4RIOA

Crystal structure of jak3 kinase domain in complex with a pyrrolopyridazine carboxamide inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
285
Chain Sequence
b'TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGSERDVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK3
publication title Discovery of pyrrolo[1,2-b]pyridazine-3-carboxamides as Janus kinase (JAK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 90
structure length 285
sequence length 285
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rioA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rioA01
2VTTA 4XRJA 5JRQA 2ITYA 1UNHA 3FXWA 3OFMA 1PKGA 4OUCA 3FLQA 4DLJA 4FIHA 4KBCA 3V5JA 3FI3A 3H0ZA 3U6IA 1GZ8A 4M15A 4D5HA 3MY1A 4BCPA 3IOKA 5J79A 4UY9A 4DINA 4E5AX 2X4ZA 3S00A 1GIIA 4BDHA 5I9XA 1OVEA 3KXXA 3MIAA 4RX7A 4ENXA 2UW9A 4H3QA 4K33A 5C27A 3ZO3A 4CG8A 2W1HA 4DEEA 4ASXA 2C5NA 2PVRA 4WBBB 5CXHA 4D1SA 1VZOA 4GS6A 5KKRC 1XQZA 2C6EA 3OD6X 4UZHA 5HEZA 4GT3A 4ZJJA 3VRZA 1KUTA 1KE8A 2I0HA 2J0JA 2UW5A 2F2CB 4FIFA 3QLGA 3FLWA 2YHVA 3LLTA 4XG2A 4BIEA 3OY1A 3FV8A 4EH5A 2XBAA 4B9DA 3VC4A 4K9YA 5BYLA 4FKGA 3KF7A 4WD5A 5D10A 4ZOGA 1VYWA 2VWYA 4RVMA 4RJ8A 3TN8A 5JFSA 4BN1A 4P5QA 3C5UA 5EH0A 3BZ3A 3V8SA 1OMWA 4DEAA 4TWCA 1FBNA 3H9OA 4QTCA 3HYHA 2WTKC 4IVDA 4AN3A 4MD7E 3AC5A 2XRWA 1NVSA 3NR9A 1UU8A 3LHJA 4FA2A 2J5FA 3UO5A 2RF9A 4O7SA 4P4CA 5CVGA 4FF8A 4NL0A 1W83A 2AYPA 5FXSA 4HW7A 4X6RA 2BRBA 3MS9A 4DGGA 4FV4A 1ZMVA 4DBNA 3U4WA 3IO7A 4WNKA 2YLEA 4E6DA 4DT9A 3D5XA 5F94A 3R71A 5JRSA 1Q8ZA 2W4JA 1XBAA 2G2HA 3QWJA 3BBTB 5I4NA 4BRXA 3VBWA 4C4FA 4EHEA 5CLPA 4Y95A 1KE9A 4Y5HA 2A27A 3O17A 3MVHA 5G6VA 2UW6A 3RAIA 2WQOA 4Y72A 3UZRA 1FMKA 3F9NA 5L6WL 3UVQA 5IDNA 3L8XA 5CI7A 3AD5A 3COHA 4C36A 5FG8A 4FEVA 3W2PA 3VS0A 4F7NA 2BAKA 4BDFA 4F9CA 3G6HA 2CGVA 1BI8A 1YDRE 2OZAA 3ELJA 1XH7A 2W7XA 3HRBA 4U5JA 4B4LA 3Q4UA 1PKDA 5EFQA 3PXQA 1JQHA 4XV2A 5J9ZA 3PXYA 3P08A 4BZDA 4CFNA 3ZRMA 4YSMA 2FVDA 4PMMA 4NYEA 3TZ9A 3R7OA 4TYHB 2VD5A 3EQDA 1REJA 3ZFXA 5JZJA 4ZSEA 5HICA 1FGIA 2BTRA 2QU5A 5EYDA 1H24A 5AV4A 1KV1A 5T68A 2YDIA 2FYSA 3KCKA 2FH9A 2CGUA 2WMAA 1W84A 1YXXA 2B4SB 4GMYA 5TR6A 3UIBA 3UVRA 5DRBA 1AGWA 2W1GA 1Q62A 2Y6OA 2W9FB 2VWVA 3O51A 3QTRA 3MVJA 5HX6A 2EXEA 3EFLA 3F5PA 3FKLA 3PY1A 4J8NA 5L2TA 3UMWA 3FC1X 1YDSE 2FUMA 3QGWA 4D2VA 5CALA 5EW8A 5KZ0A 2J90A 5HU3A 5ANIA 3Q60A 4I0TA 2BVAA 3R0TA 4EHGA 3LW0A 4B8LA 5GIOE 3DKOA 5I9UA 4DG2E 4DEGA 1CM8A 2W4KA 4QMYA 2YZAA 2ZB0A 1H4LA 2YCRA 3ZRKA 4AQCA 3U8WA 3GC0A 3C4CA 4Y46A 4JDKA 1DM2A 2A0CX 3CBLA 3A7FA 4YO6A 3DZOA 4F6SA 5BX0A 2XF0A 2WHBA 2X9EA 4KRCA 3UO4A 1YDTE 2VX1A 3I0OA 5FXRA 3MA3A 4MNEA 5LVOA 4AT5A 3RPRA 1IR3A 1LEZA 3R9RA 4KABA 4DFYA 1UWHA 2Z7QA 2C47A 5DRDA 3UNZA 1Q8TA 2KTYA 5EDQA 2PZRA 3BBWA 2VO3A 5LVNA 5GHVA 1VYZA 2VUWA 3QRKA 1PXMA 4FNZA 5FM2A 1URWA 3GQLA 2XCKA 2O3PA 4IAIA 4X3FB 3RKBA 4YHFA 4I23A 3ATTA 3GU5A 2XK7A 3JVSA 4HCVA 3AOXA 4MXXA 5AR2A 4R7BA 5IQIA 1SM2A 2HOGA 4KD1A 1I09A 5EHOA 3Q53A 4M8TA 3EL7A 3MJ2A 4LUDA 5K4IA 2WQBA 2QOFA 3VBVA 5IA3A 4MKCA 4YLKA 4A9RA 2VX3A 2YM7A 3KRLA 4TXCA 3BX5A 4NCTC 5DT3A 2LGCA 2PWLA 1G5SA 2YDJA 4XG7A 5GNKA 4ZXTA 5HO6A 5BVKA 1MUOA 1OIYA 2E9VA 3SXRA 4X2KA 5DIAA 4CFVA 3LMHA 3ANQA 3VJNA 5EYKA 4BKYA 2VNYA 4L7FA 5E91A 1JAMA 4H1JA 3E92A 4GVAA 2OIBA 3TI1A 3TUBA 3BGZA 4O91A 5IUHA 4GV1A 4U0IA 3QKLA 3MFRA 4B0GA 3EL8A 2XCHA 3NX8A 3CC6A 4OTIA 4O7YA 4BHNA 1ZMUA 3GVUA 3SQQA 3Q4TA 2BAJA 3I4BA 3QZFA 2XM8A 3BU3A 5DT4A 5EYMA 3HV6A 1YHVA 2R3GA 5EKOA 3ZZEA 5IG1A 2WMXA 3NNUA 5AP7A 3RK9A 4AWIA 2C68A 5AP1A 1T45A 2IVTA 4M13A 3TKIA 2PE1A 5LMKA 3TKHA 3GNIB 5ETFA 5B2KA 4TYEA 2IZTA 3DK6A 4L44A 4CGAA 4O22A 3QYWA 4W4XA 2HIWA 3ZLYA 3ZU7A 1J7LA 3G5DA 5D9HA 3HAVA 5M51A 4RIYA 5J87A 3OG7A 5LVMA 1DI8A 4R1YA 4FG9A 4RJ4A 4RVKA 4F9YA 4W9XA 5TE0A 5A4EA 3FBVA 3TG1A 3LJ2A 1ZYCA 5AR4A 4AE9A 3MPTA 4PPBA 4FX3A 2BILB 4ZTLA 2DUVA 3LJ1A 3BHUA 2C30A 4FIIA 5FUTA 3B2WA 2CKPA 4QO9A 2CNQA 2HELA 5C26A 4RX9A 4NTSA 4WBOA 4DF3A 4FKTA 2NRUA 4NW5A 4XP2A 4C4IA 3O0GA 4USEA 3ITZA 4DLIA 3R02A 3TNHA 3NDMA 1PXJA 3F82A 3ZZWA 3QHRA 2HZ0A 3MSSA 3R1SA 3EYHA 4G31A 4L53A 2R5TA 3AMAA 3OBGA 4NW6A 4I0SA 2XJ1A 3RCJA 4AW5A 4I6QA 3NCGA 2UZVA 3OS3A 3PA4A 3UO6A 5HO7A 5C01A 1UNLA 3E63A 3I60A 3KULA 2B55A 4ID7A 4R8QA 5LCJA 3EQHA 4DH1A 4F6WA 2XK8A 3F6XA 4OTFA 4PTGA 1NVRA 1XH4A 3LXNA 3O8TA 3GOPA 3OXZA 3POZA 3GCQA 4FSYA 2BRHA 4KA3A 3BE9A 2C5VA 3OVVA 4ZIMA 5IEXA 3EFKA 2XH5A 4I5CA 4L9IA 2ITNA 4TWPA 4DN5A 3RZFA 4ZAUA 2RG5A 2XZSA 3CKWA 4C2VA 4KSQA 3DBCA 5CNNA 2GHLA 2C69A 3BGPA 3OMVA 3QX4A 1JBPE 3UZPA 4IAFA 1YQJA 3W18A 5A4TA 3MPMA 3L8PA 3A4OX 3FXXA 1NXKA 4RBLA 3KEXA 4TWNA 2X39A 4HPTE 2JITA 3UP2A 2OI4X 3OROA 2B9IA 3CR0A 2BHHA 4PL4A 5DN3A 3Q4ZA 1V0PA 1ZAOA 4FNXA 5HBHA 5DVRA 1XH8A 1J1BA 3QZIA 5C1QB 1R78A 3NNXA 4CSVA 5AM6A 3IW5A 4J7BA 4ONAA 4CLJA 5G1XA 3QTZA 3HLLA 5ANGA 5AUTA 4FZ7A 2R0IA 1Q97A 4XRLA 2X6DA 2YWPA 1WBNA 5M4IA 5IH6A 4C57A 4DGOA 1F3MC 5F4NA 4F7SA 3CKXA 3JPVA 3GU8A 3OCTA 2C6TA 2OXXA 4QTEA 4FZ6A 2CKOA 3FYKX 4FL3A 4MBJA 2BDJA 2VU3A 3I6UA 2OK1A 3PP1A 2PHKA 3R00A 4F1TA 1OKZA 3CTHA 4YR8A 2YLFA 4FV8A 5C4KA 2CSNA 4EQUA 3QKMA 1JSUA 2C5OA 3WZEA 3HMOA 3U54A 3R2BA 2XVDA 3V5TA 1ZXEA 5EQYA 2G15A 2A4LA 4PNIA 1H07A 2VTLA 3WILA 3GC9A 1KV2A 2OF2A 2O63A 3CEKA 5J5SA 3RM7A 3UGCA 3OWLA 4AW2A 1PXOA 3F5UA 4J8MA 4OTDA 4Z16A 3VW8A 5IUGA 1J7IA 1OECA 4GH2A 1R0PA 2QQ7A 4F9AA 2J50A 4KAOA 2JDSA 3VBYA 4AA0A 1BMKA 4EOSA 3VRYA 4ZTNA 2P2IA 4OGRA 1CDKA 3KMMA 3VS7A 2PU8A 4U3ZA 4D0WA 5CSWA 2QODA 2JLDA 3DLZA 3O7LD 4YU2A 4RJ3A 5DG5A 2BMCA 2BR1A 1B6CB 4CYIA 4IDTA 3K54A 4YBJA 2B1PA 4C3RA 1J1CA 4MYGA 1ZYJA 4JLCA 4RFZA 3RCDA 3UVPA 3KXHA 4USDA 2QO7A 1ZOHA 2X8IA 3VUTA 4DGLC 4IB0A 4MCVA 5AP0A 5FEDA 2X6EA 4EH9A 4L52A 5LWNA 2BZKB 3PA5A 4EK6A 4RFYA 3OW3A 4O82A 1GY3A 4UWCA 3KREA 1FQ1B 4G3CA 4JIAA 2RKUA 3EJ1A 3DBDA 4GYIA 4QNYA 2X2LA 1ZOEA 3VS1A 4RLLA 2Z2WA 3OW4A 1IAHA 3SHEA 3PJ8A 4XG8A 4ZY5A 3SG8A 1W98A 3RJCA 2VTIA 4LQMA 3WI6A 4AGCA 4EUUA 3HX4A 1A06A 3DJ6A 3PZHA 3EYGA 4TYHA 3EFJA 3BWFA 4F0FA 3CTQA 1Y8YA 4N70A 1XKKA 1UU7A 1IEPA 4MWIA 4RIOA 4YZ9A 4YHJA 3VS6A 4HVSA 3C5IA 5GZ8A 4Z9LA 4BDIA 3ETAA 3ZDUA 3LCTA 4BCOA 3PFQA 1NY3A 4QQJA 2W06A 2F7ZE 1LUFA 5HE3A 2Q83A 4MXAA 2W5BA 1BUHA 4Q5EA 4Z7HA 1SZMA 3ZEWA 3EN7A 3ZM4A 2OO8X 3CJFA 2CPKE 4QP4A 5D7VA 5FQDC 4ANMA 4EKKA 3PYYA 3Q5ZA 2OFUA 4C35A 4M84A 3AC3A 4O0SA 5CQWA 4HPUE 4QOXA 4HJOA 4KBKA 3R7VA 4BDCA 3WIKA 5IA0A 4I5PA 5EHLA 2R0UA 5IQCA 3DLSA 3UODA 1Q3DA 1DAWA 4QTBA 4EZ3A 3TUDA 2X81A 4UYAA 2GS6A 3QC9A 4XG4A 2IPXA 2PZ5A 2R3JA 2UZLA 3LCSA 3W2CA 4JOAA 2JKOA 4GVJA 2WTDA 3ZSGA 4AXAA 4YTCA 5CANA 3I5ZA 3NVKI 4G9CA 4GUEA 4FTNA 3OT8A 3DKFA 2YIWA 2PMNX 2CKEA 4KB8A 5CAQA 2CN5A 4IB5A 4KWPA 2YA9A 4TTHB 5E9EA 5CSHA 3PWYA 1H1SA 1XO2B 4UXLA 1VJYA 5AUVA 2VWXA 3OCGA 4JX7A 4C2WA 3R7IA 4E8AA 3QTXA 4CV8A 4BC6A 3CGOA 2VTNA 5IMXA 4U43A 1Y6AA 4H36A 3D4QA 3JY0A 3DTCA 3TTJA 3DFAA 3OZ6A 4E5WA 3GXLA 4LL0A 4X3FA 4IZAA 2EVAA 1SYKA 2P2HA 2R64A 3IK3A 4RVTA 1QCFA 4AP7A 2PUNA 3SG9A 3FJQE 2IZSA 4AGWA 2RSVA 4DTKA 2R3HA 5L8JA 2IW8A 5LMBA 2X8EA 1Q24A 4RSSA 3VVHA 4FV7A 3KRRA 4HNIA 2FSTX 3ZM9A 2QNJA 2C3KA 4BIBA 1LR4A 4IX5A 3KRJA 4MQ2A 3E87A 4KNBA 3FI2A 4CT2A 1U54B 5E8YA 3RPVA 3P23A 5EM6A 3FUPA 4KKEA 3U9CA 4O2PA 4JXFA 4N57A 3ET7A 3LXLA 4BGGA 1WBOA 5FRIA 2PVYA 2VTSA 3HRCA 1KOBA 3QCXA 4TYGA 2R3QA 3HEGA 2BDFA 4ASZA 3LZBA 3QGYA 4FEQA 4D1ZA 4D9TA 2WOUA 4BL1A 4AS0A 4IANA 4N6ZA 2GNIA 2QOBA 1M2QA 4FTCA 2CCHA 4LOOA 4YJSA 3TXOA 5KMKA 3V3VA 4DFBA 1SNXA 4QMNA 3NYXA 1FVTA 2ZV7A 3COKA 3FI4A 2BKZA 4O7RA 4FZFB 4JJRA 3BEGA 2VNWA 3RK5A 1GJOA 4F1OA 5C8KA 5JN2A 2VN9A 2GNLA 5I5ZA 5IMEA 2Y4IC 3WZJA 2HCKA 4OTHA 4B8MA 3DQWA 3O23A 2GDOA 3AGMA 4DEDA 4ERWA 4CCBA 4DHFA 2ZMDA 4M68A 4D9UA 4QP8A 2JDTA 5L6PA 3NW6A 2IVUA 5I3OA 4EC8A 2WQNA 5J5TA 2DS1A 4AA5A 1ZY5A 4FL1A 3VULA 4LGGA 3COMA 4YTHA 4XBUA 3IPHA 5ITAA 5IQFA 3OT3A 2GHGA 4X6QC 4B99A 5B0XA 3FLSA 3QQGA 2QLUA 5AIRA 3R30A 5HNGA 5DH3A 1KE5A 3GT8A 4QQ5A 5IA4A 3QRIA 3D0EA 4FTIA 4BTKA 3ORLA 5CYIA 3NWWA 4QYYA 5TOZA 5KO1A 4LRJA 4FKSA 4AUAA 4O7ZA 4O0XA 4JDHA 3VW6A 2W17A 4KIPA 3P7AA 2JKQA 3AT4A 4XLVA 2XIRA 4O7LA 3IDCA 5EK7A 5LARA 2B0QA 4MWHA 4RA5A 4BDBA 1OL7A 2GU8A 4IB1A 4YLJA 4DG3E 4RIXA 3HRFA 2XS0A 1BI7A 4E6QA 5HG7A 4FSQA 5ANOA 3MH1A 4MXZA 4PTCA 4I93A 4BCHA 4BZOA 4PMPA 5IA1A 3FI8A 4F7JA 3DAEA 4F0GA 2P0CA 4G3EA 4G6OA 4IW0A 4JQEA 5DGZA 4ZEGA 3PRIA 1MRVA 5HORA 1W82A 1OL2A 2Z7RA 3A7JA 5JSMA 4D58A 3I6WA 1Q41A 3ZUTA 4BHZA 1ZZLA 4HVDA 3PSCA 4S32A 4CG9A 2UVYA 4J99A 3NRMA 2B52A 2VWZA 3EQCA 3NW7A 5HU9A 4BFMA 2H9VA 2I40A 3NS9A 5CU3A 3P9JA 3HA6A 4FV5A 5M53A 3P1AA 3TNPC 2O65A 3M11A 3ORZA 4AW0A 3DNEA 4M14A 3FC2A 4KIQA 2ETKA 2OKRA 2WMRA 2C6IA 1H0VA 4KKHA 4ANOA 3THBA 5L4QA 1FVVA 4EJNA 4CKIA 2GNHA 4AU8A 1SVEA 4HCUA 5AADA 1QPJA 3F61A 5LCKA 3UQCA 4EOQA 5J9YA 5ANEA 2ZM4A 5EI2A 5I0BA 3DZQA 1LEWA 2X7GA 4G1WA 2YZLA 2OICA 2UW0A 3D7ZA 3GC7A 4WSQA 4CZTA 5AA8A 2ZYBA 4R3RA 3ZDIA 3EOCA 1GZKA 1GZNA 3HP2A 3IW8A 4M66A 5KNJA 5E4HA 4RX5A 3REPA 1PF8A 1WBPA 3DKGA 3F88A 2HWPA 4IAZA 5HOAA 4PTEA 4YJUA 5E90A 3QZGA 1OGUA 2VX0A 4AZEA 4CNHA 3I81A 4BGQA 4MXCA 3E8EA 1CMKE 3TWJA 2E9NA 2GQSA 3TTIA 1JKSA 2XNBA 2BUJA 4TY1A 1BKXA 3CD8A 5HCYA 3ZO2A 4YTFA 3QUPA 4QMXA 3VS4A 4O0WA 4QMLA 2WTWA 4EH3A 2H6DA 1PRYA 2IZUA 1IG1A 2IZRA 2XEZA 2JIUA 5JZNA 3FZOA 1LP4A 3GGFA 2PK9A 1H1QA 3LQ5A 3VQUA 3MW1A 2R3PA 4WHZA 2BZHB 4MEDA 4ZLYA 3EHAA 3ZBXA 4RQVA 4CCUA 5HTIA 4WG4A 3FZSA 4AA4A 5GIPE 4YP8A 4QD6A 4RWKA 2LAVA 1TQPA 3KMWA 3OF0A 3TV7A 4FEXA 2OLCA 3C4ZA 1OIQA 3BYUA 3BWJA 5CEMA 3WARA 5HX8A 2GHMA 5ACKA 3VUHA 3F7ZA 4JQ7A 5TF9A 4IAAA 2XEYA 2BZIB 1YW2A 1P4FA 1P4OA 5AR3A 3V5PA 4G3DA 3O96A 4HGLA 4OTGA 4FSWA 5ANDA 3B8RA 5ETAA 4I4FA 3PY0A 1K3AA 2V55A 5JKGA 3PXKA 3R6XA 5HTCA 2QOOA 4RC3A 4EORA 1M7NA 2F2UA 3HGKA 1OITA 2BFYA 3JYAA 2J0LA 1OL5A 3BV2A 2F49A 4BBMA 4JS8A 5K5NA 3O8UA 1PJKA 2PVNA 2WNTA 4IM3A 4I6FA 5AX3A 4APCA 3DV3A 3FEGA 1V0OA 4ACDA 5A4QA 2WTIA 4RLKA 4QMWA 4P5ZA 4RPVA 3L9LA 4X2FA 3PIXA 4Y8DA 5GJDA 4EOMA 1JWHA 3LOKA 4RZWA 3KXZA 4D4SA 4O21A 5AEPA 3LFNA 4USFA 2ZMCA 1WBVA 5H8EA 2YJRA 1H08A 1PYXA 4JAIA 1A9UA 3U4UA 4HGSA 2WEVA 5A4CA 3FL5A 1YWRA 4JDJA 2W05A 4C38A 1PYEA 3UOKA 2ITOA 3TIZA 3OEZA 4PP7A 2XK3A 4FV2A 1GZOA 4FG7A 1UV5A 5I9VA 2UUEA 4FTTA 3PG1A 4NM3A 4FVRA 1M7QA 3FYJX 3R04A 3C1XA 3OHTA 4HYUA 3SOCA 2BFXA 5DWRA 3TACA 2Y4PA 1OL6A 4ZTSA 1UA2A 5DR6A 3NYNA 3TDVA 3C9WA 2WTJA 1BLXA 1WZYA 4YJQA 4A4OA 5HHWA 3I7CA 3EN4A 1ZMWA 4UMPA 4AAAA 2UZBA 4G9RA 4IH8A 3VS2A 1JOWB 4F9WA 2OG8A 4MF1A 3UOJA 5J1VA 3FLNC 2B9JA 4BDAA 4X0MA 3A2CA 3LCDA 4BDDA 4E93A 4BKJA 4QMOA 3BU6A 4MBLA 3E5AA 4NK9A 3LAUA 2BHEA 5BNJA 4ZS0A 5EDRA 4E6CA 4BB4A 2W0JA 2X7OA 3JR1A 3HUCA 3LCKA 3FMDA 2PUIA 1H25A 4ANLA 3HUBA 2PZYA 1ZOGA 3MY0A 4H3BA 3KN6A 3TJDA 3R28A 2FSOX 4CQEA 2BPMA 5CZHA 4IHPA 3F2AA 4FL2A 3MPAA 3BEAA 4U7ZA 3VUMA 4KINA 1YXTA 2YISA 5HO8A 1HCKA 3E62A 2XNNA 3ZYAA 4CMOA 4MK0A 1STCE 2NP8A 3RM6A 4AZSA 3ORTA 1ERKA 4EI4A 4HNFA 3N9XA 1YHWA 3ZLXA 4ACMA 2JAVA 1YOLA 2VTMA 2XIXA 4E1ZA 2XIZA 1U54A 4DH7A 3ODZX 5AP3A 4I0RA 4RRVA 4WKQA 5AMNA 4PQNA 5AA9A 5KMOA 3DAKA 4U6RA 2FA2A 4UMTA 4BF2A 3QD4A 3R1NA 1W7HA 2Y8OA 2XJ0A 4PF4A 1X8BA 4O6LA 3MJ1A 4WUAA 2XK6A 5DI1A 5EM5A 4ZZMA 3ZUVA 2PZIA 2R3IA 3F2NA 1E1XA 4OR5A 3CE3A 3I0QA 4FKOA 1O9UA 4UN0C 3JY9A 3PE2A 5BPYA 3QCQA 5AUYA 3P78A 1YXVA 3TNQB 5CSXA 3QD3A 3PLAE 3BGQA 3BHVA 2YM3A 2C6OA 4K18A 2G2FA 3I79A 4CRSA 3EQPA 2VTJA 4IVCA 1S9IA 2CN8A 4WRGA 3UP7A 3O7LB 4R3PA 5M4FA 5M08A 5CAVA 4FIEA 3A8XA 2UZWE 4DA5A 3QL8A 4ZLZA 2SRCA 4ARKA 3EQFA 4J52A 4ZTQA 5DNRA 3RALA 2HXQA 2HZ4A 3BLRA 2YCSA 3FMKA 3IKAA 4JG6A 4YBKA 1GNGA 2R3OA 4UXQA 3NUXA 4OTRA 3W2SA 3UTOA 3VUDA 1G8AA 1FMOE 4QP1A 3P0MA 4EL9A 5BQ0A 4XH6A 4ALWA 4ZJIA 3CLYA 3NCZA 4EEVA 5JFXA 4GK2A 5CEIA 3UG2A 5F9EA 1B39A 5FTQA 2HAKA 2GSFA 4JRNA 2WOTA 3FZRA 3GB2A 3Q96A 4FNYA 3NNVA 4FV6A 3R7UA 3QBNA 3FHIA 3MH2A 2A19B 2CDZA 5E1SA 3R73A 2J6MA 2ITTA 2CNUA 1XWSA 2QO9A 2W96B 3E8NA 5HI2A 2XNEA 4NWMA 4E3CA 4J97A 2GMXA 4E4LA 3PWDA 2WU7A 2XNOA 3G90X 3KK9A 4GU9A 2QHNA 3ORXA 1R0EA 3BQCA 4KIKB 3E8DA 4JDIA 3H30A 4ANQA 1U4DA 3TV4A 2C1BA 4II5A 5IDPA 2J0MB 4UB7A 2XKDA 3G33A 4ZSAA 3QLFA 4O6EA 3WF7A 3ZLWA 4D4VA 5IEVA 4XCUA 3FSFA 3M42A 2R3NA 5AR7A 5A54A 4DCAA 2JDOA 2B9FA 3O2MA 3D14A 3DK7A 3BPRA 4IWQA 4TZRA 2EB3A 3Q9YA 3R8PA 5BVOA 4JIKA 1M2PA 1PXPA 3AC8A 3QXOA 5AV2A 3PXZA 5HIEA 4PNKA 4CFMA 3EN5A 4YPSA 3KXNA 3I5NA 3RAKA 4LUEA 3LFDA 1TKIA 3VBQA 4FEUA 4OAUC 3KF4A 3W2QA 1Y91A 4RA4A 4YURA 2X2MA 4D0XA 1CSNA 2FSMX 4IX3A 1CKIA 3BV3A 2XBJA 3H9FA 4QMQA 4DBXA 5M57A 3MVLA 4JBOA 4TRLA 3BYOA 2YIXA 2W1DA 4K2RA 3HMPA 3SRVB 3ZSHA 3AT3A 1Q99A 2I0VA 2YITA 4RMZA 3QRJA 4GL9A 4K11A 4F1MA 1F5QA 4FUXA 1E9HA 3VBXA 1WVYA 1MQ4A 4MAOA 3R8MA 2O5KA 2PPQA 4FT5A 4FEWA 1YHSA 2PUUA 2ITWA 5KBQA 4XG6A 2WIHA 4CKRA 3FL4A 5IPJA 2R3KA 3R2YA 3A7IA 4QYFA 4R77A 3CJGA 4O7NA 4QMMA 4YZDA 3IONA 1J91A 1M2RA 3E3BX 4A4LA 4EKLA 4ZTMA 2NNWB 5CI6A 2RFNA 5LMKC 2GFCA 2UW3A 3PPZA 2W1IA 1Z5MA 2WTVA 5HE0A 3K2LA 5ACBC 3FMEA 3ZHPC 2QOHA 2WGJA 5KMLA 2J51A 5C8MA 3VNTA 5E8TA 4TL0A 2QONA 3FWQA 1OPLA 3BHTA 3R63A 4TW9A 5L2QA 3ROCA 3ZRLA 4EWHA 4K77A 3TDWA 3T3UA 2BROA 3HP5A 4CFUA 3MVMA 3MFTA 1VEBA 3II5A 4D2TA 4FTKA 4M67A 3QQUA 4XP3A 5KCVA 3P7CA 1PHKA 3SOAA 2PE2A 4PL5A 4D2RA 3G9NA 4OT6A 2YERA 4S31A 4EZ5A 3P7BA 4L8MA 3V6RA 3U55A 3UE4A 5EI6A 4GKIA 1QPCA 2X8DA 2OXYA 3BCEA 3RMFA 4R7IA 3FLZA 4Y5QA 1XJDA 3PG3A 2YDKA 4YGAA 3RVGA 3D5VA 2AUHA 3N4UA 3OUNB 3PDTA 3IW4A 1WCCA 1DI9A 3RP9A 3P86A 4G3GA 4F0IA 3VHKA 2V7OA 1Q8YA 2F7XE 4FOBA 4LGDA 3WZDA 3G15A 3NZ0A 5E8SA 4A4XA 3E7VA 4LM5A 5K0KA 3VF9A 5J7BA 5IQHA 5JMSA 2VTHA 3KVXA 2XK9A 3FKOA 2HW7A 3RAWA 5CEPA 4ASDA 4QP7A 1SNUA 3UOLA 4QRCA 4ZTRA 2C3JA 4C4JA 2NPQA 4E20A 4QP9A 4FTMA 2UZDA 1OKVA 2RGPA 4XLIA 4XHKB 4FTAA 5EW9A 4JAJA 5JFVA 3AQVA 2OJ9A 4QPMA 4NTTA 3RWPA 3P4KA 4C58A 5KMJA 3HNGA 4S2ZA 2VWWA 2C0TA 2JGZA 3A4PA 3KGAA 2H34A 4BI2A 4DFZE 4TN6A 5FDPA 5HNIX 2W1EA 3MB7A 4EOIA 4O84A 1QL6A 2OJFE 3QFVA 4C3FA 3PSDA 4IJPA 4EOPA 4RT7A 4CFFA 1PXLA 4CT1A 3QAME 3TL8A 4C62A 2W1ZA 2ZAZA 1K9AA 2OSCA 4K8AA 2WPAA 4I6HA 4FGBA 4UYNA 5CSVA 3R9NA 3R9OA 1ZRZA 4ANBA 2V7AA 5AP6A 3V5LA 5I9ZA 4NFNA 3WF6A 2OXDA 4LG4A 1NVQA 2YIYA 4AACA 4JR7A 5AUUA 1U5QA 2JIVA 2XA4A 4FV9A 4IDVA 4IEBA 1OL1A 4O86A 3F5GA 3CQEA 3RINA 3TEIA 4FV3A 4CV9A 4EK8A 1YOJA 4WG3A 4L42A 4KS8A 5CY3A 5IKWA 4GCJA 3I7BA 5E8ZA 5TO8A 1RQQA 4JR3A 4Z7GA 4RQKA 1ATPE 3OOGA 1CTPE 1BX6A 3IQ7A 4GEOA 4MBIA 1H01A 2CGWA 4EQCA 2OIDA 3RPOA 4EH7A 4FT3A 4U79A 5M56A 3C4WA 5EM8A 4CEGA 5FXQA 3A7HA 4FKJA 4BR3A 5KKRB 3V8WA 4W4YA 5CAUA 3PPKA 1HCLA 2PZPA 5FBNC 2ONLA 4JI9A 4WT6A 3VWAA 5BVNA 4BY9E 2GNJA 4IADA 4YZCA 4BBFA 5A6OA 2XK4A 2CLQA 2E9OA 4MF0A 4TT7A 2FB8A 3R21A 4W9WA 4F64A 5CVHA 1UNGA 5EDPA 4HYHA 4WSYA 3OWJA 3W33A 3W16A 2QURA 3F3ZA 2UZEA 4FKLA 4O0VA 1YWVA 3ZO1A 3KC3A 2F9GA 3C4FA 3Q6UA 4Y83A 3IGOA 4QP3A 2CNVA 2BRMA 4NEUA 2P33A 2WO6A 5HQ0A 2WTKB 2WIPA 3QKKA 4UEUA 2XIKA 3JS2A 3OC1A 4G16A 2JKMA 3UBDA 4AFEA 4WA9A 4HCTA 4P90A 3H3CA 3TNWA 5D1JA 3TT0A 4YTIA 3S4QA 5JGDA 4IE9A 1FGKA 5BMMA 3KXMA 2ONLC 4O0TA 3PJCA 3MGYA 5HVYA 2XKCA 5F20A 1MRYA 4QMVA 5EM7A 3PUPA 3WF9A 2YJSA 4F6UA 3EB0A 3S95A 2RFDA 4F65A 3EQGA 2NRYA 2UZOA 2P3GX 3D83A 4WUNA 4RIWB 3DY7A 3QTUA 4NKAA 1OPKA 4F7LA 3RHXA 4YC6A 4LYNA 3CP9A 3FMLA 1H1RA 3GCSA 3GUBA 4K1BA 1JVPP 2C0OA 2XUUA 3SC1A 3GOKA 2YCFA 3DBFA 3QQJA 4WRSA 3EIDA 4DH8A 2QU6A 4ZSLA 2XKEA 4BTFA 3ANRA 4JX3A 5HBEA 2BTSA 3QU0A 2X7FA 1H8FA 1Q8WA 4O2ZA 5B2LA 4DE4A 3PPJA 5AR8A 3ZBFA 3GEQA 4FSMA 2PSQA 4NU1A 4CMTA 3FPMA 3Q4CA 3PVGA 2ZDUA 5AP2A 4J1RA 3WF5A 3OXIA 4E7WA 1H1PA 4IZ7A 1I44A 3EKKA 4FTQA 2OWBA 1KWPA 2ITQA 2QR7A 4EQMA 3KQ7A 2GFSA 5DEWA 4EK4A 3LFEA 3PIYA 4FT9A 3ORKA 4GFGA 1T46A 4F09A 3LMGA 4QYGA 3A60A 5AWMA 3W2RA 4ZZOA 2G01A 4WIHA 4IBMA 3TIYA 2G1TA 2YABA 5HCXA 5CASA 1KE7A 3SW7A 4LL5A 5HG8A 3QA0A 2ZOQA 3EKNA 2ZV8A 1AD5A 3Q6WA 4FOCA 3IGGA 4Q9ZA 3PLSA 2C6MA 3EQRA 3RZBA 4AGDA 1YI3A 5CEOA 4X3FC 1GIJA 3DKCA 4L00A 2VTAA 2J4ZA 2Y6MA 3DAJA 3Q9ZA 4KKGA 4C34A 5A14A 5A9UA 5BUIA 5E7RA 4DGNA 2ZDTA 3HV7A 2BRNA 2I0EA 3S1HA 4YPDA 1OKYA 5HNBA 5M55A 2XKFA 3SV0A 4FBXA 4IX6A 3AC4A 3DT1A 5FWKK 4UALA 5E8VA 3R8ZA 3KY2A 3SX9A 5M4CA 5HLPA 3OXTA 2XP2A 3AC1A 2F7EE 3C0GA 2PY3A 4CFXA 3QD0A 3V8TA 3Q5IA 4D2PA 4GUBA 4DH5A 3K3IA 2JDVA 4FK3A 3QZHA 3KFAA 2QVSE 3ACKA 4PPCA 5EG3A 3SRVA 3NAXA 4WO5A 2EXCX 2WMWA 4IWPA 5J1WA 1UVRA 1G8SA 3LQ8A 4H05A 5HLWA 4XUFA 5L2IA 4QMTA 2R3MA 4FKQA 4PX6A 4XV1A 3S2PA 4KBAA 3MTFA 2QCSA 1HOWA 2OH0E 3D15A 3FAAA 3DB8A 3F3TA 5KMIA 1KOAA 2VV9A 3LXKA 4EH8A 4Q5HA 2QG5A 4K0YA 3VBTA 1WBWA 4LFIA 3A99A 3BLQA 3BYVA 5AJQA 3FPQA 4D4YA 4YUQA 4FSUA 2R9SA 4LV8A 3D5WA 5BVDA 5GINE 3DDPA 5CF5A 4G3FA 3R1YA 2QLQA 4NM0A 3F2RA 4FI1A 3A62A 3ORMA 1DAYA 4S33A 1PW2A 4BDGA 1YXUA 1R39A 4NKSA 5FTGA 5JQ5A 4W4VA 2VTPA 4ACHA 2R7BA 3A61A 3HA8A 4JBPA 1VR2A 5CQUA 4G5JA 3DA6A 4IWDA 4MH7A 2WZJA 2PVLA 4ERKA 5JEBA 4DEBA 4OT5A 2ZM3A 4R5YA 4O96A 1JSTA 2R2PA 3BRBA 2QOLA 3P79A 3DDQA 4XV9A 1O6LA 3G0EA 1WVXA 4H58A 5CF4A 5L2SA 4IACA 5GZ9A 4ACGA 3LLAA 4FV0A 4UX9A 3EZRA 2JD5A 2GQRA 4EWQA 4L68A 1U5RA 2OJJA 3LFCA 1ZZ2A 2X1NA 4GSBA 3R7EA 1TQIA 3LM5A 4PP9A 5E8WA 2YWVA 4FTRA 1XH6A 1UKIA 3UNKA 2ITPA 3NUSA 3UG1A 3NUAA 2E9UA 2UW4A 5EOLA 3DBQA 2V22A 3DNDA 2RFSA 5HE1A 3ID6C 2FSLX 4V0GB 3GFWA 3ZC6A 4MX9A 2YCQA 4AT4A 4F63A 3PRFA 3ULZA 4C61A 2QR8A 2RL5A 5HIBA 1WBTA 2C1AA 2O64A 5CEQA 4YC3A 4AN9A 4QMSA 5I3RA 4ZMEA 3QQHA 5J8IA 4D28A 3MYGA 3DK3A 4YJRA 3T8OA 5HTBA 2QD9A 3CPBA 2WXVA 3IW7A 3SAYA 4AW1A 3QCYA 4G5PA 3PZEA 3ZH8A 4BDEA 3ORIA 4QQTA 5CU0A 2BCJA 2OH4A 1EH4A 4DCEA 5AUZA 4BCIA 2OJGA 3CGFA 4D5KA 3TCPA 1FOTA 3NNWA 4RIYB 4NUSA 4JG8A 3BU5A 3IS5A 5AUXA 4O83A 3OP5A 3U87A 4U44A 3PVUA 2CKQA 5AUWA 3BELA 5KBRA 3Q3BA 5D41A 3L1SA 3CCNA 4UWYA 4Y73A 3AT2A 5HVJA 4E6AA 3P5KA 4I94A 4F08A 2ZJWA 3F3UA 2JC6A 3LM0A 4GJ2A 4R7HA 5FLFA 4YZNA 5C9CA 3UNJA 2OW3A 1Q8UA 2PVHA 4EOOA 2XYNA 5M07A 1H1WA 1OB3A 4N6YA 2YAAA 3B8QA 5DMZA 5HBJA 3NAYA 4MXYA 4ZP5A 5HGIA 4PDOA 1QPDA 4IAYA 4LRKA 4L43A 4NZWB 3GU7A 4GK3A 5E8UA 3DXPA 4FTJA 3MFSA 5CENA 4DH3A 4H3PA 3WZKA 3C0HA 2PMIA 4Y85A 2JBPA 4O7VA 4IC7A 3TJCA 5C03A 2J7TA 3TZ7A 2NO3A 3EN9A 4IX4A 5LQFA 4W4WA 5HCZA 3JXWA 4IWOA 3HAMA 2W1CA 4Q2AA 3HZTA 1O6KA 4U41A 3QHWA 2J2IB 2Q0NA 3KL8A 2YM4A 4I24A 1JKLA 2XYUA 4YJOA 1ZYDA 2G2IA 2XJ2A 5BUEA 2QO2A 3G9LX 2RG6A 4L01A 3NIEA 3M1SA 4DYMA 2CCIA 2PYWA 4TNDA 5EYCA 1NA7A 3R7YA 1PY5A 4XS2A 4APPA 3NYOA 3RBWA 3RNIA 4NJ3A 5C4LA 5HESA 3UPXA 1JLUE 4S34A 3VN9A 4AX8A 4EYMA 4IZYA 3BKBA 4RFMA 2UVZA 2WMQA 2OZOA 3QF9A 3LJ0A 4YZMA 2GNFA 3NIZA 3QRUA 4U81A 4QYEA 4CMUA 4GG5A 3KU2A 4CZUA 4QNAA 4WNPA 4ALUA 2GCDA 3TZ8A 3O8PA 4L3PA 4S30A 4X2GA 3C50A 5E8XA 5IQBA 1SVHA 3OWPA 5DPVA 5ETCA 5AM7A 2OU7A 3GI3A 3E88A 2PVJA 4WNOA 5AFVA 3R1QA 3BIZA 2VTQA 2R3FA 4FVPA 5LVLA 4DFXE 1FVRA 4IIRA 4MQ1A 3OUKA 5IQAA 4ITIA 3ZONA 3SD0A 2WMBA 4AOIA 1YRPA 3G6GA 3RNYA 4NM7A 4ZSGA 2CJMA 4BGHA 3DCVA 4GIIA 2YN8A 3NUPA 4L67A 2BALA 2W1FA 2C3LA 3R01A 4HGEA 2PUPA 1JNKA 2OFVA 3D94A 4BCKA 4YSJA 4AFJA 4KIOA 3E93A 3NW5A 4IQ6A 2X0GA 3BYSA 5JH6A 3DGKA 3DJ7A 4TKSA 3F66A 4Q9SA 3L8VA 5HZNA 4D55A 3NUUA 4J53A 1M14A 1R3CA 1ZWSA 2YEXA 3R7GA 4RIWA 3ORNA 4M69B 4I6BA 3NLBA 5TT7A 4FE2A 3G2FA 3MV5A 1P2AA 2H96A 3AGLA 4PY1A 1RJBA 3HECA 3ZXZA 4G17A 1ZY4A 2ZM1A 4QTDA 4AGUA 4FKRA 4R5SA 2VGPA 3PE1A 4OBPA 4CXAA 4JT3A 4HVGA 3F7WA 4TNBA 2BKKA 2WTCA 5FEQA 5JT2A 4X2NA 2ITUA 3GP0A 4UBAA 5FBOA 4E5BA 3LIJA 4RWLA 3V01A 1ZYLA 3GCPA 4F4PA 4DT8A 4XJ0A 3H10A 3F69A 4RG0A 3QTQA 3UC4A 5D12A 3KVWA 2VRXA 3R22A 3OTUA 4FV1A 5CU2A 2IW9A 3VHEA 4ANNA 5DYJA 2QKWB 3AMBA 5FP5A 3LKMA 1JPAA 4MD9E 3H4JA 3R8UA 2EU9A 5EOBA 4J98A 2PL0A 3BI6A 3NUYA 4JBQA 3SKCA 4AF3A 4YJTA 4U3YA 4CTBA 5K0XA 4HZSA 4N4SA 5CT7A 4E4XA 3RTPA 3UQFA 4PDYA 5BVWA 2IG7A 2WMUA 1OBGA 4GU6A 5HLNA 2ESMA 2WU6A 1JSVA 2B53A 2CMWA 3EMGA 4KUJA 3ZFMA 4IC8A 1TVOA 3E3PA 2J5EA 4TYIA 4HZRA 4Z3VA 4NIFB 4RJ5A 3UZTA 5HIDA 4EOLA 3FE3A 3VJOA 3LE6A 4P2KA 4QMUA 4EK3A 5IF1A 4E4MA 2Z8CA 3L9PA 3AXWA 2Y7JA 1YKRA 3GC8A 4BYJA 2B9HA 1PMNA 3SGCA 2PVMA 3Q52A 1IA9A 4I41A 3ROYA 1WAKA 3OCBA 2A2AA 4LMNA 1A48A 4G34A 4I21A 4DAWA 4UV0A 3W55A 1E1VA 4EC9A 2AC3A 5DHJA 5AV3A 3LMIA 4R78A 1YVJA 4JL9A 4C8BA 5L8LA 3QRTA 4FUYA 3C13A 4EH4A 5KUPA 4FMQA 4GFMA 3UIMA 2JBOA 2YACA 1U46A 3W8LA 3H9RA 4BDKA 3ZS5A 4BI1A 1APME 2G9XA 4TYJA 5IA5A 4PMTA 4U45A 4IM2A 5IUIA 3GCVA 5CSPA 3PJ2A 4YJPA 2KULA 4HVHA 4NM5A 3CXWA 3FQSA 3L9NA 3UPZA 4I20A 3DQXA 2I6LA 4NT4A 3ZFYA 4MVFA 5CVFA 3ATSA 1Q4LA 3MIYA 4ZS4A 2R7IA 5LWMA 5JQ8A 2OGVA 3CIKA 4AOJA 3RWQA 5FM3A 4K6ZA 5CU6A 4RC2A 2JAMA 2QOQA 5HG5A 4AG8A 1L8TA 2QKRA 2V62A 4QPAA 3UYSA 4NCTA 1Q5KA 4TWOA 4ALVA 3LXPA 3HDMA 4QP2A 5IU2A 4AT3A 1G3NA 3RK7A 4M97A 1Y57A 1ZLTA 2JDRA 2DQ7X 5J9LA 3U6HA 4LGHA 5FD2A 2JFLA 1IRKA 5DT0A 3IW6A 3JVRA 2AC5A 4EUTA 4IFCA 4UZDA 4ENYA 2C6DA 1PMUA 2UW8A 2YM8A 3MFUA 5AR5A 4O7TA 1Q3WA 5CF6A 3QQKA 3ZSIA 4O0UA 3R8VA 2I7QA 1WVWA 3F5XA 3LPBA 1XH9A 3Q2MA 4IJ9A 4BCQA 3O50A 3EFWA 5BVEA 5CXZA 2ETMA 4OTWA 4L7SA 2GS7A 3GFEA 2F4JA 4FKUA 4FTLA 2VWUA 3ZLSA 2QOIA 1PMEA 2R3RA 3IDPA 1GIHA 4OBQA 3FLYA 2B54A 1M52A 2VTRA 2Y4IB 4O1OA 2IVSA 4RWIA 3AD4A 4EHVA 3QYZA 4BWKA 1RDQE 5KHWA 1SVGA 3VIDA 1TQMA 2V0DA 3L8SA 3Q32A 3GU6A 4O0YA 4X7QA 4E73A 1IASA 4FSZA 3CY2A 2CLXA 4U42A 3RPYA 1O6YA 3OCSA 4ZK5A 3MWUA 3ULIA 3EH9A 4C33A 5GJFA 3OOMA 4I4EA 4V0GA 4XX9A 3HMIA 3PTGA 4MTAA 4X2JA 3DU8A 3COIA 4BWPA 4JNWA 3Q9WA 3I1AA 1Q61A 4FK6A 2EB2A 5IQEA 3RPSA 5KZIA 3LQ3A 3NVMB 2F57A 4M7IA 4LMUA 4CVAA 3BE2A 4YHTA 4YJNA 1P5EA 2PVFA 3A8WA 3EQBA 1YXSA 1UWJA 4XNEA 3LFSA 3ZMMA 3TM0A 1XH5A 2EWAA 3PSBA 2QHMA 3NYVA 3QD2B 1UU3A 2EXMA 1SMHA 1ND4A 5IQGA 5K4JA 3B2TA 3OTVA 4RGJA 2VAGA 3KKVA 4BZNA 4C3PA 5B7VA 3C0IA 3CQWA 2WMSA 3C7QA 5KX8A 3TV6A 3QC4A 4QTAA 1URCA 3MESA 2UZNA 5CTPA 2WQMA 2WMVA 1WBSA 2HY81 1NT2A 1W8CA 2BDWA 5LMAA 3FZPA 3S3IA 1LPUA 1KE6A 2E9PA 4DFLA 3N4VA 4BTMA 2Z7LA 4QYHA 4IZ5A 3CPCA 3PP0A 3FMHA 4FSNA 5H8GA 2PVKA 2OJIA 2HYYA 2RFEA 3W32A 3F3WA 5AIKA 1MP8A 3F3VA 2C6KA 5H8BA 3DFCB 4IMYA 4L3LA 4EOJA 4O0RA 3R8LA 3VQHA 3AD6A 2VZ6A 1PMVA 2C4GA 2X4FA 4RIXB 2QI8A 4V05A 5DBXA 3WOWA 3ZCLA 1BYGA 5IISA 3FY0A 2HXLA 2YFXA 2HY0A 1YWNA 3V51A 1H27A 2UV2A 3V04A 2IJMA 3WYXA 1AQ1A 4XV3A 5KE0A 4M12A 3PIZA 1Y6BA 2GS2A 4R1VA 4IXPA 1BL7A 2V5QA 3IG7A 4FODA 2JKKA 1UU9A 4G6LA 3ZTXA 5EI8A 2GQGA 2CHLA 4I22A 4U40A 3D9VA 3V6SA 4GIHA 3G51A 2CGXA 4ANSA 1MQBA 4FGRA 3QWKA 2IN6A 4E26A 1BL6A 1XBCA 5KHXA 2WB8A 5IZFA 4B7TA 4EBVA 5IH4A 4GT5A 5E1EA 5IA2A 1U59A 3SVVA 2HZNA 5AAEA 3KRWA 4A7CA 3TKUA 2C6LA 3LCOA 4D1XA 5EKNA 1OI9A 1OPJA 5L3AA 4EYJA 2BAQA 2IW6A 3EQIA 4IVBA 3HMMA 4LRMA 2R4BA 4ZY4A 3C4EA 3SW4A 4EOKA 4BCGA 4NH1A 3ALOA 4RC4A 5D11A 2W5AA 3DXNA 3K5UA 2XNGA 5CNOA 5AAFA 3HVCA 4M0YA 4DC2A 2DYLA 4RJ7A 3BLHA 4FYOA 3GQIA 5CF8A 3U51A 2P4IA 4HGTA 1ZYSA 3FY2A 3V5WA 4HVIA 3D7TB 4JVGA 5KMNA 1FPUA 3EWHA 3MI9A 1YI6A 3NPCA 5H9BA 3SA0A 1PXKA 5AP5A 4X3JA 3WBLA 3WYYA 3DB6A 5C8NA 1FINA 3FQEA 4FSTA 5K5XA 4YLLA 4M69A 3DOGA 3VAPA 4GW8A 4EK5A 5LVPA 4ZTHA 3VF8A 4KS7A 4O7WA 3ACJA 2YIQA 3ZO4A 4ITHA 3S0OA 2R3LA 3KXGA 4IFGA 4PWNA 1XBBA 3MBLA 2WMTA 3IDBA 4PRJA 3ZOSA 3QA8A 5M4UA 3WZUA 4A9SA 1M17A 3FMNA 3W10A 4QQCA 4RWJA 3MH3A 4OLIA 5BUJA 2OBJA 1CKPA 1PXNA 4EH2A 2YM5A 3LFQA 3CTJA 3QUEA 4UMUA 3PJ1A 2PE0A 5BVFA 5I9WA 5JFWA 2X2KA 3MY5A 2PMLX 4I3ZA 2PMOX 4I5HA 3RHKA 5EQPA 4CRLA 3R9DA 4YNEA 5M44A 4YO4A 1WMKA 4OAVB 5ETIA 2JFMA 5DFPA 3QQLA 2REIA 3CD3A 4FR4A 2XB7A 2Z7SA 5K3YA 5TKDA 4CTCA 3ENHA 1P14A 2ZB1A 2E2BA 2B7AA 2ZV9A 3GBZA 4O1PA 4YNOA 3SXSA 4J71A 3R9HA 1GAGA 3CS9A 3RI1A 5DOSA 4DEHA 3LFAA 2ERKA 4BCFA 4EH6A 1Z57A 3IECA 3E64A 1Z9XA 3HMNA 4IB3A 2VWBA 3RAHA 1NW1A 5CT0A 5CEKA 4HYIA 3E8CA 4LOQA 5F95A 4NIFA 1S9JA 2ETRA 4GJ3A 4HYSA 4BCJA 3D5UA 5LXMA 3TZMA 3QCSA 4EONA 4U9AA 3L9MA 3LVPA 4KRDA 4NSTA 4NFMA 4O38A 3WE8A 5LJJA 3FZ1A 4TPTA 4H39A 3KK8A 4C0TA 4ZMFA 4BKZA 5K9IA 3DBEA 4OBOA 4A07A 4A9TA 4EZ7A 4ASEA 5EHYA 4I92A 3C51A 5DE2A 3PY3A 4BICA 2BIKB 2HWOA 5L6OA 4PUZA 4ZZNA 5AV0A 2XNPA 5LOHA 3UQGA 4U8ZA 4PDPA 4XBRA 4PDSA 5T3QA 1OIUA 3GU4A 4L6QA 4AZVA 1R1WA 3HV3A 1OUYA 4YJVA 5HG9A 3OWKA 3W8QA 4Z55A 2BZJA 5F1ZA 3AG9A 1YI4A 3FMMA 4AZTA 2O2UA 1IA8A 3PVBA 3U6JA 3SXFA 1XR1A 3ZUUA 4MHAA 4FKIA 3V5QA 4YC8A 4PV0A 1OIRA 4RZVA 4DFUA 2YIRA 4FKPA 4CLIA 5A6NA 3NMUF 4FTUA 1RW8A 2EUFB 4GG7A 3W2OA 3FQHA 3NSZA 5EW3A 2XNMA 2WD1A 4ZSJA 4OTPA 5A46A 3E7OA 4FVQA 4DITA 5HD4A 5JK3A 4FIGA 4JBVA 4DGMA 2WFYA 2PTKA 3PVWA 2RIOA 4UMQA 4D2SA 4KIKA 2BIYA 2OZAB 2I1MA 4RX8A 5IH5A 4BWXA 4I1ZA 2Z02A 5HKMA 4BYIA 3HL7A 1OUKA 5ANJA 4AE6A 4AOTA 2ZV2A 3DPKA 2WQEA 4WG5A 4F70A 2VO6A 3NEWA 1H00A 2C5XA 4MD8E 2VO7A 1JKTA 4W8EA 4M0ZA 4V01A 3K3JA 3QALE 4AN2A 3QTSA 1V0BA 5H2UA 5KMMA 2C5YA 4DTAA 1CKJA 5DA3A 3BHHA 3ORPA 2ITZA 3MDYA 5GJGA 1B38A 3N51A 1RE8A 2HZIA 3MB6A 4XG9A 5L2WA 3HDNA 2QG7A 2P55A 2I0YA 3T3VA 5JGAA 5CZIA 4E4NA 4ZY6A 4MXOA 4WNMA 5CX9A 3KA0A 3LFBA 2O8YA 3JUHA 4FKVA 3PA3A 3WF8A 2H8HA 2JIIA 3QUDA 4FT0A 1J7UA 1WFCA 3ENMA 2GTNA 2JEDA 3POOA 3UDBA 1J3HA 2W4OA 4CZYB 1H0WA 2UW7A 3GENA 4LI5A 3ODYX 2Q0BA 4CFWA 4BTJA 2QOCA 3M2WA 4ZJVA 3FXZA 5AP4A 4BDJA 1ZARA 3VS5A 4QP6A 2YM6A 4J95A 3FMJA 1OBDA 2ITXA 4YZBA 1QPEA 4XP0A 5DR2A 4JQ8A 1MRUA 4FNWA 4CYJA 2J9MA 4G6NA 1V1KA 2ITVA 4QMZA 4B6LA 3CY3A 4G2FA 3G0FA 3IOPA 4FTOA 2HK5A 4FC0A 4RJ6A 4F99A 4LOPA 5GZAA 3KCFA 5L8KA 4P7EA 3W1FA 3HKOA 4MNEB 2WELA 4H1MA 4OTQA 3K5VA 4FIJA 5FDXA 1W0XC 3EZVA 4PPAA 3UJGA 4DEIA 1OZ1A 2UVXA 1IAJA 2VGOA 3KMUA 4FZDB 2IVVA 4IVAA 3UOHA 2VWIA 3FZTA 3HV5A 3VUIA 4O27B 5BYYA 3VS3A 3N4TA 2C3IB 2BRGA 4GT4A 3MN3A 4GRBA 4W8DA 3DJ5A 3PJ3A 5DLSA 4BCNA 4I5MA 5E92A 4CD0A 2ERZE 5FGKA 3EN6A 3PXRA 4L3JA 2UZTA 4JRVA 5D7AA 5T6KA 4ACCA 5HD7A 5CAOA 3BYMA 5I9YA 4X21A 3PXFA 5ICPA 3ERKA 4BIDA 4ZLOA 3H0YA 3CSVA 2ZVAA 4PMSA 3UIXA 3QTIA 3ZC5A 4AZWA 3D2IA 5FTOA 4GK4A 4V04A 4KSPA 3QQFA 3Q9XA 1YOMA 3OEFX 2XM9A 4FKWA 5AX9A 4HOKA 2FO0A 3QXPA 4C02A 3QX2A 3BHYA 4C4HA 1GOLA 1XHAA 3NUNA 4XOYA 3O71A 1QMZA 2X9FA 3A7GA 3MA6A 2ACXA 2C0IA 3CQUA 3FSKA 3OBJA 4IM0A 4C4EA 4CKJA 2VTOA 1OKWA 4R3CA 4FSRA 5EQEA 4QT1A 5DEYA 3VUKA 1PXIA 2FGIA 2O0UA 1H28A 3D2KA 5FEEA 4ITJA 5CWZA 5M09A 2XMYA 3Q04A 4XEYA 4DFNA 2J0IA 2WKMA 5CU4A 2IWIA 5H3QA 3OY3A 3ZXTA 4WOVA 4QMPA 4UMRA 2Y9QA 2W99B 3DTWA 4L45A 4U97A 3HV4A 2VO0A 4QPSA 4C37A 4D2WA 5HE2A 3VUGA 4XMOA 3LFFA 4C59A 4DTBA 2HENA 3QTWA 4OW8A 2GPHA 4UWBA 4RVLA 4N0SA 5IEYA 5CAPA 4GFOA 1REKA 4CQGA 5M06A 2A1AB 4C7TA 4D4RA 3SDJA 4JG7A 3FDNA 2QC6A 3UMXA 3VO3A 5IQDA 4NJDA 2PULA 2DWBA 1JKKA 5J95A 5AV1A 4FG8A 3BQRA 1L3RE 2IO6A 5A4LA 4XYFA 3FKNA 2XIYA 3AC2A 3ZEPA 4J96A 3RGFA 5JGBA 4O81A 2OF4A 2XRUA 5DR9A 4A9UA 3C4XA 2Y0AA 4M3QA 3D7TA 4FICA 2UZUE 4L46A 4XOZA 1DS5A 3TNIA 2QOKA 4BI0A 3DXQA 2WAJA 4IAKA 3SLSA 2WEIA 2YAKA 1H26A 2J0KA 3KULB 3UC3A 3MTLA 4BVUA 4PL3A 4XG3A 3UIUA 3GCUA 1UKHA 2W5HA 3WE4A 4DG0E 3MH0A 4A9YA 4YMJA 5CS6A 3TUCA 3ALNA 1KSWA 4F9BA 3UYTA 2GNGA 5ANKA 4FT7A 4EBWA 3KN5A 5J7HA 4FYNA 1F0QA 2GTMA 4U80A 4BCMA 4EHZA 2W9ZB 4GYGA 3WIGA 3R83A 5B2MA 5BMSA 3NGAA 4MNFA 1OM1A 3KRXA 5BYZA 4BBEA 2HW6A 4R6VA 4AZFA 4EJ7A 3FHRA 3T9TA 4ORKA 1K2PA 1Y8GA 3KB7A 5FP6A 3DS6A 3T9IA 3AMYA 4FZAB 5A3XA 5AAGA 3U9NA 5HVKA 4A06A 3Q2JA 4GKHA 4LV5A 2OIQA 4C4GA 2Z60A
chains in the Genus database with same CATH superfamily
2VTTA 4XRJA 5JRQA 2ITYA 1UNHA 3FXWA 3OFMA 1PKGA 4OUCA 3FLQA 4DLJA 4FIHA 4KBCA 3V5JA 3FI3A 3H0ZA 3U6IA 1GZ8A 4DHIB 4M15A 4D5HA 3MY1A 4BCPA 3IOKA 5J79A 4UY9A 4DINA 4E5AX 2X4ZA 3S00A 1GIIA 4BDHA 5I9XA 1OVEA 3KXXA 3MIAA 4RX7A 4ENXA 2UW9A 4H3QA 4K33A 5C27A 3ZO3A 4CG8A 2W1HA 4DEEA 4ASXA 2C5NA 2PVRA 4WBBB 5CXHA 4D1SA 1VZOA 4GS6A 5KKRC 1XQZA 2C6EA 3OD6X 4UZHA 5HEZA 4GT3A 4ZJJA 3VRZA 1KUTA 1KE8A 2I0HA 2J0JA 2UW5A 2F2CB 4FIFA 3QLGA 3FLWA 2YHVA 3LLTA 4XG2A 4BIEA 3OY1A 3FV8A 4EH5A 2XBAA 4B9DA 3VC4A 4K9YA 5BYLA 4FKGA 3KF7A 4WD5A 5D10A 4ZOGA 1VYWA 2VWYA 4RVMA 4RJ8A 3TN8A 5JFSA 4BN1A 4P5QA 3C5UA 5EH0A 3BZ3A 3V8SA 1OMWA 4DEAA 4TWCA 1FBNA 3H9OA 4QTCA 3HYHA 2WTKC 4IVDA 4AN3A 4MD7E 3AC5A 2XRWA 1NVSA 3NR9A 1UU8A 3LHJA 4FA2A 2J5FA 3UO5A 2RF9A 4O7SA 4P4CA 5CVGA 4FF8A 4NL0A 1W83A 2AYPA 5FXSA 4HW7A 4X6RA 2BRBA 3MS9A 4DGGA 4FV4A 1ZMVA 4DBNA 3U4WA 1G8KA 3IO7A 4WNKA 2YLEA 4E6DA 4DT9A 3D5XA 5F94A 3R71A 5JRSA 1Q8ZA 4DDGA 2W4JA 1XBAA 2G2HA 3QWJA 4LDTA 3BBTB 5I4NA 4BRXA 3VBWA 4C4FA 4EHEA 5CLPA 4Y95A 1KE9A 4Y5HA 2A27A 3O17A 3MVHA 5G6VA 2UW6A 3RAIA 2WQOA 4Y72A 3UZRA 1FMKA 3F9NA 5L6WL 3UVQA 5IDNA 3L8XA 5CI7A 3AD5A 3COHA 4C36A 5FG8A 4FEVA 3W2PA 3VS0A 4F7NA 2BAKA 4BDFA 4F9CA 3G6HA 2CGVA 1BI8A 1YDRE 2OZAA 3ELJA 1XH7A 2W7XA 3HRBA 4U5JA 4B4LA 3Q4UA 1PKDA 5EFQA 3PXQA 1JQHA 4XV2A 5J9ZA 3PXYA 3P08A 4BZDA 4CFNA 3ZRMA 4YSMA 2FVDA 4PMMA 4NYEA 3TZ9A 3R7OA 4TYHB 2VD5A 3EQDA 1REJA 3ZFXA 5JZJA 4ZSEA 5HICA 1FGIA 2BTRA 2QU5A 5EYDA 1H24A 5AV4A 1KV1A 5T68A 2YDIA 2FYSA 3KCKA 2FH9A 2CGUA 2WMAA 1W84A 1YXXA 2B4SB 4GMYA 5TR6A 3UIBA 3UVRA 5DRBA 4JMQA 1AGWA 2W1GA 1Q62A 2Y6OA 2W9FB 2VWVA 3O51A 3QTRA 3MVJA 5HX6A 2EXEA 3EFLA 3F5PA 3FKLA 3PY1A 4J8NA 5L2TA 3UMWA 3FC1X 1YDSE 2FUMA 3QGWA 4D2VA 5CALA 5EW8A 5KZ0A 2J90A 5HU3A 5ANIA 3Q60A 4I0TA 2BVAA 3R0TA 4EHGA 3LW0A 4B8LA 5GIOE 3DKOA 5I9UA 4DG2E 4DEGA 1CM8A 2W4KA 4QMYA 2YZAA 2ZB0A 1H4LA 2YCRA 3ZRKA 4AQCA 3U8WA 3GC0A 3C4CA 4Y46A 4JDKA 1DM2A 2A0CX 3CBLA 3A7FA 4YO6A 3DZOA 4F6SA 5BX0A 2XF0A 2WHBA 2X9EA 4KRCA 3UO4A 1YDTE 2VX1A 3I0OA 5FXRA 3MA3A 4MNEA 5LVOA 4AT5A 3RPRA 1IR3A 1LEZA 3R9RA 4KABA 4DFYA 1UWHA 2Z7QA 2C47A 5DRDA 3UNZA 1Q8TA 2KTYA 5EDQA 2PZRA 3BBWA 2VO3A 5LVNA 5GHVA 1VYZA 2VUWA 3QRKA 1PXMA 4FNZA 5FM2A 1URWA 3GQLA 2XCKA 2O3PA 4IAIA 4X3FB 3RKBA 4YHFA 4I23A 3ATTA 3GU5A 2XK7A 3JVSA 4HCVA 3AOXA 4MXXA 5AR2A 4R7BA 5IQIA 1SM2A 2HOGA 4KD1A 1I09A 5EHOA 3Q53A 4M8TA 3EL7A 3MJ2A 4LUDA 5K4IA 2WQBA 2QOFA 3VBVA 5IA3A 4MKCA 4YLKA 4A9RA 2VX3A 2YM7A 3KRLA 4TXCA 3BX5A 4NCTC 5DT3A 2LGCA 2PWLA 1G5SA 2YDJA 4XG7A 5GNKA 4ZXTA 5HO6A 5BVKA 1MUOA 1OIYA 2E9VA 3SXRA 4X2KA 5DIAA 4CFVA 3LMHA 3ANQA 3VJNA 5EYKA 4BKYA 2VNYA 4L7FA 5E91A 1JAMA 4H1JA 3E92A 4GVAA 2OIBA 3TI1A 3TUBA 3BGZA 4O91A 5IUHA 4GV1A 4U0IA 3QKLA 3MFRA 4B0GA 3EL8A 2XCHA 3NX8A 3CC6A 4OTIA 4O7YA 4BHNA 1ZMUA 3GVUA 3SQQA 3Q4TA 2BAJA 3I4BA 3QZFA 2XM8A 3BU3A 5DT4A 5EYMA 3HV6A 1YHVA 2NYAA 2R3GA 5EKOA 3ZZEA 5IG1A 2WMXA 3NNUA 5AP7A 3RK9A 4AWIA 3KIOC 2C68A 5AP1A 1T45A 2IVTA 4M13A 3TKIA 2PE1A 5LMKA 3TKHA 3GNIB 5ETFA 5B2KA 4TYEA 2IZTA 3DK6A 4L44A 4CGAA 4O22A 3QYWA 4W4XA 2HIWA 3ZLYA 3ZU7A 1J7LA 3G5DA 5D9HA 3HAVA 5M51A 4RIYA 5J87A 3OG7A 5LVMA 1DI8A 4R1YA 4FG9A 4RJ4A 4RVKA 4F9YA 4W9XA 5TE0A 5A4EA 3FBVA 3TG1A 3LJ2A 1ZYCA 5AR4A 4AE9A 3NFFB 3MPTA 4PPBA 4FX3A 2BILB 4ZTLA 2DUVA 3LJ1A 3BHUA 2C30A 4FIIA 5FUTA 3B2WA 2CKPA 4QO9A 2CNQA 2HELA 5C26A 4RX9A 4NTSA 4WBOA 4DF3A 4FKTA 2NRUA 4NW5A 4XP2A 4C4IA 3O0GA 4USEA 3ITZA 4DLIA 3R02A 3TNHA 3NDMA 1PXJA 3F82A 3ZZWA 3QHRA 2HZ0A 3MSSA 3R1SA 3EYHA 4G31A 4L53A 2R5TA 3AMAA 3OBGA 4NW6A 4I0SA 2XJ1A 3RCJA 4AW5A 4I6QA 3NCGA 2UZVA 3OS3A 3PA4A 3UO6A 5HO7A 5C01A 1UNLA 3E63A 3I60A 3KULA 2B55A 4ID7A 4R8QA 5LCJA 3EQHA 4DH1A 4F6WA 2XK8A 3F6XA 4OTFA 4PTGA 1NVRA 1XH4A 3LXNA 3O8TA 3GOPA 3OXZA 3POZA 3GCQA 4FSYA 2BRHA 4KA3A 3BE9A 2C5VA 3OVVA 4ZIMA 5IEXA 3EFKA 2XH5A 4I5CA 4L9IA 2ITNA 4TWPA 4DN5A 3RZFA 4ZAUA 2RG5A 2XZSA 3CKWA 4C2VA 4KSQA 3DBCA 5CNNA 2GHLA 2C69A 3BGPA 3OMVA 3QX4A 1JBPE 3UZPA 4IAFA 1YQJA 3W18A 5A4TA 3MPMA 3L8PA 3A4OX 3FXXA 1NXKA 4RBLA 3KEXA 4TWNA 2X39A 4HPTE 2JITA 3UP2A 2OI4X 3OROA 2B9IA 3CR0A 2BHHA 4PL4A 5DN3A 3Q4ZA 1V0PA 1ZAOA 4FNXA 5HBHA 5DVRA 1XH8A 1J1BA 3QZIA 5C1QB 1R78A 3NNXA 4CSVA 5AM6A 3IW5A 4J7BA 4ONAA 4CLJA 5G1XA 3QTZA 3HLLA 5ANGA 5AUTA 4FZ7A 2R0IA 1Q97A 4XRLA 2X6DA 2YWPA 1WBNA 5M4IA 5IH6A 4C57A 4DGOA 1F3MC 5F4NA 4F7SA 3CKXA 3JPVA 3GU8A 3OCTA 2C6TA 2OXXA 4QTEA 4FZ6A 2CKOA 3FYKX 4FL3A 4MBJA 2BDJA 2VU3A 3I6UA 2OK1A 3PP1A 2PHKA 3R00A 4F1TA 1OKZA 3CTHA 4YR8A 2YLFA 4FV8A 3VONA 5C4KA 2CSNA 4EQUA 3QKMA 1JSUA 2C5OA 3WZEA 3HMOA 3U54A 3R2BA 2XVDA 3V5TA 1ZXEA 5EQYA 2G15A 2A4LA 4PNIA 1H07A 2VTLA 3WILA 3GC9A 1KV2A 2OF2A 2O63A 3CEKA 5J5SA 3RM7A 3UGCA 3OWLA 4AW2A 1PXOA 3F5UA 4J8MA 4OTDA 4Z16A 3VW8A 5IUGA 1J7IA 1OECA 4GH2A 1R0PA 2QQ7A 4F9AA 2J50A 4KAOA 2JDSA 3VBYA 4AA0A 1BMKA 4EOSA 3VRYA 4ZTNA 2P2IA 4OGRA 1CDKA 3KMMA 3VS7A 2PU8A 4U3ZA 4D0WA 5CSWA 2QODA 2JLDA 3DLZA 3O7LD 4YU2A 4RJ3A 5DG5A 2BMCA 2BR1A 1B6CB 4CYIA 4IDTA 3K54A 4YBJA 2B1PA 4C3RA 1J1CA 4MYGA 1ZYJA 4JLCA 4RFZA 3RCDA 3UVPA 3KXHA 4USDA 2QO7A 1ZOHA 2X8IA 3VUTA 4DGLC 4IB0A 4MCVA 5AP0A 5FEDA 2X6EA 4EH9A 4L52A 5LWNA 2BZKB 3PA5A 4EK6A 4RFYA 3OW3A 4O82A 1GY3A 4UWCA 3KREA 1FQ1B 4G3CA 4JIAA 2RKUA 3EJ1A 3DBDA 4GYIA 4QNYA 2X2LA 1ZOEA 3VS1A 4RLLA 2Z2WA 3OW4A 1IAHA 3SHEA 3PJ8A 4XG8A 4ZY5A 4QDEA 3SG8A 1W98A 3RJCA 2VTIA 4LQMA 3WI6A 4AGCA 4EUUA 3HX4A 1A06A 3DJ6A 3PZHA 4DHJA 3EYGA 4TYHA 3EFJA 3BWFA 4F0FA 3CTQA 1Y8YA 4N70A 1XKKA 1UU7A 1IEPA 4MWIA 4RIOA 4YZ9A 4YHJA 3VS6A 4HVSA 3C5IA 5GZ8A 4Z9LA 4BDIA 3ETAA 3ZDUA 3LCTA 4BCOA 3PFQA 1NY3A 4QQJA 2W06A 2F7ZE 1LUFA 5HE3A 2Q83A 4MXAA 2W5BA 1BUHA 4Q5EA 4Z7HA 1SZMA 3ZEWA 3EN7A 3ZM4A 2OO8X 3CJFA 2CPKE 4QP4A 5D7VA 5FQDC 4ANMA 4EKKA 3PYYA 3Q5ZA 2OFUA 4C35A 4M84A 3AC3A 4O0SA 5CQWA 4HPUE 4QOXA 4HJOA 4KBKA 3R7VA 4BDCA 3WIKA 5IA0A 4I5PA 5EHLA 2R0UA 5IQCA 3DLSA 3UODA 1Q3DA 1DAWA 4QTBA 1TFFA 4EZ3A 3TUDA 2X81A 4UYAA 2GS6A 3QC9A 4XG4A 3AKJA 2IPXA 2PZ5A 2R3JA 2UZLA 3LCSA 3W2CA 4JOAA 2JKOA 4GVJA 2WTDA 3ZSGA 4AXAA 4YTCA 5CANA 3I5ZA 3NVKI 4G9CA 4GUEA 4FTNA 3OT8A 3DKFA 2YIWA 2PMNX 2CKEA 4KB8A 5CAQA 2CN5A 4IB5A 4KWPA 2YA9A 4TTHB 5E9EA 5CSHA 3PWYA 1H1SA 1XO2B 4UXLA 1VJYA 5AUVA 2VWXA 3OCGA 4JX7A 4C2WA 3R7IA 4E8AA 3QTXA 4CV8A 4BC6A 3CGOA 2VTNA 5IMXA 4U43A 1Y6AA 4H36A 3D4QA 3JY0A 3DTCA 3TTJA 3DFAA 3OZ6A 4E5WA 3GXLA 4LL0A 4X3FA 4IZAA 2EVAA 1SYKA 2P2HA 2R64A 3IK3A 4RVTA 1QCFA 4AP7A 2PUNA 3SG9A 3FJQE 2IZSA 4AGWA 2RSVA 4DTKA 2R3HA 5L8JA 2IW8A 5LMBA 2X8EA 1Q24A 4RSSA 3VVHA 4FJVA 4QEBA 4FV7A 3KRRA 4HNIA 2FSTX 3ZM9A 2QNJA 2C3KA 4BIBA 1LR4A 4IX5A 3KRJA 4MQ2A 3E87A 4KNBA 3FI2A 4CT2A 1U54B 5E8YA 3RPVA 3P23A 5EM6A 3FUPA 4KKEA 3U9CA 4O2PA 4JXFA 4N57A 3W0RA 3ET7A 3LXLA 4BGGA 1WBOA 5FRIA 2PVYA 2VTSA 3HRCA 1KOBA 3QCXA 4TYGA 2R3QA 3HEGA 2BDFA 4ASZA 3LZBA 3QGYA 4FEQA 4D1ZA 4D9TA 2WOUA 4BL1A 4AS0A 4IANA 4N6ZA 2GNIA 2QOBA 1M2QA 4FTCA 2CCHA 4LOOA 4YJSA 3TXOA 5KMKA 3V3VA 4DFBA 1SNXA 4QMNA 3NYXA 1FVTA 2ZV7A 3COKA 3FI4A 2BKZA 4O7RA 4FZFB 4JJRA 3BEGA 2VNWA 3RK5A 1GJOA 4F1OA 5C8KA 5JN2A 2VN9A 2GNLA 5I5ZA 5IMEA 2Y4IC 3WZJA 2HCKA 4OTHA 4B8MA 3DQWA 3O23A 2GDOA 3AGMA 4DEDA 4ERWA 4CCBA 4DHFA 2ZMDA 4M68A 4D9UA 4QP8A 2JDTA 5L6PA 3NW6A 2IVUA 5I3OA 4EC8A 2WQNA 5J5TA 2DS1A 4AA5A 1ZY5A 4FL1A 3VULA 4LGGA 3COMA 4YTHA 4XBUA 3IPHA 5ITAA 5IQFA 3OT3A 2GHGA 4X6QC 4B99A 5B0XA 3FLSA 3QQGA 2QLUA 5AIRA 3R30A 5HNGA 5DH3A 1KE5A 1TZDA 3GT8A 4QQ5A 5IA4A 2ZFYA 3QRIA 3D0EA 4FTIA 4BTKA 3ORLA 5CYIA 3NWWA 4QYYA 5TOZA 5KO1A 4LRJA 4FKSA 4AUAA 4O7ZA 4O0XA 4JDHA 3VW6A 2W17A 4KIPA 3P7AA 2JKQA 3AT4A 4XLVA 2XIRA 4O7LA 3UDSA 3IDCA 5EK7A 5LARA 2B0QA 4MWHA 4RA5A 4BDBA 3PUFC 1OL7A 2GU8A 4IB1A 4YLJA 4DG3E 4RIXA 3HRFA 2XS0A 1BI7A 4E6QA 5HG7A 4FSQA 5ANOA 3MH1A 4MXZA 4PTCA 4I93A 4BCHA 4BZOA 4PMPA 5IA1A 3FI8A 4F7JA 3DAEA 4F0GA 2P0CA 4G3EA 4G6OA 4IW0A 4JQEA 5DGZA 4ZEGA 3PRIA 1MRVA 5HORA 1W82A 1OL2A 2Z7RA 3A7JA 5JSMA 4D58A 3I6WA 1Q41A 3ZUTA 4BHZA 1ZZLA 4HVDA 3PSCA 4S32A 4CG9A 2UVYA 4J99A 3NRMA 2B52A 2VWZA 3EQCA 3NW7A 5HU9A 4BFMA 2H9VA 2I40A 3NS9A 5CU3A 3P9JA 3HA6A 4FV5A 5M53A 3P1AA 3TNPC 2O65A 3M11A 3ORZA 4AW0A 3DNEA 4M14A 3FC2A 4KIQA 2ETKA 2OKRA 2WMRA 2C6IA 1H0VA 4KKHA 4ANOA 3THBA 5L4QA 1FVVA 4EJNA 4CKIA 2GNHA 4AU8A 1SVEA 4HCUA 1W2FA 1QPJA 5AADA 3F61A 5LCKA 3UQCA 4EOQA 5J9YA 5ANEA 2ZM4A 5EI2A 5I0BA 3DZQA 1LEWA 2X7GA 4G1WA 2YZLA 2OICA 2UW0A 3D7ZA 3GC7A 4WSQA 4CZTA 5AA8A 2ZYBA 4R3RA 3ZDIA 3EOCA 1GZKA 1GZNA 3HP2A 3IW8A 4M66A 5KNJA 5E4HA 4RX5A 3REPA 1PF8A 1WBPA 3DKGA 3F88A 2HWPA 4IAZA 5HOAA 4PTEA 4YJUA 5E90A 3QZGA 1OGUA 2VX0A 4AZEA 4CNHA 3I81A 4BGQA 4MXCA 3E8EA 1CMKE 3TWJA 2E9NA 2GQSA 3TTIA 1JKSA 2XNBA 2BUJA 4TY1A 1BKXA 3CD8A 5HCYA 3ZO2A 4YTFA 3QUPA 4QMXA 3VS4A 4O0WA 4QMLA 2WTWA 4EH3A 2H6DA 1PRYA 2IZUA 1IG1A 2IZRA 2XEZA 2JIUA 5JZNA 3FZOA 1LP4A 3GGFA 2PK9A 1H1QA 3LQ5A 3VQUA 3MW1A 2R3PA 4WHZA 2BZHB 4MEDA 4ZLYA 3EHAA 4LV7A 3ZBXA 4RQVA 4CCUA 5HTIA 4WG4A 3W0OA 3FZSA 4AA4A 5GIPE 4YP8A 4QD6A 4RWKA 2LAVA 1TQPA 3KMWA 3OF0A 3TV7A 4FEXA 2OLCA 3C4ZA 1OIQA 3BYUA 3BWJA 5CEMA 3WARA 5HX8A 2GHMA 5ACKA 3VUHA 2IEWA 3F7ZA 4JQ7A 5TF9A 2IF8A 4IAAA 2XEYA 2BZIB 1YW2A 1P4FA 1P4OA 5AR3A 3V5PA 4G3DA 3O96A 4HGLA 4OTGA 4FSWA 5ANDA 3B8RA 5ETAA 4I4FA 3PY0A 1K3AA 2V55A 5JKGA 3PXKA 3R6XA 5HTCA 2QOOA 4RC3A 4EORA 1M7NA 2F2UA 3HGKA 1OITA 2BFYA 3JYAA 2J0LA 1OL5A 3BV2A 2F49A 4BBMA 4JS8A 5K5NA 3O8UA 1PJKA 2PVNA 2WNTA 4IM3A 4I6FA 5AX3A 4APCA 3DV3A 3FEGA 1V0OA 4ACDA 5A4QA 2WTIA 4RLKA 4QMWA 4P5ZA 4RPVA 3L9LA 4X2FA 3PIXA 4Y8DA 5GJDA 4EOMA 1JWHA 3LOKA 4RZWA 3KXZA 4D4SA 4O21A 5AEPA 3LFNA 4USFA 2XAMA 2ZMCA 1WBVA 5H8EA 2YJRA 1H08A 3BL7A 1PYXA 4JAIA 1A9UA 2X0PA 3U4UA 4HGSA 2WEVA 5A4CA 3FL5A 1YWRA 4JDJA 2W05A 4C38A 3TYKA 1PYEA 3UOKA 2ITOA 3TIZA 3OEZA 4PP7A 2XK3A 4FV2A 1GZOA 4FG7A 1UV5A 5I9VA 2UUEA 4FTTA 3PG1A 4NM3A 4FVRA 1M7QA 3FYJX 3R04A 3C1XA 3OHTA 4HYUA 3SOCA 2BFXA 5DWRA 3TACA 2Y4PA 1OL6A 4ZTSA 1UA2A 5DR6A 3NYNA 3TDVA 3C9WA 4AQKA 2WTJA 1BLXA 1WZYA 4YJQA 4A4OA 5HHWA 3I7CA 3EN4A 1ZMWA 4UMPA 5BV3A 4AAAA 2UZBA 4G9RA 4IH8A 3VS2A 4AAYA 1JOWB 4F9WA 2OG8A 4MF1A 3UOJA 5J1VA 3FLNC 2B9JA 4BDAA 4X0MA 3A2CA 3LCDA 4BDDA 4E93A 4BKJA 4QMOA 3BU6A 4MBLA 3E5AA 4NK9A 3LAUA 4MUQA 2BHEA 5BNJA 4ZS0A 5EDRA 4E6CA 4BB4A 2W0JA 2X7OA 3JR1A 3HUCA 3LCKA 3FMDA 2PUIA 1H25A 4ANLA 3HUBA 2PZYA 1ZOGA 3MY0A 4H3BA 1XMLA 3KN6A 3TJDA 3R28A 2FSOX 4CQEA 2BPMA 5CZHA 4IHPA 3F2AA 4FL2A 3MPAA 3BEAA 4U7ZA 3VUMA 4KINA 1YXTA 2YISA 3TMOA 5HO8A 1HCKA 3E62A 2XNNA 3ZYAA 4CMOA 4MK0A 1STCE 2NP8A 3RM6A 4AZSA 3ORTA 1ERKA 4EI4A 4HNFA 3N9XA 1YHWA 3ZLXA 4ACMA 2JAVA 1YOLA 2VTMA 2XIXA 4E1ZA 2XIZA 1U54A 4DH7A 3ODZX 5AP3A 4I0RA 4RRVA 4WKQA 5AMNA 4PQNA 5AA9A 5KMOA 3DAKA 4U6RA 2FA2A 4UMTA 4BF2A 3QD4A 3R1NA 1W7HA 2Y8OA 2XJ0A 4PF4A 1X8BA 4O6LA 3MJ1A 4WUAA 2XK6A 5DI1A 5EM5A 4ZZMA 3ZUVA 2PZIA 2R3IA 3F2NA 1E1XA 4OR5A 3CE3A 3I0QA 4FKOA 1O9UA 4DHZA 4UN0C 3JY9A 3PE2A 5BPYA 3QCQA 5AUYA 3P78A 1YXVA 3TNQB 5CSXA 3QD3A 3PLAE 3BGQA 3BHVA 2YM3A 2C6OA 4K18A 2G2FA 3I79A 4CRSA 3EQPA 2VTJA 4IVCA 1S9IA 2CN8A 4WRGA 3UP7A 3O7LB 4R3PA 5M4FA 5M08A 5CAVA 4FIEA 3A8XA 2UZWE 4DA5A 3QL8A 4ZLZA 2SRCA 4ARKA 3EQFA 4J52A 4ZTQA 5DNRA 3RALA 2HXQA 2HZ4A 3BLRA 2YCSA 3FMKA 3IKAA 4JG6A 4YBKA 1GNGA 2R3OA 4UXQA 3NUXA 4OTRA 3W2SA 3UTOA 3VUDA 1G8AA 1FMOE 4QP1A 3P0MA 4EL9A 5BQ0A 4XH6A 4ALWA 4ZJIA 3CLYA 3NCZA 4EEVA 5JFXA 4GK2A 5CEIA 3UG2A 5F9EA 1B39A 5FTQA 2HAKA 2GSFA 4JRNA 2WOTA 3FZRA 3GB2A 3Q96A 4FNYA 3NNVA 4FV6A 3R7UA 3QBNA 3FHIA 3MH2A 2A19B 2CDZA 1G8JA 5E1SA 3R73A 2J6MA 2ITTA 2CNUA 1XWSA 2QO9A 2W96B 3E8NA 5HI2A 2XNEA 4NWMA 4E3CA 4J97A 2GMXA 4E4LA 3PWDA 2WU7A 2XNOA 3G90X 3KK9A 4GU9A 2AEGA 2QHNA 3ORXA 1R0EA 3BQCA 4KIKB 3E8DA 4JDIA 3H30A 4ANQA 1U4DA 3TV4A 2C1BA 4II5A 5IDPA 2J0MB 4UB7A 2XKDA 3G33A 4ZSAA 3QLFA 4O6EA 3WF7A 3ZLWA 4D4VA 5IEVA 4XCUA 3FSFA 4AXDA 3M42A 2R3NA 5AR7A 5A54A 4DCAA 2JDOA 2B9FA 3O2MA 3D14A 3DK7A 3BPRA 4IWQA 4TZRA 2EB3A 3Q9YA 3R8PA 5BVOA 4JIKA 1M2PA 1PXPA 3AC8A 3QXOA 5AV2A 3PXZA 5HIEA 4PNKA 4CFMA 3EN5A 4YPSA 3KXNA 3I5NA 3RAKA 4LUEA 3LFDA 1TKIA 3VBQA 4FEUA 4OAUC 3KF4A 3W2QA 1Y91A 4RA4A 4YURA 2X2MA 4D0XA 1CSNA 2FSMX 4IX3A 1CKIA 3BV3A 2XBJA 3H9FA 4QMQA 4DBXA 5M57A 3MVLA 4JBOA 4TRLA 3BYOA 2YIXA 2W1DA 4K2RA 3HMPA 3SRVB 3ZSHA 3AT3A 1Q99A 2I0VA 2YITA 4RMZA 3QRJA 4GL9A 4K11A 4F1MA 1F5QA 4FUXA 1E9HA 3VBXA 1WVYA 1MQ4A 4MAOA 3R8MA 2O5KA 2PPQA 4FT5A 4FEWA 1YHSA 2PUUA 4DDIA 2ITWA 5KBQA 4XG6A 2WIHA 4CKRA 3FL4A 5IPJA 2R3KA 2XAOA 3R2YA 3A7IA 4QYFA 4R77A 3CJGA 4O7NA 4QMMA 4YZDA 2AQXA 3IONA 1J91A 1M2RA 3E3BX 4A4LA 4EKLA 4ZTMA 2NNWB 5CI6A 2RFNA 5LMKC 2GFCA 2UW3A 3PPZA 2W1IA 1Z5MA 2WTVA 5HE0A 3K2LA 5ACBC 3FMEA 3ZHPC 2QOHA 2WGJA 5KMLA 2J51A 5C8MA 3VNTA 5E8TA 4TL0A 2QONA 3FWQA 1OPLA 3BHTA 3R63A 4TW9A 5L2QA 3ROCA 3ZRLA 4EWHA 4K77A 3TDWA 3T3UA 2BROA 3HP5A 4CFUA 3MVMA 3MFTA 1VEBA 3II5A 4D2TA 4FTKA 4M67A 3QQUA 4XP3A 5KCVA 3P7CA 1PHKA 3SOAA 2PE2A 4PL5A 4D2RA 3G9NA 4OT6A 2YERA 4S31A 4EZ5A 3P7BA 4L8MA 3V6RA 3U55A 3UE4A 5EI6A 4GKIA 1QPCA 2X8DA 2OXYA 3BCEA 3RMFA 4R7IA 3FLZA 4Y5QA 1XJDA 3PG3A 2YDKA 4YGAA 3RVGA 3D5VA 2AUHA 3N4UA 3OUNB 3PDTA 3IW4A 1WCCA 1DI9A 3RP9A 3P86A 4G3GA 4F0IA 3VHKA 2V7OA 1Q8YA 2F7XE 4FOBA 4LGDA 3WZDA 3G15A 3NZ0A 5E8SA 4A4XA 3E7VA 4LM5A 5K0KA 3VF9A 5J7BA 5IQHA 5JMSA 2VTHA 3KVXA 2XK9A 3FKOA 2HW7A 3RAWA 5CEPA 4ASDA 4QP7A 1SNUA 3UOLA 4QRCA 4ZTRA 2C3JA 4C4JA 2NPQA 3PFYA 4E20A 4QP9A 4FTMA 2UZDA 1OKVA 2RGPA 4XLIA 4XHKB 4FTAA 5EW9A 4JAJA 5JFVA 3AQVA 2OJ9A 4QPMA 4NTTA 3RWPA 3P4KA 4C58A 5KMJA 3HNGA 4S2ZA 3P5JC 2VWWA 2C0TA 2JGZA 3A4PA 3KGAA 2H34A 4BI2A 4DFZE 4TN6A 5FDPA 5HNIX 2W1EA 3MB7A 4EOIA 4O84A 1QL6A 2OJFE 3QFVA 4C3FA 3PSDA 4IJPA 4EOPA 4RT7A 4CFFA 1PXLA 4CT1A 3QAME 3TL8A 4C62A 2W1ZA 2ZAZA 1K9AA 2OSCA 4K8AA 2WPAA 4I6HA 4FGBA 4UYNA 5CSVA 3R9NA 3R9OA 1ZRZA 4ANBA 2V7AA 5AP6A 3V5LA 5I9ZA 4NFNA 3WF6A 2OXDA 4LG4A 1NVQA 2YIYA 4AACA 4JR7A