3FJQE

Crystal structure of camp-dependent protein kinase catalytic subunit alpha in complex with peptide inhibitor pki alpha (6-25)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
336
structure length
334
Chain Sequence
b'VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Comparative surface geometry of the protein kinase family.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 108
structure length 334
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fjqE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fjqE02
1WFCA 2EVAA 2OJGA 3HMIA 4QMUA 5IEVA 3LFDA 5AA9A 2W1CA 2WELA 3FKOA 3MPTA 4YBJA 2JBPA 4NIFB 4EH2A 2VO7A 5HG9A 3IOKA 5DR6A 5HBJA 3VBWA 2XK7A 3OUKA 1QPCA 3ZH8A 3CSVA 4YSMA 3C5IA 2OXXA 4FV4A 2J90A 5HESA 5JGDA 2G2HA 3NAYA 2QG7A 2PUNA 3ALNA 4DTKA 4G34A 1H24A 4TT7A 5M55A 4MNEB 3EKKA 4HGTA 4IX4A 3FLQA 3PRIA 4F9AA 2OI4X 3KCKA 4WG4A 4C8BA 3AD6A 1URCA 4L7SA 4O21A 5C03A 3TV6A 4FKOA 3C4XA 3VF8A 4EHGA 2C4GA 1PXPA 4E73A 5JGBA 3QXPA 4O7LA 2IZUA 4ZXTA 3F6XA 2J0KA 3OW4A 4LGDA 4DC2A 5JN2A 4KKHA 1Y8GA 4G16A 5CU3A 5K9IA 1UWHA 5AP0A 1GZKA 4ZK5A 2E2BA 4GVJA 1JKTA 4E26A 3FL5A 3R30A 3F9NA 4FL2A 5E90A 4BB4A 1LEZA 4FEXA 3PXRA 4EK4A 4CFNA 2VWXA 2PPQA 3NDMA 2PVRA 2JKOA 2X2KA 4U0IA 1BLXA 3RINA 4EH6A 3WE4A 4GYGA 3DXQA 2YM6A 4L68A 3IGGA 4RWLA 4Y83A 3W2SA 2QOCA 3EYHA 4YC8A 1XKKA 5K5XA 5I4NA 3FSKA 3UPXA 3VHKA 1S9IA 5BMMA 3ORKA 4FVQA 4Y95A 2C5XA 4OGRA 3L8XA 4AN3A 2BHHA 4GKHA 1O6YA 3KRJA 4FTMA 5M56A 3H0ZA 1ZMWA 3PPKA 2BHEA 2ITZA 5CALA 2JKQA 1TQPA 3R7IA 3FZ1A 4DEBA 5H2UA 4AP7A 5IQAA 4Z9LA 5CLPA 4GJ2A 4O0TA 4BDKA 4QP4A 3FI2A 4DEHA 2WTDA 2XK3A 3D0EA 4D5HA 2GNGA 4AWIA 2CCIA 3L9NA 1QCFA 1FGIA 3FXWA 4FG8A 3BYUA 3FMNA 4HJOA 4AA0A 1OZ1A 3QHRA 3MFRA 2UW8A 1U46A 4KS8A 4TY1A 5IEXA 3OY1A 1IAHA 1VYZA 5EDPA 3AC8A 4JRNA 4K9YA 3LLTA 1STCE 2BZIB 3I79A 5IH5A 1V0OA 5DLSA 2W0JA 4AZTA 3D14A 2B9JA 3LCKA 4QTCA 4Y5HA 5DRBA 4BDIA 5A4EA 1WBSA 1YQJA 4J98A 3OCGA 5HIEA 2UZWE 3DCVA 4MVFA 2RFDA 5H8BA 2ETRA 4FKJA 2R3PA 4QPSA 4GV1A 5BYYA 1DAYA 4UY9A 3SQQA 1OPKA 4ORKA 2Y4IB 4G3DA 1KUTA 2BZKB 1J91A 4TYGA 4HCUA 1H0WA 4PTGA 5EM8A 5HNGA 3UQGA 4BIDA 2R7BA 5FDXA 2YDJA 3BYMA 1Z9XA 4IM0A 3COMA 2AC5A 4PPAA 5ETCA 4I3ZA 1NVQA 4FTIA 3VW8A 3TTJA 4GIIA 1IA8A 5HZNA 2BTRA 1M7QA 3F7WA 3CQEA 2VTPA 3DK3A 5CYIA 3CEKA 4CTCA 3NYNA 1OITA 3BBWA 3PTGA 5HG8A 4Q9ZA 2CNVA 3PP0A 3PSDA 5KBQA 1XH8A 4BDGA 2XEZA 4GIHA 3LCDA 3LIJA 5B0XA 3UVRA 4KBKA 4FKTA 4FTUA 2GHGA 5E8WA 3QX4A 2PUUA 3Q5ZA 2V7AA 2W99B 5BVEA 4FV2A 5FBOA 3KC3A 3ZS5A 5IA1A 3HKOA 4LQMA 5ETIA 1UVRA 3LLAA 3CPCA 2UVYA 3D7TA 3UIXA 3O96A 4E6DA 3HV4A 4ZP5A 4UYNA 4YJRA 5KX8A 4F1MA 1ZZ2A 4HGSA 4NUSA 4JX3A 4L9IA 4BCKA 3QQLA 5LMKC 5HIDA 1MQ4A 1O9UA 2BROA 4Z55A 4KSPA 2PMLX 3MN3A 4J95A 3UGCA 4ZTHA 2A0CX 2QQ7A 2R3QA 3E62A 2OGVA 4YC6A 3VS7A 3UQFA 3VHEA 3VWAA 5KHXA 3BE2A 3P08A 3S2PA 3P4KA 5HVJA 3V5JA 4LFIA 4GH2A 3FZPA 5M57A 3T9TA 1KOAA 2XS0A 3LMGA 4QTBA 4YJVA 5BVFA 5FM2A 4FTLA 2XMYA 4Q5EA 1OKVA 4FZ7A 2QOHA 3TJDA 5EQEA 4XG2A 3CC6A 5D41A 4E4LA 4F6SA 1PF8A 3SG8A 4TWNA 3RPYA 1M2PA 4JQ8A 3CS9A 4ZTRA 1KV1A 3MY1A 5LVOA 3MB7A 1H1SA 5TOZA 3Q2MA 3QD2B 4S31A 1W98A 5HNBA 4YR8A 1U5QA 3EOCA 2R0IA 2FYSA 3R02A 4JAJA 5FD2A 4CG9A 1Q5KA 4RIWA 3C5UA 4OT6A 4PNKA 5TF9A 4I5HA 4MXXA 2FH9A 4OR5A 4X7QA 3AG9A 2QOFA 3QBNA 3LJ1A 3HP2A 3A7FA 4TYHA 5CQUA 3D5VA 3MPAA 4WNMA 4L46A 4TWPA 2Y6MA 3FPMA 3QHWA 5BQ0A 3EN4A 5K4JA 2ZVAA 2CKPA 2VTIA 3PRFA 1UNGA 3GGFA 4WIHA 3QKLA 2UV2A 3DKGA 2IVTA 5IUGA 1OB3A 3LVPA 3COIA 3SD0A 5JFSA 4FVRA 3UODA 3PG1A 3ZBFA 5AR5A 5CNNA 2Q0NA 4P5ZA 3LHJA 3GEQA 4OBQA 2YWPA 3EQFA 2B4SB 3H3CA 3AC4A 3OTUA 3O7LB 2OJIA 4ASDA 4EK5A 4E6CA 4WKQA 3ROCA 3TUDA 2XIZA 4I6FA 3II5A 5L2QA 2O63A 5BUEA 2Z02A 3HLLA 3TG1A 4RJ4A 3UC3A 3IKAA 4FG9A 3VRZA 4TL0A 3TEIA 4IZ5A 2WQNA 3PJ3A 1NVRA 4LL0A 4FV3A 1Q61A 5HX6A 3W2OA 4HGLA 3DK6A 2CN5A 4GFOA 1VR2A 2WTWA 2YCFA 5EG3A 3T3VA 2YCSA 3DNEA 4K11A 5AX3A 1H08A 2Y4IC 4D2WA 2XNGA 3RBWA 4ERKA 3W2PA 3FSFA 5BVNA 5KMNA 3G90X 1QPEA 3U51A 4H3BA 2HW6A 4D1XA 2WEIA 3CKWA 3QU0A 4OTGA 5T6KA 3IG7A 5CVHA 2BMCA 4E5BA 1JKKA 2QNJA 4DGNA 5LCJA 2JC6A 4D9TA 4DLJA 3HMMA 5DEYA 4OAUC 4C36A 4F1TA 4ENXA 4BN1A 2CN8A 3R28A 2IW8A 3D15A 3EWHA 3HUBA 1Z5MA 5HX8A 2C0IA 4W4WA 4PMSA 1RQQA 5HO7A 2R3HA 3CD8A 1DAWA 1AGWA 4AW5A 4FK3A 5LOHA 4RT7A 3A62A 4A9SA 4QP6A 2PVLA 4YZ9A 5BPYA 3SDJA 4JBVA 1UKHA 3S4QA 2OFVA 2GCDA 3D9VA 1OECA 1KSWA 3KN6A 3F5GA 1RE8A 4TRLA 1JNKA 5JK3A 3LFFA 4WO5A 3LQ3A 1Q3WA 3LAUA 1HOWA 2GS7A 3Q4ZA 5IG1A 5JSMA 4GSBA 4GUEA 4JBOA 2C1BA 4NJDA 3Q04A 5A54A 3KULB 4XLIA 4MKCA 4AOTA 2YM4A 5AEPA 1U59A 2OICA 4WOVA 5IEYA 5K5NA 5CZIA 4D1ZA 5DIAA 3NVKI 3W16A 3SOAA 1GIJA 3IECA 4JS8A 4KIOA 4ID7A 2XP2A 3TNWA 3MY5A 4ZSLA 3FLSA 2ESMA 4IWDA 3WYXA 3Q5IA 3NGAA 2FSMX 2PVJA 3PFQA 5CU4A 5DH3A 4TKSA 1ZY5A 2GNJA 3R7YA 2WOTA 1V1KA 2UZEA 4I21A 3MIYA 3KXGA 1B38A 4QTDA 1IG1A 5I9VA 3ZUUA 5HLWA 5J9YA 3PWDA 3LXPA 1NW1A 3PXKA 4JL9A 5E91A 2HY0A 2OJFE 3ACKA 4RZVA 5HCXA 2UW7A 3Q9YA 4V0GA 1APME 5ACBC 4AG8A 4XG9A 3QCQA 3KREA 5AP1A 3UNKA 5IISA 5HD7A 5DYJA 5IPJA 3QTWA 4M3QA 3R9OA 4B99A 1H27A 3DXPA 2C68A 3MH2A 2UZTA 2ZM4A 3PWYA 4RX8A 5AX9A 4F7JA 1P4FA 3MVMA 2AYPA 4O38A 4PDPA 4BR3A 2PVFA 3KCFA 3PP1A 5HKMA 3FZOA 4IAYA 4S30A 4FI1A 5D10A 2UW4A 4KSQA 5DBXA 4F6WA 4I24A 1W84A 2CGWA 3D7ZA 3PIXA 2QU6A 4P7EA 2W1EA 3VS3A 3BLRA 2C5OA 4G5PA 2W9FB 2PULA 4CV8A 3MVLA 3U6HA 2J51A 3W55A 4YJOA 2WQBA 3CE3A 2HENA 5HLPA 3UYTA 4QMQA 2CCHA 4NTTA 2LAVA 3R00A 4GCJA 4YLLA 1GIHA 5J87A 5EDRA 1R0PA 4USFA 2JDSA 1YWVA 2YM8A 5LVPA 2PU8A 4BBFA 5KCVA 1OIUA 1XBCA 3OP5A 3FL4A 3JPVA 3FZTA 3R7EA 3Q96A 4O2ZA 2I7QA 2PZYA 3O0GA 1FVVA 3P7CA 5KUPA 3H9RA 4V05A 4O86A 3PXQA 1URWA 1ATPE 2R9SA 4AGWA 3FXZA 3RGFA 4L7FA 4BICA 2HAKA 1XQZA 5L8JA 4PNIA 3Q4TA 4K0YA 5JQ8A 4LGGA 3NW6A 4W4YA 1REJA 3QRUA 4QYGA 4RIOA 3SXRA 4G5JA 4XX9A 4YJSA 5BMSA 4PY1A 2KTYA 4AT3A 4D0WA 1JOWB 4FT3A 4KAOA 4HYUA 1EH4A 3IW4A 4PTEA 4QMPA 4WBBB 3TKUA 4TWOA 4ACHA 2I0EA 1Q8ZA 5CEPA 1GJOA 4C3RA 3A8XA 3GP0A 3BHYA 4TTHB 4X2FA 4BTFA 4WRSA 1MRUA 4WBOA 4BTMA 1CTPE 5ANOA 5AV4A 4Y72A 2X4FA 4FNWA 2V5QA 1Q8WA 3BHHA 2JDVA 2NP8A 3PVGA 4FIGA 1OI9A 2F7ZE 4YTHA 2OLCA 4LOQA 2IJMA 2YZAA 4F63A 2C5NA 1O6LA 4FZ6A 3FY2A 2B9HA 2W17A 4NIFA 4QP8A 4O82A 4QMYA 4ZJIA 2HK5A 4YJTA 3BV3A 1VZOA 4AE6A 3THBA 1OL2A 4M7IA 4A4XA 3NNWA 3NR9A 3EQBA 1XBBA 1Y6BA 3MSSA 3OWJA 4G9CA 4GL9A 4NFNA 4BI0A 4N57A 1KE5A 4MNEA 1UU7A 2VUWA 4O0YA 1WBTA 3EYGA 3ORXA 2NPQA 4FTKA 1CKIA 4LG4A 4BCFA 1FMOE 2R5TA 2YFXA 3PA3A 3PXFA 1Y91A 2VRXA 3HZTA 4FTJA 5C8KA 4GK2A 3DAKA 5EW8A 2C6KA 4FK6A 4R6VA 1JBPE 2RFEA 3DBCA 4IVDA 4FUYA 3I5ZA 5AR7A 4BF2A 4RC2A 4DEDA 3R9NA 5JEBA 2W06A 2CKOA 1YWRA 3R04A 3P1AA 2QU5A 4C58A 3NS9A 2YITA 5FTOA 1P14A 5DHJA 4RPVA 3PA4A 1GZNA 2WMAA 1BI8A 5AAFA 4APCA 3ORIA 4JBQA 3QZFA 2IVVA 3AC5A 3G33A 3M1SA 2XBAA 4MD8E 3VUTA 4BGGA 2OO8X 4ZTMA 4QYHA 2BZJA 3SOCA 2EU9A 4D28A 1OVEA 4OTDA 3KVXA 4F6UA 4YUQA 4IJ9A 5B7VA 3ZZWA 2W5BA 4RVLA 1OUKA 2PSQA 1YRPA 3EIDA 2OG8A 3BE9A 4MD7E 4YO6A 5IKWA 4CQGA 2PUIA 4FIIA 4IAAA 2HXLA 4JJRA 4JQ7A 3ZZEA 4F64A 3OTVA 4FNXA 4BYIA 5C1QB 5HCZA 3LQ8A 2VX3A 4KINA 4KS7A 2XKFA 2WIHA 3TI1A 3C4CA 3KKVA 4MCVA 3UG2A 1JKSA 1CDKA 2JGZA 4AN9A 2WTKB 2HZ0A 2OZOA 3S1HA 5DR2A 2WZJA 4DYMA 3L1SA 3KL8A 4GUBA 4MF0A 4O6LA 4Q9SA 4J53A 4WNKA 4EOSA 3LPBA 4U81A 2G01A 4FR4A 2F49A 3V3VA 4IWQA 4EHEA 3GC7A 4D2SA 5LWNA 4F0GA 5I9XA 1TQIA 4MXZA 2VO0A 2ITYA 4ITJA 4X6QC 3FKLA 2VTJA 2J0LA 3HECA 3MFSA 4BFMA 4PX6A 1OGUA 4EJNA 5GIPE 3B2TA 4OTRA 1U4DA 5I3OA 3H0YA 1PXLA 4CV9A 4MWHA 3QZIA 3EQHA 1YXTA 3EFJA 4O27B 3I1AA 4R7BA 5I9UA 4FKPA 3A4OX 4EI4A 4R3CA 4O7RA 3CTJA 1WCCA 5DA3A 3H10A 1HCKA 2BCJA 2FUMA 4QMVA 3MTLA 2WEVA 1H1RA 5GJGA 4PQNA 4CKJA 2YISA 3I0QA 5CEKA 1VEBA 2R7IA 4IQ6A 3GOKA 4BDBA 3EJ1A 1U54B 2GNLA 5BVWA 4PP7A 2GPHA 3QTQA 2QCSA 3QA0A 4S32A 3PA5A 3LFQA 5J9LA 2Z7RA 4IVAA 4Q5HA 4QPAA 5LARA 3S3IA 5JZJA 4XG7A 4X21A 5TT7A 3P86A 3GI3A 2XA4A 3ZO4A 1FMKA 3LCSA 3QLGA 2QLQA 3QYZA 3JYAA 5BVKA 4BKZA 2C6MA 2FSOX 3ODYX 5AWMA 5B2LA 4OT5A 4IH8A 4LOOA 4APPA 2GNIA 4OBOA 5C9CA 5DI1A 1GZ8A 4CD0A 4I0SA 4IJPA 2VTSA 2WOUA 1ZYDA 2ZM1A 1JLUE 3IPHA 3OY3A 3FUPA 4RJ7A 4RZWA 5EK7A 1OKWA 3E7OA 4HPTE 1LUFA 2RKUA 3MJ1A 5DPVA 3BYOA 1YXSA 4TN6A 4A9UA 2BR1A 2BUJA 2W1FA 2R64A 4DFNA 4D55A 1NVSA 4Y46A 5G6VA 5TE0A 4I20A 5L8LA 5J79A 3OG7A 1ZOEA 4JDJA 4YLJA 3ZYAA 2XK8A 3I0OA 3QTZA 4G6NA 3FI3A 1JSVA 5AV1A 3HV5A 3CTHA 5M4FA 3PJ1A 1AD5A 5LVMA 3U54A 2WQEA 4QP3A 5AA8A 2VTAA 3IDCA 2JAVA 3QQUA 5HE1A 4RVMA 2PUPA 1PJKA 3DLSA 4C02A 3EFKA 4U8ZA 2DQ7X 5DGZA 5EI2A 3P9JA 5ANKA 2OH4A 3SRVB 5EKOA 4MXAA 3SGCA 3FMLA 4BKYA 4DEEA 4MX9A 4EZ7A 3BHVA 4X0MA 4WT6A 3TKHA 4AT5A 2JAMA 3RWQA 5E8YA 3RCDA 3FQHA 4M14A 5CEMA 3FMKA 1PKGA 4ZLOA 3VRYA 4ACGA 3E64A 4XV2A 3RM7A 1B39A 1ZOHA 3Q4UA 4ANBA 4Q2AA 1K3AA 1FGKA 2ZJWA 4G2FA 4BCQA 3UOLA 5HORA 2FSTX 5DEWA 2IWIA 3DGKA 4KWPA 3SC1A 2XCKA 3FMEA 3CY3A 4CFXA 3S95A 3AXWA 3F66A 4BVUA 3QD3A 4WA9A 4AX8A 1ZXEA 3KVWA 5J9ZA 2HOGA 3LQ5A 3PVWA 3V8WA 2UW6A 3OCTA 3BGQA 3F5XA 2RIOA 4AA5A 3LM5A 3LXLA 2FVDA 2VO6A 3MFTA 3SLSA 3ZMMA 4C2VA 3LM0A 4CZTA 5D1JA 5K0KA 4NFMA 4U97A 2XKEA 3E8NA 5CEOA 3C0HA 2JLDA 3ENMA 4X2KA 4RLLA 4AW2A 5F20A 2VN9A 3QUPA 3V5WA 2OW3A 3BPRA 3DBQA 4TYIA 4CYJA 4FKSA 5CEQA 3ULIA 4HCVA 5IH4A 1PXKA 4OTWA 3MTFA 5E1EA 2HWPA 3V01A 3U87A 3BU5A 4D2PA 5CSPA 4UWBA 4ANMA 5CAVA 4WSQA 3NUNA 1XH5A 4FZDB 3WF8A 3F5PA 3R8LA 3D5UA 3MDYA 3WF9A 4FTQA 4GU9A 4BDEA 3LFNA 3ZOSA 3QL8A 2UZBA 4FTOA 4ZSAA 1KV2A 3PIZA 4OTQA 4UZHA 3F88A 2ONLA 3BRBA 1Q41A 3RAWA 3IW5A 4UYAA 4FE2A 3E87A 3RNYA 4IC7A 3V5TA 2BFYA 4EUUA 2X0GA 1NXKA 4UN0C 3GU5A 2RG5A 2VWWA 2WU6A 3ZO2A 2UW3A 2V55A 3VS2A 4BCGA 4IACA 3LE6A 4AZEA 4IZYA 3V5LA 1R78A 1MUOA 2C69A 2V22A 4A7CA 4RFMA 4G9RA 2WGJA 4RJ3A 1YDTE 4J52A 3V5QA 4IHPA 4ZZOA 2CLQA 1XR1A 4FGBA 3G9NA 2JIIA 1F3MC 1RDQE 2RL5A 4UWYA 3RPRA 5FGKA 3R9DA 3TV4A 2V0DA 4HVGA 2BZHB 4ANOA 4OLIA 3QC9A 1YWNA 2YAKA 2YJRA 4ASEA 4FUXA 5KE0A 4YTFA 5A4CA 2C6IA 3OBJA 3PPZA 3ATSA 4IVCA 3PJ8A 2OH0E 4D4YA 3G0EA 1Q97A 4W9XA 2C3KA 4GG5A 3V6RA 3HRCA 2O0UA 1TVOA 3EB0A 3K5UA 4PPCA 3DFAA 4EK6A 5LWMA 4UB7A 5EH0A 5AUVA 2XRWA 3R1YA 3LKMA 4FKLA 1CSNA 2ITWA 3NEWA 4EH7A 1M7NA 2OF2A 1BKXA 3CXWA 3KXHA 3TZ9A 4AACA 4WG3A 2WD1A 5CNOA 3ZBXA 2PL0A 5HIBA 2I0YA 3ZFXA 3KULA 5IA4A 3QX2A 5M06A 1X8BA 3EN7A 3PY3A 2J5EA 4IW0A 3UPZA 2IZRA 4IXPA 4MQ2A 2P3GX 5IDNA 4YJQA 2G1TA 1H0VA 2FGIA 3DBFA 1PXJA 3QCXA 5KZIA 2H8HA 4MXCA 4QT1A 3RP9A 2YDKA 4AQCA 3HGKA 4AS0A 3OVVA 2I0HA 4A07A 4I4EA 4GJ3A 1OL6A 3LJ2A 4RBLA 1XHAA 1Z57A 2PMOX 2QOBA 3G9LX 4WG5A 5AAEA 3TDWA 1ZWSA 2FB8A 2WU7A 3VIDA 1JSTA 5FG8A 3O23A 2O5KA 4CCUA 4F1OA 3ID6C 2J2IB 4CT1A 4ZS4A 3QTUA 4U41A 5CI6A 3B8RA 4YP8A 1RW8A 1UNHA 4IX6A 1T46A 5A6OA 5FRIA 1W82A 3UG1A 1F5QA 4EH8A 4N70A 1W0XC 4OBPA 4UBAA 3WZJA 3FE3A 5DWRA 3OS3A 3FMHA 3QCYA 1PYXA 4NZWB 3V6SA 4DGOA 3G15A 4M69B 1G3NA 2IN6A 3FMDA 4UALA 3WOWA 3RHKA 3FMMA 3P7BA 3ZONA 2ITPA 5GZAA 2QHNA 5EW3A 4AUAA 4EQUA 2X9FA 1KWPA 4EZ5A 2BIYA 3R7OA 2BDWA 4OTPA 4DH3A 2QOIA 4B4LA 5HTBA 2BRBA 3ANRA 3TIYA 4O6EA 4MXOA 2XJ1A 5IH6A 2VWBA 2WTVA 2YLEA 5L6WL 3H4JA 3JVSA 1WZYA 3O8TA 5LVLA 4PMPA 4CMUA 3NW5A 4FKRA 3F3ZA 3OWKA 3HV6A 3NIEA 4FKWA 4FICA 2VTTA 3OUNB 5CU2A 5DMZA 4BI2A 5AUXA 5EOBA 4R1YA 4ZTQA 3CCNA 4N0SA 4ZSGA 3UE4A 2B0QA 3HRFA 2YIRA 3R21A 4FC0A 2P55A 4LMUA 4TNDA 3EFLA 4JNWA 4YBKA 3VQHA 3IO7A 5HE2A 3IDPA 4UXLA 4ZZMA 2UW5A 4S34A 5A4LA 4M68A 5EHLA 3LZBA 4H3PA 2PE0A 1OPJA 3ZC6A 5CAPA 4UMTA 4R5SA 2XCHA 2O65A 3BGPA 4YHJA 4GEOA 4BRXA 3GT8A 3NX8A 3LW0A 4U3ZA 5AR4A 2PVKA 3QTRA 3JUHA 3GU8A 4FEWA 4G1WA 2J50A 3PUPA 1KE9A 3R73A 2XRUA 4F99A 2YCRA 4W8DA 3PE2A 1NA7A 1H1QA 3QA8A 4ZY4A 2W4JA 3MVJA 2Z8CA 3EZVA 3WYYA 5JH6A 1J7UA 2WMVA 2C0TA 1U5RA 2YACA 3ATTA 3KXXA 3IS5A 4GG7A 4P4CA 3ZDIA 3ORPA 4L8MA 4YPSA 4K8AA 1FINA 3VS6A 3VC4A 4ACDA 4K6ZA 3DDPA 4D1SA 4DGGA 4BCHA 3G6HA 4BDDA 4EK8A 3F2NA 4I6QA 4RA5A 3A60A 3ACJA 5DT0A 4I0RA 3FXXA 4E20A 4FYNA 3NUUA 4QP2A 3VJOA 4AU8A 4EK3A 4EYMA 4EJ7A 2B7AA 3P7AA 4U6RA 2YIYA 4U79A 3UOJA 4X6RA 3P79A 5ICPA 4HYHA 5E1SA 3R8PA 4ONAA 1XH9A 3MWUA 3ORLA 4MAOA 5EDQA 5LQFA 3RPVA 3ZUVA 3ZEPA 4O7SA 5EQPA 4QYEA 3FZSA 3OOGA 3GCVA 3OC1A 2CDZA 3OWPA 4GK3A 4JG6A 4JR7A 4IEBA 1SYKA 2XNMA 4L3LA 4L3PA 3MIAA 1PW2A 3BELA 4N4SA 4AW1A 4BDFA 3UZTA 1E1VA 3SV0A 2W1GA 3MA3A 3WI6A 4NTSA 3DKCA 3I6WA 2O64A 2J0MB 3F2RA 2GHLA 5HVKA 2XVDA 1IA9A 1T45A 5AUYA 4ENYA 2GFSA 1JKLA 4O7ZA 4EZ3A 3RPOA 3G5DA 4H05A 3GFEA 3U9CA 3AD4A 3GB2A 5A9UA 2QONA 4AFEA 4G31A 2XKCA 1S9JA 2ACXA 5CVGA 3V5PA 3HYHA 3KFAA 1DI8A 4NM5A 3DFCB 2H6DA 4FMQA 3HAVA 4QMWA 4RQKA 4JVGA 4C4EA 4NK9A 3JY9A 4L52A 4JQEA 2I1MA 3AQVA 5JFVA 2IZTA 4KIKB 4BCJA 3R9HA 1PKDA 4AFJA 3MY0A 3TJCA 3QKMA 3L8PA 5CI7A 4CRLA 2YABA 3C50A 1IR3A 4F4PA 3RZBA 1BYGA 3DPKA 4CZUA 2IO6A 5GJFA 2VAGA 2F57A 4JXFA 3OEFX 2B52A 2UUEA 2W5AA 5E8VA 4GKIA 4KUJA 2EB2A 3BEGA 4FNYA 4JI9A 4C35A 5KMJA 2ITVA 4G6OA 2W5HA 3LXNA 2EXEA 4CCBA 4D2VA 4M97A 3R63A 4PP9A 4W9WA 1YOMA 1BUHA 4FT5A 4A9TA 4QP9A 4FIJA 3FPQA 2Z7LA 3DJ7A 3EL8A 2XIYA 2XKDA 4PMMA 2Y8OA 3PE1A 1K9AA 4FOCA 1Q8TA 3F5UA 4IAFA 4NKSA 4HYSA 4AXAA 4E5AX 2IVSA 4F0IA 1PYEA 3KXMA 5J95A 3VVHA 4DTBA 3ROYA 2WKMA 3QZHA 4RX9A 3L8SA 2OXYA 2XJ2A 2XM8A 3NNUA 5D12A 3K3JA 5C8MA 4B0GA 3H9OA 4G3FA 5IMEA 2WMTA 3BEAA 3ELJA 1P2AA 2C0OA 1BX6A 2Z60A 1G5SA 3KMUA 4LV5A 1GAGA 3OZ6A 1UU3A 4D4VA 2A1AB 4RIYB 4EOPA 3A61A 4R8QA 2WNTA 3TZ8A 2PYWA 1IASA 4IB1A 2W9ZB 5KMKA 4C59A 3NW7A 3FKNA 4KABA 2BAJA 2RGPA 5D9HA 4MBJA 1PMEA 1U54A 4J96A 4NCTC 3BLHA 3KQ7A 4EOOA 2IW6A 4DH8A 1OKYA 3NZ0A 4LRKA 2E9OA 3AMYA 2OBJA 4FIEA 1XBAA 3PPJA 4GYIA 2X9EA 4C4HA 2ITNA 2KULA 5CANA 3W2QA 2V62A 2QVSE 5EHYA 5AUTA 4FZAB 5FQDC 4I6HA 3D2IA 4OTIA 3UOKA 3HDMA 3VS1A 4U80A 2QURA 4RWIA 1Q99A 3DQXA 5IF1A 4TZRA 4C57A 3DQWA 2OIBA 4EH3A 2ZB0A 5AUWA 3COHA 5IUIA 3ORTA 3K5VA 3MFUA 1GNGA 5HU9A 1KE6A 4J99A 5CASA 2O2UA 4PF4A 4RJ5A 3TIZA 5CY3A 3GU4A 2JBOA 5CENA 3QRJA 3ZXZA 3FV8A 4G17A 1E9HA 2C1AA 2R4BA 4JG7A 5AJQA 1RJBA 4X3FB 5LVNA 4FIFA 4FL1A 5F4NA 2CGXA 4BCIA 4BBEA 4O0UA 3FEGA 3WBLA 3KRWA 4K33A 2EB3A 4F9YA 3R1SA 1XO2B 2ZYBA 4ZTLA 4PDOA 1R1WA 4BDHA 4DF3A 2BALA 4L44A 3KF7A 4BDCA 2Q0BA 4DFLA 4NJ3A 3POZA 4DFBA 4C62A 2UW9A 5DVRA 3SRVA 4A9RA 2ZV2A 3OWLA 4BGQA 3NLBA 3VN9A 1OUYA 2PK9A 2VGOA 4BKJA 2XJ0A 3C4FA 3KMWA 3R7VA 3CP9A 4ITIA 3RKBA 5HTIA 2CKQA 3MESA 5M08A 2BILB 3E8EA 2XIKA 4QYFA 4YJUA 5CXZA 4LGHA 3D5WA 4W4XA 1UU9A 1NY3A 3KXZA 4BYJA 3NYOA 3VUHA 4L00A 4CKRA 4MYGA 5FM3A 3EQRA 3HMPA 3QRIA 1V0PA 1FQ1B 2ONLC 2WTCA 4IM2A 4EYJA 3NUPA 4FX3A 3PY0A 5EM7A 2OU7A 3CR0A 4RIXB 1L8TA 2HELA 3N4UA 4LUDA 3QTSA 3KA0A 4I6BA 2PTKA 4C4JA 2ZV7A 3EQPA 2QD9A 3KN5A 1LEWA 3GCUA 1YHVA 3C0IA 4M66A 4EWHA 3DA6A 4FT0A 1H1PA 2OKRA 3MI9A 3AT4A 2B54A 4KKEA 4PL4A 3A7JA 3B2WA 4EKKA 4WD5A 4GT4A 2UZLA 3DU8A 3E8DA 2YIQA 4R1VA 4FV9A 1O6KA 4JBPA 4AN2A 3C9WA 3DKOA 3DJ5A 1FVTA 3I5NA 3KGAA 2VGPA 3MBLA 4L43A 4QPMA 2C3IB 3MJ2A 4H3QA 2JIUA 4XH6A 5EHOA 4AZWA 4EOQA 3P78A 2X7OA 3CBLA 2W4KA 3QKKA 5CXHA 3QFVA 3PJ2A 4ZJVA 3W1FA 2ZDTA 1Q3DA 1UV5A 3DLZA 4R3RA 4YURA 4UV0A 1H4LA 4USEA 5AADA 1BMKA 1TQMA 3UP7A 1CKPA 3F3WA 1PXOA 2DS1A 3DAJA 3OFMA 4AZVA 4R7HA 2ZAZA 3FLYA 3F82A 4A4OA 3TL8A 4P5QA 3TZ7A 4CMOA 5JRQA 3D94A 2VWYA 3L9PA 3Q9ZA 1I09A 3KB7A 4PV0A 3TNHA 3F3VA 4IX5A 5EOLA 3NAXA 5A3XA 2ERZE 4BGHA 5TKDA 4D4RA 3IONA 4X2GA 2VX0A 1OL1A 5IU2A 3LFBA 3VAPA 1OPLA 2BVAA 4ZY5A 4C2WA 4TXCA 3TNPC 1XJDA 3BYVA 5JFWA 1LPUA 3Q32A 4I1ZA 4O83A 2XK4A 2J4ZA 4D58A 1Q4LA 5AP3A 1YOJA 4JDIA 3H9FA 5A14A 5FTQA 4IE9A 3UOHA 4DHFA 2CGVA 3HMNA 3VBYA 4FA2A 2E9UA 1H00A 3P23A 3UMWA 4XCUA 4R5YA 3RVGA 4YNOA 4XYFA 3DTWA 4X2NA 3UO4A 2YN8A 4ALWA 2ZDUA 5EM6A 3OROA 2IG7A 4JOAA 3QALE 2X8IA 4Z7GA 1E1XA 5CF6A 4XS2A 5BYLA 2O8YA 3GCSA 1CMKE 3ET7A 3O51A 5HE0A 5AUUA 4FV0A 2C6LA 4J71A 3LCTA 4EC9A 3RCJA 1YI4A 5FBNC 2R3NA 2E9VA 3S0OA 3QLFA 1MRVA 5DT4A 2YM3A 1SZMA 4KRCA 4FL3A 2HZNA 4HZRA 4IADA 1W83A 4IDVA 2C6TA 4U3YA 5CF4A 3IOPA 2IW9A 3C4EA 3SKCA 3VS0A 4M0ZA 2VV9A 4FYOA 1WVWA 4X3FC 2P2HA 4PL3A 4AAAA 3OMVA 2J9MA 4CRSA 3GC0A 4MBIA 2OJJA 5L6PA 3MV5A 4DTAA 5HGIA 5ANDA 1H01A 3CQWA 4GFGA 3RMFA 4E3CA 2J0IA 5E4HA 2DWBA 4DT8A 4GT5A 4QMZA 4UZDA 2JDOA 2X8EA 3N9XA 4O2PA 4KIPA 3OCBA 4Y8DA 4ALUA 4V04A 1OIQA 2XB7A 4FEQA 3GC8A 1DI9A 4RJ8A 1JAMA 3Q60A 1Y8YA 5KHWA 4E1ZA 3RAIA 3ZRMA 1OIRA 1GOLA 2W1IA 2C30A 2ZV9A 1PXNA 4AA4A 2GSFA 4LL5A 4NU1A 4FKUA 2I40A 5L4QA 2V7OA 2EXCX 3FJQE 2YJSA 3BIZA 3HNGA 4QTAA 5DRDA 5AP6A 1WVYA 2BRGA 3DBEA 3LOKA 3PVBA 4ANSA 4J97A 4FSMA 4DH7A 2C6OA 4TNBA 3QGWA 4M69A 5EYMA 4M12A 5CTPA 4DH5A 2QLUA 4DFUA 3HA8A 3AMAA 1KE7A 3Q9XA 5AMNA 4YU2A 1BL7A 2JIVA 3RWPA 4HW7A 3DK7A 4I0TA 3V51A 2XNPA 4FSRA 4C4FA 4BTKA 4D2TA 1FPUA 5I0BA 2GNFA 2UVXA 2XBJA 5B2KA 3BCEA 3RAHA 3HDNA 4DFYA 3LFSA 4IFGA 4F9WA 5HG5A 4IWPA 4UMQA 4ZTNA 3LFCA 1ZOGA 2R3MA 5KMMA 5AAGA 3QAME 1ZLTA 2JKMA 3ENHA 1R39A 3ODZX 3ZRLA 3D5XA 3IW8A 4DLIA 5HTCA 2E9PA 5CT7A 5LMAA 2YIWA 3JS2A 4O1OA 2JDRA 3CJFA 4YTCA 3PXZA 3D83A 4E6AA 3DBDA 3EN5A 5HBEA 4BC6A 5T3QA 5JMSA 4NH1A 4RMZA 2GS2A 4RC3A 5HO8A 4D4SA 5ANJA 2BAQA 2BIKB 2PZPA 2OZAB 4H1JA 5F1ZA 3U4WA 5L2IA 4FSZA 4BY9E 3ZCLA 2CMWA 5E8UA 4NCTA 3DT1A 4CNHA 3Q9WA 4XG4A 5AM7A 3HP5A 3RAKA 3VO3A 2J7TA 4UWCA 3W33A 4XRLA 2VNWA 3WF6A 3W8QA 4BL1A 3AC2A 4FTNA 4QMSA 2GFCA 3ZFYA 2Y9QA 4L53A 1J1CA 5IQBA 5HICA 4BBMA 2LGCA 4ARKA 2ITOA 5IA0A 3RK7A 2QODA 4FKIA 2YIXA 2I6LA 4DA5A 3F69A 5AP5A 5AP7A 5HE3A 1H26A 3ZUTA 4AT4A 5JGAA 4MHAA 4F09A 4HOKA 3G2FA 3O8PA 4S33A 2XIXA 3R22A 4XV1A 3UNZA 4HZSA 3VUMA 2AC3A 3FLNC 3UQCA 3OT3A 4EH9A 3QUDA 1Y57A 2ZB1A 4WUAA 4HYIA 2VWZA 2CGUA 2PE2A 3E3PA 4FKQA 4AOJA 3UDBA 1Q8UA 2QOLA 2JFLA 3QF9A 5D11A 3SA0A 4DCAA 1UWJA 3A8WA 3ERKA 2JFMA 3EH9A 3RHXA 5FLFA 4Z3VA 4C4IA 4U40A 4DEGA 4WNOA 5FWKK 4CLIA 4O7WA 3OXZA 4N6ZA 2YWVA 1OL7A 4DEAA 5JT2A 3CPBA 4L67A 3LMIA 5D7AA 3E8CA 4ZLYA 3P5KA 3KY2A 3E92A 3GNIB 3UZRA 4MF1A 2WTKC 3U6IA 2OK1A 4I5CA 4LRJA 3VS4A 4B9DA 4LI5A 4QP7A 5H8GA 4BCNA 3QQKA 4B8LA 3FYJX 3JXWA 3NPCA 4U43A 4W8EA 4XNEA 2X2MA 5CSWA 5A4TA 5C4KA 4CGAA 2R3JA 1OKZA 4WHZA 4I93A 3W8LA 1M17A 5KMIA 5L2TA 2BKKA 2FO0A 2W4OA 2QO9A 1A9UA 3P0MA 3PLSA 4M84A 2JDTA 2HY81 2YEXA 2VTOA 3HRBA 2C5YA 3KRRA 4FGRA 4LOPA 2ITUA 4U9AA 4FSQA 2BDJA 2UW0A 1B6CB 4ZEGA 4FV7A 5KO1A 3ZO3A 5LJJA 3BI6A 2GQSA 1JVPP 5AIKA 5KMOA 5AM6A 4PWNA 4DGMA 3GC9A 3AGMA 2B1PA 2B53A 3QQFA 3NIZA 4EONA 4DE4A 4BTJA 2WAJA 2X6DA 4N6YA 4FTRA 4CEGA 5I9WA 3IK3A 5CF8A 3MA6A 4KIKA 4KD1A 4F70A 5DR9A 5IQDA 1H1WA 3HAMA 3REPA 1OL5A 2C3JA 3LJ0A 4K18A 3A2CA 3RI1A 5IZFA 1IAJA 5FP5A 2BTSA 4XP0A 4XUFA 2F2UA 3NSZA 1OIYA 3BU3A 5L8KA 2QO2A 4QMOA 3MH3A 5E92A 3UVQA 3EL7A 5CSVA 3UZPA 4EUTA 1QMZA 1VYWA 3W2CA 4BIBA 3UP2A 1R3CA 5CU6A 4EC8A 3BZ3A 4DH1A 5I3RA 2HXQA 3RK9A 3U55A 4CG8A 4UXQA 3WZKA 1YVJA 3QWKA 3RJCA 4HVIA 5DN3A 2YZLA 4RSSA 2X39A 3EHAA 2Y7JA 3CGOA 5CAOA 3N4VA 1SNUA 1NT2A 3GBZA 2OSCA 2IVUA 4C4GA 3ZLSA 4QTEA 3BQCA 3ZM9A 2JD5A 2NRUA 3WIKA 3FC2A 4YMJA 4Z16A 2P33A 3BHUA 3DTCA 3BLQA 4XBUA 3SXSA 5KZ0A 4FF8A 3UVPA 2XEYA 3GU6A 3W2RA 4DBXA 4I5PA 4IZ7A 1JSUA 2BDFA 2HZIA 4CTBA 4UEUA 5F95A 5FUTA 4TPTA 3WILA 3WZUA 4C3FA 3DB8A 3U9NA 4G3EA 5ANIA 3ORNA 4FKVA 3L8VA 4OUCA 4PPBA 5H3QA 1UA2A 1SVHA 1J7IA 4FV1A 4RIYA 5AR2A 4GU6A 3BGZA 2BRHA 3DXNA 4HGEA 5FXRA 2FA2A 4NW5A 3OOMA 2F4JA 3I60A 4CMTA 4EORA 1XH4A 4AGUA 4E8AA 4YNEA 2WMRA 4L01A 2R3FA 4BCPA 3QZGA 2R2PA 2XYNA 5HHWA 2XF0A 3OCSA 5M07A 3A4PA 3DS6A 2I0VA 3Q6WA 3W10A 4DT9A 1PMUA 1J1BA 5IMXA 1YW2A 4LV8A 1MP8A 3HL7A 4E93A 3GXLA 3ORZA 4IAKA 4R78A 2WO6A 3G6GA 3NUYA 3VW6A 3QTXA 4O0RA 4L42A 4DBNA 3NYVA 3WE8A 2XIRA 2DUVA 4IAIA 4DG2E 4HNIA 5HG7A 2QOKA 4E6QA 4KB8A 3VUDA 5HCYA 4O7YA 2QOOA 4Y5QA 4C34A 4F7SA 3MH1A 3GUBA 4CFUA 2YERA 3UBDA 1M52A 4FV8A 1UU8A 1QL6A 1ZMVA 3DNDA 1M2QA 1V0BA 4ZLZA 3O8UA 3F2AA 5BUJA 3TUCA 5KMLA 3RK5A 4CFFA 1SVEA 2Y6OA 3K2LA 4ASXA 1J7LA 5HBHA 3QYWA 1XWSA 2YHVA 2ETMA 2QKWB 4U44A 4DG3E 4X3FA 3EZRA 4QQ5A 4L6QA 5FXSA 4ERWA 2OWBA 4UMPA 3I6UA 2UZUE 3BU6A 3TACA 5HD4A 4CLJA 4F7LA 1YDSE 3MW1A 3CLYA 3ZC5A 1XH6A 2WFYA 3DAEA 3PG3A 4YJNA 4O0SA 4I5MA 3FWQA 4XEYA 3VF9A 1WBPA 5KKRB 4TWCA 2A4LA 3A99A 3HA6A 4O22A 1YXVA 1GZOA 1YKRA 3D2KA 3BKBA 5EI6A 4U45A 3WF7A 4EEVA 1ZYCA 1PMNA 4IWOA 5D7VA 3TNQB 4AZFA 2Z7QA 4LRMA 4EHVA 1WAKA 4I92A 4R3PA 2X7GA 3NVMB 1OMWA 2UZNA 3EKNA 2RFNA 5IA2A 5L3AA 5AUZA 3R71A 4IANA 4QMMA 3BBTB 2HCKA 4YTIA 3WZDA 5JKGA 5AP2A 4IB3A 3FAAA 4RWKA 3TWJA 4UMRA 5IQGA 2QC6A 4KNBA 3KRXA 4C7TA 4O84A 4YC3A 1PRYA 5JZNA 4C33A 3GENA 1G8AA 3QXOA 3NNXA 2PMIA 4EOMA 4HVDA 3IDBA 3HEGA 4FTAA 4RIXA 5EW9A 2XYUA 3V04A 4JG8A 2Y4PA 3LMHA 3VBVA 5M44A 4I22A 2H9VA 3RZFA 2ITQA 4MQ1A 4RG0A 4J8NA 5A46A 3AT3A 3FY0A 1REKA 1UNLA 2YAAA 3OHTA 1Q24A 2XM9A 2QI8A 2WQMA 3R2BA 3ZSHA 3C13A 1H8FA 3MH0A 4E7WA 2QO7A 5BNJA 2OIDA 1MQBA 4JRVA 4P90A 3GQIA 4KBCA 5ETAA 3U6JA 2WMXA 4NM3A 2B55A 4C37A 1GY3A 3EMGA 4FKGA 3ULZA 2G2FA 2P0CA 2R3OA 4H36A 3QTIA 4OTHA 4IB5A 3I7CA 4M67A 2Q83A 5IQIA 2VO3A 1ZYSA 5M4IA 5GIOE 2VTQA 4O0VA 4I23A 3CKXA 4BCOA 4ZOGA 5HQ0A 3Q52A 5J8IA 4CZYB 3AMBA 4IDTA 4ASZA 1L3RE 4QYYA 5L2SA 4EOKA 2W7XA 1WBOA 4YO4A 3WZEA 2C5VA 4XOZA 1H28A 2WMSA 4II5A 4DGLC 5M53A 3EQIA 4BZOA 3UJGA 3IW7A 4PMTA 4B8MA 5CAQA 3EFWA 2F7XE 2J5FA 3KEXA 1K2PA 4WNPA 4BHNA 4FT9A 4IB0A 4YHFA 2C6DA 1ZAOA 2WMWA 4EHZA 4TYJA 5C8NA 2RG6A 4BWKA 2CHLA 2CJMA 2VNYA 3M11A 5ACKA 3ZU7A 1J3HA 5LMBA 5BVDA 2XK6A 3LCOA 3ZRKA 5TR6A 4FBXA 4PL5A 4P2KA 2WTIA 5GZ8A 2PE1A 4ZS0A 4X2JA 2QHMA 4RC4A 4H1MA 3E7VA 2GTMA 3TTIA 5E8TA 2WXVA 3BWJA 3L9LA 4XP2A 4AOIA 4WRGA 2GNHA 4M13A 5M51A 1QPJA 1JPAA 3FMJA 4BI1A 1W8CA 3NUSA 4ZSEA 3UO5A 3FI8A 1ZARA 3C51A 4WSYA 1PXIA 3T9IA 3JR1A 3SG9A 4PDYA 5E8ZA 2R3RA 2BPMA 5IQCA 2VD5A 5FTGA 5EFQA 3CGFA 3A7GA 3MVHA 4YJPA 2GQRA 3SXFA 4USDA 5IUHA 2J6MA 3R1QA 4CFMA 1KOBA 3ZLWA 2CNQA 5CSHA 4IM3A 2UZOA 3QD4A 4JLCA 2NO3A 3R9RA 4LUEA 3CIKA 5JFXA 5DG5A 4JDKA 4FODA 4BHZA 2PZ5A 5C4LA 5M4CA 1VJYA 3FQSA 1FVRA 2PVMA 5AR3A 2RFSA 5C26A 1PMVA 3OBGA 4KKGA 3M42A 4QP1A 5JRSA 3ITZA 4GT3A 5FEEA 3VUKA 5DT3A 5K3YA 3E93A 3IW6A 4S2ZA 5CF5A 4RFZA 3E5AA 2BFXA 5GINE 3C1XA 4KRDA 4ZJJA 3NNVA 5KKRC 3E88A 5TO8A 1ND4A 5BUIA 2G15A 3FLZA 4TYEA 5G1XA 3JVRA 2R3KA 3K54A 3WF5A 4NM7A 3DZOA 4XV9A 3R1NA 4E5WA 3SW4A 4AGDA 4CYIA 4L45A 4CSVA 1YI3A 4C0TA 3GCPA 2XNOA 3DZQA 2IPXA 1ZY4A 3FHRA 3R83A 3HVCA 2WQOA 3VQUA 1GIIA 3JY0A 3NWWA 4JR3A 3ZLYA 2VTRA 2F2CB 4BZDA 4NM0A 3SW7A 3GQLA 5EYDA 2RF9A 3HV3A 1I44A 2VWIA 2SRCA 3T8OA 5I9ZA 1ZRZA 2UZDA 4IX3A 1YHSA 4AZSA 2YM7A 3MPMA 5GJDA 3MS9A 4E4NA 4GMYA 3PLAE 2EWAA 5DE2A 5FXQA 3W18A 5LCKA 4ZTSA 1OBDA 2PHKA 5CX9A 2O3PA 2PWLA 4I4FA 4QO9A 5IDPA 2XNNA 5EYKA 3DV3A 5JQ5A 4FSTA 2C6EA 4MTAA 1YXUA 3TKIA 3UIBA 2G9XA 4FTCA 4NT4A 5EYCA 3ZSGA 4DITA 5ETFA 4J1RA 5CWZA 3TZMA 3LXKA 3NYXA 4XLVA 5E7RA 4XV3A 3ZO1A 2REIA 4RGJA 3VJNA 1YDRE 4GK4A 4YZNA 3NUAA 2F9GA 3DOGA 3GCQA 2G2IA 5EM5A 3EN6A 4DN5A 5A4QA 3AT2A 4YHTA 4B7TA 5C27A 3V8SA 4FSYA 4KIQA 2B9IA 3PY1A 3KMMA 4YPDA 4H39A 2GS6A 2ETKA 4FSUA 3SHEA 5HNIX 2QKRA 2PY3A 3CQUA 4RX7A 4XHKB 4UX9A 3F61A 4EL9A 4ZMEA 4QQTA 2C47A 3BX5A 3L9MA 4IIRA 3TM0A 4EWQA 3TCPA 4IVBA 2WPAA 5M4UA 3CD3A 2OZAA 2H34A 4RLKA 4A06A 5KNJA 2NNWB 4J8MA 2OIQA 4Z7HA 4V01A 4AE9A 3IGOA 2QR7A 4QQJA 3R8UA 4O91A 3FI4A 4DEIA 4GW8A 2P4IA 4U42A 3U4UA 2W1ZA 4RVTA 4QNAA 5M09A 2WB8A 2ITXA 2X8DA 4FEUA 1AQ1A 4KA3A 5HO6A 3H30A 3O50A 4F08A 4MBLA 2OJ9A 4TW9A 3ETAA 4RX5A 3DDQA 4ZAUA 3KXNA 1TKIA 3UC4A 4CFVA 4IAZA 3TT0A 3PXYA 5I5ZA 3Q53A 4PRJA 4DCEA 3ZM4A 3FYKX 5IA5A 4Y73A 2HWOA 3D7TB 2B9FA 2YA9A 5HEZA 2R3LA 5EKNA 2RSVA 5IQEA 2HW7A 1H07A 3DKFA 5HLNA 4RWJA 4ZY6A 2ZOQA 3COKA 3KK9A 3QRKA 4G3CA 3NMUF 3V8TA 3VULA 1CM8A 3GVUA 5GHVA 2ERKA 4E4MA 3VBQA 4D5KA 1ZYJA 3Q4CA 4FZFB 5F94A 4HCTA 4IBMA 3UIMA 3OT8A 1XH7A 3PVUA 4U5JA 5J1WA 4NEUA 4NW6A 5J1VA 2VWUA 2ZV8A 4YZBA 3LFEA 4D9UA 3I81A 2VX1A 1WMKA 4XG3A 3PZEA 4GS6A 2R0UA 1YOLA 2W1HA 2W96B 3PIYA 4DG0E 1IEPA 1UKIA 3EN9A 4YZMA 2ZMCA 4MD9E 3OF0A 3I7BA 5J7HA 3O2MA 5ANGA 2HYYA 3EQGA 4G3GA 4Y85A 3AGLA 2X81A 1SVGA 3Q6UA 5HU3A 3NCZA 1LR4A 4BDAA 4H58A 1ZYLA 4PTCA 5CT0A 4EOLA 2R3IA 3RM6A 2BKZA 4ZIMA 4BWPA 2GMXA 1BI7A 5CQWA 4C38A 1H25A 2VU3A 1ERKA 3FZRA 4K1BA 4LYNA 5FEQA 2J0JA 4A4LA 4DINA 5B2MA 1PXMA 4RIWB 4YZCA 5T68A 3VBTA 3R7GA 5IA3A 3N51A 2FSLX 1MRYA 2GHMA 2PVHA 3BV2A 4C3PA 5LMKA 1G8SA 3A7IA 3Q2JA 5CSXA 1DS5A 4TYHB 4RRVA 1JQHA 5HOAA 3MYGA 3ORMA 4JAIA 3FQEA 5HI2A 5K4IA 3PDTA 4QD6A 5H8EA 1HCLA 4YZDA 3TXOA 3BWFA 4F65A 2ZMDA 4JDHA 2CNUA 4QMLA 3T3UA 4CQEA 5AV3A 4QQCA 4HVSA 3Q3BA 4LM5A 3QGYA 5GZ9A 1FOTA 5DNRA 3ZSIA 3RNIA 3W32A 4BCMA 4F9BA 3MGYA 3OXIA 4RFYA 3DB6A 3BQRA 4XBRA 1QPDA 1SMHA 2JEDA 3RTPA 4D2RA 3SAYA 5L2WA 3LFAA 5IQFA 2XH5A 4O7VA 4M15A 4IFCA 3UYSA 3TNIA 3O7LD 3GU7A 4HNFA 3EQCA 4JX7A 4KBAA 4XJ0A 3KK8A 4FNZA 1WBWA 3C7QA 5A6NA 2WIPA 2Z7SA 4EBWA 3FLWA 3RPSA 4EQMA 4EOIA 3R0TA 4ITHA 2GQGA 5AR8A 3UO6A 3CJGA 4FT7A 4OW8A 2A2AA 4QRCA 4CKIA 2JKKA 4OTFA 2VZ6A 2W05A 2XNBA 4IC8A 4ANNA 4R7IA 3OEZA 3NCGA 3OD6X 1A48A 2X7FA 2YDIA 3ZHPC 3U8WA 2R3GA 4EQCA 1WBVA 4PDSA 3AD5A 2WMQA 3E3BX 4O81A 4FV6A 4MH7A 4I94A 3SVVA 5BVOA 3ZXTA 4E4XA 3BYSA 2BRNA 1W7HA 3O71A 2DYLA 3K3IA 4YGAA 3PYYA 1ZMUA 4FV5A 4FVPA 1WBNA 1M14A 5BX0A 3PJCA 5IQHA 5J5TA 3R6XA 5J5SA 3HMOA 4DFXE 1KE8A 3S00A 3WARA 1ZZLA 4NYEA 3DJ6A 3IQ7A 4AGCA 5J7BA 4X3JA 1Y6AA 3OW3A 3SX9A 2QG5A 5CU0A 3PSCA 4XG6A 1PHKA 2PVNA 4CVAA 2VTMA 2VWVA 2OXDA 5E9EA 3PZHA 2PZIA 3QQJA 2X1NA 2P2IA 5EQYA 4F7NA 3QRTA 5CS6A 4EH5A 5DFPA 3VS5A 4EKLA 3AC1A 1YI6A 4W4VA 2XNEA 5ANEA 5FEDA 3QWJA 4JT3A 4OAVB 3R8VA 2XUUA 2YLFA 4R77A 3E63A 5ITAA 4PUZA 4BDJA 4NL0A 1P5EA 2YCQA 2QOQA 3AC3A 4NKAA 4YLKA 5AIRA 5LXMA 3FDNA 3TUBA 3HV7A 2ITTA 1SM2A 2GDOA 3VUIA 4ZMFA 2BRMA 4RQVA 2CPKE 3FHIA 4UMUA 2UVZA 4JIKA 4IZAA 2QR8A 3VBXA 4EH4A 4RJ6A 2PMNX 1BL6A 2IZSA 3C4ZA 3OXTA 3ZLXA 2CKEA 4O7TA 1WVXA 3GOPA 3CY2A 5C01A 2HZ4A 3VUGA 4F9CA 4FTTA 3NRMA 4XRJA 3VNTA 3R2YA 4A9YA 2JITA 1R0EA 3ZTXA 1LP4A 3KRLA 5I9YA 1JWHA 4ZSJA 3UNJA 2WMBA 4M0YA 4AW0A 2X6EA 3O17A 5BYZA 4V0GB 5DOSA 3B8QA 5EI8A 4EOJA 2W1DA 3WIGA 4ACMA 4QMTA 3QQGA 4GRBA 4DAWA 5CAUA 5AV0A 3A7HA 5E8XA 2WMUA 4JIAA 1YXXA 2HIWA 2NRYA 3AOXA 3R7UA 4GFMA 3QUEA 2XK9A 3F7ZA 3KF4A 1OBGA 3QCSA 4NSTA 3ZEWA 4ANQA 1Q8YA 4AF3A 1Q62A 3R01A 4FEVA 4QMNA 4C61A 2GU8A 1YHWA 2F7EE 4DFZE 2AUHA 3F3TA 5E8SA 4XMOA 2Y0AA 3GFWA 5AP4A 3QD0A 4M8TA 4BZNA 4FG7A 1CKJA 2WTJA 4RVKA 4RA4A 4K77A 3UIUA 4L3JA 5KBRA 4LMNA 4XOYA 3UMXA 2UZVA 3FC1X 3FBVA 4MXYA 3DY7A 4ANLA 4HPUE 3QQHA 4XG8A 4BWXA 3C4WA 2H96A 3G0FA 5CVFA 3HUCA 3POOA 4O1PA 1PY5A 3ALOA 4QOXA 4J7BA 2X2LA 4CT2A 4FIHA 4QNYA 2ZM3A 4MWIA 2PZRA 3N4TA 1P4OA 2XZSA 4NWMA 3D4QA 3PSBA 4ZZNA 1FBNA 5CEIA 3F3UA 4O0WA 3M2WA 2E9NA 4MEDA 3KU2A 1DM2A 2X4ZA 4HVHA 4GVAA 3MB6A 3QC4A 2VTNA 5AFVA 5K0XA 1A06A 1M2RA 4ALVA 4FSWA 5HVYA 2A19B 4CFWA 2WHBA 3G51A 3I4BA 2EXMA 3EQDA 3ANQA 4EBVA 3CTQA 4D0XA 2A27A 2CLXA 4MNFA 3TN8A 2GTNA 5H9BA 2CSNA 4IMYA 5AV2A 1IRKA 3R8MA 2C3LA 4FSNA 2OF4A 4ACCA 4O96A 1OM1A 4B6LA 3HX4A 4G6LA 4YSJA 2PVYA 5L6OA 1F0QA 4WUNA 2OFUA 2VTLA 3UTOA 3TDVA 4QMXA 3ZFMA 4CXAA 4K2RA 4XP3A 3ZDUA 4F0FA 4MK0A 5F9EA 3BHTA 3R8ZA 3TV7A 2YM5A 2BAKA 5FP6A 5FDPA 4I41A 2Z2WA 5CZHA 4O7NA 2VTHA 3NUXA 1SNXA 4BIEA 2EUFB 3C0GA 4U7ZA 4O0XA 3RALA 4FOBA 5GNKA
chains in the Genus database with same CATH superfamily
1WFCA 2EVAA 2OJGA 3HMIA 4QMUA 5IEVA 3LFDA 5AA9A 2W1CA 2WELA 3FKOA 3MPTA 4YBJA 2JBPA 4NIFB 4EH2A 2VO7A 5HG9A 3IOKA 5DR6A 5HBJA 3VBWA 2XK7A 3OUKA 1QPCA 3ZH8A 3CSVA 4YSMA 3C5IA 2OXXA 4FV4A 2J90A 5HESA 5JGDA 2G2HA 3NAYA 2QG7A 2PUNA 3ALNA 4DTKA 4G34A 1H24A 4TT7A 5M55A 4MNEB 3EKKA 4HGTA 4IX4A 3FLQA 3PRIA 4F9AA 2OI4X 3KCKA 4WG4A 4C8BA 3AD6A 1URCA 4L7SA 4O21A 5C03A 3TV6A 4FKOA 3C4XA 3VF8A 4EHGA 2C4GA 1PXPA 4E73A 5JGBA 3QXPA 4O7LA 2IZUA 4ZXTA 3F6XA 2J0KA 3OW4A 4LGDA 4DC2A 5JN2A 4KKHA 1Y8GA 4G16A 5CU3A 5K9IA 1UWHA 5AP0A 1GZKA 4ZK5A 2E2BA 4GVJA 1JKTA 4E26A 3FL5A 3R30A 3F9NA 4FL2A 5E90A 4BB4A 1LEZA 4FEXA 3PXRA 4EK4A 4CFNA 2VWXA 2PPQA 3NDMA 2PVRA 2JKOA 2X2KA 4U0IA 1BLXA 3RINA 4EH6A 3WE4A 4GYGA 3DXQA 4LDTA 2YM6A 4L68A 3IGGA 4RWLA 4Y83A 3W2SA 2QOCA 3EYHA 4YC8A 1XKKA 5K5XA 5I4NA 3FSKA 3UPXA 3VHKA 1S9IA 5BMMA 3ORKA 4FVQA 4Y95A 2C5XA 4OGRA 3L8XA 4AN3A 2BHHA 4GKHA 1O6YA 3KRJA 4FTMA 5M56A 3H0ZA 1ZMWA 3PPKA 2BHEA 2ITZA 5CALA 2JKQA 1TQPA 3R7IA 3FZ1A 4DEBA 5H2UA 4AP7A 5IQAA 4Z9LA 3W0PA 5CLPA 4GJ2A 4O0TA 4BDKA 4QP4A 3FI2A 4DEHA 2WTDA 2XK3A 3D0EA 4D5HA 2GNGA 4AWIA 2CCIA 3L9NA 1QCFA 1FGIA 3FXWA 4FG8A 3BYUA 3FMNA 4HJOA 4AA0A 1OZ1A 3QHRA 3MFRA 2UW8A 1U46A 4KS8A 4TY1A 5IEXA 3OY1A 1IAHA 1VYZA 5EDPA 3AC8A 4JRNA 4K9YA 3LLTA 1STCE 2BZIB 3I79A 5IH5A 1V0OA 5DLSA 2W0JA 4AZTA 3D14A 2B9JA 3LCKA 4QTCA 4Y5HA 5DRBA 4BDIA 5A4EA 1WBSA 1YQJA 4J98A 3OCGA 5HIEA 2UZWE 3DCVA 4MVFA 2RFDA 5H8BA 2ETRA 4FKJA 2R3PA 4QPSA 4GV1A 5BYYA 1DAYA 4UY9A 3SQQA 1OPKA 4ORKA 2Y4IB 4G3DA 1KUTA 2BZKB 1J91A 4TYGA 4HCUA 1H0WA 4PTGA 5EM8A 5HNGA 3UQGA 4BIDA 2R7BA 5FDXA 2YDJA 3BYMA 1Z9XA 4IM0A 3COMA 2AC5A 4PPAA 5ETCA 4I3ZA 1NVQA 4FTIA 3VW8A 3TTJA 4GIIA 1IA8A 5HZNA 2BTRA 1M7QA 3F7WA 3CQEA 2VTPA 3DK3A 5CYIA 3CEKA 4CTCA 3NYNA 1OITA 3BBWA 3PTGA 5HG8A 4Q9ZA 2CNVA 3PP0A 4LV7A 3PSDA 5KBQA 1XH8A 4BDGA 4MUQA 2XEZA 4GIHA 3LCDA 3LIJA 5B0XA 3UVRA 4KBKA 4FKTA 4FTUA 2GHGA 3P5JC 5E8WA 4QDVA 3QX4A 2PUUA 3Q5ZA 2V7AA 2W99B 5BVEA 4FV2A 5FBOA 3O5AA 3KC3A 3ZS5A 5IA1A 3HKOA 4LQMA 5ETIA 1UVRA 3LLAA 3CPCA 2UVYA 3D7TA 3UIXA 3O96A 4E6DA 3HV4A 4ZP5A 4UYNA 4YJRA 5KX8A 4F1MA 1ZZ2A 4HGSA 4NUSA 4JX3A 4L9IA 4BCKA 3QQLA 5LMKC 5HIDA 1MQ4A 1O9UA 2BROA 4Z55A 4KSPA 2PMLX 3MN3A 4J95A 3UGCA 4ZTHA 2A0CX 2QQ7A 2R3QA 3E62A 2OGVA 4YC6A 3VS7A 3UQFA 3VHEA 3VWAA 5KHXA 3BE2A 3P08A 3S2PA 3P4KA 5HVJA 3V5JA 4LFIA 4GH2A 3FZPA 5M57A 3T9TA 1KOAA 2XS0A 3LMGA 4QTBA 4YJVA 5BVFA 5FM2A 4FTLA 2XMYA 4Q5EA 1OKVA 4FZ7A 2QOHA 3TJDA 5EQEA 4XG2A 3CC6A 5D41A 4E4LA 4F6SA 1PF8A 3SG8A 4TWNA 3RPYA 1M2PA 4JQ8A 3CS9A 4ZTRA 1KV1A 3MY1A 5LVOA 3MB7A 1H1SA 5TOZA 3Q2MA 3QD2B 4S31A 1W98A 5HNBA 4YR8A 1U5QA 3EOCA 2R0IA 2FYSA 3R02A 4JAJA 5FD2A 4CG9A 1Q5KA 4RIWA 3C5UA 4OT6A 4PNKA 5TF9A 4I5HA 4MXXA 2FH9A 4OR5A 4X7QA 3AG9A 2QOFA 3QBNA 3LJ1A 3HP2A 3A7FA 4TYHA 5CQUA 3D5VA 3MPAA 4WNMA 4L46A 4TWPA 2Y6MA 3FPMA 3QHWA 5BQ0A 3EN4A 5K4JA 2ZVAA 2CKPA 2VTIA 3PRFA 1UNGA 3GGFA 4WIHA 3QKLA 2UV2A 3DKGA 2IVTA 5IUGA 1OB3A 3LVPA 3COIA 3SD0A 5JFSA 4FVRA 3UODA 3PG1A 3ZBFA 5AR5A 5CNNA 2Q0NA 4P5ZA 3LHJA 3GEQA 1TZDA 4OBQA 2YWPA 3EQFA 2B4SB 3H3CA 3AC4A 3OTUA 3O7LB 2OJIA 4ASDA 4EK5A 4E6CA 4WKQA 3ROCA 3TUDA 2XIZA 4I6FA 3II5A 5L2QA 2O63A 5BUEA 2Z02A 3HLLA 3TG1A 4RJ4A 3UC3A 3IKAA 4FG9A 3VRZA 4TL0A 3TEIA 4IZ5A 2WQNA 3PJ3A 1NVRA 4LL0A 4FV3A 1Q61A 5HX6A 3W2OA 4HGLA 3DK6A 2CN5A 4GFOA 1VR2A 2WTWA 2YCFA 5EG3A 3T3VA 2YCSA 3DNEA 4K11A 5AX3A 2NYAA 1H08A 2Y4IC 4D2WA 2XNGA 3RBWA 4ERKA 3W2PA 3FSFA 5BVNA 5KMNA 3G90X 1QPEA 3U51A 4H3BA 2HW6A 4D1XA 2WEIA 3CKWA 3QU0A 4OTGA 5T6KA 3IG7A 5CVHA 2BMCA 4E5BA 1JKKA 2QNJA 4DGNA 5LCJA 2JC6A 4D9TA 4DLJA 3HMMA 5DEYA 4OAUC 4C36A 4F1TA 4ENXA 4BN1A 2CN8A 3R28A 2IW8A 3D15A 3EWHA 3HUBA 1Z5MA 5HX8A 2C0IA 4W4WA 4PMSA 1RQQA 5HO7A 2R3HA 3CD8A 1DAWA 1AGWA 4AW5A 4FK3A 5LOHA 4RT7A 3A62A 4A9SA 4QP6A 2PVLA 4YZ9A 5BPYA 3SDJA 4JBVA 1UKHA 3S4QA 2OFVA 2GCDA 3D9VA 1OECA 1KSWA 3KN6A 3F5GA 1RE8A 4TRLA 1JNKA 5JK3A 3LFFA 4WO5A 3LQ3A 1Q3WA 3LAUA 1HOWA 2GS7A 3Q4ZA 5IG1A 5JSMA 4GSBA 4GUEA 4JBOA 2C1BA 4NJDA 3Q04A 5A54A 3KULB 4XLIA 4MKCA 4AOTA 2YM4A 5AEPA 1U59A 2OICA 4WOVA 5IEYA 5K5NA 5CZIA 4D1ZA 5DIAA 3NVKI 3W16A 3SOAA 1GIJA 3IECA 4JS8A 4KIOA 4ID7A 2XP2A 3TNWA 3MY5A 4ZSLA 3FLSA 2ESMA 4IWDA 3WYXA 3Q5IA 3NGAA 2FSMX 2PVJA 3PFQA 5CU4A 5DH3A 4TKSA 1ZY5A 2GNJA 3R7YA 2WOTA 1V1KA 2UZEA 4I21A 3MIYA 3KXGA 1B38A 2AQXA 4QTDA 5BV3A 1IG1A 5I9VA 3ZUUA 5HLWA 5J9YA 3PWDA 3LXPA 1NW1A 3PXKA 4JL9A 5E91A 2HY0A 2OJFE 3ACKA 4RZVA 5HCXA 2UW7A 3Q9YA 4V0GA 1APME 5ACBC 4AG8A 4XG9A 3QCQA 3KREA 5AP1A 3UNKA 5IISA 5HD7A 5DYJA 5IPJA 3QTWA 4M3QA 3R9OA 4B99A 1H27A 3DXPA 2C68A 3MH2A 2UZTA 2ZM4A 3PWYA 4RX8A 5AX9A 4F7JA 1P4FA 3MVMA 2AYPA 4O38A 4PDPA 3NFGB 2PVFA 4BR3A 3KCFA 3PP1A 5HKMA 3FZOA 4IAYA 4S30A 4FI1A 5D10A 2UW4A 4KSQA 5DBXA 4F6WA 4I24A 1W84A 2CGWA 3D7ZA 3PIXA 2QU6A 4P7EA 2W1EA 3VS3A 3BLRA 2C5OA 4G5PA 2W9FB 2PULA 4CV8A 3MVLA 1XMLA 3U6HA 2J51A 3W55A 4YJOA 2WQBA 3CE3A 2HENA 5HLPA 3UYTA 4QMQA 2CCHA 4NTTA 2LAVA 2XALA 3R00A 4GCJA 4YLLA 1GIHA 5J87A 5EDRA 1R0PA 4USFA 2JDSA 1YWVA 2YM8A 5LVPA 2PU8A 4BBFA 5KCVA 1OIUA 1XBCA 3OP5A 3FL4A 3JPVA 3FZTA 3R7EA 3Q96A 4O2ZA 2I7QA 2PZYA 3O0GA 1FVVA 3P7CA 5KUPA 3H9RA 4V05A 4O86A 3PXQA 1URWA 1ATPE 2R9SA 4AGWA 3FXZA 3RGFA 4L7FA 4BICA 2HAKA 1XQZA 5L8JA 4PNIA 3Q4TA 4K0YA 5JQ8A 4LGGA 3NW6A 4W4YA 1REJA 3QRUA 4QYGA 4RIOA 3SXRA 4G5JA 4XX9A 4YJSA 5BMSA 4PY1A 2KTYA 4AT3A 4D0WA 1JOWB 4FT3A 4KAOA 4HYUA 1EH4A 3IW4A 4PTEA 4QMPA 4WBBB 3TKUA 4TWOA 4ACHA 2I0EA 1Q8ZA 5CEPA 1GJOA 4C3RA 3A8XA 3GP0A 3BHYA 4O4CA 4TTHB 4X2FA 4BTFA 4WRSA 1MRUA 4WBOA 4BTMA 1CTPE 5ANOA 3BLAA 5AV4A 4Y72A 2X4FA 4FNWA 2V5QA 1Q8WA 3BHHA 2JDVA 2NP8A 3PVGA 4FIGA 1OI9A 2F7ZE 4YTHA 2OLCA 4LOQA 2IJMA 2YZAA 4F63A 2C5NA 1O6LA 4FZ6A 3FY2A 2B9HA 2W17A 4NIFA 4QP8A 4O82A 4QMYA 4ZJIA 2HK5A 4YJTA 3BV3A 1VZOA 4AE6A 3THBA 1OL2A 4M7IA 4A4XA 3NNWA 3NR9A 3EQBA 1XBBA 1Y6BA 3MSSA 3OWJA 4G9CA 4GL9A 4NFNA 4BI0A 4N57A 1KE5A 4MNEA 1UU7A 2VUWA 4O0YA 1WBTA 3EYGA 3ORXA 2NPQA 4FTKA 1CKIA 4LG4A 4BCFA 4AXCA 1FMOE 2R5TA 2YFXA 3PA3A 3PXFA 1Y91A 2VRXA 3HZTA 4FTJA 5C8KA 3PFYA 4QDEA 4GK2A 3DAKA 5EW8A 2C6KA 4FK6A 4R6VA 1JBPE 2RFEA 3DBCA 4IVDA 4FUYA 3I5ZA 5AR7A 4BF2A 4RC2A 4DEDA 3R9NA 5JEBA 2W06A 2CKOA 1YWRA 3R04A 3P1AA 2QU5A 4C58A 3NS9A 2YITA 5FTOA 1P14A 5DHJA 4RPVA 3PA4A 1GZNA 2WMAA 1BI8A 5AAFA 4APCA 3ORIA 4JBQA 3QZFA 2IVVA 3AC5A 3G33A 3M1SA 2XBAA 4MD8E 3VUTA 4BGGA 2OO8X 4ZTMA 4QYHA 3W0SA 2BZJA 3SOCA 2EU9A 4D28A 1OVEA 4OTDA 3KVXA 4F6UA 4YUQA 4IJ9A 5B7VA 3ZZWA 4AXFA 2W5BA 4RVLA 1OUKA 2PSQA 1YRPA 3EIDA 2OG8A 3BE9A 4MD7E 4YO6A 5IKWA 4CQGA 2PUIA 3W0MA 4FIIA 4IAAA 2HXLA 4JJRA 4JQ7A 3ZZEA 4F64A 3OTVA 4FNXA 4BYIA 5C1QB 5HCZA 3LQ8A 2VX3A 4KINA 4KS7A 2XKFA 2WIHA 3TI1A 3C4CA 3KKVA 4MCVA 3UG2A 1JKSA 1CDKA 3AKLA 2JGZA 4AN9A 2WTKB 2HZ0A 2OZOA 2AEGA 3S1HA 5DR2A 2WZJA 4DYMA 3L1SA 3KL8A 4GUBA 4MF0A 4O6LA 4Q9SA 4J53A 4WNKA 4EOSA 3LPBA 4U81A 2G01A 4FR4A 2F49A 3V3VA 4IWQA 4EHEA 3GC7A 4D2SA 5LWNA 4F0GA 5I9XA 1TQIA 4MXZA 2VO0A 2ITYA 4ITJA 4X6QC 3FKLA 2VTJA 2J0LA 3HECA 3MFSA 4BFMA 4PX6A 1OGUA 4EJNA 5GIPE 3B2TA 4OTRA 1U4DA 5I3OA 3H0YA 1PXLA 4CV9A 4MWHA 3QZIA 3EQHA 1YXTA 3EFJA 4O27B 3I1AA 4R7BA 5I9UA 4FKPA 3A4OX 4EI4A 4R3CA 4O7RA 3CTJA 1WCCA 5DA3A 3H10A 1HCKA 2BCJA 2FUMA 4QMVA 3MTLA 2WEVA 1H1RA 5GJGA 4PQNA 4CKJA 2YISA 3I0QA 5CEKA 1VEBA 4DHIB 2R7IA 4IQ6A 3GOKA 4BDBA 3EJ1A 1U54B 2GNLA 5BVWA 4PP7A 2GPHA 3QTQA 2QCSA 3QA0A 4S32A 3PA5A 3LFQA 5J9LA 2Z7RA 4IVAA 4Q5HA 4QPAA 5LARA 3S3IA 5JZJA 4XG7A 4X21A 5TT7A 3P86A 3GI3A 2XA4A 3ZO4A 1FMKA 3LCSA 3QLGA 2QLQA 3QYZA 3JYAA 5BVKA 4BKZA 2C6MA 2FSOX 3ODYX 5AWMA 5B2LA 4OT5A 4IH8A 4LOOA 4APPA 2GNIA 4OBOA 5C9CA 5DI1A 1GZ8A 4CD0A 4I0SA 4IJPA 2VTSA 2WOUA 1ZYDA 2ZM1A 1JLUE 3IPHA 3OY3A 3FUPA 4RJ7A 4RZWA 5EK7A 1OKWA 3E7OA 4HPTE 1LUFA 2RKUA 3MJ1A 5DPVA 3BYOA 1YXSA 4TN6A 4A9UA 2BR1A 2BUJA 2W1FA 2R64A 4DFNA 4D55A 1NVSA 4Y46A 5G6VA 5TE0A 4I20A 5L8LA 5J79A 3OG7A 1ZOEA 4JDJA 4YLJA 3ZYAA 2XK8A 3I0OA 3QTZA 4G6NA 3FI3A 1JSVA 5AV1A 3HV5A 3CTHA 5M4FA 3PJ1A 1AD5A 5LVMA 3U54A 2WQEA 4QP3A 5AA8A 2VTAA 3IDCA 2JAVA 3QQUA 5HE1A 4JMQA 4RVMA 2PUPA 1PJKA 3DLSA 4C02A 3EFKA 4U8ZA 2DQ7X 5DGZA 5EI2A 3P9JA 5ANKA 2OH4A 3SRVB 5EKOA 4MXAA 3SGCA 3FMLA 4BKYA 4DEEA 4MX9A 4EZ7A 3BHVA 4X0MA 4WT6A 3TKHA 4AT5A 2JAMA 3RWQA 5E8YA 3RCDA 3FQHA 4M14A 5CEMA 3FMKA 1PKGA 2XARA 4ZLOA 3VRYA 4ACGA 3E64A 4XV2A 3RM7A 3UDZA 1B39A 1ZOHA 3Q4UA 4ANBA 4Q2AA 1K3AA 1FGKA 2ZJWA 4G2FA 4BCQA 3UOLA 5HORA 2FSTX 5DEWA 2IWIA 3DGKA 4KWPA 3SC1A 2XCKA 3FMEA 3CY3A 4CFXA 3S95A 3AXWA 3F66A 4BVUA 3QD3A 4WA9A 4AX8A 1ZXEA 3KVWA 5J9ZA 2HOGA 3LQ5A 3PVWA 3V8WA 2UW6A 3OCTA 3BGQA 3F5XA 2RIOA 4AA5A 3LM5A 3LXLA 2FVDA 2VO6A 3MFTA 3SLSA 3ZMMA 4C2VA 3LM0A 4CZTA 5D1JA 5K0KA 4NFMA 4U97A 2XKEA 3E8NA 5CEOA 3C0HA 2JLDA 3ENMA 4X2KA 4RLLA 4AW2A 3AKJA 5F20A 2VN9A 3QUPA 3V5WA 2OW3A 3BPRA 3DBQA 4TYIA 4CYJA 4FKSA 5CEQA 3ULIA 4HCVA 5IH4A 1PXKA 4OTWA 3MTFA 5E1EA 2HWPA 3V01A 3U87A 3BU5A 4D2PA 5CSPA 4UWBA 4ANMA 5CAVA 4WSQA 3NUNA 1XH5A 4FZDB 3WF8A 3F5PA 3R8LA 3D5UA 3MDYA 3WF9A 4FTQA 4GU9A 4BDEA 3LFNA 3ZOSA 3QL8A 2UZBA 4FTOA 4ZSAA 1KV2A 3PIZA 4OTQA 4UZHA 3PUFC 3F88A 2ONLA 3BRBA 1Q41A 3RAWA 3IW5A 4UYAA 4FE2A 3E87A 3RNYA 4IC7A 3V5TA 2BFYA 4EUUA 2X0GA 1NXKA 4UN0C 3GU5A 2RG5A 2VWWA 2WU6A 3ZO2A 2UW3A 2V55A 3VS2A 4BCGA 4IACA 3LE6A 4AZEA 4IZYA 3V5LA 1R78A 1MUOA 2C69A 2V22A 4A7CA 4RFMA 4G9RA 2WGJA 4RJ3A 1YDTE 4J52A 3V5QA 4IHPA 4ZZOA 2CLQA 1XR1A 4FGBA 3G9NA 2JIIA 1F3MC 1RDQE 2RL5A 4UWYA 3RPRA 5FGKA 3R9DA 3TV4A 2V0DA 4HVGA 2BZHB 4ANOA 4OLIA 3QC9A 1YWNA 2YAKA 2YJRA 4ASEA 4FUXA 5KE0A 4YTFA 5A4CA 2C6IA 3OBJA 3PPZA 3ATSA 4IVCA 3PJ8A 2OH0E 4D4YA 3G0EA 1Q97A 4W9XA 2C3KA 4GG5A 3V6RA 3HRCA 2O0UA 1TVOA 3EB0A 3K5UA 4PPCA 3DFAA 4EK6A 5LWMA 4UB7A 5EH0A 5AUVA 2XRWA 3R1YA 3LKMA 4FKLA 1CSNA 2ITWA 3NEWA 4EH7A 1M7NA 2OF2A 1BKXA 3CXWA 3KXHA 3TZ9A 4AACA 4WG3A 2WD1A 5CNOA 3ZBXA 2PL0A 5HIBA 2I0YA 3ZFXA 3KULA 5IA4A 3QX2A 5M06A 1X8BA 3EN7A 3PY3A 2J5EA 4IW0A 3UPZA 2IZRA 4IXPA 4MQ2A 2P3GX 5IDNA 4YJQA 2G1TA 1H0VA 2FGIA 3DBFA 1PXJA 3QCXA 5KZIA 2H8HA 4MXCA 4QT1A 3RP9A 2YDKA 4AQCA 3HGKA 4AS0A 3OVVA 2I0HA 3UDSA 4A07A 4I4EA 4GJ3A 1OL6A 3LJ2A 4RBLA 1XHAA 1Z57A 2PMOX 2QOBA 3G9LX 4WG5A 5AAEA 3TDWA 1ZWSA 1ST4A 2FB8A 2WU7A 3VIDA 1JSTA 5FG8A 3O23A 2O5KA 4CCUA 4F1OA 3ID6C 2J2IB 4CT1A 3W0QA 4ZS4A 3QTUA 4U41A 5CI6A 3B8RA 4YP8A 1RW8A 1UNHA 4IX6A 1T46A 5A6OA 5FRIA 1W82A 3UG1A 1F5QA 4EH8A 4N70A 1W0XC 4OBPA 4UBAA 3WZJA 3FE3A 5DWRA 3OS3A 3FMHA 3QCYA 1PYXA 4NZWB 3V6SA 4DGOA 3G15A 4M69B 1G3NA 2IN6A 3FMDA 4UALA 3WOWA 3RHKA 3FMMA 3P7BA 3ZONA 2ITPA 5GZAA 2QHNA 5EW3A 4AUAA 4EQUA 2X9FA 4QEBA 1KWPA 4EZ5A 2BIYA 3R7OA 2BDWA 4OTPA 4DH3A 2QOIA 4B4LA 5HTBA 2BRBA 3ANRA 3TIYA 4O6EA 4MXOA 2XJ1A 5IH6A 2VWBA 2WTVA 2YLEA 5L6WL 3H4JA 3JVSA 1WZYA 3O8TA 5LVLA 4PMPA 4CMUA 3NW5A 4FKRA 3F3ZA 3OWKA 3HV6A 3NIEA 4FKWA 4FICA 2VTTA 3OUNB 5CU2A 5DMZA 4BI2A 5AUXA 5EOBA 4R1YA 4ZTQA 3CCNA 4N0SA 4ZSGA 3UE4A 2B0QA 3HRFA 3ML1A 2YIRA 3R21A 4FC0A 2P55A 4LMUA 4TNDA 3EFLA 4JNWA 4YBKA 3VQHA 3IO7A 5HE2A 3IDPA 4UXLA 4ZZMA 2UW5A 4S34A 5A4LA 4M68A 5EHLA 3LZBA 4H3PA 2PE0A 1OPJA 3ZC6A 5CAPA 4UMTA 4O4BB 2XCHA 4R5SA 2O65A 3BGPA 4YHJA 4GEOA 4BRXA 3GT8A 3NX8A 3LW0A 4U3ZA 5AR4A 2PVKA 3QTRA 3JUHA 3GU8A 4FEWA 4G1WA 2J50A 3PUPA 1KE9A 3R73A 2XRUA 4F99A 2YCRA 4W8DA 3PE2A 1NA7A 1H1QA 3QA8A 4ZY4A 2W4JA 3MVJA 2Z8CA 3EZVA 3WYYA 5JH6A 1J7UA 2WMVA 2C0TA 1U5RA 2YACA 1G8JA 3KXXA 3IS5A 4GG7A 3ATTA 3BL7A 4P4CA 3ZDIA 3ORPA 4L8MA 4YPSA 4K8AA 1FINA 3VS6A 3VC4A 4ACDA 4K6ZA 3DDPA 4D1SA 4DGGA 4BCHA 3G6HA 4BDDA 4EK8A 3F2NA 4I6QA 4RA5A 3A60A 3ACJA 4O4EA 5DT0A 4I0RA 3FXXA 4E20A 4FYNA 3NUUA 4QP2A 3VJOA 4AU8A 4EK3A 4EYMA 4EJ7A 2B7AA 3P7AA 4U6RA 2YIYA 4U79A 3UOJA 4X6RA 3P79A 5ICPA 4HYHA 5E1SA 3R8PA 4ONAA 1XH9A 3MWUA 3ORLA 4MAOA 5EDQA 5LQFA 3RPVA 3ZUVA 3ZEPA 4O7SA 5EQPA 4QYEA 3FZSA 3OOGA 3GCVA 3OC1A 2CDZA 3OWPA 4GK3A 4JG6A 4JR7A 4IEBA 1SYKA 2XNMA 4L3LA 4L3PA 3MIAA 1PW2A 3BELA 4N4SA 4AW1A 4BDFA 3UZTA 2XAMA 1E1VA 3SV0A 2W1GA 3MA3A 3WI6A 4NTSA 3DKCA 3I6WA 2O64A 2J0MB 3F2RA 2GHLA 5HVKA 2XVDA 1IA9A 1T45A 5AUYA 4ENYA 2GFSA 3TMOA 1JKLA 4O7ZA 4EZ3A 3RPOA 3G5DA 4H05A 3GFEA 3U9CA 3AD4A 3W0RA 3GB2A 5A9UA 2XANA 2QONA 4AFEA 4G31A 2XKCA 1S9JA 2ACXA 5CVGA 3V5PA 3HYHA 3KFAA 1DI8A 4NM5A 3DFCB 2H6DA 4FMQA 3HAVA 4QMWA 4RQKA 4JVGA 4C4EA 4NK9A 3JY9A 4L52A 4JQEA 2I1MA 4O4DA 3AQVA 5JFVA 2IZTA 4KIKB 4BCJA 3R9HA 1PKDA 4AFJA 3MY0A 3TJCA 3QKMA 3L8PA 5CI7A 4CRLA 2YABA 3C50A 1IR3A 4F4PA 3RZBA 1BYGA 3DPKA 4CZUA 2IO6A 5GJFA 2VAGA 2F57A 4JXFA 3OEFX 2B52A 2UUEA 2W5AA 5E8VA 4GKIA 4KUJA 2EB2A 3BEGA 4FNYA 4JI9A 4C35A 5KMJA 2ITVA 4G6OA 2W5HA 3LXNA 2EXEA 4CCBA 4D2VA 4M97A 3R63A 4PP9A 4W9WA 1YOMA 1BUHA 4FT5A 4A9TA 4QP9A 4FIJA 3FPQA 2Z7LA 3DJ7A 3EL8A 2XIYA 2XKDA 4PMMA 2Y8OA 3PE1A 1K9AA 4FOCA 1Q8TA 3F5UA 4IAFA 4NKSA 4HYSA 4AXAA 4E5AX 2IVSA 4F0IA 1PYEA 3KXMA 2IF8A 5J95A 3VVHA 4DTBA 3ROYA 2WKMA 3QZHA 4RX9A 3L8SA 2OXYA 2XJ2A 2XM8A 3NNUA 5D12A 3K3JA 5C8MA 4B0GA 3H9OA 4G3FA 5IMEA 2WMTA 3BEAA 3ELJA 1P2AA 2C0OA 1BX6A 2Z60A 1G5SA 1G8KA 3KMUA 4LV5A 1GAGA 3OZ6A 1UU3A 4D4VA 2A1AB 4RIYB 4EOPA 3A61A 4R8QA 2WNTA 3TZ8A 2PYWA 1IASA 4IB1A 2W9ZB 5KMKA 4C59A 3NW7A 3FKNA 4KABA 2BAJA 2RGPA 5D9HA 4MBJA 1PMEA 1U54A 4J96A 4NCTC 3BLHA 3KQ7A 4EOOA 2IW6A 4DH8A 1OKYA 3NZ0A 4LRKA 2E9OA 3AMYA 2OBJA 4FIEA 1XBAA 4AXEA 3PPJA 4GYIA 2X9EA 4C4HA 2ITNA 2KULA 5CANA 3W2QA 2V62A 2QVSE 5EHYA 5AUTA 4FZAB 5FQDC 4I6HA 3D2IA 4OTIA 3UOKA 3HDMA 3VS1A 4U80A 2QURA 4RWIA 1Q99A 3DQXA 5IF1A 4TZRA 4C57A 3DQWA 2OIBA 4EH3A 2ZB0A 5AUWA 3COHA 5IUIA 3ORTA 3K5VA 3MFUA 1GNGA 4O4FA 5HU9A 1KE6A 4J99A 5CASA 2O2UA 4PF4A 4RJ5A 3TIZA 5CY3A 3GU4A 2JBOA 5CENA 3QRJA 3ZXZA 3FV8A 4G17A 1E9HA 2C1AA 2R4BA 4JG7A 5AJQA 1RJBA 4X3FB 5LVNA 4FIFA 4FL1A 5F4NA 2CGXA 4BCIA 4BBEA 4O0UA 3FEGA 3WBLA 3KRWA 4K33A 2EB3A 4F9YA