3KULA

Kinase domain of human ephrin type-a receptor 8 (epha8)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
274
structure length
267
Chain Sequence
b'TREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFGLSRVLEAAYTTTIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 8
publication title Kinase Domain of Human Ephrin Type-A Receptor 8 (Epha8)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 267
sequence length 274
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kulA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kulA01
3LVPA 1XH6A 2Q83A 4ZSEA 4JR3A 4XCUA 2X9EA 3F3VA 5BVOA 3ZZWA 2JDSA 3CY2A 4EL9A 4YLJA 5CSVA 3LFCA 5JQ5A 5CSXA 5GJFA 4IVAA 3LFEA 2GPHA 4OTFA 4X7QA 4AN9A 5I9VA 4DT8A 5F95A 2IVUA 5M57A 4LFIA 4GV1A 5JQ8A 3NVMB 2YWVA 4RX9A 2UZUE 4I94A 5BUEA 2VAGA 2CPKE 2UW8A 3KB7A 5I9WA 1GOLA 2FVDA 5HD7A 5CNOA 2YM8A 4KKEA 1G8SA 4C3RA 1H25A 3DAEA 2I6LA 2WMAA 3KVXA 5BYYA 5DHJA 3NUPA 1JKSA 1PYEA 2YCRA 2YCSA 2NNWB 3QTWA 1M7QA 4AT4A 3GC0A 4JQ8A 3PIZA 5EI8A 3TV4A 3MA3A 4YBJA 4CD0A 4D2TA 4EONA 1DM2A 3IQ7A 4I6QA 1SNXA 5CU2A 3QX2A 1H1SA 3R9OA 3S1HA 3TDVA 5EOBA 3H30A 4X2JA 5E8XA 3VNTA 5LMKC 4FYNA 1UNLA 2J5EA 4A4XA 4RFZA 4KBAA 4FUYA 2JAMA 5A4EA 3HMOA 3VHEA 1G5SA 2IVSA 4OTQA 5I9ZA 3LJ1A 5LCJA 2GCDA 4XV2A 2JBPA 1J7LA 3V04A 5BMMA 3R1YA 4AOTA 4I6FA 4FT7A 4XG9A 4KUJA 3ORTA 2JD5A 2QHMA 5IDNA 5AEPA 4L68A 3FLNC 4YHTA 2WIPA 2ZV9A 3ROCA 4EWHA 4ZIMA 5KMJA 3T3UA 2ETKA 4FV7A 1XO2B 4FL2A 4HGEA 5EHLA 3SRVB 3T9TA 4NFNA 3TG1A 4L7SA 5FGKA 1U4DA 2XJ0A 5K3YA 2I1MA 4O2ZA 4WUAA 4UMQA 3ULIA 4EOKA 5EDPA 1Y6BA 2Y4PA 4KRDA 4ZSJA 2IO6A 3NIZA 3BU5A 3Q9XA 4U45A 4KSQA 5J7HA 4C4HA 3LLAA 3S00A 4AOIA 2UW5A 4E3CA 4FEWA 4S30A 2OZAB 5AADA 2OICA 4F1MA 2EXEA 2JKKA 3V5TA 5AP0A 3ZRLA 2C69A 1UWJA 3MY5A 3R7UA 4M14A 3PJ3A 4JL9A 5HNGA 4DEAA 4YHJA 2FSOX 3L8XA 3ATSA 5K4IA 4DN5A 4MCVA 2ITOA 5EI6A 5EK7A 1JWHA 3HECA 1R3CA 1KSWA 2WU7A 5CLPA 2R3MA 3BBTB 3UYTA 3A4OX 5IH4A 4B9DA 5HIDA 3HVCA 2YERA 2CN5A 3U9NA 4AUAA 1DI9A 1OB3A 1YRPA 3FMNA 4BDIA 4BL1A 3QA8A 3U4UA 4RZWA 3UNJA 4FV3A 2WMBA 3WZJA 3ZRKA 3C4CA 4L9IA 4BZDA 2R3RA 4D0WA 4GW8A 4DH3A 3LFAA 3PXZA 1PMEA 2AUHA 5DG5A 5DI1A 3P23A 4BCQA 2BPMA 5A4CA 4LRJA 5KMLA 1J3HA 3DT1A 2J6MA 1YWRA 3H9RA 3PP1A 2QR7A 3TCPA 4CMUA 4H58A 2OH0E 4A9RA 3EQDA 2V22A 3D7TA 2GU8A 5EOLA 4PP9A 3UNKA 4IAZA 4YJOA 4FIGA 5E8VA 3Q2JA 1P4OA 3NDMA 2CNUA 3AD5A 2BILB 2GDOA 3K5VA 4R5SA 4BDFA 3UO5A 3IGOA 4XP3A 4PTGA 1PXIA 3V5QA 2ITYA 1UVRA 4QP6A 3FLQA 5AMNA 4AZWA 4U79A 5AAEA 4BGGA 4I5CA 4USDA 4EH3A 4G1WA 4FX3A 4RJ3A 1IRKA 3QHWA 3G0FA 2VTRA 4G3CA 3VBXA 3G6HA 4F9BA 3EFJA 4KKHA 2GNGA 4FKRA 4NCTC 4TY1A 5GHVA 4BY9E 4NIFA 4AZFA 2C3JA 5F94A 2BZJA 3UVPA 1CTPE 5HEZA 4J71A 4BF2A 3R7GA 5AM6A 5CU4A 1L8TA 3PY0A 2X0GA 3OP5A 3UZTA 1FPUA 1PMVA 4XUFA 4Z9LA 4GRBA 2OGVA 4FA2A 3QQUA 3SW7A 4HYHA 5CEKA 4RWKA 1W98A 1PMNA 2WNTA 2F7ZE 2NO3A 3HA8A 4EQMA 4X21A 5M08A 3DJ5A 5GIOE 4HPTE 5C9CA 4CYIA 3TIZA 3GOKA 3E8EA 3HUCA 2E9OA 4O6LA 3RJCA 2B53A 2C6MA 3FYJX 3TXOA 4CFVA 5CI7A 3KF4A 2BTSA 1URCA 2VU3A 5EYDA 5CAUA 3GCPA 3KKVA 3MESA 3NS9A 2C5YA 2VWVA 5KMMA 3BE9A 2X2MA 3A7FA 3KL8A 4QMTA 3FMEA 4QYGA 5M4FA 2XKDA 2VTNA 5JFWA 4O0XA 2EXCX 2HWPA 2A19B 2FYSA 3HMPA 4UZHA 5JGAA 4P90A 3NNVA 3UYSA 4JDHA 3G6GA 2BIKB 3ZO3A 3C13A 2QC6A 4CZYB 3PE2A 1H07A 4RWJA 4MKCA 2WEIA 3HAVA 3E5AA 3FC2A 3IW4A 3QTSA 4MYGA 2WMQA 3R71A 4WOVA 4USFA 2B9FA 1Y8YA 3FQSA 3LAUA 5IQHA 4FG8A 1OKYA 2PVJA 1G3NA 3WIGA 2PY3A 3R9RA 1YXVA 4XMOA 5AUZA 4AOJA 5CAPA 5AWMA 3TWJA 4QPAA 3SVVA 2VUWA 2UUEA 2ZM3A 3PJ2A 5IPJA 3HMIA 5KE0A 2CLXA 4TPTA 1U54A 3P08A 2EVAA 4DBXA 2XUUA 4U9AA 3BEGA 3CEKA 4G9CA 3FZOA 3DGKA 4YJRA 5EKOA 4YJSA 4TYEA 4WD5A 2A0CX 1ATPE 3JYAA 3MFTA 5HI2A 4C4GA 2ETMA 2XCHA 3ZC5A 3NUSA 5JFSA 4R1YA 3NUUA 3HRCA 3E7OA 2XNOA 2BUJA 2VX3A 4IFCA 3FWQA 1UV5A 3EZRA 3ODZX 3QZGA 4BDBA 4CMTA 4EOIA 3CE3A 3VBTA 4MBLA 5C1QB 3KVWA 4G2FA 4NSTA 3W33A 2J2IB 2GMXA 3FC1X 4GT3A 3DV3A 3E63A 3SX9A 2G9XA 2WMWA 3NGAA 1BMKA 1DI8A 2VWZA 4WKQA 3E7VA 1Q24A 2VWIA 3PRFA 5HHWA 4BGQA 3QCYA 4XG7A 3VBWA 5C8NA 3PFQA 3WE4A 2GQRA 4AZTA 4MXZA 3RAWA 4FZ6A 5FDPA 4Z3VA 2BFXA 2WMXA 3QD2B 3KC3A 4LRKA 4BDEA 4YJUA 4F0IA 3VRYA 3H0YA 4DLJA 1GIIA 2OWBA 1BYGA 3GU6A 3NYVA 3OZ6A 4U40A 5JSMA 3U51A 1L3RE 4GU6A 4MHAA 3W8LA 1M17A 4EOMA 2C4GA 4IC7A 3P86A 3FI2A 2W4JA 5AR4A 4ANMA 2WQNA 5KZIA 4BICA 2H34A 3OHTA 3KCKA 4WO5A 4BZNA 2XF0A 2XNEA 3F3WA 5ANEA 4JQEA 5JGBA 4JIAA 1ZY5A 1X8BA 2WKMA 4J53A 4EBWA 5A9UA 2QKWB 5AJQA 3A60A 2Y4IC 3PPJA 2UW0A 2DUVA 3DK6A 3PSBA 3GFEA 5F4NA 3VS0A 4F9AA 4HGTA 2RG6A 2VTJA 1TVOA 1ZWSA 1AD5A 3OW4A 4M3QA 5EW3A 1UKIA 4W8DA 3RM7A 3QRUA 4QP8A 3CQEA 3KRLA 5G1XA 2F7XE 3OOMA 2YIWA 4KB8A 3DFCB 2REIA 3FHRA 3II5A 3ETAA 4JG7A 3RHXA 3OTUA 4BCNA 4BKYA 3MS9A 3P4KA 5K5XA 3R83A 2C1BA 3ZDIA 3HDMA 3R00A 4RC4A 4WNPA 4AAAA 4DBNA 4YTFA 5TKDA 5BUJA 5FXRA 4ACMA 1PW2A 4BIBA 3W55A 2JIUA 3EYHA 3GC8A 3UIUA 3KMWA 2XRWA 1LR4A 2P2HA 4E8AA 4O2PA 5F20A 3ZXZA 3KXNA 2XNGA 3ZFYA 4X2GA 3PWDA 3BQCA 2XYUA 4K77A 4CFFA 3OMVA 3SXFA 3MB6A 5E8WA 3OC1A 3MH1A 3PIYA 4TYJA 4E4XA 3RK5A 2E2BA 4HYUA 4I5HA 5T3QA 4OW8A 3IOKA 3MIYA 3AT3A 5A54A 2Z8CA 3IGGA 3MH3A 5HIBA 3FXZA 4F6UA 3D4QA 3PLAE 3HX4A 4ZLOA 5BUIA 4F7JA 3GQLA 4EH8A 4LV5A 1JSUA 4PNKA 4U41A 4XRLA 2AC3A 4AX8A 5EW8A 2XJ1A 4EH4A 3VBQA 4ACCA 2PMLX 2JGZA 2BRGA 2YLEA 3OROA 4FODA 1KV1A 4AW1A 4O21A 3DB6A 4CV9A 2XYNA 3FE3A 3NIEA 2PVRA 2J0KA 4XG6A 4MNFA 3SRVA 3QLFA 3V01A 2XH5A 2YISA 2H96A 4W4YA 2G1TA 3R01A 1HOWA 4RVTA 3PLSA 1XWSA 4XP0A 1J7UA 3TV7A 4II5A 1NVSA 3FZ1A 4IVBA 2OZOA 5C4LA 3PSDA 1PXJA 1TQPA 4QP3A 2UZVA 2OXYA 4IX6A 1ZYJA 3N9XA 3NCGA 3FHIA 3QALE 4NW6A 4YP8A 1H8FA 4H05A 2JKQA 2OZAA 4H3BA 4D28A 5I9YA 3FSKA 4RVKA 5IUHA 4BCMA 4GYGA 5BMSA 1W0XC 1W82A 3CD8A 3P1AA 1XBBA 3RAKA 3RM6A 4PDSA 4D2PA 4GCJA 4EOOA 5I4NA 4FKSA 4EK6A 4RPVA 5LARA 2R3QA 4CG8A 4R7BA 4W4WA 3EQRA 2QKRA 1JOWB 4X0MA 2R3JA 1JSTA 3E3BX 2UV2A 4G3DA 3OWLA 3RNIA 3VC4A 3NAXA 4JOAA 3DDQA 3PA4A 4O7NA 2QCSA 4RJ4A 4GVJA 1NY3A 3EN6A 4C4IA 5CF8A 4TYHB 3QQGA 3WZUA 5FUTA 5KCVA 2G2IA 4HPUE 4Y8DA 5BPYA 2Q0BA 3MY0A 2J0LA 3LFDA 4GK3A 4QYEA 2IZTA 3EQCA 3MW1A 3PJ8A 2E9NA 2QO9A 3MFSA 3TUCA 5CEIA 4CFWA 4BDGA 2ZB1A 4QO9A 1OZ1A 4NKAA 1E1VA 2RSVA 2UZTA 3IDPA 1MP8A 3LJ0A 2I40A 4IJPA 4GU9A 4QMOA 4AA5A 2ZV8A 4I24A 3BGZA 4NEUA 4PL3A 4O38A 4UMUA 4HNIA 3VS7A 4ZY6A 2JKOA 2W1ZA 3HV4A 2HY0A 3IECA 1V0OA 3QL8A 3D15A 5H3QA 5T68A 1PXKA 4FZFB 3O23A 5IKWA 3MPAA 3VS2A 3TM0A 4Y5QA 4IW0A 2R3IA 4LQMA 3PY3A 4NW5A 2GQGA 3SKCA 4FSYA 1APME 5A6NA 5B2LA 3OD6X 3CTQA 4FK6A 5EH0A 1J1BA 3ULZA 4CTCA 3WZDA 5FXQA 2J50A 4PF4A 4TWOA 5KMOA 2VZ6A 4JXFA 3EQBA 5K0XA 5HCYA 3WE8A 1CDKA 2VRXA 2Y4IB 4G3FA 4F0GA 4UMPA 3FZRA 4E6AA 4LYNA 2BTRA 4JDIA 5CZHA 4TYIA 3LKMA 4KAOA 4O0YA 4OAVB 5CF4A 3RAIA 2Y9QA 3BKBA 2QQ7A 3C4ZA 4I0TA 3W10A 3ZCLA 4NUSA 4QMQA 5GZAA 1ZMWA 1GZ8A 3DBCA 4FIIA 5DIAA 4O81A 4BDJA 2XBAA 4RC2A 3F5UA 3QRIA 3QZFA 4XV3A 3GNIB 4G6LA 3D83A 2PSQA 2W7XA 3D14A 3OXZA 5AIRA 1RE8A 3E88A 2YIRA 4QPSA 4D2RA 2IW6A 4MWHA 2YIXA 3A7GA 1SVHA 4H3PA 1Q8WA 3O96A 3L8VA 3TNPC 4C0TA 2YEXA 3FSFA 4EH6A 3F5PA 3FZSA 2YM7A 5T6KA 4UWCA 4DE4A 4GSBA 5CQUA 5AUWA 5I9UA 2BRMA 4GFMA 3UQGA 2QG5A 3ET7A 2FUMA 3VUTA 4DCAA 2B1PA 2QG7A 3PE1A 2UZOA 4FSNA 4QMVA 5IA5A 3DKFA 4D4RA 1WFCA 1OKWA 2QNJA 5IQCA 4E26A 3H3CA 5HCZA 4E20A 5CEPA 4FI1A 4YMJA 4IVDA 3D5VA 3QF9A 3VS1A 3ZXTA 4F9WA 4WNKA 5L4QA 4HVDA 2WXVA 4L3PA 4TYGA 4H39A 5H2UA 1ZY4A 3C1XA 1YHVA 3B8RA 3OEFX 3LFBA 1OUKA 3ZH8A 4MK0A 1JLUE 2P0CA 1RJBA 4IIRA 3VUMA 2WQEA 3DZOA 4FV4A 2BDJA 4U3YA 3BYMA 5AR7A 5A14A 5E7RA 3DOGA 3VRZA 1URWA 3LMGA 5AR5A 3BYSA 5FQDC 4MXOA 4JAIA 4OUCA 3KN5A 2ZMDA 3MH0A 4OLIA 2RL5A 3A7HA 2B7AA 4O7SA 2YZLA 4EHZA 2HWOA 2F57A 3TZ7A 3MFRA 2XK9A 2CCIA 3C7QA 2HAKA 2R64A 3ELJA 3I6UA 4NIFB 4WHZA 4RVLA 3POOA 4TN6A 5BYZA 2KTYA 2BZHB 5CENA 2UZWE 3UZPA 1OL6A 2R7IA 4LOQA 2X7OA 3MVHA 4I0RA 5HBJA 3S4QA 4OTHA 4FE2A 3T9IA 3QTUA 3IW7A 4J7BA 4X3FA 1SZMA 3QD0A 3WZEA 3E87A 5DYJA 3QUDA 3MY1A 4ZTLA 3SXRA 1BLXA 4FTCA 4C4EA 4GL9A 5HU3A 3TZ9A 4CRSA 2VTHA 2RFEA 3CPBA 3G9NA 5DRDA 4C7TA 4UEUA 2XKCA 2GHLA 2YZAA 4FSMA 3ZEWA 4QNAA 4X2NA 2E9UA 4YJNA 2WQOA 1RQQA 1M52A 3ZONA 2YFXA 2IPXA 1ZAOA 1P5EA 1REKA 2PZIA 4AA0A 2C0TA 2XB7A 3LJ2A 2R0UA 1O6LA 3DA6A 4JX7A 3A7JA 4ENXA 3G15A 3NMUF 2CKEA 3R63A 3QU0A 2ITPA 1Q8UA 3F61A 3WIKA 3WBLA 3KA0A 4MNEB 4E5WA 4A06A 2P3GX 5E8SA 2YM3A 3RZFA 1BL7A 2BKKA 3CQUA 4FK3A 4DGNA 4BKZA 2B52A 4YUQA 3MTLA 5GZ8A 3PP0A 3EYGA 5LWMA 3IW8A 4C38A 2J7TA 3O50A 4U42A 2PMIA 4CRLA 5DEWA 3BPRA 4YTIA 1XBCA 3JUHA 3SDJA 4DEEA 5J9LA 2BMCA 3WZKA 5CQWA 4G17A 3HV6A 5AIKA 4F9YA 1E9HA 3F2AA 3FLZA 3DAJA 2XNBA 5KKRB 2JLDA 4KWPA 4N57A 2GS6A 4D1SA 3N4TA 4FOCA 4ACHA 4F6WA 2OFUA 3OT3A 4ALUA 5M06A 5E1SA 3AMAA 4JR7A 5E8ZA 1R78A 4IH8A 4K6ZA 3QXPA 4O0UA 1Q3WA 4QMPA 2YIQA 4YZMA 2WTKC 4FKIA 4NZWB 4ZEGA 3EQHA 4OGRA 1Y6AA 4MD8E 4IHPA 2GNJA 2NRUA 2CKQA 4YNOA 3WILA 5LQFA 2YAAA 3O8UA 3FI8A 4FKVA 5BX0A 1H1RA 4PTEA 3R8UA 4F99A 5IQGA 3F3TA 1UNHA 5M4IA 3BHVA 3N4VA 1ERKA 3KXXA 2XRUA 2YJSA 4LUEA 2ZJWA 3U8WA 4CCUA 4ANNA 2W9ZB 3BU6A 4DEIA 1YXXA 4FL1A 2W1CA 3NYOA 4AN2A 3P0MA 3BCEA 3PYYA 1BI7A 3PRIA 1PXMA 3D94A 3BLHA 5D1JA 4GJ3A 4LOOA 3PXRA 4C4FA 4JS8A 3SOAA 4O7LA 3W2OA 1H01A 4EK4A 4B99A 1V0BA 3BBWA 3ORNA 3DAKA 4XJ0A 4FIEA 5ETAA 4OBQA 1H1WA 2WPAA 4YNEA 4FBXA 5E92A 3FZTA 4C57A 2YWPA 3OW3A 3P79A 2WTJA 2ERKA 3WF7A 3P9JA 3ZHPC 4RFMA 4FUXA 4EKLA 3SD0A 4D2VA 4FTTA 4W4VA 2IW9A 4TYHA 3KEXA 4K1BA 1RW8A 4XBUA 4UV0A 3A8XA 2CLQA 1Q3DA 3GCSA 1LEZA 3OCSA 5FEDA 4YLKA 3VQHA 3R0TA 2RKUA 2WEVA 2WMRA 3GU7A 3HRBA 4MQ1A 3R7VA 3OOGA 4EK5A 4JBVA 2PMNX 3LMHA 2VWXA 4CGAA 3OUKA 3TACA 3R28A 2WTCA 4V04A 3ZSIA 4HVHA 4F4PA 4O7WA 1A48A 3LQ8A 2PZPA 2J0MB 3V5LA 2XP2A 4AZVA 4L43A 1SVGA 2VV9A 2HY81 3M11A 5DBXA 5FLFA 4E5BA 1E1XA 4O1PA 4S34A 4TL0A 4G5PA 4FOBA 4W4XA 2BAJA 2OI4X 3GUBA 4GFGA 2ZOQA 4TTHB 3W1FA 5B0XA 4BCOA 2VWWA 2XM9A 4D1XA 3PXYA 4KBKA 2QLQA 4J1RA 3LZBA 2W1IA 2OO8X 1FMOE 2WB8A 4GK2A 2VTQA 4DGLC 4GH2A 5AP6A 5LJJA 5CT0A 3NEWA 4LOPA 2HZNA 1IAJA 1YHSA 3ZOSA 2PVFA 3DY7A 3FI4A 4DFXE 4QTCA 3MYGA 3OY3A 3EIDA 4FTUA 4EHGA 4KABA 2W1FA 3TNQB 4ANLA 4DH5A 3OBJA 5HVYA 3ZTXA 4XEYA 3P7CA 4AFEA 2CHLA 5TT7A 4FT9A 4IVCA 4CT1A 4M12A 4R78A 4CLJA 4RIWB 3EWHA 3Q6UA 4K9YA 1H0VA 1XQZA 2OXDA 3DKOA 2W4KA 4BHZA 4C34A 1NXKA 5HICA 2HENA 2BKZA 3IW5A 1B39A 3MVLA 2VNWA 1FBNA 4YGAA 1XH8A 2QOIA 4ITIA 2C0OA 4Q9ZA 4FZDB 3BQRA 4ZAUA 1IR3A 3HP2A 2WMVA 3HA6A 5HNBA 2JKMA 4RFYA 4FIFA 4QQ5A 3MN3A 3VHKA 3ZFMA 2RFSA 3BEAA 4FKTA 3R22A 4L45A 4W9WA 3RCJA 4A9TA 3C51A 4BWXA 4BI2A 4X3FC 3D2KA 1GNGA 2OJFE 2X8DA 1CKJA 2XEYA 4K0YA 3FMKA 3SAYA 2WTKB 3OTVA 3AXWA 4NU1A 3FV8A 2XCKA 3EN5A 2OK1A 2NPQA 3BGQA 2QOOA 3OWKA 4U6RA 3UZRA 4IM0A 4R3RA 4DFLA 1FQ1B 4EI4A 3Q04A 5AP4A 3ZSHA 2G15A 4GG5A 4BDAA 2HXQA 3AMYA 3LE6A 3F3ZA 2OIQA 3ORPA 2PUNA 1WBVA 3WOWA 3MPMA 3U6JA 2PK9A 3LPBA 4A9YA 3PG3A 5D7AA 3RWQA 4YTCA 5CY3A 4FVPA 5EM5A 4A07A 4MBIA 5E8TA 4EEVA 2C3LA 2J4ZA 3DTCA 4CKJA 5M07A 3UO6A 2HZIA 1LEWA 1XH9A 1MQBA 4D0XA 4F1TA 3CXWA 4MQ2A 4M66A 4E4MA 4O7YA 5L8LA 3FKOA 4UXLA 3POZA 4FV6A 3L9NA 4LM5A 4RWLA 3VAPA 4DFNA 4ENYA 3RKBA 4A9SA 5H8GA 4RA5A 1OM1A 5FP5A 2Z2WA 5D7VA 5ANGA 4ITHA 4M7IA 3DBFA 3EZVA 3PIXA 4FYOA 3VUIA 4D2WA 2NRYA 4I92A 3D5WA 2F9GA 4B0GA 4PUZA 3ZLWA 1Q61A 2VWUA 5BVEA 3RTPA 2WQBA 4ORKA 1Z5MA 1JVPP 1R0EA 2ZDTA 3RINA 5DPVA 5HQ0A 4YC8A 4E6QA 3AC3A 5EG3A 2X8IA 4ZSAA 5ETIA 3P7AA 4WBOA 4R3CA 3OY1A 4DC2A 3UODA 4MXAA 1UU9A 1WBTA 3OEZA 4O0VA 3MVMA 4X3JA 3TL8A 2UZNA 1WVXA 4FSTA 4QP9A 5EM8A 5L6WL 1FMKA 3UJGA 1ZZLA 2WD1A 3C4EA 3HLLA 5CSHA 4C3FA 4FSZA 2CSNA 3GCQA 1DS5A 3VS6A 4E73A 4O84A 3F5GA 1FVRA 4QD6A 3AC1A 4FTNA 4EZ7A 5LVPA 4IB0A 3EH9A 5DT3A 3DLSA 2ZYBA 4EKKA 2A27A 4Y5HA 5C03A 3DK7A 5CEOA 5EFQA 4DEHA 4KIPA 3QTRA 3UPXA 4OTRA 4P4CA 4M68A 4E93A 1U46A 1U5QA 1GIHA 1W7HA 4HZRA 3U6IA 4CYJA 4R6VA 3CBLA 2NP8A 3VS5A 4MNEA 1JKLA 2PVKA 2WU6A 4IX4A 3W8QA 1GAGA 5AX3A 5J87A 2YN8A 4IBMA 4RMZA 5B2MA 1YXTA 5M44A 4QT1A 5AP7A 3UC4A 3G51A 3TEIA 2JFMA 4AE9A 4I6BA 3ENMA 4C4JA 4P2KA 4FSRA 4BTJA 4X6RA 4APCA 4BCPA 4BDCA 3ORMA 2YJRA 3FJQE 1PRYA 2QOBA 3GVUA 3MDYA 5AA8A 3LLTA 3AC8A 4XG4A 1I09A 3Q4UA 5IQAA 4BFMA 3NW5A 1WBSA 1WZYA 3MV5A 3OG7A 4W8EA 4HZSA 1K2PA 2X39A 5DOSA 4NL0A 4M67A 1Z57A 4MD7E 4PL5A 4D4SA 5BVNA 4CZTA 5AFVA 5DLSA 3D2IA 4G6NA 3FY0A 4BIEA 3P78A 2C6LA 2CNQA 2Z7QA 3DKCA 2JDTA 1MRUA 1R0PA 3L8PA 4NM3A 4ERKA 4U8ZA 1B6CB 1UU3A 3ORIA 2X8EA 4DGOA 2ACXA 1JAMA 3D5XA 4RA4A 3V8WA 4IM2A 1ZYLA 4YC6A 3TNWA 3ZYAA 3MBLA 5FXSA 3BIZA 4BGHA 3NYNA 4W9XA 1OECA 2C5NA 4DG3E 4HVIA 2HW7A 4Y85A 4PWNA 2W96B 4F64A 4Y72A 1H4LA 1KOAA 3PPKA 4G16A 4C62A 5HBEA 5EDQA 4J8NA 2ZVAA 2HELA 3CY3A 3K2LA 4X3FB 5FBOA 2Z60A 1JPAA 1Q41A 3EFLA 3MGYA 3QUEA 4F08A 4I5MA 3SHEA 3EN4A 3IKAA 3A99A 3M2WA 3R7IA 1OIRA 1BUHA 4FKJA 4V05A 5DR6A 5HKMA 4MXXA 1QPJA 5E1EA 4FV1A 3R8MA 4H36A 4IAAA 4AZEA 4WRSA 2GNFA 5AV0A 4C61A 3K3JA 3R9DA 2EB3A 3NLBA 3OWJA 4LGHA 3VN9A 3ZO4A 5D12A 4BYJA 3LM5A 3QTIA 4BB4A 4D2SA 2ZV2A 1YDTE 4CKIA 3GCUA 5AUYA 4FMQA 4DAWA 4OTGA 2PYWA 2XKFA 2BRNA 5EYCA 3TJCA 2R0IA 1HCLA 2HXLA 5J5SA 4R3PA 2F49A 5AP3A 3HMNA 4CT2A 3NW7A 5L8KA 4R77A 4QMXA 3QZIA 4RIXB 4UX9A 5IQBA 1MUOA 4GK4A 2XNPA 1VYWA 2OIDA 4I6HA 2PUPA 5CASA 3M1SA 1NVRA 3ID6C 4EC9A 3U54A 2XA4A 2HIWA 4U43A 5A4TA 1W8CA 1PXLA 3NNWA 5TR6A 3GENA 3HUBA 4ZJIA 2EUFB 4E6DA 5BVKA 4NTSA 1KE9A 2C3KA 3K3IA 4NH1A 5CU0A 4HJOA 1XH4A 4RQKA 3KXHA 2EWAA 4AS0A 3HL7A 2F7EE 2WMTA 3DKGA 3GXLA 2X6DA 4IC8A 2CNVA 3CKXA 1Z9XA 2WZJA 3I0QA 3DU8A 4YJPA 5IQIA 1H26A 5L6PA 5IDPA 5LOHA 3UQCA 1UWHA 3MWUA 2IZSA 5KO1A 4J99A 4R5YA 4FTIA 5L6OA 4D4YA 4L6QA 2HK5A 3PXFA 2VGPA 1VYZA 2XIKA 3NNXA 4JBOA 5CYIA 2PVLA 5AP1A 4BR3A 4CG9A 2PULA 3EFKA 4YHFA 3V5WA 2BRHA 2ZV7A 3QD3A 4L52A 4FTKA 2GHGA 4M84A 2QOQA 5KUPA 5AUTA 4IX3A 2B0QA 1V1KA 2UVZA 5DVRA 2C0IA 4WG4A 2GS7A 4Q9SA 5CVHA 3HAMA 1NT2A 3ZUUA 4C8BA 3EN7A 4UB7A 2B9JA 4DG0E 4PPAA 4YZBA 3NWWA 5DNRA 4JT3A 5JMSA 2BHEA 5CTPA 2CCHA 4FV0A 3V8SA 2R3OA 1KE5A 3KRWA 2JIIA 4H1MA 3RPSA 3LXLA 3THBA 2QO7A 2V7OA 2VTOA 4F1OA 1PKDA 3VUHA 3ZDUA 4R7HA 4D5HA 1OPJA 3BX5A 5E91A 4D9UA 2RGPA 4RIWA 4L3LA 1H24A 2OG8A 5B2KA 2BRBA 5HX6A 2XK8A 3S0OA 2R3PA 2Y7JA 3WF6A 1KOBA 4I4EA 1S9IA 2PE2A 4AW2A 3TTJA 5CEMA 1JKTA 3SV0A 4NJDA 3CS9A 5CXZA 3LQ3A 4O22A 2VD5A 2YDIA 4YO6A 1YWVA 2AYPA 3ZLSA 4QQTA 3RCDA 3TV6A 3DTWA 2BAKA 3EN9A 1KWPA 3B2TA 3CC6A 3E93A 4YU2A 4R8QA 4Q2AA 3LCOA 4FZAB 3D5UA 5L8JA 4YJQA 4P7EA 5DGZA 3VVHA 4DEDA 4CFUA 1H00A 1O6KA 1Y57A 2W06A 2A4LA 2PE0A 3Q4CA 4FG9A 3JY9A 1W84A 4CNHA 5A3XA 4DA5A 3VW8A 4PDOA 2UZLA 3HEGA 3QQKA 4BTKA 4DLIA 4KKGA 3JY0A 4QYFA 1Q97A 5F1ZA 3SC1A 4ALVA 4H1JA 3N51A 5AA9A 5EW9A 4ITJA 4C3PA 1JKKA 1KV2A 2W05A 4RX5A 1ZMVA 3BHHA 3CTHA 3MFUA 3DLZA 3ZMMA 4O1OA 2UZDA 5BVWA 2YDJA 2I0HA 4Y95A 5GINE 1FOTA 2HOGA 2ITWA 5FEEA 4EH9A 4PY1A 2YCFA 4NJ3A 4KIOA 5EHYA 2VNYA 5FTOA 5A46A 5AV4A 5AV2A 4NK9A 4H3QA 1XBAA 3VWAA 3RK7A 1BL6A 4I4FA 4UY9A 4A4LA 4UYNA 3IDBA 4EOSA 5IF1A 2YLFA 4S31A 5L2WA 4FKOA 1M2RA 4TRLA 5K5NA 1QCFA 3E62A 2F2CB 3BHUA 4BCGA 4RJ7A 5IMXA 2O63A 4EZ3A 2V5QA 4EH2A 5J8IA 4HYSA 2QI8A 3SG8A 5CU6A 5AR8A 2OKRA 4KS7A 5IA4A 4ZTNA 2HZ4A 5HVKA 4CQGA 5CI6A 2R3GA 3R73A 3UTOA 4XG8A 4FICA 3UMXA 2BDWA 1M2QA 1CKPA 4FIHA 4L44A 4ANBA 5EYKA 3R7EA 5KKRC 1OBDA 3SG9A 2CDZA 4EOPA 4EBVA 1CSNA 3NPCA 4L3JA 2IVVA 3DFAA 2P2IA 1YI4A 1U59A 2X81A 4PQNA 1CMKE 2DYLA 2X2KA 4K2RA 4EC8A 3QRKA 3TNIA 4EWQA 4FEUA 4FKUA 4PMTA 2FA2A 5CVGA 4DFBA 2OF2A 3F2NA 3GCVA 4FT0A 5GNKA 4B8LA 1OL7A 4DGGA 2SRCA 4C59A 4DINA 3VUGA 4FC0A 4YPSA 4YO4A 2LGCA 3EKNA 5FEQA 3Q60A 4PMSA 4HVGA 3G9LX 5CVFA 4JJRA 2RF9A 1ZZ2A 3UE4A 2XJ2A 1YDSE 2G2FA 3DBEA 3MTFA 3R8VA 4WSQA 4GKHA 3UOLA 1YI3A 4AXAA 5J1VA 4O6EA 3FEGA 5HO7A 1A9UA 4B6LA 4RGJA 2UVYA 1QMZA 5HBHA 1ND4A 3FY2A 2PHKA 5HESA 1W83A 2Z7LA 4L01A 2VX1A 2OW3A 3RBWA 1LUFA 2YITA 5EHOA 1OKZA 1PMUA 3LHJA 2R4BA 4FEXA 4F0FA 5D11A 5BYLA 2PZ5A 3C5IA 2E9PA 5FBNC 3AT2A 3FPQA 3F7ZA 5K0KA 2YIYA 4TNDA 2QVSE 4EYMA 3FKLA 3KFAA 4OTPA 4ZY5A 4GMYA 5EQYA 4I22A 4QRCA 2VTAA 4ACGA 3I81A 4FGRA 3HV7A 2F2UA 4DFZE 3F69A 2VO3A 3RMFA 3FUPA 3KQ7A 4BCIA 2W1DA 2B4SB 3CTJA 3S2PA 2OF4A 3IOPA 3EL7A 3R8LA 5FWKK 3ANQA 2W9FB 4EQUA 2R5TA 3VQUA 1WAKA 3C4XA 3OWPA 4N70A 4XG3A 3HP5A 3RZBA 3RPRA 3TJDA 1GJOA 3LCSA 5HE1A 1Q8TA 3FQEA 2FGIA 3MI9A 4BBFA 1KE7A 2YM5A 2JIVA 3KK8A 4NYEA 3DQXA 1JSVA 4RBLA 3AT4A 4USEA 3ZC6A 4J52A 4U5JA 3RALA 4ZXTA 2BR1A 3A8WA 2C68A 4IB1A 4L46A 3VJOA 4CV8A 3NNUA 3LMIA 4GUBA 5DEYA 3EHAA 3KK9A 2XZSA 4QOXA 1SVEA 3ENHA 1GZKA 3HV3A 4O96A 5IA0A 3Q53A 4LL0A 3S3IA 2HCKA 3VF8A 4I0SA 3MJ2A 1ZYSA 1VR2A 3MH2A 2ITVA 4F7LA 5CANA 3UOKA 3DDPA 1OKVA 2ZAZA 3RAHA 1NA7A 5TE0A 4AZSA 1IA8A 1A06A 2PZRA 2WHBA 3GU5A 4FSQA 3NR9A 4MH7A 5HGIA 4LV8A 3C50A 4DGMA 5E8UA 4GIIA 4RSSA 5AAFA 2UW7A 4QMUA 5GZ9A 4LG4A 2EU9A 2WQMA 4FTAA 5HG5A 4RQVA 4OAUC 3OT8A 3UG2A 4XRJA 5JKGA 3GU8A 3Q9ZA 2FO0A 5H8BA 3VO3A 4RIXA 3S95A 2R3FA 3F66A 5DN3A 5KX8A 2C6IA 4C58A 3TUDA 2XKEA 4LRMA 2UW3A 2WTDA 2V62A 2GSFA 4E6CA 4C2VA 3AC2A 3ZRMA 4O7VA 3LOKA 3RPYA 3UNZA 2VO6A 1B38A 3E92A 4CEGA 4FSWA 4XV1A 5ANKA 3R8PA 1QPDA 2O5KA 4ARKA 5JH6A 2W1HA 3QC4A 2OXXA 1OI9A 2G01A 3DCVA 5JRQA 4ZMEA 4N0SA 2QU5A 2VTLA 4IB5A 1F0QA 3F82A 4X6QC 5HNIX 4CQEA 3R7YA 4IE9A 1UNGA 3WI6A 3LCDA 4GS6A 4KSPA 4DTAA 3ZM9A 2JBOA 4U3ZA 1CM8A 5KMIA 1P14A 3VUKA 5C8KA 2VWBA 3DZQA 5LWNA 3V5PA 5A4LA 3G5DA 5ANOA 2ZB0A 4BVUA 4BDHA 3TDWA 4XS2A 1UKHA 1M14A 3BRBA 4OT6A 4OT5A 4TW9A 4WT6A 3EQIA 4J97A 3UIBA 4QMYA 2VTSA 1H27A 4BCFA 4KINA 1H08A 1IA9A 1XKKA 4NM0A 3VJNA 4DYMA 4UMRA 3BYOA 4M13A 3GFWA 5HTBA 5AM7A 5JK3A 4WUNA 3FMHA 3UPZA 2AC5A 4UMTA 1JBPE 1FGIA 3JVSA 4XH6A 2ITNA 3I79A 3QHRA 5EYMA 1J7IA 5C4KA 3L8SA 3DNEA 5ETFA 2WFYA 4HCUA 2ZM4A 5L2QA 2BALA 3MJ1A 5CWZA 3Q3BA 5D10A 2ITXA 2FH9A 1TQMA 2R3LA 2BVAA 3F9NA 3DQWA 4EUTA 3CSVA 1GY3A 3ZLXA 4G3GA 1HCKA 3T3VA 4B4LA 1QPCA 1T45A 3FLSA 4ZLZA 1XH7A 3DXNA 3P5KA 4GYIA 4IZ7A 4OBPA 2EXMA 5HG8A 4AGCA 2JEDA 3Q9WA 3L1SA 4L00A 4ZSGA 3R6XA 1OL2A 3PZEA 3C4FA 3QCXA 3Q52A 5K9IA 2W99B 4BI1A 2W5HA 5J5TA 3BV2A 5DRBA 3V8TA 5LCKA 2BFYA 3R02A 1YQJA 3BI6A 3HDNA 4GG7A 4WIHA 1SYKA 4B7TA 2O3PA 1J1CA 2O2UA 2WTIA 4EHVA 3PXQA 2J90A 3ORLA 5L2TA 4U44A 1PJKA 3NSZA 4AWIA 3E8DA 4MXCA 5J95A 5EI2A 3AC5A 3HNGA 4XOYA 2WGJA 5L3AA 1WVWA 2WMSA 2X6EA 3TKIA 4C2WA 4E1ZA 1PXOA 3EJ1A 3KULB 4TT7A 2GFSA 4FT3A 4AQCA 2LAVA 1OUYA 3R04A 2W4OA 4QYHA 3HKOA 4AT5A 4S33A 1YOLA 4ZLYA 2KULA 5CSPA 4TWPA 1Q8YA 3QD4A 4KNBA 4RJ5A 3GC9A 4U0IA 4XLIA 2R3NA 4ZTMA 4ASXA 2ZM1A 4MEDA 5JZNA 4F7NA 3VF9A 3KRJA 3WF9A 4QP4A 1AQ1A 5ICPA 1IAHA 4EOJA 4FEQA 3F7WA 2OH4A 2PUIA 2IZUA 4FNWA 5BNJA 4FIJA 2RFDA 2ZMCA 4EYJA 3QX4A 1GZOA 4U80A 3UO4A 3I4BA 5HU9A 2I0YA 3BGPA 5C8MA 3EL8A 3UOHA 5HORA 4PPCA 3Q5ZA 3EQGA 2BCJA 4FV9A 4DCEA 2GTMA 1I44A 3Q4TA 3O8TA 2BIYA 4KA3A 3U87A 2ITZA 3TUBA 4FT5A 4K18A 4L67A 4F9CA 4IAKA 4KBCA 4WG5A 4S32A 5HG7A 4IZYA 4QMWA 4EHEA 5IEVA 2F4JA 4AW5A 3F5XA 4BBMA 1PKGA 2FB8A 3PVWA 3NVKI 2JITA 3BLQA 4EJ7A 4UXQA 3W2SA 4FG7A 4NFMA 1OIYA 4XG2A 3NW6A 3WYYA 1K3AA 3NUXA 4CFMA 3ZS5A 3LXPA 3QAME 3UQFA 4QMLA 2CKOA 1REJA 4C36A 4YC3A 4EOQA 4Z55A 2QODA 2WOTA 2XK4A 4GVAA 2WO6A 2CGWA 4BN1A 2C6TA 3OCTA 4JVGA 2XBJA 4ZTSA 5HVJA 2R3HA 3ZZEA 3GT8A 4EZ5A 3RWPA 5IQDA 3ACKA 3RI1A 5HG9A 4JNWA 5ANJA 1JQHA 5CZIA 3VW6A 2BZIB 4O0TA 4O7TA 4D55A 3W2QA 2PMOX 5CF6A 2IG7A 3U55A 3CJGA 3MVJA 2IVTA 1QPEA 4UWYA 3UDBA 4K8AA 2JC6A 3TZMA 5A6OA 2PU8A 2OU7A 4D9TA 4HCTA 4ZP5A 5J79A 5M09A 2CN8A 5JZJA 4I41A 3BHTA 2J51A 4NM5A 2IJMA 4FZ7A 3PPZA 1KE8A 5H8EA 5M4CA 4Y83A 4QMNA 4RIYB 4BIDA 3JXWA 3PVUA 3G2FA 3REPA 3ZU7A 3OFMA 4CXAA 5M51A 3RVGA 4D1ZA 3IPHA 4EH7A 3PA5A 4LGDA 3QQLA 3KMMA 5LMAA 3ITZA 1OPKA 4LGGA 1YXUA 2C6DA 4PMPA 4J96A 1WCCA 3FDNA 1JNKA 4DEBA 2XIZA 4ZSLA 1YWNA 2GNIA 4AA4A 1U5RA 2C6KA 5D41A 2BHHA 5IUGA 5AV3A 5DR2A 4UBAA 1MRYA 4AT3A 4BTMA 3VIDA 4QYYA 3DXPA 5EDRA 4QTAA 5J9YA 2QONA 3NUYA 4GIHA 5KMKA 1YKRA 4CMOA 2QO2A 5BVDA 3QBNA 4TNBA 5KHXA 2XK3A 4M8TA 4YZ9A 2OJIA 2PWLA 3PWYA 3LXNA 3RGFA 2ESMA 2QOHA 3UOJA 5ANIA 3QXOA 4JAJA 4C02A 1BKXA 4ZOGA 5FDXA 4JIKA 2QOKA 1DAYA 3UGCA 3KCFA 4JI9A 2PUUA 4I20A 4KRCA 4QMZA 5AP2A 4BWKA 4N6YA 2E9VA 4O27B 2I0VA 1LP4A 1PHKA 3NRMA 2DQ7X 2Z7SA 4WRGA 1QL6A 5J9ZA 4GT5A 3F2RA 4FKQA 2GFCA 2CJMA 2VWYA 2HYYA 1ZLTA 2QR8A 3RP9A 3U4WA 4AACA 4A9UA 4M0ZA 4DT9A 2H6DA 3FXWA 5HD4A 2PVMA 4XP2A 4ANSA 1F3MC 4PP7A 2Z02A 4XNEA 4NT4A 3D0EA 3Q6WA 4IWOA 2V0DA 3LQ5A 5IEXA 2YM4A 1TKIA 4IMYA 4YR8A 2C3IB 3GI3A 1WBWA 3H10A 3JPVA 3NX8A 5L2IA 4ZS0A 3EQPA 4CCBA 5IQEA 4DTBA 3ZUVA 4V0GB 3HZTA 2J9MA 4HOKA 2C6EA 2XIXA 4YJVA 3UP2A 4KS8A 4BCJA 3A7IA 2UW9A 2I7QA 2B9IA 5CAVA 2C5XA 2P4IA 2Y0AA 3AQVA 5CAOA 3F3UA 3MB7A 4IAIA 4OTWA 4EOLA 2R9SA 4CTBA 4NM7A 4LL5A 2A2AA 4IACA 1G8AA 4ASZA 4M15A 3ZBFA 3KXZA 4PX6A 2W1GA 3HGKA 4BYIA 2XIRA 4FTRA 3ALNA 3TT0A 5JGDA 1SM2A 3CP9A 3AD6A 3LIJA 4WA9A 3PY1A 2XK6A 3C4WA 5FTQA 4KD1A 4RX7A 3KF7A 2H8HA 2YDKA 4EJNA 3SGCA 3RPVA 4ZS4A 5FP6A 3OUNB 2XEZA 4YZNA 3QRTA 1R39A 2VTTA 2OLCA 2UZEA 3ZM4A 2XVDA 3H4JA 3O51A 4ZTHA 3R7OA 5I5ZA 3ZLYA 4D4VA 3DBQA 3ZEPA 3R1QA 1YOJA 4I3ZA 4RLKA 5KZ0A 2X4ZA 3DB8A 4DTKA 3VUDA 3UIMA 3ORXA 5IH5A 4JLCA 5HE2A 4QNYA 3KY2A 3NZ0A 3CD3A 2JAVA 4OBOA 3H0ZA 1VEBA 2X7GA 2O64A 4A4OA 4C33A 4KIKB 2RFNA 4R1VA 2X4FA 4TWNA 2GNLA 2PTKA 2YACA 5DMZA 5AP5A 4UN0C 2R2PA 4MXYA 3QTZA 4FR4A 4N6ZA 1DAWA 1OMWA 3PJ1A 4QTEA 5IQFA 1ZRZA 4QTBA 3RHKA 3DNDA 4IAYA 3ROYA 4M97A 5CALA 2C5OA 5AR3A 3I5NA 4MAOA 3R9HA 3AGLA 4RJ8A 3NCZA 1ZARA 2OBJA 1WBPA 4NTTA 3OXIA 2VTPA 4FNYA 2B9HA 5CNNA 4TWCA 3GU4A 5FG8A 3C0GA 3GB2A 4WNOA 4YLLA 4FEVA 5FM2A 3KXMA 2IW8A 4CVAA 3E8NA 5CF5A 3GC7A 5DR9A 3DBDA 1R1WA 2BROA 3O7LD 2OIBA 3KN6A 4QQCA 4HW7A 3QWJA 5DH3A 3K54A 4RG0A 1Q62A 2XK7A 3WF5A 5K4JA 3E64A 2VN9A 3E3PA 4L8MA 3FMJA 5HE3A 4AE6A 3NYXA 4JQ7A 3FI3A 1WBNA 1P4FA 2J5FA 5M53A 5IU2A 4O0RA 4IDVA 3I6WA 3LW0A 3I7BA 3CJFA 5LVOA 4I5PA 3O7LB 3L9LA 4ID7A 4ASDA 4HVSA 2GNHA 4JRNA 3B2WA 3SLSA 4F63A 3QFVA 2B55A 1YXSA 3U6HA 3ATTA 4AN3A 4CLIA 5LVLA 5IG1A 4V01A 2J0IA 1SMHA 3R1NA 4OTIA 1Y8GA 4YZCA 3PVBA 4G9RA 4ZK5A 4UWBA 4ZJVA 3KULA 3L9PA 2WOUA 2Y6OA 4XV9A 3HRFA 2Q0NA 4Y46A 3TI1A 3ZUTA 3MPTA 2C6OA 2IN6A 1K9AA 3FXXA 3CIKA 4IXPA 3COKA 3AG9A 4O7RA 5M4UA 4ANOA 2BZKB 3FMMA 4EQCA 3NUAA 4EH5A 2JDOA 2VGOA 4HYIA 3W2PA 4LMNA 2VTMA 3H9FA 1PXNA 4EUUA 3CGOA 4XHKB 4AGWA 4ZTRA 4ZY4A 1XH5A 2CMWA 3CGFA 4PRJA 4ZJJA 4AG8A 5AUXA 1ZMUA 4F6SA 1OIUA 3QC9A 3IK3A 1PY5A 5KMNA 1NVQA 5G6VA 5KBQA 1PXPA 3FPMA 1YVJA 2OFVA 4ZZOA 1Y91A 3CQWA 5E90A 3PUPA 4IEBA 4FVRA 4E4NA 2PZYA 2YABA 2V7AA 4RZVA 3G90X 3V6RA 3KGAA 2QHNA 2GTNA 1H1QA 2R3KA 3AOXA 4JG8A 4APPA 1M7NA 1FVVA 4DITA 3IONA 1NW1A 5L2SA 1LPUA 4I23A 4UZDA 4X2KA 1FINA 5CU3A 2PVNA 4RVMA 3R2YA 1YI6A 2C30A 3LFFA 1P2AA 4MBJA 5BVFA 2XMYA 3UC3A 3O8PA 3PVGA 1OGUA 3QQJA 3SXSA 3COMA 3A4PA 4BWPA 3C9WA 1ZOGA 3T8OA 4NKSA 3BE2A 2W0JA 1V0PA 3BHYA 4EK8A 5M56A 4Y73A 3TN8A 4D5KA 3GQIA 3KRRA 4FTLA 4BDDA 5HTIA 3Q32A 4G31A 1RDQE 1STCE 2W1EA 3LFNA 4YZDA 5JFVA 4RLLA 5J1WA 5FTGA 1J91A 2XNNA 4CKRA 3FMDA 4FKWA 4PV0A 3CLYA 2OSCA 3IW6A 3JVRA 3ORZA 1FGKA 2RG5A 1O6YA 3DJ6A 5HO6A 1IASA 4F09A 4D58A 5IZFA 2Y8OA 3QTQA 3ZFXA 4YSJA 3V5JA 3FLYA 5JRSA 2YM6A 3TZ8A 4RJ6A 5KHWA 5HLPA 5GJGA 2CGVA 5CXHA 1UU8A 2YHVA 3P7BA 3I7CA 3AC4A 4M69B 4MTAA 1BX6A 2W5AA 3DK3A 4O83A 4DEGA 1Q99A 3DJ7A 1GIJA 1UA2A 3LXKA 3VULA 3DS6A 2QOLA 4FTMA 4YBKA 3LFQA 3Q9YA 5EM6A 4ACDA 2WIHA 5CSWA 3Q5IA 2UZBA 3BV3A 3QUPA 4X2FA 4MVFA 3WYXA 4HCVA 4LI5A 3V3VA 4IWDA 4WNMA 3W2CA 4Z7HA 2QD9A 4O91A 4OTDA 4PPBA 1H1PA 4RIYA 3BYVA 2PE1A 2CGUA 4FF8A 5DT4A 3QKMA 4PDYA 3QWKA 1YDRE 5FM3A 5C27A 4DHFA 1MQ4A 3Q4ZA 5CX9A 5AUUA 2DWBA 3PA3A 4BCKA 3Q2MA 2UW6A 3AD4A 1S9JA 3UMWA 3VBYA 4CFNA 2RIOA 4LUDA 3CR0A 3QA0A 5C26A 4TZRA 4GJ2A 3K5UA 1TQIA 2QOFA 3BWJA 4IADA 4WG3A 2QOCA 1OPLA 4PTCA 5D9HA 3QRJA 3RPOA 5A4QA 3FKNA 5I3OA 3CKWA 3FBVA 5GJDA 3W32A 3C5UA 3ORKA 4ANQA 2XM8A 4L7FA 5HX8A 5IA3A 3EQFA 3QKKA 4LMUA 3LCTA 3E8CA 3IDCA 4AF3A 5F9EA 4PL4A 4A7CA 2YAKA 3R1SA 1UU7A 5LVNA 4U81A 4CFXA 5LXMA 5IEYA 3COHA 3OBGA 1OIQA 4RT7A 3SA0A 3EMGA 4MD9E 4FV2A 1EH4A 2ITTA 3QYWA 4O0SA 5LMBA 4AGDA 3BU3A 1OVEA 2YCQA 3FYKX 2GS2A 2ONLA 2XIYA 3EB0A 3OCGA 5FRIA 2C47A 3QLGA 4FGBA 4XBRA 4GUEA 2W17A 2WTWA 4QPMA 4F65A 2QLUA 4G3EA 4IZ5A 2FSLX 3QTXA 3KU2A 2H9VA 4IDTA 4JDJA 4Q5HA 4R7IA 3W2RA 2PPQA 4DF3A 4TKSA 5AR2A 1ZXEA 5E4HA 4BRXA 5JN2A 4O82A 2JDRA 3PSCA 4UYAA 4BCHA 4JBPA 3ODYX 4V0GA 1YW2A 4MWIA 3R2BA 5AUVA 4DFYA 4DH8A 1VJYA 3HYHA 5IUIA 5JT2A 4E7WA 5EQEA 4IZAA 4L42A 4JG6A 3UIXA 3G33A 4AFJA 2QU6A 4G5JA 3HV5A 4L53A 4U97A 3JR1A 1Q4LA 2PVHA 3OCBA 5DWRA 3DPKA 4FNZA 3A61A 3BZ3A 4AU8A 3PTGA 3ANRA 3VS3A 3GP0A 4IAFA 3A2CA 2X2LA 3QYZA 5KNJA 5IA1A 5ACKA 4CZUA 4E5AX 2WAJA 2BAQA 3BLRA 4BC6A 2G2HA 4I1ZA 1WVYA 2X7FA 3ALOA 3OXTA 4FTOA 2FSMX 4QP1A 4DH7A 2CGXA 4MX9A 4FV8A 5EKNA 4WBBB 4KIQA 2R7BA 4BTFA 3GEQA 1PYXA 4M0YA 2EB2A 3ERKA 3V6SA 5J7BA 3Q96A 1OL5A 3FL4A 4J95A 5LMKA 4ZZMA 4ALWA 2GHMA 4FSUA 3V51A 5IMEA 1XHAA 4JRVA 3WARA 3FAAA 4PNIA 4AW0A 4B8MA 3QCSA 5AAGA 3EOCA 2XS0A 4G6OA 3W16A 5DFPA 3PDTA 4KIKA 3I60A 3QQHA 3LCKA 3NAYA 1OL1A 4BBEA 4N4SA 4O7ZA 2WELA 3ZO1A 1XR1A 4JBQA 4P5ZA 4QP2A 1F5QA 3D7TB 3IG7A 3BELA 3C0IA 4DH1A 3RK9A 2P33A 3OS3A 4NWMA 2VX0A 3F88A 4F70A 2PL0A 5EQPA 4FV5A 4O0WA 2ITUA 5I9XA 3O0GA 5E8YA 4U7ZA 4K33A 5BQ0A 5IH6A 5TF9A 4BDKA 4HNFA 1Q5KA 3R8ZA 4EK3A 5AV1A 5EM7A 4ZTQA 2J0JA 2QURA 4XX9A 3G0EA 3L9MA 4BKJA 4GKIA 5DT0A 4RX8A 4AP7A 3OVVA 3QGWA 4I21A 3SW4A 3WF8A 2BDFA 3ZSGA 4IM3A 3KRXA 4BI0A 3CCNA 4O86A 2ERZE 3F6XA 2VTIA 3QGYA 5CEQA 4FNXA 1OITA 4UALA 3IS5A 4FKGA 3C0HA 1H0WA 5IA2A 1FVTA 3VBVA 2HZ0A 4P5QA 3UP7A 5ANDA 2YA9A 3UVRA 1XJDA 2X1NA 4HGSA 2A1AB 1ZYCA 2I0EA 2ETRA 2VO7A 1WMKA 3TNHA 4YPDA 4ZMFA 4OR5A 5I0BA 3D7ZA 1O9UA 3R30A 3QKLA 3SOCA 3ZBXA 1WBOA 2ITQA 2W5BA 4QP7A 5DE2A 5AX9A 5ACBC 3FMLA 3JS2A 3OF0A 2FSTX 1KE6A 4YJTA 4ERWA 1ZOHA 1GZNA 3M42A 4FKLA 3TKHA 3VS4A 1Q8ZA 1CKIA 2ZDUA 4RIOA 4E4LA 2X9FA 2O8YA 3I1AA 1BI8A 3I0OA 3AMBA 4ONAA 2IZRA 2O0UA 3QZHA 3PG1A 4HGLA 3BYUA 4IANA 5CAQA 4TXCA 4ASEA 4YTHA 3EKKA 3KREA 1MRVA 3I5ZA 5LVMA 1T46A 2WTVA 3QQFA 4BZOA 4EORA 2PVYA 4FKPA 4Z7GA 3GBZA 5GIPE 4XOZA 3A62A 2B54A 3HMMA 4FTJA 3PJCA 4FVQA 5JFXA 5C01A 5ITAA 3DXQA 1YHWA 3TKUA 3UBDA 1AGWA 4MF0A 4F7SA 4RRVA 5H9BA 4J98A 2JFLA 4JDKA 5HLNA 5KBRA 2UW4A 2DS1A 4NCTA 4PDPA 3PXKA 4Z16A 1IG1A 2UVXA 2Y6MA 2XNMA 3MIAA 1PF8A 4JX3A 4QMSA 3SQQA 3UG1A 2CKPA 2Z7RA 4RWIA 5ETCA 4DG2E 3O17A 2IWIA 4GT4A 3D9VA 2P55A 1H28A 3NUNA 5HE0A 1U54B 3B8QA 4YURA 4ZZNA 3ZO2A 3PZHA 3TTIA 5HCXA 4K11A 3RNYA 3EFWA 4QTDA 2OJGA 5HOAA 3U9CA 2HW6A 3FL5A 4C35A 3QCQA 4IJ9A 4J8MA 3W18A 4PMMA 4XYFA 5JEBA 4FTQA 2JDVA 3GGFA 4IB3A 2O65A 3BWFA 4AGUA 3N4UA 1SNUA 2VO0A 3FQHA 4IX5A 3COIA 5TO8A 2V55A 1IEPA 4IFGA 4CSVA 3H9OA 5CT7A 5CS6A 4I93A 2OJ9A 3IO7A 4XLVA 5HO8A 3GOPA 4C37A 1VZOA 5B7VA 5HIEA 4RC3A 1OBGA 3AGMA 4QQJA 2C5VA 4DFUA 1KUTA 3R9NA 3R21A 3LM0A 5HTCA 4Q5EA 5DA3A 3ACJA 3MSSA 5I3RA 1ZYDA 3UVQA 4IWQA 5M55A 3CPCA 4MF1A 3LFSA 5E9EA 4IWPA 1ZOEA 4S2ZA 4M69A 2GQSA 4FL3A 5HLWA 5FD2A 4WSYA 4IQ6A 5HZNA 5IISA 3FZPA 1YOMA 2OJJA 3KMUA 4G34A 4QMMA 2ONLC 4YSMA 3O71A 4GEOA 1M2PA 5TOZA 3FLWA 3O2MA 2C1AA 3MA6A 4GFOA 4BHNA 3TIYA 2WMUA 3KXGA
chains in the Genus database with same CATH superfamily
3LVPA 1XH6A 2Q83A 4ZSEA 4JR3A 4XCUA 2X9EA 3F3VA 5BVOA 3ZZWA 2JDSA 3CY2A 4EL9A 4YLJA 5CSVA 3LFCA 5JQ5A 5CSXA 5GJFA 4IVAA 3LFEA 2GPHA 4OTFA 4X7QA 4AN9A 5I9VA 4DT8A 5F95A 2IVUA 5M57A 4LFIA 4GV1A 5JQ8A 3NVMB 2YWVA 4RX9A 2UZUE 4I94A 5BUEA 2VAGA 2CPKE 2UW8A 3KB7A 5I9WA 1GOLA 2FVDA 5HD7A 3W0RA 5CNOA 2YM8A 4AQKA 4KKEA 1G8SA 4C3RA 1H25A 3DAEA 2I6LA 2WMAA 3KVXA 5BYYA 5DHJA 3NUPA 1JKSA 1PYEA 2YCRA 2YCSA 2NNWB 3QTWA 1M7QA 4AT4A 3GC0A 4JQ8A 3PIZA 5EI8A 3TV4A 3MA3A 4YBJA 4CD0A 4D2TA 4EONA 1DM2A 3IQ7A 4I6QA 1SNXA 5CU2A 3QX2A 1H1SA 3R9OA 3S1HA 3TDVA 5EOBA 3H30A 4X2JA 5E8XA 3VNTA 5LMKC 4FYNA 1UNLA 2J5EA 4A4XA 4RFZA 4KBAA 4FUYA 2JAMA 5A4EA 3HMOA 3VHEA 1G5SA 2IVSA 4OTQA 5I9ZA 3LJ1A 5LCJA 2GCDA 4XV2A 2JBPA 1J7LA 3V04A 5BMMA 3R1YA 4AOTA 4I6FA 4FT7A 4XG9A 4KUJA 3ORTA 2JD5A 2QHMA 5IDNA 5AEPA 4L68A 3FLNC 4YHTA 2WIPA 2ZV9A 3ROCA 4EWHA 4ZIMA 5KMJA 3T3UA 2ETKA 4FV7A 1XO2B 4FL2A 4HGEA 5EHLA 3SRVB 4FRFA 3T9TA 4NFNA 3TG1A 4L7SA 5FGKA 1U4DA 2XJ0A 5K3YA 2I1MA 4O2ZA 4WUAA 4UMQA 3ULIA 4EOKA 5EDPA 1Y6BA 2Y4PA 4KRDA 4ZSJA 2IO6A 3NIZA 3BU5A 3Q9XA 4U45A 4KSQA 5J7HA 4C4HA 3LLAA 3S00A 4AOIA 2UW5A 4E3CA 3NFFB 4FEWA 4S30A 2OZAB 5AADA 2OICA 4F1MA 2EXEA 2JKKA 3V5TA 5AP0A 3ZRLA 2C69A 1UWJA 3MY5A 3R7UA 4M14A 3PJ3A 4JL9A 5HNGA 4DEAA 4YHJA 2FSOX 3L8XA 3ATSA 5K4IA 4DN5A 4MCVA 2ITOA 5EI6A 5EK7A 1JWHA 3HECA 1R3CA 1KSWA 2WU7A 5CLPA 2R3MA 3BBTB 3UYTA 3A4OX 5IH4A 4B9DA 5HIDA 3HVCA 2YERA 2CN5A 3U9NA 4AUAA 1DI9A 1OB3A 1YRPA 3FMNA 4BDIA 4BL1A 3QA8A 3U4UA 4RZWA 3UNJA 4FV3A 2WMBA 3WZJA 3ZRKA 3C4CA 4L9IA 4BZDA 2R3RA 4D0WA 4GW8A 4DH3A 3LFAA 3PXZA 1PMEA 2AUHA 5DG5A 5DI1A 3P23A 4BCQA 2BPMA 5A4CA 4LRJA 5KMLA 1J3HA 3DT1A 2J6MA 1YWRA 3H9RA 3PP1A 2QR7A 3TCPA 4CMUA 4H58A 2OH0E 4A9RA 3EQDA 2V22A 3D7TA 2GU8A 5EOLA 4PP9A 4AXFA 3UNKA 4IAZA 4YJOA 4FIGA 5E8VA 3Q2JA 1P4OA 3NDMA 2CNUA 3AD5A 2BILB 2GDOA 3K5VA 4R5SA 4BDFA 3UO5A 3IGOA 4QEBA 4XP3A 4PTGA 1PXIA 3V5QA 2ITYA 1UVRA 4QP6A 3FLQA 5AMNA 4AZWA 3ML1A 4U79A 5AAEA 4BGGA 4I5CA 4USDA 4EH3A 4G1WA 4FX3A 4RJ3A 2X0QA 1IRKA 3QHWA 3G0FA 2VTRA 4G3CA 3VBXA 3G6HA 4F9BA 3EFJA 4KKHA 2GNGA 4FKRA 4NCTC 4TY1A 5GHVA 4BY9E 4NIFA 4AZFA 2C3JA 3AKLA 5F94A 2BZJA 3UVPA 1CTPE 5HEZA 4J71A 4BF2A 3R7GA 5AM6A 5CU4A 1L8TA 3PY0A 2X0GA 3OP5A 3UZTA 1FPUA 1PMVA 4XUFA 4Z9LA 4GRBA 2OGVA 4FA2A 4BJJB 3QQUA 3SW7A 4HYHA 5CEKA 4RWKA 1W98A 1PMNA 2WNTA 2F7ZE 2NO3A 3HA8A 4EQMA 3NFGB 4X21A 4DDIA 5M08A 3DJ5A 5GIOE 4HPTE 5C9CA 4CYIA 3TIZA 3GOKA 3E8EA 3HUCA 2E9OA 4O6LA 3RJCA 2B53A 2C6MA 3FYJX 3TXOA 4CFVA 5CI7A 3KF4A 2BTSA 1URCA 2VU3A 5EYDA 5CAUA 3GCPA 3KKVA 3MESA 3NS9A 2C5YA 2VWVA 5KMMA 3BE9A 2X2MA 3A7FA 3KL8A 4QMTA 3FMEA 4QYGA 5M4FA 2XKDA 2VTNA 5JFWA 4O0XA 2EXCX 2HWPA 2A19B 2FYSA 3HMPA 4UZHA 5JGAA 4P90A 3NNVA 3UYSA 4JMQA 4JDHA 3G6GA 2BIKB 3ZO3A 3C13A 2QC6A 4CZYB 3PE2A 1H07A 4RWJA 4MKCA 2WEIA 3HAVA 3E5AA 3FC2A 3IW4A 3QTSA 4MYGA 2WMQA 3R71A 4WOVA 4USFA 2B9FA 1Y8YA 3FQSA 3LAUA 5IQHA 4FG8A 1OKYA 2PVJA 1G3NA 3WIGA 2PY3A 3R9RA 1YXVA 4XMOA 5AUZA 4AOJA 5CAPA 5AWMA 3TWJA 4QPAA 3SVVA 2VUWA 2UUEA 2ZM3A 3PJ2A 5IPJA 3HMIA 5KE0A 2CLXA 4TPTA 1U54A 3P08A 2EVAA 4DBXA 2XUUA 4U9AA 3BEGA 3CEKA 4G9CA 3FZOA 3DGKA 4YJRA 5EKOA 4YJSA 4TYEA 4WD5A 2A0CX 1ATPE 3JYAA 3MFTA 5HI2A 4C4GA 2ETMA 2XCHA 3ZC5A 3NUSA 5JFSA 4R1YA 3NUUA 3HRCA 3E7OA 2XNOA 2BUJA 2VX3A 4IFCA 3FWQA 1UV5A 3EZRA 3ODZX 3QZGA 4BDBA 4CMTA 4EOIA 3CE3A 3VBTA 4MBLA 5C1QB 3KVWA 4G2FA 4NSTA 3W33A 2J2IB 2GMXA 3FC1X 4GT3A 3DV3A 3E63A 3SX9A 2G9XA 4MUQA 2WMWA 3NGAA 1BMKA 1DI8A 2VWZA 4WKQA 3E7VA 1Q24A 2VWIA 3PRFA 5HHWA 4BGQA 3QCYA 4XG7A 3VBWA 5C8NA 3PFQA 3WE4A 2GQRA 4AZTA 4MXZA 3RAWA 4FZ6A 5FDPA 4Z3VA 2BFXA 2WMXA 3QD2B 3KC3A 4LRKA 4BDEA 4YJUA 4F0IA 3VRYA 4DHIB 3H0YA 4DLJA 1GIIA 2OWBA 1BYGA 3GU6A 3NYVA 3OZ6A 4U40A 5JSMA 3U51A 1L3RE 4GU6A 4MHAA 3TYKA 3W8LA 1M17A 4EOMA 2C4GA 4IC7A 3P86A 3FI2A 2W4JA 5AR4A 4ANMA 2WQNA 5KZIA 4BICA 2H34A 3OHTA 3KCKA 4WO5A 4BZNA 2XF0A 2XNEA 3F3WA 5ANEA 4JQEA 5JGBA 4JIAA 1ZY5A 1X8BA 2WKMA 4J53A 4EBWA 5A9UA 2QKWB 5AJQA 3A60A 2Y4IC 3PPJA 2UW0A 2DUVA 3DK6A 3PSBA 3GFEA 5F4NA 3VS0A 4F9AA 4HGTA 2RG6A 2VTJA 1TVOA 1ZWSA 1AD5A 3OW4A 4M3QA 5EW3A 1UKIA 4W8DA 3RM7A 3QRUA 4QP8A 3CQEA 3KRLA 5G1XA 2F7XE 3OOMA 2YIWA 4KB8A 3DFCB 2REIA 3FHRA 3II5A 3ETAA 4JG7A 3RHXA 3OTUA 4BCNA 4BKYA 3MS9A 3P4KA 5K5XA 3R83A 2C1BA 3ZDIA 3HDMA 3R00A 4RC4A 4WNPA 4AAAA 4DBNA 4YTFA 5TKDA 5BUJA 5FXRA 4ACMA 1PW2A 4BIBA 3W55A 2JIUA 3EYHA 3GC8A 3UIUA 3KMWA 2XRWA 1LR4A 2P2HA 4E8AA 4O2PA 5F20A 3ZXZA 3KXNA 2XNGA 3ZFYA 4X2GA 3PWDA 3BQCA 2XYUA 4K77A 4CFFA 3OMVA 3SXFA 3MB6A 5E8WA 3OC1A 3MH1A 3PIYA 4TYJA 4E4XA 3RK5A 2E2BA 4HYUA 4I5HA 5T3QA 4OW8A 3IOKA 3MIYA 3AT3A 5A54A 2Z8CA 3IGGA 3MH3A 5HIBA 3FXZA 4F6UA 3D4QA 3PLAE 3HX4A 4ZLOA 5BUIA 4F7JA 3GQLA 4EH8A 4FJVA 4LV5A 1JSUA 4PNKA 4U41A 4XRLA 2AC3A 4AX8A 5EW8A 2XJ1A 4EH4A 3VBQA 4ACCA 2PMLX 2JGZA 2BRGA 2YLEA 3OROA 4FODA 1KV1A 4AW1A 4O21A 3DB6A 4CV9A 2XYNA 3FE3A 3NIEA 2PVRA 2J0KA 4XG6A 4MNFA 3SRVA 3QLFA 3V01A 2XH5A 2YISA 2H96A 4W4YA 2G1TA 3R01A 1HOWA 4RVTA 3PLSA 1XWSA 4XP0A 1J7UA 3TV7A 2NYAA 4II5A 1NVSA 3FZ1A 4IVBA 2OZOA 5C4LA 3PSDA 1PXJA 1TQPA 4QP3A 4AAYA 2UZVA 2OXYA 4IX6A 1ZYJA 3N9XA 3NCGA 3FHIA 3QALE 4NW6A 4YP8A 1H8FA 4H05A 2JKQA 2OZAA 4H3BA 4D28A 5I9YA 3FSKA 4RVKA 5IUHA 4BCMA 4GYGA 5BMSA 1W0XC 1W82A 3CD8A 3P1AA 1XBBA 3RAKA 3RM6A 4PDSA 4D2PA 4GCJA 4EOOA 5I4NA 4FKSA 4EK6A 4RPVA 5LARA 2R3QA 4CG8A 4R7BA 4W4WA 3EQRA 2QKRA 1JOWB 4X0MA 2R3JA 1JSTA 3E3BX 2UV2A 4G3DA 3OWLA 3RNIA 3VC4A 3NAXA 4JOAA 3DDQA 3PA4A 4O7NA 2QCSA 4RJ4A 4GVJA 1NY3A 3EN6A 4C4IA 5CF8A 4TYHB 3QQGA 3WZUA 5FUTA 5KCVA 2G2IA 4HPUE 4Y8DA 5BPYA 2Q0BA 3MY0A 2J0LA 3LFDA 4GK3A 4QYEA 2IZTA 3EQCA 3MW1A 3PJ8A 2E9NA 2QO9A 3MFSA 3TUCA 5CEIA 4I6LA 4CFWA 4BDGA 2ZB1A 4QO9A 1OZ1A 4NKAA 1E1VA 2RSVA 2UZTA 3IDPA 1MP8A 3LJ0A 2I40A 4IJPA 4GU9A 4QMOA 4AA5A 2ZV8A 4I24A 3BGZA 4NEUA 4PL3A 4O38A 4UMUA 4HNIA 3VS7A 4ZY6A 2JKOA 2W1ZA 3HV4A 2HY0A 3IECA 1V0OA 3QL8A 3D15A 5H3QA 5T68A 1PXKA 4FZFB 3O23A 5IKWA 3MPAA 3VS2A 3TM0A 4Y5QA 4IW0A 2R3IA 4LQMA 3PY3A 4NW5A 2GQGA 3SKCA 4FSYA 1APME 5A6NA 5B2LA 3OD6X 3CTQA 4FK6A 5EH0A 1J1BA 3ULZA 4CTCA 3WZDA 5FXQA 2J50A 4PF4A 4TWOA 5KMOA 2VZ6A 4JXFA 3EQBA 5K0XA 4DHZA 5HCYA 3WE8A 1CDKA 2VRXA 2Y4IB 4G3FA 4F0GA 4UMPA 3FZRA 4E6AA 4LYNA 2BTRA 4JDIA 5CZHA 4TYIA 3LKMA 4BJJA 4KAOA 4O0YA 4OAVB 5CF4A 3RAIA 2Y9QA 3BKBA 2QQ7A 3C4ZA 4I0TA 3W10A 3ZCLA 4NUSA 4QMQA 5GZAA 1ZMWA 1GZ8A 3DBCA 4FIIA 5DIAA 4O81A 4BDJA 2XBAA 4RC2A 3F5UA 3QRIA 3QZFA 4XV3A 3GNIB 4G6LA 3D83A 2PSQA 2W7XA 3D14A 3OXZA 5AIRA 1RE8A 3E88A 2YIRA 4QPSA 4D2RA 2IW6A 4MWHA 2YIXA 3A7GA 1SVHA 4H3PA 1Q8WA 3O96A 3L8VA 3TNPC 4C0TA 2YEXA 3FSFA 4EH6A 3F5PA 3FZSA 2YM7A 5T6KA 4UWCA 4DE4A 4GSBA 5CQUA 5AUWA 5I9UA 2BRMA 4GFMA 3UQGA 2QG5A 3ET7A 2FUMA 3VUTA 4DCAA 2B1PA 2QG7A 3PE1A 2UZOA 4FSNA 4QMVA 5IA5A 3DKFA 4D4RA 1WFCA 1OKWA 2QNJA 5IQCA 4E26A 3H3CA 5HCZA 4E20A 5CEPA 4FI1A 4YMJA 4IVDA 3D5VA 3QF9A 3VS1A 3ZXTA 4F9WA 4WNKA 5L4QA 4HVDA 2WXVA 4L3PA 4TYGA 4H39A 5H2UA 1ZY4A 3C1XA 1YHVA 3B8RA 3OEFX 3LFBA 1OUKA 3ZH8A 4MK0A 1JLUE 2P0CA 2XALA 1RJBA 4IIRA 3VUMA 2WQEA 3DZOA 4FV4A 2BDJA 4U3YA 3BYMA 5AR7A 5A14A 5E7RA 3DOGA 3VRZA 1URWA 4DDGA 3LMGA 5AR5A 3BYSA 5FQDC 4MXOA 4JAIA 4OUCA 3KN5A 2ZMDA 3MH0A 4OLIA 2RL5A 3A7HA 2B7AA 4O7SA 2YZLA 4EHZA 2HWOA 2F57A 3TZ7A 3MFRA 2XK9A 2CCIA 3C7QA 2HAKA 2R64A 3ELJA 3I6UA 4NIFB 4WHZA 4RVLA 3POOA 4TN6A 5BYZA 2KTYA 2BZHB 5CENA 2UZWE 3UZPA 1OL6A 2R7IA 4LOQA 2X7OA 3MVHA 4I0RA 5HBJA 3S4QA 4OTHA 4FE2A 3T9IA 3QTUA 3IW7A 4J7BA 4X3FA 1SZMA 3QD0A 3WZEA 3E87A 5DYJA 3QUDA 3MY1A 3AKJA 4ZTLA 3SXRA 3W0OA 1BLXA 4FTCA 4C4EA 4GL9A 5HU3A 3TZ9A 4CRSA 2VTHA 2RFEA 3CPBA 3G9NA 5DRDA 4C7TA 4UEUA 2XKCA 2GHLA 2YZAA 4FSMA 3ZEWA 4QNAA 4X2NA 2E9UA 4YJNA 2WQOA 1RQQA 1M52A 3ZONA 2YFXA 2IPXA 1ZAOA 1P5EA 1REKA 2PZIA 4AA0A 2C0TA 2XB7A 3LJ2A 2R0UA 1O6LA 3DA6A 4JX7A 3A7JA 4ENXA 3G15A 3NMUF 2CKEA 3R63A 3QU0A 2ITPA 1Q8UA 3F61A 3WIKA 3WBLA 3KA0A 4MNEB 4E5WA 4A06A 2P3GX 5E8SA 2YM3A 3RZFA 1BL7A 2BKKA 3CQUA 4FK3A 4DGNA 4BKZA 2B52A 4YUQA 3MTLA 5GZ8A 3PP0A 3EYGA 5LWMA 3IW8A 4C38A 2J7TA 3O50A 4U42A 2PMIA 4CRLA 5DEWA 3BPRA 4YTIA 1XBCA 3JUHA 3SDJA 4DEEA 5J9LA 2BMCA 3WZKA 5CQWA 4G17A 3HV6A 5AIKA 4F9YA 1E9HA 3F2AA 3FLZA 3DAJA 2XNBA 5KKRB 1W2FA 2JLDA 4KWPA 4N57A 2GS6A 4D1SA 3N4TA 4FOCA 4ACHA 4F6WA 2OFUA 3OT3A 4ALUA 5M06A 5E1SA 3AMAA 4JR7A 5E8ZA 1R78A 4IH8A 4K6ZA 3QXPA 4O0UA 1Q3WA 4QMPA 2YIQA 4YZMA 2WTKC 4FKIA 4NZWB 4QDVA 4ZEGA 3EQHA 4OGRA 1Y6AA 4MD8E 4IHPA 2GNJA 2NRUA 2CKQA 4YNOA 3WILA 5LQFA 2YAAA 3O8UA 3FI8A 4FKVA 5BX0A 1H1RA 4PTEA 3R8UA 4F99A 5IQGA 3F3TA 1UNHA 5M4IA 3BHVA 3N4VA 1ERKA 3KXXA 2XRUA 2YJSA 4LUEA 2ZJWA 3U8WA 4CCUA 4ANNA 2W9ZB 3BU6A 4DEIA 1YXXA 4FL1A 2W1CA 3NYOA 4AN2A 3P0MA 3BCEA 3PYYA 1BI7A 3PRIA 1PXMA 3D94A 3BLHA 5D1JA 4GJ3A 4LOOA 3PXRA 4C4FA 4JS8A 3SOAA 4O7LA 3W2OA 3KIOC 1H01A 4EK4A 4B99A 1V0BA 3BBWA 3ORNA 3DAKA 4XJ0A 4FIEA 5ETAA 4OBQA 1H1WA 2WPAA 4YNEA 4FBXA 5E92A 3FZTA 2AQXA 4C57A 2YWPA 3OW3A 3P79A 2WTJA 2ERKA 3WF7A 3P9JA 3ZHPC 4RFMA 4FUXA 4EKLA 3SD0A 4D2VA 4FTTA 4W4VA 2IW9A 4TYHA 3KEXA 4K1BA 1RW8A 4XBUA 4UV0A 3A8XA 2CLQA 1Q3DA 3GCSA 1LEZA 3OCSA 5FEDA 4YLKA 3VQHA 3R0TA 2RKUA 2WEVA 2WMRA 3GU7A 3HRBA 4MQ1A 3R7VA 3OOGA 4EK5A 4JBVA 2PMNX 3LMHA 2VWXA 4CGAA 3OUKA 3TACA 3R28A 2WTCA 4V04A 3ZSIA 4HVHA 4F4PA 4O7WA 1A48A 3LQ8A 2PZPA 2J0MB 3V5LA 2XP2A 4AZVA 4L43A 3W0QA 1SVGA 2VV9A 2HY81 3M11A 5DBXA 5FLFA 4E5BA 1E1XA 4O1PA 4S34A 4TL0A 4G5PA 4FOBA 4W4XA 2BAJA 2OI4X 3GUBA 4GFGA 2ZOQA 4TTHB 3W1FA 5B0XA 4BCOA 2VWWA 2XM9A 4D1XA 3PXYA 4KBKA 2QLQA 4J1RA 3LZBA 2W1IA 2OO8X 1FMOE 2WB8A 4GK2A 2VTQA 4DGLC 4GH2A 5AP6A 5LJJA 5CT0A 3NEWA 4LOPA 1ST0A 2HZNA 1IAJA 1YHSA 3ZOSA 2PVFA 3DY7A 3FI4A 4DFXE 4QTCA 3MYGA 3OY3A 3EIDA 4FTUA 4EHGA 4KABA 2W1FA 3TNQB 4ANLA 4DH5A 3OBJA 5HVYA 3ZTXA 4XEYA 3P7CA 4AFEA 2CHLA 3UDZA 5TT7A 4FT9A 4IVCA 4CT1A 4M12A 4R78A 4CLJA 4RIWB 3EWHA 3Q6UA 4K9YA 1H0VA 1XQZA 2OXDA 3DKOA 2W4KA 4BHZA 4C34A 1NXKA 5HICA 2HENA 2BKZA 3IW5A 1B39A 3MVLA 2VNWA 1FBNA 4YGAA 1XH8A 2QOIA 3UDTA 4ITIA 2C0OA 4Q9ZA 4FZDB 3BQRA 4ZAUA 1IR3A 3HP2A 2WMVA 3HA6A 5HNBA 2JKMA 4RFYA 4FIFA 4QQ5A 3MN3A 3VHKA 3ZFMA 2RFSA 3BEAA 4FKTA 3R22A 4L45A 4W9WA 3RCJA 4A9TA 3C51A 4BWXA 4BI2A 4X3FC 3D2KA 1GNGA 2OJFE 2X8DA 1CKJA 2XEYA 4K0YA 3P5JC 3FMKA 3SAYA 2WTKB 3OTVA 3AXWA 4NU1A 3FV8A 2XCKA 1W2DA 2OK1A 3EN5A 2NPQA 3BGQA 2QOOA 3OWKA 4U6RA 3UZRA 4IM0A 4R3RA 4DFLA 1FQ1B 4EI4A 3Q04A 5AP4A 3ZSHA 2G15A 4GG5A 4BDAA 2HXQA 3AMYA 3LE6A 3F3ZA 2OIQA 3ORPA 2PUNA 1WBVA 3WOWA 3MPMA 3U6JA 2PK9A 3LPBA 4A9YA 3PG3A 5D7AA 3RWQA 4YTCA 4O4DA 4FVPA 5CY3A 5EM5A 4MBIA 5E8TA 4A07A 2C3LA 2J4ZA 3DTCA 4EEVA 4CKJA 5M07A 1VLRA 3UO6A 2HZIA 1LEWA 1XH9A 1MQBA 4D0XA 4F1TA 3CXWA 4MQ2A 4M66A 4E4MA 1ST4A 4O7YA 5L8LA 3FKOA 2IF8A 4UXLA 3POZA 4FV6A 3L9NA 4LM5A 4RWLA 3VAPA 4DFNA 4ENYA 3RKBA 4A9SA 5H8GA 4RA5A 1OM1A 5FP5A 2Z2WA 5D7VA 5ANGA 4ITHA 4M7IA 3DBFA 3EZVA 3PIXA 4FYOA 3VUIA 4D2WA 2NRYA 4I92A 3D5WA 2F9GA 4B0GA 4PUZA 3ZLWA 1Q61A 2VWUA 5BVEA 3RTPA 2WQBA 4ORKA 1Z5MA 1JVPP 1R0EA 2ZDTA 3RINA 5DPVA 5HQ0A 4YC8A 4E6QA 3AC3A 5EG3A 2X8IA 4ZSAA 5ETIA 3P7AA 4WBOA 4R3CA 3OY1A 4DC2A 3UODA 4MXAA 1UU9A 1WBTA 3OEZA 4O0VA 3MVMA 4X3JA 3TL8A 2UZNA 1WVXA 4FSTA 4QP9A 5EM8A 5L6WL 1FMKA 3UJGA 1ZZLA 2WD1A 3C4EA 3HLLA 5CSHA 4C3FA 4FSZA 2CSNA 3GCQA 1DS5A 3VS6A 4E73A 4O84A 3F5GA 1FVRA 4QD6A 3AC1A 4FTNA 4EZ7A 5LVPA 4IB0A 3EH9A 5DT3A 3DLSA 2ZYBA 4EKKA 2A27A 4Y5HA 5C03A 3DK7A 5CEOA 5EFQA 4DEHA 4KIPA 3QTRA 3UPXA 4OTRA 4P4CA 4M68A 4E93A 1U46A 1U5QA 1GIHA 1W7HA 4HZRA 3U6IA 4CYJA 4R6VA 3CBLA 2NP8A 3VS5A 4MNEA 1JKLA 2PVKA 2WU6A 4IX4A 3W8QA 1GAGA 5AX3A 5J87A 2YN8A 4IBMA 4RMZA 5B2MA 1YXTA 5M44A 4QT1A 5AP7A 3UC4A 3G51A 3TEIA 2JFMA 4AE9A 4O4CA 4I6BA 3ENMA 4C4JA 4P2KA 4FSRA 4BTJA 4X6RA 4APCA 4BCPA 4BDCA 3ORMA 2YJRA 3FJQE 1PRYA 2QOBA 3GVUA 3MDYA 5AA8A 3LLTA 3AC8A 4XG4A 1I09A 3Q4UA 5IQAA 4BFMA 3NW5A 1WBSA 1WZYA 3MV5A 3OG7A 4W8EA 4HZSA 1K2PA 2X39A 5DOSA 4NL0A 4M67A 1Z57A 4MD7E 4PL5A 4D4SA 5BVNA 2XAMA 4CZTA 5AFVA 5DLSA 3D2IA 4G6NA 3FY0A 4BIEA 3P78A 2C6LA 2CNQA 2Z7QA 3DKCA 2JDTA 1MRUA 1R0PA 3L8PA 4NM3A 4ERKA 4U8ZA 1B6CB 1UU3A 3ORIA 2X8EA 4DGOA 2ACXA 1JAMA 3D5XA 4RA4A 3V8WA 4IM2A 1ZYLA 4YC6A 3TNWA 3ZYAA 3MBLA 5FXSA 3BIZA 4BGHA 3NYNA 4W9XA 1OECA 2C5NA 4DG3E 4HVIA 2HW7A 4Y85A 4PWNA 2W96B 4F64A 4Y72A 1H4LA 1KOAA 3PPKA 4G16A 4C62A 5HBEA 5EDQA 4J8NA 2ZVAA 2HELA 3CY3A 3K2LA 4X3FB 5FBOA 2Z60A 1JPAA 1Q41A 3EFLA 3MGYA 3QUEA 4F08A 4I5MA 3SHEA 3EN4A 3IKAA 3A99A 3M2WA 3R7IA 1OIRA 1BUHA 4FKJA 4V05A 5DR6A 5HKMA 4MXXA 1QPJA 5E1EA 4FV1A 3R8MA 4H36A 4IAAA 1G8KA 4AZEA 4WRSA 2GNFA 5AV0A 4C61A 3K3JA 3R9DA 2EB3A 3NLBA 3OWJA 4LGHA 3VN9A 3ZO4A 5D12A 4BYJA 3LM5A 3QTIA 4BB4A 4D2SA 2ZV2A 1YDTE 4CKIA 3GCUA 5AUYA 4FMQA 4DAWA 4OTGA 2PYWA 2XKFA 2BRNA 5EYCA 3TJCA 2R0IA 1HCLA 2HXLA 5J5SA 4R3PA 2F49A 5AP3A 3HMNA 4CT2A 3NW7A 5L8KA 4R77A 4QMXA 3QZIA 4RIXB 4UX9A 5IQBA 1MUOA 4GK4A 2XNPA 1VYWA 2OIDA 4I6HA 2PUPA 5CASA 3M1SA 1NVRA 3ID6C 4EC9A 3U54A 2XA4A 2HIWA 4U43A 5A4TA 1W8CA 1PXLA 3NNWA 5TR6A 3GENA 3HUBA 4ZJIA 2EUFB 3W0SA 4E6DA 5BVKA 4NTSA 1KE9A 2C3KA 3K3IA 4NH1A 5CU0A 4HJOA 1XH4A 4RQKA 3KXHA 2EWAA 4AS0A 3HL7A 2F7EE 2WMTA 3DKGA 3GXLA 2X6DA 4IC8A 2CNVA 3BL7A 3CKXA 1Z9XA 2WZJA 3I0QA 3DU8A 4YJPA 5IQIA 1H26A 5L6PA 5IDPA 5LOHA 3UQCA 1UWHA 3MWUA 2IZSA 5KO1A 4J99A 4R5YA 4FTIA 5L6OA 4D4YA 4L6QA 2HK5A 3PXFA 2VGPA 1VYZA 2XIKA 3NNXA 4JBOA 5CYIA 2PVLA 5AP1A 4BR3A 4CG9A 2PULA 3EFKA 4YHFA 3V5WA 2BRHA 2ZV7A 4QDEA 3QD3A 4L52A 4FTKA 2GHGA 4M84A 2QOQA 5KUPA 5AUTA 4IX3A 2B0QA 1V1KA 2UVZA 5DVRA 2C0IA 4WG4A 2GS7A 4Q9SA 5CVHA 3HAMA 1NT2A 3ZUUA 4C8BA 3EN7A 4UB7A 2B9JA 4DG0E 4PPAA 4YZBA 3NWWA 5DNRA 4JT3A 5JMSA 2BHEA 5CTPA 2CCHA 4FV0A 1XMMA 3V8SA 2R3OA 1KE5A 3KRWA 2JIIA 4H1MA 3RPSA 3LXLA 3THBA 2QO7A 2V7OA 2VTOA 4F1OA 1PKDA 3VUHA 3ZDUA 4R7HA 4D5HA 1OPJA 3W0MA 3BX5A 5E91A 4D9UA 2RGPA 4RIWA 4L3LA 1H24A 2OG8A 5B2KA 2BRBA 5HX6A 2XK8A 3S0OA 2R3PA 2Y7JA