4RIOA

Crystal structure of jak3 kinase domain in complex with a pyrrolopyridazine carboxamide inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
285
Chain Sequence
TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGSERDVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK3
publication title Discovery of pyrrolo[1,2-b]pyridazine-3-carboxamides as Janus kinase (JAK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 90
structure length 285
sequence length 285
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rioA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rioA01
2YDKA 4IW0A 3Q32A 4H3PA 4Q9ZA 1M14A 5AR5A 3QX4A 2OZOA 2PMOX 3DU8A 3OFMA 1H0WA 4G5PA 5KMIA 3VHEA 4K0YA 3V5LA 3C0IA 4D58A 3A62A 4ERKA 1J1CA 4X2GA 3AC8A 1LEWA 2WTJA 3PVWA 4PY1A 4F0FA 3AMYA 2C6MA 3LXKA 1Y8GA 2XNEA 1JQHA 3RGFA 4A9RA 1PW2A 3RPSA 4AP7A 4E4LA 4Y85A 2OJIA 5AUVA 3CQUA 4YMJA 4LUDA 4IWOA 4L42A 4P4CA 3R7UA 3SKCA 1ZOEA 1QPDA 3MY5A 3VQUA 5GJGA 3BU5A 3ZFMA 4XOZA 3ZBFA 3FYJX 4YTCA 5EHOA 3BU6A 4ZTMA 5H8GA 2JBOA 4MQ2A 5BMSA 2CPKE 3BV2A 4AX8A 4XV2A 4NM5A 2NO3A 2X2KA 4QTBA 5EKNA 3MB6A 1AD5A 2P4IA 2XYNA 4WNKA 1U5RA 1NXKA 4HNIA 3RPYA 3F3UA 3I60A 2PMNX 3LQ5A 2JFMA 4HYHA 3R8LA 4YC8A 3E8EA 4KBCA 4YC6A 5DT4A 2OJGA 3QD0A 3C5IA 1PY5A 2HELA 3FLZA 2O5KA 2CNUA 3B2WA 3H30A 1H1RA 3PJ8A 4GJ2A 1UNGA 5ETFA 4FEXA 3F5UA 5D7AA 1Q97A 2W96B 4C4GA 3QRKA 4HYUA 2OZAA 3ACKA 3VS6A 4WNMA 3ZEPA 4RQVA 4WBOA 3IDPA 5GZ9A 1OL5A 4TZRA 4QMWA 2HK5A 5HCXA 3C50A 3TV4A 4ARKA 5CALA 3IDBA 4TXCA 1PXMA 4ITJA 3ATSA 3DQXA 1MP8A 3O2MA 2RKUA 1DAYA 2QG7A 4E3CA 3M2WA 4H05A 2GTMA 3ALOA 3DDPA 4DEBA 2Z7RA 4C3RA 4ANSA 5A46A 4I92A 1OKVA 2C0IA 3CQWA 3PXFA 5IH6A 3SHEA 2F7XE 4KIPA 4CFFA 4F7LA 4YJQA 5ITAA 4IAAA 4NTTA 5IPJA 2R3QA 5AV0A 4S33A 1M7QA 2UV2A 1WFCA 2PUNA 1CSNA 3EH9A 1UWHA 4I6BA 2H6DA 3MFRA 3VRZA 4KRCA 4RMZA 5B2LA 3OW4A 3SV0A 4DF3A 4IB3A 5J95A 2P3GX 4QPAA 3R04A 4PTCA 4FZAB 5CSPA 1SYKA 5IEYA 1HOWA 1PJKA 3DFCB 5IH5A 4GEOA 1SVEA 3I5ZA 5DT3A 3OTUA 3JYAA 4MNEB 3AD4A 4EH6A 1J3HA 4EL9A 5BVEA 1R1WA 1WMKA 4I1ZA 2WMWA 3P5KA 3R9RA 1DS5A 2HIWA 3LOKA 4HGEA 4M15A 5A9UA 4HGSA 5HLNA 1KE8A 4UMTA 5AUUA 3R9DA 4JDKA 4JQ7A 3IW8A 4LUEA 4QMTA 5DBXA 5CU4A 4A9UA 4ALVA 3DZQA 2PE1A 2XKCA 1K9AA 2GNGA 4J95A 4DFXE 4J96A 3R7GA 2VWWA 2ITZA 4ASDA 3FJQE 4YUQA 3TNIA 4DG2E 4FSTA 4GUBA 3HECA 4HGLA 3T3VA 2F7EE 3ZLSA 4BL1A 5JMSA 3IOKA 4DT9A 2PZIA 4MYGA 4P5QA 4FK3A 3SAYA 3Q2JA 2C6KA 4KINA 4YHFA 4RA4A 1IAHA 4ACGA 5CZIA 3QBNA 5K0XA 3W2CA 2Q0BA 4YHTA 3MESA 2C3IB 3I0OA 1BMKA 4MXXA 4TWPA 1W84A 3U6JA 3PXQA 2QOLA 3DNEA 3IDCA 1AGWA 2G15A 4F4PA 4EOOA 4ZLYA 1HCKA 3L8XA 2E9UA 3R71A 3KULA 3WZJA 5J9ZA 5AA8A 4IQ6A 4DTKA 3FQHA 3KXXA 3G2FA 4EJ7A 4GMYA 5I3OA 1WCCA 3NIZA 1XH7A 2VWVA 3KXZA 5K3YA 3I81A 4EWHA 1Q99A 4XV1A 4F0IA 5KMNA 3SOCA 5M53A 4NTSA 2HENA 2EUFB 2VUWA 3F69A 4F99A 2R2PA 2VWBA 4GIHA 5GZAA 2ITTA 3RPRA 3FI4A 3R7EA 4FVQA 3KKVA 3BGPA 3NWWA 3WZUA 4QO9A 5CQUA 4EH3A 2WQEA 1OBGA 1RDQE 1QPEA 3MPMA 5D11A 3PY3A 4BI0A 5C8NA 3D15A 4XRJA 4BDHA 4CFVA 5AV3A 2WB8A 4PQNA 3LQ8A 3BGZA 4X2FA 2P55A 2QO9A 2WTIA 3NCZA 5LVNA 3IK3A 4FKTA 4EZ5A 4DTBA 3QTQA 4MXCA 3ORNA 3TN8A 2C0TA 4QYEA 4S32A 4JOAA 4TNBA 3HMPA 3ZEWA 5CEQA 4AXAA 2RIOA 2BZHB 2WMXA 1M2PA 4RWKA 4F9WA 3B8RA 3Q60A 4AOJA 1WBVA 1JNKA 5CAUA 4KA3A 4C33A 5IKWA 3G15A 2WO6A 4BCFA 4MWHA 4F7SA 5F95A 1CKPA 4FMQA 4Y5HA 3RNYA 4ASXA 4O0WA 2HZ4A 2ZV9A 3M1SA 4FNXA 5FLFA 4D2WA 5L6PA 2VTJA 5LJJA 3TDVA 3HP2A 3QYWA 1H0VA 2W1CA 3KEXA 4JXFA 4F9BA 4RX8A 2VWIA 4XOYA 3P9JA 4EH5A 5AV1A 3EQIA 4FT7A 3S00A 5E9EA 2JKQA 3VVHA 4P7EA 3R2YA 1E1VA 4L3JA 4EYJA 3PA3A 4QMYA 1YWVA 4BGQA 4A4LA 3Q9XA 4L8MA 4FTLA 1OBDA 2BZKB 1GIIA 3T3UA 4WG4A 5HTCA 2CN5A 3A61A 5HTIA 3CLYA 3GCSA 4M67A 2UZBA 4G3EA 4XUFA 2GHGA 3SLSA 3N51A 4DEIA 4BZNA 4ZP5A 2V5QA 4EHGA 5LVMA 2P0CA 3R02A 5FQDC 3UOKA 4ZS0A 4GKHA 4KIQA 4XEYA 5IEXA 3OWPA 3CTJA 4V04A 4O0SA 2BALA 3VW8A 4ZS4A 5IG1A 3PE1A 3PRIA 4GT5A 4RC3A 4DCEA 3F61A 5BVWA 4JAJA 4IMYA 3K2LA 3VAPA 2BHHA 5FBNC 5F9EA 2YWPA 1KE7A 2PVJA 3BYSA 2WMRA 1LUFA 1SVHA 4EKKA 5K9IA 2H8HA 5HX6A 5I9ZA 1ATPE 2Y7JA 5C03A 2GNJA 3R7YA 3MSSA 3AC1A 5HKMA 4APPA 5ACBC 4OTPA 2XJ2A 4CNHA 1ZY4A 2QQ7A 5CU2A 3R0TA 4JR3A 1U54A 4LL0A 3SDJA 3PPJA 1H00A 2JD5A 4YURA 5AADA 5I9YA 3COIA 3GC0A 3Q9WA 3U8WA 1OKYA 1HCLA 3D0EA 4BBFA 4WA9A 4BDCA 5KHXA 1SVGA 3DY7A 3MI9A 4FK6A 4FKRA 2P2IA 3PXZA 1I09A 5C9CA 4BDFA 4DBNA 2E9NA 2OICA 4FEUA 3PFQA 2C3KA 3DT1A 5FM3A 2HXQA 3VBWA 4IADA 3P86A 5ANIA 5IDPA 2RSVA 2ZVAA 3O8UA 4YZ9A 3GU6A 5HG8A 4E26A 5HU3A 3OCSA 1OKZA 2JIIA 4WUNA 5HNGA 1KE9A 5AP5A 5GZ8A 4RIOA 2BRGA 3A7GA 5DVRA 3L9MA 4CSVA 5HOAA 4XH6A 5HG9A 4GFGA 5DGZA 2XS0A 4RIWA 4M3QA 4N70A 3P23A 3CC6A 4HZRA 1OM1A 3FZPA 2VTSA 4BHZA 1R0EA 5FGKA 4MNEA 3E92A 4KIKA 3UP7A 4MTAA 3UTOA 4BDBA 3EWHA 4E4XA 5L8JA 5KMLA 2LGCA 5KE0A 2O64A 2DQ7X 4IJPA 3RVGA 4KAOA 5A3XA 3JXWA 5LOHA 4JQEA 3ZRKA 4KB8A 3PTGA 4FIEA 3AD6A 2WD1A 2G9XA 2GHLA 1YXTA 3QTXA 4IXPA 4I24A 2OBJA 2UZTA 3RAWA 4FTKA 4HCVA 4WNOA 4AG8A 4IDTA 3UG2A 3PWYA 2PPQA 4EK3A 3EMGA 3Q04A 3QHWA 3RK7A 3EQFA 2QLUA 1OVEA 3ZYAA 3NAXA 5HNIX 2G01A 4C2VA 5CY3A 2OU7A 3QLGA 3ENMA 4XHKB 4EZ7A 3LFQA 2BMCA 4FKWA 5EOBA 2GNLA 1JLUE 1ZMUA 3GU4A 3DTCA 3EKNA 3FMNA 4XLIA 1GIHA 2I0HA 5CXHA 1FQ1B 3OXZA 3A8XA 3TACA 1YOLA 3JVSA 4AGWA 5KKRC 3EN9A 1FBNA 5GIOE 5CSWA 2B53A 3S2PA 5LMBA 3BRBA 3NUUA 5KZIA 3OMVA 3BWFA 5KBRA 1BLXA 5HHWA 1YW2A 2DYLA 3LIJA 4I41A 5IQDA 1GZNA 2PK9A 3KU2A 4G6NA 4EH4A 3A60A 3LLTA 5AAFA 2C1AA 4II5A 3VUTA 1ZLTA 2IO6A 4TWNA 3V8TA 4MCVA 2OO8X 1JSTA 2QONA 3QCSA 4I20A 2A2AA 5EDRA 4IZ7A 3UNKA 4RZWA 1H07A 4BY9E 3CY3A 4ZIMA 3CP9A 2P33A 5DOSA 5IH4A 3FMEA 4ZLZA 1PMUA 2E2BA 3DV3A 3ET7A 4CQEA 2B4SB 3KF4A 4XRLA 2XVDA 2QI8A 3WF8A 2ITNA 4AGCA 4X2KA 5BYLA 3ZO1A 5L4QA 4FI1A 2RFSA 2PTKA 2BR1A 3TIZA 3FSFA 5L2WA 3EFWA 3EZVA 4EOSA 2X81A 2C69A 3D7TA 4UWCA 4EJNA 1R78A 3BQRA 3DB6A 3VULA 5E8SA 5IISA 4QQJA 1ZYJA 5EH0A 4BGGA 1Q62A 2PY3A 4X0MA 3AT3A 3DBDA 4CEGA 3DOGA 4FBXA 4YZCA 4YP8A 4L53A 5AFVA 2RG6A 1BYGA 4BWPA 4XV9A 4M0YA 4PMSA 4NYEA 2UZEA 3Q4CA 4FTUA 3DA6A 4MEDA 4NJDA 5HO6A 2W0JA 3ZSGA 3VS3A 5GIPE 4QPSA 3FWQA 2JBPA 4BWKA 5CT7A 4DEDA 3WIGA 3QQFA 4YJOA 4FSUA 3W32A 3NDMA 4TYHB 3EQDA 3DKFA 4FV4A 3WF6A 2V7AA 4AT5A 3COMA 5E1EA 2CCHA 4YJTA 1OKWA 3VUHA 4ACMA 3D7ZA 5F94A 4F65A 3W33A 3ZXZA 4DFUA 2OJJA 4FX3A 4JR7A 4S2ZA 3HGKA 4WRGA 5KKRB 3TL8A 2J50A 5FDXA 4C0TA 1KV1A 1UVRA 4NT4A 3K5VA 3UJGA 2JGZA 4IE9A 5K5XA 2FSOX 3C4WA 3T9IA 4RJ4A 5D1JA 4GK3A 3KMUA 2W1ZA 4O2ZA 4XCUA 4D1ZA 3PIZA 1G8SA 4QYGA 1JVPP 3QTIA 4E6AA 3FC2A 3PVGA 5DPVA 5FP6A 5J1WA 5ACKA 1YXSA 2PE2A 2XNBA 3BX5A 4IVDA 2PZPA 4TYJA 4BKYA 2GPHA 4LRMA 3QRUA 2HY81 4OT6A 4BDJA 4GFMA 1B39A 1FGKA 5AP2A 3GC8A 4O7LA 4PL5A 5EQYA 4GV1A 5FRIA 4R8QA 2ERZE 3NNVA 4R6VA 2VRXA 3G6GA 5E8UA 4CVAA 1A48A 2J0MB 3MFSA 4MNFA 3BU3A 4FOBA 3ORPA 4YJNA 2QLQA 2VWYA 3E87A 3V5QA 2Y4PA 4L6QA 4OTQA 2YIRA 2VTAA 3H0ZA 4CYIA 3ZXTA 3IOPA 3FI2A 4F6SA 5AR8A 2JAMA 4W4XA 3QTSA 3FXWA 3WIKA 4Z55A 3OTVA 1G8AA 5J5TA 4ZZOA 2CDZA 4QD6A 3FKNA 4ZEGA 4MWIA 3IGOA 3DBEA 5T6KA 3FUPA 3M42A 4KKEA 3QQKA 5T3QA 3SXRA 4BIDA 2WELA 1MRYA 4CT1A 1H25A 2WHBA 5KCVA 4XYFA 3R8MA 4O86A 2Y8OA 2CCIA 4L3LA 5DHJA 2G2IA 2C5NA 4XNEA 3ZTXA 4DHFA 2HW7A 4UX9A 3CY2A 2XF0A 4AZFA 3BYUA 2EXMA 2ZAZA 2OXXA 4AGUA 4IDVA 3RTPA 2WPAA 5C27A 3LJ2A 3RK5A 2QR7A 4AOTA 2W5HA 4OBOA 3G90X 3OBGA 3HZTA 3F7ZA 4MAOA 2JAVA 3LMHA 4BTFA 3FDNA 1KE5A 5HD7A 3NYVA 1URCA 4U3ZA 3HX4A 3EFLA 4FSWA 1PF8A 5KMJA 3DAKA 3DKOA 3EL8A 4KIOA 3U4WA 3FZSA 3I5NA 3BE9A 4CXAA 1Z57A 4BFMA 5GHVA 4C4HA 4MX9A 4YPSA 3C0HA 4B7TA 2AYPA 3ULZA 1SNUA 3QC9A 4L45A 4ZLOA 1J7UA 2ERKA 1ZYCA 2VTLA 4W8DA 3ORMA 4EI4A 3F6XA 4GH2A 4JG6A 3P78A 4O1OA 3S3IA 4EK4A 5LMKA 5M4IA 2I6LA 4ZSAA 2FGIA 2E9OA 3FLSA 4IEBA 2UZVA 4N0SA 2ACXA 2IVTA 3P7BA 3DXNA 4B8MA 5I3RA 2YM8A 4JDHA 2JIVA 4EOJA 1Q8YA 5HO7A 3ITZA 4TN6A 5L3AA 5H8EA 4Z3VA 3QL8A 4Z9LA 4AT3A 4FUYA 3FKLA 5EQPA 2W1FA 5C8KA 4HVSA 2CN8A 1BL6A 2GNFA 2J51A 4OTHA 3SRVB 3VS4A 2PSQA 4FSRA 3WARA 5A6OA 5J7BA 1P4OA 2OIDA 4F70A 3PXKA 3FZTA 4TPTA 5L8LA 2O63A 3FZOA 2BDFA 3HMMA 4KWPA 4EHEA 4MH7A 4EC9A 1EH4A 5HVYA 2Z02A 1OIQA 2BRNA 4I0SA 2AUHA 1E1XA 2WMTA 3OW3A 3A2CA 4W8EA 1Y57A 3R9HA 4DEAA 2B9FA 2OJ9A 3SGCA 3CXWA 4E1ZA 4UMPA 2EU9A 1PHKA 4Y72A 5D12A 3FSKA 4MXZA 4EHZA 4IANA 1I44A 4C38A 1LR4A 4AGDA 2O8YA 4IM0A 3CD8A 3LFNA 2PVHA 3I79A 3LAUA 3POOA 4V0GB 5GJFA 4F1TA 5C1QB 5CEMA 2BAKA 4ZTRA 3VS7A 3F3WA 2PZRA 2ZMCA 1XH4A 3KN5A 3OD6X 4EQUA 2RFEA 3BHVA 3OOGA 3FQEA 4GL9A 4EQCA 4ZXTA 4HVDA 4JRNA 5HNBA 3RJCA 5A54A 1J1BA 4K8AA 3CJGA 3R6XA 4E6CA 2QOKA 4L44A 4CFUA 3OWJA 3D5VA 4FUXA 3OUKA 3BI6A 5LMAA 1UKHA 4EQMA 1K3AA 4G31A 3MH0A 2WTVA 4WUAA 3SA0A 3AQVA 4NH1A 4JBOA 3CTHA 1Q24A 3HV4A 4M68A 2FUMA 4HYSA 4DFLA 4YTIA 3GEQA 1H4LA 2WTCA 4ZAUA 3O71A 1NVSA 3H0YA 4RSSA 4BDKA 4IHPA 1IA8A 3QX2A 4TYHA 4I4EA 4BDEA 3MFTA 4YGAA 2UW3A 4FL1A 2J0JA 3TNPC 3O17A 2C1BA 1WBSA 1W98A 1CMKE 1VEBA 2X39A 4FGBA 4QMXA 4W4WA 4F1MA 5EFQA 3A8WA 2QHMA 4BTJA 5CF4A 3NRMA 3BHTA 3PY0A 3LW0A 2ITWA 4QMVA 2XIKA 3CTQA 3K5UA 1WBOA 3VBQA 3W2QA 3U87A 1KV2A 1Q41A 3JY9A 3LCOA 4FV7A 5DLSA 4IIRA 2BRMA 3PJ2A 5HBHA 5HG5A 1UA2A 5TKDA 1JKTA 4GSBA 3IGGA 4X6QC 5AP3A 3VS1A 3WE8A 3CKWA 4O2PA 4FICA 3OS3A 1YRPA 4RJ3A 2ZB0A 4EEVA 3MH2A 2QOCA 3R9OA 2YCRA 2R3NA 3Q6WA 2ZYBA 2O65A 3LFDA 4FIGA 5CAOA 3W2OA 1UWJA 3IQ7A 4R1YA 3E7OA 4FA2A 2HY0A 3TZ8A 4XP0A 2GQSA 2ITUA 2W1DA 3GCPA 3PLAE 1O6YA 4AFJA 5IDNA 1KE6A 3PG1A 2FYSA 3MIAA 4ZMFA 3LM0A 4YTHA 5EG3A 1NT2A 1V0OA 4IAYA 3TTJA 2X1NA 3QHRA 1YXUA 3PDTA 1G3NA 2W9FB 4ACCA 3CJFA 5CVGA 5CVFA 2B54A 3AXWA 1YHWA 3BYOA 2QO2A 4UZHA 3UPXA 3V6RA 4U44A 1OL6A 4JQ8A 4MBIA 2VX1A 3NCGA 4AAAA 4I94A 4F64A 5EQEA 3RHXA 3W2RA 5E7RA 2GS7A 3QRTA 2QOIA 3BELA 3QF9A 1QPCA 5EW8A 2UVXA 4EK8A 1BI8A 4TRLA 4GUEA 2BFXA 1YI3A 2QOHA 1QPJA 3JY0A 4AE9A 3NMUF 5DE2A 2VV9A 1U4DA 4YNOA 3KCKA 1YWRA 4C36A 3EN4A 1KSWA 1YQJA 3KREA 1MRVA 5BUJA 3PSBA 5KHWA 3BYVA 3EL7A 3KGAA 5CQWA 2X4FA 5EM5A 4OAUC 2C4GA 2UUEA 2HWOA 3F3VA 1PMVA 4KS8A 2V55A 2IN6A 3G6HA 4JBVA 4ERWA 4DEHA 4DC2A 3P1AA 5E92A 4LGGA 3ZFYA 2WQOA 2BFYA 3QA8A 4K11A 4GG5A 3EN6A 4QMZA 4CD0A 4HCUA 3UIUA 4ANLA 1NA7A 3UZPA 4M69A 3DKCA 3OHTA 4FT3A 5BQ0A 3M11A 4OW8A 1PMNA 1PKDA 3QKLA 5EW3A 2CKEA 1WBNA 5C01A 2BZJA 4FEQA 4QMOA 3HP5A 3G9LX 5FWKK 5HVJA 2X8EA 3E7VA 3AT2A 3ZC5A 3ZBXA 2BIYA 4CZUA 2YERA 4N6ZA 5EI2A 2IZSA 4U97A 2R9SA 2I0EA 5E90A 1OECA 2HCKA 3GENA 2PWLA 5E91A 3MIYA 4LI5A 2WEIA 4FTRA 2Y6MA 1ZOGA 3TDWA 2C6DA 2GU8A 4F6UA 3SRVA 4XG9A 4YZBA 3W8LA 3ERKA 4F9AA 2VNYA 4N4SA 5JGBA 3LKMA 4WT6A 3DQWA 4EUUA 5KX8A 4LRJA 4RC2A 4RWLA 1Q8UA 4FG9A 3KN6A 5FTGA 4U40A 5LARA 4BYJA 2W17A 3QD4A 2F9GA 4X3FA 4D5HA 3PIYA 3AMBA 4TWCA 3QZFA 3QUPA 2BZIB 4EH8A 3BIZA 4CZTA 2R3GA 3V6SA 3ZRMA 3FYKX 3DNDA 5HI2A 5HE1A 3NVKI 3KRXA 5CSXA 5HEZA 5DRDA 4IC8A 1JKLA 4C3PA 3W18A 1OZ1A 3KXHA 5AAEA 3MYGA 4NZWB 3HRCA 5FG8A 2FO0A 3VBTA 4F09A 2VAGA 3MA3A 3V5PA 4AA0A 1JKKA 3D94A 1JAMA 2ZV2A 3QLFA 1XWSA 3UVQA 2YIQA 3F82A 2CHLA 4HZSA 3FZ1A 3ZLWA 4WG3A 1NVQA 4HVHA 4WRSA 3OF0A 2IVVA 2WAJA 3EB0A 4JS8A 4RVTA 3PP1A 4NFMA 3KQ7A 5AIRA 4I5PA 4QMQA 3NYXA 5AR2A 2OFUA 5IMXA 4JG7A 4XG8A 1OI9A 1XH6A 2GSFA 3PJCA 3PVBA 3I4BA 3Q6UA 5A4TA 2XRWA 4ALWA 4CLIA 2XK3A 2QOBA 4BYIA 1LP4A 1J91A 2NRYA 4GS6A 5HE3A 5HX8A 5EI8A 4RVKA 4DGNA 3DCVA 4FG7A 4IB0A 5HGIA 3UIXA 4J53A 5ICPA 3DJ5A 4FYNA 3C9WA 3AGLA 4GK4A 2XKEA 3QWKA 3Q4TA 3FMKA 4FZ7A 2XEZA 4IFGA 4IZYA 4UYNA 5LWNA 3E5AA 3GCVA 4DH7A 4G5JA 3FAAA 2HW6A 4FOCA 5CLPA 1STCE 4I93A 3EQBA 5J7HA 1YDSE 2OKRA 4U7ZA 4UY9A 5CWZA 5L2SA 4X21A 3C1XA 4D4VA 3SG8A 4CCUA 4GYIA 2R5TA 4K9YA 4RX7A 2DWBA 4BICA 4CFXA 3F9NA 5ANOA 2CGWA 2UW0A 5L2TA 2X0GA 4J98A 4C62A 1VYWA 4J99A 4HYIA 3O0GA 4QPMA 2W9ZB 2VN9A 3TZ7A 4R77A 5A4CA 1YHVA 4FG8A 2PZ5A 3ZUTA 2X7OA 4BN1A 4F9YA 1XH9A 4QNYA 2A27A 2X9FA 4QP1A 4TYIA 3D5WA 4O7YA 4BR3A 4PNIA 2YZLA 1Z9XA 2W06A 1PXPA 2G2HA 4LOQA 3TWJA 4R5SA 1BL7A 5I4NA 3QYZA 3OEZA 4I6QA 3L8VA 4JX7A 2WFYA 5EDPA 1ZWSA 3AD5A 3THBA 3MY0A 2G1TA 4FV1A 2Z8CA 4V01A 4E5BA 3LJ1A 4V05A 3Q9ZA 1A06A 4NCTC 4P90A 2RFNA 5JSMA 4J52A 3P4KA 1V1KA 3ZDIA 3UQCA 2X8DA 1IEPA 4FC0A 4FTOA 4BKJA 3U9CA 4D0WA 1SMHA 1X8BA 4U3YA 4PF4A 2YHVA 4WSQA 3V8SA 2H96A 3DB8A 3SVVA 4ZSEA 3R1YA 4O6LA 5LQFA 2V22A 4OTIA 3MJ1A 3OROA 4OR5A 1U59A 2YA9A 5CI7A 3E93A 3PA4A 2YN8A 3NUAA 2ONLA 4BZDA 4CRLA 3Q5ZA 3V51A 4XG4A 1MQBA 1E9HA 3OC1A 4BI2A 4ID7A 2JDVA 4BBEA 4FIHA 4BKZA 2J6MA 4YLKA 5IF1A 3ORTA 1SM2A 5CX9A 3CBLA 2J90A 2X9EA 4ASEA 3Q96A 5D7VA 4JDIA 5AM7A 3TCPA 3O51A 3C7QA 2FVDA 5DYJA 2YLEA 5HD4A 2W1IA 4LMUA 3TUBA 5FEQA 3JR1A 4B0GA 3NZ0A 4ZJIA 5E8VA 4XBUA 4RFMA 3ZO3A 2EB3A 2YJRA 3PUPA 3GBZA 4QNAA 1GNGA 5KZ0A 4BVUA 1PYXA 1GZOA 1P5EA 2ETMA 4YJUA 5G6VA 3FXXA 3QCYA 2HZIA 4AN3A 2ZJWA 4U45A 3I1AA 3E8NA 3GOPA 3GC7A 3CGFA 4ZTSA 4BCGA 1OITA 4BWXA 3O50A 4XS2A 3W55A 4A4OA 4CFWA 5CEOA 1W83A 2CNVA 3N4TA 3ZO2A 4UALA 3GVUA 5JZJA 4UV0A 4MVFA 1TQPA 2OF4A 3QQHA 4IFCA 1Z5MA 3Q5IA 3Q52A 4W9XA 5TO8A 4L67A 4DGMA 4USFA 2C3JA 2E9PA 5ANJA 4CLJA 4NWMA 1OGUA 1PXOA 1MRUA 4CGAA 5CENA 4QTDA 3GCQA 4G3CA 4KKHA 4RVLA 3HV6A 2J0IA 2QURA 5CYIA 1APME 2VTPA 4NUSA 4E6QA 2JIUA 4EOLA 3GFEA 1XJDA 4QOXA 2IVUA 3ZOSA 2W5AA 5AP4A 4P2KA 1R39A 4JBQA 3DFAA 1KWPA 5EYKA 3WZKA 3AC5A 2BRBA 2JKOA 4NIFB 5M07A 4XP2A 2JDSA 4BDDA 4M14A 5IUIA 4N57A 3FQSA 5CAQA 4A4XA 4KABA 3EOCA 4UWBA 2R3HA 3RI1A 1TQIA 2PVKA 3FE3A 4BDIA 4JLCA 3LCKA 4C57A 4E7WA 2B1PA 4GIIA 4ZTHA 4R5YA 4PP9A 4BCPA 5CF8A 1H8FA 5FDPA 3BLRA 4NM7A 4YBKA 5EI6A 1H28A 3DXPA 3L9PA 4EZ3A 5HZNA 3WZEA 5GNKA 1H26A 1RQQA 4K33A 2Y6OA 3S0OA 2GS6A 3H10A 3K3JA 3PPZA 1VZOA 4QTAA 2YDJA 2ZM1A 3BEGA 4IH8A 2XEYA 5F1ZA 1YDTE 2C6IA 2QODA 3QFVA 4FE2A 1YXVA 2XCHA 4QQCA 4L68A 3V5JA 4ORKA 2BAQA 3PSCA 3MVJA 4DFBA 3A99A 3MWUA 2GTNA 4QP7A 5ANKA 4FTNA 4KRDA 2R3FA 2VGPA 1ZY5A 2R0IA 3HEGA 3JUHA 4JRVA 3PY1A 2W4JA 5IA5A 3VRYA 5IA4A 2RG5A 2WEVA 4CMOA 3RALA 3GC9A 1XH5A 3C0GA 4NSTA 3ZM9A 2R3MA 4DTAA 2J5FA 2QVSE 2R3PA 1UNHA 3LFSA 3ODZX 3KK9A 3LXLA 4BIEA 4F6WA 3U6HA 2OK1A 4ZTNA 1VYZA 4TY1A 3CIKA 2JLDA 4M7IA 4RJ6A 3L9NA 3BHYA 4JJRA 1H27A 3A7FA 3UO6A 4AOIA 5EOLA 5TOZA 4JG8A 4PMTA 3UDBA 2OSCA 3EIDA 4EBWA 2J9MA 2KTYA 3NUPA 4GT3A 4E20A 2WMAA 1M7NA 4FV3A 4IB5A 1JSUA 4UXQA 4RGJA 2QHNA 5JFXA 4FKUA 1BUHA 5AM6A 2QU6A 3TV6A 5AX9A 4C8BA 1DI9A 2YITA 5EDQA 2PYWA 3LQ3A 4GKIA 4ZJJA 3UVPA 1O9UA 1PMEA 3F88A 5CVHA 5CU0A 3WZDA 4GVJA 2IW8A 4AW2A 5C4KA 3R1NA 4D4SA 2YM4A 4CZYB 5FTQA 3O23A 4FZ6A 3PJ3A 4RT7A 3KXMA 3VBYA 4H3QA 3HAVA 4C4EA 5EK7A 3ZSHA 3DAEA 4O96A 3TJDA 4FT5A 4NKAA 1XO2B 2W5BA 5AP1A 4GFOA 4AW1A 2PVNA 3V01A 4DLIA 4ZTLA 3TT0A 4DA5A 3FLNC 4YJVA 4EH7A 2CLQA 2FH9A 4O7TA 1WBWA 2LAVA 5CAPA 2ZM4A 2PVYA 1UNLA 3U51A 1Y8YA 4YZNA 3OZ6A 2W1HA 5BVDA 4J8MA 1PXKA 1VR2A 3SXFA 4QP4A 3QALE 4M0ZA 4O6EA 3IG7A 3RAHA 3RCDA 4Z7GA 3G51A 1URWA 3MJ2A 1QMZA 2BTRA 3EQCA 3G33A 4FV6A 4FZDB 2UW5A 2R3IA 3D83A 4BHNA 5IQIA 4D9TA 3DBFA 4MD8E 3KB7A 3RPVA 5J79A 5L8KA 4DCAA 3TIYA 5CEIA 3DBQA 3KMWA 2CJMA 2ITVA 2VWUA 2WOTA 5CEKA 1OUYA 3UC3A 3O8PA 4KD1A 5M06A 2XZSA 4CFNA 2UW9A 4HCTA 2YCFA 1M52A 2WQBA 3CCNA 4IC7A 3QXOA 4YSMA 3LFEA 2VTNA 4JI9A 3TEIA 4G9CA 2R7BA 3VF9A 5A4EA 5M55A 1Q8TA 3QQGA 2YCQA 3L1SA 3ULIA 2HWPA 2R0UA 1G5SA 3OXTA 3W2PA 4EH2A 2Z60A 3KXGA 4I21A 4PDYA 4I22A 4FV5A 4RJ8A 5HBJA 2DS1A 3UNZA 2EXCX 4KBAA 3BBWA 1XR1A 3OWLA 2JC6A 4Y5QA 2OGVA 1YWNA 4LL5A 3DJ7A 2XJ1A 3KF7A 3HL7A 3LCDA 3ZU7A 3FLYA 5F4NA 4CQGA 1L8TA 1R3CA 4BC6A 4W4YA 3W8QA 3CGOA 1Q61A 4YZMA 2PU8A 3MPTA 2PVLA 3PPKA 4LV8A 1WVYA 3UIBA 1Q3WA 4C61A 4I5MA 3OCGA 4M12A 3BWJA 5IQAA 4EBVA 3CEKA 2QKRA 4Z7HA 1F0QA 1OL2A 3RKBA 1H08A 3F3ZA 4HW7A 5CEPA 4IX5A 5E1SA 4PNKA 4ZSGA 2Z2WA 1V0PA 3MFUA 5LVOA 4D2TA 2WU7A 2YM3A 4FNYA 1REJA 4E6DA 5CZHA 2WTKC 1RW8A 3R30A 5HIBA 3EFKA 3FBVA 2XNNA 3H3CA 3HV5A 3UODA 3R7IA 5M57A 1KOAA 2W05A 3FL5A 3LZBA 1XBBA 2RL5A 2VO3A 2X6EA 5I9UA 4DG0E 2W1GA 4QP6A 4WD5A 5CU6A 5DT0A 1H1PA 4NIFA 3RP9A 2GHMA 4ZTQA 3FMDA 5IQEA 2WQMA 4YNEA 2C47A 2GQGA 3VWAA 2CKOA 4BCMA 5L6OA 2W7XA 4IX3A 4X2JA 3AOXA 4C7TA 4BCKA 4PX6A 3EKKA 4YJPA 2IVSA 4FGRA 4L00A 5JGDA 4AWIA 3FY2A 1NVRA 1Q8ZA 3O8TA 3FV8A 4F7NA 4ZY4A 4EH9A 2WNTA 2XIXA 3A7IA 2IW6A 3GQLA 4AW0A 5BYYA 3NR9A 2EXEA 5E8TA 2CMWA 5FXRA 4ZJVA 3AC2A 4KSQA 3HUBA 4RWJA 4XBRA 4BDAA 4LRKA 4QMUA 5EYMA 1K2PA 4W4VA 4XX9A 2UZUE 3FLQA 2YM7A 4Y8DA 3GOKA 2AC5A 4BCQA 1ND4A 2BDJA 1LPUA 3KK8A 4WHZA 2CKQA 1FVVA 1WZYA 2CGUA 1YI4A 5AX3A 3U4UA 3FLWA 3MTFA 4I4FA 4FSNA 4Y83A 4RZVA 3TKHA 2PMIA 4QP3A 1FGIA 2J0LA 4IX6A 4XG2A 4CV8A 3F66A 2OZAB 2ESMA 4C34A 3ORLA 3LPBA 1OIRA 4FT0A 2PVFA 3MN3A 4FV8A 5M08A 4G9RA 4FVPA 4BCHA 2QNJA 2VTOA 5LCKA 4NM3A 4O81A 1OMWA 2ETKA 1JWHA 2OXDA 4IVAA 4XMOA 2OXYA 1Q3DA 1IAJA 3GUBA 3HUCA 3D2KA 3TV7A 2QD9A 3MBLA 3ZZEA 4BDGA 2Q83A 3L8PA 3GB2A 1M2QA 2YM5A 3ID6C 1P14A 5C4LA 2WTKB 2B9HA 4YPDA 2VO7A 2B0QA 3EHAA 3O7LB 5JEBA 5DFPA 2BDWA 4G3GA 3ZM4A 2XA4A 2XK9A 5J8IA 5KNJA 1WVWA 2V0DA 4AN9A 3ZLXA 2WMVA 1YKRA 2XNGA 4BTMA 5BVKA 2FSLX 3UO4A 3SW4A 5JFWA 5IQGA 3MH1A 4R7HA 4C37A 1ZYSA 4XV3A 4QMSA 2XNPA 5HLWA 1ZYLA 4O0YA 5EYDA 2O3PA 4MD7E 5FBOA 4NL0A 5LXMA 2ITOA 4GRBA 2CSNA 4OTGA 3GT8A 2VTQA 4XG6A 4AA5A 3RK9A 1ZARA 5AV4A 4DITA 1OL7A 2ITPA 5EKOA 2F2UA 3EYHA 3RHKA 5DA3A 3WYXA 2UVZA 3RM7A 4BBMA 2XK6A 2VTIA 3G0EA 3N4UA 3T8OA 4AA4A 2YFXA 5BX0A 4AZEA 3CE3A 2YABA 2Q0NA 4IX4A 4WNPA 3CPBA 4FKJA 4FTTA 3HAMA 2WTDA 2OWBA 3VQHA 3R8VA 2WIPA 3VBXA 2VX3A 3OY1A 1ERKA 4IBMA 4R1VA 1T45A 3NVMB 5AUWA 4DH8A 3VJNA 3L8SA 3MA6A 4MBJA 4CTBA 2VTRA 4DLJA 4FKGA 3VS2A 4IVCA 1XHAA 1DAWA 1PXLA 5HBEA 4M97A 3R8UA 4AE6A 4NU1A 3V04A 4NJ3A 2C0OA 3ZLYA 4EOIA 4IM2A 4PPAA 5BVOA 2YAAA 3KULB 4M13A 4FSQA 2C3LA 4KSPA 5EW9A 3SX9A 3GP0A 3UNJA 4EK6A 5J9LA 3PZHA 1B6CB 5B2KA 4UN0C 4DE4A 4DH1A 5JQ5A 4APCA 3UMXA 3D14A 4C59A 4EHVA 4GT4A 3G9NA 4X7QA 3DK7A 4J8NA 2ETRA 2XUUA 4J71A 5JRQA 3LVPA 1YDRE 3BHUA 3VUIA 1Q8WA 5M56A 3B2TA 3CS9A 5D9HA 3I6WA 3OBJA 4IAFA 3LLAA 5DEYA 4BZOA 1UU3A 4C4JA 3UQGA 4CKRA 3UYSA 4GYGA 1YOMA 3PXYA 4RWIA 5JK3A 3G0FA 1IA9A 1P4FA 5BVNA 2YIXA 4PWNA 3PE2A 1XBCA 2J4ZA 2R4BA 4R78A 2YEXA 1FVTA 4FSZA 4MHAA 4G6LA 2F2CB 4I23A 3LFCA 5IZFA 2UZDA 1AQ1A 1RE8A 4PMPA 4OBQA 2BPMA 3P7AA 3QRIA 2C5VA 4FTIA 5EHLA 4S31A 3SW7A 3C4FA 3ZHPC 2YCSA 4X2NA 4IVBA 4DBXA 4FTQA 2PVRA 4PL3A 4E5AX 3PYYA 5FEEA 3MB7A 2PHKA 4U43A 4QMMA 3FHIA 2OIBA 3RMFA 3DPKA 2WXVA 2VTTA 3PJ1A 3QQLA 4LMNA 5H2UA 3MW1A 4A9YA 5A4LA 2R7IA 1RJBA 3NUSA 5GINE 2ZMDA 5IEVA 4O1PA 1ZYDA 4ENYA 3QAME 4JIKA 4DAWA 1CKJA 5IQCA 5LWMA 3OCBA 4NFNA 2C5XA 4D2SA 3EQHA 5ANDA 3UO5A 4E73A 3ETAA 5CF5A 4H39A 1Q5KA 2EWAA 4PRJA 5DMZA 3VIDA 2CGXA 5DR6A 2X6DA 3PVUA 4G1WA 4ASZA 4D5KA 3GQIA 3HRBA 4L43A 3QQJA 4QMNA 3R9NA 2VZ6A 1YI6A 3BZ3A 4DGGA 1V0BA 2W99B 4U80A 2WKMA 3H9OA 4BCJA 4TW9A 5L6WL 4DGOA 5ETIA 2R3LA 4USEA 4Q2AA 4JIAA 3LFBA 3UE4A 2CKPA 1OIUA 3DK3A 2VNWA 2JEDA 5AUYA 2XM8A 3NPCA 4ITHA 2OI4X 4EONA 4O7RA 4LG4A 3H9RA 3FKOA 2REIA 2W4KA 3OY3A 3R22A 5I9XA 2R3JA 4IAIA 4U41A 4RFZA 1PYEA 2Z7SA 4U9AA 2SRCA 3EYGA 3S1HA 4FEVA 5AUXA 2QOOA 4QTEA 4DEEA 2XIRA 3ACJA 4BTKA 4NW6A 2UZOA 3ORZA 2R3OA 5LCJA 2IZTA 3VUGA 2GQRA 2C5YA 4IACA 4RIXB 4TYEA 4CTCA 3C13A 4DT8A 1S9IA 1U54B 1FMOE 3BPRA 4IWPA 4ACDA 2AC3A 3FPQA 4AACA 2JFLA 4QMPA 3F5PA 3JVRA 4ZSJA 4CFMA 4PUZA 2YIYA 5IQFA 5TE0A 3FEGA 1DM2A 4UYAA 3HMIA 3IW7A 2J5EA 3HKOA 3LCTA 4FKOA 4FTJA 2A4LA 4XG3A 2C6TA 4U0IA 5HTBA 3VBVA 5HQ0A 3NNUA 3CSVA 3R83A 4PMMA 4AN2A 2IG7A 5FXSA 3RZBA 3A4OX 2WMBA 4FKVA 4LGDA 4GVAA 3WE4A 4YC3A 4DYMA 2JDTA 5FXQA 2C6EA 2FSMX 4EORA 2NRUA 2BVAA 2X8IA 5E8ZA 4O7ZA 2UW6A 4I0TA 4UB7A 4V0GA 3TXOA 1ZZLA 2XCKA 4RIWB 3EQPA 2BTSA 4D2VA 3E62A 4WIHA 3AMAA 3BBTB 3RINA 3ZMMA 3DZOA 3TJCA 3GU7A 3TZ9A 3UOHA 4AU8A 3ELJA 2GNIA 3FPMA 4GJ3A 2I40A 4KIKB 4MXAA 3GCUA 4R7BA 2R64A 5HCYA 3QTWA 3E8DA 1F3MC 2Y0AA 3MY1A 3QGWA 1TQMA 2G2FA 1GZKA 2JKKA 3QTZA 4IM3A 3NW7A 2JITA 5L2QA 3VF8A 1UU7A 1O6KA 4C2WA 5I9WA 3BEAA 4YJSA 2VWZA 2ZB1A 2QCSA 5C26A 5E4HA 3WF7A 4ZSLA 3MV5A 3C4ZA 3DGKA 4TT7A 5DG5A 5I9VA 3Q3BA 5A6NA 3UMWA 3DKGA 5DEWA 3TUDA 3IS5A 2HZNA 1NY3A 3I7BA 3NUYA 4RLKA 5ANEA 3DBCA 4EOQA 2YWVA 1W0XC 5HG7A 3LXNA 2HZ0A 3ANRA 1FINA 4O0TA 3NUNA 2XK8A 2X2LA 4ANOA 3SD0A 3NUXA 3HV7A 4NEUA 1OPKA 5M44A 3FZRA 3QUDA 3QZGA 4FZFB 3WI6A 3S4QA 4TL0A 5IU2A 2OF2A 3F2RA 3NNWA 4OUCA 4DFYA 4E4MA 4RG0A 2IPXA 3KMMA 3GI3A 4IJ9A 4MK0A 4Y95A 3KCFA 4LFIA 4EYMA 3U55A 3F5XA 3NLBA 1XQZA 3Q4UA 4K6ZA 5HLPA 2CNQA 4UEUA 3TZMA 4QYYA 4WBBB 4O82A 3QRJA 3DTWA 2P2HA 2BKZA 3VUDA 5BUEA 4O0UA 1H1QA 1REKA 3LCSA 3R00A 4MQ1A 3LMIA 2YLFA 5KBQA 3PZEA 4YSJA 3TUCA 1QCFA 4RPVA 3MTLA 4DFNA 4EKLA 2WU6A 2XM9A 5L2IA 4EOMA 5BNJA 2IWIA 5AAGA 3CQEA 4JNWA 1CTPE 1J7LA 2QG5A 4G2FA 1GAGA 3KRRA 3KVXA 3Q4ZA 4FKSA 4R7IA 4FR4A 3UVRA 3VO3A 3WILA 4BI1A 4DEGA 2F7ZE 3QKKA 4Q5EA 1VJYA 4RVMA 4ANQA 3S95A 2C68A 4YBJA 3RWPA 3BCEA 4H1JA 5IA3A 1J7IA 3C4XA 5DI1A 3GXLA 3LHJA 3LXPA 4I6FA 2V7OA 2CGVA 2VU3A 3MS9A 1U46A 3KRWA 4G34A 4S34A 4D9UA 5JH6A 5AA9A 4G3DA 3VUMA 3UYTA 1OPLA 1GJOA 2XMYA 4M84A 3D7TB 5JN2A 2QOFA 2IJMA 2WMSA 3P79A 2QR8A 4TNDA 4P5ZA 1O6LA 4YHJA 4H58A 1KUTA 4LGHA 2PUIA 4A06A 4FTCA 2Y4IC 2NPQA 2PL0A 4H1MA 3IW5A 2YM6A 3H4JA 4FF8A 4HNFA 3FXZA 3WYYA 4UWYA 3DLSA 3POZA 4D28A 1Y6BA 3GU5A 3ZUVA 3WBLA 3UC4A 5HO8A 3A7JA 1XBAA 5FM2A 2XNOA 3FHRA 4KKGA 5DWRA 4CMTA 2C6OA 4E5WA 3QC4A 1IR3A 5IUGA 2J7TA 1PXIA 2OFVA 4RJ7A 3ENHA 2YDIA 3QTUA 4LM5A 4WG5A 5CNNA 5DR2A 4DN5A 4FTAA 4IAZA 4FSYA 5EM8A 3DXQA 2FA2A 2OH4A 2XIZA 2XK4A 3R8PA 4CV9A 4O7NA 3I6UA 1IG1A 4QT1A 1JBPE 4Y73A 3BV3A 2R3KA 2RF9A 3ROCA 2PULA 3EN5A 3QCXA 1GZ8A 3WF5A 5DNRA 4ZK5A 3QD2B 4TYGA 2XKDA 3D5XA 2XBAA 2GS2A 3UIMA 4HVIA 2VD5A 5AIKA 2XIYA 3QQUA 2YAKA 2W1EA 3F2AA 3CPCA 3NYOA 4O0XA 4UZDA 3NAYA 5JFSA 4M66A 3VS5A 4L46A 4OBPA 5KMKA 4L01A 2WMUA 3MVLA 2HAKA 4JDJA 4PTEA 4IWQA 5EYCA 5B0XA 5LMKC 1GIJA 4M8TA 3QUEA 5CI6A 5CSHA 4YTFA 1CDKA 3HA6A 3SC1A 3W1FA 3UG1A 4FSMA 4L9IA 5J5SA 5HVKA 2XJ0A 4GCJA 4ANMA 4E4NA 4ANBA 2XKFA 5EM6A 5AWMA 4A9TA 2WZJA 3MVHA 1M17A 3R2BA 5M4UA 2YISA 2UW4A 3QKMA 2FB8A 4R3RA 4X6RA 2E9VA 2B7AA 1OL1A 3NEWA 4OTFA 4UMUA 4RIXA 1OPJA 1H24A 3E8CA 1BX6A 3C51A 4I0RA 4MD9E 4FV0A 4OAVB 5KO1A 4G17A 4E8AA 2X2MA 4AQCA 4I3ZA 5H9BA 5AR4A 1JSVA 4RQKA 1NW1A 5ETCA 4AZSA 2I7QA 3HVCA 4YO6A 5DR9A 1UU9A 5TF9A 2XK7A 2Y4IB 3ZC6A 2IZRA 3ZCLA 4AT4A 2OG8A 2YIWA 4DG3E 3RAIA 4O83A 2BUJA 4H3BA 3A7HA 4AF3A 5DIAA 3HLLA 3TTIA 5AUZA 4I5HA 4PDOA 4OTRA 5B2MA 4KNBA 2VX0A 1PXJA 4NK9A 3PXRA 2UVYA 3R8ZA 4F08A 4L3PA 5BYZA 3ZO4A 3ANQA 4JT3A 1KOBA 3BLHA 3IW6A 2XYUA 5AEPA 2VWXA 1SNXA 2B55A 2HXLA 3I7CA 3QU0A 3KXNA 4F1OA 5IA2A 2A0CX 5J9YA 4QRCA 3QWJA 2Z7QA 3G5DA 2F57A 3VNTA 2EB2A 2RGPA 3OVVA 1R0PA 3C4EA 4FKPA 4IWDA 4HPTE 3RAKA 4BCOA 4E93A 3ZDUA 2PMLX 2PUPA 3BGQA 3W16A 3IW4A 5FEDA 1WBPA 3QTRA 2C30A 3P0MA 4G16A 3VC4A 4QYFA 2R3RA 4ACHA 4TKSA 4EK5A 3OT8A 3QCQA 3BQCA 4JL9A 4MXYA 4LOPA 4RX5A 1ZZ2A 2JDRA 4I6HA 4MXOA 3EN7A 3LMGA 2QO7A 4OGRA 4W9WA 4NM0A 2DUVA 4FT9A 3KRLA 3HDNA 3FC1X 3W2SA 5JKGA 4O21A 3V5TA 4F9CA 3AC4A 4FNZA 3E63A 3SOAA 3HA8A 5M4CA 4CG9A 1U5QA 3FMHA 4FKLA 4IZAA 3F7WA 3ZS5A 3WF9A 2YJSA 5CF6A 1T46A 3VJOA 4K1BA 4QYHA 3DDQA 4BB4A 3NW5A 1BI7A 2PE0A 3OT3A 1H1WA 3AG9A 2ZM3A 4YLLA 5E8YA 5ETAA 5H8BA 3UGCA 2QKWB 3IPHA 1L3RE 2XRUA 3EQRA 4YZDA 1W7HA 3LJ0A 2XH5A 4XG7A 4B6LA 3VW6A 4QTCA 3EZRA 4C4IA 3OXIA 4YLJA 4ZZMA 3UPZA 4XLVA 5AV2A 5K0KA 5CAVA 1ZMVA 4LOOA 4PPBA 4U5JA 3CKXA 4JVGA 5KUPA 1ZAOA 3H9FA 3O96A 2OLCA 4R3CA 5C8MA 4FIIA 4RC4A 4D4RA 3PWDA 5CSVA 3TI1A 4D4YA 3OEFX 4BF2A 1TVOA 2VGOA 3AC3A 5HICA 4HPUE 3V8WA 3QXPA 2XBJA 5CU3A 1LEZA 1P2AA 5CT0A 4USDA 3E88A 4ENXA 2WIHA 2ZOQA 4RRVA 5K4JA 1UKIA 2VO6A 3COHA 3CD3A 5CNOA 4A07A 5T68A 3ROYA 2ITYA 2I1MA 3NSZA 4PDSA 3E3PA 5JQ8A 3RZFA 3U9NA 3HRFA 3REPA 3HYHA 3V3VA 4FVRA 3A4PA 2B9IA 3L9LA 4QP8A 5F20A 4EWQA 4HVGA 4ZOGA 2IZUA 4HGTA 5H3QA 5CXZA 3D4QA 1F5QA 3KFAA 3RPOA 4B4LA 1W82A 4LYNA 4FIFA 2GMXA 1PKGA 5HIEA 3QZIA 1CM8A 4OLIA 3D5UA 1BKXA 4JX3A 2JKMA 3SG9A 2F4JA 3LE6A 3R21A 3F5GA 4G6OA 5D10A 4PPCA 2J0KA 2NP8A 4EOKA 4RJ5A 1ZRZA 2HOGA 2WGJA 3KRJA 3TKIA 3ALNA 4RIYB 4UMRA 4ZZNA 2I0VA 3R28A 2ITQA 2OJFE 1MUOA 1FVRA 3GU8A 4J97A 3TKUA 4WOVA 3ZRLA 3NYNA 4PL4A 5AUTA 3PSDA 5KMOA 3E3BX 3UQFA 2YACA 3NNXA 3O7LD 4CKJA 5AR3A 2X7GA 3Q2MA 1H01A 2BCJA 3FMJA 1FPUA 1WVXA 4BRXA 2CLXA 3T9TA 5M09A 1Y6AA 2C6LA 5HE0A 5LVPA 4KS7A 4GK2A 3ZFXA 4C4FA 5K5NA 1UU8A 1JKSA 4PV0A 3DAJA 1CKIA 5I0BA 5HCZA 3RNIA 4D1SA 5DRBA 4DINA 5HORA 5TR6A 3MH3A 5CASA 5IUHA 3MVMA 3BE2A 2GNHA 4F63A 4AFEA 3IECA 1XKKA 4QMLA 4DFZE 3FMMA 3AT4A 4FTMA 5CS6A 4AW5A 3HNGA 2WTWA 3RM6A 5E8XA 2KULA 2O2UA 4U79A 3UP2A 3OG7A 4RBLA 2PZYA 4F0GA 3IONA 3PLSA 4ALUA 2O0UA 3FI3A 5A14A 3WOWA 2QC6A 2EVAA 4TTHB 2WMQA 2VTMA 3EFJA 4C58A 1PXNA 4B8LA 4CKIA 3NGAA 3F2NA 3ZZWA 1YOJA 3R1SA 5ANGA 4D55A 2BAJA 2GFCA 4L7SA 4NCTA 1UV5A 5JRSA 3W10A 4FL3A 3TNWA 5CANA 3FY0A 4AZVA 2YZAA 2ZDUA 1GY3A 2Z7LA 3C5UA 4AZTA 1MQ4A 4X3FC 1ZMWA 2JDOA 3NS9A 4CG8A 3JS2A 3R7OA 3OWKA 3BYMA 1XH8A 4N6YA 2B9JA 3ATTA 5CTPA 2X7FA 2OIQA 3OP5A 5BPYA 4ZY6A 1FOTA 4PP7A 4ONAA 4O7VA 3Q53A 4FNWA 5IA1A 1GOLA 4U8ZA 3RCJA 5M51A 4GW8A 4AUAA 1DI8A 1ZOHA 2GDOA 3NX8A 3IKAA 2QU5A 4XP3A 4K18A 4KUJA 4UBAA 5FTOA 5TT7A 4CRSA 2OW3A 4O84A 2GCDA 3KC3A 5IA0A 1WBTA 1QL6A 3QZHA 3GFWA 3ORKA 3HMNA 3QD3A 5J1VA 3DJ6A 4O22A 3UBDA 4A7CA 2I0YA 4WSYA 3SQQA 1B38A 2W4OA 4M69B 2GFSA 3ORXA 4L7FA 3ZONA 4U81A 1JOWB 4DGLC 1OUKA 3B8QA 3MDYA 1YHSA 3K3IA 4RX9A 2VO0A 3IO7A 5HESA 3KVWA 3AGMA 2F49A 3KL8A 2A1AB 2FSTX 4TWOA 4MBLA 3V5WA 3R73A 2IW9A 4D2RA 2H9VA 1Y91A 4QP2A 3COKA 3RWQA 3P7CA 4ZY5A 1IRKA 4D0XA 4RA5A 1Q4LA 4YO4A 5JT2A 3TNHA 4BGHA 3GNIB 1YVJA 3DS6A 2PUUA 4J1RA 5AR7A 4O7SA 5BVFA 5FD2A 4CYJA 5I5ZA 4IB1A 4JBPA 4KBKA 1OB3A 5IQBA 4NKSA 4B99A 4BCNA 2WOUA 3UZRA 2WQNA 4OT5A 4A9SA 3ORIA 4ITIA 4EUTA 3PA5A 4AZWA 4O91A 3C4CA 4PDPA 4R3PA 1JPAA 5DH3A 5B7VA 4IAKA 5JZNA 2C5OA 2QOQA 3I0QA 2X4ZA 2UW7A 2A19B 1S9JA 2BRHA 5AP7A 4JAIA 3D2IA 4X3FB 4G3FA 5BMMA 2UZWE 3BKBA 4WKQA 4ZMEA 3PG3A 3HV3A 3R7VA 4FEWA 3VUKA 5FP5A 1ZXEA 4CCBA 4FL2A 3FL4A 3NIEA 4NW5A 4MKCA 3DK6A 3VS0A 3OOMA 2BIKB 3Q9YA 4HJOA 1FMKA 2RFDA 3UOLA 3VN9A 4FKQA 1H1SA 4DH3A 5GJDA 2PVMA 3BHHA 4K2RA 5FUTA 3TNQB 4CT2A 5EHYA 3U54A 3SXSA 4QP9A 5J87A 2ITXA 4GU6A 3ZH8A 1W8CA 4D2PA 1IASA 4FODA 3ODYX 5AP0A 2ZV7A 4OTWA 4RFYA 3DLZA 4H36A 4O27B 4OTDA 4ANNA 4X3JA 4FV2A 3GGFA 5E8WA 4B9DA 4DH5A 2ZDTA 4Y46A 5A4QA 2V62A 2UW8A 2Y9QA 2BKKA 2HYYA 2VTHA 4C02A 5JFVA 4O0VA 4Z16A 4HOKA 4LQMA 3LFAA 2UZLA 4WO5A 3TG1A 5K4IA 5IQHA 2J2IB 5BUIA 3II5A 4S30A 4IZ5A 4XJ0A 1YXXA 4L52A 2XB7A 3CR0A 4J7BA 4FV9A 4QQTA 4D1XA 4K77A 4RIYA 1OIYA 1M2RA 3JPVA 1PRYA 2ONLC 3LM5A 2XP2A 5EM7A 2BILB 3OCTA 4GG7A 5DN3A 5D41A 3UZTA 1SZMA 3EJ1A 4C3FA 2BROA 3R63A 4Q5HA 3VHKA 3ZSIA 5JGAA 5KMMA 3N9XA 3HMOA 4UMQA 2XNMA 4FIJA 4YR8A 4MF1A 3FMLA 4LV5A 5AP6A 3P08A 3QGYA 2B52A 3MPAA 4RLLA 5M4FA 4QQ5A 3NW6A 3K54A 3KA0A 4BIBA 4EC8A 4O7WA 3HDMA 3TM0A 4GU9A 4I5CA 3E64A 3PRFA 4YU2A 3BLQA 3PIXA 5IMEA 3EQGA 4EOPA 5HE2A 2H34A 4C35A 2OH0E 3QA0A 5HIDA 2ZV8A 2NNWB 1WAKA 3PP0A 4CMUA 5G1XA 4U42A 3RBWA 3R01A 1A9UA 3MGYA 4PTGA 3KY2A 5AJQA 4F7JA 4UXLA 3D9VA 4YJRA 4BCIA 3UOJA 3U6IA 3F3TA 3R1QA 4O0RA 3OUNB 4FKIA 2BHEA 4Q9SA 3LFFA 3FI8A 3ZUUA 5AMNA 5LVLA 4MF0A 4O38A 4AS0A 1TKIA 4U6RA 5HU9A 4FYOA 3N4VA 2UZNA
chains in the Genus database with same CATH superfamily
2YDKA 4IW0A 3Q32A 4H3PA 4Q9ZA 1M14A 5AR5A 3QX4A 2OZOA 2PMOX 3DU8A 3OFMA 1H0WA 4G5PA 5KMIA 3VHEA 4K0YA 3V5LA 3C0IA 4D58A 3A62A 4ERKA 1J1CA 4X2GA 3AC8A 1LEWA 2WTJA 3PVWA 4PY1A 4F0FA 3AMYA 2C6MA 3LXKA 1Y8GA 2XNEA 1JQHA 3RGFA 4A9RA 1PW2A 3RPSA 4AP7A 4E4LA 4Y85A 2OJIA 5AUVA 3CQUA 4YMJA 4LUDA 4IWOA 4L42A 4P4CA 3R7UA 3SKCA 1ZOEA 1QPDA 3MY5A 3VQUA 5GJGA 3BU5A 3ZFMA 4XOZA 3ZBFA 3FYJX 4YTCA 5EHOA 3BU6A 4ZTMA 5H8GA 2JBOA 4MQ2A 5BMSA 2CPKE 3BV2A 4AX8A 4XV2A 4NM5A 2NO3A 2X2KA 4QTBA 4FRFA 5EKNA 3MB6A 1AD5A 2P4IA 2XYNA 4WNKA 1U5RA 1NXKA 4HNIA 3RPYA 3F3UA 3I60A 2PMNX 3LQ5A 2JFMA 4HYHA 3R8LA 4YC8A 3E8EA 4KBCA 4YC6A 5DT4A 2OJGA 3QD0A 3C5IA 1PY5A 2HELA 3FLZA 2O5KA 2CNUA 3B2WA 3H30A 1H1RA 3PJ8A 4GJ2A 1UNGA 5ETFA 4FEXA 3F5UA 5D7AA 1Q97A 2W96B 4C4GA 3QRKA 4HYUA 4O4BB 2OZAA 3ACKA 3VS6A 4JMQA 4WNMA 3ZEPA 4RQVA 4WBOA 3IDPA 5GZ9A 1OL5A 4TZRA 4QMWA 2HK5A 5HCXA 3C50A 3TV4A 4ARKA 5CALA 3IDBA 4TXCA 1PXMA 4ITJA 3ATSA 3DQXA 1MP8A 3O2MA 2RKUA 1DAYA 2QG7A 4E3CA 3M2WA 4H05A 2GTMA 3ALOA 3DDPA 4DEBA 2Z7RA 4C3RA 4ANSA 5A46A 4I92A 1ST4A 1OKVA 2C0IA 3CQWA 3PXFA 5IH6A 3SHEA 1W2FA 2F7XE 4KIPA 4CFFA 4F7LA 4YJQA 5ITAA 4IAAA 4NTTA 5IPJA 2R3QA 5AV0A 4S33A 1M7QA 2UV2A 1WFCA 2PUNA 1CSNA 3EH9A 1UWHA 4I6BA 2H6DA 3MFRA 3VRZA 4KRCA 4RMZA 5B2LA 3OW4A 3SV0A 4DF3A 4IB3A 5J95A 2P3GX 4QPAA 3R04A 4PTCA 4FZAB 5CSPA 1SYKA 5IEYA 1HOWA 1PJKA 3DFCB 5IH5A 4GEOA 1SVEA 3I5ZA 5DT3A 3OTUA 3JYAA 4MNEB 3AD4A 4EH6A 1J3HA 4EL9A 5BVEA 1R1WA 1WMKA 4I1ZA 2WMWA 3P5KA 3R9RA 1DS5A 2HIWA 3LOKA 4HGEA 4M15A 5A9UA 4HGSA 5HLNA 1KE8A 4UMTA 5AUUA 3R9DA 4JDKA 4JQ7A 3IW8A 4LUEA 4QMTA 5DBXA 4QDEA 5CU4A 4A9UA 4ALVA 3DZQA 2PE1A 2XKCA 1K9AA 2GNGA 4J95A 4DFXE 4J96A 3TYKA 3R7GA 2VWWA 2ITZA 4ASDA 3FJQE 4YUQA 3TNIA 4DG2E 4FSTA 4GUBA 3HECA 4HGLA 3T3VA 2F7EE 3ZLSA 4BL1A 5JMSA 3IOKA 4DT9A 2PZIA 4MYGA 4P5QA 4FK3A 3SAYA 3Q2JA 2C6KA 4KINA 4YHFA 4RA4A 1IAHA 4ACGA 5CZIA 3QBNA 5K0XA 3W2CA 2Q0BA 4YHTA 3MESA 2C3IB 3I0OA 1BMKA 4MXXA 4TWPA 1W84A 3U6JA 3PXQA 2QOLA 3DNEA 3IDCA 1AGWA 2G15A 4F4PA 4EOOA 4ZLYA 1HCKA 3L8XA 2E9UA 3R71A 3KULA 3VONA 3WZJA 5J9ZA 5AA8A 4IQ6A 4DTKA 3FQHA 3KXXA 3G2FA 4EJ7A 4GMYA 5I3OA 1WCCA 3NIZA 1XH7A 2VWVA 3KXZA 5K3YA 3I81A 4EWHA 1Q99A 4XV1A 4F0IA 5KMNA 3SOCA 5M53A 4NTSA 2HENA 2EUFB 2VUWA 3F69A 4F99A 2R2PA 2VWBA 4GIHA 5GZAA 2AEGA 2ITTA 3RPRA 3FI4A 3R7EA 4FVQA 3KKVA 3BGPA 3NWWA 3WZUA 4QO9A 5CQUA 4EH3A 2WQEA 1OBGA 1RDQE 1QPEA 3MPMA 5D11A 3PY3A 4BI0A 5C8NA 3D15A 4XRJA 4BDHA 4CFVA 5AV3A 2WB8A 4PQNA 3LQ8A 3BGZA 4X2FA 2P55A 2QO9A 2WTIA 3NCZA 5LVNA 4DHZA 3IK3A 4FKTA 4EZ5A 4DTBA 3QTQA 2A98A 4MXCA 3ORNA 3TN8A 2C0TA 4QYEA 4S32A 4JOAA 4TNBA 3HMPA 3ZEWA 5CEQA 4AXAA 2RIOA 2BZHB 2WMXA 1M2PA 4RWKA 4F9WA 3B8RA 3Q60A 4AOJA 1WBVA 1JNKA 5CAUA 4KA3A 4C33A 5IKWA 3G15A 4AQKA 2WO6A 4BCFA 4MWHA 1TZDA 4F7SA 5F95A 1CKPA 4FMQA 4Y5HA 3RNYA 4ASXA 4O0WA 2HZ4A 2ZV9A 3M1SA 4FNXA 5FLFA 4D2WA 5L6PA 2VTJA 5LJJA 3TDVA 3HP2A 3QYWA 1H0VA 2W1CA 3KEXA 4JXFA 4F9BA 4RX8A 2VWIA 4XOYA 3P9JA 4EH5A 5AV1A 3EQIA 4FT7A 3S00A 5E9EA 2JKQA 3VVHA 4P7EA 3R2YA 1E1VA 4L3JA 4EYJA 3PA3A 4QMYA 1YWVA 4BGQA 4A4LA 3Q9XA 4L8MA 4FTLA 1OBDA 2BZKB 1GIIA 3T3UA 4WG4A 5HTCA 2CN5A 3A61A 5HTIA 3CLYA 3GCSA 4M67A 2UZBA 4G3EA 4XUFA 2GHGA 3SLSA 3N51A 4DEIA 4BZNA 4ZP5A 2V5QA 4EHGA 5LVMA 2P0CA 3R02A 5FQDC 3UOKA 4ZS0A 4GKHA 4KIQA 4XEYA 5IEXA 3OWPA 3CTJA 4V04A 4O0SA 2BALA 3VW8A 4ZS4A 5IG1A 3PE1A 2XANA 3PRIA 4GT5A 4RC3A 4DCEA 3F61A 5BVWA 4JAJA 4IMYA 4BJJA 3K2LA 3VAPA 2BHHA 5FBNC 5F9EA 2YWPA 1KE7A 2PVJA 3BYSA 2WMRA 1LUFA 1SVHA 4EKKA 5K9IA 2H8HA 5HX6A 5I9ZA 1ATPE 2Y7JA 5C03A 2GNJA 3R7YA 3MSSA 3AC1A 5HKMA 4APPA 5ACBC 4OTPA 2XJ2A 4CNHA 1ZY4A 2QQ7A 5CU2A 3R0TA 4JR3A 1U54A 4LL0A 3SDJA 3PPJA 1H00A 2JD5A 4YURA 5AADA 5I9YA 3COIA 3GC0A 3Q9WA 3U8WA 1OKYA 1HCLA 3D0EA 4BBFA 4WA9A 4BDCA 5KHXA 1SVGA 3DY7A 3MI9A 4FK6A 4FKRA 2P2IA 3PXZA 1I09A 5C9CA 4BDFA 4DBNA 2E9NA 2OICA 4FEUA 3PFQA 2C3KA 3DT1A 5FM3A 2HXQA 3VBWA 4IADA 3P86A 5ANIA 5IDPA 2RSVA 2ZVAA 3O8UA 4YZ9A 3GU6A 5HG8A 4E26A 5HU3A 3OCSA 1OKZA 2JIIA 4WUNA 5HNGA 1KE9A 5AP5A 5GZ8A 4RIOA 2BRGA 3A7GA 5DVRA 3L9MA 4CSVA 5HOAA 4XH6A 5HG9A 4GFGA 5DGZA 2XS0A 4RIWA 4M3QA 4N70A 3P23A 3CC6A 4HZRA 1OM1A 3FZPA 2VTSA 4BHZA 1R0EA 5FGKA 4MNEA 3E92A 4KIKA 3UP7A 4MTAA 3UTOA 4BDBA 3EWHA 4E4XA 5L8JA 5KMLA 2LGCA 5KE0A 2O64A 2DQ7X 4IJPA 3RVGA 4KAOA 5A3XA 3JXWA 5LOHA 4JQEA 3ZRKA 4KB8A 3PTGA 4FIEA 3AD6A 2WD1A 2G9XA 2GHLA 1YXTA 3QTXA 4IXPA 4I24A 2OBJA 2UZTA 3RAWA 4FTKA 4HCVA 4WNOA 4AG8A 4IDTA 3UG2A 3PWYA 2PPQA 4EK3A 3EMGA 3Q04A 3QHWA 3RK7A 3EQFA 2QLUA 1OVEA 3ZYAA 3NAXA 5HNIX 2G01A 4C2VA 5CY3A 2OU7A 3QLGA 3ENMA 4XHKB 4EZ7A 3LFQA 2BMCA 4FKWA 5EOBA 2GNLA 1JLUE 1ZMUA 3GU4A 3DTCA 3EKNA 3FMNA 4XLIA 1GIHA 2I0HA 5CXHA 1FQ1B 3OXZA 3A8XA 3TACA 1YOLA 3JVSA 4AGWA 5KKRC 3EN9A 1FBNA 5GIOE 5CSWA 2B53A 3S2PA 5LMBA 3BRBA 3NUUA 5KZIA 3OMVA 3BWFA 5KBRA 1BLXA 5HHWA 1YW2A 2DYLA 3LIJA 4I41A 5IQDA 1GZNA 2PK9A 3KU2A 4G6NA 4EH4A 3A60A 3LLTA 5AAFA 2C1AA 4II5A 3VUTA 1ZLTA 2IO6A 4TWNA 3V8TA 4MCVA 2OO8X 1JSTA 2QONA 3QCSA 4I20A 2A2AA 5EDRA 4IZ7A 3UNKA 4RZWA 1H07A 4BY9E 3CY3A 4ZIMA 3CP9A 2P33A 5DOSA 5IH4A 3FMEA 4ZLZA 1PMUA 2E2BA 3DV3A 3ET7A 4CQEA 2B4SB 3KF4A 4XRLA 2XVDA 2QI8A 3WF8A 2ITNA 4AGCA 4X2KA 5BYLA 3ZO1A 5L4QA 4FI1A 2RFSA 2PTKA 2BR1A 3TIZA 3FSFA 5L2WA 3EFWA 3EZVA 4EOSA 2X81A 2C69A 3D7TA 4UWCA 4EJNA 1R78A 3BQRA 3DB6A 3VULA 5E8SA 5IISA 4QQJA 1ZYJA 5EH0A 4BGGA 1Q62A 2PY3A 4X0MA 3AT3A 3DBDA 4CEGA 3DOGA 4FBXA 4YZCA 4YP8A 4L53A 5AFVA 2RG6A 1BYGA 4BWPA 4XV9A 4M0YA 4PMSA 4NYEA 2UZEA 3Q4CA 4FTUA 3DA6A 4MEDA 4NJDA 5HO6A 2W0JA 3ZSGA 3VS3A 5GIPE 4QPSA 3FWQA 2JBPA 4BWKA 5CT7A 4DEDA 3WIGA 3QQFA 4YJOA 4FSUA 3W32A 3NDMA 4TYHB 3EQDA 3DKFA 3KIOC 4FV4A 3WF6A 2V7AA 4AT5A 3COMA 5E1EA 2CCHA 4YJTA 1OKWA 3VUHA 4ACMA 3D7ZA 5F94A 4F65A 3W33A 3ZXZA 4DFUA 2OJJA 4FX3A 4JR7A 4S2ZA 3HGKA 4WRGA 5KKRB 3TL8A 2J50A 5FDXA 4C0TA 1KV1A 1UVRA 4NT4A 3K5VA 3UJGA 2JGZA 4IE9A 5K5XA 2FSOX 3C4WA 3T9IA 4RJ4A 5D1JA 4GK3A 3KMUA 2W1ZA 4O2ZA 4XCUA 4D1ZA 3PIZA 1G8SA 4QYGA 1JVPP 3QTIA 4E6AA 3FC2A 3PVGA 5DPVA 5FP6A 4DHIB 5J1WA 5ACKA 1YXSA 2PE2A 2XNBA 3BX5A 4IVDA 2PZPA 4TYJA 4BKYA 2GPHA 4LRMA 3QRUA 2HY81 4OT6A 4BDJA 4GFMA 1B39A 1FGKA 5AP2A 3GC8A 4O7LA 4PL5A 5EQYA 4GV1A 5FRIA 4R8QA 2ERZE 3NNVA 4R6VA 2VRXA 3G6GA 5E8UA 4CVAA 1A48A 3PUFC 2J0MB 3MFSA 4MNFA 3BU3A 4FOBA 3ORPA 4YJNA 2QLQA 2VWYA 3E87A 3V5QA 2Y4PA 4L6QA 4OTQA 2YIRA 2VTAA 3H0ZA 4CYIA 3ZXTA 3IOPA 3FI2A 4F6SA 5AR8A 2JAMA 4W4XA 3QTSA 3FXWA 3WIKA 4Z55A 3OTVA 1G8AA 5J5TA 4ZZOA 2CDZA 4QD6A 3FKNA 4ZEGA 4MWIA 3IGOA 3DBEA 5T6KA 3FUPA 3M42A 4KKEA 3QQKA 5T3QA 3SXRA 4BIDA 2WELA 1MRYA 4CT1A 1H25A 1G8KA 2WHBA 5KCVA 4XYFA 3R8MA 4O86A 2Y8OA 2CCIA 4L3LA 5DHJA 2G2IA 2C5NA 4XNEA 3ZTXA 4DHFA 2HW7A 4UX9A 3CY2A 2XF0A 4AZFA 3BYUA 2EXMA 3AKJA 2ZAZA 2OXXA 4AGUA 4IDVA 3RTPA 2WPAA 5C27A 3LJ2A 3RK5A 2QR7A 4AOTA 2W5HA 4OBOA 3G90X 3OBGA 3HZTA 3F7ZA 4MAOA 2JAVA 3LMHA 4BTFA 3FDNA 1KE5A 5HD7A 3NYVA 1URCA 4U3ZA 3HX4A 3EFLA 4FSWA 1PF8A 5KMJA 3DAKA 3DKOA 3EL8A 4KIOA 3U4WA 3FZSA 3I5NA 3BE9A 4CXAA 1Z57A 4BFMA 5GHVA 4C4HA 4MX9A 4YPSA 3C0HA 4B7TA 2AYPA 3ULZA 1SNUA 3QC9A 4L45A 4ZLOA 1J7UA 2ERKA 1ZYCA 2VTLA 4W8DA 3ORMA 4EI4A 3F6XA 4GH2A 4JG6A 3P78A 4O1OA 3S3IA 4EK4A 5LMKA 5M4IA 2I6LA 4ZSAA 2FGIA 2E9OA 3FLSA 4IEBA 2UZVA 4N0SA 2ACXA 2IVTA 3P7BA 3DXNA 4B8MA 5I3RA 2YM8A 4JDHA 2JIVA 4EOJA 1Q8YA 5HO7A 3ITZA 4TN6A 5L3AA 5H8EA 4Z3VA 3QL8A 4Z9LA 4AT3A 4FUYA 3FKLA 5EQPA 2W1FA 5C8KA 4HVSA 2CN8A 1BL6A 2GNFA 2J51A 4OTHA 3SRVB 3VS4A 2PSQA 4FSRA 3WARA 5A6OA 5J7BA 1P4OA 2OIDA 4F70A 3PXKA 3FZTA 4TPTA 5L8LA 2O63A 3FZOA 2BDFA 3HMMA 4KWPA 4EHEA 4MH7A 4EC9A 1EH4A 5HVYA 2Z02A 1OIQA 2BRNA 4I0SA 2AUHA 1E1XA 2WMTA 3OW3A 3A2CA 4W8EA 1Y57A 3R9HA 4DEAA 2B9FA 2OJ9A 3SGCA 3CXWA 4E1ZA 4UMPA 2EU9A 1PHKA 4Y72A 5D12A 3FSKA 4MXZA 4EHZA 4IANA 1I44A 4C38A 1LR4A 4AGDA 2O8YA 4IM0A 3CD8A 3LFNA 2PVHA 3I79A 3LAUA 3POOA 4V0GB 5GJFA 4F1TA 5C1QB 5CEMA 2BAKA 4ZTRA 3VS7A 3F3WA 2PZRA 2ZMCA 1XH4A 3KN5A 3OD6X 4EQUA 2RFEA 3BHVA 3OOGA 3FQEA 4GL9A 4EQCA 4ZXTA 4HVDA 4JRNA 5HNBA 3RJCA 5A54A 1J1BA 4K8AA 3CJGA 3R6XA 4E6CA 2QOKA 4L44A 4CFUA 3OWJA 3BLAA 3D5VA 4FUXA 3OUKA 3BI6A 5LMAA 1UKHA 4EQMA 1K3AA 4G31A 3MH0A 2WTVA 4WUAA 3SA0A 3AQVA 4NH1A 4JBOA 3CTHA 1Q24A 3HV4A 4M68A 2FUMA 4HYSA 4DFLA 4YTIA 3GEQA 1H4LA 2WTCA 4ZAUA 1VLRA 3O71A 1NVSA 3H0YA 4RSSA 4BDKA 4IHPA 1IA8A 3QX2A 4TYHA 4I4EA 4BDEA 3MFTA 4YGAA 2UW3A 4FL1A 2J0JA 3TNPC 3O17A 2C1BA 1WBSA 1W98A 1CMKE 1VEBA 2X39A 4FGBA 4QMXA 4W4WA 4F1MA 5EFQA 3A8WA 2QHMA 4BTJA 5CF4A 3NRMA 3BHTA 3PY0A 3LW0A 2ITWA 2NYAA 4QMVA 2XIKA 3CTQA 3K5UA 1WBOA 3VBQA 3W2QA 3U87A 1KV2A 1Q41A 3JY9A 3LCOA 4FV7A 5DLSA 4IIRA 2BRMA 3PJ2A 5HBHA 5HG5A 1UA2A 5TKDA 1JKTA 4GSBA 3IGGA 4X6QC 5AP3A 3VS1A 3WE8A 3CKWA 4O2PA 4FICA 3OS3A 1YRPA 4RJ3A 2ZB0A 4EEVA 3MH2A 2QOCA 3R9OA 2YCRA 2R3NA 3Q6WA 2ZYBA 2O65A 3LFDA 4FIGA 4O4FA 5CAOA 3W2OA 1UWJA 3IQ7A 4R1YA 3E7OA 4FA2A 2HY0A 3TZ8A 4XP0A 2GQSA 2ITUA 2W1DA 3GCPA 3PLAE 1O6YA 4AFJA 5IDNA 1KE6A 3PG1A 2FYSA 3MIAA 4ZMFA 3LM0A 4YTHA 5EG3A 1NT2A 1V0OA 4IAYA 3TTJA 2X1NA 3QHRA 1YXUA 3PDTA 1G3NA 2W9FB 4ACCA 3CJFA 5CVGA 5CVFA 2B54A 3AXWA 1YHWA 3BYOA 2QO2A 4UZHA 3UPXA 3V6RA 4U44A 1OL6A 4JQ8A 4MBIA 2VX1A 3NCGA 4AAAA 4I94A 4F64A 5EQEA 3RHXA 3W2RA 5E7RA 2GS7A 3QRTA 2QOIA 3BELA 3QF9A 1QPCA 5EW8A 2UVXA 4EK8A 1BI8A 4TRLA 4GUEA 2BFXA 1YI3A 2QOHA 1QPJA 3JY0A 4AE9A 3NMUF 5DE2A 2VV9A 1U4DA 4YNOA 3KCKA 1YWRA 4C36A 3EN4A 1KSWA 1YQJA 3KREA 1MRVA 5BUJA 3PSBA 5KHWA 3BYVA 3EL7A 3KGAA 5CQWA 2X4FA 5EM5A 4OAUC 2C4GA 2UUEA 2HWOA 3F3VA 1PMVA 4KS8A 2V55A 2IN6A 3G6HA 4JBVA 4ERWA 4DEHA 4DC2A 3P1AA 5E92A 4LGGA 3ZFYA 2WQOA 2BFYA 3QA8A 4K11A 4GG5A 3EN6A 4QMZA 4CD0A 4HCUA 3UIUA 4ANLA 1NA7A 3UZPA 4M69A 3DKCA 3OHTA 4FT3A 5BQ0A 3M11A 4OW8A 1PMNA 1PKDA 3QKLA 5EW3A 2CKEA 1WBNA 5C01A 2BZJA 1ST0A 4FEQA 4QMOA 3HP5A 3G9LX 5FWKK 4AXFA 5HVJA 2X8EA 3E7VA 3AT2A 3ZC5A 1W2CA 2BIYA 3ZBXA 4CZUA 2YERA 4N6ZA 5EI2A 2IZSA 4U97A 2R9SA 2I0EA 5E90A 1OECA 2HCKA 3GENA 2PWLA 5E91A 3MIYA 4LI5A 2WEIA 4FTRA 2Y6MA 1ZOGA 3TDWA 2C6DA 2GU8A 4F6UA 3SRVA 4XG9A 4YZBA 3W8LA 3ERKA 4F9AA 2VNYA 4N4SA 5JGBA 3LKMA 4WT6A 3DQWA 4EUUA 5KX8A 4LRJA 4RC2A 4RWLA 1Q8UA 4FG9A 3KN6A 5FTGA 4U40A 5LARA 4BYJA 2W17A 3QD4A 2F9GA 4X3FA 4D5HA 3PIYA 3AMBA 2X0PA 4TWCA 3QZFA 3QUPA 2BZIB 4EH8A 3BIZA 4CZTA 2R3GA 3V6SA 3ZRMA 3FYKX 3DNDA 5HI2A 5HE1A 3NVKI 3KRXA 5CSXA 5HEZA 5DRDA 4IC8A 1JKLA 4C3PA 3W18A 1OZ1A 3KXHA 5AAEA 3MYGA 4NZWB 3HRCA 5FG8A 2FO0A 3VBTA 4F09A 2VAGA 3MA3A 3V5PA 4AA0A 1JKKA 3D94A 1JAMA 2ZV2A 3QLFA 1XWSA 3UVQA 2YIQA 3ML1A 3F82A 2CHLA 4HZSA 3FZ1A 3ZLWA 4WG3A 1NVQA 4HVHA 4WRSA 3OF0A 2IVVA 2WAJA 3W0OA 3EB0A 4JS8A 4RVTA 3PP1A 4NFMA 3KQ7A 5AIRA 4I5PA 4QMQA 3NYXA 5AR2A 2OFUA 5IMXA 4JG7A 4XG8A 1OI9A 1XH6A 2GSFA 3PJCA 3PVBA 3I4BA 3Q6UA 5A4TA 2XRWA 4ALWA 4CLIA 2XK3A 2QOBA 4O4EA 4BYIA 1LP4A 1J91A 2NRYA 4GS6A 5HE3A 5HX8A 5EI8A 4RVKA 4DGNA 3DCVA 4FG7A 4IB0A 5HGIA 3UIXA 4J53A 5ICPA 3DJ5A 4FYNA 3C9WA 3AGLA 4GK4A 2XKEA 3QWKA 3Q4TA 3FMKA 4FZ7A 2XEZA 4IFGA 4IZYA 4UYNA 5LWNA 3E5AA 3GCVA 4DH7A 4G5JA 3FAAA 2HW6A 4FOCA 5CLPA 1STCE 4I93A 3EQBA 5J7HA 1YDSE 2OKRA 4U7ZA 4UY9A 5CWZA 5L2SA 4X21A 3C1XA 4D4VA 3SG8A 4CCUA 4GYIA 2R5TA 4K9YA 4RX7A 2DWBA 4BICA 4CFXA 3F9NA 5ANOA 2CGWA 2UW0A 5L2TA 2X0GA 4J98A 4C62A 1VYWA 4J99A 4HYIA 3O0GA 4QPMA 2W9ZB 2VN9A 3TZ7A 4R77A 5A4CA 1YHVA 4FG8A 2PZ5A 3ZUTA 2X7OA 4BN1A 4F9YA 1XH9A 4QNYA 2A27A 2X9FA 4QP1A 4TYIA 3D5WA 4O7YA 4BR3A 4PNIA 2YZLA 1Z9XA 2W06A 1PXPA 2G2HA 4LOQA 3TWJA 4R5SA 1BL7A 5I4NA 3QYZA 3OEZA 4I6QA 3L8VA 4JX7A 2WFYA 5EDPA 1ZWSA 3AD5A 3THBA 3MY0A 2G1TA 4FV1A 2Z8CA 4V01A 4E5BA 3LJ1A 4V05A 3Q9ZA 1A06A 4NCTC 4P90A 2RFNA 5JSMA 4J52A 3P4KA 1V1KA 3ZDIA 3UQCA 2X8DA 1IEPA 4FC0A 4FTOA 4BKJA 3U9CA 4D0WA 1SMHA 1X8BA 4U3YA 4PF4A 2YHVA 4WSQA 3V8SA 2H96A 3DB8A 3SVVA 4AXDA 4ZSEA 3R1YA 4O6LA 5LQFA 3W0SA 2V22A 4OTIA 3MJ1A 3OROA 4OR5A 1U59A 2YA9A 5CI7A 3E93A 3PA4A 2YN8A 3NUAA 2ONLA 4BZDA 4CRLA 3Q5ZA 3V51A 4XG4A 1MQBA 1E9HA 3OC1A 4BI2A 4ID7A 2JDVA 4BBEA 4FIHA 4BKZA 2J6MA 4YLKA 5IF1A 3ORTA 1SM2A 5CX9A 3CBLA 2J90A 2X9EA 4ASEA 3Q96A 5D7VA 4JDIA 5AM7A 3TCPA 3O51A 3C7QA 2FVDA 5DYJA 2YLEA 5HD4A 2W1IA 4LMUA 3TUBA 5FEQA 3JR1A 4B0GA 3NZ0A 4ZJIA 5E8VA 4XBUA 4RFMA 3ZO3A 2EB3A 2YJRA 3PUPA 3GBZA 4QNAA 1GNGA 5KZ0A 4BVUA 1PYXA 1GZOA 1P5EA 2ETMA 4YJUA 5G6VA 3FXXA 3QCYA 2HZIA 4AN3A 2ZJWA 4U45A 3I1AA 3E8NA 2X0QA 3GC7A 3CGFA 3GOPA 4ZTSA 1OITA 4BCGA 4BWXA 3O50A 4XS2A 3W55A 4A4OA 4CFWA 5CEOA 1W83A 2CNVA 3N4TA 3ZO2A 4UALA 3GVUA 5JZJA 4UV0A 4MVFA 1TQPA 2OF4A 3QQHA 4IFCA 1Z5MA 3Q5IA 3Q52A 4W9XA 5TO8A 4L67A 4DGMA 4USFA 2C3JA 2E9PA 5ANJA 4CLJA 4NWMA 1OGUA 1PXOA 1MRUA 4CGAA 5CENA 4QTDA 3GCQA 4G3CA 4KKHA 4RVLA 3HV6A 2J0IA 2QURA 5CYIA 1APME 2VTPA 4NUSA 4E6QA 2JIUA 4EOLA 3GFEA 3UDZA 1XJDA 4QOXA 2IVUA 3ZOSA 2W5AA 5AP4A 4P2KA 4DDGA 1R39A 4JBQA 3DFAA 1KWPA 5EYKA 3WZKA 3AC5A 2BRBA 2JKOA 4NIFB 5M07A 4XP2A 2JDSA 4BDDA 4M14A 5IUIA 4N57A 3FQSA 5CAQA 4A4XA 4KABA 3EOCA 4UWBA 2R3HA 3RI1A 1TQIA 2PVKA 3FE3A 4BDIA 4JLCA 3LCKA 4C57A 4E7WA 2B1PA 4GIIA 4ZTHA 4R5YA 4PP9A 4BCPA 5CF8A 1H8FA 5FDPA 3BLRA 4NM7A 4YBKA 5EI6A 1H28A 3DXPA 4FJVA 3L9PA 4EZ3A 5HZNA 3WZEA 5GNKA 1H26A 1RQQA 4K33A 2Y6OA 3S0OA 2GS6A 3H10A 3K3JA 3PPZA 1VZOA 4QTAA 2YDJA 2ZM1A 3BEGA 4IH8A 2XEYA 5F1ZA 1YDTE 2C6IA 2QODA 3QFVA 4FE2A 1YXVA 2XCHA 4QQCA 4L68A 3V5JA 4ORKA 2BAQA 3PSCA 3MVJA 4DFBA 3A99A 3MWUA 2GTNA 4QP7A 5ANKA 4FTNA 4KRDA 2R3FA 5BV3A 2VGPA 1ZY5A 2R0IA 3HEGA 3JUHA 2IEWA 4JRVA 3PY1A 2W4JA 5IA5A 3VRYA 5IA4A 2RG5A 2WEVA 4CMOA 3RALA 3GC9A 1XH5A 3C0GA 4NSTA 3ZM9A 2R3MA 4DTAA 2J5FA 2QVSE 2R3PA 1UNHA 3LFSA 3ODZX 3KK9A 3LXLA 4BIEA 4F6WA 3U6HA 2OK1A 4ZTNA 1VYZA 4TY1A 3CIKA 2JLDA 4M7IA 4RJ6A 3L9NA 3BHYA 4JJRA 1H27A 3A7FA 3UO6A 4AOIA 3W0QA 5EOLA 5TOZA 4JG8A 4PMTA 3UDBA 2OSCA 3EIDA 4EBWA 2J9MA 2KTYA 3NUPA 4GT3A 4E20A 2WMAA 1M7NA 4FV3A 4IB5A 1JSUA 4UXQA 4RGJA 2QHNA 5JFXA 4FKUA 1BUHA 5AM6A