3FJQE

Crystal structure of camp-dependent protein kinase catalytic subunit alpha in complex with peptide inhibitor pki alpha (6-25)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
336
structure length
334
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Comparative surface geometry of the protein kinase family.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 108
structure length 334
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fjqE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fjqE02
4PMTA 5KCVA 5KO1A 3R2YA 2RIOA 4RGJA 3D7ZA 4O0VA 5HTIA 3I0OA 3WZEA 5CWZA 4RVMA 3N4VA 4O7NA 4AT3A 3VJOA 5M06A 2VTQA 2ONLC 1UKIA 2R3LA 4AS0A 4D55A 2VNWA 3P0MA 1OL2A 3G6HA 4M13A 3KY2A 4DINA 2J9MA 4M69B 3D5UA 2R7BA 3LQ8A 4OT5A 4YPDA 4ZTQA 4BDFA 5E8ZA 4U80A 4KAOA 5BVFA 1XH7A 2OK1A 5E8SA 3MY1A 3MDYA 5IQEA 1YHVA 2UVZA 5J1WA 4HPTE 5HD4A 3D5VA 5EDRA 5J8IA 2PHKA 3SV0A 4AW5A 3I7CA 2PPQA 5M4FA 3HP5A 5JSMA 1OZ1A 4JIKA 3QX2A 5HE3A 4DH1A 4FG9A 2VV9A 4JG8A 4PX6A 2VX3A 4YJSA 2PVHA 5IUIA 3QQHA 5G6VA 5FTOA 4NW6A 4FV0A 4HGEA 3ID6C 2Z02A 3SLSA 2PWLA 4EUUA 3DAKA 3ZBXA 3FKLA 4NYEA 3FPMA 1GOLA 2B9HA 4U3YA 3DBDA 2QOIA 4UBAA 4O83A 3O71A 5J95A 4CQEA 4IAFA 4U5JA 4BC6A 3AQVA 2V55A 4F08A 3GQIA 4EOSA 3F2NA 3NAXA 5CSHA 3HV5A 3OS3A 3HA8A 1KOAA 1H00A 1WVYA 4LGDA 3RGFA 4ANQA 3VJNA 2VTOA 3PP0A 2PMIA 5CF5A 1K9AA 2HW6A 2ZV9A 3QQJA 3QZIA 3RJCA 4Y5HA 2WQEA 3D5XA 2QKRA 1BL6A 2B0QA 2YHVA 4FMQA 4IVBA 3F7WA 2X2LA 4UY9A 2XRWA 4XH6A 4Q5HA 5IPJA 2IVVA 3ITZA 3W2SA 3TIYA 2ZYBA 5G1XA 4BCKA 2WMWA 3NUSA 2YLFA 3GU7A 4A06A 4DEIA 4CCUA 5KHWA 3G2FA 2YIQA 4Y46A 4YJPA 1ND4A 4RJ8A 4AGUA 3KVWA 4YTIA 3ODZX 4JR7A 4XV1A 2GNFA 1NY3A 4O82A 4PPAA 5CEQA 4NIFB 3VULA 3NYVA 5EKOA 4CLIA 2BRMA 3BX5A 4N4SA 4ZIMA 4QP2A 5BVOA 3VC4A 1G5SA 5CT0A 4USFA 3BHHA 3DJ5A 4ASXA 2GPHA 4D58A 3BI6A 3UIMA 2IZUA 4AGWA 4IC8A 4HYSA 4BF2A 2HZIA 3POZA 3QQUA 2YITA 3Q3BA 2CLQA 1M52A 3I7BA 4U9AA 2HK5A 3UZPA 3TDVA 5KZ0A 4MCVA 4MD9E 4MXXA 3VRZA 1AQ1A 3QTRA 3QX4A 3MY0A 3W2QA 4EI4A 3ZBFA 4FSRA 2FB8A 1OPJA 4IIRA 3PYYA 3IDBA 4YTHA 4FNZA 5KNJA 1WBTA 4UYAA 2IVSA 4IZ5A 1FBNA 1R1WA 4Y8DA 4WG5A 3GCUA 4WO5A 3HKOA 2XM8A 3UIUA 4BIBA 5BUEA 1J7IA 3AGMA 2VTHA 1UA2A 2O2UA 4X6QC 4MQ1A 4FEUA 1PW2A 3QD3A 2F9GA 4CZTA 2YAAA 5AV3A 3ZLWA 1IA8A 1H24A 5ETCA 1CSNA 3CGFA 3HDMA 1TQIA 1JSTA 2ZM3A 5AUWA 2OJJA 5TOZA 1ZYCA 1WBPA 3HA6A 5AX3A 4C36A 4ZZNA 5DT0A 4C02A 4JQ7A 2PUNA 4I94A 3WBLA 3B8QA 1PXKA 3S3IA 3P79A 1F3MC 5JFVA 3QCQA 3R01A 3UIXA 3KXXA 5C03A 2JDVA 5JQ5A 5CT7A 4HGLA 2OH0E 4B0GA 3EQPA 5BYLA 4BDAA 4CSVA 5CALA 2IZSA 4DH3A 4FV9A 4EZ3A 3ET7A 4GT5A 4QYGA 4GH2A 4DFBA 1O6LA 2XMYA 4QMOA 1KWPA 3K3IA 1HCKA 3C51A 1GZ8A 4I6QA 4JT3A 4CYIA 5FEQA 1V1KA 4RMZA 4AQCA 3OXZA 3IS5A 2WFYA 3TZ8A 4AA0A 4EH6A 5CASA 1XR1A 4KIPA 1Z9XA 4DEGA 2J2IB 5EOBA 4O22A 2PZIA 4K6ZA 1ZRZA 3UMXA 3AG9A 3UJGA 3NMUF 5GJDA 2XZSA 2PZPA 4EQMA 3NCGA 2OXXA 2C4GA 4HYIA 5CI7A 4FKWA 4ID7A 3SG9A 3LCSA 2CCHA 3E8DA 3R8ZA 4GYIA 1R0PA 3H9FA 4L53A 4PL5A 5I5ZA 5BMSA 3GOKA 3Q5IA 5JK3A 3VO3A 5HIEA 5KMMA 2PULA 2VWUA 4DG3E 4JR3A 5I4NA 4CZYB 3JVSA 1UKHA 3IOPA 4KNBA 4CVAA 3PA5A 4KINA 2NRYA 1LEWA 1JKLA 4YHFA 1MQ4A 4FKVA 5CEPA 5LWMA 3BU5A 4GEOA 5HTCA 3L9MA 4ZLZA 3OY1A 3ULIA 2V62A 5HD7A 3U4WA 1SMHA 4BGHA 3KMWA 2ITYA 4G5PA 3KXHA 4C8BA 4K9YA 2OIBA 2HXLA 3DXNA 1ZYLA 3F3UA 2BZJA 2C68A 1Y57A 3DTWA 3VBQA 4IFGA 1H8FA 3CE3A 3KRLA 4UWYA 3H0ZA 3OHTA 4FTCA 1F5QA 2YIRA 1L8TA 5GIOE 2UZOA 1QPEA 3VUIA 1MRYA 2PMLX 2PVNA 3F3TA 4YLKA 5EHLA 1CTPE 2XRUA 4ZSGA 4AGCA 1Q97A 3UNJA 2RL5A 2KULA 3BWFA 3W55A 4YLLA 4A9YA 3PTGA 3DK6A 4D2RA 2PZRA 2IO6A 4II5A 1CMKE 3C4FA 4O7LA 3RCDA 2YCRA 5LVNA 3C13A 1PYEA 4ZTMA 1LR4A 2GNJA 3OWLA 4C2VA 1G3NA 3VUHA 2R7IA 4DN5A 3KXZA 2C3JA 4YZDA 3GI3A 4BYJA 3BQRA 4E5WA 2WEVA 3E8EA 4YC3A 3LFBA 4OBQA 3R9HA 1GZKA 5M09A 3FMKA 4QYEA 4E3CA 3SVVA 4KSPA 4TY1A 3KEXA 1FMOE 2UUEA 2XS0A 3MFUA 4GUEA 3BCEA 5E90A 5TF9A 1PMUA 4QTDA 1UVRA 4FKLA 4RZVA 2YDKA 2YM4A 3L8PA 2JEDA 3VS4A 4DEBA 2FH9A 3FJQE 4RJ7A 2REIA 5CS6A 1YQJA 4EONA 3OUKA 3COIA 4MVFA 3GU6A 4DYMA 4H05A 4YHTA 4ZK5A 4NCTA 4FX3A 5KX8A 2VTAA 3EL7A 4O7ZA 3A7GA 2C6DA 3RCJA 3JR1A 3E92A 5EM6A 4CTBA 4BCJA 5LMBA 4OTPA 4USDA 4K11A 3A8WA 1IRKA 2WMRA 2XKEA 3E7VA 2WTJA 4O86A 3MB7A 3AC1A 4Q2AA 5CXZA 1CDKA 2PSQA 3F61A 4JDHA 5CX9A 4ZEGA 4CFXA 1GZNA 2A1AB 2VX1A 3BYSA 1LP4A 3D7TA 5I9VA 5L6PA 1H26A 1PXPA 4UX9A 3B8RA 4ZSLA 4YURA 3AT3A 4JBPA 4CMTA 2X2KA 4XOYA 4FSUA 3OROA 3FHIA 4NH1A 4PMSA 4YTCA 3R7VA 3AC5A 5AP1A 2OKRA 4XG9A 1PMVA 2C6TA 4ACHA 5B2KA 4FIGA 5AIRA 4NFNA 4IWQA 1U5RA 3BZ3A 5HIBA 3QCSA 2G01A 4EZ7A 4O0WA 2F2UA 2NO3A 4XLVA 3AD5A 3V04A 3NSZA 3IGOA 3QF9A 2HY81 5EI8A 4I5CA 4ZTSA 4BDGA 1OL5A 4FIIA 2OF4A 3R8UA 3VQUA 4ASZA 4S34A 4L46A 4XV3A 2VTMA 5ANDA 1PRYA 3ZFYA 4DF3A 2I0EA 4G6LA 3HLLA 2QQ7A 4YJQA 3A7HA 4G3FA 4WHZA 3ZUVA 3TZMA 3P08A 2WQBA 4AZSA 3P4KA 3QA8A 3WI6A 4D28A 1KSWA 3QBNA 2X7GA 3EKNA 4XUFA 5CU0A 4FTQA 5AAGA 3DPKA 4C7TA 5CZHA 3S00A 2BVAA 3THBA 4ANLA 1OL6A 5EDQA 4O84A 4AP7A 3MESA 5DEWA 4PDOA 1JNKA 3CBLA 1U46A 3BV2A 3R7GA 5AUVA 4UB7A 4BIEA 2X8IA 4X2GA 4EOPA 1Q4LA 2VZ6A 3MPAA 5FD2A 4F99A 5FBOA 2VWVA 3PSDA 2GNLA 3KCKA 5D9HA 4QMYA 3P5KA 5IH4A 4Y95A 4FODA 1FVVA 2AUHA 4FT9A 4S33A 3FXXA 4YJRA 4KIKA 4AT5A 1J91A 3KRJA 5L3AA 3PJ2A 2X7OA 3LMHA 2EUFB 2R3QA 3CD3A 1KUTA 4H3PA 4IVDA 3GOPA 5IA1A 4W9XA 2C6MA 4LUEA 2BFXA 3P7CA 3I5ZA 3BEGA 3R30A 4YU2A 2ITZA 3H3CA 4FZ6A 1Q61A 2DQ7X 3IPHA 3I60A 4M0YA 4B8LA 3TM0A 2ITWA 5LMKC 4V05A 3F66A 1U54B 1YOMA 4F65A 1Q8ZA 3KF4A 3ZSHA 4R1VA 4LOOA 1OKYA 3Q6UA 2VU3A 4XG4A 3NYXA 3LKMA 2BFYA 2JC6A 2OF2A 4TNBA 4OR5A 4OLIA 4EK5A 1IG1A 4O7RA 2VD5A 1XHAA 2JDSA 3CTJA 3EWHA 3R73A 1M7QA 3UMWA 4ENYA 4HGSA 2CJMA 2C3IB 2W1HA 4EHZA 4O7YA 4UWBA 5DA3A 5HO6A 3KXNA 4Q5EA 4HCVA 2B53A 3RK9A 5JKGA 4BBEA 1KV2A 3PVGA 3CQUA 4NK9A 4X2FA 3ZS5A 5AR5A 5AR3A 4FV8A 3Q2MA 3R8LA 3SG8A 3FDNA 4EOKA 2EXMA 3SDJA 1VZOA 3RPRA 2XF0A 3PXRA 2OZAA 4IM3A 1P14A 2CKEA 3VF9A 1IR3A 2BZKB 2B55A 4RIWA 5B0XA 2BIKB 2G15A 2XIKA 3CKXA 1YWRA 2PVJA 4DCEA 5FM2A 3POOA 4OBOA 1Q62A 3GFWA 4FIHA 4TWOA 1SNUA 4FI1A 5A54A 4V01A 4ACMA 1Y91A 1BMKA 2O65A 3MVJA 4FV1A 4GFGA 3CY2A 4XS2A 3VW6A 4MNEB 5FTGA 3KVXA 4DG2E 3MTLA 5GJGA 3AC2A 2CGVA 4ZY6A 2P55A 4O38A 2YDIA 4PWNA 4U97A 3QRJA 3VBYA 4BDJA 5K0XA 3Q9XA 3OT3A 4GMYA 3SD0A 4R1YA 3UVPA 3TCPA 2ITVA 4DFXE 4E4NA 4F1OA 3ODYX 3GU4A 3K5VA 3PZHA 3UOLA 4EQUA 3TG1A 3ZO1A 1SYKA 4EWHA 3G6GA 5A14A 3ZC5A 3AD6A 4BCOA 4BKJA 4C38A 4F6SA 2PU8A 4JLCA 3TNHA 4LUDA 4FYOA 5BPYA 3R8VA 4QMLA 5JN2A 4ASDA 1B38A 1M14A 1YHWA 1ZARA 2E9UA 3BHVA 4KKGA 5EYMA 4XNEA 3R1SA 4NIFA 4C4GA 3GT8A 5AEPA 4QMSA 1CKJA 3ZM4A 2ZJWA 2EXCX 3BHYA 4L45A 3DQXA 4JIAA 4PTGA 4QMMA 4JDIA 5AMNA 5FP6A 4LG4A 5CEMA 2XKFA 1QMZA 3HYHA 3II5A 3R71A 3R6XA 2WU6A 4GK2A 4AA5A 4F0FA 4PP9A 4FTRA 2XCHA 3F69A 4LGHA 4X21A 4EH3A 1CKIA 1PYXA 5EHOA 1WBSA 5AUYA 3HV3A 4QT1A 5JRSA 4CGAA 2GHGA 5D12A 3FMNA 5L6WL 2YWVA 2BALA 2X4FA 1BL7A 5CI6A 4X6RA 1H1QA 3Q4CA 3OCGA 3ZEWA 4JG7A 4L00A 4O0XA 5DR2A 3UOJA 3FL4A 2FVDA 3WF5A 3M1SA 3QUPA 4BI0A 1OVEA 4E1ZA 4RX8A 4D0XA 3Q04A 3DB6A 4HNFA 3PVBA 2WMUA 3ZLXA 3ALNA 1U5QA 4GIIA 5LVLA 2BAKA 3FMHA 5JGAA 3HMPA 2WTDA 4BWKA 4USEA 3VS6A 3Q4ZA 5LVOA 2UW5A 2ZB1A 3A61A 3LXKA 1FGKA 2PL0A 2WIHA 5IZFA 5H9BA 1PXMA 3LCDA 4HZSA 4OTWA 4LMUA 4U79A 4EOLA 5TE0A 4AOJA 5C8KA 4X2NA 1MRUA 1T45A 2Y8OA 1WMKA 2J7TA 4GG7A 3R8PA 3LCTA 4GYGA 2CDZA 5EW8A 4X7QA 3TACA 5K4IA 1W84A 1WFCA 3UG2A 4FSWA 1REJA 2R3JA 2JKMA 3QTUA 3SHEA 4FEWA 2HIWA 3RHKA 1ZAOA 2CKQA 3P7BA 4U40A 5EHYA 2G9XA 4ZTRA 1YWNA 2VTRA 2WIPA 3DFAA 3KL8A 3U6JA 2C69A 2YIYA 3HECA 2HXQA 4TWNA 2IVTA 3L1SA 4CFFA 5DRDA 4F1MA 4RLLA 2GU8A 3M42A 3VW8A 4EWQA 5BUJA 2W1ZA 2WTCA 3QLFA 5M53A 4XJ0A 4KKHA 4GG5A 3CGOA 4KKEA 4F9BA 1YDTE 3UO6A 5EW3A 2XBAA 4K18A 3TDWA 4AX8A 5ANIA 2H96A 3DNEA 1E1VA 4FG8A 5HU3A 2ZV2A 3ZCLA 4OW8A 3C7QA 2YJSA 3E3PA 1DS5A 3CP9A 3CTHA 2PUUA 4FKOA 2VTNA 2X81A 5EQYA 3TNWA 3CQEA 3WF7A 4ASEA 4CD0A 2UVYA 2I6LA 5F4NA 2PVKA 2Z7LA 1H08A 3NWWA 3FLZA 4JQ8A 1Z5MA 4PV0A 4I0TA 3R9DA 4ZJVA 3D15A 2V0DA 1SZMA 2RKUA 4CV9A 3OUNB 2Z2WA 5IQDA 3SXRA 3IONA 4EJNA 5EKNA 2XEYA 3DKGA 3GQLA 5IDNA 2JKOA 4FZAB 5FUTA 3MYGA 4ZSJA 1UU3A 2W5HA 3OEFX 2ITXA 4FV5A 4CKRA 4RQKA 3D83A 3QRIA 3V5TA 1Z57A 4TRLA 4QMWA 4RC4A 5I9UA 3VBXA 3LXLA 3CS9A 4D5KA 3UC3A 4CZUA 4GKIA 1YOJA 4G6OA 4OAUC 4YO6A 3UG1A 4C62A 3E93A 5AV0A 4NL0A 4CV8A 4AUAA 4L3LA 4JI9A 3OOMA 1MP8A 2VWXA 4NW5A 5M4IA 4QQTA 3CSVA 3U51A 3SGCA 2QI8A 3F5PA 4AF3A 5BNJA 4PP7A 3BGQA 3HMMA 1PY5A 3FWQA 3P78A 3HRFA 4DEDA 3QKKA 4PY1A 4DFNA 3MH3A 2IW9A 4I4FA 3EQBA 4GIHA 3UBDA 4CTCA 4JQEA 1ZWSA 1GIHA 3WYYA 3FHRA 3R1NA 3BQCA 4L43A 4F64A 3AC4A 4FR4A 3RZBA 5AM7A 4EOQA 4ZY5A 5KKRB 1S9IA 2UZBA 4ANMA 4EUTA 3R00A 4YR8A 2Q0BA 3AT2A 3DZOA 4JAJA 4FNWA 5D7VA 2V22A 4XRJA 4Y73A 3WF6A 5GZ8A 2PVMA 3G0FA 5JGDA 2JAMA 3MB6A 3A2CA 4FTAA 4GFOA 4GVJA 2FSOX 4AGDA 2IWIA 5AV2A 4DE4A 1UWHA 3ENHA 4G2FA 3DU8A 2FGIA 4R5SA 4AU8A 2VNYA 2YEXA 4BCIA 2C0IA 2JBOA 4FSYA 4ANOA 4I20A 4I6HA 4KIKB 4A4OA 3O50A 4NJDA 2OFVA 4IWOA 3DAJA 5C1QB 4IEBA 4I6BA 4IZ7A 4XCUA 3HMIA 5AR8A 5M44A 3IG7A 5ACBC 1O6KA 3IOKA 1FINA 2H6DA 4RWJA 1VYZA 3GC8A 4C34A 4RJ3A 1V0BA 1DI8A 2FYSA 1UU7A 5GJFA 5TT7A 4ORKA 3V5LA 3EFWA 4UMUA 4C59A 3F3ZA 3WF9A 1ZOGA 2YZLA 2GS2A 3DQWA 4ITHA 2BILB 4FF8A 1YW2A 5AUZA 5FQDC 5CSWA 3REPA 3V5WA 4O96A 3P1AA 4F9WA 2OBJA 4ACGA 3C0GA 3KN6A 3QXPA 3OWPA 4BN1A 1OBDA 2GHMA 2PVFA 4M97A 3C4CA 1H1RA 4Y83A 2R3MA 4A7CA 5CVHA 2CMWA 3TV7A 4IX5A 3MFSA 2IJMA 3QHRA 5KMLA 5EH0A 4RC2A 1BYGA 1TVOA 2V7OA 1W82A 4IZYA 4RLKA 4CQGA 3W10A 4D5HA 3OOGA 4U8ZA 3FXZA 2P0CA 5HG8A 4E26A 4L68A 4B6LA 4IJPA 4O27B 2YABA 2YACA 3GVUA 2QVSE 3OTUA 3BHTA 2OZAB 2BZIB 3GU5A 3PXFA 3GGFA 4RIWB 3PLAE 4FKSA 4G9CA 3FLSA 4V0GA 2OO8X 5AUUA 3ETAA 3H4JA 4DTAA 3QD4A 5E8TA 4KRCA 5C27A 3W18A 4LMNA 1JSUA 3NGAA 3OG7A 2FSTX 3RP9A 5FBNC 4MXOA 4TWCA 2DUVA 3LFAA 4FK3A 3FLNC 4DFZE 2UW4A 3O51A 4EH4A 5CANA 4WD5A 4PPCA 1ZZ2A 4ALWA 4BDDA 2OFUA 4GK3A 2ZM4A 4WUAA 4ZJJA 2UZVA 3UO5A 1M17A 2I0VA 4J52A 4JRNA 3ORKA 1RJBA 3ATSA 2JDOA 1JQHA 4M8TA 3TZ7A 1GNGA 2XK7A 4FSTA 4YMJA 5AFVA 4MHAA 3IECA 4GS6A 3FMDA 1H4LA 1OKVA 2GTMA 3U8WA 1O9UA 4H39A 4BDBA 4NKSA 5I9XA 5H8GA 4LYNA 4XEYA 2HY0A 4JX3A 4IAKA 5F1ZA 2Z7QA 3DOGA 3RK5A 4AE9A 4O0YA 5AAEA 5C4LA 1ZY5A 3BELA 4TYJA 3FYKX 4EYJA 5EW9A 4FV2A 4BTJA 5DFPA 1KE8A 2OIDA 4I1ZA 3OT8A 5ICPA 2V5QA 3PDTA 5AAFA 3WYXA 4FIEA 3R9NA 5AP3A 3VWAA 3DDQA 3GB2A 5DH3A 1U54A 4ZTNA 2HZ0A 3LE6A 4CMOA 4CFUA 5IQAA 3KC3A 5A4CA 5B7VA 3DXPA 3CJFA 3A99A 3QC4A 2ZAZA 5FGKA 2I40A 3BU3A 2I0HA 4EJ7A 3FYJX 2X9EA 3CTQA 4WNMA 1YDRE 1FQ1B 2RG6A 3EQDA 5HVKA 4FEVA 5KMJA 4DTKA 1QPCA 4BDIA 3B2WA 5DR9A 1PXJA 3W2CA 2BR1A 3QTQA 4OTRA 4CFVA 3TWJA 4HVHA 4AE6A 3RPOA 4M68A 4QNYA 3WE8A 3NX8A 3HGKA 3OBJA 5T3QA 3BGPA 4FKUA 2J4ZA 3NVKI 2I7QA 2CCIA 4L6QA 3D9VA 4EL9A 5L4QA 4QTBA 3A62A 5D7AA 5HE1A 4B7TA 4KBCA 5AV4A 4J8MA 5CZIA 3IKAA 2JAVA 3I79A 5E8UA 1MQBA 2W7XA 4O1PA 4KBKA 4YJTA 3TTJA 2GFSA 5E8XA 3UYTA 3ZRMA 3OXIA 3DFCB 2GS6A 2FO0A 2XK9A 3GEQA 3ZFXA 4KS8A 5A6OA 4I24A 4H1MA 3TTIA 2UW8A 2I0YA 2W1DA 2R9SA 4C4EA 1YVJA 3WOWA 5IQFA 2OJGA 2WD1A 4KIQA 4W4VA 5BQ0A 4MNEA 3RHXA 3QQKA 4PL3A 1Q3DA 3FQEA 5KMOA 2OIQA 4FBXA 3A7JA 2E9VA 4FVRA 3PJ1A 3C4WA 4EZ5A 3AC8A 4ZZMA 2GHLA 3E8CA 4IANA 4O6EA 3CQWA 3RNIA 4BBFA 4QYFA 4UXQA 2QO9A 3S2PA 1E1XA 5CSXA 3BBWA 1OBGA 1UU8A 3V51A 3W2OA 4AW1A 3GCSA 3FI3A 3P86A 4PQNA 4EH8A 3S0OA 3AT4A 3QTSA 5HCZA 3CCNA 4RIYA 2B7AA 3G33A 3W8LA 4V04A 3LFQA 3QLGA 1YXTA 4EOOA 3TUBA 1XWSA 1OKWA 3BYUA 5DMZA 4PUZA 4YZCA 2C0TA 5HNBA 3UQFA 5CF6A 1PMNA 4FTNA 2PZYA 2PE1A 1H07A 2XK3A 2Z60A 2B4SB 1URWA 3QAME 4EORA 4F7JA 4NM0A 5AWMA 2A2AA 1I44A 3R8MA 5C01A 3EYHA 4W8DA 4M0ZA 4MK0A 2BAQA 2C5OA 5HNGA 4BI1A 2BDJA 4ZTLA 3R0TA 2CKPA 1ATPE 2BDWA 4I6FA 5CU6A 3UGCA 4EBVA 5GIPE 3WILA 1OGUA 3D0EA 4WUNA 1H1SA 5LMAA 3OVVA 4EH7A 5EYCA 4J98A 4AZEA 4BGQA 3O7LB 3ZDIA 3ZSIA 3EMGA 3ZFMA 1B39A 4E5AX 1NA7A 3BKBA 5M56A 3NS9A 3RPVA 3DBFA 3RMFA 3Q9YA 1LPUA 4KUJA 3WZUA 4H3QA 4O2ZA 3QC9A 2UZNA 3R7YA 2J0LA 3TV4A 2RFDA 2XNBA 4DLIA 3A4PA 3EOCA 3H9OA 4PNIA 4IM2A 4IDVA 2R3RA 1YWVA 2JDRA 3EZVA 4KIOA 2OH4A 4W4XA 2R2PA 4HNIA 4X2JA 3MVHA 4I41A 1OI9A 4BTMA 5HE0A 4CYJA 2R3KA 4HPUE 4QYYA 4EH5A 4XG3A 2A0CX 3R04A 3R7EA 5I9ZA 5JZJA 5DBXA 2WO6A 2ZVAA 3E3BX 3PPJA 1YI6A 4X3JA 4D1SA 4HVIA 2Y6MA 4U81A 3QTXA 3AGLA 3HMOA 5E91A 4MBLA 3UODA 3WZDA 2ITOA 3SXSA 4EK8A 5A4EA 1A48A 2JIVA 2YERA 4BIDA 5E9EA 2VWBA 4B8MA 3EH9A 3LJ2A 2YCFA 3Q2JA 3A4OX 4F63A 3CJGA 3FSFA 1NVRA 4NM5A 3L9NA 5E1EA 3UZTA 4E4XA 3IK3A 2UZUE 4YP8A 2XH5A 3NUYA 3VS2A 4Y72A 2QOFA 2VO3A 3JY0A 4G5JA 4XBUA 4YNOA 2ZMCA 2SRCA 2JBPA 4U7ZA 5HLPA 4C4HA 3C4EA 3ZEPA 4FUYA 4KABA 5IISA 1IAHA 3RAIA 4HOKA 4JBQA 1ZMWA 5CU4A 3SXFA 2YIXA 3QKMA 5H8BA 2WTIA 3E62A 4IACA 4LRJA 4D2SA 5ANGA 5EM7A 3AC3A 3BRBA 3EN9A 5T6KA 4G16A 3CPCA 3D14A 3ZZEA 4G3EA 4K33A 3RAKA 5K5NA 2CHLA 5IH5A 2GQSA 5CEKA 4W4YA 3RKBA 2GFCA 3ALOA 3NW6A 1ZXEA 3KREA 2WAJA 3OEZA 3UVQA 4RIXB 3QZFA 4RA4A 3DZQA 4CCBA 3Q5ZA 4TYHA 3S95A 3CC6A 5ETIA 3WF8A 4DA5A 2O0UA 4RT7A 5FDXA 3OP5A 1ZY4A 4M67A 5DG5A 4CKIA 4E20A 2QOQA 3O8PA 2GNGA 2BUJA 2PY3A 3ZMMA 5IUHA 4MEDA 5FEDA 4DEEA 1URCA 4DGLC 4BR3A 2VN9A 4AACA 4M14A 4J7BA 2WTVA 4H58A 1IAJA 3NZ0A 3LFCA 3LZBA 3KXMA 3Q4TA 4FKTA 3DLSA 5EM5A 4ALUA 3PWDA 5HICA 1OL7A 1JLUE 3COKA 5DR6A 3L9PA 4FEQA 3T8OA 4BB4A 3QL8A 5EDPA 2X1NA 3LFDA 3FV8A 3LOKA 4RRVA 1KE9A 3ORMA 3PJCA 4F70A 1K3AA 3OW4A 4V0GB 4K77A 3BYVA 2XCKA 4MAOA 3ZDUA 4A9UA 2XIXA 3IQ7A 1BKXA 1PMEA 5IEVA 3P23A 2CNVA 2W4OA 1JAMA 1R0EA 4QPAA 2WOUA 4UN0C 4JNWA 1H1PA 4EC8A 4XYFA 3N4TA 3OW3A 4GT4A 3ZO4A 4F6WA 1UU9A 4QPMA 5AM6A 5AUXA 4D2WA 2BRGA 3IW8A 3DV3A 2OSCA 4FTMA 3QWKA 4R5YA 2ONLA 3ZSGA 4AW0A 3MVLA 3G15A 5AP6A 1REKA 2E9NA 4YZMA 4BDHA 1LUFA 5HZNA 3NYNA 3DKOA 4C61A 5A6NA 4FZDB 1U4DA 5J87A 3W1FA 4O7VA 4QMUA 3V8TA 4BBMA 1L3RE 4TYIA 3PXKA 2IZRA 4K2RA 4IAAA 4RG0A 4ZS4A 1DAWA 1W8CA 2JDTA 3RNYA 2BTSA 4AOIA 1M2QA 4B4LA 3ZXZA 3V6RA 2JITA 5HG9A 3DBQA 3R1YA 4HGTA 3G51A 5LVMA 3L8VA 2GSFA 5DPVA 1EH4A 2WQOA 4DGOA 4RVTA 2B52A 4EHGA 4F6UA 3LMIA 2DWBA 3LHJA 2XJ2A 4TT7A 4DH5A 4RQVA 2YM5A 5EI2A 1GIJA 3LQ3A 4WT6A 5A3XA 3N4UA 3M11A 2C3KA 1QCFA 2F7ZE 4D1ZA 1BX6A 4UYNA 2UV2A 5D11A 4TKSA 1OB3A 5GZAA 3FQHA 2IZTA 3GUBA 3QTZA 5EFQA 2AC5A 4FL3A 4FICA 4I5PA 3Q6WA 3LM5A 4APCA 3S1HA 3R9RA 2LAVA 3K54A 3HUBA 3D2KA 4AT4A 4FT3A 2WMXA 3KQ7A 3ORIA 4LL0A 5HCYA 3VNTA 3MVMA 2BPMA 3DCVA 3RBWA 2J0JA 1ZOEA 2Y6OA 3RZFA 1Q3WA 4XV9A 2RF9A 4U45A 4A07A 1YHSA 2XK8A 3VBWA 2VWWA 1XH6A 2UW3A 2W1FA 3LAUA 5H8EA 3PLSA 4QRCA 3U9NA 2VTJA 3K5UA 4GCJA 2IW6A 4XMOA 1APME 5E92A 5JMSA 3KULB 4P4CA 4J95A 2J5FA 3ENMA 3ZC6A 4EKKA 3SQQA 2QG7A 4G34A 3ANQA 2W1GA 5FM3A 5BVNA 3DBCA 1PJKA 4QMTA 3Q32A 5DLSA 3I81A 2C5VA 4YBKA 4YJNA 1XH4A 2Y4PA 2ZM1A 3EN5A 4JOAA 4E4LA 4YO4A 3DXQA 5HBJA 3FKNA 3TKUA 4QMZA 1H25A 1ERKA 5HNIX 3PY0A 4O2PA 4I23A 4Z7HA 4D9TA 4XHKB 4S2ZA 5DOSA 4E7WA 5BX0A 5L6OA 4QP9A 3F3WA 4RIYB 3HV4A 4M84A 4ERKA 5J9ZA 3OBGA 4L3JA 4MF1A 4U42A 4LV8A 3PJ8A 1IASA 2UZDA 1S9JA 5H3QA 1HOWA 3ZUUA 2Y4IB 3WARA 4GJ3A 1E9HA 3OF0A 2ITTA 3MV5A 4J8NA 5E1SA 4RFMA 3R02A 4ALVA 4E6DA 4EK4A 4HYHA 2GTNA 5ETAA 2J0MB 3EFJA 2QOKA 5HVYA 4E6AA 3PXYA 4YPSA 4OT6A 1OKZA 3WE4A 1QL6A 2W4JA 2Y7JA 4GL9A 3FY0A 4IAIA 3HZTA 5HKMA 4DHFA 3DK3A 3EQIA 5J7BA 1R3CA 2J0KA 5HBHA 3PY3A 3FZPA 4CXAA 4U41A 2ZV7A 2ITNA 3OY3A 5GINE 3CR0A 5IG1A 3CKWA 4RFYA 3LQ5A 5FLFA 3JXWA 5IUGA 3IW6A 2XA4A 3NNUA 1UWJA 4OTQA 2EB2A 3MFRA 4KA3A 1YDSE 4Z9LA 1RQQA 2VO6A 4D2TA 1V0PA 4D4VA 2RFSA 3K2LA 4JDJA 1PHKA 1M2PA 3ORLA 1G8AA 4FG7A 1Q8WA 5IF1A 3L8XA 3FBVA 3HMNA 3PIXA 1Q99A 2J90A 2YDJA 4JG6A 3ZUTA 5DE2A 2H9VA 2VWYA 1UNHA 4U43A 2WQNA 3BYOA 2QHNA 3QQFA 2R3HA 3OWJA 2G1TA 5AV1A 2P33A 4BCQA 4H1JA 1QPDA 3HNGA 3TL8A 3DDPA 4CRLA 3I0QA 4MBIA 1OUYA 3C5UA 4AZWA 4EKLA 3WZJA 3JVRA 3PG3A 4NM7A 3BV3A 2HYYA 4XX9A 2DYLA 2UW7A 4HJOA 4L44A 3SW4A 1JOWB 1STCE 2WEIA 4IJ9A 4WOVA 5IEXA 4RWIA 2G2HA 2YN8A 1J7UA 2G2IA 1P4FA 5DEYA 5CNNA 4ANBA 4WIHA 4ZJIA 2OGVA 4A9RA 3EN7A 5CENA 4M7IA 3ZH8A 3E5AA 4C0TA 3SKCA 4BRXA 3ORTA 4QP8A 5BYZA 2ACXA 5JH6A 3MIAA 4NU1A 2QR8A 1X8BA 3GCVA 4JBVA 4LM5A 3QGYA 5E8WA 2NRUA 3MH1A 5I9YA 5HGIA 4O0RA 4N6YA 5L8KA 4O81A 2W1CA 4IAYA 3ZZWA 2PUIA 4QO9A 2R3IA 5ANJA 5FEEA 2VTPA 3FAAA 3LFEA 4I3ZA 3TV6A 1J3HA 3GC9A 5DI1A 4IX6A 4RA5A 3VUTA 4WNKA 2UW6A 3VF8A 1PKGA 4DG0E 2VO7A 3FC2A 2O8YA 2AC3A 1XH5A 2EVAA 1VEBA 2ZB0A 4CMUA 5L2IA 4FV7A 4QQJA 3RVGA 3KKVA 4EEVA 4E6QA 2A27A 5HLWA 1Q8YA 4FOCA 4JBOA 4Q9ZA 4OBPA 5HG7A 2J6MA 2E9OA 4FSQA 4R3RA 1GIIA 1TQMA 2R5TA 3FZSA 4R6VA 5BVWA 5IMXA 3JY9A 3FXWA 2QHMA 4DGGA 4O7TA 3MIYA 4HVGA 4N57A 4TYHB 2GNHA 3OZ6A 5KE0A 4AW2A 2YLEA 1Y8YA 3EL8A 2AYPA 3AOXA 1NT2A 3B2TA 3O8UA 3GXLA 3FZOA 3UVRA 4BL1A 2HCKA 2FA2A 1FGIA 3FSKA 2XK6A 3ZLYA 4KD1A 4J97A 1JWHA 4BTKA 5EG3A 5DNRA 3AXWA 3RWQA 4TPTA 3U6IA 1R78A 4ZMFA 1KE6A 4YSJA 1JSVA 4FYNA 2VTLA 4E73A 4FKPA 5HOAA 4RFZA 3KCFA 3EN6A 4EHEA 3F5GA 4NTSA 5HEZA 4S31A 1BI7A 5CVFA 2JKKA 3FEGA 1H28A 4GT3A 5M08A 4IQ6A 2VTSA 4OTFA 4ZZOA 2YISA 5J7HA 4KS7A 4I92A 5HO8A 4Q9SA 1XBCA 3HAVA 3LW0A 2BMCA 3PVWA 4F09A 4QMVA 1YXSA 3EIDA 3C4ZA 5EQEA 1VJYA 4ZSAA 4DEAA 3BPRA 3QCYA 3PIZA 5AA9A 4G9RA 3OC1A 4J53A 1OIQA 3ZM9A 2JKQA 4PRJA 4KWPA 3UP2A 5JRQA 2W1IA 1OECA 3DT1A 2C47A 5A9UA 3VS1A 2OW3A 3NEWA 2CPKE 2BKZA 2CSNA 5HVJA 4WBOA 4GJ2A 5DIAA 2WTKC 2OJFE 5AADA 2C6KA 4D2PA 5M51A 2A4LA 3V5QA 2W5BA 3A7FA 3UQGA 3W16A 4I5HA 2W4KA 2XKCA 1IEPA 3GCPA 1FVRA 4BZDA 4GUBA 4X3FC 5GZ9A 4CRSA 3MBLA 4G3CA 3QD2B 3AMAA 4R3PA 3W2RA 2H34A 3DJ7A 3C5IA 2YM7A 3R21A 4G31A 2W06A 4TXCA 5HIDA 2CN8A 1SNXA 2WMTA 4PTEA 1H01A 2CN5A 5IMEA 4ZLOA 3QD0A 1KOBA 3W2PA 3KMMA 1V0OA 2W9FB 3HRBA 4IB5A 3E7OA 3MW1A 3H10A 2YZAA 4A4XA 3DKFA 4IVCA 1AGWA 1H27A 4RX7A 4R3CA 3MSSA 4D4RA 2O5KA 4FTOA 5AP0A 3UOHA 4C3RA 1WVWA 5M57A 3P7AA 3ACJA 5IQCA 4FKQA 4LI5A 5TR6A 4I5MA 2OLCA 2C3LA 2EU9A 4QP3A 3CIKA 5CNOA 4BYIA 3OFMA 3RM6A 1VR2A 3UE4A 3G9NA 2W99B 4I93A 3ACKA 4RIXA 3EYGA 1W98A 4IW0A 1YXVA 3ZU7A 3ANRA 2J51A 4CFMA 3QA0A 3VBVA 4AXAA 5AA8A 1WBWA 2W96B 4FZ7A 1K2PA 4C33A 4UXLA 5IQBA 4JXFA 2NP8A 5EM8A 4ANNA 1VYWA 4EOJA 3KN5A 2R3FA 4FL1A 2QOBA 3UIBA 4H3BA 3VAPA 4BCMA 3R28A 4E93A 4FTUA 3EJ1A 3SAYA 1UV5A 3V8SA 4M15A 1JKKA 5F9EA 3IO7A 4IZAA 3SRVA 5J5TA 5KKRC 3UOKA 5JFSA 3MGYA 4BZOA 1IA9A 4YZNA 3PPKA 3O7LD 4KRDA 4UALA 4Y5QA 3VRYA 3BYMA 1YI3A 2H8HA 5KHXA 4E8AA 3VQHA 3QYZA 5HO7A 4P5QA 3VIDA 5L2QA 2P2HA 4MXZA 1XBAA 4PL4A 5IDPA 1ZYDA 1ZZLA 4FSMA 5T68A 1FVTA 4XBRA 4UEUA 1ZOHA 1SVEA 5L2TA 4FSZA 4WNOA 3CXWA 3E64A 4YZBA 2C5YA 4UWCA 2XIRA 3QRTA 3U87A 5LMKA 1GY3A 2QO2A 2UZLA 4PDSA 4UMQA 3NNWA 4ONAA 4DFYA 3AD4A 5J9YA 3C1XA 2GS7A 3MH0A 2XYUA 3L9LA 3R7IA 5ANOA 3DA6A 2QG5A 3F88A 3FMMA 4BCGA 4L67A 2QNJA 2WMBA 4U3ZA 2OZOA 2XYNA 2WMQA 5CTPA 1OIYA 2BRHA 2VRXA 4W4WA 3COMA 5FG8A 1JVPP 4D0WA 2IN6A 4BCHA 2QD9A 1NW1A 4DBXA 3E88A 1ZMUA 1WVXA 3BE9A 2UZWE 4IMYA 3FI8A 4FNXA 4M3QA 4F0IA 3G5DA 3MJ2A 2UZTA 4LOPA 4NFMA 5FXQA 3VHEA 1SM2A 2B1PA 3LFNA 4QQ5A 4W9WA 4J1RA 4R7IA 4ZS0A 3EQRA 4WRGA 3O8TA 3QTWA 2C6OA 4YJVA 4MH7A 2VTIA 2QCSA 3TUCA 2X9FA 3LCKA 2NNWB 3T3UA 3KRXA 4L7SA 5CAQA 3EFLA 1FMKA 2QOOA 5KBQA 3O23A 3E63A 2XEZA 4BGGA 4C3PA 4MWIA 4DITA 2BTRA 3O17A 2C5NA 3R2BA 3U9CA 4BWPA 4FGBA 4D4SA 3I4BA 4I21A 4M66A 4D9UA 2ITQA 3V8WA 3HX4A 4L3PA 2RFNA 3C9WA 3ORNA 4S32A 1UNGA 5M55A 4IC7A 4QD6A 5CY3A 5IA4A 4FKIA 4I22A 3MTFA 3TIZA 5FTQA 2XJ1A 4IAZA 5IQGA 4U44A 2R0UA 4FTKA 4ZXTA 2XM9A 4BWXA 3SA0A 5EQPA 2F7XE 4MX9A 4RJ4A 5JGBA 4QQCA 2Y0AA 2PMNX 4DH8A 1Y8GA 5IA3A 4IXPA 3ZRKA 4RIOA 4RPVA 4MNFA 5CVGA 1KE5A 2ZDTA 3TNPC 5BMMA 3PXZA 1NVSA 4FEXA 3KULA 4EH9A 1XKKA 2R3GA 5CXHA 4LQMA 5HU9A 1ZLTA 3FLYA 5C26A 4RSSA 3T3VA 3F5UA 4IB3A 3QU0A 2XUUA 2F49A 2VGPA 5DYJA 3LMGA 4IX3A 4WRSA 1DI9A 5CAUA 4WKQA 2W9ZB 3FY2A 4HYUA 4XP2A 4AZTA 4MKCA 2ITUA 2OICA 2C6IA 4GU9A 4EH2A 2ETRA 3MPMA 4QMPA 5CLPA 3EZRA 1Q8TA 4RWKA 5FXRA 3H0YA 3ORZA 2VWZA 4Y85A 4C4IA 5IH6A 5A4QA 2C1AA 3LIJA 2C0OA 5F95A 2EB3A 4O0SA 4XG8A 3QRKA 4WA9A 3R1QA 1B6CB 3MJ1A 3NUUA 4IFCA 3WZKA 1TKIA 4BCFA 3NUNA 3BBTB 4WNPA 4PDYA 4MXAA 3HV6A 4XRLA 5HX8A 1CKPA 3EQGA 2BDFA 3P9JA 2F57A 5HI2A 2PVLA 3CEKA 3D5WA 4CKJA 3OTVA 2W5AA 3D4QA 4XP3A 5AP2A 3C0HA 3UDBA 2QO7A 3KB7A 4O0TA 5JT2A 3PRIA 4MYGA 1ZYSA 4ANSA 4F9CA 3FZRA 4FT7A 5H2UA 2C5XA 4UMTA 1G8SA 4M12A 4FVPA 3KRWA 4BI2A 4DBNA 1M2RA 4RX9A 4FT0A 4OAVB 2Z7RA 4PDPA 3PP1A 5AR4A 5FWKK 3E87A 3RK7A 4BKYA 5A4TA 4LFIA 3RWPA 2O63A 3ORXA 3PSCA 4BFMA 4CT2A 2EWAA 2DS1A 2OU7A 2XNPA 4QP4A 4LRKA 2J50A 2VGOA 4NSTA 1OIRA 4FUXA 3RI1A 3TEIA 4L01A 2X0GA 2B9FA 4K1BA 3S4QA 3LXPA 5J1VA 1GAGA 2WPAA 3HEGA 4O1OA 5B2MA 4C3FA 3V5PA 4X2KA 4TL0A 3I1AA 5BVDA 3FLQA 4FIFA 1PXNA 4IHPA 3O96A 5LOHA 1TQPA 2B9IA 2J0IA 2OI4X 1R39A 3C0IA 4RZWA 3W32A 3QRUA 2Q83A 4MF0A 4K0YA 4ZTHA 3JYAA 2R64A 3EFKA 3PWYA 3ROCA 3OCSA 4K8AA 2XB7A 4CG8A 3GENA 2Z7SA 4DFLA 5HLNA 1YXUA 1H1WA 3Q9WA 3RALA 4ZP5A 3VS5A 5JFXA 3HAMA 1GZOA 5EYDA 3VHKA 4NM3A 3ZONA 4N6ZA 5CF4A 3R83A 5E8VA 5JZNA 3LFSA 2OG8A 4YC8A 2HWOA 2VO0A 4YSMA 5LQFA 3QQGA 2HW7A 3FL5A 2E2BA 5I3RA 3ATTA 3HL7A 4PPBA 4KB8A 4YTFA 4HVDA 4FKGA 3HRCA 3MA6A 2XVDA 3Q4UA 3TUDA 5AP5A 2R3NA 2WNTA 5BUIA 4LV5A 1CM8A 5GNKA 5K0KA 3PUPA 2WMVA 3NCZA 3UPXA 1Q41A 3F3VA 3JS2A 2X8DA 4MQ2A 4L7FA 3ZO3A 4E4MA 1RE8A 3UTOA 3BHUA 3DGKA 2NPQA 5TO8A 3VN9A 4QTEA 4FTLA 5HBEA 4F7SA 2ERKA 2W0JA 4P2KA 2UVXA 1A06A 1Q24A 2VAGA 4C4FA 3PE1A 3OCBA 2XIZA 5J79A 5IQIA 5K3YA 3IW4A 4JAIA 5CQUA 2WELA 3QUDA 2QR7A 3ULZA 4R7HA 5A4LA 2JIIA 3F82A 2HZ4A 3MFTA 3C4XA 4QMXA 3GNIB 4F9YA 2YAKA 4N0SA 4HZRA 4JX7A 2JFLA 4FKRA 4C4JA 4QYHA 2W17A 4WSYA 1T46A 2PMOX 3VS7A 3EB0A 3F9NA 4FA2A 4EQCA 4Z16A 2QC6A 4GKHA 5KMIA 4TYEA 4YZ9A 3W33A 2WQMA 2P3GX 3FC1X 5EOLA 4E5BA 2GNIA 3BEAA 1OPLA 5F94A 3V3VA 4NKAA 3HP2A 1WBOA 1BI8A 3U6HA 4YC6A 2QONA 4XG2A 4X3FA 2OJIA 2ETKA 2PE0A 3HV7A 3SRVB 4BHZA 4LRMA 4JDKA 4F4PA 4ZAUA 4G3GA 3VS0A 1OMWA 4OTGA 4BDKA 3GCQA 5BYYA 5I9WA 1W0XC 2XK4A 3PXQA 3KFAA 4P5ZA 4UZHA 5AJQA 1WZYA 5C9CA 4PMPA 5LJJA 4O7WA 1OITA 2WXVA 4OTHA 5AX9A 5FDPA 4R78A 3SC1A 4OUCA 3SX9A 5KZIA 3WIKA 4XG6A 3N51A 4CEGA 3GBZA 3UQCA 2CNUA 4MXCA 3TN8A 3N9XA 5ACKA 4AFJA 4WSQA 3UNZA 2QLUA 4X0MA 4KBAA 2UW9A 5DGZA 4DCAA 1FPUA 5CYIA 3NUXA 4RVKA 3U4UA 2XP2A 2W05A 2QODA 4QTCA 5CEIA 4B9DA 2BAJA 3H30A 4TW9A 4E6CA 3UZRA 4BVUA 3PA3A 3DBEA 4L42A 3HDNA 1JBPE 4FNYA 3PSBA 4HCUA 4PTCA 4FV4A 3DY7A 2CGXA 3A60A 2WGJA 2XKDA 4I0RA 2F7EE 3VUGA 2X6EA 1NVQA 3F7ZA 4TYGA 1A9UA 2QOLA 5I3OA 3TJDA 3UP7A 2HAKA 3R7OA 4YGAA 1I09A 2XNOA 3BLHA 1H0VA 1XO2B 4JL9A 3F2AA 5HCXA 5LARA 3LVPA 3QXOA 3TKIA 2GQRA 3O0GA 2ZMDA 4C35A 5IEYA 4FVQA 3ELJA 3NLBA 3KA0A 4RJ5A 3R7UA 4APPA 4RC3A 4EBWA 4AZFA 3QZGA 3LFFA 4AFEA 3Q52A 4FIJA 2BHEA 4TTHB 3ZO2A 4I4EA 5KMNA 4KSQA 4QNAA 3QQLA 5L2SA 4IM0A 2JFMA 2WMSA 4TWPA 2KTYA 1PKDA 5ANEA 3NUPA 4UMRA 3PE2A 1M7NA 3FQSA 2PYWA 4L9IA 4DLJA 4PNKA 5J5SA 1KE7A 4PF4A 4CT1A 5CU3A 4EK6A 2ZOQA 2C30A 5J9LA 3ERKA 2VWIA 3NNXA 1NXKA 4QP7A 1QPJA 3IDPA 4AAAA 2YCSA 5K4JA 3OXTA 2R0IA 3FUPA 4FK6A 4WBBB 5ITAA 1GJOA 2UW0A 4A4LA 4CNHA 4OTDA 1OL1A 5F20A 2FUMA 3Q53A 4JJRA 1YKRA 4P7EA 4HVSA 5HORA 3QKLA 3KU2A 3NW5A 3ZRLA 2HOGA 3BIZA 2WZJA 3UO4A 2WTWA 1SVGA 3E8NA 5DT3A 5E7RA 5KBRA 1P4OA 5KUPA 1SVHA 1Q5KA 1PXLA 4W8EA 2PVYA 1MRVA 4EHVA 4F9AA 3I5NA 3EHAA 5HTBA 1Q8UA 1MUOA 5L8JA 3V6SA 2RSVA 4CLJA 4NT4A 4DGNA 4OGRA 4JVGA 3D2IA 3FLWA 2RGPA 4GVAA 3TXOA 4LGGA 5HESA 4BTFA 3SOAA 4FV6A 5DVRA 5EI6A 2PE2A 4G17A 4IE9A 3C50A 1PXOA 1OPKA 1WBNA 2QOHA 3KK8A 4M69A 3VS3A 4BDEA 4AG8A 4EOIA 4ENXA 3AMYA 3LLAA 2X2MA 5DT4A 3WIGA 5LCKA 3GC0A 3QZHA 3DJ6A 5K5XA 5CAOA 3NNVA 4Z3VA 2YFXA 3RINA 3ZHPC 3L8SA 3U54A 3CPBA 2QLQA 3G90X 3VUKA 4DAWA 5AUTA 4XV2A 3LM0A 5HX6A 5TKDA 4AWIA 2F4JA 2O64A 4C37A 1RDQE 2P2IA 4BCPA 4DFUA 2PZ5A 2ETMA 4GFMA 5DN3A 3ZYAA 4ACCA 4IWDA 3UC4A 4YLJA 3FE3A 3K3JA 3LLTA 3PRFA 3RTPA 3D94A 4AN3A 4ZMEA 4QPSA 4IDTA 1YI4A 4F1TA 4BDCA 5IA0A 5L8LA 2IPXA 4EC9A 4G3DA 3ORPA 4S30A 4DTBA 3QGWA 2CGWA 5IU2A 4LOQA 3NAYA 4RJ6A 3HVCA 2BCJA 4ZLYA 2PVRA 4IB0A 4ITIA 1YRPA 1WBVA 5DRBA 5LXMA 2J5EA 3COHA 2F2CB 2YIWA 3MS9A 1AD5A 2IVUA 3Q96A 2GQGA 4F7LA 2R3OA 2QOCA 4CG9A 3R22A 4YHJA 3ZLSA 4ZOGA 2FSMX 4FTTA 3VVHA 3G0EA 4XP0A 3IW5A 4IADA 3QUEA 3QALE 3NIEA 4J96A 2HZNA 2XNNA 2GDOA 2P4IA 3MI9A 4FV3A 4IBMA 4ACDA 4GV1A 2BKKA 1J7LA 4OTIA 2XJ0A 4FKJA 4UZDA 3ROYA 3A8XA 4WG3A 3IGGA 1U59A 3KGAA 3V5JA 3VBTA 3QYWA 3PPZA 4N70A 2CGUA 2JLDA 1J1BA 2IW8A 1Y6AA 4BCNA 2OXDA 3PZEA 5CF8A 3OCTA 5HHWA 4IX4A 3UYSA 5BVEA 5M07A 4U0IA 1BUHA 3RAWA 2G2FA 2HENA 3EN4A 3KXGA 3MY5A 2BRNA 3F5XA 3LXNA 2WU7A 4PMMA 5AR7A 4R7BA 3GFEA 4MWHA 3W8QA 2E9PA 3LPBA 5E8YA 5C8MA 2QKWB 4D4YA 3PFQA 4QP6A 3MH2A 2JD5A 4FL2A 1Y6BA 4MD7E 1UNLA 3Q60A 3I6UA 2O3PA 2VX0A 4TNDA 3O2MA 4NEUA 1H0WA 5DWRA 3TKHA 3QFVA 3G9LX 5M4UA 2X39A 4QTAA 4UV0A 4DEHA 4EK3A 1ZYJA 4R8QA 4AOTA 3GC7A 3EQCA 4C57A 3TT0A 4TN6A 4CFWA 2ERZE 3KMUA 4D2VA 3FKOA 2XBJA 4FOBA 5FRIA 5BVKA 4UMPA 5CAPA 2ZDUA 3CLYA 3DB8A 3MWUA 2X7FA 4NUSA 4O6LA 3FMLA 2Y4IC 3EQFA 4QP1A 3OMVA 3PVUA 1KV1A 2WHBA 3PJ3A 5KMKA 3F2RA 4MD8E 4XLIA 3DKCA 3FI4A 2YM8A 4FTIA 1J1CA 2YCQA 5JQ8A 3NUAA 4IWPA 2GMXA 2R3PA 3QCXA 5FP5A 3VUMA 3KRRA 5EYKA 5A46A 5JFWA 4A9TA 3SOCA 2QURA 1YXXA 2PK9A 1XJDA 3BGZA 3IDCA 5CQWA 3RPYA 5EK7A 3BLQA 5IA2A 2HWPA 3BE2A 4AA4A 2V7AA 3SW7A 2WKMA 5AP7A 2ITPA 4O21A 2CNQA 4EYMA 1PXIA 2WMAA 2EXEA 4L52A 4AZVA 4D1XA 2CKOA 2R4BA 4BZNA 5IQHA 1DM2A 3HUCA 5AP4A 3F6XA 2YJRA 5FXSA 4C2WA 4QMNA 3OD6X 4Z55A 1WAKA 3ZTXA 2FSLX 3QHWA 4I0SA 4P90A 5L2WA 4IVAA 2A19B 4MXYA 3FPQA 5CU2A 3VUDA 2CLXA 3RPSA 4C58A 4ZY4A 3FI2A 3BWJA 2BROA 3EKKA 2XNMA 1BLXA 2Z8CA 4FC0A 4B99A 1F0QA 2WTKB 2PTKA 4H36A 1FOTA 4ERWA 5LCJA 3ZXTA 4YBJA 2B54A 3IW7A 3DS6A 4GSBA 4U6RA 3BU6A 3TI1A 4BY9E 3NRMA 3Q9ZA 3FZ1A 4R77A 4NTTA 2LGCA 4G1WA 4IB1A 3ZOSA 4HW7A 1OUKA 4X3FB 4JRVA 3FMEA 3RAHA 3NVMB 4A9SA 2BRBA 4CFNA 4G6NA 4GU6A 4IH8A 4WG4A 4DH7A 5HQ0A 2ZV8A 3CY3A 2OXYA 3A7IA 1JPAA 3D7TB 2WOTA 4L8MA 3DLZA 2C1BA 5B2LA 3PIYA 4NWMA 1ZMVA 4FT5A 5D10A 3KK9A 4QOXA 4DT9A 1LEZA 5E4HA 3NR9A 3FZTA 3H9RA 3PA4A 3QWJA 4FTJA 5CSVA 2HELA 4RX5A 5CEOA 5LWNA 3NW7A 4FGRA 4J71A 2BHHA 1WCCA 4O7SA 5IA5A 1XBBA 1HCLA 1XH8A 2IG7A 3FMJA 3BLRA 1W83A 3AMBA 2RG5A 3DTCA 4F0GA 5M4CA 3UNKA 4RVLA 5ETFA 3TNIA 4BKZA 3R63A 4RBLA 3TJCA 4F7NA 4DT8A 1JKSA 2ESMA 3GP0A 4YNEA 5CSPA 4NCTC 5LVPA 1XQZA 1JKTA 4RWLA 5IKWA 2VUWA 2XNEA 3MPTA 5AR2A 5D41A 2X8EA 3R9OA 3T9IA 3LCOA 3JUHA 2C6EA 4NJ3A 1DAYA 1RW8A 5DHJA 5HG5A 4YJOA 4AN2A 4NZWB 4O91A 2PUPA 2VTTA 2YWPA 2XNGA 3PG1A 1XH9A 5ANKA 3U55A 4YJUA 2OWBA 4FSNA 4MBJA 4GK4A 4TZRA 3NDMA 3CD8A 2RFEA 1OIUA 2BIYA 3RM7A 2B9JA 2Y9QA 3KF7A 3UPZA 4FE2A 1P2AA 2YA9A 1OM1A 4GW8A 5HE2A 3DK7A 2WB8A 4JS8A 3LJ1A 3TNQB 3GU8A 3NIZA 3OWKA 3PY1A 2X4ZA 3JPVA 3TZ9A 4QMQA 1W7HA 3DAEA 2GCDA 5I0BA 3I6WA 4BICA 2Q0NA 2UZEA 4DC2A 1YOLA 4ARKA 4XOZA 2YM3A 2XIYA 2OJ9A 4HCTA 4XG7A 2JIUA 3LJ0A 2C6LA 5JEBA 4LL5A 4ITJA 5CAVA 2QU5A 1PF8A 3MN3A 2JGZA 3NYOA 5D1JA 4ZSEA 2BZHB 5GHVA 3V01A 5AIKA 3QTIA 3M2WA 3NPCA 3DNDA 5C8NA 5C4KA 4J99A 4AN9A 2I1MA 4O0UA 3T9TA 2YM6A 4GRBA 4BHNA 4EOMA 4Z7GA 3MA3A 2W1EA 1P5EA 2QU6A 1O6YA 5K9IA 3EQHA 4DGMA 4MTAA 2X6DA 4YUQA 4FZFB
chains in the Genus database with same CATH superfamily
4PMTA 5KCVA 5KO1A 3R2YA 2RIOA 4RGJA 3D7ZA 4O0VA 5HTIA 3I0OA 3WZEA 5CWZA 4RVMA 3N4VA 4O7NA 4AT3A 3VJOA 5M06A 2VTQA 2ONLC 1UKIA 2R3LA 4AS0A 4D55A 2VNWA 3P0MA 1OL2A 3G6HA 4M13A 3KY2A 4DINA 2J9MA 4M69B 3D5UA 2R7BA 3LQ8A 4OT5A 4YPDA 4ZTQA 4BDFA 5E8ZA 4U80A 4KAOA 5BVFA 1XH7A 2OK1A 5E8SA 3MY1A 3MDYA 5IQEA 1YHVA 2UVZA 5J1WA 4HPTE 5HD4A 3D5VA 5EDRA 5J8IA 2PHKA 3SV0A 4AW5A 3I7CA 2PPQA 5M4FA 3HP5A 5JSMA 1OZ1A 4JIKA 3QX2A 5HE3A 4DH1A 4FG9A 2VV9A 4JG8A 4PX6A 3AKKA 2VX3A 4YJSA 2PVHA 5IUIA 3QQHA 5G6VA 5FTOA 4NW6A 4FV0A 4HGEA 3ID6C 2Z02A 3SLSA 2PWLA 4EUUA 3DAKA 3ZBXA 3FKLA 4NYEA 3FPMA 1GOLA 2B9HA 4U3YA 3DBDA 2QOIA 4UBAA 4O83A 3O71A 5J95A 4CQEA 4IAFA 4U5JA 4BC6A 3AQVA 2V55A 4F08A 3GQIA 4EOSA 3F2NA 3NAXA 5CSHA 3HV5A 3OS3A 3HA8A 1KOAA 1H00A 1WVYA 4LGDA 3RGFA 4ANQA 3VJNA 4AXDA 2VTOA 3PP0A 2PMIA 5CF5A 1K9AA 2HW6A 2ZV9A 3QQJA 3QZIA 3RJCA 4Y5HA 2WQEA 3D5XA 2QKRA 1BL6A 2B0QA 2YHVA 4FMQA 4IVBA 3F7WA 2X2LA 4UY9A 2XRWA 4XH6A 4Q5HA 5IPJA 2IVVA 3ITZA 3W2SA 3TIYA 2ZYBA 5G1XA 4BCKA 2WMWA 3NUSA 2YLFA 3GU7A 4A06A 4DEIA 4CCUA 5KHWA 3G2FA 2YIQA 4Y46A 4YJPA 1ND4A 4RJ8A 4AGUA 3KVWA 4YTIA 3ODZX 4JR7A 4XV1A 2GNFA 1NY3A 4O82A 4PPAA 5CEQA 4NIFB 3VULA 3NYVA 5EKOA 4CLIA 2BRMA 3BX5A 4N4SA 4ZIMA 4QP2A 5BVOA 3VC4A 1G5SA 5CT0A 4USFA 3BHHA 3DJ5A 4ASXA 2GPHA 4D58A 3BI6A 3UIMA 2IZUA 4AGWA 4IC8A 4HYSA 4BF2A 2HZIA 3POZA 3QQUA 2YITA 3Q3BA 2CLQA 1M52A 3I7BA 4U9AA 2HK5A 3UZPA 3TDVA 5KZ0A 4MCVA 4MD9E 4MXXA 3VRZA 1AQ1A 3QTRA 3QX4A 3MY0A 3W2QA 4EI4A 3ZBFA 4FSRA 1VLRA 2FB8A 1OPJA 4IIRA 3PYYA 3IDBA 4YTHA 4FNZA 5KNJA 1WBTA 4UYAA 2IVSA 4IZ5A 1FBNA 5BV3A 1R1WA 4Y8DA 4WG5A 3GCUA 3W0MA 4WO5A 3HKOA 2XM8A 3UIUA 4BIBA 5BUEA 1J7IA 3AGMA 2VTHA 1UA2A 2O2UA 4X6QC 4MQ1A 4FEUA 1PW2A 3QD3A 2F9GA 4CZTA 2YAAA 5AV3A 3ZLWA 1IA8A 1H24A 5ETCA 1CSNA 3CGFA 3HDMA 1TQIA 1JSTA 2ZM3A 5AUWA 2OJJA 5TOZA 1ZYCA 1WBPA 3HA6A 5AX3A 4C36A 4ZZNA 5DT0A 4C02A 4JQ7A 2PUNA 4I94A 3WBLA 3B8QA 1PXKA 3S3IA 3P79A 1F3MC 5JFVA 3QCQA 3R01A 3UIXA 3KXXA 5C03A 2JDVA 5JQ5A 5CT7A 4HGLA 2OH0E 4B0GA 3EQPA 5BYLA 4BDAA 4CSVA 5CALA 2IZSA 4DH3A 4FV9A 4EZ3A 3ET7A 4GT5A 4QYGA 4GH2A 4DFBA 1O6LA 2XMYA 4QMOA 1KWPA 3K3IA 1HCKA 3C51A 1GZ8A 4I6QA 4JT3A 4CYIA 5FEQA 1V1KA 4RMZA 4AQCA 3OXZA 3IS5A 2WFYA 3TZ8A 4AA0A 4EH6A 5CASA 1XR1A 4KIPA 1Z9XA 4DEGA 2J2IB 5EOBA 4O22A 2PZIA 4K6ZA 1ZRZA 3UMXA 3AG9A 3UJGA 3NMUF 5GJDA 2XZSA 2PZPA 4EQMA 3NCGA 2OXXA 2C4GA 4HYIA 5CI7A 4FKWA 4ID7A 3SG9A 3LCSA 2CCHA 3E8DA 3R8ZA 4GYIA 1R0PA 3H9FA 4L53A 4PL5A 5I5ZA 5BMSA 3GOKA 3Q5IA 5JK3A 3VO3A 5HIEA 5KMMA 2PULA 2VWUA 4DG3E 4JR3A 5I4NA 4CZYB 3JVSA 1UKHA 3IOPA 4KNBA 4CVAA 4LV7A 3PA5A 4KINA 2NRYA 1LEWA 1JKLA 4YHFA 1MQ4A 4FKVA 5CEPA 5LWMA 3BU5A 4GEOA 5HTCA 3L9MA 4ZLZA 3OY1A 3ULIA 2V62A 5HD7A 3U4WA 1SMHA 4BGHA 3KMWA 2ITYA 4G5PA 3KXHA 4C8BA 4K9YA 2OIBA 2HXLA 3DXNA 1ZYLA 3F3UA 2BZJA 2C68A 1Y57A 3DTWA 3VBQA 4IFGA 1H8FA 3CE3A 3KRLA 4UWYA 3H0ZA 3OHTA 4FTCA 1F5QA 2YIRA 1L8TA 5GIOE 3NFGB 2UZOA 1QPEA 3VUIA 1MRYA 2PMLX 2PVNA 3F3TA 4YLKA 5EHLA 1CTPE 2XRUA 4ZSGA 4AGCA 1Q97A 3UNJA 2RL5A 2KULA 3BWFA 3W55A 4YLLA 4A9YA 3PTGA 3DK6A 4D2RA 2PZRA 2IO6A 4II5A 1CMKE 3C4FA 4O7LA 3RCDA 2YCRA 5LVNA 3C13A 1PYEA 4ZTMA 1LR4A 2GNJA 3OWLA 4C2VA 1G3NA 3VUHA 2R7IA 4DN5A 3KXZA 2C3JA 4YZDA 3GI3A 4BYJA 3BQRA 4E5WA 2WEVA 3E8EA 4YC3A 3LFBA 4OBQA 3R9HA 1GZKA 5M09A 3FMKA 4QYEA 4E3CA 3SVVA 4KSPA 4TY1A 3KEXA 1FMOE 2UUEA 2XS0A 3MFUA 4GUEA 3BCEA 5E90A 5TF9A 1PMUA 4QTDA 1UVRA 4FKLA 4RZVA 2YDKA 2YM4A 3L8PA 2JEDA 3VS4A 4DEBA 2FH9A 3FJQE 4RJ7A 2REIA 5CS6A 1YQJA 4EONA 2XAMA 3OUKA 3COIA 4MVFA 3GU6A 4DYMA 4H05A 4YHTA 4ZK5A 4NCTA 4FX3A 5KX8A 2VTAA 3EL7A 4O7ZA 3A7GA 2C6DA 3RCJA 3JR1A 3E92A 5EM6A 4CTBA 4BCJA 5LMBA 4OTPA 4USDA 4AQKA 4K11A 3A8WA 1IRKA 2WMRA 2XKEA 3E7VA 2WTJA 4DHIB 4O86A 3MB7A 3AC1A 4Q2AA 5CXZA 1CDKA 2PSQA 3F61A 4JDHA 5CX9A 4ZEGA 4CFXA 1GZNA 2A1AB 2VX1A 3BYSA 1LP4A 3D7TA 5I9VA 5L6PA 1H26A 1PXPA 4UX9A 3B8RA 4ZSLA 4YURA 3AT3A 4JBPA 4CMTA 2X2KA 4XOYA 4FSUA 3OROA 3FHIA 4NH1A 4PMSA 4BJJA 4YTCA 3R7VA 3AC5A 5AP1A 2OKRA 4XG9A 1PMVA 2C6TA 4ACHA 3AKLA 5B2KA 4FIGA 5AIRA 4NFNA 4IWQA 1U5RA 3BZ3A 5HIBA 3QCSA 2G01A 4EZ7A 4O0WA 2F2UA 2NO3A 4XLVA 3AD5A 3V04A 3NSZA 3IGOA 3QF9A 2HY81 5EI8A 3O5AA 4I5CA 4ZTSA 4BDGA 1OL5A 4FIIA 2OF4A 3R8UA 3VQUA 4ASZA 4JMQA 4S34A 4L46A 4XV3A 2VTMA 5ANDA 1PRYA 3ZFYA 4DF3A 2I0EA 4G6LA 3HLLA 2QQ7A 4YJQA 3A7HA 4G3FA 4WHZA 3ZUVA 3TZMA 3P08A 2WQBA 4AZSA 1ST4A 3P4KA 3QA8A 3WI6A 4D28A 1KSWA 3QBNA 2X7GA 3EKNA 4XUFA 5CU0A 4FTQA 5AAGA 3DPKA 4C7TA 5CZHA 3S00A 2BVAA 3THBA 4ANLA 1OL6A 5EDQA 4O84A 4AP7A 3MESA 5DEWA 4PDOA 1JNKA 3CBLA 1U46A 3BV2A 3R7GA 5AUVA 4UB7A 4BIEA 2X8IA 4X2GA 4EOPA 1Q4LA 2VZ6A 3MPAA 5FD2A 4F99A 5FBOA 2VWVA 3PSDA 2GNLA 3KCKA 5D9HA 4QMYA 3P5KA 5IH4A 4Y95A 4FODA 1FVVA 2AUHA 4FT9A 4S33A 3FXXA 4YJRA 4KIKA 4AT5A 1J91A 3KRJA 5L3AA 3PJ2A 2X7OA 3LMHA 2EUFB 2R3QA 3CD3A 1KUTA 4H3PA 4IVDA 3GOPA 5IA1A 4W9XA 2C6MA 4LUEA 2BFXA 3P7CA 3I5ZA 3BEGA 3R30A 4YU2A 2ITZA 3H3CA 4FZ6A 1Q61A 2DQ7X 3IPHA 3I60A 4M0YA 4B8LA 3TM0A 2ITWA 5LMKC 4V05A 3F66A 1U54B 1YOMA 4O4FA 4F65A 1Q8ZA 3KF4A 3ZSHA 4R1VA 4LOOA 1OKYA 3Q6UA 2VU3A 4XG4A 3NYXA 3LKMA 2BFYA 2JC6A 2OF2A 4TNBA 4OR5A 4OLIA 4EK5A 1IG1A 4O7RA 2VD5A 1XHAA 2JDSA 3CTJA 3EWHA 3R73A 1M7QA 3UMWA 4ENYA 4HGSA 2CJMA 2C3IB 2W1HA 4EHZA 4O7YA 4UWBA 5DA3A 5HO6A 3KXNA 4Q5EA 4HCVA 2B53A 3RK9A 5JKGA 4BBEA 1KV2A 3PVGA 3CQUA 4NK9A 4X2FA 3ZS5A 5AR5A 5AR3A 4FV8A 3Q2MA 3R8LA 3SG8A 3FDNA 4EOKA 2EXMA 3SDJA 1VZOA 3RPRA 2XF0A 3PXRA 2OZAA 4IM3A 1P14A 2CKEA 3VF9A 1IR3A 2BZKB 2B55A 4RIWA 5B0XA 2BIKB 2G15A 2XIKA 3CKXA 1YWRA 2PVJA 4DCEA 5FM2A 3POOA 4OBOA 1Q62A 3GFWA 4FIHA 4TWOA 1SNUA 4FI1A 5A54A 4V01A 4ACMA 1Y91A 1BMKA 2O65A 3MVJA 4FV1A 4GFGA 3CY2A 4XS2A 3VW6A 4MNEB 5FTGA 3KVXA 4DG2E 3MTLA 5GJGA 3AC2A 2CGVA 4ZY6A 2P55A 4O38A 2YDIA 4PWNA 4U97A 3QRJA 3VBYA 4BDJA 5K0XA 3Q9XA 3OT3A 4GMYA 3SD0A 4R1YA 4AAYA 3UVPA 3TCPA 2ITVA 4DFXE 4E4NA 4F1OA 3ODYX 3GU4A 3K5VA 3PZHA 3UOLA 4EQUA 3TG1A 3ZO1A 1SYKA 4EWHA 3G6GA 5A14A 3ZC5A 3AD6A 4BCOA 4BKJA 4C38A 4F6SA 2PU8A 4JLCA 3TNHA 4LUDA 4FYOA 5BPYA 3R8VA 4QMLA 5JN2A 4ASDA 1B38A 1M14A 1YHWA 1ZARA 3BHVA 2E9UA 4KKGA 5EYMA 4XNEA 3R1SA 4NIFA 4C4GA 3GT8A 5AEPA 3W0RA 4QMSA 1CKJA 3ZM4A 2ZJWA 2EXCX 3BHYA 4L45A 3DQXA 4JIAA 4PTGA 4QMMA 4JDIA 5AMNA 5FP6A 4LG4A 5CEMA 2XKFA 1QMZA 3HYHA 3II5A 4F78A 3R71A 3R6XA 2WU6A 4GK2A 4AA5A 4F0FA 4PP9A 4FTRA 2XCHA 3F69A 4LGHA 4X21A 4EH3A 1CKIA 1PYXA 5EHOA 1WBSA 5AUYA 3HV3A 4QT1A 5JRSA 4CGAA 2GHGA 5D12A 3FMNA 5L6WL 2YWVA 2BALA 2X4FA 1BL7A 5CI6A 4X6RA 4DHJA 1H1QA 3Q4CA 3OCGA 3ZEWA 4JG7A 4L00A 4O0XA 5DR2A 3UOJA 3FL4A 2FVDA 3WF5A 3M1SA 3QUPA 4BI0A 1OVEA 4E1ZA 4RX8A 4D0XA 3Q04A 3DB6A 4HNFA 3PVBA 2WMUA 3ZLXA 3ALNA 1U5QA 4GIIA 5LVLA 2BAKA 3FMHA 5JGAA 3HMPA 2WTDA 4BWKA 4USEA 3VS6A 3Q4ZA 5LVOA 2UW5A 2ZB1A 3A61A 3LXKA 1FGKA 2PL0A 2WIHA 5IZFA 5H9BA 1PXMA 3LCDA 4HZSA 4OTWA 4LMUA 4U79A 4EOLA 5TE0A 4AOJA 5C8KA 4X2NA 1MRUA 1T45A 2Y8OA 1WMKA 2J7TA 4GG7A 3R8PA 3LCTA 4GYGA 2CDZA 5EW8A 4X7QA 3TACA 5K4IA 1W84A 1WFCA 3UG2A 4FSWA 1REJA 2R3JA 2JKMA 3QTUA 3SHEA 4FEWA 2HIWA 3RHKA 1ZAOA 2CKQA 3P7BA 4U40A 5EHYA 4O4EA 2G9XA 4ZTRA 1YWNA 2VTRA 2WIPA 3DFAA 3KL8A 3U6JA 2C69A 2YIYA 3HECA 2HXQA 4TWNA 2IVTA 3BL7A 3L1SA 4CFFA 5DRDA 4F1MA 4RLLA 2GU8A 3M42A 3VW8A 4EWQA 5BUJA 2W1ZA 2WTCA 3QLFA 5M53A 4XJ0A 4KKHA 4GG5A 3CGOA 4KKEA 4F9BA 1YDTE 3UO6A 5EW3A 2XBAA 4K18A 3TDWA 4AX8A 5ANIA 2H96A 3DNEA 1E1VA 4FG8A 5HU3A 2ZV2A 3ZCLA 4OW8A 3C7QA 2YJSA 3E3PA 1DS5A 3CP9A 3CTHA 2PUUA 4FKOA 2VTNA 2X81A 5EQYA 3TNWA 3CQEA 3WF7A 4ASEA 4CD0A 2UVYA 2I6LA 5F4NA 2PVKA 2Z7LA 1H08A 3NWWA 3FLZA 4JQ8A 1Z5MA 4PV0A 4I0TA 3PUFC 3R9DA 4ZJVA 3D15A 2V0DA 1SZMA 2RKUA 4CV9A 3OUNB 2Z2WA 5IQDA 3SXRA 3IONA 4EJNA 5EKNA 2XEYA 3DKGA 3GQLA 5IDNA 2JKOA 4FZAB 5FUTA 3MYGA 4ZSJA 1UU3A 2W5HA 3OEFX 2ITXA 4FV5A 4CKRA 4RQKA 3D83A 3QRIA 3V5TA 1Z57A 4TRLA 4QMWA 4RC4A 5I9UA 3VBXA 3LXLA 3CS9A 4D5KA 3UC3A 4CZUA 4GKIA 1YOJA 4G6OA 4OAUC 4YO6A 3UG1A 4C62A 3E93A 5AV0A 4NL0A 4CV8A 4AUAA 4L3LA 4JI9A 3OOMA 1MP8A 2VWXA 4NW5A 5M4IA 4QQTA 3CSVA 3U51A 3SGCA 2QI8A 3F5PA 4AF3A 5BNJA 4PP7A 3BGQA 3HMMA 1PY5A 3FWQA 3P78A 3HRFA 4DEDA 3QKKA 4PY1A 4DFNA 3MH3A 2IW9A 4I4FA 3EQBA 4GIHA 3UBDA 4CTCA 4JQEA 1ZWSA 1GIHA 3WYYA 3FHRA 3R1NA 3BQCA 4L43A 4F64A 3AC4A 4FR4A 3RZBA 5AM7A 4EOQA 4ZY5A 5KKRB 1S9IA 2UZBA 4ANMA 4EUTA 3R00A 4YR8A 2Q0BA 3AT2A 3DZOA 4JAJA 4FNWA 5D7VA 2V22A 4XRJA 4Y73A 3WF6A 5GZ8A 2PVMA 3G0FA 5JGDA 2JAMA 3MB6A 3A2CA 4FTAA 4GFOA 4GVJA 2FSOX 4AGDA 2IWIA 5AV2A 4DE4A 1UWHA 3ENHA 4G2FA 3DU8A 2FGIA 4R5SA 4AU8A 2VNYA 2YEXA 4BCIA 2C0IA 2JBOA 4FSYA 4O4BB 4ANOA 4I20A 4I6HA 4KIKB 4A4OA 3O50A 4NJDA 2OFVA 4IWOA 3DAJA 5C1QB 4IEBA 4I6BA 4IZ7A 4XCUA 3HMIA 5AR8A 5M44A 3IG7A 5ACBC 1O6KA 3IOKA 1FINA 2H6DA 4RWJA 1VYZA 3GC8A 4C34A 4RJ3A 1V0BA 1DI8A 2FYSA 1UU7A 5GJFA 5TT7A 4ORKA 3V5LA 3EFWA 4UMUA 4C59A 3F3ZA 3WF9A 1ZOGA 2YZLA 2GS2A 3DQWA 4ITHA 2BILB 4FF8A 1YW2A 5AUZA 5FQDC 5CSWA 3REPA 3V5WA 4O96A 4QEBA 3P1AA 4F9WA 2OBJA 4ACGA 3C0GA 3KN6A 3QXPA 3OWPA 4BN1A 1OBDA 2GHMA 2PVFA 4M97A 3C4CA 1H1RA 4Y83A 2R3MA 4A7CA 5CVHA 2CMWA 3TV7A 4IX5A 3MFSA 2IJMA 3QHRA 5KMLA 5EH0A 4RC2A 1BYGA 1TVOA 2V7OA 1W82A 4IZYA 4RLKA 4CQGA 3W10A 4D5HA 3OOGA 4U8ZA 3FXZA 2P0CA 5HG8A 4E26A 4L68A 4B6LA 4IJPA 4O27B 2YABA 2YACA 3GVUA 2QVSE 4FJVA 3OTUA 3BHTA 2OZAB 2BZIB 3GU5A 3PXFA 3GGFA 4RIWB 3PLAE 4FKSA 4G9CA 3FLSA 4V0GA 2OO8X 5AUUA 3ETAA 3H4JA 4DTAA 4FRFA 3QD4A 5E8TA 4KRCA 5C27A 3W18A 4LMNA 1JSUA 3NGAA 3OG7A 2FSTX 3RP9A 5FBNC 4MXOA 4TWCA 2DUVA 3LFAA 4QDVA 4FK3A 3FLNC 4DFZE 2UW4A 3O51A 4EH4A 5CANA 4WD5A 4PPCA 1ZZ2A 4ALWA 4BDDA 2OFUA 4GK3A 2ZM4A 4WUAA 4ZJJA 2UZVA 3UO5A 1M17A 2I0VA 4J52A 4JRNA 3ORKA 1RJBA 3ATSA 2JDOA 1JQHA 4M8TA 3TZ7A 1GNGA 2XK7A 4FSTA 4YMJA 5AFVA 4MHAA 3IECA 4GS6A 3FMDA 2XANA 1H4LA 1OKVA 2GTMA 3U8WA 1O9UA 4H39A 4BDBA 4NKSA 5I9XA 5H8GA 4LYNA 4XEYA 2HY0A 4JX3A 4IAKA 5F1ZA 2Z7QA 3DOGA 3RK5A 4AE9A 4O0YA 5AAEA 5C4LA 1ZY5A 3BELA 4TYJA 3FYKX 4EYJA 5EW9A 4FV2A 4BTJA 5DFPA 1KE8A 2OIDA 4I1ZA 3OT8A 5ICPA 2V5QA 3PDTA 5AAFA 3WYXA 4FIEA 3R9NA 5AP3A 3VWAA 3DDQA 3GB2A 5DH3A 1U54A 4ZTNA 2HZ0A 3LE6A 4CMOA 4CFUA 5IQAA 3KC3A 5A4CA 5B7VA 3DXPA 3CJFA 3A99A 3QC4A 2ZAZA 5FGKA 2I40A 3BU3A 2I0HA 4EJ7A 3FYJX 2X9EA 3CTQA 4WNMA 1YDRE 1FQ1B 2RG6A 3EQDA 5HVKA 4FEVA 5KMJA 4DTKA 1QPCA 4BDIA 3B2WA 5DR9A 1PXJA 3W2CA 2BR1A 3QTQA 4OTRA 4CFVA 3TWJA 4HVHA 4AE6A 3RPOA 4M68A 1G8KA 4QNYA 3WE8A 3NX8A 3HGKA 3OBJA 5T3QA 3BGPA 4FKUA 2J4ZA 3NVKI 2I7QA 2CCIA 4L6QA 3D9VA 4EL9A 5L4QA 4QTBA 3A62A 5D7AA 5HE1A 4B7TA 4KBCA 5AV4A 4J8MA 5CZIA 3IKAA 2JAVA 3I79A 5E8UA 1MQBA 2W7XA 4O1PA 4KBKA 4YJTA 3TTJA 2GFSA 5E8XA 3UYTA 3ZRMA 3OXIA 3DFCB 2GS6A 2FO0A 2XK9A 3GEQA 3ZFXA 4KS8A 5A6OA 4I24A 4H1MA 3TTIA 2UW8A 2I0YA 2W1DA 2R9SA 4C4EA 1YVJA 3WOWA 3KIOC 5IQFA 2OJGA 2WD1A 4KIQA 4W4VA 5BQ0A 4MNEA 3RHXA 3QQKA 4PL3A 1Q3DA 3FQEA 5KMOA 2OIQA 4FBXA 3A7JA 2E9VA 4FVRA 3PJ1A 3C4WA 4EZ5A 3AC8A 4ZZMA 2GHLA 3E8CA 4IANA 4O6EA 3CQWA 3RNIA 4BBFA 4QYFA 4UXQA 2QO9A 3S2PA 1E1XA 5CSXA 3BBWA 1OBGA 1UU8A 3V51A 3W2OA 4AW1A 3GCSA 3FI3A 3P86A 4PQNA 4EH8A 3S0OA 3AT4A 3QTSA 5HCZA 3CCNA 4RIYA 2B7AA 3G33A 3W8LA 4V04A 3LFQA 3QLGA 1YXTA 4EOOA 1W2FA 3TUBA 1XWSA 1OKWA 3BYUA 5DMZA 4PUZA 4YZCA 2C0TA 5HNBA 3UQFA 3AKJA 5CF6A 1PMNA 4FTNA 2PZYA 2PE1A 1H07A 2XK3A 2Z60A 2B4SB 1URWA 3QAME 4EORA 4F7JA 3P5JC 4NM0A 5AWMA 2A2AA 1I44A 3R8MA 5C01A 3EYHA 4W8DA 4M0ZA 4MK0A 2BAQA 2C5OA 5HNGA 4BI1A 2BDJA 4ZTLA 3R0TA 2CKPA 1ATPE 2BDWA 4I6FA 5CU6A 3UGCA 4EBVA 5GIPE 3WILA 1OGUA 3D0EA 4WUNA 1H1SA 5LMAA 3OVVA 4EH7A 5EYCA 4J98A 4AZEA 4BGQA 3O7LB 3ZDIA 3ZSIA 3EMGA 3ZFMA 1B39A 4E5AX 1NA7A 3BKBA 5M56A 3NS9A 3RPVA 3DBFA 3RMFA 3Q9YA 1LPUA 1XMLA 4KUJA 3WZUA 4H3QA 4O2ZA 3QC9A 2UZNA 3R7YA 2J0LA 3TV4A 2RFDA 2XNBA 4DLIA 3A4PA 3EOCA 3H9OA 4PNIA 4IM2A 4IDVA 2R3RA 1YWVA 2JDRA 3EZVA 4KIOA 2OH4A 4W4XA 2R2PA 4HNIA 4X2JA 3MVHA 4I41A 1OI9A 4BTMA 5HE0A 4CYJA 2R3KA 4HPUE 4QYYA 4EH5A 4XG3A 2A0CX 3R04A 4DDGA 3R7EA 5I9ZA 5JZJA 5DBXA 2WO6A 2ZVAA 3E3BX 3PPJA 1YI6A 4X3JA 4D1SA 4HVIA 2Y6MA 4U81A 3QTXA 3AGLA 3HMOA 5E91A 4MBLA 3UODA 3WZDA 2ITOA 3SXSA 4EK8A 5A4EA 1A48A 2JIVA 2YERA 4BIDA 5E9EA 2VWBA 4B8MA 3EH9A 3LJ2A 2YCFA 3Q2JA 3A4OX 4F63A 3CJGA 3FSFA 1NVRA 4NM5A 3L9NA 5E1EA 3UZTA 4E4XA 3IK3A 2UZUE 4YP8A 2XH5A 3NUYA 3VS2A 4Y72A 2QOFA 2VO3A 3JY0A 4G5JA 4XBUA 4YNOA 2ZMCA 2SRCA 2JBPA 4U7ZA 5HLPA 4C4HA 3C4EA 3ZEPA 4FUYA 4KABA 5IISA 1IAHA 3RAIA 4HOKA 4JBQA 1ZMWA 5CU4A 3SXFA 2YIXA 3QKMA 5H8BA 2WTIA 3E62A 4IACA 4LRJA 4D2SA 5ANGA 5EM7A 3AC3A 3BRBA 3EN9A 5T6KA 4G16A 3CPCA 3D14A 3ZZEA 4G3EA 4K33A 3RAKA 5K5NA 2CHLA 5IH5A 2GQSA 5CEKA 4W4YA 3RKBA 2GFCA 3ALOA 3NW6A 1ZXEA 3KREA 2WAJA 3OEZA 3UVQA 4RIXB 3QZFA 4RA4A 3DZQA 4CCBA 3Q5ZA 4TYHA 3S95A 3CC6A 5ETIA 3WF8A 4DA5A 1XMMA 2O0UA 4RT7A 5FDXA 3OP5A 1ZY4A 4M67A 5DG5A 4CKIA 4E20A 2QOQA 3O8PA 2GNGA 2BUJA 2PY3A 2X0PA 3ZMMA 5IUHA 4MEDA 3W0OA 5FEDA 4DEEA 1URCA 4DGLC 4BR3A 2VN9A 4AACA 4M14A 4J7BA 3VONA 2WTVA 4H58A 1IAJA 3NZ0A 3LFCA 3LZBA 3KXMA 3Q4TA 4FKTA 3DLSA 5EM5A 4ALUA 3TMOA 3PWDA 5HICA 1OL7A 1JLUE 3COKA 5DR6A 3L9PA 4FEQA 3T8OA 4BB4A 3QL8A 5EDPA 2X1NA 3LFDA 3FV8A 3LOKA 4RRVA 1KE9A 3ORMA 3PJCA 4F70A 1K3AA 3OW4A 4V0GB 4K77A 3BYVA 2XCKA 4MAOA 3ZDUA 4A9UA 2XIXA 3IQ7A 1BKXA 1PMEA 5IEVA 3P23A 2CNVA 2W4OA 1JAMA 1R0EA 4QPAA 2WOUA 2IF8A 4UN0C 4JNWA 1H1PA 4EC8A 4XYFA 3N4TA 3OW3A 4GT4A 3ZO4A 4F6WA 1UU9A 4QPMA 5AM6A 5AUXA 4D2WA 2BRGA 3IW8A 3DV3A 2OSCA 4FTMA 3QWKA 4R5YA 2ONLA 3ZSGA 4AW0A 3MVLA 3G15A 5AP6A 1REKA 2E9NA 4YZMA 4BDHA 1LUFA 5HZNA 3NYNA 3DKOA 4C61A 5A6NA 4FZDB 1U4DA 5J87A 3W1FA 4O7VA 4QMUA 3V8TA 4BBMA 1L3RE 4TYIA 3PXKA 2IZRA 4K2RA 4IAAA 4RG0A 4ZS4A 1DAWA 1W8CA 2JDTA 3RNYA 2BTSA 4AOIA 1M2QA 4B4LA 3ZXZA 3V6RA 2JITA 5HG9A 3DBQA 3R1YA 4HGTA 3G51A 5LVMA 3L8VA 2GSFA 5DPVA 1EH4A 2WQOA 4DGOA 4RVTA 2B52A 4EHGA 4F6UA