3KULA

Kinase domain of human ephrin type-a receptor 8 (epha8)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
274
structure length
267
Chain Sequence
TREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFGLSRVLEAAYTTTIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 8
publication title Kinase Domain of Human Ephrin Type-A Receptor 8 (Epha8)
rcsb
source organism Homo sapiens
total genus 87
structure length 267
sequence length 274
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kulA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kulA01
1J7UA 2C68A 4FSYA 3TNPC 5I9YA 4KRDA 4EHEA 4GVJA 2BZIB 4KBAA 1B39A 3P08A 1Z5MA 3DXQA 3TKUA 4AN9A 3QX2A 2VWVA 4IBMA 3Q6WA 4IEBA 4U41A 4IXPA 5L8JA 3EJ1A 3TZ8A 1A48A 3BWJA 5EI6A 5CI6A 3GOKA 4D1ZA 4JNWA 4RC4A 3OCGA 3PIYA 4B0GA 3F3VA 2RG5A 3IOKA 3LAUA 2H96A 1REKA 4WSQA 5CVFA 1Q24A 5EG3A 4FZ6A 3FLZA 5C4KA 2W1FA 4IHPA 4X6RA 2VWUA 3HUCA 3UOJA 5AIKA 3PVBA 5FP5A 4F6WA 4CQGA 4Y95A 3K3IA 5LMBA 2BKZA 1R3CA 3NUUA 1RE8A 3QLGA 4GJ3A 3UZPA 3LHJA 2VTJA 4L9IA 5CNOA 2HK5A 3E88A 4ZSLA 4JQEA 4P2KA 5AV3A 3FKLA 4YTFA 2Y4PA 4RIOA 5DEYA 5GJGA 2EUFB 5EDPA 5IEXA 1MRUA 4RJ5A 4RX5A 3GBZA 5AP0A 3HDNA 3GI3A 5AX9A 5AV0A 2Y6OA 4FI1A 5EYDA 2C5NA 4Z7GA 5IH4A 3DB6A 4IAYA 2BZJA 3FZ1A 5HBJA 4PWNA 3M1SA 4ANMA 4OTWA 4C02A 3Q52A 4DH3A 4ANQA 2Q0NA 3WF5A 4EOPA 5AUTA 2JFLA 4EUTA 5LCJA 4FSMA 4FKTA 3ZFYA 1PKDA 4J71A 4NTSA 3CIKA 4MF1A 5C03A 3C9WA 2Y7JA 5GIOE 3EQGA 5JKGA 3W16A 5A4LA 2XK8A 2IJMA 3OHTA 2R3PA 4KABA 3MY0A 1GIIA 4OW8A 2PHKA 3PXYA 3F66A 3FMLA 1QPEA 4FSRA 3U55A 4MNEB 1KE9A 2YCQA 3EIDA 3O96A 3P78A 4JDIA 4S2ZA 4YTIA 3FXZA 3R8MA 4AGDA 1QL6A 4GIIA 3TDVA 3PP0A 5CXZA 3PA4A 2XNMA 2OJIA 2Y8OA 3ROYA 3ORTA 4AF3A 5K5NA 3PJ3A 3ZXTA 5ETCA 3G6GA 3RPVA 4HCVA 2XUUA 3NDMA 1OBDA 5HBHA 4C3PA 1JOWB 3S3IA 2DYLA 2IVVA 3A8WA 5FLFA 4G3FA 3VS2A 1R39A 3V51A 3VUDA 3DGKA 2ETRA 4L7FA 1YDRE 4BI2A 5CS6A 4JDHA 4L01A 2PK9A 3R71A 4DTKA 1SM2A 2J0KA 3E93A 4GG7A 4I0TA 5JH6A 4QP7A 4QTAA 3FZTA 3ZXZA 3WILA 3C4FA 1YKRA 4R78A 3BWFA 4NK9A 4TY1A 4BR3A 3CCNA 2R7IA 2J0IA 5EKOA 2C1BA 3TXOA 3FZPA 4X0MA 5E92A 4G3DA 1DAWA 4ZY6A 1LEWA 2ZB0A 3Q9WA 3ZO1A 1XBBA 1CDKA 4U44A 4M0ZA 3UC4A 2WKMA 5EYKA 3WF7A 4EC8A 3FL5A 2CSNA 2HY81 2ERKA 3R30A 3EQHA 4UV0A 3R9OA 4F7NA 3DFCB 3ZYAA 3P23A 4WG3A 4HJOA 3TACA 3QALE 4C8BA 2VNYA 2QONA 4I5MA 5DOSA 3HLLA 5A14A 2VWYA 5HO6A 5EW3A 4EOMA 2PMLX 4EEVA 2OJGA 3W2QA 4O38A 4YJSA 5FQDC 2V0DA 3DBDA 2WB8A 1IR3A 4YZMA 4O0VA 4JS8A 3W2RA 2OLCA 3KA0A 4FTJA 1M2PA 5JFXA 4UMTA 3DTWA 1WAKA 2VWWA 3OW3A 3V04A 1H1SA 3SOCA 4CD0A 4O96A 1TQPA 4FBXA 3RGFA 3H10A 4CFUA 4UBAA 5KNJA 1OPKA 2QU5A 3ZO2A 3KK9A 2FSMX 2OF4A 3PFQA 4JXFA 4OTGA 4QQCA 2QC6A 4F4PA 3QQHA 4IW0A 5LQFA 5IQGA 1KE6A 5ANKA 5EKNA 3FZOA 4HGEA 3DCVA 4FIJA 1OPJA 3UYTA 4YSJA 2OF2A 2C30A 2BR1A 4RG0A 4BVUA 3LFFA 3HVCA 3C51A 4X2JA 1DM2A 4K18A 5E7RA 3TT0A 2ZDUA 1OUYA 1K3AA 4XEYA 4ANNA 3UQGA 1NY3A 4E7WA 3ATSA 3B8QA 1MQ4A 2B7AA 2WQNA 4O1OA 4RIYB 3JYAA 4FOCA 4IACA 1MP8A 4IE9A 3RP9A 2PPQA 1W98A 4BDEA 4AW0A 3QCYA 3U8WA 2BDJA 3PSCA 4MK0A 3VC4A 3FAAA 3QQFA 4HGSA 4JG6A 3HX4A 5IA0A 1ZYDA 4FV8A 4FV7A 3T9IA 3QKKA 4QTCA 5FBNC 2WQEA 2R3GA 1M52A 3FI8A 2QOQA 3GVUA 4FUXA 2YLEA 4YC6A 4EOJA 4WKQA 1PY5A 4II5A 1ZMWA 3OCSA 4MVFA 3PRIA 3Q96A 3GCUA 1YDSE 3KMWA 4LRKA 2OGVA 4I5HA 4PTEA 2VWBA 3F82A 1NVRA 4FKUA 3DQWA 4KD1A 3RPYA 5AEPA 5TF9A 4FSQA 5CF8A 4IH8A 3RINA 4GEOA 3DBFA 4CMUA 4FICA 1H4LA 5HNIX 4C2VA 3UPXA 2QG7A 4BDHA 2EU9A 5HG5A 4U80A 5H9BA 3RI1A 3A7HA 3OD6X 3KRWA 3TJDA 4ZTSA 3TV7A 3D7ZA 5E9EA 2PMIA 3D15A 4MH7A 3RALA 5HG7A 1AQ1A 1XKKA 2JAVA 3FC1X 4OR5A 2WMWA 2RL5A 2P3GX 5M56A 4EH7A 2CCIA 2GPHA 4JX7A 4S31A 4M8TA 4YHTA 3R2BA 5FG8A 3UGCA 5E91A 3AMBA 5AR4A 4BTKA 4C0TA 2UUEA 3OTUA 4LGGA 3LCTA 2E9OA 3U9CA 2KULA 2JKOA 4AW5A 4BTFA 2VTPA 1PW2A 1KSWA 2WU6A 3BHUA 3IECA 3QTXA 3ZS5A 4FG8A 3FZSA 3PLSA 3U6HA 4RIWA 4AGWA 2JGZA 3H0ZA 4KKGA 4R5SA 4DN5A 3FMJA 5DMZA 3ODZX 3G33A 5EM7A 5CAQA 4RA5A 2XM8A 3EQDA 1OL2A 4FV5A 3PA5A 3FXWA 4B9DA 5J9ZA 5CXHA 4C61A 4BKZA 5EOLA 5DRBA 2ERZE 1UWHA 4CT1A 1BI7A 2XF0A 5HE0A 3IW5A 5EQYA 2X8DA 4TYJA 4O84A 5L2SA 3W2PA 2VNWA 4D2TA 3HA8A 4R3RA 3F2AA 2YM3A 3EQIA 3FI4A 3GT8A 4JVGA 3CLYA 5HGIA 2Y0AA 4FV1A 1Q99A 3ZH8A 5EQEA 2PVMA 5ETIA 1VYZA 3JR1A 4F09A 1Q5KA 4OGRA 4OT5A 4B4LA 2FB8A 3EL8A 4FEXA 3R2YA 3QHRA 4YZ9A 2WELA 2QO7A 2UVYA 1JAMA 3GOPA 3VVHA 5IA3A 5KKRB 5LARA 4IX6A 4I6HA 2B4SB 5IA5A 4ZY4A 4Y8DA 4IX3A 5KMKA 3GQIA 3SLSA 3NR9A 1R78A 1OL5A 4XV3A 4BHZA 3UZRA 4FT7A 4KIPA 2ITTA 3VQHA 2VX3A 2BIYA 3KRXA 4UALA 3QCSA 1OITA 4KAOA 3MFSA 4GFOA 4RQKA 2Y9QA 1YHWA 1HCLA 2E9NA 4O7YA 3ZC6A 3ZZEA 1YVJA 4DCAA 3W32A 5KMNA 3ZLSA 5B0XA 5IMEA 4V0GB 4K9YA 5LMKA 3BYUA 2ZV9A 3HGKA 4O86A 4MBIA 2UW7A 4F64A 5A4CA 1P14A 5KMOA 4CZUA 4TL0A 4PV0A 3P7CA 2IW8A 4ACGA 2IWIA 3BYSA 2YDIA 3MVJA 1O6LA 4FKLA 4YLLA 3D5XA 4EL9A 1OIUA 2QCSA 4WRGA 3QUEA 3C0GA 2X81A 2CNUA 4XX9A 3W8LA 3M11A 2F57A 3F5GA 2QOHA 4C3RA 3LOKA 3DZOA 3P5KA 2YWVA 5TO8A 2XNGA 5T68A 3WE8A 3QA0A 3PJCA 4ASDA 3RPSA 1Q61A 5AV2A 2WMTA 4U81A 4BCKA 3HMIA 4FEUA 1YXUA 4UXLA 1RJBA 2J50A 2ONLA 4Y5QA 2GSFA 5HKMA 3OF0A 2BALA 4CMTA 3RVGA 4DFLA 3HEGA 5CAPA 1VR2A 2CGXA 3A7IA 4MNEA 4F0FA 2X8EA 3WZKA 3GENA 3KL8A 1XH4A 3NUAA 4G6OA 4C4GA 4F0GA 5CEKA 5IISA 3AGMA 4WRSA 2HENA 3IW6A 2C6LA 3KXMA 5CAOA 4ZSGA 1Y8YA 3LMGA 4NM7A 4L67A 4E6DA 4E6AA 4N57A 4RBLA 1VZOA 3SRVB 4FTUA 4MX9A 2WO6A 3VJOA 4XG9A 5AUWA 2GQSA 2IG7A 5I9WA 3EKNA 5ETAA 3FQHA 3EB0A 3F9NA 1VYWA 4ASXA 4QO9A 2XJ0A 1JSUA 3LXNA 4YBKA 3S95A 4KIOA 1WMKA 2YABA 5M55A 4ZZMA 4EHVA 4B99A 3AD5A 4USFA 5IMXA 2X6EA 3IW7A 2RG6A 2CKPA 3SA0A 3LCSA 3VBVA 3F6XA 4YJPA 5CF6A 4ACDA 4JBOA 5HNBA 1S9IA 3WYXA 5D10A 4B8MA 2YIXA 2GHLA 2WEIA 3F3TA 4YURA 1ZLTA 4RVLA 2X7FA 2OH0E 4IM2A 4QMVA 4OUCA 5FXRA 4E6QA 1YXSA 3FMEA 4FL2A 1V0BA 4XP0A 1H25A 5CT7A 3U51A 5I3OA 3PE1A 4BDCA 4FL1A 1P4FA 3LE6A 2QHMA 4PPAA 3DXNA 4IJ9A 4GVAA 4Z16A 4CKJA 3QA8A 2PYWA 2I6LA 4V04A 2A4LA 3EQRA 1J3HA 2C5YA 5HESA 5CEQA 4UMRA 3O7LD 4OAVB 3UZTA 2I7QA 4A4OA 5C9CA 2XB7A 3GQLA 4X2GA 2HWPA 3UP7A 5BMSA 3E3BX 4MD9E 1JQHA 4F7JA 3IOPA 4D2SA 3G15A 4BCPA 4BI0A 4A06A 1NW1A 2A19B 2VO6A 3BQCA 3CBLA 3C4CA 2GNFA 4QMXA 4WUNA 1RDQE 4EYJA 4F9CA 1IAJA 5LWNA 4BCNA 2W1HA 2J5FA 2QR8A 3QQLA 4IB3A 4WD5A 3AG9A 3U54A 4BCIA 3T8OA 1U46A 3P7AA 3Q4ZA 3HMMA 4QMWA 3UP2A 1WZYA 5CY3A 5HE3A 4QNAA 4KKEA 5KMJA 3ZOSA 3HDMA 3NUNA 4RIYA 1DAYA 2JD5A 2VTHA 4QP3A 4U0IA 5HIDA 4IM3A 2REIA 1K9AA 4FTRA 4TYGA 2OSCA 1Q8ZA 1H1WA 3BU5A 2OZAA 3FL4A 3GCQA 2WIHA 3SAYA 5GINE 3V8TA 1H1PA 4UY9A 4AGUA 3R8VA 3HV5A 4D0XA 4IAFA 4LGHA 1KOBA 3GC0A 3NYOA 4EKLA 2YM7A 4GT5A 3E62A 3O2MA 4I93A 3PA3A 2JLDA 4H58A 2CN8A 4O2ZA 4QOXA 2QURA 4IVBA 3UOHA 4EHGA 5IQAA 3L8XA 4RT7A 3KXGA 3H3CA 1O6YA 3FEGA 4X2KA 4BBMA 3Q5ZA 2F7ZE 5I9ZA 4MF0A 3HMNA 2X7GA 2AUHA 5AR7A 2H8HA 4XOYA 3UJGA 3FE3A 4HYIA 4AWIA 5A6OA 4OTRA 4AE6A 3U6JA 4LQMA 3K3JA 2PZ5A 4TWOA 3DZQA 4QMZA 3BU6A 5JEBA 2XEYA 4JI9A 4DC2A 3FSKA 1WVXA 4XG6A 2NPQA 1LPUA 3MA6A 2IPXA 2GNGA 4NEUA 5EYMA 4GK3A 2IVTA 3C5UA 2RFNA 4FA2A 4I6FA 4EOLA 3PVGA 1CM8A 2X9FA 3PY1A 4Z7HA 5EQPA 4A4LA 4FIEA 5GJFA 4TYEA 2XBJA 4JJRA 3UTOA 4D1XA 5GZ8A 3VW6A 3BYMA 2VX0A 1U54B 3KXNA 4FKOA 1OKYA 4O91A 5AUVA 5BVEA 4BIBA 2W96B 3POOA 4KRCA 4XBRA 2C5XA 3OUNB 5FRIA 4MHAA 4RLLA 1DI8A 2QHNA 5J7BA 4BCQA 3Q4CA 4ZY5A 2I0EA 3E3PA 4QQJA 3W2OA 2W7XA 5HLWA 3G6HA 2V62A 1OVEA 2XCKA 1Q41A 4L53A 4RSSA 4CMOA 3WOWA 2X7OA 3PXZA 2XVDA 4GW8A 2R9SA 3TWJA 3R8PA 4QMPA 3R21A 4J52A 4FTOA 5LWMA 4F7LA 4FKJA 1WBWA 4NJDA 3Q3BA 2PVKA 3BELA 3COHA 4RIXA 2XMYA 2WMXA 1CKIA 3U6IA 4DTBA 3MIYA 4L46A 5HTBA 3L1SA 4EOSA 4IANA 3AMAA 4ZMEA 4G2FA 2WMQA 5C4LA 2W9ZB 5E8SA 4XJ0A 3MA3A 3MH1A 4D5HA 1ZMUA 4APPA 5D11A 4MXCA 2YDKA 3K2LA 4M12A 4D5KA 2W1CA 4J97A 5JFSA 4DH7A 4RFMA 3UPZA 5BYLA 1IA9A 3W1FA 3O51A 5CAVA 3UMXA 4C33A 4GKIA 5GIPE 4FIGA 2CGUA 3PZHA 2GQGA 5AUUA 2C6KA 2XCHA 4K1BA 5E8UA 4JAJA 5DYJA 5DG5A 5IQDA 2J51A 2WQBA 4GUEA 5BVNA 5FDPA 2BCJA 2O8YA 4G6LA 1UA2A 3R9HA 3V5PA 3VBTA 4BB4A 1PMVA 4F99A 5I0BA 4NM5A 2YCSA 3OP5A 3LMIA 2CCHA 5EI8A 3D0EA 2YITA 5ANEA 2E9VA 2HAKA 4TNBA 3UYSA 4KBCA 3VHEA 3AD6A 5JQ8A 4KS8A 4L3LA 4CZYB 4BTJA 5GZAA 4YO4A 3MSSA 4PUZA 2A2AA 2PVYA 5E8YA 3UE4A 4LRJA 3CD8A 4RJ8A 5AP2A 3NW5A 1T46A 1XH6A 3ELJA 4W4YA 4JL9A 2BZKB 2H6DA 2YFXA 2JEDA 3CJFA 3R7YA 2QLQA 5TR6A 3TTJA 1GAGA 3KXHA 4L00A 4LMNA 4U8ZA 2UW5A 4NM0A 4BBFA 4FZDB 2W9FB 3PLAE 3ZU7A 4GUBA 4FOBA 3ZLXA 4H1MA 1UKHA 4M7IA 5BMMA 3DKOA 5ANJA 3BU3A 4RJ3A 3CGFA 3TKIA 2I40A 3PXFA 4J7BA 3V6SA 4BCJA 3O23A 3LMHA 3NNWA 3OCBA 5KZIA 2PSQA 2XK9A 4Y83A 2UZEA 3RK5A 3EQPA 3GC9A 1WBTA 2KTYA 4EQUA 3MJ1A 1J1BA 4ARKA 3DPKA 3CKWA 4LM5A 4EH6A 3CTHA 4OTFA 5G1XA 1IRKA 3BQRA 1M17A 2ITZA 4A9UA 1W0XC 4KB8A 4FTKA 5FXSA 3ACJA 3IKAA 4M69B 2QOIA 4J8MA 1PYXA 3A7GA 3E8DA 2WIPA 3RTPA 5E90A 1F5QA 3LFEA 5HU3A 4R1YA 2WXVA 3FXXA 5FWKK 4EONA 3PJ2A 3R9NA 5A46A 5M51A 4L45A 2YIRA 3O8PA 4CT2A 3A7JA 4ALWA 2J9MA 5IEYA 3MV5A 4CG9A 1H08A 4XOZA 2UW4A 4DYMA 2WMUA 4DGGA 3SRVA 5CF5A 5HX8A 1CSNA 3V01A 2LGCA 5M06A 4DEEA 5CNNA 4F9BA 4FTCA 5TOZA 3KCFA 3PXQA 3WF8A 4DH5A 1H1QA 2XZSA 3D2IA 4AXAA 3DV3A 2YWPA 4FNWA 1LEZA 2QO9A 4NCTC 3VO3A 4E5AX 4YZDA 4IJPA 3F61A 3IS5A 4ALUA 3ALOA 4YPDA 5ANDA 3JPVA 3NX8A 1GNGA 4M15A 2PE0A 4EH9A 1OECA 3NNVA 4GS6A 5AP5A 4D55A 1UU8A 3QZIA 5LMKC 5IQBA 3Q9XA 4O1PA 3I0OA 3I6WA 4FUYA 2Z8CA 5HX6A 2VUWA 4D2WA 5C01A 3OOGA 4RGJA 2HXLA 3I1AA 2ZYBA 2GS6A 3E87A 3JS2A 4FGBA 4F9WA 3PXRA 2R3RA 3R7VA 5AP1A 2ZM1A 3GU7A 3B8RA 2PWLA 3QYZA 3TZ9A 4BWXA 4PP7A 4YSMA 2X8IA 1FQ1B 5KHXA 3ZO4A 4ZSJA 3C4XA 3D5UA 3FMMA 4PMSA 4PF4A 5EM6A 3KKVA 3QF9A 5HBEA 5IA1A 3QRKA 3CTJA 3IW8A 4F0IA 5TKDA 1AD5A 2V7OA 5GZ9A 5LVLA 3GU5A 3LFSA 1ZXEA 4RJ7A 3LXPA 3MFTA 4PNKA 4EK6A 1XH9A 4F65A 2JDSA 2PE2A 2ONLC 1ZYLA 2WMSA 4JRNA 5HG8A 4BWKA 4J8NA 3FLYA 3TNQB 4EWHA 3LVPA 4O6LA 4JBQA 4ZLZA 5M09A 4D9UA 3HKOA 4UX9A 2WEVA 3ACKA 2R0IA 2PZIA 2CGVA 2XA4A 4HYHA 2ZM4A 3ZUUA 4BZNA 5AR2A 4H39A 4L3JA 3GC8A 4BL1A 1Q97A 5C8NA 4MTAA 3DK3A 2DUVA 3EZVA 4PDPA 3FKOA 1H0VA 3KXZA 2GS7A 2ZB1A 1PMNA 4CFWA 2YN8A 1OIYA 2VTMA 2HYYA 2W17A 4Y85A 4XV1A 3ZRKA 3N51A 1Z9XA 4FIIA 1YOMA 4FT9A 3OS3A 3A60A 4E4LA 3GGFA 3ODYX 5AAGA 4D2PA 3ZUVA 4DGLC 1CTPE 3PY0A 4WG5A 3UVPA 4O7TA 1ZYCA 3OG7A 2C0IA 3KK8A 5KMLA 5DFPA 1H0WA 3HV4A 5EDQA 3KB7A 4XG8A 3FQEA 3FMHA 2ZDTA 3R00A 2G2HA 4FYNA 4O6EA 5D7VA 3QTUA 4IAZA 3SVVA 2G2IA 4F1OA 4RZWA 4IMYA 3Q60A 2VGPA 3AT4A 3OVVA 4FVPA 1PF8A 4JDKA 5L6WL 4CFMA 3R9DA 4TN6A 3ID6C 4I94A 1YWRA 3HZTA 2W5AA 4DBNA 5M4CA 3RKBA 2R64A 4ZLOA 4FF8A 4IADA 3GFWA 1B38A 5EOBA 3PPKA 1M2QA 5K0KA 4AT5A 4EH2A 3QD3A 2ITNA 2GFSA 3WZJA 2XBAA 4YHFA 4M97A 4FKWA 3CSVA 2QKWB 3DAKA 3NCGA 4PPCA 2YAKA 4CG8A 3SC1A 3SG9A 3BIZA 1ZOGA 2XRWA 3DDQA 2WMRA 2QNJA 4K77A 5EW9A 2V22A 4C4EA 2F9GA 3MIAA 3ZSGA 4ERWA 3EL7A 3GU4A 2V7AA 3BEAA 3HV7A 5HO8A 3RAHA 4ITIA 4Q5HA 4I22A 2OBJA 1U54A 4RWLA 4OAUC 1STCE 3P0MA 4BWPA 3Q4UA 3IGOA 1XH5A 2OICA 3ANQA 1GOLA 3FUPA 1FVTA 3E8CA 3LLAA 3W10A 2X4FA 2IW6A 3EZRA 4EZ7A 3KRRA 1I44A 3ZO3A 2BRMA 2WZJA 3GCPA 5ANIA 5JMSA 4TYHA 2PZPA 1ATPE 2E9PA 2JBOA 5A4EA 1W82A 3FPMA 3D83A 3I81A 4ERKA 5HD4A 3TM0A 5IDNA 1Q3WA 3C5IA 2WTKB 5LXMA 3F2RA 4O7SA 5KCVA 1YXXA 3O8TA 2W5HA 3UO5A 2W1GA 4FKQA 3QQKA 3ZDUA 4FV9A 3ROCA 1PHKA 4FV0A 2CJMA 2WTJA 3EFLA 3F3UA 4KIKB 5HVYA 2FGIA 2J0JA 1DS5A 1Q3DA 4RVKA 3I7CA 3Q5IA 4QP4A 4W4XA 4G1WA 1PKGA 5CSHA 4IC7A 3DQXA 3NPCA 4UZHA 4S30A 3TKHA 5J5TA 4CYIA 2XP2A 3H30A 1KE8A 3ZUTA 4CRLA 3KCKA 3NZ0A 5C1QB 3BHVA 3Q9YA 2GFCA 5DI1A 3LM5A 2FSOX 3NEWA 4M0YA 4P90A 5I9UA 3SXSA 2Q0BA 4C35A 3MTLA 4FSTA 5K5XA 2Y4IB 4I5PA 4P5QA 4PMPA 5LVOA 5IA2A 4FEQA 4BRXA 5J1VA 4AE9A 3IK3A 1W8CA 4PY1A 4BKYA 2QOCA 4UWCA 3LQ8A 3UNZA 3PG1A 3TN8A 2WGJA 3N4TA 3GP0A 3OBGA 3CR0A 2VU3A 3GNIB 4JG8A 4D4RA 3GCVA 4WHZA 1QMZA 2YIQA 1MRVA 4IZYA 5EHYA 5L8KA 3KULB 3IDCA 2PVFA 1G3NA 5DIAA 3MFRA 2JDTA 1W83A 2JKMA 3OXIA 4LFIA 4QP6A 3CC6A 4MD7E 4P5ZA 5DT4A 3V5WA 3KRJA 4ITJA 2PL0A 3E64A 2R4BA 4XBUA 3BEGA 1PRYA 4D28A 5GJDA 3NYVA 5M4FA 2Z02A 1M7QA 1APME 3PE2A 1G5SA 5F9EA 5FD2A 3UQFA 1QPDA 5K3YA 4BCOA 3NMUF 4XNEA 5D41A 4UEUA 4O83A 4JX3A 2XRUA 3V8SA 4TW9A 1FOTA 1PXOA 4YJNA 2W5BA 3BGZA 2IVSA 2OIDA 2VZ6A 3VWAA 2ZVAA 1GIHA 4PTCA 4G6NA 4KWPA 1YHSA 3HMOA 3WYYA 4YZNA 4ASZA 5CU0A 4M69A 1XHAA 1XH8A 2WOTA 3BI6A 1NA7A 2JKQA 3RWPA 2UZWE 3G90X 3MFUA 5AM6A 2C5VA 1UU7A 1P4OA 3EFWA 3M42A 4ZTMA 2NO3A 3R01A 3VS5A 4AW1A 3LXLA 2WAJA 3IQ7A 4WOVA 3OROA 4F1TA 3R9RA 2ZV2A 1WCCA 2OU7A 2BTRA 1JLUE 2CLXA 3QCXA 5JN2A 1HOWA 5KKRC 1WBNA 3ZRMA 3FLWA 4OBPA 2XJ2A 2OJ9A 4E26A 4R3PA 3W18A 4N4SA 4DH8A 4X2FA 4X3FB 4O7RA 2HELA 4P7EA 5AADA 2GHMA 5M53A 3NRMA 5AWMA 3FV8A 4PP9A 3F3ZA 1TQIA 4RX9A 3LQ3A 5IKWA 4NSTA 2GTMA 2HZIA 5CU4A 4DFNA 3QD0A 1J7IA 2XKDA 3BLHA 4XS2A 1U5QA 5DN3A 5H8GA 3NUPA 4YNEA 3TUBA 4G34A 3I0QA 3EN9A 5AM7A 5IF1A 5M4UA 3TTIA 4I6QA 2UW8A 3R8LA 3LFDA 2XK7A 4ENXA 1J91A 4MQ2A 5ACBC 5J87A 2P55A 3ORNA 4YBJA 2YA9A 5CWZA 1GJOA 2O63A 4KNBA 4G5PA 5EDRA 1UWJA 3FWQA 2WQMA 4DG3E 3DU8A 3LCKA 5CU2A 3TZ7A 3VBYA 4JRVA 3JXWA 4U42A 4PQNA 2W1EA 5HIBA 4RC2A 3QBNA 1BUHA 4W8EA 4UYAA 3VRZA 4BDAA 4TTHB 3BHTA 5D12A 3LFAA 3R8UA 3KEXA 3DKCA 3FYKX 3FQSA 1H26A 3MB6A 4S32A 5A3XA 4EZ5A 3FLNC 4OLIA 3HP2A 4GK4A 2CHLA 2UVZA 3QL8A 3WZUA 3G2FA 4HOKA 2WQOA 3ENHA 5C8MA 4IWPA 4FKGA 4PDOA 2XIRA 4GMYA 4GU9A 4CRSA 3NWWA 4NCTA 5CSPA 3PPJA 4U5JA 4W4VA 4JOAA 5CX9A 2P2HA 4DTAA 3ZM4A 5BVKA 1Q62A 4C2WA 3QGYA 4U3YA 3HAVA 2BAKA 3VUKA 4RPVA 4FE2A 2GNIA 3C4WA 3ETAA 5GHVA 4FC0A 2QOOA 2JIVA 3OFMA 3S0OA 3DS6A 3L8PA 3RJCA 2WMBA 3BYVA 1JKKA 2ITPA 2OH4A 1Z57A 2Z60A 3F5XA 3IO7A 5CVHA 1WVYA 5HVJA 3T3VA 1NVQA 3BYOA 4QTBA 2F2CB 4HW7A 4FNYA 2F2UA 3KU2A 4QRCA 3RCDA 3KF7A 1SYKA 3HECA 3G0FA 4YJTA 1CKPA 3O0GA 4WO5A 3SW4A 4EK4A 4QP8A 4IVCA 4YC8A 4XYFA 4DFZE 2UW9A 1WBVA 1YDTE 4I23A 5LMAA 2J90A 4FEVA 3OOMA 1HCKA 3DY7A 4XP3A 5DT0A 3II5A 3I60A 4IZ5A 4WNPA 4CNHA 3LPBA 2C6MA 4HPUE 4E1ZA 4FV4A 4K2RA 5A54A 4FSNA 2GTNA 2HOGA 2QLUA 4FTIA 4IC8A 4QMMA 1M2RA 4FSZA 4BIDA 2BDWA 4Z3VA 5BUEA 2HXQA 3QTZA 4EJ7A 3IG7A 5AR3A 2ITOA 3QD4A 5E8VA 5J8IA 3UG2A 1WBOA 3D9VA 4DEAA 3VUGA 5BVFA 4EJNA 1BLXA 3CEKA 4YU2A 4YLJA 3NUXA 2EB3A 3QC4A 4CFXA 1OL7A 3DNEA 3LJ0A 4RMZA 2J0LA 2VTTA 3ORXA 4G17A 4YTCA 4AOTA 3H4JA 4QMSA 3UOKA 4RZVA 2C6DA 5CEIA 3QQGA 3AC1A 3Q53A 2BRNA 5AR5A 3R7GA 4YTHA 4IX5A 3SXFA 4BHNA 2QOBA 3IW4A 2A0CX 2GCDA 2BRGA 3AC5A 4NFMA 5KMMA 5ACKA 2H34A 4HVSA 3H9RA 4BKJA 2P33A 4O7NA 5BQ0A 3SKCA 4EBWA 5CANA 1DI9A 3P79A 5FP6A 4ENYA 5J5SA 5EH0A 4DHFA 1YOJA 2I0HA 5KMIA 4C34A 4I1ZA 2WU7A 3BV3A 2EXEA 2X6DA 3UIMA 1PXIA 4KIKA 4OTDA 3W8QA 4ACMA 2C0OA 1UNLA 3I79A 5J95A 3P9JA 3EQCA 4C62A 1IASA 4PL5A 4FYOA 2B1PA 1E1XA 5DR2A 3VUTA 2PMOX 3ZTXA 4C38A 5IDPA 3FY0A 3B2WA 5EM5A 2W06A 3NAYA 4YP8A 4YJUA 4DT8A 1XBAA 1ZMVA 5HCXA 3C4ZA 1A06A 4HVIA 5B7VA 1OUKA 5DWRA 3UODA 5CQWA 3ZONA 3OXZA 4FIFA 5DT3A 3RM6A 4A9SA 4HVHA 2XS0A 3GB2A 2C1AA 4XLVA 3Q9ZA 5ETFA 4PX6A 2YZAA 4ASEA 4F9YA 2VRXA 3VHKA 4ZMFA 3DBQA 4E5BA 3IONA 3FC2A 2HIWA 2VTRA 4U97A 2BHEA 3JY0A 4F7SA 4KKHA 2HWOA 3GC7A 4NT4A 1NT2A 1OIQA 2B52A 4IB0A 4F9AA 1VEBA 1OM1A 3NSZA 2VTLA 4BDFA 4I0SA 4QMNA 4FK6A 1K2PA 1RQQA 1V0PA 3HRFA 4AUAA 4EWQA 3QRJA 2PU8A 2Z2WA 4A9YA 3GEQA 2RSVA 1FINA 5CZIA 4C7TA 5BX0A 2B55A 5BYZA 4O7ZA 4C58A 3MY1A 3E5AA 3SGCA 4AFJA 2GNLA 3AC3A 4R77A 5JK3A 2XNOA 2QG5A 3FDNA 3FHIA 4XRJA 3PZEA 1IA8A 4JR7A 3D5WA 2CKEA 1KV2A 4U3ZA 3OW4A 3OMVA 1G8AA 4HPTE 4N0SA 3RBWA 3NVKI 4KIQA 1GZOA 1OKZA 3MH3A 4EI4A 3RAKA 2J2IB 5M07A 3P7BA 4ANLA 2W0JA 3HNGA 2YIWA 4A4XA 5DRDA 4IDVA 4L42A 2ZMDA 2ITYA 4WBBB 2EXMA 4X2NA 1YWNA 3RK7A 1MUOA 3O8UA 3V5TA 3PP1A 3I6UA 5IUGA 4RRVA 3THBA 1BYGA 2JBPA 2R3LA 3HV3A 4JDJA 1OIRA 2XYUA 3NAXA 4AA5A 3NYXA 2YISA 3CQEA 4RJ4A 4AU8A 4DLIA 2C3JA 4MWIA 3TI1A 2R3MA 2W05A 4S33A 4NZWB 4APCA 3MH0A 4M3QA 4GG5A 4ORKA 2BROA 4BIEA 4D1SA 2XKCA 1OL1A 2X39A 1NVSA 4GIHA 3D7TB 3RZBA 5A4TA 1O6KA 5GNKA 3EQBA 4BZDA 2B9JA 5IZFA 3AQVA 4Q2AA 4JIAA 2VO7A 4QNYA 4IFGA 4JQ7A 2A1AB 4NWMA 4H3PA 4B8LA 1OB3A 2FO0A 4IM0A 2X2MA 3UG1A 4HYUA 3FMNA 2PY3A 3AD4A 4WBOA 4G5JA 3NCZA 2AC5A 4TRLA 2BILB 4H3BA 4X3FA 2ZOQA 3VAPA 4JIKA 2PULA 2WTCA 2R3JA 4A9RA 4FMQA 3ENMA 5DE2A 4ZTRA 4U43A 4G3CA 3COKA 5L6OA 1YW2A 5HTIA 3R02A 4F70A 2DWBA 4U6RA 2UZOA 4FGRA 4O82A 2OWBA 4XCUA 5H2UA 4NKAA 5HI2A 2FA2A 1PMUA 5JGBA 1XJDA 2YAAA 1R0PA 2WMAA 5CQUA 2UZLA 1KWPA 4C59A 4WA9A 5DLSA 3QLFA 4M13A 3U4WA 5CEOA 4EYMA 4YNOA 3LKMA 4CZTA 4E3CA 3CTQA 2QOFA 2UZDA 2WOUA 2YLFA 3JY9A 3MBLA 3OCTA 4L44A 4PL3A 3BKBA 2X1NA 3E7OA 4I0RA 4DFXE 2J6MA 3QX4A 3KMUA 1UNGA 2R3HA 3UIUA 4WSYA 3DT1A 4C36A 5L3AA 2BUJA 1UV5A 5AUZA 2PUPA 4FT3A 1SVGA 2BFYA 3EWHA 3PWDA 2B9IA 2R7BA 1ZZLA 4ITHA 2BZHB 1U4DA 2ITQA 2W1DA 4DGNA 4EOQA 5CAUA 5B2LA 3VBQA 3QKMA 3RPOA 2GNHA 2XNEA 3BX5A 1JSTA 4JBPA 3VJNA 1MQBA 3PSDA 4UB7A 4JLCA 3E7VA 4CEGA 4USDA 2J5EA 4QYYA 1PYEA 1H8FA 3VUIA 1KUTA 5AP4A 5HQ0A 5CEMA 4V0GA 2XK6A 2PMNX 2I1MA 1WVWA 4FTMA 1BL6A 3QC9A 4G16A 5EW8A 3A99A 1I09A 5CLPA 3MVMA 4QMLA 2QQ7A 3FMDA 3FSFA 2EXCX 3MJ2A 4RVMA 3WE4A 2WTWA 1L3RE 4G9CA 5KE0A 3QTQA 2G2FA 2W4KA 3ALNA 5DA3A 1FBNA 3V5QA 2ZMCA 4XG4A 3QGWA 2R0UA 3OUKA 1LP4A 4QP1A 3OT3A 2W99B 4EC9A 4UN0C 4K8AA 1JWHA 2CPKE 1E9HA 4RX8A 1UVRA 2QO2A 5AJQA 2OIQA 2ETKA 3NIZA 5ICPA 3I5NA 4KINA 1NXKA 5DEWA 4E93A 2O5KA 1PJKA 2R3KA 4YHJA 2VTQA 2IZUA 2OIBA 3CQWA 3L9NA 3H9FA 2XNBA 4BGGA 5IQHA 1OKWA 3F7ZA 3KVXA 2B53A 5M44A 3MH2A 4QYEA 2WTIA 1JNKA 2Z7QA 1YQJA 1QPJA 3BCEA 5C8KA 3FI3A 2PZRA 4MQ1A 5EHLA 5CU3A 3FHRA 5FGKA 3MW1A 1V1KA 3HUBA 4XUFA 3P86A 3KF4A 5AAEA 3KVWA 4L68A 3COMA 1SVEA 3P1AA 4QMUA 4QMOA 1MRYA 5JT2A 3EYHA 3H0YA 4O0YA 4AN3A 4RWJA 3C0IA 3LFBA 4MXXA 3R7UA 4FEWA 1SNUA 1UNHA 5HE1A 4G3EA 3BBTB 4X6QC 5BUIA 2VX1A 3GFEA 4O7VA 4M67A 4K33A 3TNIA 2EWAA 3DBCA 4FG9A 4YPSA 3MYGA 3W2CA 4Q9ZA 3BLRA 4N6YA 1WBSA 3HP5A 2VN9A 1KOAA 3OEFX 4MD8E 4PNIA 3DLZA 3NW6A 3LJ2A 3MS9A 3ORLA 1Q8TA 3OXTA 4YO6A 3R6XA 3ZBFA 2CN5A 3UIXA 4BYJA 2QI8A 4V01A 5E8WA 5HLNA 4DA5A 1OBGA 4YJVA 4AT4A 5BVDA 2CMWA 3PVUA 2W4OA 3RCJA 5BUJA 3WI6A 3DDPA 4DEBA 3R83A 4CTCA 4B7TA 2C0TA 3A61A 4O21A 3KFAA 2VGOA 5HG9A 5AA8A 4DG2E 4BCFA 5JRSA 2XNPA 4LGDA 1OL6A 3SQQA 3HA6A 5TT7A 2YACA 5HD7A 5CSXA 4D2RA 4D58A 4BBEA 3PUPA 4FT0A 1ZOEA 2R3OA 4D2VA 4E4MA 4UWYA 1GIJA 4M14A 4TKSA 4F6UA 4TYIA 5ANGA 3VS6A 1OI9A 3EN6A 3QQUA 5FTOA 3SDJA 4EK8A 5J1WA 3LZBA 3IGGA 4A7CA 2IO6A 3SXRA 5K4IA 4G31A 4XV2A 2ZJWA 5M57A 3SHEA 1BKXA 2ZAZA 4C4IA 3EN4A 2ITUA 4GSBA 3PRFA 4GFGA 3OTVA 3H9OA 3QXPA 5AUXA 4HNFA 4FL3A 4ZJIA 1GZKA 3EN7A 3R1SA 1YWVA 4AOIA 3UO4A 3FY2A 3KY2A 3OC1A 3DKFA 3ZLWA 4IFCA 3EKKA 3S1HA 1YI4A 4QPSA 4GRBA 4RQVA 3MPTA 3VW8A 2CKOA 1OZ1A 5I9XA 2PVHA 4RJ6A 4O7LA 4FZFB 3TZMA 3UO6A 4QYHA 4D4SA 1H00A 4M68A 5HCYA 3OBJA 3BGPA 2HCKA 4EHZA 5JFWA 5J9LA 5I4NA 3R8ZA 1RW8A 3DBEA 5H8EA 3DAEA 3MB7A 3RAWA 5DR9A 4M84A 5H8BA 3D94A 1CMKE 3NYNA 1FGKA 3A2CA 4LUEA 1G8SA 4I24A 3LFQA 3DA6A 5IUIA 3ZFMA 4YMJA 3PY3A 3UC3A 4LRMA 2BIKB 5K0XA 4CQEA 3TG1A 2HZNA 3NW7A 4NH1A 4NW5A 3QQJA 3QZHA 4U45A 4DAWA 3IDPA 3OY3A 4FVQA 2Y6MA 2WTKC 4QP9A 4BDKA 4EOIA 3PPZA 4EH5A 3CY2A 3OY1A 4GK2A 1TKIA 2DQ7X 4CXAA 2FSLX 2XEZA 5C26A 4BICA 3I7BA 4MXOA 5AV4A 4D4VA 5BYYA 4GFMA 4ALVA 4ANOA 3SD0A 4AZTA 4LG4A 2WPAA 4ACCA 4MKCA 1FMKA 3KREA 2UZBA 5FM3A 4FV3A 3UVRA 4BDJA 4DGMA 4LV5A 3P4KA 4N70A 3KN5A 3MPAA 2JC6A 2R3NA 3O71A 4XG3A 1QCFA 2R5TA 3D7TA 4E4NA 1P5EA 3BHHA 4B6LA 2GS2A 3MGYA 5A6NA 3QWJA 4QTDA 3ZFXA 3WARA 3ERKA 3ZM9A 1ZY4A 2Y4IC 3HRBA 4R1VA 1SNXA 5LOHA 4KUJA 2Z7SA 4J99A 1YXTA 4IQ6A 2F49A 4O0UA 3R04A 3R22A 4GV1A 1YI6A 4NIFB 4RWIA 4WNMA 4BN1A 3LFNA 2ZM3A 3PYYA 4LOQA 4CYJA 2WFYA 4ONAA 5FEEA 4C3FA 2X2KA 4H36A 3DKGA 4ZAUA 3C4EA 4IAAA 1ZRZA 3RNIA 4BCGA 4JQ8A 3DJ5A 3UQCA 1J7LA 4QD6A 4F6SA 5F94A 3F3WA 2Q83A 3AT3A 4BCMA 3RZFA 3KQ7A 4L43A 2VTIA 4GT3A 2C5OA 2B9FA 3RM7A 2VTNA 3DK7A 4PDYA 3ATTA 2ITXA 4ID7A 2JITA 4L52A 4W9XA 4RFYA 4E5WA 3COIA 4NKSA 5KUPA 4LL0A 5DPVA 1H28A 2YM5A 3C50A 3VBWA 2WNTA 4O27B 3A4PA 4NUSA 3V5JA 2VWXA 3BE9A 5D1JA 1Y91A 4FZAB 3S00A 2C6TA 2JDRA 3AC2A 5F20A 3R1YA 2HW6A 3QU0A 2BRBA 1CKJA 3ULIA 4L8MA 2OFUA 4KSPA 2BKKA 3L9MA 4QQTA 2XH5A 1XWSA 3F88A 4FVRA 5TE0A 2EVAA 2VO0A 4PL4A 3QFVA 3CY3A 4UWBA 3HV6A 4USEA 5LVPA 4ZP5A 5IQIA 4E4XA 2RF9A 3VRYA 3G51A 1J1CA 5IUHA 4MBJA 2OO8X 2BHHA 1BMKA 4FKIA 5FM2A 3TJCA 3T3UA 5FUTA 5E4HA 4YJQA 3OEZA 2Z7RA 4J53A 4LL5A 2UVXA 3C13A 4BI1A 4AA4A 4ZSEA 2JDOA 2XYNA 2P0CA 3CKXA 4GH2A 2CNQA 4AAAA 2NRYA 3DXPA 4XP2A 4W9WA 3ZLYA 5CEPA 4HCUA 4OBQA 2NRUA 1KV1A 5CZHA 3BZ3A 4DITA 4C4JA 2ETMA 5T3QA 4KA3A 3ZC5A 4XMOA 4GKHA 3AOXA 1LUFA 2YM4A 3I4BA 3L8SA 4O0RA 4X3FC 2AC3A 2GHGA 5D7AA 1H1RA 4EK3A 5EHOA 1PXLA 4BC6A 2O3PA 5LJJA 4I5CA 1JBPE 4O0SA 2UZUE 5CT0A 1U5RA 5KO1A 5M4IA 3EFJA 4NM3A 3RPRA 1H24A 5AP7A 4HGLA 4MAOA 2B0QA 3M2WA 1JVPP 5KBQA 1Y6AA 3UVQA 3VF9A 4UMPA 5JGAA 2OZAB 3LFCA 2XKFA 1F3MC 3Q4TA 2PVRA 4MXZA 2O64A 3DAJA 4QTEA 3W55A 1W7HA 4U40A 2OJJA 2V5QA 3UNKA 3PVWA 3A4OX 3EQFA 4TNDA 3C1XA 5DHJA 5M08A 2QVSE 4AS0A 4GL9A 5JRQA 5IPJA 4X21A 4ZTHA 4FV2A 3PXKA 4QQ5A 4A07A 3Q2JA 3CPCA 2UZNA 4NJ3A 4O0XA 3HRCA 2OI4X 2UZVA 4H3QA 3TIZA 5I3RA 4FNZA 4AQCA 4IVAA 4YZBA 5F95A 3L9PA 4Y72A 5HTCA 3G9LX 3LLTA 2G01A 4H1JA 3SG8A 5BVOA 4RLKA 4EZ3A 3LQ5A 2PVJA 5F1ZA 2VD5A 3DNDA 1E1VA 5LVNA 1URCA 3A7FA 5CALA 2W4JA 4E73A 5HIEA 2QU6A 2FH9A 3HAMA 4GJ2A 1YXVA 3ZSHA 1PXNA 4ANSA 3TCPA 4WNKA 3VS1A 4QMYA 4FX3A 3TNHA 4GT4A 5LVMA 3FZRA 4ZSAA 3PIZA 5L2WA 4CSVA 3POZA 5C27A 1A9UA 4FSUA 3BLQA 4JG7A 5E8XA 3VQUA 4LUDA 5AMNA 4D9TA 5EYCA 3DJ7A 2W1ZA 4QYGA 4Q9SA 3MVLA 5E8ZA 4X7QA 3QUPA 4EQCA 3NGAA 4ANBA 4D4YA 2VO3A 3QRIA 4C4FA 4DT9A 4FR4A 3LCOA 4O0WA 2X0GA 4HNIA 1H07A 4FZ7A 3R7OA 2O0UA 3SV0A 2BAQA 4R7BA 3E63A 3MN3A 3NLBA 4FKVA 1OKVA 4CFVA 3L8VA 1KE5A 4DE4A 3QZFA 4RIXB 4M66A 4WG4A 5FTQA 4U79A 4TWPA 1YI3A 3R7IA 4O2PA 4BDDA 4YC3A 4UMQA 3VULA 1ERKA 2VTSA 5L6PA 5J7HA 3CE3A 4Y5HA 5EI2A 4HVDA 4QT1A 2CKQA 4ZS4A 4R7IA 1ZOHA 3QUDA 4DINA 5A4QA 2JIIA 2X9EA 3KN6A 5HVKA 4NYEA 3TDWA 2E2BA 3ZHPC 1YRPA 2BTSA 4OT6A 5IQFA 4QMQA 4I41A 3REPA 4E8AA 4AP7A 4Z55A 5JFVA 3NUYA 2BVAA 2QOLA 4UYNA 3VF8A 2YHVA 4AACA 4DFYA 4AZVA 2SRCA 2VWZA 3MPMA 4DGOA 5F4NA 5AV1A 3DB8A 3QRUA 4YGAA 5ITAA 2GDOA 4FSWA 5CVGA 3S4QA 4XHKB 4MXAA 1OGUA 4WUAA 1ZY5A 1WBPA 5J9YA 4GYGA 2VWIA 1R0EA 4AW2A 1JKLA 2G15A 4KS7A 4HGTA 2BPMA 1Y8GA 2CGWA 2BRHA 4LOPA 3FLSA 5E8TA 2ZV8A 4DCEA 4QYFA 2C6EA 3FBVA 1P2AA 2IZSA 4Y73A 4EQMA 3ZDIA 2XK3A 3QHWA 3KGAA 4UMUA 5L2TA 4F63A 4ZEGA 1JKSA 3D14A 4IDTA 5G6VA 4NW6A 4DF3A 2JDVA 2X4ZA 4WIHA 3EMGA 3QTIA 4TPTA 5AIRA 3AMYA 4KBKA 3OWPA 5E1SA 4TT7A 3EH9A 1T45A 4YUQA 2OXYA 4E20A 1ZZ2A 3O50A 5DR6A 4IX4A 3KC3A 3WF9A 1FPUA 3NIEA 3F69A 3GU8A 4DEIA 3QAME 2WTDA 3V8WA 4O22A 2JKKA 1FGIA 3FJQE 4NTTA 4XG7A 3VUHA 4CTBA 4MCVA 1TVOA 4IWOA 3QKLA 3R63A 4AG8A 4ZTNA 3LM0A 3WBLA 2QR7A 2A27A 4R6VA 5DBXA 4EH4A 4LI5A 1UKIA 4IIRA 3PJ8A 2PE1A 5FDXA 5IH6A 5DNRA 3QTSA 3PG3A 3O17A 4TWCA 3LXKA 4CV8A 2WMVA 3FLQA 1PXJA 2QOKA 4OTQA 3MI9A 3N9XA 2WD1A 3LIJA 4PTGA 4JAIA 5EK7A 4L7SA 5CENA 3UBDA 4DBXA 4EH3A 3ZEPA 2I0YA 4Y46A 5AAFA 5HU9A 4FKRA 2YCFA 2RFEA 3B2TA 2Z7LA 2HZ0A 4NIFA 4AZEA 1AGWA 3T9TA 1FVRA 2ITWA 5E1EA 2OXDA 2QD9A 4PRJA 3OWKA 3ANRA 5CSVA 1ND4A 3K5UA 3BV2A 4FG7A 4J96A 4CKIA 5HNGA 4IAKA 2IZRA 2FYSA 3TUDA 4F08A 2PUUA 1FMOE 3CXWA 3AXWA 5J79A 4BYIA 5CASA 2BDFA 3MY5A 2C4GA 3WIGA 3U4UA 2PTKA 5I5ZA 5HE2A 4ACHA 2GU8A 1M14A 2P2IA 2WTVA 3E8EA 3G5DA 3Q32A 4MNFA 3MTFA 2C3LA 4K0YA 3FKNA 2EB2A 2RFSA 3G0EA 2AYPA 2GMXA 3V3VA 2XM9A 3LCDA 1Q8YA 4R7HA 5DH3A 1M7NA 2G1TA 5HOAA 5I9VA 3VS7A 3AC4A 5IH5A 1PXKA 5FEDA 4FTNA 2R2PA 4Q5EA 5IQEA 3PIXA 3ORPA 4WT6A 4ZK5A 2OW3A 4RX7A 2RKUA 5D9HA 1ZYSA 3IPHA 4O7WA 4CGAA 4BDBA 3VUMA 4AZFA 4TXCA 3BHYA 5DVRA 5IEVA 3F5PA 5L4QA 2FUMA 3NUSA 3QYWA 3DOGA 3Q6UA 4H05A 3ZMMA 4R3CA 5HICA 3R73A 5EFQA 2ITVA 1Q8WA 3NNUA 5FEQA 4CFFA 5IU2A 2UV2A 2J4ZA 1PMEA 5HCZA 3R28A 3ZZWA 3NVMB 1JKTA 4QPAA 3R1QA 4QP2A 4NFNA 4ZJJA 3N4VA 3KULA 5HEZA 5HLPA 3HL7A 2OJFE 1EH4A 3PTGA 5FXQA 4AA0A 4CFNA 4CLJA 5IA4A 1R1WA 4FIHA 2C6IA 4I21A 1Q4LA 3MESA 1GZ8A 2XJ1A 2UW0A 1KE7A 3R7EA 3CS9A 3AGLA 4IWQA 4EORA 3TEIA 4DG0E 3Q2MA 4O0TA 4ZJVA 4G9RA 3Q04A 2YIYA 2UW3A 2QKRA 2OG8A 3F2NA 1GZNA 1TQMA 4FTAA 4EH8A 2YZLA 2W1IA 2YM6A 2VAGA 5AX3A 5KZ0A 4CCUA 3PDTA 4DH1A 3SOAA 4JT3A 3A62A 4BZOA 5CU6A 3OWJA 2G9XA 3VIDA 3QWKA 4IVDA 4CV9A 5JZJA 4QMTA 1ZWSA 3JVRA 4I3ZA 4IZ7A 2OKRA 4N6ZA 4FTTA 4EKKA 2WHBA 3FPQA 3DFAA 3S2PA 3K54A 1S9JA 2XIYA 2ACXA 3JVSA 2XKEA 2JFMA 4ZS0A 4FTQA 2P4IA 2YM8A 2YERA 2OFVA 4MXYA 5AFVA 3QRTA 2R3FA 2XK4A 4A9TA 2ZV7A 1JPAA 3E8NA 3KMMA 5T6KA 4AGCA 3EN5A 2HZ4A 4IB1A 3RNYA 4ZLYA 2F4JA 4TZRA 4OTPA 2VTOA 4G3GA 2YDJA 4X3JA 5DGZA 3EOCA 3QZGA 4EOKA 3IDBA 3MDYA 4S34A 4ZOGA 4CKRA 1SVHA 4YZCA 3GU6A 2F7EE 3CJGA 3DLSA 4I92A 4QPMA 1GY3A 1Y57A 2O65A 2I0VA 4YJRA 4DEHA 3HYHA 3W2SA 4AT3A 1XR1A 4UXQA 3BRBA 4OTIA 4GCJA 5HZNA 5AR8A 4XV9A 4CVAA 5AP6A 4C4HA 1L8TA 1YOLA 5CI7A 5L2QA 3WZDA 2C6OA 3VS4A 4HVGA 5L2IA 3UIBA 4D0WA 4K6ZA 1LR4A 4I6BA 3VS3A 2CLQA 3C7QA 4YJOA 3NNXA 4ZIMA 2OK1A 3ZBXA 5IQCA 4XRLA 5CYIA 2UZTA 2HY0A 2XIKA 4Z9LA 4EBVA 4PPBA 4TWNA 4AFEA 5JQ5A 4RA4A 5H3QA 4RVTA 1QPCA 3EFKA 1ZAOA 3UNJA 2FSTX 2YEXA 3KXXA 3LJ1A 3ORMA 4HZRA 4ZZOA 2HW7A 4C37A 4TYHB 3R0TA 1BI8A 2B9HA 1PXMA 4FODA 1IG1A 3RMFA 3TIYA 3O7LB 5HO7A 5B2MA 5AUYA 2OZOA 5IG1A 2PUIA 5ANOA 3PSBA 4DFBA 3ZCLA 4V05A 4YR8A 2NNWB 3FYJX 4HCTA 4FT5A 4ZTQA 3D2KA 5HHWA 3DTCA 4OBOA 2IVUA 3QCQA 1H27A 3QTWA 4IZAA 2F7XE 4GYIA 4YLKA 3UMWA 2J0MB 4HYSA 2J7TA 3ITZA 3RHKA 2XIXA 3UDBA 5EM8A 4L6QA 1O9UA 2UW6A 2PVLA 3GUBA 3HMPA 4RC3A 4DLJA 3F5UA 3OWLA 4BCHA 4CCBA 2NP8A 4FV6A 4U7ZA 2BMCA 1IAHA 3V6RA 3QD2B 2BAJA 4ZTLA 3C0HA 1Q8UA 1BL7A 2DS1A 4E6CA 4ZZNA 2R3IA 4BGQA 4NL0A 4XH6A 4BGHA 3TNWA 5K9IA 3L9LA 3SX9A 4JR3A 2C3KA 3PWYA 1BX6A 3QXOA 4EOOA 4J98A 4GU6A 4KSQA 3WZEA 5K4JA 3U9NA 3FI2A 4LOOA 1OPLA 2LAVA 3SW7A 4AZSA 4FKPA 5HORA 2XIZA 4R8QA 3VN9A 2JAMA 5CSWA 3N4UA 2RIOA 4W8DA 2V55A 2CDZA 1XO2B 3FMKA 4I20A 3CP9A 1SZMA 5FBOA 4DFUA 2GQRA 3V5LA 3CD3A 3BPRA 4UZDA 5AP3A 3A8XA 3K5VA 3RHXA 2X2LA 4U9AA 3TV6A 4EK5A 4C57A 2JIUA 3E92A 3ORKA 2IW9A 3ZRLA 1VJYA 1XBCA 4PMMA 3TUCA 1XH7A 4XLIA 3MVHA 4PDSA 3BE2A 4R5YA 3TV4A 3WF6A 1URWA 1V0OA 3GXLA 4FNXA 4IAIA 4LYNA 4BFMA 2YJRA 2QODA 3ORZA 3UOLA 5A9UA 2RFDA 5BVWA 4NU1A 3ZEWA 2VTAA 4BF2A 4FK3A 3AT2A 5KBRA 3VS0A 4ZXTA 3KRLA 3ULZA 3WIKA 3G9NA 4DEDA 4BDGA 5BNJA 1FVVA 1JSVA 4HZSA 3I5ZA 3RAIA 4PMTA 1F0QA 4FTLA 2IZTA 4EUUA 3W33A 2OXXA 4J95A 1ZYJA 2YJSA 1XQZA 4W4WA 3RWQA 3QTRA 2C69A 2O2UA 3D4QA 2VV9A 4IWDA 4RFZA 5JGDA 3NS9A 3OT8A 5FTGA 2R3QA 3VBXA 5JSMA 1W84A 1Y6BA 4BTMA 4JBVA 1PXPA 2E9UA 2PZYA 3OZ6A 4RWKA 4BY9E 5BPYA 4K11A 2XNNA 5L8LA 5LCKA 5KX8A 3BGQA 3DK6A 4L3PA 1H01A 1IEPA 3PJ1A 3MWUA 2PVNA 4IB5A 5CTPA 4I4FA 4LV8A 4I4EA 2CNVA 2FVDA 3ET7A 2C3IB 1OMWA 4J1RA 4P4CA 4O81A 3ZSIA 3U87A 3GCSA 3CPBA 4FKSA 5B2KA 2H9VA 3D5VA 2GNJA 4F1MA 4BDIA 4MWHA 2BFXA 3LW0A 5JZNA 1X8BA 3CQUA 3RK9A 4LMUA 4MBLA 4WNOA 3EYGA 4AX8A 4AOJA 1B6CB 1SMHA 3R1NA 2PUNA 3EHAA 3ORIA 2RGPA 1WFCA 4RIWB 1U59A 4XG2A 3TL8A 3CGOA 5KHWA 3AC8A 4MYGA 3VNTA 4AZWA 1REJA 1YHVA 2ESMA 2B54A 2YCRA 3F7WA 4CLIA 1UU9A 4DEGA 5AA9A 3JUHA 1ZARA 4OTHA 5CF4A 3BBWA 4AN2A 3DJ6A 1UU3A 2C47A 4MEDA 2IN6A
chains in the Genus database with same CATH superfamily
1J7UA 2C68A 4FSYA 3TNPC 5I9YA 4KRDA 4EHEA 4GVJA 2BZIB 4KBAA 1B39A 3P08A 1Z5MA 3DXQA 3TKUA 4AN9A 3QX2A 2VWVA 4IBMA 3Q6WA 4IEBA 4U41A 4IXPA 5L8JA 3EJ1A 3TZ8A 3BLAA 1A48A 3BWJA 5EI6A 5CI6A 3GOKA 4D1ZA 4JNWA 4RC4A 3OCGA 3PIYA 4B0GA 3F3VA 2RG5A 3IOKA 3LAUA 2H96A 1REKA 4WSQA 5CVFA 1Q24A 5EG3A 4FZ6A 3FLZA 5C4KA 2W1FA 4IHPA 4X6RA 2VWUA 3HUCA 3UOJA 5AIKA 3PVBA 5FP5A 4F6WA 4CQGA 4Y95A 3K3IA 5LMBA 2BKZA 1R3CA 3NUUA 1RE8A 3QLGA 1W2FA 4GJ3A 3UZPA 3LHJA 2VTJA 4L9IA 5CNOA 2HK5A 3E88A 4ZSLA 4JQEA 4P2KA 5AV3A 3FKLA 4YTFA 2Y4PA 4RIOA 5DEYA 5GJGA 2EUFB 5EDPA 5IEXA 1MRUA 4RJ5A 4RX5A 3GBZA 5AP0A 3HDNA 3GI3A 5AX9A 5AV0A 2Y6OA 4FI1A 5EYDA 2C5NA 4Z7GA 5IH4A 3DB6A 4IAYA 2BZJA 3FZ1A 5HBJA 4PWNA 3M1SA 4ANMA 4LV7A 4OTWA 4C02A 3Q52A 4DH3A 4ANQA 2Q0NA 3WF5A 4EOPA 5AUTA 2JFLA 4EUTA 4O4FA 4FSMA 5LCJA 4FKTA 3ZFYA 1PKDA 4J71A 4NTSA 3CIKA 4MF1A 5C03A 3C9WA 2Y7JA 5GIOE 3EQGA 5JKGA 3W16A 5A4LA 2XK8A 2IJMA 3OHTA 2R3PA 4KABA 3MY0A 1GIIA 4OW8A 2PHKA 3PXYA 3F66A 3FMLA 1QPEA 4FSRA 3U55A 4MNEB 1KE9A 2YCQA 3EIDA 3O96A 3P78A 4JDIA 4S2ZA 4YTIA 3FXZA 3R8MA 4AGDA 1QL6A 4GIIA 3TDVA 3PP0A 5CXZA 3PA4A 2XNMA 2OJIA 2Y8OA 3ROYA 3ORTA 4AF3A 5K5NA 3PJ3A 3ZXTA 5ETCA 3G6GA 3RPVA 4HCVA 2XUUA 3NDMA 1OBDA 5HBHA 4C3PA 1JOWB 3S3IA 2DYLA 2IVVA 3A8WA 5FLFA 4G3FA 3VS2A 1R39A 3V51A 3VUDA 3DGKA 2ETRA 4L7FA 1YDRE 4BI2A 5CS6A 4JDHA 4L01A 2PK9A 3R71A 4DTKA 1SM2A 2J0KA 3E93A 4GG7A 4I0TA 5JH6A 4QP7A 4QTAA 3FZTA 3ZXZA 3WILA 2X0PA 3C4FA 1YKRA 4R78A 3BWFA 4NK9A 4TY1A 4BR3A 3CCNA 2R7IA 2J0IA 5EKOA 2C1BA 3TXOA 3FZPA 4X0MA 5E92A 4G3DA 1DAWA 4ZY6A 3BL9A 1LEWA 2ZB0A 3Q9WA 3ZO1A 1XBBA 1CDKA 4U44A 4M0ZA 3UC4A 2WKMA 5EYKA 3WF7A 4EC8A 3FL5A 2CSNA 2HY81 2ERKA 3R30A 3EQHA 4UV0A 3R9OA 4F7NA 3DFCB 3ZYAA 3P23A 4WG3A 4HJOA 3TACA 3QALE 4C8BA 2VNYA 2QONA 4I5MA 5DOSA 2XANA 3HLLA 5A14A 2VWYA 5HO6A 5EW3A 4EOMA 2PMLX 4EEVA 2OJGA 3W2QA 4O38A 4YJSA 5FQDC 2V0DA 3DBDA 2WB8A 1IR3A 4YZMA 4O0VA 4JS8A 3W2RA 2OLCA 3KA0A 4FTJA 1M2PA 5JFXA 4UMTA 3DTWA 1WAKA 2VWWA 3OW3A 3V04A 1H1SA 3SOCA 4CD0A 4O96A 1TQPA 4FBXA 3RGFA 3H10A 4CFUA 4UBAA 5KNJA 1OPKA 2QU5A 3ZO2A 3KK9A 2FSMX 2OF4A 3PFQA 4JXFA 4OTGA 4QQCA 2QC6A 2X0QA 3QQHA 4F4PA 4IW0A 5LQFA 5IQGA 1KE6A 5ANKA 5EKNA 3FZOA 4HGEA 3DCVA 4FIJA 1OPJA 3UYTA 4YSJA 2OF2A 2C30A 2BR1A 4RG0A 4BVUA 3LFFA 3HVCA 3C51A 4X2JA 1DM2A 4K18A 5E7RA 3TT0A 2ZDUA 1OUYA 1K3AA 4XEYA 4ANNA 3UQGA 1NY3A 4E7WA 3ATSA 3B8QA 1MQ4A 2B7AA 2WQNA 4O1OA 4RIYB 3JYAA 4FOCA 4IACA 1MP8A 4IE9A 3RP9A 2PPQA 1W98A 4BDEA 4AW0A 3QCYA 3U8WA 2BDJA 3PSCA 4MK0A 3VC4A 3FAAA 3QQFA 4HGSA 4JG6A 3HX4A 5IA0A 1ZYDA 4FV8A 4FV7A 3T9IA 3QKKA 4QTCA 5FBNC 2WQEA 2R3GA 1M52A 3FI8A 2QOQA 3GVUA 4FUXA 2YLEA 4YC6A 4EOJA 4WKQA 1PY5A 4II5A 1ZMWA 3OCSA 4MVFA 3PRIA 3Q96A 3GCUA 1YDSE 3KMWA 4LRKA 2OGVA 4I5HA 4PTEA 3W0NA 2VWBA 3F82A 1NVRA 4FKUA 3DQWA 4KD1A 3RPYA 5AEPA 5TF9A 4FSQA 5CF8A 4IH8A 3RINA 4GEOA 3DBFA 4CMUA 4FICA 1H4LA 5HNIX 4C2VA 3UPXA 2QG7A 4BDHA 2EU9A 5HG5A 4U80A 5H9BA 3RI1A 3A7HA 3OD6X 3KRWA 3TJDA 4ZTSA 3TV7A 3D7ZA 5E9EA 2PMIA 3D15A 4MH7A 3RALA 5HG7A 1AQ1A 1XKKA 2JAVA 3FC1X 4OR5A 1G8KA 2WMWA 2RL5A 2P3GX 5M56A 4EH7A 2CCIA 2GPHA 4JX7A 4S31A 4M8TA 4YHTA 3R2BA 5FG8A 3UGCA 5E91A 3AMBA 5AR4A 4BTKA 4C0TA 2UUEA 3OTUA 4LGGA 3LCTA 2E9OA 3U9CA 2KULA 2JKOA 4AW5A 4BTFA 2VTPA 1PW2A 1KSWA 2WU6A 3BHUA 3IECA 3QTXA 3ZS5A 4FG8A 3FZSA 3PLSA 3U6HA 4RIWA 4AGWA 2JGZA 3H0ZA 4KKGA 4R5SA 4DN5A 4AXEA 3FMJA 5DMZA 3ODZX 3G33A 5EM7A 5CAQA 4RA5A 2XM8A 3EQDA 1OL2A 4FV5A 3PA5A 3FXWA 4B9DA 5J9ZA 5CXHA 4C61A 4BKZA 5EOLA 5DRBA 2ERZE 1UWHA 4CT1A 1BI7A 2XF0A 5HE0A 3IW5A 5EQYA 2X8DA 4TYJA 4O84A 5L2SA 3W2PA 2VNWA 4D2TA 3HA8A 4R3RA 3W0PA 3F2AA 2YM3A 3EQIA 3FI4A 3GT8A 4JVGA 3CLYA 4O4BB 2Y0AA 4FV1A 1Q99A 5HGIA 3ZH8A 2PVMA 5EQEA 5ETIA 1VYZA 3JR1A 4F09A 1Q5KA 4OGRA 4OT5A 4B4LA 2FB8A 3EL8A 4FEXA 3R2YA 3QHRA 4YZ9A 2WELA 2QO7A 2UVYA 1JAMA 3GOPA 3VVHA 5IA3A 5KKRB 5LARA 4IX6A 4I6HA 2B4SB 5IA5A 4ZY4A 4Y8DA 4IX3A 5KMKA 3GQIA 3SLSA 3NR9A 1R78A 1OL5A 4XV3A 4BHZA 3UZRA 4FT7A 4KIPA 2ITTA 3VQHA 2VX3A 2BIYA 3KRXA 4UALA 3QCSA 1OITA 4KAOA 3MFSA 4GFOA 4RQKA 2Y9QA 1YHWA 1HCLA 2E9NA 4O7YA 3ZC6A 3ZZEA 1YVJA 4DCAA 3W32A 5KMNA 3ZLSA 5B0XA 5IMEA 4V0GB 4K9YA 5LMKA 3BYUA 2ZV9A 3HGKA 4O86A 4MBIA 2UW7A 4F64A 5A4CA 1P14A 5KMOA 4DDGA 4CZUA 4TL0A 4PV0A 3P7CA 2IW8A 4ACGA 2IWIA 3BYSA 2YDIA 3MVJA 1O6LA 4FKLA 4YLLA 3D5XA 4EL9A 1OIUA 2QCSA 4WRGA 3QUEA 3C0GA 2X81A 2CNUA 4XX9A 3W8LA 3M11A 2F57A 3F5GA 2QOHA 4C3RA 3LOKA 3DZOA 3P5KA 2YWVA 5TO8A 2XNGA 5T68A 3WE8A 3QA0A 3PJCA 4ASDA 3RPSA 1Q61A 5AV2A 2WMTA 4U81A 4BCKA 3HMIA 4FEUA 1YXUA 4UXLA 1RJBA 2J50A 2ONLA 4Y5QA 2GSFA 5HKMA 3OF0A 2BALA 4CMTA 3RVGA 4DFLA 3HEGA 5CAPA 1VR2A 2CGXA 3A7IA 4MNEA 4F0FA 2X8EA 3WZKA 3GENA 3KL8A 1XH4A 3NUAA 4G6OA 4C4GA 4F0GA 5CEKA 5IISA 3AGMA 4WRSA 2HENA 3IW6A 2C6LA 3KXMA 5CAOA 4ZSGA 1Y8YA 3LMGA 4NM7A 4L67A 4E6DA 4E6AA 4N57A 4RBLA 1VZOA 3SRVB 4FTUA 4MX9A 2WO6A 3VJOA 4XG9A 5AUWA 2GQSA 2IG7A 5I9WA 3EKNA 5ETAA 3FQHA 3EB0A 3F9NA 1VYWA 4ASXA 4QO9A 2XJ0A 1JSUA 3LXNA 4YBKA 3S95A 4KIOA 1WMKA 2YABA 5M55A 4ZZMA 4EHVA 4B99A 3AD5A 4USFA 5IMXA 2X6EA 3IW7A 2RG6A 2CKPA 3SA0A 3LCSA 3VBVA 3F6XA 4YJPA 5CF6A 4ACDA 4JBOA 5HNBA 1S9IA 3WYXA 5D10A 4B8MA 2YIXA 2GHLA 2WEIA 3F3TA 4YURA 1ZLTA 4RVLA 2X7FA 2OH0E 4IM2A 4QMVA 4OUCA 5FXRA 4E6QA 1YXSA 3FMEA 4FL2A 1V0BA 4XP0A 1H25A 5CT7A 3U51A 4MUQA 5I3OA 3PE1A 4BDCA 4FL1A 1P4FA 3LE6A 2QHMA 4PPAA 3DXNA 4IJ9A 4GVAA 4Z16A 4CKJA 3QA8A 2PYWA 2I6LA 4V04A 4JMQA 2A4LA 3EQRA 1J3HA 2C5YA 5HESA 5CEQA 4UMRA 3O7LD 4OAVB 3UZTA 2I7QA 4A4OA 5C9CA 2XB7A 3GQLA 2XARA 4X2GA 2HWPA 3AKLA 3UP7A 5BMSA 3E3BX 4MD9E 1JQHA 4F7JA 3IOPA 4D2SA 3G15A 4BCPA 4BI0A 4A06A 1NW1A 2A19B 2VO6A 3BQCA 3CBLA 3C4CA 2GNFA 4QMXA 4WUNA 1RDQE 4EYJA 4F9CA 1IAJA 5LWNA 4BCNA 4QEBA 2W1HA 2J5FA 2QR8A 3QQLA 4IB3A 4WD5A 3AG9A 3U54A 4BCIA 3T8OA 1U46A 3P7AA 3Q4ZA 3HMMA 4QMWA 3UP2A 1WZYA 5CY3A 5HE3A 4QNAA 4KKEA 5KMJA 3ZOSA 3HDMA 3NUNA 4RIYA 1DAYA 2JD5A 2VTHA 4QP3A 4U0IA 5HIDA 4IM3A 2REIA 1K9AA 4FTRA 4TYGA 2OSCA 1Q8ZA 1H1WA 3BU5A 2OZAA 3FL4A 3GCQA 2WIHA 3SAYA 4F78A 5GINE 3V8TA 1H1PA 4UY9A 3AKJA 4AGUA 3R8VA 3HV5A 4D0XA 4IAFA 4LGHA 1KOBA 3GC0A 3NYOA 4EKLA 2YM7A 4GT5A 3E62A 3O2MA 4I93A 3PA3A 2JLDA 4H58A 2CN8A 4O2ZA 2AQXA 2QURA 4IVBA 4QOXA 3UOHA 4EHGA 3L8XA 4RT7A 3KXGA 3H3CA 1O6YA 3FEGA 5IQAA 4X2KA 4BBMA 3Q5ZA 2F7ZE 5I9ZA 4MF0A 3HMNA 2X7GA 2AUHA 5AR7A 2H8HA 4XOYA 3UJGA 3FE3A 4HYIA 4AWIA 5A6OA 4OTRA 4AE6A 3U6JA 4LQMA 3TMOA 3K3JA 2PZ5A 4TWOA 3DZQA 4QMZA 3BU6A 5JEBA 2XEYA 4JI9A 4DC2A 3FSKA 1WVXA 4XG6A 2NPQA 1LPUA 3MA6A 2IPXA 4LDTA 2GNGA 4NEUA 5EYMA 4GK3A 2IVTA 3C5UA 2RFNA 4FA2A 4I6FA 4EOLA 3PVGA 1CM8A 2X9FA 3PY1A 4Z7HA 5EQPA 4A4LA 4FIEA 5GJFA 4TYEA 2XBJA 4JJRA 3UTOA 4D1XA 5GZ8A 3VW6A 3BYMA 2VX0A 1U54B 3KXNA 4FKOA 1OKYA 4O91A 5AUVA 5BVEA 4BIBA 2W96B 3POOA 4KRCA 4XBRA 2C5XA 3OUNB 5FRIA 4MHAA 4RLLA 1DI8A 2QHNA 5J7BA 4BCQA 3Q4CA 4ZY5A 2I0EA 3E3PA 4QQJA 3W2OA 2W7XA 5HLWA 3G6HA 2V62A 1OVEA 2XCKA 1Q41A 4L53A 4RSSA 4CMOA 3WOWA 2X7OA 3PXZA 2XVDA 4GW8A 2XALA 2R9SA 3TWJA 3R8PA 4QMPA 3R21A 4J52A 4FTOA 5LWMA 4F7LA 4FKJA 1WBWA 4NJDA 3Q3BA 2PVKA 3BELA 3COHA 4RIXA 2XMYA 2WMXA 1CKIA 3U6IA 4DTBA 3MIYA 4L46A 5HTBA 3L1SA 4EOSA 4IANA 3AMAA 4ZMEA 4G2FA 2WMQA 5C4LA 2W9ZB 5E8SA 4XJ0A 3MA3A 3MH1A 4D5HA 1ZMUA 4APPA 5D11A 4MXCA 2YDKA 3K2LA 4M12A 4D5KA 2W1CA 4J97A 5JFSA 4DH7A 4RFMA 3UPZA 5BYLA 1IA9A 3W1FA 3O51A 5CAVA 3UMXA 4C33A 4GKIA 5GIPE 4FIGA 2CGUA 3PZHA 2GQGA 5AUUA 2C6KA 2XCHA 4K1BA 5E8UA 4JAJA 5DYJA 5DG5A 5IQDA 2J51A 2WQBA 4GUEA 5BVNA 5FDPA 3NFFB 2BCJA 2O8YA 4G6LA 1UA2A 3R9HA 3V5PA 3VBTA 4BB4A 1PMVA 4F99A 5I0BA 4NM5A 2YCSA 3OP5A 3LMIA 3W0RA 2CCHA 5EI8A 3D0EA 2YITA 5ANEA 2E9VA 2HAKA 4TNBA 3UYSA 4KBCA 3VHEA 3AD6A 5JQ8A 4KS8A 4L3LA 4CZYB 4BTJA 5GZAA 4YO4A 3MSSA 4PUZA 2A2AA 2PVYA 5E8YA 3UE4A 4LRJA 3CD8A 4RJ8A 5AP2A 3NW5A 1T46A 1XH6A 3ELJA 4W4YA 4JL9A 2BZKB 2H6DA 2YFXA 2JEDA 3CJFA 3R7YA 2QLQA 5TR6A 3TTJA 3AKKA 1GAGA 3KXHA 4L00A 4LMNA 4U8ZA 2UW5A 4NM0A 4BBFA 4FZDB 2W9FB 1G8JA 3PLAE 3ZU7A 4GUBA 4FOBA 3ZLXA 4H1MA 1UKHA 4M7IA 5BMMA 3DKOA 5ANJA 3BU3A 4RJ3A 3CGFA 3TKIA 2I40A 3PXFA 4J7BA 4BJJB 3V6SA 4BCJA 3O23A 3LMHA 3NNWA 3OCBA 5KZIA 2PSQA 2XK9A 4Y83A 2UZEA 3RK5A 3EQPA 3GC9A 1WBTA 2KTYA 4EQUA 3MJ1A 1J1BA 4FRFA 4ARKA 3DPKA 3CKWA 4LM5A 4EH6A 3CTHA 4OTFA 5G1XA 1IRKA 3BQRA 1M17A 2ITZA 4A9UA 1W0XC 4KB8A 4FTKA 5FXSA 3ACJA 3IKAA 4M69B 2QOIA 4J8MA 1PYXA 3A7GA 3E8DA 2WIPA 3RTPA 5E90A 1F5QA 3LFEA 5HU3A 4R1YA 2WXVA 3FXXA 5FWKK 4EONA 3PJ2A 3R9NA 5A46A 5M51A 4L45A 2YIRA 3O8PA 4CT2A 3A7JA 4ALWA 2J9MA 5IEYA 3MV5A 4CG9A 1H08A 4XOZA 2UW4A 4DYMA 2WMUA 4DGGA 3SRVA 5CF5A 5HX8A 1CSNA 3V01A 2LGCA 5M06A 4DEEA 5CNNA 4F9BA 4FTCA 5TOZA 3KCFA 3PXQA 3WF8A 4DH5A 1H1QA 2XZSA 3D2IA 4AXAA 3DV3A 2YWPA 4FNWA 1LEZA 2QO9A 4NCTC 3VO3A 4E5AX 4YZDA 4IJPA 3F61A 3IS5A 4ALUA 3ALOA 4YPDA 5ANDA 3JPVA 3NX8A 1GNGA 4M15A 2PE0A 4EH9A 1OECA 3NNVA 4GS6A 5AP5A 4D55A 1UU8A 3QZIA 5LMKC 5IQBA 3Q9XA 4O1PA 3I0OA 3I6WA 4FUYA 2Z8CA 5HX6A 2VUWA 4D2WA 5C01A 3OOGA 4RGJA 2HXLA 3I1AA 2ZYBA 2GS6A 3E87A 3JS2A 4FGBA 2X0OA 4F9WA 3PXRA 2R3RA 3R7VA 5AP1A 2ZM1A 3GU7A 3B8RA 2PWLA 3QYZA 3TZ9A 4BWXA 4PP7A 4YSMA 2X8IA 1FQ1B 5KHXA 3ZO4A 4ZSJA 3C4XA 3D5UA 3FMMA 4PMSA 4PF4A 5EM6A 3KKVA 3QF9A 5HBEA 5IA1A 3QRKA 3CTJA 3IW8A 4F0IA 5TKDA 1AD5A 2V7OA 5GZ9A 5LVLA 3GU5A 3LFSA 1ZXEA 4RJ7A 3LXPA 3MFTA 4PNKA 4EK6A 1XH9A 4F65A 2JDSA 2PE2A 2ONLC 1ZYLA 2WMSA 4JRNA 5HG8A 4BWKA 4J8NA 3FLYA 3TNQB 4EWHA 3LVPA 4O6LA 4JBQA 4ZLZA 5M09A 4D9UA 3HKOA 4UX9A 2WEVA 3ACKA 2R0IA 2PZIA 2CGVA 2XA4A 4HYHA 2ZM4A 3ZUUA 4BZNA 5AR2A 4H39A 4L3JA 3GC8A 4BL1A 1Q97A 5C8NA 4MTAA 3DK3A 2DUVA 3EZVA 4PDPA 3FKOA 1H0VA 3KXZA 2GS7A 2ZB1A 1PMNA 4CFWA 2YN8A 1OIYA 2VTMA 2HYYA 2W17A 4Y85A 4XV1A 3ZRKA 3N51A 1Z9XA 4FIIA 1YOMA 4FT9A 3OS3A 1XMLA 3A60A 4E4LA 3GGFA 3ODYX 5AAGA 4D2PA 3ZUVA 4DGLC 1CTPE 3PY0A 4WG5A 3UVPA 4O7TA 1ZYCA 3OG7A 2C0IA 3KK8A 5KMLA 5DFPA 1H0WA 3HV4A 5EDQA 3KB7A 4XG8A 3FQEA 3FMHA 2ZDTA 3R00A 2G2HA 4FYNA 4O6EA 5D7VA 3QTUA 4IAZA 3SVVA 2G2IA 4F1OA 4RZWA 4IMYA 3Q60A 2VGPA 3AT4A 3OVVA 4FVPA 1PF8A 4JDKA 5L6WL 4CFMA 3R9DA 4TN6A 3ID6C 4I94A 1YWRA 3HZTA 2W5AA 4DBNA 5M4CA 3RKBA 2R64A 4ZLOA 4FF8A 4IADA 3GFWA 1B38A 5EOBA 3PPKA 1M2QA 5K0KA 4AT5A 4EH2A 3QD3A 2ITNA 2GFSA 3WZJA 2XBAA 4YHFA 4M97A 4FKWA 3CSVA 2QKWB 3DAKA 3NCGA 4PPCA 2YAKA 4CG8A 3SC1A 3SG9A 3BIZA 1ZOGA 2XRWA 3DDQA 2WMRA 2QNJA 4K77A 5EW9A 2V22A 4C4EA 2F9GA 3MIAA 3ZSGA 4ERWA 3EL7A 3GU4A 2V7AA 3BEAA 3HV7A 5HO8A 3RAHA 4ITIA 4Q5HA 4I22A 2OBJA 1U54A 4RWLA 4OAUC 1STCE 3P0MA 4BWPA 3Q4UA 3IGOA 1XH5A 2OICA 3ANQA 1GOLA 3FUPA 1FVTA 3E8CA 3LLAA 3W10A 2X4FA 2IW6A 3EZRA 4EZ7A 3KRRA 1I44A 3ZO3A 2BRMA 2WZJA 3GCPA 5ANIA 5JMSA 4TYHA 2PZPA 1ATPE 4DHZA 2E9PA 2JBOA 5A4EA 1W82A 3FPMA 3D83A 3I81A 4ERKA 5HD4A 3TM0A 5IDNA 1Q3WA 3C5IA 2WTKB 5LXMA 3F2RA 4O7SA 5KCVA 1YXXA 3O8TA 2W5HA 4O4DA 3UO5A 2W1GA 4FKQA 3QQKA 3ZDUA 4FV9A 3ROCA 1PHKA 4FV0A 2CJMA 2WTJA 3EFLA 3F3UA 4KIKB 5HVYA 2FGIA 2J0JA 1DS5A 1Q3DA 4RVKA 3I7CA 3Q5IA 4QP4A 4W4XA 4G1WA 1PKGA 5CSHA 4IC7A 3DQXA 3NPCA 4UZHA 4S30A 3TKHA 5J5TA 4CYIA 2XP2A 3H30A 1KE8A 3ZUTA 4CRLA 3KCKA 3NZ0A 5C1QB 3BHVA 3Q9YA 2GFCA 5DI1A 3LM5A 2FSOX 3NEWA 4M0YA 4P90A 5I9UA 3SXSA 2Q0BA 4C35A 3MTLA 4FSTA 5K5XA 2Y4IB 4I5PA 4P5QA 4PMPA 5LVOA 5IA2A 4FEQA 4BRXA 5J1VA 4AE9A 3IK3A 1W8CA 4PY1A 4BKYA 2QOCA 4UWCA 3LQ8A 3UNZA 3PG1A 3TN8A 2WGJA 3N4TA 3GP0A 3OBGA 3VONA 3CR0A 2VU3A 3GNIB 4JG8A 4D4RA 3GCVA 4WHZA 1QMZA 2YIQA 1MRVA 4IZYA 5EHYA 5L8KA 3KULB 3IDCA 2PVFA 1G3NA 5DIAA 3MFRA 2JDTA 1W83A 2JKMA 3OXIA 4LFIA 4QP6A 3CC6A 4MD7E 4P5ZA 5DT4A 3V5WA 3KRJA 4ITJA 2PL0A 3E64A 2R4BA 4XBUA 3BEGA 1PRYA 4D28A 5GJDA 3NYVA 5M4FA 2Z02A 1M7QA 1APME 3PE2A 1G5SA 5F9EA 5FD2A 3UQFA 1QPDA 5K3YA 4BCOA 3NMUF 4XNEA 5D41A 4UEUA 4O83A 4JX3A 4BJJA 2XRUA 3V8SA 4TW9A 1FOTA 1PXOA 4YJNA 2W5BA 3BGZA 1TFFA 2IVSA 2OIDA 2VZ6A 3VWAA 2ZVAA 1GIHA 4PTCA 4G6NA 4KWPA 1YHSA 3HMOA 3WYYA 3TYKA 4YZNA 4ASZA 5CU0A 4M69A 1XHAA 1XH8A 2WOTA 3BI6A 1NA7A 2JKQA 3RWPA 2UZWE 3G90X 3MFUA 5AM6A 2C5VA 1UU7A 1P4OA 3EFWA 3M42A 4ZTMA 2NO3A 3R01A 3VS5A 4AW1A 3LXLA 2WAJA 3IQ7A 4WOVA 3OROA 4F1TA 3R9RA 2ZV2A 1WCCA 2OU7A 2BTRA 1JLUE 2XAOA 2CLXA 3QCXA 5JN2A 1HOWA 5KKRC 1WBNA 3ZRMA 3FLWA 4OBPA 2XJ2A 2OJ9A 4E26A 4R3PA 3W18A 4N4SA 4DH8A 4X2FA 4X3FB 4O7RA 2HELA 1W2CA 4P7EA 5AADA 2GHMA 5M53A 3NRMA 5AWMA 3FV8A 4PP9A 3F3ZA 1TQIA 4RX9A 3LQ3A 5IKWA 4NSTA 2GTMA 2HZIA 5CU4A 4DFNA 3QD0A 1J7IA 2XKDA 3BLHA 4XS2A 1U5QA 5DN3A 5H8GA 3NUPA 4YNEA 3TUBA 4G34A 3I0QA 3EN9A 5AM7A 5IF1A 5M4UA 3TTIA 4I6QA 2UW8A 3R8LA 3LFDA 2XK7A 4ENXA 1ST0A 1J91A 5BV3A 4MQ2A 5ACBC 5J87A 2P55A 3ORNA 4YBJA 2YA9A 5CWZA 1GJOA 2O63A 4KNBA 4G5PA 5EDRA 1UWJA 3FWQA 2WQMA 4DG3E 3DU8A 3LCKA 5CU2A 3TZ7A 3VBYA 4JRVA 3JXWA 4U42A 4PQNA 2W1EA 5HIBA 4QDVA 4RC2A 3QBNA 1BUHA 4W8EA 4UYAA 3VRZA 4BDAA 4TTHB 3BHTA 5D12A 3LFAA 3R8UA 3KEXA 3DKCA 3FYKX 3FQSA 1H26A 3MB6A 4S32A 5A3XA 4EZ5A 3FLNC 4OLIA 3HP2A 4GK4A 2CHLA 2UVZA 3QL8A 3WZUA 3G2FA 4HOKA 2WQOA 3ENHA 5C8MA 4IWPA 4FKGA 4PDOA 2XIRA 4GMYA 4GU9A 4CRSA 3NWWA 4NCTA 5CSPA 3PPJA 4U5JA 4W4VA 4JOAA 4O4EA 5CX9A 2P2HA 4DTAA 3ZM4A 5BVKA 1Q62A 4C2WA 3QGYA 4U3YA 3HAVA 2BAKA 3VUKA 3W0OA 4RPVA 4FE2A 2GNIA 3C4WA 3ETAA 5GHVA 4FC0A 2QOOA 2JIVA 3OFMA 3S0OA 3DS6A 3L8PA 3RJCA 2WMBA 3BYVA 1JKKA 2ITPA 2OH4A 1Z57A 2Z60A 3F5XA 3IO7A 5CVHA 1WVYA 5HVJA 3T3VA 1NVQA 3BYOA 4QTBA 2F2CB 4HW7A 4FNYA 2F2UA 3KU2A 4QRCA 3RCDA 3KF7A 1SYKA 3HECA 3G0FA 4YJTA 1CKPA 3O0GA 4WO5A 3SW4A 4EK4A 4QP8A 4IVCA 4YC8A 4XYFA 4DFZE 2UW9A 1WBVA 1YDTE 4I23A 5LMAA 2J90A 4FEVA 3OOMA 1HCKA 3DY7A 4XP3A 5DT0A 3II5A 3I60A 4IZ5A 4WNPA 4CNHA 3LPBA 2C6MA 4HPUE 4E1ZA 4FV4A 4K2RA 5A54A 4FSNA 2GTNA 2HOGA 2QLUA 4FTIA 4IC8A 4QMMA 1M2RA 4FSZA 4BIDA 2BDWA 4Z3VA 5BUEA 2HXQA 3QTZA 4EJ7A 3IG7A 5AR3A 2ITOA 3QD4A 5E8VA 5J8IA 3UG2A 1WBOA 3D9VA 4DEAA 3VUGA 3ML1A 5BVFA 4EJNA 1BLXA 3CEKA 4YU2A 4YLJA 3NUXA 2EB3A 3QC4A 4CFXA 1OL7A 3DNEA 3LJ0A 4RMZA 2J0LA