4RIOA

Crystal structure of jak3 kinase domain in complex with a pyrrolopyridazine carboxamide inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
285
Chain Sequence
TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGSERDVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/inhibitor
molecule keywords Tyrosine-protein kinase JAK3
publication title Discovery of pyrrolo[1,2-b]pyridazine-3-carboxamides as Janus kinase (JAK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 285
sequence length 285
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rioA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rioA01
2ERZE 5BVKA 2XP2A 3KCKA 4MBLA 2BROA 4ZJJA 3V8WA 3PJCA 3MGYA 4I93A 3FE3A 3MBLA 3DXNA 1OM1A 2PVRA 4PWNA 4AFEA 3UNKA 4E5BA 3QXOA 3A7GA 4E93A 3TUDA 3FXXA 4MF0A 5HTBA 4NU1A 4CV8A 5A6NA 2ONLA 4JBPA 1UU8A 3KN5A 1J7LA 2HZIA 3LFFA 4FZ6A 4AT4A 1YI6A 2IW9A 3QTQA 3R8MA 4FKGA 4EWHA 3D9VA 2X7OA 4TN6A 3DFAA 3TKHA 3IPHA 3EN5A 2J0IA 1JAMA 5CU4A 4D1XA 3RVGA 4O21A 5CYIA 3V8SA 4NYEA 3TKIA 3RZFA 2WMVA 3RM6A 2J0JA 5DHJA 5M4IA 5M4CA 1XH9A 1R1WA 5E8YA 1H0WA 4L7FA 3MESA 3EZRA 2W99B 2IWIA 3H0ZA 4YNEA 5AAGA 4HCTA 3R8LA 2WMQA 4CZUA 2WOUA 5LWMA 5ANEA 1K3AA 4MQ1A 4AZEA 2OJIA 3HDNA 5ANGA 3MY1A 3L9PA 5ITAA 4RWJA 2UVYA 4RJ8A 4X2NA 2NRUA 4NJDA 3ORMA 4C02A 4JL9A 1DI8A 4P2KA 2X8EA 3N4UA 4JNWA 3DU8A 2C6KA 4TYGA 4AS0A 3BE2A 4FT0A 3LJ2A 4I5PA 2BAKA 2OO8X 3V5LA 3C13A 3F7ZA 1YXVA 3IQ7A 3AMYA 2CCHA 4DEGA 5AAFA 3KREA 3MN3A 1SVGA 3E63A 3Q5ZA 3FLWA 1LR4A 3FI2A 3UPZA 3UQFA 2ONLC 3NUPA 3UZRA 3E88A 5HIDA 4KWPA 4A4XA 2YISA 5CU0A 1J91A 3QQUA 2X9EA 3IKAA 2W1IA 3U51A 2R3FA 3UO6A 3SW4A 2X7FA 4A06A 2PYWA 1A06A 4IAYA 5HI2A 2NP8A 3VBWA 2XRWA 4BCJA 4F7NA 4KIOA 5L3AA 3VF8A 3OBJA 4G3GA 3DY7A 4F4PA 5I9UA 4FNZA 1WVXA 3GU6A 4YJUA 5ANIA 4N4SA 4MWIA 4G3DA 3QKLA 4J53A 4BTJA 3TL8A 5CEQA 3R04A 4WUAA 3SXRA 4ZMEA 2C6DA 4TWPA 2IG7A 3VUDA 3A99A 3E3PA 5EM5A 3TNIA 1BKXA 5HESA 4EWQA 3LIJA 2IO6A 1IEPA 3P5KA 4X3JA 3K5UA 3K3IA 5KBRA 2P2HA 2YIYA 3ORPA 5J7BA 2XM8A 4FBXA 5I9ZA 5E8TA 3MVMA 2ZDUA 3LVPA 3NCZA 2XUUA 2OJ9A 5CEIA 3SV0A 2E9VA 4ZK5A 2OH0E 2VX3A 3VUTA 1H1PA 3TNHA 5IMXA 4OTIA 3OCTA 2VUWA 3W33A 1M14A 1OITA 2WMXA 3OUNB 5AWMA 4X7QA 4AW2A 5HLNA 3A7IA 4BCNA 3TDWA 5EQPA 2WEIA 5HQ0A 5ETFA 4WNKA 4GG5A 4IANA 3JXWA 4O38A 4IB0A 3OT8A 1SZMA 1WVWA 3R7GA 4EUUA 4FNXA 2B53A 1T45A 4FV0A 1W98A 2YEXA 3OT3A 4BICA 4EKLA 4L68A 3C4EA 3NGAA 2ZOQA 4EEVA 2YM3A 3TACA 1P2AA 4BBEA 2QOBA 3SDJA 2Q0BA 2JAVA 3UTOA 5HORA 3KF7A 4X6QC 4ASZA 5IMEA 3LHJA 4HVIA 3QLFA 4YLJA 3K54A 2IVUA 4FOCA 1G8AA 2PULA 5IH4A 2VWXA 4YBKA 4BWXA 2R3GA 5CAOA 2YA9A 4B0GA 5CANA 2QU6A 2PUPA 2ITPA 1XWSA 2YIXA 1W82A 3AT2A 2O3PA 1S9JA 4EK3A 2DUVA 4BZNA 2OJJA 1K9AA 3PTGA 4O0TA 3LW0A 4L44A 3EFJA 4I0TA 1A48A 3NWWA 3Q04A 3IW7A 1PF8A 3D5VA 5DEWA 3WE8A 4FZAB 2WGJA 4G3EA 4BDIA 3JVRA 2YDIA 4C4IA 2VTLA 2XJ2A 2IVSA 3R28A 5HX8A 1FVVA 3RGFA 3MJ1A 3LXPA 3QHRA 4LM5A 4FZFB 4IVBA 1XH4A 4RQKA 4EL9A 1R0EA 5E9EA 4FTAA 1ATPE 4XG6A 1LEZA 5FBOA 1UNGA 1BL6A 5H2UA 4EOMA 3ANRA 1KOBA 4Y46A 3BPRA 5B2LA 3O0GA 5AP7A 2W05A 3JPVA 2UZBA 3PZHA 5H8EA 4H39A 3R73A 2GCDA 2WD1A 4PQNA 1V0BA 1W83A 1VYZA 5M4UA 3TDVA 3QQGA 5FUTA 3SVVA 4E5AX 1LPUA 4YURA 2NPQA 3SOCA 4XJ0A 4RC4A 2ZMCA 4F9BA 3LFDA 1H4LA 5J5TA 2J6MA 4XP0A 3IW5A 1IA9A 3BU6A 4QYHA 3BBTB 2EXEA 5K0XA 1JSVA 3V8TA 3VULA 4ENYA 3NNWA 4U8ZA 3ZONA 4JLCA 2B0QA 3MTLA 2BAJA 2PVKA 5CASA 4DCEA 3R7EA 2YCQA 3BU3A 3RP9A 4G34A 4YJTA 4IAAA 3NUAA 3K2LA 2J0MB 3ACKA 5M09A 1WCCA 4KIKA 4S31A 1PXMA 4IBMA 2QOQA 4ENXA 4F1OA 3DXQA 2J90A 1LUFA 2YWVA 3ULIA 4NZWB 2WEVA 2QOIA 1UKIA 3GC0A 1OECA 3RBWA 2IZTA 3O17A 2C6TA 3QTIA 4L9IA 4CT1A 4D28A 2ZB0A 4CVAA 2XJ1A 1PMUA 3HMNA 4EI4A 4JX3A 5EH0A 4FT7A 4IX5A 3ZFMA 5CEPA 4TYHB 2P4IA 2QODA 2QLQA 3DB6A 4QD6A 3UP7A 2OXYA 5M51A 3ZUUA 4RIYB 3UVRA 4D0XA 4ZLYA 1REJA 3QRJA 3NMUF 2YITA 3UIUA 3V3VA 1DAYA 3OMVA 4PX6A 3GCQA 4EH3A 2DYLA 2JIIA 4G5JA 4M8TA 5IUIA 5D7VA 4CXAA 2IVVA 5LMAA 5CF6A 5G6VA 5BVDA 3E87A 4MD8E 4RWKA 4M3QA 2VTNA 2W7XA 5AR2A 1XH8A 2C6EA 3MIYA 3Q52A 4YTIA 2W17A 4BGGA 3QCQA 4FKPA 4RT7A 4GYGA 1FINA 2R0UA 1H00A 3DBDA 3FXWA 3SC1A 3W8QA 5I9WA 4YJQA 4C3FA 4FNWA 4I6QA 3HRBA 2WQEA 3MSSA 4OBQA 3CTQA 5BMMA 4IHPA 3UODA 1KE5A 4BHNA 1H25A 4D1ZA 4D2TA 1JNKA 2XNEA 3TTIA 3WYYA 3OWJA 3H3CA 4AZSA 3WILA 2C0OA 3SOAA 4F08A 4I1ZA 5EDRA 4UN0C 1GZNA 5FTOA 4EQCA 4LOOA 2VTMA 4YJPA 4UMRA 4AP7A 4IWOA 4YTCA 3QD0A 3PJ8A 2FSTX 5EG3A 5FRIA 4J99A 3VUGA 5A4TA 2OF4A 3LFAA 3IG7A 4FV6A 4D2PA 2YM5A 2YDJA 3DB8A 3N51A 2J5EA 3V5WA 2HOGA 3TI1A 3RPVA 2XEYA 4Z55A 3DZQA 4ZTNA 4EH9A 3ZEPA 3OCBA 2VWZA 2BIKB 1PXPA 3AC1A 3P7AA 5EDPA 4JDIA 4RIWA 1WMKA 4ANBA 3OP5A 4IX3A 3Q4CA 4CFFA 5DVRA 2WOTA 1CDKA 2XCKA 2JKOA 4A9RA 4AOTA 5LXMA 5FM3A 4EK8A 4GFMA 4ZZMA 4FTMA 3HAMA 4HCUA 5KE0A 4C58A 1KE9A 4L46A 4ZEGA 2WMWA 3JVSA 2EU9A 3QRIA 2OIBA 4I6HA 2OFVA 4P4CA 4RLKA 3RCDA 2VTSA 4GW8A 3OHTA 3ORKA 4O7LA 4X6RA 3I81A 4FC0A 4BN1A 2BDWA 3G33A 2J4ZA 2GNHA 1OB3A 5HD4A 1CKJA 4WIHA 1Q4LA 1GZKA 5EM6A 1YKRA 2YAKA 2QHMA 3KL8A 4BWPA 4MK0A 3FLZA 4E1ZA 4YLLA 1W0XC 5HO7A 2IW8A 3D2KA 4D2WA 2VGPA 4UEUA 1BUHA 4F64A 5GINE 4YJRA 3WOWA 2O0UA 3F3UA 3KXGA 1ZOHA 2O2UA 2KTYA 3EFWA 5M53A 3QD4A 4RFYA 4QP6A 4U40A 5AR5A 4BWKA 4MBJA 4CKIA 5FLFA 4E7WA 3FQEA 4ALUA 1UWJA 2JLDA 2XYNA 4PL4A 3L8SA 3OWLA 5CSPA 4LFIA 3AC3A 5I3RA 1U5RA 5JQ8A 4ITJA 4E73A 4IH8A 3ROCA 4FIGA 4FUXA 3ORZA 3FLYA 5IQDA 4M69B 2XNPA 3LFQA 4C4EA 1F5QA 4O91A 4O7NA 5AJQA 5EYCA 4UYNA 4CSVA 4RMZA 4AZFA 2WQOA 4OTWA 3II5A 4R7HA 2Z7LA 4G3CA 2OW3A 2PZRA 4EOJA 2VWYA 4FSRA 4QP3A 2XNGA 5BYZA 2PVMA 3AG9A 3GP0A 3QXPA 3BIZA 5DGZA 2R7IA 4QP7A 4XNEA 4IB1A 3CEKA 3ANQA 2BILB 3TZMA 3FMJA 4FTNA 4O0SA 1U54B 1KE7A 4RZVA 2A27A 2HENA 2VO7A 1ZZ2A 4BZOA 1UV5A 2PUIA 4R77A 2YCSA 3QQHA 4H3BA 3BLQA 4ITHA 2BTRA 1TQMA 4JG7A 2ITVA 3EN7A 3W1FA 4WBBB 3GVUA 4BI1A 1O6YA 3UOLA 5CAQA 4OTPA 4WG5A 5JKGA 4A9YA 3D0EA 5EW3A 1PW2A 3CY2A 3EYGA 5AP6A 5KMJA 3RINA 4WNPA 3VUMA 5KX8A 4AACA 2YFXA 1OIRA 5AV1A 4KB8A 3ET7A 2UW3A 4LQMA 4XOYA 2ZV9A 2I0HA 5A46A 3C1XA 4HJOA 4PV0A 3ROYA 3FLQA 2JBPA 4YZBA 3OEFX 4EK5A 3LMIA 4XYFA 2ITZA 3H9RA 3UO5A 3MVJA 1U5QA 1J3HA 2WQBA 3F7WA 3R30A 4H1JA 4DFXE 3RPOA 4RG0A 2IW6A 4E20A 2UW6A 4RA5A 2H9VA 3GUBA 3MA6A 3QRTA 3EZVA 4EHGA 5FTGA 3PRIA 5IQGA 4L53A 4JRNA 4XP2A 1ND4A 3ZM4A 2BZJA 5DT0A 2F57A 2GS7A 2FSOX 2GDOA 2X2KA 4C57A 2YHVA 3VF9A 4F09A 4W8DA 2XIYA 2I40A 3TEIA 4DG3E 4EK6A 3DT1A 2CGVA 5KNJA 5C9CA 3TKUA 4GCJA 2BTSA 5J9YA 2Z7RA 2Y8OA 2UZWE 4F99A 4HYHA 4IXPA 4NW5A 3NIZA 5HG5A 5K3YA 4UMPA 4YHFA 3L9MA 1TKIA 4FKSA 4JS8A 2ZM4A 3NYXA 3PSCA 3DFCB 3EIDA 4I5HA 4L6QA 5HIEA 4D2SA 1GIJA 2WKMA 3EQFA 3QRUA 2QOOA 4IMYA 4DFLA 3FSFA 1ZXEA 5KZIA 5J79A 1KOAA 2R3RA 4I94A 1I09A 4FGRA 4FKUA 3FXZA 4V0GA 3BV3A 2OH4A 3FYJX 4N6YA 4ZSAA 4DGMA 3GOKA 3GFEA 2BVAA 4ANNA 5M44A 4CRSA 1IA8A 3GCVA 3NW6A 4OTFA 5D1JA 3FQSA 1ERKA 3HP5A 4QO9A 5I0BA 3SA0A 2Y4PA 3O8TA 2OBJA 2JIUA 2ITXA 5JZJA 2BKZA 3KA0A 3GB2A 5EOLA 3VS2A 4JAIA 4L52A 4OTQA 4BYIA 1FGKA 3HDMA 2QOFA 3CR0A 5EI8A 5A4CA 5AV3A 3PP1A 4BIDA 5TF9A 3NVMB 4O2PA 5CQWA 2C6LA 3G0EA 4FT3A 5FP6A 4F9YA 3BE9A 3R2BA 5ACBC 2QG5A 4Z16A 4JJRA 3BQCA 4M12A 5AIRA 5AUYA 1P4OA 4F6WA 3OW3A 3VRYA 3L1SA 2ZAZA 3FMLA 3QTSA 1HOWA 2YAAA 4FKQA 2BZKB 4CTCA 4J8NA 3FDNA 3GC7A 4S2ZA 5B7VA 2XNBA 3CP9A 3FZ1A 1JVPP 3DNDA 3MH2A 3PWYA 1H8FA 5IH5A 2JEDA 3PVGA 5AP2A 4GL9A 5B2KA 5JFSA 5D12A 4J98A 2UW5A 3S2PA 3BLRA 3ZBFA 4FV4A 4E4NA 4DEDA 4XUFA 4FMQA 3PPKA 3C0IA 4MWHA 2BUJA 2GHLA 1OL5A 1J1CA 4G17A 3TIYA 3TZ9A 3WI6A 3H0YA 3BWJA 2GFSA 3TV4A 2GPHA 3KB7A 4AAAA 4C59A 4O83A 3G5DA 4RIOA 4HVGA 1M7NA 4F9CA 4JDJA 4FVPA 1JWHA 3ZDUA 3QBNA 4JT3A 1OZ1A 2XKDA 3GFWA 5CEOA 2REIA 2QOHA 1YHVA 3UBDA 1NXKA 4NH1A 1OIQA 5LQFA 3O7LB 1E1XA 5ETCA 4GV1A 4A07A 2Z8CA 3A7JA 4YJNA 4B7TA 1CKIA 4EOQA 3JS2A 4QP9A 3R7YA 1XJDA 4I0RA 2R3KA 4WA9A 2XNMA 2PHKA 4FIEA 3PDTA 3TUBA 4Y8DA 3PXFA 1VYWA 5AV4A 1L3RE 1Q8UA 2E9NA 3PE1A 4KIQA 3BHTA 2X1NA 3UVPA 3VBYA 3DLSA 3MFTA 2PUNA 1UA2A 5C4LA 3Q9YA 3R00A 3PXRA 2JITA 4E4LA 1PMEA 1H01A 3WZEA 4B9DA 1J7UA 2X8DA 5IZFA 1IRKA 2V0DA 3GT8A 4RRVA 3VS1A 3VBTA 2CGUA 5IA1A 3F3ZA 5C4KA 5GIOE 3UQGA 2W1ZA 3KXNA 4UMQA 4JBQA 4BCMA 2HIWA 3D5XA 3KVWA 3QFVA 4R8QA 4YPSA 3VQUA 4CMTA 4ZTMA 5AFVA 5JZNA 4C4FA 4TKSA 2GNJA 3BGPA 4F6UA 2CNQA 4C35A 1NVSA 1BL7A 2IZSA 5CLPA 3VWAA 4CV9A 3FI4A 4D4RA 4RBLA 2RIOA 4XHKB 1BMKA 4K11A 5M08A 1YOLA 1GOLA 1V0PA 3AGLA 3ENHA 4I23A 5LVLA 5AV0A 3O50A 3ZM9A 5GZ9A 4FYNA 3RAWA 3RHKA 4KRCA 2VTRA 3A8XA 5CQUA 3HX4A 5AP3A 4NIFA 4ZS0A 4FNYA 1MQBA 4KKHA 5FEDA 1ZYJA 4FSUA 4DH7A 3KRWA 1OPKA 4BCFA 3VC4A 1OKYA 5FXQA 2WMSA 2WMUA 2GS6A 5JGDA 4TWNA 4G9RA 5AR7A 1Q5KA 3HECA 1URWA 4ZMFA 4O2ZA 5CS6A 3O7LD 4G16A 3EKNA 2C68A 5KMMA 4BY9E 2W0JA 3VBQA 5L4QA 4ZAUA 4X2KA 5FDXA 3Q9ZA 2VTQA 2Z7SA 5L8KA 4JVGA 3LFCA 4I20A 4TRLA 4FI1A 4I24A 4YO6A 4FT9A 2C5YA 4BDCA 5LMKC 3DNEA 3A61A 3QD3A 4J7BA 4CNHA 2P33A 3ID6C 2AUHA 3C51A 3FMDA 1MUOA 4KKGA 3V04A 4CKJA 3ZXTA 4MVFA 3E93A 5E8UA 2JGZA 1SVEA 4M7IA 2Z02A 3DAEA 4XG9A 3TNPC 3RPYA 3Q4TA 5AR8A 3NCGA 1PYEA 3DS6A 3MB6A 5FXRA 2ZV2A 2YACA 1NW1A 4DA5A 3ZLWA 2ITQA 2HYYA 2YJRA 1O6LA 3FHRA 3RPRA 3UPXA 4AGWA 3R1QA 3LCOA 2OJFE 1ZARA 1MRVA 4ASDA 5FD2A 2CNVA 3L9LA 2QKRA 5C8MA 2QOLA 1H27A 2W5AA 2WMTA 4IVDA 4EZ3A 1KWPA 4RGJA 1WBTA 4NM3A 2ETRA 5KMNA 3R63A 4W8EA 2LAVA 4O82A 3GU7A 4PF4A 4PL3A 4UWCA 2IZRA 4UWYA 3PVUA 3BYUA 4CYJA 2CGXA 4QPSA 3TJCA 2BMCA 3EQBA 4XBRA 1ZMWA 4EH6A 5EKNA 3ZEWA 2VD5A 3G90X 5CSXA 2OXXA 2X6EA 4GVAA 1OGUA 2C3IB 4RFMA 1J1BA 4BTMA 2WTIA 3EN9A 4ASXA 5JFVA 1H28A 4E6DA 4IADA 3R9RA 3O8PA 2DS1A 2YERA 1YDSE 3VW6A 4LL5A 4C2WA 3PG3A 4UV0A 4JDHA 4O0RA 3NNVA 4QMXA 4U7ZA 4CFMA 1WAKA 1NY3A 3Q6UA 3RNYA 2HW7A 2X2LA 4FZ7A 4PNKA 4O7WA 1YW2A 5AUXA 2W96B 4M15A 3NYNA 5CEKA 3QGYA 3E8EA 3TN8A 5CF8A 3LXLA 3PPJA 4FV8A 4IJ9A 5GHVA 3BU5A 3BEAA 4XX9A 3H9FA 4IX6A 3OW4A 4U79A 5D41A 2PZPA 2XF0A 3FSKA 3T9TA 1CSNA 4U81A 3LM5A 5IH6A 3QZGA 4F9AA 2VTAA 3EN4A 4OT5A 5TKDA 3DDQA 5E91A 5E8ZA 4Y83A 4X3FA 3VS0A 3UMWA 4BDFA 5K5XA 2BALA 3HGKA 4W4VA 2ZYBA 1B6CB 1R0PA 4PRJA 2V7OA 4XV9A 5IA5A 4BI0A 4EJ7A 5A3XA 4BC6A 3PFQA 4FTRA 3V6RA 2C0IA 3SRVB 1GNGA 2R2PA 2PUUA 5T6KA 4GKHA 3IS5A 5ACKA 3OVVA 5CI6A 5K4JA 3ZO3A 3O23A 3SX9A 4IIRA 1UNHA 2XVDA 3FC2A 3FKLA 4PL5A 1OL1A 3MH3A 5HX6A 3CGOA 1XH6A 4MXXA 4EH5A 3QZFA 4JQ7A 3P08A 5AP0A 2Y7JA 3G51A 5DR2A 3MDYA 3OCGA 4IC7A 5AEPA 3O51A 3W18A 2R64A 4FTOA 3HMOA 3VS6A 4Q9ZA 1IAJA 5HU9A 3ODYX 3R71A 1H07A 4PNIA 1Y8GA 3UIMA 5CXZA 2AC3A 4GK2A 3OTUA 4S34A 4BCIA 4E4XA 2F7ZE 2BFYA 3CIKA 4RVTA 3RI1A 4ANMA 4Y5HA 5EYMA 4LI5A 3NIEA 4DN5A 1JKSA 4G5PA 4RC3A 2OZAB 1WVYA 3ZRLA 4AE6A 3U54A 4NW6A 3DK6A 3U4WA 4UALA 3V5QA 3UDBA 2XKFA 2V5QA 4ZY4A 4O7RA 4GVJA 4ZLZA 4MXYA 1UU3A 3R9DA 1FOTA 1IR3A 3G9LX 4UY9A 3VS7A 4DTBA 4V05A 2WU6A 1RQQA 3PP0A 4ZTHA 2W9FB 4FUYA 3SLSA 5E7RA 3F5XA 4I6BA 1Y6BA 3LMHA 3R8VA 2C3JA 3C0HA 3NZ0A 4C4HA 1TVOA 4F70A 3LFEA 3MFUA 3OROA 2I7QA 4ZTQA 2UZUE 4M0ZA 4TY1A 2X9FA 2YM7A 3PIZA 3WZUA 3QC9A 5KHXA 4XOZA 4AWIA 3NVKI 3LKMA 4OBOA 2FSMX 2VZ6A 3PZEA 4FL1A 4IACA 1GZOA 4P5QA 3KGAA 5IU2A 4RIWB 3R0TA 4JR3A 4EORA 4DCAA 4EHVA 5EI6A 4GSBA 1KV1A 5FWKK 4DG0E 4HYUA 3I7CA 3TUCA 4GU6A 4R1YA 4DTAA 3MYGA 4Y5QA 1FMKA 2Z2WA 5GZ8A 2VNYA 3BV2A 4I92A 2CKEA 4O1PA 2CNUA 2C6MA 5BX0A 2EXCX 3PSBA 4F7JA 4RQVA 1S9IA 2XA4A 1JBPE 4AT5A 5HD7A 4C8BA 2W1GA 4YZCA 3REPA 3IDCA 2UZTA 4K33A 1W7HA 3WBLA 4L43A 3TZ7A 5HU3A 1YWRA 4BKZA 4ZY5A 3BLHA 3S3IA 3KU2A 4GT4A 3SW7A 3EN6A 4WNOA 3QZHA 2FH9A 2O8YA 1IASA 2J0KA 3NNUA 4QP8A 4EOLA 3OOMA 3JUHA 4K9YA 5HCXA 4FEWA 4E4MA 2UZLA 3DZOA 3TV6A 4YR8A 2PE1A 4HGEA 3HNGA 1YDTE 3UE4A 3VUIA 2HZ4A 4C7TA 2B9IA 5EKOA 2QU5A 2I0EA 4YJVA 4O81A 4CFVA 3F9NA 5CX9A 4O7TA 3AOXA 4IM3A 5BMSA 3ZH8A 3QUEA 4XRJA 1WBOA 1Q61A 3R9OA 4NFNA 3MB7A 4J71A 4NFMA 5AP1A 2ITTA 5AM6A 3R7IA 3CTJA 2FYSA 2HXLA 1VZOA 5H8BA 3DQXA 4PY1A 2QKWB 2B9FA 2Z7QA 4FTIA 3A2CA 2HWOA 4UXQA 4AOIA 5ICPA 4TNBA 1YWVA 2ITOA 2RFEA 2PZIA 4AGCA 4K0YA 2WO6A 5BQ0A 1Q99A 3W16A 4PMSA 2J5FA 2W9ZB 3KVXA 2BRHA 3R6XA 5JRSA 4BR3A 4DFYA 1PJKA 3E3BX 4U6RA 1ZYCA 2HAKA 4UXLA 4FK6A 1P5EA 2O63A 1WBSA 2XBJA 4U3ZA 3SXFA 4LL0A 3S0OA 2VN9A 3EFKA 4O0YA 4U97A 3ALOA 3LPBA 5H8GA 3TWJA 2WAJA 2ZVAA 3HA8A 4C4JA 5KMKA 4N57A 4MXAA 3HRCA 5HCZA 3GENA 2VTTA 3A7FA 2W4JA 2WTVA 3ZSIA 1F3MC 3FHIA 3DDPA 5DI1A 5CT0A 2F7XE 2LGCA 2PMOX 4IM2A 3VS5A 5HHWA 3GQLA 5HNIX 3CXWA 5EHOA 4AX8A 4IWPA 3F2AA 4DYMA 1Q62A 5GJFA 5GNKA 5EYKA 4ERKA 2W1FA 2CN5A 3HMPA 4RLLA 2PMLX 3R7VA 3MVLA 3KQ7A 5EI2A 3GNIB 5HG7A 3I7BA 4X2JA 4QMMA 4ZSEA 3E62A 2HZ0A 2IJMA 3F82A 5M4FA 3KULB 2C0TA 3FY0A 2GNLA 3I1AA 4CLIA 5F9EA 4QMWA 1XR1A 3HV5A 2VO6A 1B39A 3GCSA 3TCPA 3PXZA 2G01A 4YJSA 1F0QA 3POOA 5C01A 4C4GA 3BWFA 3DK7A 4JOAA 4PTGA 2YZAA 4EBWA 3FQHA 3UOHA 1V1KA 3RK7A 3RWPA 4F9WA 5IEYA 1GJOA 3U6IA 4FEXA 2VWWA 3RALA 2CKPA 3B8QA 4W9WA 3C4XA 4Z7HA 5C8KA 2Y0AA 5E1SA 3GU5A 2R3QA 4RJ6A 3SHEA 3G6HA 3MVHA 3JYAA 2WMRA 3H10A 5BUJA 3BYMA 3OXIA 4HGSA 3P79A 4FKTA 4ARKA 3QTWA 3AMAA 4OT6A 3Q2MA 2IZUA 1QPJA 5FXSA 2XNOA 2C3KA 4AXAA 5I9YA 3W55A 2E9PA 3VS3A 5DBXA 4O6LA 2CJMA 4EC9A 2V22A 4RIXB 3DA6A 5KMOA 4C33A 5AA8A 3EH9A 3VHEA 2C5OA 3HP2A 4TYEA 4AT3A 3CKWA 4BCHA 5F1ZA 3C4ZA 4GJ3A 4ACGA 1A9UA 5AUZA 3WYXA 3R2YA 1APME 3Q6WA 3QALE 1XH5A 4K8AA 3KFAA 4HOKA 4G1WA 4BCOA 4KINA 2I0VA 4AGDA 1JLUE 4E6QA 1QCFA 2GHGA 4LMNA 4XCUA 2DWBA 4A9UA 1PXLA 3E92A 3ZHPC 4QMTA 1ZLTA 5EW9A 5J8IA 2EB2A 3ZLYA 3LXKA 3R8UA 4LV5A 4I3ZA 4TWOA 4Y73A 2W1CA 5K0KA 3NDMA 3R1SA 5AR3A 2BHHA 4YHTA 4WSQA 1BX6A 3P0MA 3I6WA 5HVJA 1OVEA 1ZY4A 4D4YA 4A4LA 4D4VA 1YHSA 3O96A 2JC6A 2QHNA 2PMNX 3CTHA 4QMVA 3ZOSA 3GC9A 2CN8A 3M2WA 5BUEA 3ATSA 3EJ1A 4G3FA 3ZZEA 2GSFA 4F1MA 4W9XA 4MNEA 5DLSA 3R22A 4K1BA 4DGLC 4JDKA 5BPYA 5GZAA 2F49A 3D2IA 3F3WA 3WIKA 5L6OA 3AT3A 2OI4X 2IN6A 4ANOA 2YIWA 4U41A 3OOGA 4BFMA 1PKGA 3PLAE 2RGPA 2WQNA 3CY3A 4TXCA 3SD0A 3IGOA 1OIYA 4AQCA 3QX2A 4QQ5A 2CGWA 3RTPA 4Z9LA 1U4DA 5JGBA 2GHMA 3QQFA 4USDA 5HBJA 3IO7A 4A7CA 4ZLOA 4DH8A 4FSMA 4L7SA 4CZYB 4NCTA 2H34A 2XK6A 3LCKA 3ORXA 2JKQA 4FTJA 2RFNA 2QO2A 5CVHA 2EXMA 3TIZA 4CFUA 5F94A 4YGAA 5J87A 4QNAA 4S32A 3HV4A 1KV2A 4WBOA 3ORIA 4P5ZA 5IPJA 2R3MA 1Q3DA 1R39A 1CTPE 2RL5A 3IGGA 2W5BA 5J7HA 2QI8A 4KS7A 4R5YA 3S95A 3VBVA 4KA3A 3O2MA 1W8CA 3ERKA 4D55A 3DOGA 4OGRA 4EHEA 4IAKA 2H96A 5HVKA 3FZPA 4YTHA 4IFCA 2GNFA 2XYUA 3FJQE 3LZBA 4RX5A 1AD5A 3D94A 2HELA 4FL3A 1MP8A 3MTFA 4MD7E 5FP5A 4D5HA 5DRBA 4BTFA 3QHWA 5FBNC 5HGIA 2YABA 5TE0A 3A60A 2P0CA 3ZMMA 5DA3A 4IZAA 1UWHA 4RVMA 4XG8A 3BGQA 4IWDA 4L8MA 5AR4A 3W32A 4EH7A 1NT2A 5GIPE 4GIHA 5LMBA 3IK3A 4XG4A 3DAJA 3WF8A 4BBFA 3MA3A 4Q5EA 3PPZA 4FKRA 3W8LA 3ORLA 4I0SA 4QQJA 4JR7A 3NUXA 1PXJA 3ZO2A 5CAUA 4DGNA 2YIRA 3GOPA 5HNBA 2RFSA 3ZFXA 2BKKA 4EK4A 1EH4A 3OG7A 4P90A 1ZZLA 4WRGA 2YIQA 1YVJA 4HZSA 4QTDA 2BRGA 3EL7A 5CSVA 5HO8A 4KD1A 2F9GA 2FB8A 4GK3A 3U9CA 4NCTC 3C50A 3OBGA 1SNUA 5BVNA 2OG8A 4TTHB 2UZVA 1BI7A 3TNQB 4KIPA 3FMKA 3ZC5A 2YWPA 1IG1A 4C34A 2C5VA 1ZYSA 5C26A 4ZZNA 2GS2A 3UG2A 5KMLA 3HYHA 4ORKA 5DN3A 4R6VA 3ITZA 1MRYA 3COKA 2HK5A 2BR1A 1FBNA 4D0WA 3ZC6A 4E5WA 5JMSA 3QLGA 1ZOGA 3C0GA 3F66A 2C1AA 4MTAA 3FWQA 4UWBA 4YP8A 3QCYA 1RJBA 4EOPA 3OEZA 5AM7A 5IUHA 1SM2A 4TYHA 1ZAOA 5HNGA 3TJDA 2F2CB 5IEVA 3Q4ZA 1JKTA 2C6IA 2O5KA 2XB7A 3EQDA 2WTDA 4MBIA 3QU0A 5LVNA 3E64A 5AP4A 4QPMA 5G1XA 3OXTA 4PDPA 1XBCA 4XS2A 4U0IA 5EHLA 4QQTA 3RAIA 4DGOA 3NUYA 4FKWA 2Y9QA 3MH1A 4FR4A 4AN9A 5K5NA 1O9UA 4BYJA 1PXKA 5LCJA 4AF3A 3R8ZA 4FF8A 4BIEA 2ZDTA 4CMUA 1H1QA 2WFYA 4TPTA 1J7IA 2EUFB 4FL2A 4DF3A 4MXOA 2ZV8A 2RKUA 4FV9A 5KO1A 5HZNA 5HCYA 4NL0A 3E7VA 5ANKA 4D1SA 1IAHA 4R1VA 4WG4A 4XG2A 5CZIA 3EQGA 4C3RA 1Y57A 2FGIA 2PVNA 4GUBA 2HW6A 1Z5MA 1KUTA 4P7EA 3PJ1A 4U80A 4BB4A 3ZFYA 4EJNA 4USFA 3QRKA 2G9XA 5E4HA 1GZ8A 5EM8A 3R1YA 3UZPA 3LQ3A 2JFMA 3HKOA 5A9UA 4M97A 2WB8A 4FSYA 3U4UA 3MV5A 2XZSA 5IG1A 4O86A 3TM0A 3JY9A 4V04A 4YBJA 3MPAA 3BHYA 3QCXA 3B2TA 4CGAA 4RVLA 3Q2JA 4UMUA 3KXMA 5M06A 3I79A 5CALA 3M11A 4PMTA 4YSJA 4O84A 3KMWA 5AX9A 4AU8A 5AX3A 1OMWA 5CI7A 3ZCLA 4PDYA 2XK8A 4GG7A 4KNBA 4YLKA 4FYOA 5E1EA 3N4VA 4GJ2A 4ZTRA 1DI9A 4X2FA 5FGKA 4H1MA 3RCJA 5CVGA 2B1PA 2YZLA 4WSYA 5BUIA 5F20A 5FTQA 1PKDA 1YRPA 3AT4A 4F7SA 2BIYA 3MS9A 3PIXA 4YC3A 4AA5A 3BZ3A 2X81A 4EC8A 1REKA 2UW9A 2E2BA 2ACXA 3WZJA 3U9NA 1G3NA 4EOKA 5J1VA 2ITWA 2WU7A 4UYAA 1WBVA 5C03A 3RM7A 4BCQA 3KXZA 4R7BA 3CC6A 1H24A 2QO9A 2YCRA 3OS3A 3MJ2A 4L3JA 5ANOA 3KEXA 1FVTA 3DQWA 3MIAA 4UMTA 2Y6MA 4AN2A 2Z60A 4FV5A 3ZTXA 4O22A 3G2FA 2W4OA 4AE9A 5IQHA 3DBFA 5J9LA 4UZHA 2VWVA 3TV7A 3DKCA 2XK9A 3F61A 4HVSA 3LLTA 5L2TA 3C9WA 2OSCA 5EFQA 3EQHA 4UBAA 5M55A 4O7YA 4YZNA 3CCNA 5C1QB 2B4SB 3H30A 3IONA 3QTRA 4ITIA 5FEQA 4QMNA 2OIQA 1PXNA 2HY0A 1YI3A 4O0UA 4OTGA 3NW7A 1HCKA 4JRVA 5IKWA 4AA4A 2OF2A 4H3PA 3ODZX 4X2GA 5IF1A 2R3OA 2W4KA 3P7BA 3VHKA 2YM6A 5IA4A 4OAUC 2C5NA 3WIGA 3HAVA 4TYIA 3C7QA 5A14A 3A62A 4LV8A 4ACHA 3UGCA 4XLIA 4C62A 2UW4A 5H9BA 4KABA 4EONA 3ENMA 1BLXA 1PXOA 3BKBA 1OPLA 4NK9A 4QT1A 1UNLA 4S33A 1PY5A 3EHAA 3I4BA 4QPAA 4C37A 4EOOA 4QMQA 2PPQA 4L01A 3NNXA 2CKQA 1OIUA 2R3IA 2C5XA 4APPA 3NSZA 4E6AA 1UU9A 3OFMA 2CDZA 4WOVA 4JI9A 2BPMA 1U54A 3EL8A 3HA6A 2VX1A 1YOMA 4LRMA 3F2RA 4IDTA 5BVFA 4FTQA 2X4ZA 4F7LA 4CLJA 1Y91A 3Q9XA 5CU3A 3R1NA 1H0VA 2GNIA 2CLXA 3WZKA 5BYYA 2CCIA 2B54A 4ZTLA 1H1WA 2CLQA 2GQRA 3KMMA 3WF6A 3QTUA 2BRBA 3I0QA 2O64A 3NW5A 3UOJA 4K77A 3KRXA 1PYXA 2JDTA 4XMOA 2W1EA 1B38A 4IE9A 5DIAA 4F65A 1YQJA 1RE8A 4CYIA 4ALVA 4UX9A 3FLNC 3FL4A 3ZRKA 3HUBA 4ZSLA 3VW8A 4CFXA 1URCA 3U55A 4GRBA 2QR7A 5AUTA 3LCSA 1M2QA 3HUCA 3I6UA 4BDDA 3ZUTA 3P86A 5KKRC 3EMGA 4ACMA 2VX0A 4FKOA 3QC4A 3E8NA 4PUZA 3TZ8A 4RFZA 3PY1A 3PY3A 4J1RA 4IZ7A 3D15A 4CT2A 5AUUA 4RJ7A 3OY1A 5CEMA 4MF1A 3WF9A 2BRMA 1GIHA 4XEYA 4APCA 5CAPA 4BCGA 4CFWA 3MFRA 4YMJA 2OWBA 4U9AA 3FZRA 5HIBA 3QX4A 4FOBA 1XH7A 5A4EA 2E9OA 3PSDA 4CQGA 3HL7A 3K5VA 4PMPA 1TQPA 1VJYA 3LFBA 1QL6A 5HBHA 4KUJA 1KE6A 1ZOEA 4IZ5A 4YHJA 3WZDA 2WHBA 5E8SA 2Y4IC 3F5PA 4A9TA 4CCBA 4OTDA 3R21A 4B8MA 2HXQA 2QQ7A 4JBOA 4N70A 4E26A 3G9NA 1UVRA 1FVRA 3GQIA 3JY0A 3LQ8A 5JFXA 3SG9A 3FLSA 1OBDA 3CQEA 1DM2A 3KCFA 4OTHA 3OF0A 4LRJA 4MHAA 4QNYA 5E90A 5TT7A 2W06A 3FL5A 3C4WA 4K6ZA 4C36A 2Y6OA 3QTZA 4FZDB 3I60A 3DPKA 3KC3A 5ANDA 5AV2A 2B7AA 3D7ZA 1AGWA 3BBWA 4O0VA 1L8TA 4M0YA 3QGWA 3VIDA 4I21A 5J95A 4ZIMA 4LOQA 4HGLA 2H6DA 1ZY5A 3C4FA 5KHWA 3QA8A 1G8SA 4DFUA 1YXSA 5EHYA 3OUKA 4BVUA 3HMIA 4GU9A 4J96A 1QPCA 2JDRA 4R3PA 4RX8A 3RK9A 3F2NA 3BCEA 4F0FA 2PWLA 3DBCA 3LJ0A 3RAHA 1CKPA 2CMWA 2FA2A 3EFLA 4IDVA 3N9XA 4XRLA 4D2VA 5A6OA 3MY5A 4A9SA 3DXPA 4HNIA 4F6SA 4GUEA 5HE2A 3G15A 3CS9A 2ESMA 5L8JA 4FT5A 1VR2A 5HVYA 1YWNA 3D5UA 4DITA 5BVWA 3UYSA 4NJ3A 4C38A 2XK4A 5IA3A 3CQUA 4LG4A 3VUHA 4EKKA 4JXFA 4FIJA 4XG7A 2JDSA 1FGIA 4DBNA 4J95A 1VEBA 2YCFA 3A7HA 1E1VA 5DH3A 5IISA 5EQEA 4LGDA 3QL8A 4KIKB 3VNTA 4D2RA 4DFNA 3LQ5A 2VAGA 4D58A 4DEEA 4ASEA 2B9HA 3LAUA 4HYSA 2HWPA 4W4YA 1OI9A 3R02A 4QTAA 1W84A 4FX3A 3QQLA 4GIIA 4XLVA 5CSHA 5AMNA 2UZNA 4OUCA 4KS8A 3D7TA 2VU3A 4KKEA 2JKMA 3ZO4A 3MY0A 4W4WA 4ZZOA 4E8AA 4NM0A 2H8HA 4FTTA 4PPAA 4ACCA 4Z7GA 4QTEA 5EM7A 3NYOA 3PA3A 3KK8A 3VAPA 3FC1X 2BZIB 2O65A 2NO3A 2WMAA 5TR6A 3ACJA 3FMHA 1I44A 1KE8A 4XG3A 1FQ1B 2PVFA 2OXDA 2QC6A 1HCLA 4FSQA 4J97A 4L67A 4QP2A 4PMMA 5FG8A 3VN9A 3UQCA 2X0GA 4G6OA 2C1BA 3AC2A 3F5GA 3BHUA 3POZA 4RJ3A 1YXTA 4GFGA 4TWCA 4FSNA 4YSMA 2R3LA 2AC5A 4IQ6A 5DFPA 5DOSA 4QMSA 3HLLA 3KK9A 4MEDA 3W2QA 3MPMA 3ZLSA 4B8LA 4JIAA 5JGAA 4GT3A 1XBBA 1GY3A 4IAFA 1E9HA 4FG7A 5AUVA 1Q24A 2R3HA 5IQBA 4I4EA 4JQEA 4DH3A 4YUQA 5CF5A 2XIKA 2PVJA 3ZLXA 5DT4A 4FV1A 2JD5A 3OXZA 4XV3A 4IVCA 4G2FA 4TT7A 4BDKA 5LVMA 4OAVB 2C47A 4X3FC 4QOXA 5E92A 4ANSA 3KRRA 4RPVA 3FEGA 4JX7A 4O7VA 3NEWA 5L6WL 4DAWA 2PZYA 4IEBA 3PRFA 3ZBXA 3COHA 3BYOA 2RSVA 3OWPA 4ERWA 4BGQA 4L00A 3P78A 2P55A 4G6LA 5DWRA 2A0CX 3CSVA 4DLIA 4AA0A 3ZXZA 4O7ZA 2XKEA 4EZ7A 1U59A 2G2FA 4GFOA 3Q60A 3KN6A 4DG2E 4HW7A 2GFCA 2WTKC 5AAEA 5A4QA 4M14A 2RG6A 2ETMA 3I0OA 3GU4A 2QVSE 4LMUA 4Z3VA 1ZRZA 3BX5A 4N6ZA 2EWAA 4FV2A 5FM2A 3LLAA 4LUDA 5DG5A 2FSLX 4WO5A 4DEHA 4EHZA 4YU2A 3FKNA 3M42A 4BBMA 2A4LA 2I6LA 2OICA 4K18A 4PP9A 4BHZA 2X2MA 2XH5A 5FDPA 3DKGA 2GTMA 1PHKA 4NM7A 5FEEA 5BVOA 4ALWA 4R3RA 4MNEB 3U8WA 2SRCA 4RSSA 2FVDA 3UVQA 4OLIA 4TZRA 1QMZA 3DKOA 3CQWA 3ZO1A 4Y95A 5HTIA 4C2VA 5JQ5A 1WBNA 4ONAA 4TYJA 3R7UA 4E3CA 2X7GA 5CY3A 4RWIA 2VO3A 4BDAA 5M07A 3RMFA 2ERKA 3KY2A 4BDGA 4RX9A 4Y72A 4MXZA 5BVEA 4C3PA 2OK1A 4XV1A 4I41A 3VVHA 3V5TA 3UO4A 4BF2A 5CT7A 2VTPA 4QYYA 2UW0A 3QAME 4KSPA 1K2PA 3QQKA 4KAOA 3PE2A 3JR1A 4BCKA 3CE3A 5HG8A 3ZUVA 3T3VA 2PMIA 4WD5A 4AN3A 4JQ8A 3KXXA 1NA7A 3EKKA 3MH0A 4ZS4A 2UZDA 2FUMA 3DJ5A 4R7IA 4H3QA 1OUKA 3GGFA 5CU6A 1RW8A 1H08A 4II5A 3ZYAA 5HLWA 3BELA 4BDEA 3EWHA 5TO8A 1PRYA 4O6EA 1M2RA 5E8XA 3BEGA 4Q5HA 4WG3A 1JQHA 3PY0A 3RZBA 3NLBA 4I5CA 3S4QA 4GS6A 4BRXA 4PDSA 1FPUA 2VWBA 5KBQA 3KXHA 5CWZA 4FEVA 2ITYA 4AOJA 5LCKA 3CGFA 4QYEA 4HVDA 3FBVA 3CJFA 2GTNA 2OIDA 4KRDA 5DE2A 3K3JA 2BCJA 3PA4A 2QG7A 2JAMA 2QOCA 4KBCA 5JRQA 3LE6A 1XBAA 5JFWA 2JIVA 3HV3A 4J8MA 1XKKA 4IB5A 4FTLA 4ZOGA 4ZTSA 3E8DA 2ITNA 3EYHA 3R7OA 5HEZA 2YDKA 3GBZA 3DGKA 1OBGA 2C69A 3G0FA 1YDRE 2G15A 2WIPA 4AZWA 4M84A 5LWNA 5E8WA 4ANLA 5IDPA 4FSZA 3FI8A 3HMMA 4OW8A 4J52A 3NUSA 1TQIA 1XHAA 1Z9XA 3ORTA 2QOKA 5DR9A 1OL7A 4C61A 4LOPA 1ZYDA 3U6JA 2PU8A 2Q0NA 3PWDA 3QWKA 5HG9A 5K4IA 3O8UA 4PP7A 2BZHB 2VO0A 2J0LA 3F88A 5AADA 3UZTA 4FV7A 2QCSA 3Q3BA 2OLCA 4IJPA 4MKCA 2XNNA 4BTKA 3C4CA 4XP3A 3UNZA 4B4LA 4NKAA 5HOAA 4EYMA 5EQYA 3G6GA 2VRXA 1YI4A 3LXNA 5D10A 2FO0A 2JBOA 4TNDA 3SRVA 5JK3A 1UKHA 5AIKA 3NYVA 4BL1A 3ATTA 3W2PA 2VV9A 3ORNA 2C30A 2QNJA 2VWIA 4EUTA 1JPAA 2WMBA 4FK3A 4JBVA 4CCUA 3A8WA 4FVQA 5JH6A 1BI8A 4BCPA 4FIHA 2QR8A 3NAXA 5IQFA 4BDJA 3DJ7A 3KF4A 4HPTE 4DHFA 3CKXA 3PVWA 1ZMUA 2VTOA 4QTBA 1PMVA 4QP1A 3UJGA 2UV2A 4WT6A 4XV2A 1Q3WA 4EQUA 3AGMA 4QMYA 4R3CA 3THBA 4USEA 1P4FA 3MW1A 4NT4A 3TT0A 3KRJA 2CSNA 3UC3A 4JG8A 2WTJA 5DT3A 5I3OA 3VJOA 1Y6AA 3L8VA 4U3YA 1ZWSA 2VTHA 4V0GB 5D9HA 1R78A 3IOKA 5B0XA 3BQRA 2OZAA 5J5SA 3QKKA 2UZEA 3V5JA 4NEUA 3R83A 3PYYA 4ACDA 4IX4A 3SXSA 3LFSA 4FTCA 3CJGA 4LRKA 1YOJA 3DBQA 4KBKA 3TG1A 2X8IA 4WNMA 3UOKA 5A54A 5I9VA 3BI6A 3QZIA 4EH4A 4EYJA 2YM4A 4RJ5A 2UUEA 3NS9A 3CD3A 3ETAA 5EK7A 2VWUA 1NVQA 3F3VA 2XIRA 3V01A 4R5SA 2PVYA 2R0IA 2X39A 2OGVA 4QTCA 5F95A 5HLPA 3UMXA 3W2SA 4BIBA 4CKRA 5KMIA 1OKVA 1Q97A 2W1DA 3LCTA 3R8PA 5I4NA 5JSMA 4D5KA 5IDNA 3M1SA 3FKOA 3QUPA 4ZY6A 3GEQA 3W10A 1DAWA 4YZMA 2ETKA 5JN2A 5L2WA 4NWMA 4I6FA 2PSQA 4HYIA 4I5MA 3ZSGA 2XIXA 2VNWA 2VTIA 4AZTA 1H26A 1G5SA 4ZSJA 3CLYA 3V5PA 4D9TA 4AZVA 4W4XA 5K9IA 2P2IA 3FY2A 3LFNA 3I5ZA 1M17A 3LOKA 2W1HA 3VRZA 4YTFA 4F63A 5DNRA 4DTKA 5J9ZA 3F3TA 3SKCA 5EOBA 3FZOA 3V6SA 5ETIA 5LVPA 3QA0A 5BYLA 2R5TA 3U87A 3UYTA 2P3GX 2CKOA 3E7OA 3VBXA 5FQDC 2ZMDA 3IW8A 1JKLA 1ZYLA 2UZOA 4ZSGA 4F1TA 1Q8WA 2ZV7A 5ETAA 5KUPA 4FSWA 4RVKA 3NPCA 4MNFA 2I1MA 3RWQA 1MRUA 5CTPA 4EBVA 4E6CA 3UC4A 2PL0A 3KRLA 1QPDA 5T3QA 4IZYA 4FEQA 5HE3A 1KSWA 4C0TA 4PTEA 4MD9E 4DT9A 3VUKA 3DCVA 1R3CA 3S1HA 3P23A 4WRSA 4BDBA 4L45A 4DFBA 4QYFA 3WF5A 4H05A 3ELJA 1V0OA 4FIFA 5IQIA 4IAZA 4CEGA 3D83A 2ZJWA 3CPCA 4HCVA 3Q32A 1OL2A 4X21A 4HZRA 2F4JA 5HE1A 4B6LA 5KKRB 4S30A 5HKMA 4LUEA 4GMYA 4BKJA 5LARA 1Q8TA 2PZ5A 3AC8A 3NRMA 4IWQA 4MX9A 3T9IA 4OTRA 3TTJA 4CZTA 2G2HA 2W5HA 5J1WA 1OUYA 4AW5A 4K2RA 4FKLA 3U6HA 2OZOA 4MCVA 5L2IA 1M52A 4U42A 5L2QA 5F4NA 3RHXA 4D4SA 2R3PA 2XEZA 4I4FA 3DTWA 1O6KA 2YJSA 3FZTA 3NX8A 3BYVA 4NTTA 4ZJVA 5C8NA 4DT8A 4DFZE 4DEBA 3UIXA 4YZDA 2X6DA 4M67A 4YC8A 4NTSA 4O0XA 3EQPA 2Y4IB 3Q96A 4FTKA 3RJCA 2BRNA 2RF9A 3R01A 4DGGA 2XM9A 2HZNA 5A4LA 3FMNA 3RNIA 2R7BA 3PLSA 3AD4A 5HBEA 3QF9A 1X8BA 5T68A 3QQJA 3FPQA 1GIIA 1JSUA 1SNXA 4M66A 4NIFB 4EZ5A 1XO2B 5H3QA 5B2MA 4Q9SA 4G9CA 3OCSA 3VS4A 2PE2A 4DE4A 2WZJA 1XQZA 4L42A 4AFJA 5IA0A 1BYGA 2XBAA 3BYSA 3QWJA 3VQHA 3FI3A 2XIZA 3BHHA 2J50A 3AMBA 3KULA 1LP4A 3FUPA 3OTVA 4O0WA 4YJOA 4UZDA 3HV6A 5HO6A 5JEBA 5L8LA 2PY3A 2ZM1A 3FYKX 2I0YA 2ZB1A 3AC4A 3L8PA 3TNWA 4DEAA 1WFCA 4ANQA 4RIYA 3AQVA 4F0GA 3HZTA 2CHLA 3PJ2A 1Q8ZA 1Z57A 1M2PA 1YXUA 5KZ0A 4ZP5A 4F0IA 3A4OX 5DPVA 3EQIA 1UU7A 3P9JA 3Q9WA 3PG1A 4RZWA 3ZZWA 1Q41A 4BZDA 3PUPA 5BNJA 1CMKE 2F2UA 5IUGA 4MYGA 4GK4A 3AC5A 4FKJA 3ZSHA 5AA9A 2B55A 2UVXA 5CSWA 3UIBA 3PXKA 2BFXA 3UP2A 4X0MA 3RK5A 5GJDA 2QO7A 3MWUA 2G1TA 4N0SA 1OKWA 4LYNA 1OL6A 4YC6A 3IW6A 4WHZA 3QYZA 3PXYA 5CNNA 1LEWA 4V01A 3DJ6A 5DYJA 3W2CA 3D4QA 4L3LA 4LGHA 4QMZA 4MXCA 3IECA 2BHEA 3ULZA 4RIXA 1JSTA 3BGZA 4JAJA 1GAGA 3GCPA 3N4TA 2J9MA 2WTWA 3GC8A 3NAYA 4M13A 2X4FA 4ZXTA 3F6XA 3IOPA 5CAVA 1ZMVA 4CG9A 4PPCA 3RKBA 4FVRA 4HNFA 4FKVA 3GU8A 3NUNA 1AQ1A 3WE4A 2B52A 1OKZA 4O96A 2B9JA 3FMEA 4DC2A 4GYIA 3HEGA 2PVHA 4KBAA 4MH7A 4RC2A 5C27A 3ZS5A 3SG8A 3FMMA 4YNOA 2UVZA 2QLUA 3MPTA 4MAOA 3KKVA 2BDFA 4CRLA 5IEXA 4EOIA 4AW0A 2J2IB 3DAKA 3PVBA 2YLEA 4PTCA 3COIA 4B99A 3FPMA 5JT2A 1U46A 2IPXA 4Q2AA 3WARA 4BGHA 3T3UA 2XMYA 3DLZA 1SVHA 2XS0A 2NRYA 2WQMA 2XKCA 3L9NA 4FKIA 2R4BA 4WKQA 4A4OA 2XCHA 2F7EE 5E8VA 2J7TA 2JDVA 2V62A 5D11A 2R3NA 2C4GA 3DK3A 1SYKA 5DR6A 3FAAA 3F5UA 3BRBA 4OR5A 4XH6A 5EDQA 4PDOA 2BAQA 2GNGA 4X3FB 2ZM3A 4CTBA 2E9UA 4GT5A 5M57A 2WIHA 2OU7A 5D7AA 2YN8A 5IQAA 4OBPA 5HICA 3NUUA 4IVAA 4RWLA 4FG8A 4MQ2A 3WF7A 2XJ0A 5TOZA 4YO4A 3EQRA 3D7TB 3F69A 5CVFA 4L3PA 5LJJA 3LCDA 3D5WA 4U43A 3FV8A 4JIKA 2VTJA 4DH5A 2RFDA 2ITUA 3GXLA 4BI2A 4DEIA 5DMZA 2QD9A 2WTKB 2AYPA 2EB3A 3EB0A 3VO3A 2NNWB 4BDHA 5L6PA 5IQCA 1Y8YA 1SMHA 1YHWA 3OWKA 3Q53A 4U44A 4TL0A 2WELA 2GQGA 3SQQA 4EH8A 4LGGA 2YM8A 2XRUA 3LMGA 3T8OA 2KULA 4FODA 1PXIA 2VGOA 4DLJA 1FMOE 3RAKA 1YXXA 4DH1A 4AGUA 3CBLA 3SGCA 3IDBA 4NSTA 4M69A 3E5AA 4HVHA 4CG8A 3QTXA 4NUSA 3O71A 3GI3A 2CPKE 2PE0A 3B8RA 4FICA 3OY3A 3R9HA 5LOHA 3ALNA 4QRCA 3UG1A 1Q8YA 4JG6A 4U45A 3PJ3A 3W2OA 4NKSA 4RA4A 5AUWA 4WUNA 3QCSA 2JKKA 1JOWB 4DBXA 4QYGA 3MFSA 2WNTA 3CPBA 3P4KA 5I9XA 3H9OA 4EH2A 3ZRMA 3GCUA 4O7SA 1OPJA 2R9SA 2G2IA 2IVTA 2XK7A 3DTCA 4H36A 1P14A 5LMKA 4CFNA 3PXQA 5GJGA 5HTCA 4FA2A 4FEUA 2RG5A 3E8CA 3IW4A 4G31A 1WZYA 3P7CA 3ZDIA 2OKRA 3AD6A 2J51A 3AD5A 3COMA 4DINA 4FIIA 2Q83A 2WPAA 5CZHA 3MI9A 4GKIA 1T46A 5L2SA 4O27B 3SAYA 4QMLA 3OZ6A 5EW8A 4IM0A 3P1AA 4FTUA 4KSQA 2WTCA 2DQ7X 3HVCA 3V51A 4QP4A 2GU8A 3BHVA 4O1OA 1RDQE 3Q4UA 4FE2A 4BKYA 4Y85A 4QMPA 4YZ9A 1CM8A 4QMUA 4XBUA 5EYDA 4AW1A 4IAIA 4CD0A 4FGBA 4CMOA 2C3LA 3LM0A 2JDOA 3HRFA 5IA2A 3DBEA 2UW7A 4FSTA 3OD6X 2HCKA 2QURA 3QD2B 2QONA 5CENA 3UNJA 3EQCA 3L8XA 4AG8A 4UB7A 1PMNA 4R78A 3W2RA 2PTKA 4RX7A 3S00A 3DKFA 1DS5A 1QPEA 3B2WA 3OC1A 1MQ4A 5AP5A 4TW9A 2HY81 4PPBA 2PVLA 3Q5IA 3TXOA 5CU2A 2R3JA 2V55A 3PA5A 2EVAA 3H4JA 4IB3A 3QKMA 4RJ4A 4ZJIA 4EOSA 4M68A 3EOCA 3C5UA 4IC8A 3PIYA 3IDPA 5I5ZA 2WXVA 2BDJA 2GMXA 4GH2A 2XK3A 3D14A 2A2AA 3HV7A 5DEYA 3FZSA 3QUDA 3I5NA 5CF4A 1WBWA 5M56A 4QMOA 2PK9A 3CD8A 4I22A 3NR9A 4AUAA 5KCVA 3AXWA 4QQCA 4D9UA 3C5IA 3A4PA 3DV3A 2GQSA 4ID7A 4EQMA 2YLFA 2A1AB 4GEOA 4HGTA 4FV3A 4IW0A 2OJGA 4IFGA 2A19B 4CQEA 1JKKA 4NM5A 3R9NA 5IQEA 1NVRA 5LVOA 5CNOA 1H1RA 2V7AA 4G6NA 3LJ1A 3RPSA 3ZU7A 2OFUA 2JFLA 1H1SA 5DRDA 3VJNA 1STCE 5ANJA 3QYWA 2UW8A 5CXHA 4U5JA 2C6OA 4FG9A 1WBPA 3KMUA 4YPDA 5HE0A 1M7QA 4HPUE 4H58A
chains in the Genus database with same CATH superfamily
2ERZE 5BVKA 2XP2A 3KCKA 4MBLA 2BROA 4ZJJA 3V8WA 3PJCA 3MGYA 4I93A 3FE3A 3MBLA 3DXNA 1OM1A 2PVRA 4PWNA 4AFEA 3UNKA 4E5BA 3QXOA 3A7GA 4E93A 3TUDA 3FXXA 4MF0A 5HTBA 4NU1A 4CV8A 5A6NA 2ONLA 4JBPA 1UU8A 3KN5A 1J7LA 2HZIA 3LFFA 4FZ6A 4AT4A 1YI6A 2IW9A 3QTQA 3R8MA 4FKGA 4EWHA 3D9VA 2X7OA 4TN6A 2A98A 3DFAA 3TKHA 3IPHA 3EN5A 2J0IA 1JAMA 5CU4A 4D1XA 3RVGA 4O21A 5CYIA 3V8SA 4NYEA 3TKIA 3RZFA 2WMVA 3RM6A 2J0JA 5DHJA 5M4IA 5M4CA 2XALA 1XH9A 1R1WA 5E8YA 1H0WA 4L7FA 3MESA 3EZRA 2W99B 2IWIA 3H0ZA 4YNEA 5AAGA 4HCTA 3R8LA 2WMQA 4CZUA 2WOUA 5LWMA 5ANEA 1K3AA 4MQ1A 4AZEA 2XANA 2OJIA 3HDNA 5ANGA 3MY1A 3L9PA 5ITAA 4RWJA 3UDZA 2UVYA 4RJ8A 4X2NA 2NRUA 4NJDA 3ORMA 4C02A 4JL9A 1DI8A 4P2KA 2X8EA 3N4UA 4JNWA 3DU8A 2C6KA 4TYGA 4AS0A 3BE2A 4FT0A 3LJ2A 4I5PA 2BAKA 2OO8X 3V5LA 3C13A 3F7ZA 1YXVA 3IQ7A 3AMYA 2CCHA 4DEGA 5AAFA 3KREA 3MN3A 1SVGA 3E63A 3Q5ZA 3FLWA 1LR4A 3FI2A 3UPZA 3UQFA 2ONLC 3NUPA 3UZRA 3E88A 5HIDA 4KWPA 4A4XA 2YISA 5CU0A 1J91A 3QQUA 2X9EA 3IKAA 2W1IA 3U51A 2R3FA 3UO6A 3SW4A 2X7FA 4A06A 2PYWA 1A06A 4IAYA 5HI2A 2NP8A 3VBWA 2XRWA 4BCJA 4F7NA 4KIOA 5L3AA 2AQXA 3VF8A 3OBJA 4G3GA 3DY7A 3NFFB 4F4PA 5I9UA 4FNZA 1WVXA 3GU6A 4YJUA 5ANIA 4N4SA 4MWIA 4G3DA 3QKLA 4J53A 4BTJA 3TL8A 5CEQA 3R04A 4WUAA 3SXRA 4ZMEA 2C6DA 4TWPA 2IG7A 3W0OA 3VUDA 3A99A 3E3PA 5EM5A 3TNIA 1BKXA 5HESA 4EWQA 3LIJA 2IO6A 1IEPA 3P5KA 4X3JA 3K5UA 3K3IA 5KBRA 2P2HA 2YIYA 3ORPA 5J7BA 2XM8A 4FBXA 5I9ZA 2X0QA 3MVMA 5E8TA 2ZDUA 3LVPA 3NCZA 2XUUA 2OJ9A 5CEIA 3SV0A 2E9VA 4ZK5A 2OH0E 2VX3A 3VUTA 1H1PA 3TNHA 5IMXA 4OTIA 3OCTA 2VUWA 3W33A 1M14A 1OITA 2WMXA 3OUNB 5AWMA 4X7QA 4AW2A 5HLNA 3A7IA 4BCNA 3TDWA 5EQPA 2WEIA 5HQ0A 5ETFA 4WNKA 4GG5A 2XARA 4IANA 3JXWA 4O38A 4IB0A 3OT8A 1SZMA 1WVWA 3R7GA 4EUUA 4FNXA 2B53A 1T45A 4FV0A 1W98A 2YEXA 3OT3A 4BICA 4EKLA 4L68A 3C4EA 3NGAA 2ZOQA 4EEVA 2YM3A 3TACA 1P2AA 4BBEA 2QOBA 3SDJA 2Q0BA 2JAVA 3UTOA 5HORA 3KF7A 4X6QC 4ASZA 5IMEA 3LHJA 4HVIA 3QLFA 4YLJA 3K54A 2IVUA 4FOCA 1G8AA 2PULA 5IH4A 2VWXA 4YBKA 4BWXA 2R3GA 5CAOA 2YA9A 4B0GA 5CANA 2QU6A 2PUPA 2ITPA 1XWSA 2YIXA 1W82A 3AT2A 2O3PA 1S9JA 4EK3A 2DUVA 4BZNA 2OJJA 1K9AA 3PTGA 4O0TA 3LW0A 4L44A 3EFJA 4I0TA 1A48A 3NWWA 1ST0A 3Q04A 3IW7A 3W0PA 1PF8A 3D5VA 5DEWA 3WE8A 4FZAB 2WGJA 3VONA 4G3EA 4BDIA 3JVRA 4AXFA 2YDIA 4C4IA 2VTLA 2XJ2A 2IVSA 3R28A 5HX8A 1FVVA 3RGFA 3MJ1A 3LXPA 3QHRA 4LM5A 4FZFB 4IVBA 1XH4A 4RQKA 4EL9A 1R0EA 5E9EA 4FTAA 1ATPE 4XG6A 1LEZA 5FBOA 1UNGA 1BL6A 5H2UA 4EOMA 3ANRA 1KOBA 4Y46A 3BPRA 5B2LA 3O0GA 5AP7A 2W05A 3JPVA 2UZBA 3PZHA 5H8EA 4H39A 3R73A 2GCDA 2WD1A 4PQNA 1V0BA 1W83A 1VYZA 5M4UA 3TDVA 3QQGA 5FUTA 3SVVA 4E5AX 1LPUA 4YURA 2NPQA 3SOCA 4XJ0A 4RC4A 2ZMCA 4F9BA 3LFDA 1H4LA 5J5TA 2J6MA 4XP0A 3IW5A 1IA9A 3BU6A 4QYHA 3BBTB 2EXEA 5K0XA 1JSVA 3V8TA 3VULA 4ENYA 3NNWA 4U8ZA 3ZONA 4JLCA 2B0QA 3MTLA 2BAJA 2PVKA 5CASA 3TMOA 4DCEA 3R7EA 2YCQA 3BU3A 3RP9A 4FRFA 4G34A 4IAAA 4YJTA 3NUAA 3K2LA 2J0MB 3ACKA 5M09A 1WCCA 4KIKA 4S31A 1PXMA 4IBMA 2QOQA 4ENXA 4F1OA 3DXQA 2J90A 1LUFA 2YWVA 3ULIA 4NZWB 2WEVA 2QOIA 1UKIA 3GC0A 1OECA 3RBWA 2IZTA 3O17A 2C6TA 3QTIA 4L9IA 4CT1A 4D28A 2ZB0A 4CVAA 2XJ1A 1PMUA 3HMNA 4EI4A 4JX3A 5EH0A 4FT7A 4IX5A 3ZFMA 5CEPA 4TYHB 2P4IA 2QODA 2QLQA 3DB6A 4QD6A 3UP7A 2OXYA 5M51A 3ZUUA 4RIYB 3UVRA 4D0XA 4ZLYA 1REJA 3QRJA 3NMUF 2YITA 3UIUA 3V3VA 1DAYA 3OMVA 4PX6A 3GCQA 4EH3A 2DYLA 2JIIA 4G5JA 4M8TA 5IUIA 5D7VA 4CXAA 2IVVA 5LMAA 5CF6A 5G6VA 5BVDA 3E87A 4MD8E 4RWKA 4BJJA 1W2FA 4M3QA 2VTNA 2W7XA 5AR2A 1XH8A 2C6EA 3MIYA 3Q52A 4YTIA 2W17A 4BGGA 3QCQA 4FKPA 4RT7A 4GYGA 1FINA 2R0UA 1H00A 2X0PA 3DBDA 3FXWA 3SC1A 3W8QA 4YJQA 4C3FA 4FNWA 4I6QA 3HRBA 2WQEA 3MSSA 4OBQA 3CTQA 5BMMA 4IHPA 3UODA 1KE5A 4BHNA 1H25A 4D1ZA 4D2TA 1TFFA 1JNKA 4QDVA 2XNEA 3TTIA 3WYYA 1XMMA 3OWJA 3H3CA 4AZSA 3WILA 2C0OA 3SOAA 4F08A 4I1ZA 5EDRA 4UN0C 1GZNA 5FTOA 4EQCA 4LOOA 3P5JC 2VTMA 4YJPA 4UMRA 4AP7A 4IWOA 4YTCA 3QD0A 3PJ8A 2FSTX 5EG3A 5FRIA 4J99A 3VUGA 5A4TA 2OF4A 4AQKA 3LFAA 3IG7A 4FV6A 4D2PA 2YM5A 2YDJA 3DB8A 3N51A 2J5EA 3V5WA 2HOGA 3TI1A 3RPVA 2XEYA 4Z55A 3DZQA 4ZTNA 4EH9A 3ZEPA 3OCBA 2VWZA 2BIKB 1PXPA 3AC1A 3P7AA 4O4BB 4JDIA 4RIWA 1WMKA 5EDPA 3OP5A 4ANBA 4IX3A 3Q4CA 4JMQA 4CFFA 5DVRA 2WOTA 1CDKA 2XCKA 2JKOA 4A9RA 4AOTA 5LXMA 5FM3A 4EK8A 4GFMA 4ZZMA 4FTMA 3HAMA 4HCUA 5KE0A 4C58A 1KE9A 4L46A 4ZEGA 2WMWA 3JVSA 2EU9A 3QRIA 2OIBA 4I6HA 2OFVA 4P4CA 4RLKA 3RCDA 2VTSA 4GW8A 3OHTA 3ORKA 4O7LA 4X6RA 3I81A 4FC0A 4BN1A 2BDWA 3G33A 2J4ZA 2GNHA 1OB3A 5HD4A 1CKJA 4WIHA 1Q4LA 1GZKA 5EM6A 1YKRA 2YAKA 2QHMA 3KL8A 4BWPA 4MK0A 3FLZA 4E1ZA 4YLLA 1W0XC 5HO7A 1G8KA 2IW8A 3D2KA 4D2WA 2VGPA 4UEUA 1BUHA 4F64A 5GINE 4YJRA 3WOWA 2O0UA 3F3UA 3KXGA 1ZOHA 2O2UA 2KTYA 3EFWA 5M53A 3QD4A 4RFYA 4QP6A 4U40A 5AR5A 4BWKA 4MBJA 4CKIA 5FLFA 4E7WA 3FQEA 4ALUA 1UWJA 4AAYA 2JLDA 2XYNA 4PL4A 3L8SA 3OWLA 5CSPA 4LFIA 3AC3A 5I3RA 1U5RA 5JQ8A 4ITJA 4E73A 4IH8A 3ROCA 4FIGA 4FUXA 3ORZA 3FLYA 5IQDA 4M69B 2XNPA 3LFQA 4C4EA 1F5QA 4O91A 4O7NA 5AJQA 5EYCA 4UYNA 4CSVA 4RMZA 4AZFA 2WQOA 4OTWA 3II5A 4R7HA 2Z7LA 4G3CA 2OW3A 2PZRA 4EOJA 2VWYA 4FSRA 4QP3A 2XNGA 5BYZA 2PVMA 3AG9A 3GP0A 3QXPA 3BIZA 5DGZA 2R7IA 4QP7A 4XNEA 4IB1A 3CEKA 3ANQA 2BILB 3TZMA 3FMJA 4FTNA 4O0SA 1U54B 1KE7A 4RZVA 2A27A 2HENA 2VO7A 1ZZ2A 4BZOA 1UV5A 2PUIA 4R77A 2YCSA 3QQHA 4H3BA 3BLQA 4ITHA 2BTRA 1TQMA 4JG7A 2ITVA 3EN7A 3W1FA 4WBBB 3GVUA 4BI1A 3TYKA 4LV7A 1O6YA 3UOLA 5CAQA 4OTPA 4WG5A 5JKGA 4A9YA 3D0EA 5EW3A 1PW2A 3CY2A 3EYGA 5AP6A 5KMJA 3RINA 4WNPA 3VUMA 5KX8A 4AACA 4MUQA 2YFXA 1OIRA 5AV1A 4KB8A 3ET7A 2UW3A 4LQMA 4XOYA 2ZV9A 2I0HA 5A46A 3C1XA 4HJOA 4PV0A 3ROYA 3FLQA 2JBPA 4YZBA 3OEFX 4EK5A 3LMIA 4XYFA 2ITZA 3H9RA 3UO5A 3MVJA 1U5QA 1J3HA 2WQBA 3F7WA 3R30A 4H1JA 4DFXE 3RPOA 4RG0A 2IW6A 4E20A 2UW6A 4RA5A 2H9VA 4DHIB 3GUBA 3MA6A 3QRTA 3EZVA 4EHGA 5FTGA 3PRIA 5IQGA 4L53A 4JRNA 4XP2A 1ND4A 3ZM4A 2BZJA 5DT0A 2F57A 2GS7A 2FSOX 2GDOA 2X2KA 4C57A 2YHVA 3VF9A 4F09A 4W8DA 2XIYA 2I40A 3TEIA 4DG3E 4EK6A 3DT1A 2CGVA 5KNJA 5C9CA 3TKUA 4GCJA 2BTSA 5J9YA 2Z7RA 2Y8OA 2UZWE 4F99A 4HYHA 4IXPA 4NW5A 3NIZA 5HG5A 5K3YA 4UMPA 4YHFA 3L9MA 1TKIA 4FKSA 4JS8A 2ZM4A 3NYXA 3PSCA 3DFCB 3EIDA 4I5HA 4L6QA 5HIEA 4D2SA 1GIJA 2WKMA 3EQFA 3QRUA 2QOOA 4IMYA 4DFLA 3FSFA 1ZXEA 5KZIA 5J79A 1KOAA 2R3RA 4I94A 1I09A 4FGRA 4FKUA 3FXZA 4V0GA 3BV3A 2OH4A 3FYJX 4N6YA 4ZSAA 4DGMA 3GOKA 3GFEA 2BVAA 4ANNA 5M44A 4CRSA 1IA8A 3GCVA 3NW6A 4OTFA 5D1JA 3FQSA 1ERKA 3HP5A 4QO9A 5I0BA 3SA0A 2Y4PA 3O8TA 2OBJA 2JIUA 2ITXA 5JZJA 2BKZA 3KA0A 3GB2A 5EOLA 3VS2A 4JAIA 4L52A 4OTQA 4BYIA 1FGKA 3HDMA 2QOFA 3CR0A 5EI8A 5A4CA 5AV3A 3PP1A 4BIDA 5TF9A 3NVMB 4O2PA 5CQWA 2C6LA 3G0EA 4FT3A 5FP6A 4F9YA 3BE9A 3R2BA 5ACBC 2QG5A 4Z16A 4JJRA 3BQCA 4M12A 5AIRA 5AUYA 1P4OA 4F6WA 3OW3A 3VRYA 3L1SA 2ZAZA 3FMLA 3QTSA 1HOWA 2YAAA 4FKQA 2BZKB 4CTCA 4J8NA 3FDNA 3GC7A 4S2ZA 5B7VA 2XNBA 3CP9A 3FZ1A 1JVPP 3DNDA 3MH2A 3PWYA 1H8FA 5IH5A 2JEDA 3PVGA 5AP2A 4GL9A 5B2KA 5JFSA 5D12A 4J98A 2UW5A 3S2PA 3BLRA 3ZBFA 4FV4A 4E4NA 4DEDA 4XUFA 4FMQA 3PPKA 3C0IA 4MWHA 2BUJA 2GHLA 1OL5A 1J1CA 4G17A 3TIYA 3TZ9A 3WI6A 1XMLA 3H0YA 3BWJA 2GFSA 3TV4A 2GPHA 3KB7A 4AAAA 4C59A 4O83A 3G5DA 4RIOA 4HVGA 1M7NA 4F9CA 4JDJA 4O4EA 4FVPA 1JWHA 3ZDUA 3QBNA 4JT3A 1OZ1A 2XKDA 3GFWA 5CEOA 2REIA 2QOHA 1YHVA 3UBDA 1NXKA 4NH1A 1OIQA 5LQFA 3O7LB 1E1XA 5ETCA 4GV1A 4A07A 2Z8CA 3A7JA 4YJNA 4B7TA 1CKIA 4EOQA 3JS2A 4QP9A 3R7YA 1XJDA 4I0RA 2R3KA 4WA9A 2XNMA 2PHKA 4FIEA 3PDTA 3TUBA 4Y8DA 3PXFA 1VYWA 5AV4A 1L3RE 1Q8UA 2E9NA 3PE1A 4KIQA 3BHTA 2X1NA 3UVPA 3VBYA 3DLSA 3MFTA 2PUNA 1UA2A 5C4LA 3Q9YA 3R00A 3PXRA 2JITA 4E4LA 1PMEA 1H01A 3WZEA 4B9DA 1J7UA 2X8DA 5IZFA 1IRKA 2V0DA 3GT8A 4RRVA 3VS1A 3VBTA 2CGUA 5IA1A 3F3ZA 5C4KA 5GIOE 3UQGA 2W1ZA 3KXNA 4UMQA 4JBQA 4BCMA 2HIWA 3D5XA 3KVWA 3QFVA 4R8QA 4YPSA 3VQUA 4CMTA 4ZTMA 5AFVA 5JZNA 4C4FA 4TKSA 2GNJA 3BGPA 4F6UA 2CNQA 4C35A 1NVSA 1BL7A 2IZSA 5CLPA 3VWAA 4CV9A 3FI4A 4D4RA 4RBLA 2RIOA 4XHKB 1BMKA 4K11A 5M08A 1YOLA 1GOLA 1V0PA 3AGLA 3ENHA 4DHZA 4I23A 5LVLA 5AV0A 3O50A 3ZM9A 5GZ9A 4FYNA 3RAWA 3RHKA 4KRCA 2VTRA 3A8XA 5CQUA 3HX4A 5AP3A 4NIFA 4ZS0A 4FNYA 1MQBA 4KKHA 5FEDA 1ZYJA 4FSUA 4DH7A 3KRWA 1OPKA 4BCFA 3VC4A 1OKYA 5FXQA 2WMSA 2WMUA 2GS6A 5JGDA 4TWNA 4G9RA 5AR7A 1Q5KA 3HECA 1URWA 4ZMFA 4O2ZA 5CS6A 3O7LD 4G16A 3EKNA 2C68A 5KMMA 4BY9E 2W0JA 3VBQA 5L4QA 4ZAUA 4X2KA 5FDXA 3Q9ZA 2VTQA 2Z7SA 5L8KA 4JVGA 3LFCA 4I20A 4TRLA 4FI1A 4I24A 4YO6A 4FT9A 2C5YA 4BDCA 5LMKC 3DNEA 3A61A 3QD3A 4J7BA 4CNHA 2P33A 3ID6C 2AUHA 3C51A 3FMDA 1MUOA 4KKGA 3V04A 4CKJA 3ZXTA 4MVFA 3E93A 5E8UA 2JGZA 1SVEA 4FJVA 4M7IA 2Z02A 3DAEA 4XG9A 3TNPC 3RPYA 3Q4TA 5AR8A 3NCGA 1PYEA 3DS6A 3MB6A 5FXRA 2ZV2A 2YACA 1NW1A 4DA5A 3ZLWA 2ITQA 2HYYA 2YJRA 1O6LA 3FHRA 3RPRA 3UPXA 4AGWA 3R1QA 3LCOA 2OJFE 1ZARA 1MRVA 4ASDA 5FD2A 2CNVA 3L9LA 2QKRA 5C8MA 2QOLA 1H27A 2W5AA 2WMTA 4IVDA 4EZ3A 1KWPA 4RGJA 1WBTA 4NM3A 2ETRA 5KMNA 3R63A 4W8EA 2LAVA 4O82A 3GU7A 4PF4A 4PL3A 3W0NA 4UWCA 2IZRA 4UWYA 3PVUA 3BYUA 4CYJA 4I6LA 2CGXA 4QPSA 3TJCA 2BMCA 3EQBA 4XBRA 1ZMWA 4EH6A 5EKNA 3ZEWA 2VD5A 3G90X 5CSXA 2OXXA 2X6EA 4GVAA 1OGUA 2C3IB 4RFMA 1J1BA 4BTMA 2WTIA 3EN9A 4ASXA 5JFVA 1H28A 4O4CA 4E6DA 4IADA 3R9RA 3O8PA 2DS1A 2YERA 1YDSE 3VW6A 4LL5A 4C2WA 3PG3A 4UV0A 4JDHA 4O0RA 3NNVA 4QMXA 4U7ZA 4CFMA 1WAKA 1NY3A 3Q6UA 3RNYA 2HW7A 2X2LA 4FZ7A 4PNKA 4O7WA 1YW2A 5AUXA 2W96B 4M15A 3NYNA 5CEKA 3QGYA 3E8EA 3TN8A 5CF8A 3LXLA 3PPJA 4FV8A 4IJ9A 5GHVA 3BL7A 3BU5A 3BEAA 4XX9A 3H9FA 4IX6A 3OW4A 4U79A 5D41A 2PZPA 2XF0A 3FSKA 3T9TA 1CSNA 4U81A 3LM5A 5IH6A 3QZGA 4F9AA 2VTAA 3EN4A 4OT5A 5TKDA 3DDQA 5E91A 5E8ZA 4Y83A 4X3FA 3VS0A 3UMWA 4BDFA 5K5XA 2BALA 3HGKA 4W4VA 2ZYBA 1B6CB 1R0PA 4PRJA 2V7OA 4XV9A 5IA5A 4BI0A 4EJ7A 5A3XA 4BC6A 3PFQA 4FTRA 3V6RA 2C0IA 3SRVB 1GNGA 2R2PA 2PUUA 5T6KA 4GKHA 3IS5A 5ACKA 3OVVA 5CI6A 5K4JA 3ZO3A 3O23A 3SX9A 4IIRA 1UNHA 2XVDA 3FC2A 3FKLA 4PL5A 1OL1A 3MH3A 5HX6A 3CGOA 1XH6A 4MXXA 4EH5A 3QZFA 4JQ7A 3P08A 5AP0A 2Y7JA 3G51A 5DR2A 3MDYA 3OCGA 4IC7A 5AEPA 3O51A 3W18A 2R64A 4FTOA 3HMOA 3VS6A 4Q9ZA 1IAJA 5HU9A 3W0RA 3ODYX 3R71A 1H07A 4PNIA 1Y8GA 3UIMA 5CXZA 2AC3A 4GK2A 3OTUA 4S34A 4BCIA 4E4XA 2F7ZE 2BFYA 3CIKA 4RVTA 3RI1A 4ANMA 4Y5HA 5EYMA 4LI5A 3NIEA 4DN5A 1JKSA 4G5PA 4RC3A 2OZAB 1WVYA 3ZRLA 4AE6A 3U54A 4NW6A 3DK6A 3U4WA 4UALA 3V5QA 3UDBA 2XKFA 2V5QA 4ZY4A 4O7RA 4GVJA 4ZLZA 4MXYA 1UU3A 3R9DA 1FOTA 1IR3A 3G9LX 4UY9A 3VS7A 4DTBA 4V05A 2WU6A 1RQQA 3PP0A 4ZTHA 2W9FB 4FUYA 3SLSA 5E7RA 3W0QA 3F5XA 4I6BA 1Y6BA 3LMHA 3R8VA 2C3JA 3C0HA 3NZ0A 4C4HA 1TVOA 4F70A 3LFEA 3MFUA 3OROA 2I7QA 4ZTQA 2UZUE 4M0ZA 4TY1A 2X9FA 2YM7A 3PIZA 3WZUA 3QC9A 5KHXA 4XOZA 4AWIA 3NVKI 3LKMA 4OBOA 2FSMX 2VZ6A 3PZEA 4FL1A 4IACA 1GZOA 4P5QA 1W2CA 3KGAA 5IU2A 4RIWB 3R0TA 4JR3A 4EORA 4DCAA 4EHVA 5EI6A 4GSBA 1KV1A 5FWKK 4DG0E 4HYUA 3I7CA 3TUCA 4GU6A 4R1YA 4DTAA 3MYGA 4Y5QA 1FMKA 2Z2WA 5GZ8A 2VNYA 3BV2A 1OGYA 4I92A 2CKEA 4O1PA 2CNUA 2C6MA 5BX0A 2EXCX 3PSBA 4F7JA 4RQVA 1S9IA 2XA4A 1JBPE 4AT5A 5HD7A 4C8BA 2W1GA 4YZCA 3REPA 3IDCA 2UZTA 4K33A 1W7HA 3WBLA 4L43A 3TZ7A 5HU3A 1YWRA 4BKZA 4ZY5A 3BLHA 3S3IA 3KU2A 4GT4A 3SW7A 3EN6A 4WNOA 3QZHA 2FH9A 2O8YA 1IASA 2J0KA 3NNUA 4QP8A 4EOLA 3OOMA 3JUHA 4K9YA 5HCXA 4FEWA 4E4MA 2UZLA 3DZOA 3TV6A 4YR8A 2PE1A 4HGEA 3HNGA 1YDTE 3UE4A 3VUIA 2HZ4A 4C7TA 2B9IA 5EKOA 2QU5A 2I0EA 4YJVA 4O81A 4CFVA 3F9NA 5CX9A 4O7TA 3AOXA 4IM3A 5BMSA 3ZH8A 3QUEA 4XRJA 1WBOA 1Q61A 3R9OA 4NFNA 3MB7A 4J71A 4NFMA 5AP1A 2ITTA 5AM6A 3R7IA 3CTJA 2FYSA 2HXLA 1VZOA 5H8BA 3DQXA 4PY1A 2QKWB 2B9FA 2Z7QA 4FTIA 3A2CA 2HWOA 4UXQA 4AOIA 5ICPA 4TNBA 1YWVA 2ITOA 2RFEA 2PZIA 4AGCA 4K0YA 2WO6A 5BQ0A 1Q99A 3W16A 4PMSA 2J5FA 2W9ZB 3KVXA 2BRHA 3R6XA 5JRSA 4BR3A 4DFYA 1PJKA 3E3BX 4U6RA 1ZYCA 2HAKA 4UXLA 4FK6A 1P5EA 2O63A 1WBSA 2XBJA 4U3ZA 3SXFA 4LL0A 3S0OA 2VN9A 3EFKA 4O0YA 4U97A 3ALOA 3LPBA 5H8GA 3TWJA 2WAJA 2ZVAA 3HA8A 4C4JA 5KMKA 4N57A 4MXAA 3HRCA 5HCZA 3GENA 2VTTA 3A7FA 2W4JA 2WTVA 3ZSIA 1F3MC 3FHIA 3DDPA 5DI1A 5CT0A 2F7XE 2LGCA 2PMOX 4IM2A 3VS5A 5HHWA 3GQLA 5HNIX 3CXWA 5EHOA 4AX8A 4IWPA 3F2AA 4DYMA 1Q62A 5GJFA 5GNKA 5EYKA 4ERKA 2W1FA 2CN5A 3HMPA 4RLLA 2PMLX 3R7VA 3MVLA 3KQ7A 5EI2A 3GNIB 5HG7A 3I7BA 4X2JA 4QMMA 4ZSEA 3E62A 2HZ0A 2IJMA 3F82A 5M4FA 3KULB 2C0TA 3FY0A 2GNLA 3I1AA 4CLIA 5F9EA 4QMWA 1XR1A 3HV5A 2VO6A 1B39A 3GCSA 3TCPA 1TZDA 3PXZA 2G01A 4YJSA 1F0QA 3POOA 5C01A 4C4GA 3BWFA 3DK7A 4JOAA 4PTGA 2YZAA 4EBWA 3FQHA 3UOHA 1V1KA 3RK7A 3RWPA 4F9WA 5IEYA 1GJOA 3U6IA 4FEXA 2VWWA 3RALA 2CKPA 3B8QA 4W9WA 3C4XA 4Z7HA 5C8KA 2Y0AA 5E1SA 3GU5A 2R3QA 4RJ6A 3SHEA 3G6HA 3MVHA 3JYAA 2WMRA 3H10A 5BUJA 3BYMA 3OXIA 4HGSA 3P79A 4FKTA 4ARKA 3QTWA 3AMAA 4OT6A 3Q2MA 2IZUA 1QPJA 5FXSA 2XNOA 2C3KA 4AXAA 5I9YA 3W55A 2E9PA 3VS3A 5DBXA 4O6LA 2CJMA 4EC9A 2V22A 4RIXB 3DA6A 5KMOA 4C33A 5AA8A 3EH9A 3VHEA 2C5OA 3HP2A 4TYEA 4AT3A 3CKWA 4BCHA 5F1ZA 3C4ZA 4GJ3A 4ACGA 1A9UA 5AUZA 3WYXA 3R2YA 1APME 3Q6WA 3QALE 1XH5A 4K8AA 3KFAA 4HOKA 4G1WA 4BCOA 4KINA 2I0VA 4AGDA 1JLUE 4E6QA 1QCFA 2GHGA 4LMNA 4XCUA 2DWBA 4A9UA 1PXLA 3E92A 3ZHPC 4QMTA 1ZLTA 5EW9A 5J8IA 2EB2A 3ZLYA 3LXKA 3R8UA 4LV5A 4I3ZA 4TWOA 4Y73A 2W1CA 5K0KA 3NDMA 3R1SA 5AR3A 2BHHA 4YHTA 4WSQA 1BX6A 3P0MA 3I6WA 5HVJA 1OVEA 1ZY4A 4D4YA 4A4LA 4D4VA 1YHSA 3O96A 2JC6A 2QHNA 3W0MA 2PMNX 3CTHA 4QMVA 3ZOSA 3GC9A 4QEBA 2CN8A 3M2WA 5BUEA 3ATSA 3EJ1A 4G3FA 3ZZEA 2GSFA 4F1MA 4W9XA 4MNEA 5DLSA 3R22A 4K1BA 4DGLC 4JDKA 5BPYA 5GZAA 2F49A 3D2IA 3F3WA 3WIKA 5L6OA 2X0OA 2OI4X 3AT3A 2IN6A 4ANOA 2YIWA 4U41A 3OOGA 4BFMA 1PKGA 3PLAE 2RGPA 2WQNA 3CY3A 4TXCA 3SD0A 3IGOA 1OIYA 4AQCA 3QX2A 4QQ5A 2CGWA 3RTPA 4Z9LA 1U4DA 5JGBA 2GHMA 3QQFA 4USDA 5HBJA 3IO7A 4A7CA 4ZLOA 4DH8A 4FSMA 4L7SA 4CZYB 4NCTA 2H34A 2XK6A 3LCKA 3ORXA 2JKQA 4FTJA 2RFNA 2QO2A 5CVHA 2EXMA 3TIZA 4CFUA 5F94A 2AEGA 4YGAA 5J87A 4QNAA 4S32A 3HV4A 1KV2A 4WBOA 3ORIA 4P5ZA 5IPJA 2R3MA 1Q3DA 1R39A 1CTPE 2RL5A 3IGGA 2W5BA 5J7HA 2QI8A 4KS7A 4R5YA 3S95A 3VBVA 4KA3A 3O2MA