4UY9A 5FXQA 5IEYA 4DEBA 4G9RA 3N4VA 4O4CA 5H8EA 1J3HA 2V5QA 1OKZA 4OT5A 1JKLA 4ZJIA 4A4OA 3NVKI 2O8YA 4MBIA 2I0YA 4QD6A 1QPDA 3BYVA 4AA5A 4HVDA 4IE9A 5B0XA 4IC7A 4DCEA 4RX8A 5KO1A 4N6ZA 4AT4A 4QP6A 5ETIA 3V5TA 4AGDA 1NY3A 3ORTA 4HYHA 3QWKA 4FTCA 3REPA 2IO6A 3PP0A 4BDCA 2HXQA 3EQCA 4OAVB 2PVLA 2EWAA 1CTPE 4K2RA 2V0DA 2OU7A 2OO8X 3BU6A 1WBPA 1OPLA 4DBNA 5B2LA 2GFSA 3DDQA 1BL6A 3FXZA 3GC9A 4LRJA 3WYXA 4CLIA 3D5VA 3PVWA 3SOAA 4BCPA 3ORXA 4CV9A 2UW7A 4DA5A 3RM7A 4FKGA 2LGCA 4GT3A 4KRCA 4FTMA 5FRIA 2RSVA 3GOPA 2H6DA 5CSWA 2HCKA 2OFUA 4CCBA 4IB5A 4UV0A 4RA4A 4OTDA 2A1AB 2PVKA 2XNBA 3AGMA 3C4CA 2IWIA 3TJCA 4TYHB 2CCIA 5K0KA 1GY3A 4ZTHA 1YDSE 3EKKA 3F2AA 4IZ7A 5KE0A 4AWIA 5J1VA 2EXCX 4IAFA 3OY3A 3PY1A 4TKSA 4FV6A 5D7AA 4E73A 3NFFB 1O6KA 2F7XE 1E1VA 4KBCA 1Y6AA 4D5HA 1OB3A 3FLZA 3G51A 4ZS4A 4M67A 3DV3A 2HK5A 4NM7A 4PMPA 5AAGA 4BB4A 4I0RA 5M09A 4P2KA 4IWPA 2XIZA 4C4HA 5TF9A 3RAIA 3VF9A 3QRKA 4EH5A 2VZ6A 3FHIA 3EQRA 3LPBA 4JRNA 5CANA 4FE2A 4AAYA 4CSVA 3ZLWA 4ID7A 2YM3A 5ANGA 3CGOA 2F7EE 4GL9A 1F5QA 5A4EA 4NU1A 2YIQA 4QMZA 4EI4A 3R7VA 2JDSA 2OKRA 4O6LA 1OKVA 2W4KA 5HBHA 5IISA 3COIA 3F5UA 2C3IB 3SAYA 5LVLA 4ZTRA 4AAAA 3F3ZA 5AP6A 2Y4IB 4AW2A 3GT8A 3PRIA 4GFOA 3CLYA 1UNHA 4APPA 5E8TA 4FTLA 3UO5A 3V8SA 3KA0A 2WQOA 5KMLA 5EW8A 2QKWB 5LOHA 2WHBA 3Q9YA 3ZLXA 3TKUA 2ITYA 3ZUTA 5HX8A 5HD7A 3WZKA 1GZ8A 1UWHA 4PDYA 4BIDA 2R7IA 2QONA 4RBLA 1ZXEA 1CMKE 3C1XA 5DGZA 3QCQA 4KSPA 3DKFA 3QQLA 3SW4A 1DM2A 4BCKA 3WBLA 4U3YA 3V5JA 5E92A 4HCVA 4RC3A 2C47A 3OHTA 4TPTA 3FYKX 5AWMA 3AMBA 3UC3A 3OXTA 4JBQA 1X8BA 2R9SA 4U5JA 4BIEA 4JIKA 3R1NA 4DC2A 1V0OA 1H0WA 5AUYA 1MP8A 2IVUA 2WTKC 4C4IA 5C8KA 4DFYA 4DN5A 4WHZA 1PMUA 1IEPA 4OTPA 3AC8A 4Y85A 5EOBA 3FZPA 5E91A 4O0UA 3MW1A 1QL6A 1ZOHA 3DTWA 5IDPA 4I5MA 3VULA 1K9AA 3LFSA 1UWJA 4HCUA 5HNIX 4C33A 4W9WA 4WT6A 3E88A 2JDOA 3G9NA 4QOXA 5I9XA 3VBQA 3E3PA 1B39A 1U54B 1GAGA 5HG9A 4AXEA 4GV1A 2ZDTA 3ORZA 3EQDA 4L45A 5IQCA 2YIWA 1IAJA 4FRFA 1IAHA 1FVRA 3RK7A 4LQMA 5JFSA 2KTYA 3L1SA 3A7HA 2PVRA 2WMSA 4FYNA 4I23A 3PRFA 3PXRA 4JRVA 4L44A 5EH0A 5FLFA 3CR0A 4BZNA 5M4FA 3JY0A 3BE9A 5HTBA 3DCVA 1P4OA 3UPZA 5E8ZA 4NYEA 4ITIA 2DWBA 2B9HA 1AGWA 3QALE 4XNEA 3RKBA 2IZRA 4DFZE 2XNNA 3OF0A 3GFEA 3ML1A 3IECA 3QA8A 3FXXA 2ZDUA 4K11A 3QZHA 4JDJA 3RAWA 2Z60A 3QHWA 4NJDA 4YTCA 4CT2A 2R3PA 2JD5A 2UZVA 1R39A 2X9EA 5CQWA 5CWZA 4M0YA 4RJ6A 4BVUA 4U8ZA 4IDTA 2G2HA 5J7HA 4BDFA 5HLNA 1SYKA 4XV2A 1OMWA 4ASEA 3KULA 5HLWA 3E62A 2C4GA 3COMA 3C4ZA 5E9EA 3R0TA 3UIMA 4XCUA 4EC9A 2RIOA 3GUBA 3ALNA 4LRKA 4S32A 5CU6A 5LXMA 3GCUA 4FT5A 2R3LA 4M97A 1O6YA 2OIQA 3FY0A 2YLEA 4G1WA 1STCE 4WNOA 3S00A 4FL1A 4IAKA 4QPSA 4KKHA 3IW8A 4FOCA 4OLIA 4MXAA 4X3FC 3P0MA 4R3RA 3I0QA 3OC1A 4RIYB 5KBQA 1Q8TA 3U9CA 2AEGA 2CCHA 2OJJA 3ZO3A 2XM9A 3QTWA 2C6DA 3OBJA 5GZ9A 4IBMA 4GK3A 3FKLA 3WZEA 4DH1A 5JGAA 2BFYA 4PMMA 4XH6A 2CHLA 2R5TA 3H3CA 4CYIA 3FPMA 2QO9A 5CF4A 5DFPA 5FM2A 3HRBA 3KN6A 4HYIA 5DOSA 4FEUA 2JDTA 4JG6A 4WBOA 4E6CA 2X1NA 5JGDA 5KMKA 4FV0A 1Q41A 3VUGA 4CG9A 4UYNA 4ASZA 2Y4PA 3TKIA 3O2MA 1WBOA 3UOHA 2R3JA 4IEBA 4NM3A 2A19B 3IDCA 3TNQB 4D2VA 4L42A 3HVCA 1SNXA 4MD8E 4RC2A 3FC1X 4M15A 5IZFA 1ATPE 4OUCA 2C6OA 3BBWA 1BI8A 4HVSA 4TL0A 4QMNA 4RJ3A 1H1PA 4Z16A 4APCA 3DKOA 3BHYA 2I6LA 4EBVA 3FLQA 4CXAA 3K2LA 2XNGA 4UXLA 3CP9A 2Y6MA 3QAME 3CTQA 2NP8A 5DNRA 5HIDA 1DAYA 3TZ7A 4NZWB 5BVEA 2ZM1A 3IQ7A 3COHA 3K54A 5DIAA 4KB8A 3VVHA 3I81A 1OBDA 2I0EA 3KRJA 2ITOA 4G3CA 3WE8A 2R3QA 2JDRA 4JAIA 5ACKA 1WVWA 1GOLA 2PSQA 3E3BX 3CXWA 2J2IB 4C3RA 2JKMA 4KAOA 4UMUA 3GU7A 5ANJA 3LMIA 4ZK5A 1ZYJA 2CNQA 3CSVA 3A7FA 2WMTA 3E7VA 3FLWA 3OTVA 4JAJA 4NM0A 3TV7A 4YLLA 3F9NA 4D0WA 4M7IA 4AQKA 2VRXA 4PWNA 2NNWB 1XH4A 4RQVA 3FI3A 5EKOA 4FV8A 5C4LA 4X2JA 2VX0A 4O7LA 3O17A 3ORKA 5D11A 3TM0A 3NX8A 2Z7SA 3QQGA 3QQHA 3COKA 3SC1A 4KRDA 5L8LA 3U8WA 4L43A 3F3UA 4WA9A 3I5NA 4YBJA 4W4VA 3LQ8A 2R2PA 1MUOA 2CLQA 4QRCA 3WF7A 5C9CA 1E9HA 2OZAA 4YZ9A 4A07A 4FZDB 4FA2A 3HAVA 5H8GA 3BHHA 3OXZA 3V8WA 2C1BA 4NM5A 5CQUA 3PLAE 3EYHA 2YZLA 3HP5A 2XJ2A 2ZB0A 4XP0A 5EHOA 3QRUA 3MVLA 1Z5MA 4CLJA 2XZSA 4FZ6A 4QPMA 2DUVA 5KBRA 3G90X 2C6EA 2IZUA 4L7SA 5EG3A 3ZO2A 3PJCA 1ZARA 3IW4A 4U0IA 2FH9A 1Q5KA 3UPXA 3LFCA 3O5AA 3PUFC 4BWXA 1U5RA 1OGYA 4OR5A 5HE0A 1H4LA 4ORKA 3M2WA 4I94A 3W10A 4GT4A 3IW5A 2VWVA 4W8DA 3PYYA 1H07A 4KABA 4IAAA 3F66A 5HORA 4FT7A 2BAJA 2BAKA 4EJ7A 4QTAA 1YDTE 2W1EA 3QA0A 4WIHA 4FR4A 4ACDA 5AR4A 3W2QA 4G17A 3AXWA 4I6BA 4D28A 4F7NA 1O6LA 4R1VA 1CSNA 1UVRA 3MGYA 5I5ZA 3MBLA 5K0XA 1Y57A 1B6CB 3FXWA 4EH3A 3VS1A 3DFAA 2F2UA 1VYWA 2YCSA 4U9AA 3OEFX 4FT3A 3PPKA 4EH4A 4AZTA 5AR5A 5CI6A 4J99A 5HNBA 3JXWA 1ZLTA 4HYSA 3LOKA 4FKQA 5HU3A 4BHNA 4FC0A 4JG8A 4F4PA 4FV1A 3RGFA 3LCTA 2X6DA 3ZCLA 4YZDA 4I92A 4DBXA 2C5YA 3BBTB 4EOKA 1NT2A 4DHIB 1PXIA 2Z8CA 3EN6A 3F2NA 4H39A 4R1YA 5EHLA 3POZA 3QZGA 2X4ZA 1JPAA 4DHJA 2PVNA 2X0PA 3OOMA 3RAKA 3KN5A 5EDPA 4KSQA 2QOIA 5BVOA 4BGGA 2VTPA 1FGKA 1IR3A 2JEDA 3SW7A 4IVBA 4LDTA 2B54A 3ZM9A 5IKWA 3ELJA 3M42A 4D1ZA 5IU2A 4D55A 2PUPA 2GNLA 3FSFA 3OFMA 4DF3A 1ERKA 2EB2A 2XIYA 1I44A 4H58A 5TKDA 3N4UA 2QI8A 4EOIA 4QMLA 3DGKA 2WFYA 3CD8A 3BYSA 4IX3A 3FL4A 3BYUA 3P7AA 4NW6A 1Q61A 4F1TA 4FMQA 4YNOA 2W1FA 1RDQE 4UXQA 1H27A 4PL3A 2YM4A 4P4CA 5EYMA 1Q4LA 5BVWA 5DRDA 3KCKA 4MD7E 4P7EA 4FSRA 2ITNA 3AC4A 3FC2A 3LFBA 5A4CA 3KB7A 4FBXA 4C57A 3PIZA 3SG9A 3EN4A 3RK9A 2UW3A 4O38A 3F3VA 2XEYA 3RPVA 2VTIA 3E64A 3HYHA 2ZAZA 4GK4A 4XRJA 3LXPA 4HPUE 4C38A 3QX4A 4BCJA 3E63A 2GQRA 2PU8A 4C62A 4EUUA 4M12A 4R5YA 4WD5A 4AZWA 4TN6A 4V0GA 2W7XA 4CD0A 2OI4X 4Y5HA 4QYEA 4RFYA 3O51A 4C0TA 5J9LA 4LRMA 3TDVA 3VRYA 3AMAA 2GNJA 4C4JA 4FTRA 3ITZA 4IVAA 4UEUA 4TNDA 2GNGA 2XCKA 2UW0A 5D10A 4PPCA 2GS2A 4E26A 4CFWA 1JKSA 3R1QA 4FSTA 3PPJA 1ZYDA 3R8MA 5L2WA 4H3BA 3GCSA 3UBDA 3DAJA 4DLJA 2X0QA 4U43A 3GGFA 3GBZA 4Y72A 4FNZA 3LQ5A 3I1AA 1U54A 3V51A 2A4LA 3Q60A 2DS1A 2PZIA 2QOHA 2CGXA 1WMKA 3ZM4A 2JGZA 4MWIA 4O86A 3LW0A 5AP7A 2J0IA 2QC6A 2W17A 1Q99A 4LMUA 3ANRA 4NSTA 3IOPA 4AZEA 3QRJA 1CKPA 5A46A 4GVJA 1W7HA 4I1ZA 2DQ7X 3JY9A 3MFTA 4TWNA 3UQGA 4F9AA 5AP2A 5HO6A 4TWOA 3MIAA 5HOAA 3ZFXA 4XX9A 4I0TA 3MPTA 4TNBA 3M1SA 4I5CA 3G15A 1UKIA 3D2IA 4O4EA 2WMXA 2O65A 3KXZA 3DLZA 3BU3A 5H2UA 5AA8A 4FEXA 4HVGA 1XBBA 4S30A 3WF5A 3A99A 2GS6A 4D2PA 3Q5ZA 2PL0A 4CZUA 2IW6A 2VD5A 4FIJA 2X2KA 4TYHA 1PXMA 4JVGA 2ZVAA 5CALA 2GMXA 2IZTA 2J0LA 4EHEA 3HRFA 3F61A 3FDNA 4XS2A 2HY0A 3KKVA 4E20A 4Z7GA 4FSQA 5JH6A 4RVTA 3TXOA 5GIPE 3T3VA 2GHGA 4ZTNA 4CFFA 2C3JA 4BHZA 2QR7A 1PYEA 2W06A 5DR9A 3AOXA 4AZSA 1OL5A 4QMTA 1OGUA 4GCJA 4XOYA 3DY7A 3L9LA 4M0ZA 3TNIA 4O7WA 4U7ZA 2PUIA 5HBJA 4RG0A 4C2WA 4B0GA 2HIWA 2WMUA 4F08A 3QUEA 4HGSA 1NVRA 4PNIA 5BUEA 4MD9E 4C3PA 4QDVA 4DGNA 3TNPC 5DI1A 1FGIA 5M44A 4X2GA 1GJOA 2WMWA 2YM7A 3Q9XA 4YC8A 3EN5A 4G2FA 3EJ1A 4NJ3A 2ITPA 3LLTA 4AOTA 4HOKA 4AOIA 4BGHA 5AUVA 4EYJA 4K6ZA 5M57A 3TN8A 3I6WA 4ZMFA 4FZAB 3QZFA 3PPZA 4O0RA 2XAOA 5HIBA 3OZ6A 3LM0A 3OWLA 2AC5A 3DTCA 3C0HA 4LUEA 4WO5A 2QO2A 3KMMA 2P33A 3NS9A 1G3NA 4YUQA 2Y9QA 2C6TA 1QPEA 2XIRA 3DOGA 3KRRA 3EHAA 1JVPP 5CS6A 3F3WA 5BVDA 4QYYA 3GP0A 3CKWA 4BRXA 5EFQA 3UQCA 2WIPA 2PE0A 2CKQA 4F0FA 4IQ6A 5J87A 5EYKA 1IG1A 4ERKA 2Y6OA 3R7IA 5KNJA 2CKEA 3IGGA 1S9IA 3HUCA 3LJ2A 1LEWA 3PXKA 4FVQA 4QP3A 4QMQA 3HMIA 1FINA 4BC6A 4BKJA 3EQIA 2GSFA 2QHMA 3HP2A 4HNIA 3ZEPA 4BYIA 3WZDA 4CFVA 4YTIA 4G3EA 3FHRA 3DBEA 4MTAA 5FEDA 3PSDA 5HHWA 5L8JA 3W32A 3DKCA 4AX8A 1PXPA 5CSHA 3UODA 4RIOA 3MN3A 2WNTA 4ZTLA 4BDHA 2BTSA 4ANQA 5CF5A 4IZ5A 4EH6A 3TV4A 2IW9A 3FZRA 4CMUA 3ET7A 5ANDA 2A98A 4YJPA 3U55A 3KREA 5BQ0A 3EL7A 3MPAA 3FJQE 4XUFA 3QX2A 1KE8A 3ZLYA 1OVEA 2FUMA 3LM5A 1U5QA 2VTHA 4CQGA 3VS2A 1APME 4R8QA 3BHVA 3NAXA 3OT8A 3Q4TA 3TZMA 4GG7A 3BGPA 2GTNA 2UUEA 4JR3A 4LG4A 4MBJA 4XP3A 4F7SA 1MRYA 1W2DA 3C50A 4PV0A 2Y0AA 4CFMA 4FTTA 5CEPA 4YJTA 3QD2B 4XG2A 3HV4A 4G5JA 1JNKA 3LLAA 4YJSA 2GHLA 2W9ZB 3FL5A 2O63A 4ZJVA 4O81A 2Z7RA 4ZOGA 5DLSA 2Z7LA 4H3QA 5E1SA 5E8YA 3LCOA 1W2FA 4FG8A 3QQUA 4CFNA 3PG1A 4ZZMA 1IA9A 4FKVA 5I9UA 3HX4A 2OLCA 4CRLA 2XNOA 4JI9A 3C4FA 3LJ0A 4CEGA 4DDIA 3EFKA 5AX3A 2VNWA 3B8RA 1WBSA 4YJQA 4C58A 5KCVA 2C30A 4K77A 3P08A 4B99A 1CM8A 2W05A 2X7GA 3NCGA 3RNIA 2OH0E 5JSMA 3GQLA 1OL1A 3LAUA 3HNGA 5HG5A 3R7OA 3WF9A 4EWQA 4D2WA 3R71A 2IZSA 3QF9A 4NWMA 3MV5A 3SA0A 4F1MA 1L8TA 1WVXA 1JQHA 1Y91A 4Y8DA 2BZIB 3DNDA 4YJRA 3BLAA 2ZM3A 4EC8A 2F9GA 4RC4A 2HXLA 4AT5A 4TYIA 4UWCA 5JZNA 5L2QA 4ZP5A 5HICA 3HV5A 5A9UA 2JLDA 3I6UA 3KRLA 4FKIA 4EK6A 4XG7A 4ZEGA 2UZBA 5IMXA 1XJDA 2XNPA 4KIKB 1R0EA 5EOLA 3AKLA 1PMEA 4IAYA 5FDXA 2YA9A 3TWJA 4MXOA 4DH7A 5LMKC 4LV7A 4HGTA 4TZRA 4XG3A 4EKKA 2RFSA 2PZYA 3JPVA 5EI6A 5J79A 1URWA 1XBCA 1ZZ2A 3ZUVA 4BDBA 3FKOA 4J52A 3Q52A 4LV8A 3R00A 3VS5A