3FJQE

Crystal structure of camp-dependent protein kinase catalytic subunit alpha in complex with peptide inhibitor pki alpha (6-25)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
336
structure length
334
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Comparative surface geometry of the protein kinase family.
pubmed doi rcsb
source organism Mus musculus
total genus 108
structure length 334
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fjqE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fjqE02
5JK3A 4XP3A 3C4ZA 2UZVA 2B55A 4BZOA 5M4UA 2WMBA 4GCJA 3PWYA 1PXPA 2E9NA 4TYGA 5HBHA 3DLSA 4QMTA 3PY1A 5BVFA 5GZAA 3QHRA 2JC6A 5EG3A 3ROCA 3A8WA 2QLQA 4QMZA 4J97A 2GNJA 3D5UA 3HNGA 5F95A 4H3BA 4E4MA 3UBDA 3UG1A 2PUIA 3MVMA 2WU6A 2W9ZB 2W7XA 4H1MA 4RJ4A 4AACA 3EN6A 3LQ8A 5EHYA 1CDKA 4RFYA 5TE0A 4DGGA 3ZZEA 2CKQA 3BRBA 3D14A 4FNZA 2WQNA 2RG5A 5M56A 4DC2A 1WBWA 2WZJA 3BU3A 3HV5A 4RC3A 5D11A 5ANGA 3II5A 4JQEA 2IJMA 5HD7A 3CTJA 5CASA 3KRLA 4MXZA 3ERKA 5A14A 4R5YA 4IX3A 2CGXA 4Y85A 4E20A 5JFSA 5KNJA 4HYUA 3P7BA 3HMNA 4JR3A 5CS6A 3P7AA 4D2RA 1CKIA 2GNIA 3VBWA 4BGGA 3MY1A 2X8DA 2X9FA 1K2PA 3FSKA 4CNHA 5FTGA 3BV3A 5AADA 4U3YA 2XIRA 3S0OA 4BCJA 2ZV8A 5AUVA 2QHMA 4O2PA 4BY9E 3HP5A 5C27A 5DFPA 4LRJA 3W32A 2WTWA 3UPXA 3BE2A 4RZVA 2XJ2A 4DH1A 2BAKA 2GSFA 3TUCA 1RJBA 3R8VA 4ZY4A 1JSUA 3R63A 3RBWA 4BCMA 4E1ZA 1OL1A 2JBOA 5J7HA 2VTPA 3BHHA 2XB7A 4CFMA 2HWOA 4UWYA 4G6LA 5HBJA 2H34A 4ZTNA 4EZ7A 4NM0A 4YZCA 2HZ4A 4RZWA 4EQUA 1JKKA 4EK6A 2IVSA 1L3RE 3OW4A 1F3MC 5IPJA 3E63A 4GL9A 2F7EE 4FTJA 3F3VA 5AR8A 4BBEA 3VUMA 4E3CA 4V01A 3LFBA 2R4BA 4GT4A 4TPTA 4WT6A 5CLPA 1WVXA 5T6KA 3MPTA 1KE5A 2BAQA 2PZIA 4FK6A 4KIQA 1XH6A 2W9FB 5AUUA 5BUIA 2BALA 4QTAA 5EDPA 3CKWA 2B4SB 4ANOA 3UIMA 3C5UA 4UYAA 3MPAA 3ANQA 5AV0A 4IB1A 4KKGA 2R0IA 3MH3A 4D2PA 1REKA 3R1YA 4F9WA 2PVYA 2QQ7A 2XIKA 2XZSA 3BU6A 2VTIA 1XH5A 2YWPA 1OB3A 3CC6A 4GT5A 3FLQA 1SMHA 1YXUA 4IDTA 3R7YA 4FICA 4EWQA 2VNYA 3RPOA 3R30A 5EW9A 1ZYLA 4U44A 2H6DA 1PKDA 3FZRA 4CGAA 2EXEA 2X6EA 3QCXA 3KB7A 4ZLOA 2QR7A 4FGRA 4FR4A 2DQ7X 2J90A 3GXLA 3U9NA 1V0BA 4DFZE 2JFMA 3SC1A 4WG4A 5HTIA 3POOA 4WUNA 3W2PA 2G15A 2BRBA 2NPQA 5BUJA 4JBOA 2R9SA 4HVIA 4CFUA 1SVHA 5KMJA 5AR7A 5L8JA 3VNTA 2CNUA 2BAJA 3OS3A 3K3IA 4H1JA 4C38A 2XRWA 4FSYA 2WIHA 4ZP5A 3A8XA 2VTRA 1NXKA 2BTRA 4OTFA 1GZKA 4TYHB 4ZTRA 2WKMA 3IG7A 4X2JA 5JRQA 1FPUA 2PVRA 2XCHA 4RWJA 4PMTA 2C6OA 3QKKA 4I5MA 3MDYA 1V0OA 3NAXA 4JOAA 3UQFA 4I41A 1SYKA 3QA8A 3HDMA 4IJPA 3VWAA 3M11A 3WIGA 3F5UA 4JR7A 4MNEA 4D2SA 5IQCA 4FTAA 1OVEA 2R2PA 4HGLA 4CFXA 2BFXA 3DB8A 5J9ZA 4GK4A 4JDJA 3SA0A 5J9YA 4J7BA 3LMHA 1K3AA 1BL7A 3BELA 4FSZA 4FSWA 1H24A 5BYYA 2UW5A 3TZ7A 4GU9A 1XH8A 4IBMA 5D7VA 4AXAA 3QC9A 4AW0A 4G3DA 3ZXTA 4C4HA 1TKIA 3KN5A 5B7VA 3TWJA 4C3PA 4PV0A 2C6MA 5IEVA 4RT7A 5AP1A 2Y4IB 5AP6A 3PZHA 4FA2A 2OJFE 5EM5A 2WMUA 3AMYA 4XRJA 5HICA 4V0GA 4DEAA 4XBRA 2RG6A 1FVVA 4IAFA 3MVJA 4DG3E 1WBVA 4QYEA 4BB4A 4QMPA 1KUTA 4PY1A 4TYJA 5EFQA 4BI0A 2W17A 4KKEA 2FVDA 4UMQA 3DKGA 3NR9A 2A2AA 4L52A 4XV2A 3TXOA 2YA9A 5HG7A 2X0GA 3BV2A 4W4WA 4G6OA 3G9LX 1W0XC 4DFNA 4JVGA 4FF8A 2WQMA 2YIXA 4WG5A 1OI9A 1ZOGA 4CV9A 2YIWA 4OUCA 5B2KA 4MVFA 3FYJX 1JAMA 2QKWB 3SRVB 4DN5A 4C4GA 4Z16A 4DEBA 5AV3A 3O8PA 1YDTE 4F9CA 4TT7A 5CWZA 5D9HA 3WBLA 5AAGA 4R7IA 3HAMA 2W4OA 4FSNA 3IKAA 2ITOA 2ITXA 2JDVA 2XK9A 1FINA 4ALVA 4EONA 2PUUA 3Q32A 5HG8A 4AGWA 3NW6A 2XNEA 2R3PA 3CPBA 3TDWA 3F7ZA 5DLSA 4H3PA 4U97A 2FA2A 2J0LA 4ASEA 5CEOA 4PTGA 2OGVA 4QTBA 3ENMA 3QD2B 3CEKA 3F3WA 4HVGA 1KOAA 3BCEA 4HGSA 2ZDTA 5AWMA 4O21A 2YM6A 4L3PA 2Q0BA 2YCFA 2OZAB 4IAKA 2W99B 3DTCA 4EK8A 2YZAA 4EH4A 5I9ZA 3Q2MA 4ONAA 3N4TA 4E6DA 3DPKA 4EH7A 2WB8A 3HYHA 1W7HA 3CLYA 3NW7A 2VX1A 5EK7A 3SGCA 2OJ9A 3GBZA 3O7LD 3QYWA 4UB7A 4ZTMA 4KS8A 4FTUA 4DH8A 4TL0A 4RX8A 3DZOA 1Q24A 3GU4A 4EOLA 4DG0E 4QP2A 2GS2A 3EN5A 1FMOE 3C4WA 5ANKA 3CY2A 1XBAA 2G2FA 3KF7A 2GNGA 4WNPA 4ZMEA 3BQRA 2HIWA 2WAJA 2YN8A 4DEEA 2BR1A 1J7IA 2R3HA 3PE1A 5FTOA 5J7BA 2BHEA 4RVMA 4A9UA 1STCE 5HD4A 2ZVAA 3IW8A 4MKCA 4QMOA 4DFUA 3LFSA 3OFMA 3H9OA 1CKJA 3ET7A 3Q3BA 4PDOA 4Y83A 4JRVA 1Q97A 4N70A 2OKRA 4RA4A 2QNJA 2EB3A 3I6UA 4GVAA 5C8MA 1PMNA 3MFTA 2YM8A 2V0DA 2UZDA 4AZEA 3HUBA 4TXCA 3AG9A 4LYNA 4ZZMA 5A4CA 3O71A 1BI7A 3GOKA 4AGUA 3MB6A 3LW0A 4ZSAA 5K5XA 3E3BX 4FT3A 4FZ7A 5EI8A 4ACDA 4EC8A 4FIJA 1NVSA 3DBCA 3DV3A 4USDA 5BX0A 5CAQA 2P4IA 2XJ1A 3CTQA 3D9VA 3E87A 4L67A 3OVVA 5GJFA 1ZY5A 4BF2A 3DJ7A 4ZY6A 3F5GA 5HU3A 3GENA 3P0MA 5E8UA 2VNWA 3F3TA 3LPBA 3E8DA 3GU5A 4S33A 4JIAA 1LP4A 3S95A 4DAWA 2HZ0A 3E8CA 5HE0A 5AAEA 5AUXA 5T68A 1CM8A 3PA4A 5FTQA 3ZLWA 4A4XA 4CMOA 4CT1A 5KBRA 1H1RA 4L3JA 2GTNA 4GIHA 3BZ3A 4RLLA 4DINA 4ANBA 1PF8A 2QURA 2R7BA 5C9CA 3RI1A 3KRWA 3ACKA 5BVKA 1U54A 4FSRA 3QTWA 3ZH8A 3C51A 2IG7A 2GDOA 3E7VA 4MXXA 3WZEA 4AZSA 5KMIA 2PU8A 5H9BA 3RK9A 1UNHA 4BFMA 3QZIA 2R64A 3EQRA 3QTQA 3P1AA 4PPCA 4OR5A 3DU8A 1BI8A 3UZPA 2ITYA 4F1MA 4YJPA 3Q96A 3UYSA 4FVPA 3UPZA 2YCRA 4MF1A 3P79A 4XBUA 4G3GA 1EH4A 3JVSA 3I0QA 3PRIA 3PJCA 1J7UA 2I7QA 4D28A 2XP2A 4YJSA 2OW3A 3JUHA 4C3FA 3TTIA 4XMOA 5D12A 4CCBA 1M14A 3BU5A 3FKOA 5HVKA 4XOZA 2EXCX 3WI6A 3QUEA 3I7BA 2PVHA 3TV4A 3NYOA 4MH7A 3UC3A 2XYUA 2ZMCA 3EQCA 3FMEA 3VUIA 4CG8A 4K0YA 3V8SA 1OL5A 5DOSA 3F3ZA 2I1MA 3EN9A 3CQWA 3IW5A 5FRIA 2XK8A 2WFYA 3DBFA 3SLSA 2GQSA 2GTMA 1H1WA 4BZDA 2XA4A 4FT5A 2W1CA 4KSPA 4RVTA 4WD5A 3W10A 2OJJA 4MNFA 5FP6A 5DH3A 3DY7A 4HVSA 3L8SA 2GHLA 4I0RA 2PMIA 2PSQA 3VS6A 4N0SA 3ZMMA 3CPCA 1S9IA 1OPLA 3EOCA 3KQ7A 5AP2A 5KO1A 3MSSA 2J50A 3NPCA 3FQHA 1SVGA 4F7JA 1WBTA 3LIJA 3NAYA 4ANQA 5J8IA 3OT8A 3PY3A 4XRLA 3UNZA 4Q9ZA 5C4KA 3FZOA 3OOMA 4FZDB 1PXIA 5FUTA 4O0XA 4J8MA 1APME 2CGVA 4BI2A 5IMEA 4FYNA 1WBOA 3LVPA 3NUPA 2X39A 2WELA 2Y6MA 2JD5A 5EI6A 4F64A 1T46A 2IWIA 3TJCA 4BCIA 4V04A 4O0TA 5D1JA 1M7NA 5HCZA 4NM7A 5HO6A 2JKOA 1QPEA 3AC1A 2X2LA 4GVJA 3HAVA 3FMHA 1RE8A 4ZAUA 4IMYA 4ZS0A 1XR1A 1O6LA 2Y0AA 2RKUA 4LGDA 1YVJA 3F2RA 2JAVA 4G2FA 5ACBC 3TTJA 4JX7A 2J9MA 3AQVA 3E7OA 3TJDA 4GYGA 1R3CA 3V8TA 3R7IA 2QU6A 2J5EA 2VTMA 4QRCA 3W18A 4XG4A 5DNRA 4YMJA 2XYNA 1OIYA 3PSBA 4HNFA 3H30A 4F9AA 3I5ZA 3PP0A 5GJDA 2PE0A 4M7IA 3IPHA 5ACKA 4AW5A 3ETAA 3B2WA 2PTKA 3D4QA 3IOPA 2CDZA 4XLVA 5FEEA 2QLUA 4EYMA 3G0FA 3ORKA 2W1HA 4BKJA 3FEGA 4XV1A 1H8FA 3BLQA 4GK3A 3K3JA 4FIIA 4FV6A 4I6BA 2B9HA 3GI3A 4QMLA 2QOKA 3UO6A 4O7LA 3V01A 4YSMA 2F2CB 3GFWA 3WZJA 4F7NA 2VWYA 2RGPA 3ZS5A 4R3RA 5M4FA 1YOMA 4IVAA 5HI2A 5BYLA 4ZSLA 3F9NA 4P4CA 4FG7A 1GY3A 4RJ5A 4YU2A 4QMSA 2Q0NA 2WXVA 2NO3A 3I60A 3OWPA 4G34A 3NVKI 4YPDA 2G2IA 4LL0A 4QMXA 4PDPA 5C1QB 5CZIA 2CGWA 2CSNA 3U87A 4MYGA 4XH6A 4HZRA 3E64A 4R7HA 4UBAA 3TV7A 4LUDA 4IAAA 4GV1A 1YHVA 3B8QA 4GYIA 4UXQA 2OIBA 3BQCA 3TV6A 5LARA 2R3LA 3LQ3A 5IQEA 2JDRA 3DS6A 2JDTA 3F5PA 5JFVA 5HEZA 4FNWA 4CSVA 5I9UA 5K3YA 2OSCA 5I5ZA 1DS5A 3RZBA 4DEHA 5AAFA 4YLLA 2YERA 3AGMA 4C0TA 4R5SA 3RAWA 4F6SA 4ZSEA 4FI1A 3K5UA 3TNHA 1IRKA 3VS4A 2BDWA 1FGKA 2Z02A 3K2LA 4FTCA 2XIYA 5DA3A 1ZLTA 2HXLA 4OAUC 4HNIA 2VWUA 4RC4A 5AUZA 5GHVA 4YP8A 5E8XA 3C50A 2C5YA 4RWLA 2J2IB 5CNNA 2CJMA 5D7AA 4AOTA 1T45A 4K77A 1YXVA 4PPBA 1U5RA 2W5HA 4RX7A 4O0UA 5FBNC 3TI1A 3DDPA 5JQ5A 3G5DA 4AN9A 3FZSA 5CVFA 4MWIA 2IZSA 5E9EA 1XH4A 3UZRA 4NKAA 5M09A 1VYZA 4MBLA 2B0QA 3ODYX 4ERKA 3QC4A 4YC6A 4E6CA 2BRHA 3HV7A 4IAIA 4M84A 5DT4A 4IW0A 3OXTA 3RKBA 5HIEA 5A4QA 1HOWA 5E8ZA 4GT3A 1H26A 2YCQA 5DVRA 1ZZLA 4YJQA 4RGJA 4I23A 4F63A 1OZ1A 4UX9A 3C7QA 3OROA 3KVXA 3LFAA 3I1AA 4C37A 1YQJA 2WTKB 4WRGA 1Q41A 4AA0A 4KABA 3SXRA 4RLKA 5HGIA 2Q83A 5AIKA 5IA0A 5EYMA 2CNQA 3R04A 2W1FA 5IMXA 2XEZA 3PDTA 1ZYCA 4P90A 4AA5A 4FL2A 3T3VA 3EFLA 3EJ1A 3D5VA 2VWWA 4BRXA 4C02A 2OG8A 4BGQA 5DI1A 3ATSA 3OXZA 3QXPA 5BMMA 4UEUA 2AUHA 2Y9QA 3E93A 2H96A 5CT0A 3O96A 3I81A 5BVWA 5LMKC 1WCCA 4GFOA 3C0IA 4HJOA 5AA8A 5L6OA 1BL6A 4IWQA 1DI8A 4O6EA 4BDJA 5CEKA 1KE9A 2ZB0A 4W9WA 2O0UA 4UWCA 4FZAB 4RQVA 3JYAA 2E9PA 3QZFA 3OY3A 4I93A 4I92A 2UZLA 4YO4A 2A4LA 3QD0A 3ZUTA 3D7ZA 4E8AA 2F7XE 4AA4A 5E92A 2F2UA 2EXMA 3HMIA 1OUKA 4ZJVA 2R3JA 4O7YA 3R7VA 4J52A 4MXCA 3G6GA 2XEYA 4G9CA 4YHJA 5JT2A 3R9NA 2B9FA 2EWAA 3PIYA 3GCQA 3FMLA 3FKNA 2VWZA 4WA9A 5HE2A 4AW1A 3KC3A 5I4NA 3P23A 4YJNA 2VO7A 4IANA 4J53A 4DLIA 4DE4A 4O7NA 3C4FA 5DGZA 3GT8A 4FKIA 4NM3A 5AIRA 3DKFA 3OXIA 4FKTA 4BHNA 3EQPA 3G51A 5CALA 3EZVA 2XNGA 4CKJA 5LMKA 3VUGA 3ODZX 3A7IA 3MJ1A 3QCYA 2H8HA 4YPSA 4AX8A 2CMWA 5HX8A 3QTIA 1REJA 3GGFA 4A7CA 2IW6A 1G3NA 3VN9A 4QQTA 4OAVB 3UQGA 2X8EA 2PHKA 4XCUA 1H1PA 3WF9A 3KK9A 4KS7A 5AV2A 4FUXA 3SAYA 3VULA 3ORPA 4ACHA 4JDIA 2OICA 3QD3A 3RP9A 4CQGA 5DR6A 2B1PA 1SM2A 1UU9A 3LFNA 3NNXA 3RNYA 4QP1A 4J98A 3VUHA 5BVDA 4IEBA 3CE3A 4S31A 2F7ZE 1WBPA 4OT6A 5GZ9A 5ICPA 4F1TA 4XHKB 4KBKA 5DE2A 1OL6A 4FVQA 3RTPA 4CRSA 2C3KA 2O65A 5KMKA 2WTIA 3PZEA 2XNPA 2HK5A 2ERZE 4J71A 2YIYA 4PQNA 4W8DA 5CAPA 1GZ8A 1OPJA 2ITPA 1MQBA 3KXHA 4I4EA 4MEDA 4QPSA 3QTSA 4NEUA 4X3JA 3QQUA 3R83A 3ZDIA 4BTFA 4DH5A 1RW8A 1X8BA 4FV7A 3PPZA 1KE7A 1Q8ZA 2WMRA 5IQBA 2OF4A 1Q3WA 3IDBA 1ZMVA 3DKOA 3NS9A 3ORIA 1P5EA 4L46A 4YLKA 4PTCA 3TG1A 2FH9A 2WMVA 3F6XA 4CTBA 3K54A 5LMBA 4KSQA 4NCTA 2GFCA 3ZM4A 4PF4A 2UVZA 4FZ6A 4FSUA 1UKIA 3IK3A 1H28A 5HU9A 3F69A 5TKDA 1OKZA 4XLIA 2R0UA 2GS6A 3D94A 3TZ8A 1GZNA 2C47A 3B8RA 4JQ7A 4P5QA 4NT4A 1H25A 3FI3A 3F61A 3C0GA 3VF9A 5I0BA 2YCSA 2BZIB 3QA0A 4ANNA 1U4DA 2UW0A 2XKCA 4LM5A 2OK1A 5EI2A 2E9VA 4N6YA 4V0GB 4OW8A 4FIEA 3CJFA 4QP4A 5AP3A 5GIPE 5AR3A 1PY5A 3PE2A 3VHEA 3KRXA 5LCJA 4HGEA 4DT9A 2NRUA 2UW9A 2GNFA 3AC2A 5HBEA 1YOLA 4FV5A 4B8MA 4LOPA 3L8VA 4IB0A 1JKLA 4ITIA 4BTKA 5HNIX 4DT8A 1GIJA 1P2AA 3I79A 5KMMA 3TACA 3KULA 3IQ7A 4R1YA 1H0VA 4DA5A 5DEWA 3ZLXA 4TKSA 3FLZA 2ZM3A 4XG3A 5J9LA 3EL8A 4YO6A 3GC0A 4P7EA 2JDOA 3LAUA 4RX9A 3TCPA 3V04A 2P2HA 3PVUA 2A27A 3PP1A 3PXYA 3LXLA 1YOJA 4IVDA 4AGDA 4TWOA 4ZS4A 3LLAA 4AOIA 2XIXA 5LMAA 3BGZA 3DXPA 3ORTA 4AGCA 1U46A 2V22A 3NNVA 4KBAA 3GU8A 4W4XA 4APCA 5CAOA 3QCSA 3HRFA 4JBPA 4D55A 2VTNA 3EB0A 2IZUA 5HO7A 2ETMA 1CTPE 1R0EA 2XH5A 4FUYA 3HMOA 3ITZA 3NNUA 3KMUA 3NEWA 4GSBA 3MH0A 4K9YA 4LUEA 4QOXA 4OTIA 4I22A 3KXGA 2AYPA 3HA8A 3P08A 3QRTA 3KKVA 5EOLA 3ZC6A 3FY2A 2WTJA 5B2LA 1FVRA 3OHTA 4QYYA 4TRLA 2HY0A 4BCNA 2JBPA 4FOBA 3FMKA 4FTOA 4U5JA 3S2PA 5KUPA 3QZGA 2NP8A 3TNIA 3W8LA 3RZFA 5FEQA 3ZUUA 3FAAA 4FMQA 4BCKA 3ORXA 3GP0A 4I24A 4YC8A 2UZEA 4I6HA 4JT3A 4MCVA 3R2YA 4XG2A 3ATTA 4YHFA 2X4ZA 4FKUA 1GOLA 3HRCA 4KAOA 3BEGA 1BMKA 2G9XA 4II5A 4JDKA 3DBQA 3FZPA 4DTKA 4BYJA 5CI6A 2RFSA 3Q4CA 4OTWA 4Z3VA 5KHXA 3Q4TA 3R6XA 5JRSA 1ZYJA 2FB8A 3NYNA 5CSVA 2GMXA 2PVMA 4OLIA 5DR9A 4G6NA 3CKXA 1Y6BA 1WVYA 5HIDA 4L7SA 4G1WA 4N4SA 5IUHA 3OT3A 3W2RA 4KB8A 1H08A 1OMWA 4TNDA 3MW1A 5E8VA 4KRDA 5CU2A 1QMZA 5HG9A 4M14A 2V7OA 4LQMA 5BVOA 4L6QA 1Q4LA 2QOIA 4CRLA 5EYCA 4TW9A 2G01A 4Y5QA 1DAYA 2XNNA 5G1XA 5A6NA 5IEYA 4GUEA 3SVVA 2QI8A 3KFAA 1E9HA 3AT4A 3Q9YA 3MB7A 3CXWA 2OJIA 2Z8CA 4C57A 3SX9A 5EW3A 5FGKA 2P0CA 3A62A 2X1NA 4YZ9A 3VS7A 4AZVA 5FDPA 3D83A 4EHEA 1JSTA 3PXRA 4IWOA 4GK2A 2VTQA 3HL7A 3EYGA 3G6HA 1O6YA 3IONA 3V5WA 2XF0A 5JGAA 3BLHA 4GIIA 5A46A 2I6LA 4C61A 2XUUA 2BPMA 1U54B 3SKCA 4AZFA 3FZTA 5CF8A 3OCGA 2YM3A 2PMNX 3WZUA 2NRYA 2CLQA 3QWJA 1PYEA 4LG4A 5D10A 1OITA 3MY5A 3K5VA 3IW4A 3PVGA 3FQSA 4EOMA 4JRNA 2QOBA 4FKRA 3NX8A 5M06A 2R3FA 1F5QA 4M97A 4ID7A 5DT0A 4FTMA 1GNGA 1W82A 3PG1A 1R0PA 4JG7A 5D41A 4FTTA 5ANIA 1UWHA 4TYIA 4W8EA 4IFGA 4WRSA 4EK4A 3BPRA 4LGHA 1J91A 5IG1A 1OM1A 5HE3A 3ENHA 1OKYA 2YISA 2OIDA 3L1SA 4H39A 2UZBA 3NUUA 3OBGA 3ORZA 3JVRA 4U43A 3Q9WA 5K5NA 2VU3A 2IPXA 3VRZA 2X81A 1LUFA 2GHMA 3DNEA 5IU2A 4NIFA 2CKOA 3N4VA 5IH5A 4EOQA 3SQQA 5GIOE 3EYHA 3UC4A 3KCKA 3GB2A 1H07A 2WOTA 4NU1A 2ITNA 1W84A 2UW8A 4JQ8A 4FBXA 4PL3A 5E4HA 4KWPA 4IX4A 5M4CA 3OWLA 3OEZA 4TY1A 4AFEA 3GQIA 1V1KA 3C5IA 2GQRA 5JH6A 3MJ2A 3QQFA 3A4PA 2C5NA 2RFNA 3OCBA 1IA9A 4I0TA 1XWSA 4HGTA 4RJ8A 4DEIA 3ZSHA 3R22A 4ENXA 2JAMA 3BYMA 2OXYA 3MV5A 2Y7JA 4R78A 2WU7A 5IDNA 3EFWA 3W2SA 4BZNA 2GPHA 2Z2WA 3ZXZA 3UO4A 3QGWA 2BRGA 4FNXA 4WOVA 1M2RA 3DBEA 2X4FA 1TVOA 2BKKA 3OP5A 5K4IA 2GCDA 4YJVA 1AD5A 5BUEA 3JY9A 2R3RA 3MN3A 4EZ3A 3UVRA 2ITTA 3LFCA 2YLFA 4AUAA 2YDIA 5CQWA 1PXMA 2CPKE 3A60A 3QBNA 3FMNA 4C4IA 4J95A 4PWNA 3RPRA 3ALNA 2ETRA 1MRUA 5C26A 3WF8A 5IKWA 3R9RA 1WFCA 2JKKA 3ZOSA 3C4EA 4IX5A 2J5FA 2XRUA 3NMUF 5L4QA 2Z7RA 2V7AA 2UUEA 2WQEA 2XNBA 3OF0A 4C34A 4R77A 2WMAA 4EK5A 3PJ2A 4OT5A 2JIIA 3IGOA 5DBXA 2BIYA 3QLGA 5HLNA 5DIAA 1FGIA 3ZZWA 2XM9A 2ACXA 4LRKA 4MBJA 5CAUA 3U54A 1I09A 5AUYA 1Q62A 4FOCA 2FGIA 2CKEA 3TN8A 4NWMA 1KOBA 3FSFA 5HOAA 1XO2B 5CYIA 4E93A 4EOOA 5CVHA 2C5XA 5IEXA 3DK3A 2WQOA 2YIQA 4FV4A 4IVBA 4NW6A 4IWPA 4YNEA 4F9YA 2EUFB 4EOJA 4IZ7A 3SXSA 4N6ZA 3NCGA 4XP2A 3QTZA 4FV2A 5JEBA 3BBTB 4GEOA 5FLFA 1MRVA 3R1QA 4B99A 4YJTA 5AM6A 3BWJA 4PP9A 3A7JA 2VX3A 3DQXA 3LFEA 4R3CA 4FODA 4L42A 5DPVA 2HW6A 2QD9A 5I9WA 3R73A 4CFWA 5CEPA 4IFCA 1BX6A 4TTHB 3BI6A 3LCSA 3QKLA 4LI5A 4X3FA 5HHWA 4AFJA 5CNOA 3AGLA 3Q5IA 1MUOA 2W1IA 3LFQA 3ZLYA 2BRNA 4BDEA 3W33A 4Q9SA 2HOGA 2QOLA 5AP5A 3UGCA 3LM5A 3L8PA 2VTTA 4IAYA 2QVSE 4RIWA 1Q8TA 3KXXA 4ACMA 4USFA 1URCA 5HO8A 3PJ8A 5J5TA 5AX9A 3U6IA 1KV2A 2ZM4A 5CU4A 2PZPA 4O7RA 1LEWA 2PVJA 3JY0A 4BTJA 2ITWA 3UOHA 5EW8A 3L9LA 3TKIA 2CNVA 2I0VA 3KVWA 3WARA 2CHLA 4AG8A 3FUPA 1WAKA 3QKMA 3VC4A 4BCQA 5JGDA 5IQGA 3E5AA 3MBLA 4CLJA 3H3CA 4U42A 1UNLA 4WSYA 3SHEA 4BCHA 5EQPA 4NKSA 2GQGA 1CSNA 2OWBA 2GU8A 3EQIA 3EZRA 3IO7A 3NUSA 2QG7A 4FL3A 3ALOA 1AQ1A 2Y8OA 2QOOA 1IG1A 2WTDA 1M7QA 3ORNA 4K18A 4QYHA 3R8PA 1PKGA 4EWHA 3LFFA 5KBQA 5M53A 4RIXA 2J51A 1UV5A 5M51A 5F20A 4FG9A 2PVNA 3BHVA 5JQ8A 4RWIA 4WO5A 2IZRA 3V5QA 4QMUA 1UVRA 4QTCA 3IS5A 2QC6A 1PJKA 1Q8WA 1M2PA 3KGAA 1MRYA 2VGOA 3OMVA 5KMLA 3P86A 2B53A 3ZCLA 1ZWSA 2ESMA 2ZM1A 4DCEA 4YBKA 4K11A 1BKXA 4QT1A 5I3OA 4F65A 3AC4A 5L8KA 5JSMA 5DT3A 3UO5A 4O91A 1RQQA 2XJ0A 4YZMA 3TL8A 5K4JA 3BYVA 3DJ6A 2O63A 2IVVA 3LCTA 3M2WA 5BMSA 3DNDA 4KNBA 4EKKA 1Y8YA 3EKKA 4UMUA 2X2KA 4L68A 4BIDA 2EVAA 3R8MA 3TIZA 3V6RA 4DF3A 3A2CA 4XV9A 3DA6A 1IASA 2FSTX 5L3AA 3SW4A 2UZNA 2RFEA 2YJRA 4WIHA 5HKMA 2QOQA 4FKLA 3ZU7A 2RF9A 1YKRA 3G33A 4Z7HA 2PVKA 4E4XA 5A9UA 5GNKA 3RALA 4NSTA 3RJCA 4C33A 3NYXA 4IM0A 5CU0A 3FLWA 4BWKA 1SZMA 2J0MB 3T9TA 3EQDA 5L2TA 3O17A 2YFXA 3NUXA 3U8WA 1J1BA 4RIYA 4Y8DA 2HZIA 3UTOA 4ZEGA 4GG5A 4KRCA 4AP7A 4F09A 2P2IA 3BX5A 3ROYA 1FMKA 3JPVA 3PXZA 5KHWA 5A4LA 4FNYA 4IE9A 4U79A 3UVQA 4ASXA 3OWKA 4FKPA 5TR6A 3RCDA 5LQFA 2XCKA 5LVMA 3SRVA 1IAHA 3DQWA 4ACCA 1G8SA 4YNOA 4O82A 2C6LA 3AMAA 2Y6OA 5ANEA 4WSQA 3F66A 2OF2A 2GS7A 2XK4A 3P78A 4K33A 2UW7A 3FL5A 4MWHA 4OTQA 4BDHA 5AP7A 4ZLYA 5AP4A 4RRVA 3F3UA 1H0WA 3FPMA 4TZRA 4YJUA 2YAAA 4PX6A 5KMOA 5BPYA 2BKZA 4M69A 3UIUA 3M42A 2BUJA 3ULIA 5DMZA 3ZSIA 4CMTA 4FIHA 3LKMA 2FUMA 4FKQA 2C0OA 1KE8A 3WE8A 1YWNA 2QOFA 3PG3A 4IWDA 5EM6A 4FVRA 3E92A 4ORKA 1OUYA 4IXPA 4X2KA 5AV4A 3W55A 4C3RA 3AC3A 4EHVA 4L7FA 3HZTA 1GAGA 3RCJA 3GEQA 2BMCA 2W0JA 4ZLZA 4CYJA 4DYMA 5ITAA 4RMZA 3KXZA 4P2KA 5ANOA 2X7GA 3QWKA 4U41A 3AT3A 4H36A 1YHWA 4PPAA 5CXHA 3MH2A 4O0RA 4FT0A 3CR0A 2CN8A 2O3PA 4GUBA 3R7UA 4ZMFA 4WHZA 4RVLA 4MTAA 4C2WA 1YHSA 2C5OA 2DUVA 1PXLA 4O0WA 4C58A 2PK9A 5J5SA 3H9FA 2OH4A 5J87A 3F7WA 3LMIA 4FEVA 2F9GA 3V5TA 4EUUA 4KD1A 3UZTA 2UW3A 1B39A 4ALWA 5E8SA 5L2WA 2VO6A 3S4QA 5L6PA 1OIUA 3R02A 5BYZA 3R8LA 1Y91A 3EMGA 2W4JA 3ID6C 1UU7A 3OC1A 3R9OA 2GFSA 5H8BA 5BNJA 3UMXA 3MFUA 4U81A 5AV1A 1GZOA 4M67A 4XS2A 4QTDA 3QUDA 4MXAA 4J1RA 3DLZA 3PLSA 4E4LA 4D5KA 4ZSJA 4N57A 2I0EA 4D4YA 2JKQA 4AF3A 3FPQA 2XNOA 2YLEA 5KCVA 2C6TA 3NWWA 4IQ6A 1OPKA 3ZO3A 3ZO2A 4AWIA 2OIQA 3VIDA 3R00A 5H8EA 4RG0A 4O6LA 3VVHA 2IN6A 1H1QA 1YXSA 1PXNA 4IB5A 5AP0A 5E8TA 5FG8A 2B9IA 3UODA 2VWBA 5M57A 3M1SA 3FDNA 2ZV2A 5IH6A 3COIA 2BHHA 3KXNA 4YHTA 3N9XA 1VZOA 5LCKA 3TEIA 4QP7A 4F6UA 5F4NA 3RHXA 4TWNA 1W83A 4KIKA 4FKVA 3UIBA 4ITHA 1OBDA 1QCFA 4QMVA 1Q99A 3NRMA 2YEXA 2ZV9A 4FZFB 4U3ZA 4X2GA 4BHZA 4E26A 5AUWA 5HNBA 3FHIA 3HA6A 3QX4A 4I4FA 2R7IA 4G31A 3R7EA 4DFLA 5HZNA 3DJ5A 4X6RA 3TKUA 5J79A 2P33A 4GFGA 4Q5HA 3ZFXA 4BYIA 1YXXA 3P4KA 1J7LA 2QONA 2V5QA 2X7OA 3QXOA 5CEQA 3OUKA 4DEGA 2RFDA 1ZMUA 3KULB 4HZSA 2W4KA 3I7CA 4M0YA 3DK7A 4XUFA 4F4PA 1DI9A 3GOPA 5M44A 4D5HA 3DXQA 4QMNA 3OTVA 5CEIA 2E9UA 2HW7A 1QPCA 3VW6A 3OEFX 3P7CA 4QMQA 1E1XA 4JG8A 4FV8A 5LVOA 3NUAA 3R7GA 3VF8A 2BILB 4BKYA 5EKNA 5L6WL 4J8NA 2UW4A 2E2BA 3NSZA 4C4EA 3Q9XA 4EH5A 4EH6A 2CLXA 5TO8A 1UU3A 3WZDA 3VQHA 2KTYA 3FKLA 4NJ3A 1UA2A 2LAVA 4EORA 1XHAA 3DAKA 2WO6A 3EL7A 4NZWB 4C8BA 4DGOA 1JPAA 4WNKA 4BBMA 3NVMB 5IDPA 3KK8A 4XG8A 5TF9A 3KA0A 5CZHA 3NUYA 3ZO4A 2X6DA 5HLPA 3MESA 2FSLX 2C0TA 3AD4A 4FKOA 3KMWA 4BIEA 1XH9A 3A7FA 3FZ1A 4OBQA 3RNIA 3S1HA 4EHZA 1ZAOA 4FEXA 2VN9A 1SVEA 2WMWA 3SOCA 3QTRA 3MIYA 3TT0A 2XS0A 1G5SA 1P4FA 2F49A 2PVLA 4WNMA 2C0IA 2WD1A 4TNBA 2XKFA 2C4GA 4IIRA 4D9UA 3U6JA 4AE6A 2J0JA 3HRBA 3A7HA 4OTDA 3HMPA 5CSXA 4C36A 3TZMA 1YDRE 5HQ0A 3QQJA 3WILA 3BGQA 3OCSA 4RJ3A 4I94A 4C2VA 4CLIA 5FDXA 3TM0A 2YHVA 2VTAA 4D4VA 2YAKA 2GHGA 2PZ5A 2BROA 3ANRA 3NYVA 5DHJA 4J99A 1Q8UA 2GNHA 3Q5ZA 4NTSA 2O64A 3UOLA 4FV1A 4RX5A 4Z9LA 5A4EA 2IW8A 3DT1A 4O22A 3S00A 2ETKA 2RIOA 1V0PA 2BCJA 5DEYA 3L9MA 2V62A 4BIBA 4EOPA 3ZRLA 3QX2A 3RPVA 5B0XA 3WF5A 4QO9A 4D58A 5AX3A 3SXFA 1G8AA 4DBXA 4PRJA 4F99A 4FK3A 4IADA 4FV3A 1YW2A 1F0QA 4NCTC 3L9NA 4AS0A 4IACA 4DLJA 3VUKA 3GUBA 3PIXA 4TWCA 3UG2A 4U0IA 2J6MA 2J0KA 5BVNA 2X2MA 4XG6A 5TOZA 4ZJIA 2XIZA 4DGNA 4CKIA 4QMWA 2VAGA 3THBA 2B54A 5EHOA 3VBTA 4F0IA 3LQ5A 4Z7GA 2OBJA 3ZONA 5DRDA 5IA3A 1YI6A 4MD8E 4B6LA 2ZB1A 4AT4A 3LOKA 3CBLA 3ZHPC 3Q52A 2C6KA 3U51A 3DAJA 4BCPA 3HMMA 3QTXA 3U4UA 3U4WA 4CYIA 3EWHA 3ZM9A 4LMNA 4YZNA 1PXOA 1DAWA 2IVTA 3AT2A 4X2FA 5CF5A 3D5XA 3DBDA 4MD9E 5AEPA 5IQHA 4M8TA 4D2TA 4DEDA 2IW9A 2VO0A 4BN1A 1URWA 5IUIA 4UN0C 5LVLA 2B52A 4XP0A 1YI3A 4MNEB 4RC2A 3RWPA 5HX6A 4MXYA 1JNKA 3UP7A 2A0CX 3RK7A 4WG3A 3KL8A 4YBJA 3VS5A 3LFDA 4QP9A 5TT7A 3PXKA 5DRBA 4K6ZA 4R3PA 2C30A 5CEMA 5IF1A 2BZJA 3B2TA 4Y5HA 4CCUA 3CD8A 3MS9A 1YXTA 4L43A 4I3ZA 5M07A 2BFYA 3D7TA 1PXKA 2RL5A 3D15A 2QO2A 3BYOA 3KEXA 4D0XA 3FLNC 3LMGA 1WMKA 4KA3A 4XEYA 3W16A 1FBNA 3QHWA 4A4LA 2YABA 4UYNA 3AXWA 3QF9A 4AAAA 3R9DA 1PRYA 4NIFB 1YWRA 5E8YA 4ZIMA 3D2KA 4QD6A 3U9CA 2DS1A 3ZDUA 1ZOHA 2R5TA 4ZK5A 4K1BA 5HCXA 3VS1A 3UOJA 2AC3A 3NCZA 3TZ9A 2UW6A 3LE6A 4I6FA 4DCAA 3ELJA 5K0KA 4A9RA 4YR8A 4M15A 5KX8A 3PLAE 4MXOA 4BKZA 5IA1A 2VWIA 4F9BA 2ITQA 3FMMA 3LJ1A 4U7ZA 4C35A 2AC5A 2XVDA 4FG8A 4FSTA 4F08A 5E91A 2QG5A 2ZDUA 2HCKA 4RA5A 4UMRA 3F88A 4ZZOA 2HAKA 4RSSA 3R8ZA 2EB2A 2BZKB 4XJ0A 4IZAA 4PMMA 4DG2E 4AT5A 1Z9XA 2ZAZA 5F94A 3PIZA 4D0WA 4H05A 3H9RA 3CQEA 4JBVA 5CVGA 3UQCA 3CGFA 1HCLA 1VYWA 1UNGA 3GC7A 1B38A 1PHKA 3O0GA 4Q5EA 4Y73A 4CFVA 3MH1A 4FTLA 4O86A 3H0YA 2OJGA 2J7TA 3C1XA 5DR2A 4BBFA 2VUWA 3O23A 4OTRA 2VWVA 4WBOA 2BDJA 4ENYA 2VTJA 4KIPA 3VBXA 3CP9A 2XBAA 3LM0A 3U55A 4BDIA 5I9VA 2PL0A 2YM5A 3NUNA 3Q2JA 5CSHA 3RGFA 1L8TA 5A6OA 1WBSA 4KBCA 3PYYA 3TKHA 5HTCA 4PL5A 2P3GX 3QZHA 4RIOA 4L9IA 2CN5A 5C01A 5CXZA 2XK7A 3R01A 5CF4A 2IZTA 2ZV7A 4YURA 3EFKA 5BQ0A 2HELA 2Z60A 5CX9A 3PRFA 5HVYA 2XK6A 4GKIA 5F1ZA 4E6QA 4XG7A 3W1FA 2WIPA 2I40A 3FYKX 2OO8X 3VJNA 5C4LA 1XBBA 3FL4A 3NLBA 4HYHA 4ZJJA 4ACGA 2EU9A 4MBIA 3TNQB 2JIVA 3DFCB 3G15A 2RSVA 4UY9A 2W96B 3GCSA 5DYJA 2C68A 2VTOA 5LOHA 4JAIA 4PDSA 5C8KA 3RPYA 2PUNA 4D1XA 2PE2A 2OFVA 3LLTA 4LFIA 5L8LA 5JGBA 3I5NA 4D2VA 3RPSA 4MQ1A 4U40A 1JWHA 3VBVA 3HP2A 4U45A 4RVKA 3PFQA 3CIKA 3ZUVA 4FEUA 3DZQA 3HECA 3CD3A 1OKWA 1NVQA 4L53A 3W2OA 4E5BA 4YTCA 4CV8A 3EHAA 3PWDA 1H4LA 2PMLX 3OZ6A 4M3QA 4CEGA 2V55A 5JZJA 4FT7A 3A4OX 4B9DA 2XM8A 2ITVA 3E8EA 3NGAA 3PA3A 5CQUA 2QOCA 4IVCA 3HDNA 4L45A 1H00A 4X3FB 4C4FA 2OFUA 3QLFA 5AUTA 3DB6A 3MVLA 3Q4UA 4GJ2A 5DG5A 3UVPA 2UV2A 5EOBA 4G9RA 1W98A 1Y6AA 4RIWB 4ALUA 2WMSA 4RBLA 4YZDA 5H8GA 3CSVA 2ZOQA 2WPAA 3MVHA 4PTEA 3LXKA 3A99A 4NJDA 4X7QA 2O5KA 1FOTA 4I20A 3VHKA 2BVAA 3C4XA 4GJ3A 4JXFA 4HCUA 5KKRB 4TWPA 1OECA 4B7TA 2I0HA 1K9AA 2VTSA 4A07A 4OGRA 5AR2A 3I0OA 5HCYA 5LWMA 3KREA 3DGKA 4AU8A 5AR5A 4FE2A 2W1GA 3VW8A 4FKGA 3FMJA 2QU5A 3HKOA 1S9JA 3E88A 3PJ1A 3TUDA 2Y4PA 3VS2A 1JQHA 2R3NA 4LV5A 4CQEA 3QQHA 2BDFA 5J1WA 3IDCA 2ONLC 2VTLA 3HUCA 4FL1A 4RIXB 3MFSA 1NT2A 3LJ2A 1Z57A 3COMA 3PXQA 3C4CA 1RDQE 4AN2A 3PSDA 4BCFA 3CY3A 3FMDA 3GU6A 5CTPA 5EDQA 4FKSA 1Y57A 4O0YA 3SOAA 2FO0A 3I6WA 2CCHA 2JEDA 2JKMA 3MYGA 3PXFA 5FD2A 4RQKA 2C69A 1NY3A 4U8ZA 4F7SA 2WMXA 2FSMX 3FHRA 3HX4A 3OBJA 2IVUA 2IO6A 4MQ2A 5JZNA 3FJQE 2WGJA 5HORA 4E73A 2XKEA 2QO7A 3FBVA 3FWQA 5HE1A 2QODA 4E4NA 1BYGA 2YDJA 3NDMA 5L2QA 4A9SA 4OTHA 2XK3A 3R71A 5ANJA 3ZFYA 3O8TA 4O96A 3G9NA 4B8LA 2ONLA 5ANDA 3MWUA 4FGBA 1NA7A 1VEBA 2PZRA 4OTGA 4M0ZA 3O8UA 3PJ3A 5AFVA 5FXRA 4H3QA 4A06A 3UDBA 1M17A 2YDKA 3FC2A 5HESA 3RINA 4RIYB 4XG9A 3DKCA 2ZMDA 3ULZA 5L2IA 3OY1A 4KKHA 3RK5A 3PVBA 4CMUA 3UE4A 5LXMA 3FV8A 4FV9A 3QGYA 3A7GA 3R2BA 3LZBA 3DXNA 3VS3A 4D2WA 3TDVA 3CS9A 4QPMA 3IOKA 4QQCA 5IQAA 3KN6A 2VO3A 4G3FA 3MA3A 5IQFA 4YZBA 4I1ZA 2OXXA 4BWXA 1UU8A 2UZTA 2XBJA 5JFWA 3ZFMA 2A19B 2JGZA 3UNJA 2C6EA 4L01A 4EKLA 2JLDA 4JS8A 2OH0E 4U80A 4AZTA 3G90X 4GW8A 5HG5A 3EH9A 4FSQA 3MFRA 5FXSA 4X3FC 3R8UA 1YI4A 4HPUE 4I21A 4BDFA 3PY0A 4XNEA 3A61A 3Q60A 4M69B 2VZ6A 4G5PA 1HCKA 4J96A 5EHLA 4EUTA 2HY81 2PY3A 4BDDA 5DWRA 4ASZA 3L8XA 3O2MA 5ETCA 4UWBA 4CFNA 4E5AX 1Q61A 3QL8A 1R78A 3ZTXA 2BZHB 2OZOA 4WUAA 5CSPA 3LJ0A 3DOGA 5KKRC 3QTUA 1ATPE 4D1ZA 4R7BA 4WBBB 3IGGA 5M55A 3BHYA 3ACJA 4IB3A 1XQZA 4ZXTA 3GQLA 5CY3A 4BGHA 5KZ0A 3GVUA 2LGCA 5EQEA 2C1BA 2C6DA 2CGUA 2O2UA 4DFXE 2Z7LA 2B9JA 3F82A 4EK3A 1TQPA 3Q4ZA 3W8QA 3WE4A 2XKDA 3MGYA 5KMNA 2PPQA 4JG6A 2O8YA 4CT2A 3W2QA 5EYDA 3HV4A 1UWJA 3MIAA 3O7LB 4X0MA 2XNMA 4I5HA 3BE9A 1OIRA 4O1OA 4YGAA 5CF6A 3HLLA 4AE9A 3QAME 4O7SA 4F0GA 1Q3DA 1GJOA 1KWPA 3NZ0A 4FSMA 1H27A 5IA4A 4BWPA 1XBCA 2R3QA 3H4JA 5F9EA 1W8CA 1FQ1B 2WHBA 4AQCA 5IISA 4Q2AA 4KINA 1M52A 2WOUA 5E8WA 3H10A 1WBNA 5C8NA 3RAKA 4NW5A 4A4OA 3U6HA 2F4JA 1ND4A 4L3LA 5CAVA 1OIQA 4EI4A 3OTUA 3OG7A 4U6RA 3EQHA 4AW2A 3Q04A 2HWPA 4YC3A 2VGPA 5AR4A 5CI7A 4BR3A 1XKKA 2VTHA 2W1EA 3NW5A 1U59A 3QRIA 4YJRA 5ETIA 5KE0A 3COKA 4D4RA 5KZIA 4EL9A 4DGMA 5HNGA 3SG8A 3VUTA 2WNTA 3BYSA 5EM7A 1OL2A 4P5ZA 2YM7A 4LGGA 5K9IA 3GU7A 1Q5KA 4G17A 3SD0A 2Y4IC 3D2IA 2C3JA 3PSCA 3TNWA 3GNIB 4EHGA 4QPAA 2FSOX 2WMQA 3EKNA 3GCPA 2G2HA 3R0TA 1JLUE 3GCUA 4ZOGA 4TYHA 3KCFA 5LVNA 4FT9A 1U5QA 4CKRA 4BDCA 2I0YA 1LEZA 2VD5A 3HVCA 3QQLA 4UZHA 1GIIA 3TIYA 4B0GA 3PVWA 4IHPA 3VS0A 3I4BA 3ZRMA 4JLCA 4FKJA 1QPJA 2Z7SA 3G2FA 1PW2A 2BRMA 2DWBA 4KIKB 3UYTA 4EEVA 4F70A 5IA2A 2PZYA 4IX6A 4BCOA 2KULA 5FM3A 3FI4A 1P4OA 5CANA 3W2CA 4F0FA 4UZDA 4EBWA 4UMPA 3ZYAA 3CGOA 4W9XA 5AM7A 4DH7A 5LWNA 4LV8A 4MD7E 3CQUA 1M2QA 3VBYA 4JDHA 3UMWA 1ERKA 3DDQA 2W5BA 4EQMA 1JOWB 2H9VA 3UIXA 3EIDA 2BTSA 4ANLA 4W4YA 4O7TA 4NH1A 4O1PA 4BDKA 5JN2A 3DTWA 4WNOA 1E1VA 4CZUA 2ZJWA 3AD6A 4BC6A 4PP7A 2PUPA 1TQMA 3QU0A 4FTRA 4O38A 5K0XA 3V51A 5M4IA 2W1ZA 4YJOA 4D4SA 4X21A 3POZA 3RAIA 3BGPA 5J95A 4LOOA 5FQDC 2WQBA 2OLCA 4IM3A 2ZYBA 2C6IA 1PMEA 4IC7A 4L8MA 2CCIA 4QP3A 3ZRKA 1IAJA 1R1WA 4HW7A 2JFLA 4IZ5A 4QMMA 1CKPA 4DFYA 3V5LA 5GZ8A 2ERKA 3O50A 1JKTA 3NIZA 4RJ6A 2VX0A 2YZLA 1CMKE 1ZXEA 4JAJA 4BDGA 4HVDA 2HZNA 3FLYA 3AD5A 4M12A 4LL5A 5CT7A 3E62A 3PPJA 4CD0A 4EOKA 4K2RA 4PDYA 3FQEA 3DAEA 3AMBA 2OU7A 2R3IA 4JX3A 1ZYDA 4X6QC 5DN3A 2OXDA 4MAOA 1PYXA 5CENA 4AOJA 2CKPA 3EQGA 5IQDA 3PTGA 3QD4A 3UNKA 2PULA 2QCSA 4NTTA 3SV0A 4APPA 1UKHA 5H3QA 4ZTSA 5A3XA 2X9EA 4IM2A 3F2NA 3GCVA 4FX3A 2XMYA 4HCVA 2YACA 3ZLSA 4Y72A 3NNWA 4M13A 3CJGA 2OZAA 2VRXA 2C3IB 2WMTA 3OUNB 2UZWE 4I5PA 4R1VA 1XJDA 4AT3A 1MP8A 4ZTHA 1IA8A 5HIBA 2PE1A 1TQIA 3AOXA 5FWKK 5H2UA 1ZARA 3KY2A 3GC8A 5G6VA 4NUSA 4BVUA 4M68A 2QOHA 4EOIA 4NK9A 2PYWA 3OOGA 2QO9A 4UXLA 5EYKA 4DGLC 4O7ZA 3QRKA 1H1SA 4EH3A 5CU6A 3IW7A 4ANSA 4E7WA 4JIKA 5LVPA 3QUPA 2YJSA 4NM5A 3BIZA 4JI9A 3ZEPA 3KRJA 4OTPA 3FC1X 3VRYA 1QL6A 3JS2A 3ORLA 1B6CB 5AA9A 3Q6UA 4HCTA 2G1TA 1OGUA 4JBQA 4R6VA 4O84A 3CTHA 4RJ7A 4QQ5A 5BVEA 4GFMA 4Y46A 4YLJA 5EQYA 1J1CA 3V3VA 5ETAA 5GJGA 3V8WA 5B2MA 3COHA 3EFJA 4IZYA 5FM2A 5IZFA 4O7WA 1GIHA 2UVXA 3LXNA 4UV0A 3UJGA 3QCQA 5GINE 4X2NA 1KE6A 3LCKA 5I9XA 1AGWA 3MI9A 4QP8A 2UVYA 4FIFA 3P5KA 4GG7A 4BI1A 1SNUA 5A54A 4FEQA 4YTHA 3RMFA 3CCNA 2ITUA 5I9YA 3H0ZA 2QR8A 4EQCA 2C1AA 4IDVA 5AMNA 4O0VA 3V5JA 3WF7A 4DHFA 3N51A 5J1VA 5AJQA 2WTVA 1BUHA 4FKWA 5C03A 1ZY4A 4F1OA 3TUBA 1ZRZA 4O0SA 1KV1A 2UZOA 3BYUA 4EJNA 4BL1A 4GMYA 4D9TA 3SG9A 4CZYB 5LJJA 4EH8A 3AC5A 2J4ZA 1KSWA 3D7TB 3LXPA 4ERWA 2YITA 1P14A 2X8IA 4OBOA 3SW7A 4HYIA 4EH2A 2FYSA 4XOYA 5E1SA 4YTIA 4EBVA 4MX9A 4FTKA 5JMSA 2B7AA 4RPVA 4G3EA 5FBOA 1Z5MA 4NFNA 2R3MA 2WEVA 3E8NA 4S34A 4GKHA 3ZO1A 2PVFA 4S2ZA 3WZKA 4A9TA 5A4TA 3OWJA 4HOKA 4DFBA 4FC0A 4FTNA 5CU3A 4CTCA 4MF0A 4M66A 5FEDA 4PMPA 4D1SA 4ZTQA 3FXWA 4BICA 4Z55A 3BLRA 4JJRA 3WF6A 3AC8A 4QP6A 3LCDA 4RWKA 5E1EA 2JITA 4ZY5A 3R21A 4WKQA 4FTIA 3QRJA 3ZBFA 4FV0A 3R7OA 4XYFA 4IC8A 5EM8A 3DK6A 1NVRA 5E90A 3KU2A 3GFEA 4DITA 1Q8YA 1YDSE 2QKRA 4C7TA 3MTFA 5HTBA 4S30A 3BHTA 5ETFA 4ARKA 3WIKA 3N4UA 2WEIA 1NW1A 4EC9A 4JL9A 2P55A 5FXQA 2PWLA 2W05A 3OW3A 3QFVA 3RHKA 3RVGA 4EOSA 5JFXA 2W06A 4YTFA 3DFAA 1H01A 1I44A 3F2AA 4ASDA 1MQ4A 1WVWA 3QQKA 4HYSA 3WYYA 4MK0A 4ANMA 3R28A 4LMUA 3ZBXA 4E5WA 3QRUA 4CXAA 1YWVA 4DTAA 1ZYSA 4O27B 1IR3A 2C5VA 3EN7A 4RFMA 4I0SA 3BEAA 3QALE 4W4VA 3Q9ZA 3WOWA 1ZZ2A 4GS6A 3ZEWA 3UP2A 1BLXA 5CSWA 3BWFA 3SDJA 4FEWA 4A9YA 1YRPA 2ITZA 4NFMA 3ZSGA 5L2SA 3C9WA 3BBWA 3HV3A 3MPMA 5EDRA 5IA5A 3KMMA 3QYZA 3HGKA 4G5JA 1JBPE 3L9PA 4BCGA 3JR1A 4H58A 3FE3A 4DTBA 4QNYA 2HENA 4FYOA 4UMTA 3IDPA 3NIEA 4NYEA 4ZTLA 2VV9A 4BDAA 1PXJA 1PMUA 2SRCA 1J3HA 2F57A 2REIA 3MY0A 3P9JA 3PA5A 3OD6X 4PMSA 2E9OA 4FTQA 1OL7A 2UZUE 2YM4A 2WTCA 4RFZA 4CFFA 4DH3A 4HVHA 1A48A 1O9UA 4PUZA 4HPTE 1LR4A 1VR2A 3EQFA 4F7LA 3VUDA 4ZZNA 2R3OA 4BDBA 4G3CA 4DBNA 4GRBA 3LHJA 3T3UA 4GH2A 4PNKA 4R8QA 3F5XA 3VBQA 3FXXA 3Q53A 1DM2A 4B4LA 3E3PA 4PNIA 5EKOA 5T3QA 1OBGA 2NNWB 2A1AB 4CVAA 4AN3A 2JDSA 3IECA 4O7VA 2Z7QA 4NL0A 3UOKA 4LRMA 3C0HA 4AZWA 3D0EA 2HXQA 3FLSA 3PPKA 3O51A 4XV3A 2W1DA 4PL4A 2GNLA 3WYXA 3KXMA 4ITJA 3S3IA 4FIGA 2VWXA 3EN4A 3KF4A 4C62A 1LPUA 2DYLA 4QMYA 3RM6A 1Y8GA 4I6QA 4TN6A 3FI8A 3VAPA 3ZC5A 5IH4A 4CG9A 3FY0A 3T9IA 4V05A 3R9HA 1ZMWA 3REPA 3VQUA 5E7RA 4Y95A 4MHAA 4CZTA 3V6SA 4K8AA 3JXWA 2X7FA 1VJYA 2PMOX 2YIRA 4QTEA 4KUJA 3VO3A 5I3RA 1R39A 3HV6A 4USEA 4IJ9A 4EH9A 1ZOEA 4IH8A 4U9AA 3R1SA 3MA6A 3PUPA 1IEPA 3MTLA 3RM7A 1PMVA 1WZYA 2W5AA 3FI2A 4QYFA 3VJOA 4C4JA 1QPDA 4F6WA 4KIOA 4TYEA 4XX9A 4C59A 3IW6A 2YWVA 1JKSA 4UALA 3EQBA 3Q6WA 3TNPC 4S32A 4LOQA 4L00A 4YSJA 3RAHA 1JSVA 3HEGA 2C3LA 4E6AA 4QQJA 5HVJA 4EZ5A 4G16A 4I5CA 5IQIA 4QNAA 3KRRA 4O81A 4BTMA 4GU6A 3RWQA 3G0EA 2R3KA 3DCVA 4YUQA 1JVPP 2BIKB 2J0IA 4OBPA 2JIUA 3BHUA 5FP5A 5EH0A 3QQGA 2OI4X 5JKGA 3BKBA 4O83A 1SNXA 4JNWA 1O6KA 3V5PA 2WTKC 4QYGA 5HLWA 3OCTA 3GC9A 2QHNA 4ZSGA 4EJ7A 3C13A 3ORMA 3D5WA 5M08A 2R3GA 1A9UA 1OKVA 1FVTA 3LCOA 4O2ZA 3T8OA 1XH7A 2HYYA 5IUGA 1A06A 3R1NA 4EYJA 4IAZA 4L44A 3FXZA
chains in the Genus database with same CATH superfamily
5JK3A 4XP3A 3C4ZA 2UZVA 2B55A 4BZOA 5M4UA 2WMBA 4GCJA 3PWYA 1PXPA 2E9NA 4TYGA 5HBHA 3DLSA 4QMTA 3PY1A 5BVFA 5GZAA 3QHRA 2JC6A 5EG3A 3ROCA 3A8WA 2QLQA 4QMZA 4J97A 2GNJA 3D5UA 3HNGA 5F95A 4H3BA 4E4MA 3UBDA 3UG1A 2PUIA 3MVMA 2WU6A 2W9ZB 2W7XA 4H1MA 4RJ4A 4AACA 3EN6A 3LQ8A 5EHYA 1CDKA 4RFYA 5TE0A 4DGGA 3ZZEA 2CKQA 3BRBA 3D14A 4FNZA 2WQNA 2RG5A 5M56A 4DC2A 1WBWA 2WZJA 3BU3A 3HV5A 4RC3A 5D11A 5ANGA 3II5A 4JQEA 2IJMA 5HD7A 3CTJA 5CASA 3UDZA 3KRLA 4MXZA 3ERKA 5A14A 4R5YA 4IX3A 2CGXA 4Y85A 4E20A 5JFSA 5KNJA 4HYUA 3P7BA 3HMNA 4JR3A 5CS6A 3P7AA 4D2RA 2XAOA 1CKIA 2GNIA 3VBWA 4BGGA 3MY1A 2X8DA 2X9FA 1K2PA 3FSKA 4CNHA 5FTGA 3BV3A 5AADA 4U3YA 2XIRA 3S0OA 4BCJA 2ZV8A 5AUVA 2QHMA 4O2PA 4BY9E 3HP5A 5C27A 5DFPA 4LRJA 3W32A 2WTWA 3UPXA 3BE2A 4RZVA 2XJ2A 4DH1A 2BAKA 2GSFA 3TUCA 1RJBA 3R8VA 4ZY4A 1JSUA 3R63A 3RBWA 4BCMA 4E1ZA 1OL1A 2JBOA 5J7HA 2VTPA 3BHHA 2XB7A 4CFMA 2HWOA 4UWYA 4G6LA 5HBJA 2H34A 4ZTNA 4EZ7A 4NM0A 4YZCA 2HZ4A 4RZWA 4EQUA 1JKKA 4EK6A 2IVSA 1L3RE 3OW4A 1F3MC 5IPJA 3E63A 4GL9A 2F7EE 4FTJA 3F3VA 5AR8A 4BBEA 3VUMA 4E3CA 4V01A 3LFBA 2R4BA 4GT4A 4TPTA 4WT6A 5CLPA 1WVXA 5T6KA 3MPTA 1KE5A 2BAQA 2PZIA 4FK6A 4KIQA 1XH6A 2W9FB 5AUUA 5BUIA 2BALA 4QTAA 5EDPA 3CKWA 2B4SB 4ANOA 3UIMA 3C5UA 4UYAA 3MPAA 3ANQA 5AV0A 4IB1A 4KKGA 2R0IA 3MH3A 4D2PA 1REKA 3R1YA 4F9WA 2PVYA 2QQ7A 2XIKA 2XZSA 3BU6A 2VTIA 1XH5A 2YWPA 1OB3A 3CC6A 4GT5A 3FLQA 1SMHA 1YXUA 4IDTA 3R7YA 4FICA 4EWQA 2VNYA 3RPOA 3R30A 5EW9A 1ZYLA 4U44A 2H6DA 1PKDA 3FZRA 4CGAA 2EXEA 2X6EA 3QCXA 3KB7A 4ZLOA 2QR7A 4FGRA 4FR4A 2DQ7X 2J90A 3GXLA 1W2CA 3U9NA 1V0BA 4DFZE 2JFMA 3SC1A 4WG4A 5HTIA 3POOA 4WUNA 3W2PA 2G15A 2BRBA 2NPQA 5BUJA 4JBOA 2R9SA 4HVIA 4CFUA 1SVHA 5KMJA 5AR7A 5L8JA 3VNTA 2CNUA 2BAJA 3OS3A 3K3IA 4H1JA 4C38A 2XRWA 4FSYA 2WIHA 4ZP5A 3A8XA 2VTRA 4DDIA 1NXKA 2BTRA 4OTFA 1GZKA 4TYHB 4ZTRA 2WKMA 3IG7A 4X2JA 5JRQA 1FPUA 2PVRA 2XCHA 4RWJA 4PMTA 2C6OA 3QKKA 4I5MA 3MDYA 1V0OA 3NAXA 4JOAA 3UQFA 4I41A 4BJJB 1SYKA 3QA8A 3HDMA 4IJPA 3VWAA 3M11A 3WIGA 3F5UA 4JR7A 4MNEA 4D2SA 5IQCA 4FTAA 1OVEA 2R2PA 4HGLA 4CFXA 2BFXA 3DB8A 5J9ZA 4GK4A 4JDJA 3SA0A 5J9YA 4J7BA 3LMHA 1K3AA 1BL7A 3BELA 4FSZA 4FSWA 1H24A 5BYYA 2UW5A 3TZ7A 4GU9A 1XH8A 4IBMA 5D7VA 4AXAA 3QC9A 4AW0A 4G3DA 3ZXTA 4C4HA 1TKIA 3KN5A 5B7VA 3TWJA 4C3PA 4PV0A 2C6MA 5IEVA 4RT7A 5AP1A 2Y4IB 3W0OA 5AP6A 3PZHA 4FA2A 2OJFE 5EM5A 2WMUA 3AMYA 4XRJA 5HICA 4V0GA 4DEAA 4XBRA 2RG6A 1FVVA 4IAFA 3MVJA 4DG3E 1WBVA 4QYEA 4BB4A 4QMPA 1KUTA 4PY1A 4TYJA 5EFQA 4BI0A 2W17A 4KKEA 2FVDA 4UMQA 3DKGA 3NR9A 2A2AA 4L52A 4XV2A 4DDGA 3TXOA 2YA9A 5HG7A 2X0GA 3BV2A 4W4WA 4G6OA 3G9LX 1W0XC 4DFNA 4JVGA 4FF8A 2WQMA 2YIXA 4WG5A 1OI9A 1ZOGA 4CV9A 2YIWA 4OUCA 5B2KA 4MVFA 3FYJX 1JAMA 2QKWB 3SRVB 4DN5A 4C4GA 4Z16A 4DEBA 5AV3A 3O8PA 1YDTE 4F9CA 4TT7A 5CWZA 5D9HA 3WBLA 5AAGA 4R7IA 3HAMA 2W4OA 4FSNA 3IKAA 2ITOA 2ITXA 2JDVA 2XK9A 1FINA 4ALVA 4EONA 2PUUA 3Q32A 5HG8A 4AGWA 3NW6A 2XNEA 2R3PA 3CPBA 3TDWA 3F7ZA 5DLSA 4H3PA 4U97A 2FA2A 2J0LA 4ASEA 5CEOA 4PTGA 2OGVA 4QTBA 3ENMA 3QD2B 3CEKA 3F3WA 4HVGA 1KOAA 3BCEA 4HGSA 2ZDTA 5AWMA 4O21A 2YM6A 4L3PA 2Q0BA 2YCFA 2OZAB 4IAKA 2W99B 3DTCA 4EK8A 2YZAA 4EH4A 5I9ZA 3Q2MA 4ONAA 3N4TA 4E6DA 3DPKA 4EH7A 2WB8A 3HYHA 1W7HA 3CLYA 3NW7A 2VX1A 5EK7A 3SGCA 2OJ9A 3GBZA 3O7LD 3QYWA 4UB7A 4ZTMA 4KS8A 4FTUA 4DH8A 4TL0A 4RX8A 3DZOA 1Q24A 3GU4A 4EOLA 4DG0E 4QP2A 2GS2A 3EN5A 1FMOE 3C4WA 5ANKA 3CY2A 1XBAA 2G2FA 3KF7A 2GNGA 4WNPA 4ZMEA 3BQRA 2HIWA 2WAJA 2YN8A 4DEEA 2BR1A 1J7IA 2R3HA 3PE1A 5FTOA 5J7BA 2BHEA 4RVMA 4A9UA 1STCE 5HD4A 2ZVAA 3IW8A 4MKCA 4QMOA 4DFUA 3LFSA 3OFMA 3H9OA 1CKJA 3ET7A 3Q3BA 4PDOA 4Y83A 4JRVA 1Q97A 4N70A 2OKRA 4RA4A 2QNJA 2EB3A 3I6UA 4GVAA 5C8MA 1PMNA 3MFTA 2YM8A 2V0DA 2UZDA 4AZEA 3HUBA 4TXCA 3AG9A 4LYNA 4ZZMA 5A4CA 3O71A 1BI7A 3GOKA 4AGUA 3MB6A 3LW0A 4ZSAA 5K5XA 3E3BX 4FT3A 4FZ7A 5EI8A 4ACDA 4EC8A 4FIJA 1NVSA 3DBCA 3DV3A 4USDA 5BX0A 5CAQA 2P4IA 2XJ1A 3CTQA 3D9VA 3E87A 4L67A 3OVVA 5GJFA 1ZY5A 4BF2A 3DJ7A 4ZY6A 3F5GA 5HU3A 2ZFYA 3GENA 3P0MA 5E8UA 2VNWA 3F3TA 3LPBA 3E8DA 3GU5A 4S33A 4JIAA 1LP4A 4AQKA 3S95A 4DAWA 2HZ0A 3E8CA 5HE0A 5AAEA 5AUXA 5T68A 1CM8A 3PA4A 5FTQA 3ZLWA 4A4XA 4CMOA 4CT1A 5KBRA 1H1RA 4L3JA 2GTNA 4GIHA 3BZ3A 4RLLA 4DINA 4ANBA 1PF8A 2QURA 2R7BA 5C9CA 3RI1A 3KRWA 3ACKA 5BVKA 1U54A 4FSRA 3QTWA 2X0QA 3ZH8A 3C51A 2IG7A 2GDOA 3E7VA 4MXXA 3AKJA 3WZEA 4AZSA 5KMIA 2PU8A 5H9BA 3RK9A 1UNHA 4BFMA 3QZIA 2R64A 3EQRA 3QTQA 3P1AA 4PPCA 4OR5A 3DU8A 1BI8A 3UZPA 2ITYA 4F1MA 4YJPA 3Q96A 3UYSA 4FVPA 3UPZA 2YCRA 4MF1A 3P79A 4XBUA 4G3GA 1EH4A 3JVSA 3I0QA 3PRIA 3PJCA 1J7UA 2I7QA 4D28A 2XP2A 4YJSA 2OW3A 3JUHA 4C3FA 3TTIA 4XMOA 5D12A 4CCBA 1M14A 3BU5A 3FKOA 5HVKA 4XOZA 2EXCX 3WI6A 3QUEA 3I7BA 2PVHA 3TV4A 3NYOA 4MH7A 3UC3A 2XYUA 2ZMCA 3EQCA 3FMEA 3VUIA 4CG8A 4K0YA 3V8SA 1OL5A 5DOSA 3F3ZA 2I1MA 3EN9A 3CQWA 3IW5A 5FRIA 2XK8A 2WFYA 3DBFA 3SLSA 2GQSA 2GTMA 1H1WA 4BZDA 2XA4A 4FT5A 2W1CA 4KSPA 4RVTA 4WD5A 3W10A 2OJJA 4MNFA 5FP6A 5DH3A 3DY7A 4HVSA 3L8SA 2GHLA 4I0RA 2PMIA 2PSQA 3VS6A 4N0SA 3ZMMA 3CPCA 1S9IA 1OPLA 3EOCA 3KQ7A 5AP2A 5KO1A 3MSSA 2J50A 3NPCA 3FQHA 1SVGA 4F7JA 1WBTA 3LIJA 3NAYA 4ANQA 5J8IA 3OT8A 3PY3A 4XRLA 3UNZA 4Q9ZA 5C4KA 3FZOA 3OOMA 4FZDB 1PXIA 5FUTA 4O0XA 4J8MA 1APME 2CGVA 4BI2A 5IMEA 4FYNA 1WBOA 3LVPA 3NUPA 2X39A 2WELA 2Y6MA 2JD5A 5EI6A 4F64A 1T46A 2IWIA 3TJCA 4BCIA 4V04A 4O0TA 5D1JA 1M7NA 5HCZA 4NM7A 5HO6A 2JKOA 1QPEA 3AC1A 2X2LA 4GVJA 3HAVA 3FMHA 1RE8A 4ZAUA 4IMYA 4ZS0A 1XR1A 1O6LA 2Y0AA 2RKUA 4LGDA 1YVJA 3F2RA 2JAVA 4G2FA 5ACBC 3TTJA 4JX7A 2J9MA 3AQVA 3E7OA 3TJDA 4GYGA 1R3CA 3V8TA 3R7IA 2QU6A 2J5EA 2VTMA 4QRCA 3W18A 4XG4A 5DNRA 4YMJA 2XYNA 1OIYA 3PSBA 4HNFA 3H30A 4F9AA 3I5ZA 3PP0A 5GJDA 2PE0A 4M7IA 3IPHA 5ACKA 4AW5A 3ETAA 3B2WA 2PTKA 3D4QA 3IOPA 2CDZA 4XLVA 5FEEA 2QLUA 4EYMA 3G0FA 3ORKA 2W1HA 4BKJA 3FEGA 3W0QA 4XV1A 1H8FA 3BLQA 4GK3A 3K3JA 4FIIA 4FV6A 4I6BA 2B9HA 3GI3A 4QMLA 2QOKA 3UO6A 4O7LA 3V01A 4YSMA 2F2CB 3GFWA 3WZJA 4F7NA 4O4DA 2VWYA 2RGPA 3ZS5A 4R3RA 5M4FA 1YOMA 4IVAA 5HI2A 5BYLA 4ZSLA 3F9NA 4P4CA 4FG7A 1GY3A 4RJ5A 4YU2A 4QMSA 2Q0NA 2WXVA 2NO3A 3I60A 3OWPA 4G34A 3NVKI 4YPDA 2G2IA 4LL0A 4QMXA 4PDPA 5C1QB 5CZIA 2CGWA 2CSNA 3U87A 4MYGA 4XH6A 4HZRA 3E64A 4R7HA 4UBAA 3TV7A 4LUDA 4IAAA 4GV1A 1YHVA 3B8QA 4GYIA 4UXQA 2OIBA 3BQCA 3TV6A 5LARA 2R3LA 3LQ3A 5IQEA 2JDRA 3DS6A 2JDTA 3F5PA 5JFVA 5HEZA 4FNWA 4CSVA 5I9UA 5K3YA 2OSCA 5I5ZA 1DS5A 3RZBA 4DEHA 5AAFA 4YLLA 2YERA 3AGMA 4C0TA 4R5SA 3RAWA 4F6SA 4ZSEA 4FI1A 3K5UA 3TNHA 1IRKA 3VS4A 2BDWA 1FGKA 2Z02A 3K2LA 4FTCA 2XIYA 5DA3A 1ZLTA 2HXLA 4OAUC 4HNIA 2VWUA 4RC4A 5AUZA 5GHVA 4YP8A 5E8XA 3C50A 2C5YA 4RWLA 2J2IB 5CNNA 2CJMA 5D7AA 4AOTA 1T45A 4K77A 2XANA 1YXVA 4PPBA 1U5RA 2XALA 2W5HA 4RX7A 4O0UA 5FBNC 3TI1A 3DDPA 5JQ5A 3G5DA 4AN9A 3FZSA 5CVFA 4MWIA 2IZSA 5E9EA 1XH4A 3UZRA 4NKAA 5M09A 1VYZA 4MBLA 2B0QA 3ODYX 4ERKA 3QC4A 4YC6A 4E6CA 2BRHA 3HV7A 4IAIA 4M84A 5DT4A 4IW0A 3OXTA 3RKBA 5HIEA 5A4QA 1HOWA 5E8ZA 4GT3A 1H26A 2YCQA 5DVRA 1ZZLA 4YJQA 4RGJA 4I23A 4F63A 1OZ1A 4UX9A 3C7QA 3OROA 3KVXA 3LFAA 3I1AA 4C37A 1YQJA 2WTKB 4WRGA 1Q41A 4AA0A 4KABA 3SXRA 4RLKA 5HGIA 2Q83A 5AIKA 5IA0A 5EYMA 2CNQA 3R04A 2W1FA 5IMXA 2XEZA 3PDTA 1ZYCA 4P90A 4AA5A 4FL2A 3NFGB 3T3VA 3EFLA 3EJ1A 3D5VA 2VWWA 4BRXA 4C02A 2OG8A 4BGQA 5DI1A 3ATSA 3OXZA 3QXPA 5BMMA 4UEUA 2AUHA 2Y9QA 3E93A 2H96A 5CT0A 3O96A 3I81A 5BVWA 5LMKC 1WCCA 4GFOA 3C0IA 4HJOA 5AA8A 5L6OA 1BL6A 4IWQA 1DI8A 4O6EA 4BDJA 5CEKA 3PFYA 1KE9A 2ZB0A 4W9WA 2O0UA 4UWCA 4FZAB 4RQVA 3JYAA 2E9PA 3QZFA 3OY3A 4I93A 4I92A 2UZLA 4YO4A 2A4LA 3QD0A 1VLRA 3ZUTA 3D7ZA 4E8AA 2F7XE 4AA4A 5E92A 2F2UA 2EXMA 3HMIA 1OUKA 4ZJVA 2R3JA 4O7YA 3R7VA 4J52A 4MXCA 3G6GA 2XEYA 4G9CA 4YHJA 5JT2A 4I6LA 3R9NA 2B9FA 2EWAA 3PIYA 3GCQA 3FMLA 3FKNA 2VWZA 4WA9A 5HE2A 4AW1A 3KC3A 5I4NA 3P23A 4YJNA 2VO7A 4IANA 4J53A 4DLIA 4DE4A 4O7NA 3C4FA 5DGZA 3GT8A 4FKIA 4NM3A 5AIRA 3DKFA 3OXIA 4FKTA 4BHNA 3EQPA 3G51A 5CALA 3EZVA 2XNGA 4CKJA 5LMKA 3VUGA 3ODZX 3A7IA 3MJ1A 3QCYA 2H8HA 4YPSA 4AX8A 2CMWA 5HX8A 3QTIA 1REJA 3GGFA 4A7CA 2IW6A 1G3NA 3VN9A 4QQTA 4OAVB 3UQGA 2X8EA 2PHKA 4XCUA 4DHJA 1H1PA 3WF9A 3KK9A 4KS7A 5AV2A 4FUXA 3SAYA 3VULA 3ORPA 4ACHA 4JDIA 2OICA 3QD3A 3RP9A 4CQGA 5DR6A 2B1PA 1SM2A 1UU9A 3LFNA 3NNXA 3RNYA 4QP1A 4J98A 3VUHA 5BVDA 4IEBA 3CE3A 4S31A 1G8KA 2F7ZE 3O5AA 1WBPA 4OT6A 5GZ9A 5ICPA 4F1TA 2NYAA 4XHKB 4KBKA 5DE2A 1OL6A 4FVQA 3RTPA 4CRSA 2C3KA 2O65A 5KMKA 2WTIA 3PZEA 2XNPA 2HK5A 2ERZE 4J71A 2YIYA 4PQNA 4W8DA 5CAPA 1GZ8A 1OPJA 2ITPA 1MQBA 3KXHA 4I4EA 4MEDA 4QPSA 3QTSA 4NEUA 4X3JA 3QQUA 3R83A 3ZDIA 4BTFA 4DH5A 1RW8A 1X8BA 4FV7A 3PPZA 1KE7A 1Q8ZA 2WMRA 5IQBA 2OF4A 1Q3WA 3IDBA 1ZMVA 3DKOA 3NS9A 3ORIA 1P5EA 4L46A 4YLKA 4PTCA 3TG1A 2FH9A 2WMVA 3F6XA 4CTBA 3K54A 5LMBA 4KSQA 4NCTA 2GFCA 3ZM4A 4PF4A 2UVZA 4FZ6A 5BV3A 4FSUA 1UKIA 3IK3A 1H28A 5HU9A 3F69A 1XMLA 5TKDA 1OKZA 4XLIA 2R0UA 2GS6A 3D94A 3TZ8A 1GZNA 2C47A 3B8RA 4JQ7A 4P5QA 4NT4A 1H25A 3FI3A 3F61A 3C0GA 3VF9A 5I0BA 2YCSA 2BZIB 3QA0A 4ANNA 1U4DA 2UW0A 2XKCA 4LM5A 2OK1A 5EI2A 2E9VA 4N6YA 4V0GB 4OW8A 4FIEA 3CJFA 4QP4A 5AP3A 5GIPE 5AR3A 1PY5A 3PE2A 3VHEA 3KRXA 5LCJA 4HGEA 4DT9A 2NRUA 2UW9A 2GNFA 3AC2A 5HBEA 1YOLA 4FV5A 4B8MA 4LOPA 3L8VA 4IB0A 1JKLA 4ITIA 4BTKA 5HNIX 4DT8A 1GIJA 1P2AA 3I79A 5KMMA 3TACA 3KULA 3IQ7A 4R1YA 1H0VA 4DA5A 5DEWA 3ZLXA 4TKSA 3FLZA 2ZM3A 4XG3A 5J9LA 3EL8A 4YO6A 3GC0A 4P7EA 2JDOA 3LAUA 4RX9A 3TCPA 3V04A 2P2HA 3PVUA 2A27A 3PP1A 3PXYA 3LXLA 1YOJA 4IVDA 4AGDA 4TWOA 4ZS4A 3LLAA 4AOIA 2XIXA 5LMAA 3BGZA 3DXPA 3ORTA 4AGCA 1U46A 2V22A 3NNVA 4KBAA 3GU8A 4W4XA 4APCA 1TZDA 5CAOA 3QCSA 3HRFA 4JBPA 4D55A 2VTNA 3EB0A 2IZUA 2AEGA 5HO7A 2ETMA 1CTPE 1R0EA 4AAYA 2XH5A 4FUYA 3HMOA 3ITZA 3NNUA 3KMUA 3NEWA 4GSBA 3MH0A 4K9YA 4LUEA 4QOXA 4OTIA 4I22A 2IEWA 3KXGA 2AYPA 3HA8A 3P08A 3QRTA 3KKVA 5EOLA 3ZC6A 3FY2A 2WTJA 5B2LA 1FVRA 3OHTA 4QYYA 4TRLA 2HY0A 4BCNA 2JBPA 4FOBA 3FMKA 4FTOA 4U5JA 3S2PA 5KUPA 3QZGA 2NP8A 3TNIA 3W8LA 3RZFA 5FEQA 3ZUUA 3FAAA 4FMQA 4BCKA 3ORXA 3GP0A 4I24A 4YC8A 2UZEA 4I6HA 4JT3A 4MCVA 3R2YA 4XG2A 3ATTA 4YHFA 2X4ZA 4FKUA 1GOLA 3HRCA 4KAOA 3BEGA 1BMKA 2G9XA 4II5A 4JDKA 3DBQA 3FZPA 4DTKA 4BYJA 5CI6A 2RFSA 3Q4CA 4OTWA 4Z3VA 5KHXA 3Q4TA 3R6XA 5JRSA 1ZYJA 2FB8A 3NYNA 5CSVA 2GMXA 2PVMA 4OLIA 5DR9A 4G6NA 3CKXA 1Y6BA 1WVYA 5HIDA 4L7SA 4G1WA 4N4SA 5IUHA 3OT3A 3W2RA 4KB8A 1H08A 1OMWA 4TNDA 3MW1A 5E8VA 4KRDA 5CU2A 1QMZA 5HG9A 4M14A 2V7OA 4LQMA 5BVOA 4L6QA 1Q4LA 2QOIA 4CRLA 5EYCA 4TW9A 2G01A 4Y5QA 1DAYA 2XNNA 5G1XA 5A6NA 5IEYA 4GUEA 3SVVA 2QI8A 3KFAA 1E9HA 3AT4A 3Q9YA 3MB7A 3CXWA 2OJIA 1OGYA 2Z8CA 4C57A 3SX9A 5EW3A 5FGKA 2P0CA 3A62A 2X1NA 4YZ9A 3VS7A 4AZVA 5FDPA 3D83A 4EHEA 1JSTA 3PXRA 4IWOA 4GK2A 2VTQA 3HL7A 3EYGA 3G6HA 1O6YA 3IONA 3V5WA 2XF0A 5JGAA 3BLHA 4GIIA 5A46A 2I6LA 4C61A 2XUUA 2BPMA 1U54B 3SKCA 4AZFA 3FZTA 5CF8A 3OCGA 2YM3A 4F78A 2PMNX 3WZUA 2NRYA 2CLQA 3QWJA 1PYEA 4LG4A 5D10A 1OITA 3MY5A 3K5VA 3IW4A 3PVGA 3FQSA 4EOMA 4JRNA 2QOBA 4FKRA 3NX8A 5M06A 2R3FA 1F5QA 4M97A 4ID7A 5DT0A 4FTMA 1GNGA 1W82A 3PG1A 1R0PA 4JG7A 5D41A 4FTTA 5ANIA 1UWHA 4TYIA 4QEBA 4W8EA 4IFGA 4WRSA 4EK4A 3BPRA 4LGHA 1J91A 5IG1A 1OM1A 5HE3A 3ENHA 1OKYA 2YISA 2OIDA 3L1SA 4H39A 2UZBA 3NUUA 3OBGA 3ORZA 3JVRA 4U43A 3Q9WA 5K5NA 2VU3A 2IPXA 3VRZA 2X81A 1LUFA 2GHMA 3DNEA 5IU2A 4NIFA 2CKOA 3N4VA 5IH5A 4EOQA 3SQQA 5GIOE 3EYHA 3UC4A 3KCKA 3GB2A 1H07A 2WOTA 4NU1A 2ITNA 1W84A 2UW8A 4JQ8A 4FBXA 4PL3A 5E4HA 4KWPA 3AKLA 4IX4A 5M4CA 3OWLA 3OEZA 4TY1A 4AFEA 3GQIA 1V1KA 3C5IA 2GQRA 5JH6A 3MJ2A 3QQFA 3A4PA 2C5NA 2RFNA 3OCBA 1IA9A 4I0TA 1XWSA 4HGTA 4RJ8A 4DEIA 3ZSHA 3R22A 4ENXA 2JAMA 3BYMA 2OXYA 3MV5A 2Y7JA 4R78A 2WU7A 5IDNA 3EFWA 3W2SA 4BZNA 2GPHA 2Z2WA 3ZXZA 3UO4A 3QGWA 2BRGA 4FNXA 4WOVA 1M2RA 3DBEA 2X4FA 1TVOA 2BKKA 3OP5A 5K4IA 2GCDA 4YJVA 1AD5A 5BUEA 3JY9A 2R3RA 3MN3A 4EZ3A 3UVRA 2ITTA 3LFCA 2YLFA 4AUAA 2YDIA 5CQWA 1PXMA 2CPKE 3A60A 3QBNA 3FMNA 4C4IA 4J95A 4PWNA 3RPRA 3ALNA 2ETRA 1MRUA 5C26A 3WF8A 5IKWA 3R9RA 1WFCA 2JKKA 3ZOSA 3C4EA 4IX5A 2J5FA 2XRUA 3NMUF 5L4QA 2Z7RA 2V7AA 2UUEA 2WQEA 2XNBA 3OF0A 4C34A 4R77A 2WMAA 4EK5A 3PJ2A 4OT5A 4O4BB 2JIIA 3IGOA 5DBXA 2BIYA 3QLGA 5HLNA 5DIAA 1FGIA 3ZZWA 2XM9A 2ACXA 4LRKA 4MBJA 5CAUA 3U54A 1I09A 5AUYA 1Q62A 4FOCA 2FGIA 2CKEA 3TN8A 4NWMA 1KOBA 3FSFA 5HOAA 1XO2B 5CYIA 4E93A 4EOOA 5CVHA 2C5XA 5IEXA 3DK3A 2WQOA 2YIQA 4FV4A 4IVBA 4NW6A 4IWPA 4YNEA 4F9YA 2EUFB 4EOJA 4IZ7A 3SXSA 4N6ZA 3NCGA 4XP2A 3QTZA 4FV2A 5JEBA 3BBTB 4GEOA 5FLFA 1MRVA 3R1QA 4B99A 4YJTA 5AM6A 3BWJA 4PP9A 3A7JA 2VX3A 3DQXA 3LFEA 4R3CA 4FODA 4L42A 5DPVA 2HW6A 2QD9A 5I9WA 3R73A 4CFWA 5CEPA 4IFCA 1BX6A 4TTHB 3BI6A 3LCSA 3QKLA 4LI5A 4X3FA 5HHWA 4AFJA 5CNOA 3AGLA 3Q5IA 1MUOA 2W1IA 3LFQA 3ZLYA 2BRNA 4BDEA 3W33A 4Q9SA 2HOGA 2QOLA 5AP5A 3UGCA 3LM5A 3L8PA 2VTTA 4IAYA 2QVSE 4RIWA 1Q8TA 3KXXA 4ACMA 4USFA 1URCA 5HO8A 3PJ8A 5J5TA 5AX9A 3U6IA 1KV2A 2ZM4A 5CU4A 2PZPA 4O7RA 1LEWA 2PVJA 3JY0A 4BTJA 2ITWA 3UOHA 5EW8A 3L9LA 3TKIA 2CNVA 2I0VA 3KVWA 3WARA 2CHLA 4AG8A 3FUPA 1WAKA 3QKMA 3VC4A 4BCQA 5JGDA 5IQGA 3E5AA 3MBLA 4CLJA 3H3CA 4U42A 1UNLA 4WSYA 3SHEA 4BCHA 5EQPA 4NKSA 2GQGA 1CSNA 2OWBA 2GU8A 3EQIA 3EZRA 3IO7A 3NUSA 2QG7A 4FL3A 3ALOA 1AQ1A 2Y8OA 2QOOA 1IG1A 2WTDA 1M7QA 3ORNA 4K18A 4QYHA 3R8PA 1PKGA 4EWHA 3LFFA 5KBQA 5M53A 4RIXA 2J51A 1UV5A 5M51A 5F20A 4FG9A 2PVNA 3BHVA 5JQ8A 4RWIA 4WO5A 2IZRA 3V5QA 4QMUA 1UVRA 4QTCA 3IS5A 2QC6A 1PJKA 1Q8WA 1M2PA 3KGAA 1MRYA 2VGOA 3OMVA 5KMLA 3P86A 2B53A 3ZCLA 1ZWSA 2ESMA 2ZM1A 4DCEA 4YBKA 4K11A 1BKXA 4QT1A 5I3OA 4F65A 3AC4A 5L8KA 5JSMA 5DT3A 3UO5A 4O91A 1RQQA 2XJ0A 4YZMA 3TL8A 5K4JA 3BYVA 3DJ6A 2O63A 2IVVA 3LCTA 3M2WA 5BMSA 3DNDA 4KNBA 4EKKA 1Y8YA 3EKKA 4UMUA 2X2KA 4L68A 4BIDA 2EVAA 3R8MA 3TIZA 3V6RA 4DF3A 3A2CA 4XV9A 3DA6A 1IASA 2FSTX 5L3AA 3SW4A 2UZNA 2RFEA 2YJRA 4WIHA 5HKMA 2QOQA 4FKLA