2IVVA

Crystal structure of phosphorylated ret tyrosine kinase domain complexed with the inhibitor pp1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
312
structure length
282
Chain Sequence
GPLSLSVDAFKIKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRLTMGDLISFAWQISQGMQYLAEMSLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET PRECURSO
publication title Structure and chemical inhibition of the RET tyrosine kinase domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 282
sequence length 312
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ivvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ivvA01
5HBJA 1BYGA 3A7HA 2EVAA 2YJSA 1LR4A 2IW8A 4S32A 4RWIA 4DEDA 5L8LA 2EXEA 4U97A 4EH6A 4XLVA 2R3HA 2JBOA 5DHJA 5K0KA 3R83A 4BRXA 2OF4A 2VWUA 2JDRA 1BKXA 2ITZA 3PZEA 3UOJA 1YW2A 4CMOA 5CASA 4FKJA 4RIOA 1IG1A 2UZOA 3OHTA 2H9VA 1FBNA 4AE9A 3HMNA 3RAKA 4EHEA 1R1WA 4EWQA 2QO2A 3CQWA 1EH4A 5AX3A 4F1TA 1WBVA 3DLZA 1QPJA 1Q99A 3S1HA 5CQWA 3L9NA 3ZDUA 3LCTA 2OSCA 4MNEB 5DR6A 4MNEA 5D9HA 1GNGA 3GCQA 4J1RA 2VX0A 4W4YA 5HX8A 4O84A 4O7SA 3GU5A 5IQGA 3O8TA 3PE2A 4HCTA 2HW6A 4BFMA 4XG9A 4DGLC 3R30A 1H0VA 1AGWA 4OTDA 3ZH8A 3ZM4A 3R1YA 2VWZA 2PVJA 2WMUA 3MFTA 3TKUA 4N0SA 3F5XA 3F7WA 3LM5A 3UMXA 2UV2A 3LMGA 5AIKA 4GL9A 5HKMA 4C8BA 3NNXA 1NXKA 4O27B 4L46A 1ZARA 4EI4A 4GJ2A 5M09A 3R9HA 4I22A 2GDOA 3R8UA 2C3KA 3PG3A 2QOQA 3E93A 3E88A 4U8ZA 4F09A 4JAJA 1A9UA 3KEXA 1H01A 4RC2A 5CVGA 1XBCA 3RGFA 3ZFYA 5AEPA 1YDRE 3AXWA 5CANA 4TW9A 1WVWA 2VTRA 3KXMA 4AW1A 3S2PA 4MBLA 1PJKA 2YIYA 3Q9YA 5KCVA 4JG8A 4GRBA 4L01A 5JK3A 5LOHA 1JAMA 4G34A 3BKBA 5C4LA 5ANIA 5IH4A 2ERKA 4KAOA 5CEOA 2GNJA 1MUOA 3LXNA 3NW7A 5IUIA 3W55A 3ORKA 3D5VA 3DXNA 4QMPA 4AFEA 3E7VA 3O71A 4E4XA 4JRNA 5C8KA 4RWJA 2W7XA 2YA9A 3RNYA 3ATSA 4UN0C 1ZYLA 4WOVA 4PUZA 2B52A 3NUPA 3RZFA 1WFCA 4EOSA 1UWHA 3RZBA 3MA6A 1PXJA 4NCTA 4WBOA 5CAPA 4CG8A 3UVRA 4EUTA 2XM9A 4ZS0A 2A4LA 2ETMA 5IA3A 5M4CA 3W2OA 2BRGA 2PZIA 3BPRA 3IGOA 2UZLA 2XP2A 3BZ3A 4ENXA 4BZOA 4QQJA 5FBNC 2FUMA 3ZSIA 3DZOA 1Q24A 4ZP5A 5HIBA 4RIYB 3TCPA 2PMLX 3NYXA 4WUAA 3UC3A 4H05A 5FXQA 1DM2A 1WBSA 3F5PA 3L8PA 4DEAA 4DBXA 2R3QA 2PMNX 3F66A 4ALUA 4XOYA 4RJ3A 3ZYAA 2IJMA 4N4SA 3NLBA 4FGRA 2GNIA 3R6XA 3CSVA 2JDTA 4PMTA 5AV4A 3F6XA 4YJNA 1PW2A 1PMUA 4ZY4A 3ZLWA 2IZRA 2JD5A 2XIXA 4R7BA 2C6MA 2BALA 3EN6A 4A7CA 2H6DA 3BEAA 2WTCA 3QZHA 4M66A 2B0QA 1GOLA 2YN8A 3C9WA 3FXXA 3QQLA 4WA9A 3AC8A 5ETFA 3Q60A 5BUIA 2X7FA 2PMOX 2XKCA 2V62A 3JPVA 3MYGA 3R2YA 4QPSA 4AGUA 4APCA 2BZJA 4B6LA 5IEXA 5EI6A 2HIWA 3WF9A 2AC5A 2VX3A 4G9RA 4ENYA 2V5QA 3FC2A 3MBLA 2VX1A 3MIAA 3NNUA 4BYJA 3FI2A 3IO7A 3PWYA 4M13A 2GS7A 3FQSA 5AR5A 4EQMA 4FKLA 2JKQA 5K0XA 3QTZA 1JLUE 3DB6A 3UODA 3MSSA 5A6OA 2OJ9A 4RBLA 3BBWA 1CMKE 2YIQA 4IXPA 2PUNA 2EB2A 2X8IA 5EOBA 1TQMA 4YLLA 1UU7A 3WF7A 3BWJA 5ETAA 2RFEA 2OO8X 3RHXA 2C6KA 2E2BA 1QPDA 2VGPA 1REJA 3GCSA 3NUNA 1O6LA 3Q9XA 4QTBA 2Y4IB 3R8MA 3I0OA 2CDZA 3ODYX 4GS6A 3WBLA 4GVAA 2RGPA 3P23A 4YHTA 4L3LA 4HNFA 4CXAA 2QD9A 1P4OA 2F2UA 2GPHA 4UYNA 3PP1A 4USEA 1E1VA 4NTTA 3N4VA 3NCGA 4RA5A 5HORA 2BAQA 3E3BX 4J99A 5L6OA 5DT4A 4LGGA 3C4FA 4HVDA 4IBMA 5FXRA 4DTKA 4RJ7A 4PNKA 5FTOA 4EOPA 5D7AA 3B8QA 3N51A 1GIHA 1J1BA 4AX8A 2ACXA 3QYZA 2G15A 5CALA 2I0EA 5EI8A 3VHKA 3R9RA 4JDJA 2FSTX 4CV9A 3E62A 3FDNA 3HAMA 3MJ2A 1VEBA 3BHVA 4FBXA 4FV7A 3ZLYA 2QKWB 3GEQA 4EJNA 5CAUA 1YHWA 3TUCA 4KIKB 3BHHA 4FEVA 2VTSA 2XA4A 3NAXA 4X2GA 4AZFA 3BE2A 4M0ZA 1J1CA 3ATTA 4G9CA 5H9BA 4G5PA 4UWBA 1OUKA 4PL4A 1UA2A 2QOLA 4JX3A 2PVYA 3O23A 2XKEA 3DCVA 4FOBA 2YM3A 4XP3A 5AV1A 3WF6A 3BGZA 3VWAA 1XH6A 1MRVA 4ERWA 1J7UA 3LKMA 3RWPA 2HOGA 4IWOA 5CSWA 4CFWA 5LCKA 4LL0A 2NRUA 4OGRA 3FUPA 2CLQA 3H9RA 4EH5A 4XG6A 3U6HA 4CSVA 2OXXA 2EWAA 3KXHA 5JKGA 4PTEA 4AGCA 1PYEA 4O91A 4EK6A 4I4EA 2B9JA 4C4FA 1KV1A 4AUAA 5AUZA 3HRFA 1MRUA 5HLNA 5AR4A 5JQ5A 3I6WA 4KKGA 4XRJA 3C4ZA 3WZJA 5CF5A 2PYWA 4BIEA 2J5EA 4IX4A 5FM2A 5EHYA 4B99A 2I1MA 4G6LA 4IAFA 5HVJA 3ZCLA 1OKVA 4X2FA 3CS9A 3QUEA 3KVXA 4QMSA 4WNPA 5E8YA 3QRUA 5ANKA 4CCBA 3ID6C 4J71A 4O0VA 4NJDA 4IAIA 4C4JA 3MPMA 4MXAA 3PUPA 3KRRA 2QQ7A 4FG8A 3ZO4A 5M44A 4FIIA 3FZSA 4QMOA 4DEEA 3KRXA 1NW1A 3K5UA 4O38A 3FZRA 2J0LA 1OL7A 3G9LX 4C4IA 4CTCA 4HVHA 3KVWA 4R7HA 3DTCA 5HU9A 2VTQA 3GU8A 4FTMA 3KRWA 4OBPA 5EOLA 5J8IA 4D2WA 5IH6A 5M4UA 2OXYA 3LFDA 5TF9A 3D5XA 4IVAA 2UVYA 3JY0A 2UW5A 5KZ0A 1J91A 2RG6A 3DAJA 1Q3WA 3FQEA 2OJFE 4FKOA 3TTIA 1H1WA 4AN3A 5HQ0A 3HV5A 2IVUA 3AGLA 5M55A 5F1ZA 3FMEA 3HNGA 4RMZA 4KNBA 2LGCA 3RM6A 2SRCA 2RG5A 2A0CX 3BYMA 3DTWA 4O0WA 4YUQA 2F9GA 2H34A 3RCDA 4XX9A 3LXPA 3R1QA 4XH6A 3SVVA 4TT7A 1PMNA 1PXNA 3FI3A 4CRLA 3VS4A 3EN5A 1Y8YA 3MH1A 2R7IA 3NAYA 3OW4A 5BVNA 2XNGA 3FPQA 5IG1A 3II5A 2DQ7X 4QP4A 1BLXA 3P86A 4LL5A 1IASA 3FBVA 3FY0A 3AD6A 3L9LA 1Y6AA 2J90A 4ONAA 3LLTA 3TNHA 3MTFA 1XJDA 4L44A 4Y5HA 5FBOA 5C03A 3DK6A 3R02A 3UG1A 3ACKA 3ZC6A 1T45A 4FSZA 2WELA 4O21A 3V8TA 4DFYA 4GKIA 3C4EA 2UW6A 1LEWA 2Y4IC 4HGSA 4J95A 4UB7A 4Z9LA 5IA2A 5DH3A 4ZMFA 3FMJA 2FSOX 4FV5A 3L8XA 4HYIA 2JC6A 3FI4A 3K5VA 4QMUA 1K2PA 2J51A 2V7OA 2X6EA 2W1FA 4B4LA 4BR3A 4FSNA 5TO8A 3FV8A 3F3VA 4ALVA 5M53A 5HG8A 4OT5A 2IVTA 3V5TA 5J5TA 4LOOA 3CTQA 2Y4PA 1RE8A 3V01A 1BL7A 5IQCA 1KE5A 4W9WA 4R5SA 3RK9A 2QU6A 4GT4A 4WT6A 4V0GB 4OAVB 3GUBA 4TWOA 4RVMA 4YHFA 4AW0A 4QPMA 2PVKA 4IJPA 1KE8A 4OTFA 4ORKA 3NZ0A 3V04A 2QONA 4IACA 4E6DA 5JGBA 4O96A 2PSQA 3DNEA 4P7EA 3QTWA 3ZSHA 1WBWA 2BRHA 5HVYA 3D7ZA 3RM7A 3PLSA 2UW8A 4L68A 4Y85A 2YZAA 3MDYA 4RFZA 5ETCA 3WOWA 4MH7A 5AP2A 4D2VA 4FF8A 1PXMA 4Y8DA 3HV4A 3UOKA 5DG5A 2XBAA 4JG6A 5F9EA 5HICA 2XNOA 3LCDA 3Q6WA 4I0SA 3S0OA 3TI1A 2QHMA 4AW5A 4BDFA 3OBJA 4D2PA 2E9OA 1FMOE 3GCPA 5EKOA 2QC6A 2Z7SA 4TN6A 5DE2A 1WBTA 2F7XE 1KE9A 2VTIA 3EQPA 5AP5A 4BBMA 2Q0NA 3BQCA 1OIUA 3QCYA 4C61A 3GGFA 4YZMA 5EM8A 3RPRA 4FC0A 4C36A 4NL0A 2GS6A 3UQFA 1URWA 3HP5A 5M56A 4I4FA 4V04A 3GU4A 2VV9A 2XRUA 2Z2WA 1J3HA 3I81A 4I0TA 3TV6A 2UZUE 2W5HA 4UWYA 4DBNA 3U55A 3UNJA 4TRLA 4K2RA 3D2IA 4IH8A 3C50A 1TQPA 4PL3A 3FLZA 2PVLA 3W32A 5DIAA 5M51A 5BPYA 4EYJA 3ZMMA 3A99A 4F1MA 4GYGA 3Q9WA 5J9YA 4BTMA 3QKMA 3O0GA 4F6SA 4P2KA 5IQHA 1ND4A 5FWKK 3R8LA 3HYHA 3CTJA 3BIZA 3PPKA 3RJCA 2R4BA 4KA3A 3KCFA 3K54A 4DLJA 5JT2A 4D4SA 3PDTA 3WYXA 3F88A 3LFEA 4ZLOA 2QLQA 3CP9A 3GQLA 4ANNA 2X4FA 4FIJA 3EMGA 4YJRA 3WIGA 2C1AA 1FOTA 2X0GA 4C02A 4CVAA 3IDBA 2A19B 4FKIA 4HW7A 4YTFA 1AD5A 4QMWA 4H1JA 2I7QA 1I09A 4LRJA 3PJ1A 3G9NA 4FKUA 3ORTA 4OTWA 4M84A 2JBPA 4J53A 3EQFA 5D7VA 3ZZEA 1TKIA 4FV8A 1DI9A 3EB0A 4LOPA 4RWKA 4ALWA 2PVMA 2XF0A 1FGKA 2ZMCA 3HLLA 5CENA 4BB4A 5C8NA 4QP7A 4EBVA 2X2MA 2YITA 2PMIA 5B2LA 4E8AA 4E5AX 2O5KA 3WZUA 1OBGA 4BY9E 2PHKA 2PVFA 4DF3A 2P2IA 2QO7A 2PE2A 3EFKA 4YR8A 1WZYA 4Q5EA 4PL5A 3DJ7A 5HU3A 3TV7A 4I5HA 4KD1A 5D11A 3QU0A 4FG7A 4FNXA 4AT3A 4KBCA 5IU2A 3SQQA 5KBRA 4XJ0A 4C37A 3DV3A 4EOQA 4H3PA 3POOA 4B9DA 2CNQA 4YPSA 2QURA 3FSKA 2DWBA 2ZV8A 3DAKA 2B1PA 5H2UA 4AGWA 4DE4A 4I5CA 1QL6A 4L53A 3QWJA 2VO0A 1R39A 4MCVA 4X3FB 3RKBA 4EOKA 5IEYA 4AA4A 4P5QA 3R01A 4EOJA 4XG8A 4CLJA 4R3RA 1M52A 4UMRA 2JLDA 3TNWA 4DC2A 4E5WA 4FL2A 4L3PA 4QMZA 5IA5A 3TN8A 3VAPA 4Y5QA 3MVLA 2OZOA 3MV5A 4PMPA 1KOAA 2C6DA 3QD4A 2IW6A 5KMJA 4NH1A 5F4NA 4ZSAA 3FLYA 3MIYA 3TNPC 3I5NA 3WF5A 3C1XA 3M2WA 4CGAA 3HRCA 4Z16A 2VD5A 5LMKA 2R3PA 4I6HA 4TYHB 4FKWA 4TYHA 3BWFA 5L2TA 4FA2A 3QLGA 2VAGA 3LFAA 3OFMA 2C5OA 2VN9A 1WMKA 4FT7A 1VR2A 3SC1A 3MGYA 5DFPA 4X3JA 4L67A 3SOCA 3QTIA 4I20A 3QTRA 4IC7A 4MXYA 4ZAUA 4XLIA 3T3UA 4YSJA 1U5QA 1YOLA 3RPSA 4YJVA 4CEGA 4GH2A 3DKCA 4ASDA 2CLXA 2VTJA 2P55A 5I4NA 4DCAA 3EYGA 3NUYA 3KQ7A 5E92A 3UNKA 3VBXA 4D1ZA 2UZTA 4Q9SA 2O0UA 4MF1A 3SDJA 3ZUUA 4QP6A 1F5QA 3ENMA 3MVHA 2I6LA 4I24A 4JRVA 3R8ZA 3WARA 4BL1A 4F6WA 2X8EA 3CC6A 2PULA 5D41A 2B9HA 4ZSGA 5EDPA 5ICPA 4TNBA 5K9IA 4J8MA 4RVLA 4DTBA 3E8EA 4FKTA 4IC8A 4U0IA 3M1SA 3PPJA 1OKWA 3RP9A 4U41A 1Q5KA 3E8DA 3ZO2A 4ACGA 5J9LA 2YERA 4O7WA 4NJ3A 3PJ3A 5GZ9A 4EH9A 4FODA 5IISA 5L3AA 4I94A 1OIRA 2AC3A 4C57A 1YI6A 3KMWA 2X81A 4UMUA 4JIKA 3MVMA 4CKRA 3SA0A 4IVDA 4GFMA 2UW7A 5L2WA 5G6VA 4QMMA 4BHNA 4FSQA 4OT6A 3EKNA 3C4XA 2YWVA 1PMVA 5EDRA 3BGPA 4HZRA 4RC3A 3ULIA 1URCA 2W0JA 4Q2AA 4BI2A 3F5UA 1V0PA 4NM7A 2VWYA 3FC1X 3M42A 3PVWA 3ZUVA 5GNKA 2R3MA 5I9ZA 3PRIA 4TY1A 2PU8A 4CNHA 5CSHA 1Q97A 2LAVA 2C4GA 4O2PA 4FZFB 3NW5A 4LRMA 4E73A 4ERKA 4CTBA 2ZDUA 1ZRZA 5AUVA 3NYNA 4W8EA 5K5NA 4ZZNA 4FTKA 4FTQA 2QO9A 2UZEA 4MYGA 1U4DA 1Q62A 2W4JA 3G0FA 4FKRA 4M14A 4PPAA 4YZNA 5HVKA 4EORA 5FGKA 4XNEA 5EW8A 5BNJA 3CQUA 2BKZA 3ZLXA 3AT3A 3IDCA 4CQGA 1DAYA 4YZDA 4EOIA 3UPZA 3D15A 5C4KA 3FXWA 4GV1A 4RX7A 4UY9A 3VIDA 4J98A 3B8RA 3P08A 1OL6A 2R3LA 1QCFA 3LQ3A 2XKDA 3C0GA 3C51A 4H36A 4DYMA 2ITWA 2ONLA 3BYSA 4M67A 1OKYA 2C6EA 2VTHA 2JIUA 3NIZA 4Z7GA 2FB8A 2HWPA 2BDWA 3HECA 3R71A 5L2IA 1JQHA 4FTNA 4O86A 5KUPA 3PVUA 3R8VA 4C3FA 4HVGA 2HZ0A 2G01A 2PWLA 3UOHA 5BYYA 4BKZA 2QU5A 5H8GA 5CLPA 3DZQA 3NNWA 3IDPA 5CAQA 3R7EA 5AP4A 4A4LA 4NW5A 3QALE 4FE2A 3AC3A 3ZXTA 2XIRA 3O17A 4QYGA 1PHKA 4FL1A 5C27A 3KK9A 4HGLA 3S95A 5IA0A 5E8SA 4H3QA 4C4EA 5LMKC 1H27A 3CLYA 1M7NA 3OCSA 4BI1A 5AUTA 2ITPA 2O3PA 4LGDA 1PXOA 4FI1A 4R5YA 3FMLA 5M4IA 2BIKB 4XV3A 2AUHA 3I79A 4ITIA 1SMHA 3QTXA 3WIKA 3ZEWA 4FV0A 4FKVA 1XWSA 4MD7E 3OEZA 2CSNA 4NIFB 4NEUA 4YC6A 5FLFA 3W16A 4NIFA 3D4QA 5HTCA 1YOJA 4AACA 4YJTA 4W4WA 1K9AA 5JEBA 3KGAA 5ETIA 1I44A 3OEFX 3SW4A 3WE4A 4CMTA 4GKHA 2CGWA 4QT1A 3MPAA 1IAHA 4M15A 4H1MA 1GZ8A 3HMOA 4CZUA 3SXFA 1HOWA 3OCBA 4QNAA 3QC9A 4EEVA 4NZWB 3IQ7A 2BHEA 5ANEA 2RF9A 5I5ZA 4FKGA 3T9TA 4LQMA 5TT7A 2XK8A 1ZAOA 3U6IA 4KKEA 4UMPA 4RJ4A 5AR2A 3MPTA 4F9CA 2XK6A 5HGIA 4Z55A 2VRXA 3MY0A 2Z8CA 3S4QA 3ZRMA 5DWRA 3TL8A 2IW9A 4R7IA 3UOLA 5E91A 5IQDA 2CCHA 3AT4A 2A2AA 2HK5A 4F7JA 3QWKA 2KULA 4XBUA 5CS6A 5IDNA 3EYHA 5GINE 1YI3A 5IKWA 3UIUA 4LG4A 3O7LD 2HZNA 3K3IA 3UTOA 1ATPE 4GCJA 2Z7RA 4O7LA 4XG4A 4WUNA 4X21A 4O7TA 5JZJA 5LVMA 1F3MC 4XV2A 2YM5A 4ANSA 2WB8A 3VUKA 1OUYA 3GNIB 2JEDA 3NYOA 3V6SA 4FV4A 4TYGA 3BLRA 5CSVA 3A60A 3LPBA 4YMJA 1IEPA 2PY3A 3ZRLA 3DY7A 3I6UA 5FDXA 2C6IA 4FZ7A 2C47A 2GHLA 3COIA 2FYSA 3ETAA 3OD6X 4D55A 4FZ6A 5EM5A 4IB3A 3UC4A 1YDSE 3PJCA 5GJGA 2W9ZB 4OTIA 1KE7A 2C30A 4RX9A 1U5RA 2P0CA 3AC1A 4U43A 4EOLA 3HMIA 3EL7A 1V1KA 4IDTA 2XIZA 3KY2A 3VNTA 4TL0A 2GNGA 4BCKA 3BCEA 4IAKA 4ASZA 4EHGA 3EKKA 4GT3A 5J5SA 1SVEA 5KX8A 3QGYA 2JAVA 2WQMA 3KXGA 3Q04A 4Y83A 3ZC5A 4BKJA 3DFCB 1S9JA 2WKMA 4QPAA 2C0TA 4O7YA 2HY0A 4CRSA 4ZZOA 3IG7A 4G2FA 3EHAA 5H3QA 3Q3BA 4GIHA 4LV8A 5KZIA 4FG9A 2I0HA 4ACMA 3CCNA 3V6RA 3IGGA 2VUWA 4RVTA 4Y72A 3PE1A 5I9YA 4O7NA 2IVVA 3EN9A 4CFFA 4AT5A 1YDTE 3PY0A 4CYIA 2VTAA 5CT7A 4C2VA 4IZ5A 2ONLC 2CHLA 3QL8A 4UX9A 3ERKA 3BELA 5E7RA 2RFSA 3EQGA 4O0YA 4GEOA 4D28A 4GUEA 4KBAA 2C0OA 3KFAA 3DB8A 1H1RA 1PMEA 2JIVA 4ZTNA 1H25A 5EYKA 4D5HA 1H8FA 4HVIA 2X7OA 2VTNA 3OC1A 3IONA 3OBGA 3AMAA 2R3RA 4AOIA 3G33A 3DQXA 3CPCA 4U6RA 1Q8YA 3ZLSA 4BIBA 4D9UA 2XYUA 3A2CA 3KCKA 4XP0A 5FD2A 4BDKA 2W05A 1IAJA 2YJRA 5DYJA 1AQ1A 3SXSA 5L2SA 4NW6A 4ACHA 4F0IA 1L8TA 2HXLA 3THBA 2P33A 4BDGA 4RPVA 2YM4A 4ZXTA 1YXXA 3LQ5A 3LCOA 4ZLZA 3VS1A 3R7OA 2XNPA 2Y7JA 4O0RA 4PPBA 4RIYA 4IX5A 3FZ1A 4A9TA 3TG1A 2XK9A 3TKHA 3ZXZA 2ZJWA 4QP8A 2O64A 3RK7A 3QD2B 4EKKA 5AJQA 5M57A 1H24A 4DT9A 4B8LA 2WMTA 4DEBA 3NVMB 4NU1A 3H0ZA 2ZV7A 4BDJA 4AW2A 2H8HA 4X2NA 1PXLA 3DOGA 2PZRA 1Q8ZA 1OPLA 2ZDTA 2Z02A 3P7BA 2WMVA 4RJ5A 3Q4CA 2C3LA 5B7VA 2GU8A 4W9XA 3P1AA 2XZSA 2WMRA 5CEQA 5LMBA 1X8BA 2WGJA 4QMLA 3UZPA 3LFSA 4AF3A 2VZ6A 3AC5A 3Q96A 3W2SA 4KIPA 4ZJVA 4WNKA 2XK7A 1OKZA 3HUCA 4A06A 2UZDA 2NO3A 4APPA 5KMIA 4BI0A 2GTMA 1NVQA 5CYIA 3RVGA 5LQFA 3H30A 4E4NA 4FZAB 3DKFA 4RA4A 2XEYA 4U80A 4E6AA 1FVTA 4ZEGA 5BYZA 1E1XA 2B7AA 3PA3A 4PP7A 4HPTE 5CEKA 2HYYA 3RPOA 2XM8A 2YM8A 4FGBA 3VBQA 4DH1A 3LZBA 3TUBA 4QO9A 3RI1A 4ZY6A 5E8UA 3OZ6A 5LWNA 2OH0E 4FEUA 3OTVA 1OVEA 4E4MA 4AOTA 3TIZA 4ARKA 4DH8A 3A8XA 1GIJA 5I9WA 4TYEA 4ZIMA 5T68A 3JXWA 3FXZA 2ZV9A 3TZ9A 3NYVA 2PPQA 2BVAA 3VS6A 4C38A 4CT2A 2WOUA 2QKRA 3DT1A 1KV2A 3KRJA 3LM0A 3TV4A 4CMUA 1M2RA 3HV6A 2G2IA 1P14A 3R9OA 5M08A 5JGDA 4QQTA 3QX2A 3VS2A 4L9IA 4F99A 4RJ8A 4I6FA 3WYYA 2I0VA 3KMUA 2YM6A 4IB0A 4DFUA 2OZAB 3U4UA 5IMXA 4LRKA 4GMYA 2OZAA 1W84A 2I40A 3HKOA 4M68A 5A9UA 3D9VA 4BC6A 1XQZA 4LOQA 2HXQA 4QNYA 4LMNA 5HBEA 3MESA 4YJPA 1ZYSA 5TOZA 3OF0A 3P7CA 1E9HA 3OWJA 2RFNA 2BIYA 3L8SA 4KIKA 3RTPA 4I92A 2XNNA 1W8CA 5A54A 1JSUA 2C5VA 4DFXE 3MB7A 3R0TA 5HNGA 3ULZA 3GP0A 3GU6A 5KO1A 4HYSA 4CKJA 3QRJA 5EW9A 1P4FA 4X6RA 3LCSA 4O0SA 3CIKA 4JS8A 2RSVA 4DG0E 3MVJA 2WOTA 3R1NA 4JBVA 3V5JA 2R3FA 4PNIA 4PX6A 3ORLA 3O51A 5T6KA 3W8QA 5E8WA 2WHBA 4XRLA 1KE6A 3EN7A 4QOXA 2BAJA 3EFWA 5BVWA 1UU9A 2YIXA 4ACDA 1LEZA 2NP8A 4LYNA 1L3RE 4BDCA 4CFNA 5EYDA 4ZTRA 4QP1A 3C0HA 4HOKA 1OB3A 2ITTA 4DEIA 3N4UA 3HA6A 4HJOA 5E90A 1FVRA 2YAAA 3BV3A 4YLKA 4IZ7A 4D4VA 4M69B 1Q61A 4M69A 3ZO1A 1VZOA 4K8AA 2QR7A 1Y6BA 3G5DA 3RALA 4BCMA 4F1OA 3AOXA 3CKXA 3CGFA 4RVKA 1CKIA 3KA0A 3FQHA 4YPDA 2F7ZE 3ALOA 5AP7A 1OL2A 4RT7A 5DRBA 3V8WA 4I5PA 3ZM9A 3WILA 1G8AA 3EWHA 3OWPA 4RQVA 1CKPA 2DYLA 4QTCA 5LVLA 2WTKB 5DT3A 3Q2JA 3F69A 4YGAA 2VTTA 3FAAA 4G6OA 3CBLA 3PFQA 4QRCA 4ASXA 2REIA 4BDDA 4WSQA 4EYMA 1OZ1A 3R9NA 5KMOA 1XKKA 4OAUC 4O7VA 4PDPA 2R3GA 4I1ZA 5CXHA 2ZMDA 4I0RA 2JKMA 3QQJA 1R3CA 3FE3A 3PXFA 3A4PA 3VVHA 4AAAA 5A4QA 2Q83A 1REKA 3LMIA 2WPAA 3QX4A 4AXAA 4Z7HA 3QTUA 1LPUA 3TZ8A 4IM2A 3ANQA 4LGHA 3VBVA 3IW8A 5AIRA 1DS5A 4BZDA 4F7NA 2C6OA 5HG7A 5IQAA 1Y91A 3IW5A 1ZY4A 4L7SA 4NM3A 4V01A 2JFLA 1PXKA 2ITUA 3DK7A 3E64A 3C5IA 4ZS4A 1ZYDA 1M17A 2YCQA 3KC3A 5GJFA 5ANGA 3FKNA 3V5PA 3HX4A 4DTAA 3DBCA 3D14A 4QTDA 3TJDA 2YM7A 3VS3A 4FIHA 5ACKA 4RWLA 3MFUA 3L9MA 2VNYA 2PUPA 3R22A 1GZKA 4ZTHA 3GENA 3TIYA 3W2CA 5GIPE 4TZRA 2R0UA 4TWNA 4AZVA 1M2PA 3BHYA 5AR3A 4EH7A 3QF9A 4AA5A 4EQCA 3UJGA 4EUUA 2BTRA 4G1WA 4IEBA 5HE0A 3DS6A 4AG8A 4AOJA 5JFXA 1IR3A 3CXWA 1YWNA 3QD3A 4F9WA 4KINA 1OI9A 4NM0A 2RFDA 4JQ7A 4W4XA 4EH2A 3NUSA 5CNOA 4D4RA 3EJ1A 5CTPA 1SNXA 4K33A 4FEXA 3Q4ZA 3MFRA 4IHPA 4ZOGA 3VQHA 3VUGA 5J7HA 5K4JA 3IOPA 3HV7A 4IAYA 4QQCA 4FT3A 4DEGA 2J0JA 4FT0A 2UZWE 4YNEA 1M2QA 2WMSA 4PTGA 3TJCA 4V0GA 4DH5A 3LVPA 3R28A 4XG7A 2G2FA 3OWLA 2Q0BA 3LJ0A 4ANBA 3RNIA 3PP0A 3VF8A 3LXKA 4FV1A 5A4TA 3TZMA 4YP8A 3TEIA 4BICA 4DFNA 4R8QA 3U6JA 1OIYA 3UIXA 1W0XC 4X7QA 5FEDA 3V5LA 3OROA 4U40A 2HWOA 2JKKA 4QMYA 1QPCA 4K9YA 3UYTA 2G2HA 5I9XA 4QTAA 4F4PA 4QMQA 2XBJA 3GXLA 5HE1A 2PVNA 2W1DA 1TQIA 4XV1A 5AV0A 5HCYA 4YSMA 3VUTA 5CEPA 2GSFA 2XJ0A 2GFCA 4IWQA 5J87A 4OTRA 5DVRA 2B9IA 5E8TA 4IW0A 5G1XA 3T8OA 3NW6A 2WEVA 3QRTA 2V7AA 3QZFA 4FK6A 3PXQA 3EFJA 4FYNA 3NMUF 3ZU7A 4BTKA 4AQCA 1KWPA 5C1QB 5A3XA 1QPEA 1U46A 3I7CA 5A46A 2XEZA 4TPTA 4TYIA 2OFVA 4FSTA 4GT5A 5LXMA 2XH5A 4L7FA 4X6QC 4ZSEA 3TNQB 4EOMA 2CKOA 3D94A 1YKRA 2WMBA 3DU8A 4NK9A 4DHFA 2QOIA 4HCUA 4C35A 2R3JA 3CGOA 3KB7A 4FEQA 3FL4A 4MX9A 3OXTA 2YWPA 4BKYA 1PXPA 4HPUE 4JQ8A 3NSZA 4U79A 2UW4A 5I0BA 4BCOA 2F49A 4F0FA 5J1WA 5D12A 2WTKC 2R3OA 3GQIA 3PY1A 3NPCA 3REPA 2XRWA 2YDJA 4WNOA 2C3IB 2VTMA 4BBFA 4E26A 5HCXA 4YNOA 5BQ0A 5AP0A 2X7GA 3E7OA 5EM7A 2OF2A 4F08A 4R3PA 4C34A 3I0QA 3QA0A 4L00A 4AZSA 4N57A 2EXMA 3BX5A 5ACBC 3AQVA 3CD8A 4QYEA 5EQYA 3OW3A 4CD0A 4FTUA 2OBJA 3B2TA 4PTCA 4RLKA 3CY2A 2HAKA 4Y95A 3SGCA 1LP4A 2QG5A 2XIKA 2F2CB 2XK4A 3FMNA 2IWIA 3GFEA 3NUXA 1WAKA 4O2ZA 4RRVA 5AA8A 3VS7A 3CJFA 2Z60A 3QQHA 5M06A 3F7ZA 1PXIA 3LIJA 3W2QA 3NX8A 4D0XA 3UVQA 5E8ZA 2BZKB 2W1EA 3FYJX 4DFBA 3BU3A 4BCGA 2WNTA 2GHMA 2W1IA 5C01A 4FL3A 3C4WA 3OT8A 4NYEA 1XBAA 4EC9A 4HGEA 3DBDA 3R7GA 4K18A 3G6HA 4R1YA 4X3FA 4NKAA 4DEHA 3R63A 4PDSA 5EFQA 4FX3A 4RLLA 1YHSA 3E8CA 1YI4A 2OH4A 3VULA 2QOCA 1H28A 5AAEA 5AM7A 4AA0A 1APME 3C7QA 2OGVA 5EKNA 5KBQA 1FINA 3PLAE 3PXRA 2FH9A 3I5ZA 1XR1A 3P0MA 4N6YA 4UV0A 3F82A 3DAEA 3KULB 4IANA 1V0OA 4FSWA 3KULA 3Q53A 4IQ6A 3RAHA 4F7SA 4TWPA 4AS0A 2BILB 3HAVA 1U59A 4A9YA 4IX3A 4ZY5A 3FZTA 2WMQA 2V55A 5EW3A 3POZA 4K0YA 5EH0A 2VWIA 4EKLA 3W1FA 3JVSA 5CY3A 5EQPA 5DEWA 4BVUA 2KTYA 3KL8A 3NIEA 5CU6A 3QGWA 3AT2A 3LW0A 1JBPE 3O7LB 3VC4A 4QYFA 3WZEA 4A9UA 5JH6A 3BBTB 4FTJA 2E9UA 3G15A 3DK3A 2FO0A 3O8UA 1G3NA 3PA5A 1G5SA 3FMHA 2R3NA 2WQEA 3P78A 3E92A 4EBWA 3HMMA 2IPXA 4OTPA 5KE0A 5HI2A 3V51A 5A4CA 4FUXA 4F0GA 2HELA 5BUJA 5I3RA 2X9FA 1HCLA 2YHVA 3ANRA 4IB1A 4D1SA 3TM0A 1BMKA 3ZS5A 3OS3A 5LVNA 3QLFA 3DXPA 4PDOA 3DLSA 2QI8A 4PQNA 4QQ5A 3JVRA 3UVPA 3ZFMA 2BFYA 3VUIA 2YISA 1YXTA 2WIHA 3RHKA 2WQBA 2OIDA 5HOAA 3DPKA 3R21A 3WZDA 3OOMA 2C5NA 2XB7A 3QCXA 4XUFA 4G5JA 1WBNA 3TTJA 3W33A 2C5YA 4FNYA 3RCJA 4QMNA 2P2HA 3OWKA 2HZ4A 2QLUA 4YC8A 5CAOA 4FT9A 1OECA 3OMVA 5I9VA 5L4QA 2XNEA 2OKRA 4ZLYA 5ANDA 5JFWA 2QOKA 4BHZA 3FHRA 5HCZA 1PY5A 2JAMA 5LVPA 5E1SA 2FSMX 4GU6A 3GBZA 1BUHA 4PV0A 1JKTA 1O9UA 4UBAA 5M4FA 2W5AA 2IN6A 1GIIA 2CN5A 4CV8A 1VYWA 3H3CA 4IMYA 5DEYA 3ZRKA 2W9FB 3RMFA 3W10A 3PSCA 4Q5HA 3V5WA 3NUAA 2XYNA 3EZVA 2OWBA 3NS9A 2C6LA 4O0TA 5A6NA 5HD4A 4D58A 2UW0A 4RX5A 4AT4A 4O7RA 3CY3A 5IMEA 4ZTSA 1Q8UA 1LUFA 2R64A 4FK3A 4JBOA 4N70A 2ETKA 5ANOA 3QFVA 3FKOA 4WKQA 5FQDC 4IWDA 4FVRA 3RWQA 1DAWA 4JI9A 3HZTA 1M14A 4ITHA 4QD6A 3SV0A 3SHEA 3IW7A 5CX9A 4IIRA 2GNLA 1BI8A 4BYIA 4CT1A 2NNWB 2CMWA 5KKRB 3SG8A 1ZZ2A 2E9PA 1KSWA 4F9AA 2O65A 2XKFA 1VJYA 1V0BA 2J6MA 2J0KA 4RIWB 4RIWA 2CNUA 3ELJA 4QMXA 3QRIA 2R3IA 4FNWA 4C59A 3H4JA 1ZOHA 2OJJA 3A61A 3ITZA 5E9EA 2XK3A 4Z3VA 3TWJA 3E3PA 2OICA 4G3DA 4JDKA 4B7TA 3VRYA 2JDVA 4JIAA 3NWWA 4EH3A 2VU3A 1XH7A 2WZJA 1GZOA 4DFZE 3LHJA 3TUDA 5IEVA 4GK3A 2QVSE 4LFIA 4V05A 3HUBA 4IE9A 4JNWA 4BGHA 2ZM1A 4RZVA 4X3FC 3MJ1A 4YLJA 2ITOA 2OJGA 3WE8A 4BCFA 3KF4A 5IZFA 3Q2MA 4I41A 2FVDA 4YJUA 5BVEA 4GG5A 3ZSGA 3S3IA 2B53A 2VO7A 4M0YA 4WIHA 4TXCA 1M7QA 5C9CA 4DH7A 3LJ2A 3DBFA 3COHA 4MWHA 1UVRA 1Z57A 3L9PA 3GCVA 4YC3A 3ZTXA 3F2NA 1PYXA 3T3VA 3EQHA 3A7JA 4DN5A 4EHVA 4BDEA 2R0IA 1UV5A 3EQCA 3SOAA 4MD8E 3U51A 5AAGA 4BWPA 3ZOSA 4NKSA 3OVVA 4FV9A 4M97A 4FTRA 4DG3E 2WMAA 5HTIA 2HENA 4U9AA 3OT3A 4ZTLA 3LOKA 1UU8A 4KB8A 4ANOA 4ASEA 2BFXA 4FV3A 4D2TA 5HIDA 4F63A 5TR6A 3I60A 5DPVA 2A27A 3Q9ZA 3AC4A 3UG2A 4A9RA 1JSTA 5CEMA 3PJ2A 4MNFA 4OBQA 1S9IA 4YO6A 3ET7A 2HCKA 5E8VA 2PK9A 3LLAA 3COMA 3GC9A 4NWMA 5IH5A 1SVGA 3BI6A 5FUTA 1Y57A 3E5AA 2OFUA 3A7IA 5DGZA 4QP3A 5J7BA 3FMMA 4JXFA 5IA4A 5LCJA 2W4OA 4JX7A 3QKLA 3BYVA 4UYAA 3W18A 4FTCA 5L6PA 1JWHA 2F7EE 1RW8A 5IPJA 3CD3A 3HP2A 4QYYA 4BDAA 3VRZA 4MXXA 3LFCA 4I6QA 4IDVA 1Q8WA 2PTKA 2ZM4A 4GFOA 5HG5A 3UO6A 4BCPA 4BGGA 3FZPA 4JDHA 4K1BA 1ZY5A 3U8WA 4CFXA 4TTHB 4D2RA 5JSMA 2VNWA 1H4LA 2ZAZA 3MI9A 3IPHA 3RBWA 5GZ8A 2PZPA 5FEEA 2XCHA 2CCIA 4YTHA 2FA2A 2BZIB 4QYHA 4C4GA 2ESMA 4J96A 3LQ8A 2GFSA 3GC7A 1ZYJA 5CEIA 2QCSA 3P9JA 3LAUA 5CT0A 5L8JA 1R0PA 2BZHB 3FLQA 3D0EA 5J1VA 4EZ3A 5IA1A 3AG9A 4R6VA 3IKAA 4CQEA 5FTQA 5T3QA 3UP7A 3BHTA 4MQ2A 4BCJA 3QHRA 5H8BA 1IA9A 4FSUA 3QRKA 3B2WA 4U45A 4FSRA 3VS5A 3EQDA 3IK3A 1WVYA 3FI8A 4FT5A 4A4OA 4IWPA 3BGQA 4FKPA 5HNBA 1YHVA 2WU7A 3OXIA 2PL0A 4A9SA 5KKRC 4OW8A 3HDNA 5EYMA 2UUEA 5FM3A 3E8NA 2GQSA 4ZK5A 1JPAA 3HL7A 4YJQA 5DI1A 4IADA 3TDWA 5FXSA 4J8NA 1BL6A 5ITAA 3E87A 4M8TA 3LFQA 5C8MA 3RPYA 4KS7A 2X2KA 1UWJA 2OJIA 2X8DA 5CF6A 4FIFA 3RPVA 4R78A 3IECA 4HNIA 2IZSA 2E9VA 2VTLA 2YACA 3PY3A 3ZUTA 3QCSA 4MF0A 4XEYA 3LXLA 5CVFA 1W7HA 3QTSA 2CJMA 3FL5A 4C7TA 4B0GA 5E4HA 3G2FA 4MWIA 2WO6A 4G31A 1SNUA 1YWVA 2YIRA 2XIYA 3Q4TA 4FEWA 4J52A 1GY3A 4MXZA 3P79A 4JT3A 4UZDA 4I21A 4GFGA 4HVSA 1XH9A 4G3EA 4YO4A 3Q52A 4MTAA 3NEWA 4RFMA 2X39A 3EQRA 4YBKA 4NUSA 2QG7A 3QA8A 1T46A 4IJ9A 2WEIA 4I5MA 3EZRA 3I4BA 4D0WA 3UO5A 3BE9A 3ZFXA 3TKIA 1JVPP 4U7ZA 3R8PA 5A4EA 4ZMEA 1A06A 1MP8A 1YOMA 2C68A 3I1AA 1YQJA 3PTGA 3DJ6A 4AE6A 4AN2A 1W98A 4EOOA 2Z7LA 4XYFA 1RJBA 3D7TB 4EQUA 3D7TA 4M7IA 3JYAA 1U54B 1U54A 4MBJA 3UMWA 2VGOA 2UZBA 1B39A 5AR7A 2OXDA 5BMSA 1PRYA 3MFSA 3VUHA 1GAGA 3RK5A 4OLIA 1YWRA 4Y73A 4D9TA 5AP1A 1YVJA 3MTLA 1W83A 4G3CA 3GVUA 4L52A 5CWZA 4DGNA 2NRYA 4YTIA 4GK2A 4Q9ZA 4O6LA 2VWXA 5HD7A 2WIPA 1RQQA 3OXZA 3FPMA 4JG7A 4EZ5A 4FTIA 4HYUA 2BKKA 3GU7A 1Z5MA 3E63A 4UALA 1FMKA 1STCE 3QC4A 2GQGA 2WMWA 2XUUA 1GJOA 2XNMA 3QKKA 4R1VA 3OCTA 3QHWA 4GVJA 4JAIA 4K6ZA 4YJSA 5AUXA 5TE0A 4BCNA 5HX6A 4BF2A 4MXCA 3Q32A 4F65A 3LJ1A 5AA9A 3AD4A 3QXPA 2BDFA 3NDMA 4GUBA 3SRVB 3OOGA 3SRVA 3NGAA 5CQUA 2PZ5A 4S31A 2WTJA 2CN8A 4FKSA 2ZM3A 4CFVA 2J5FA 2YCRA 3QAME 1SZMA 1B38A 2P3GX 3TT0A 5E1EA 2O2UA 1VYZA 4MK0A 5AWMA 2PUIA 2C5XA 1J7IA 4X2KA 5KMKA 3SG9A 3QYWA 5A4LA 3CTHA 3SD0A 5J79A 4DT8A 4PPCA 3CPBA 2YLFA 2YDKA 3UPXA 1H1PA 5CU2A 5AV2A 5HTBA 2ITNA 3IW6A 3FHIA 1Y8GA 4L45A 4XP2A 3DKOA 2V0DA 3HVCA 3NNVA 4YZ9A 1FQ1B 4GW8A 2W1ZA 2ZYBA 2RIOA 3QD0A 4FV2A 4IFCA 3ZEPA 3MWUA 5CU3A 3A8WA 4UWCA 4BGQA 4DFLA 4L6QA 4JJRA 3A7FA 2C3JA 4CYJA 2X2LA 5CAVA 4O7ZA 3BHUA 3QUPA 2W1GA 3Q6UA 3VBYA 4R77A 1CTPE 2ZOQA 3EH9A 2ZB0A 3ACJA 1SYKA 4BCIA 1H1SA 3HRBA 2ERZE 2OI4X 5HO7A 4MD9E 5L6WL 5F94A 3QQFA 2J0IA 3JS2A 2W06A 3OCGA 4BTFA 4E1ZA 5LVOA 4X0MA 2Z7QA 3U4WA 4RSSA 3PIYA 4IM3A 5FTGA 4L8MA 3ODZX 4ZZMA 3VW6A 5JMSA 4ANMA 4JQEA 5AP3A 3F5GA 4O0XA 4NTSA 4OUCA 4EH8A 2W5BA 2PE0A 5DLSA 1Q8TA 4FIGA 4ZTMA 3FJQE 3R04A 3C4CA 3EIDA 3DNDA 3F2RA 1NVRA 3OUKA 4JBPA 3LMHA 1PKDA 2J4ZA 3D2KA 3O96A 3DDPA 2AYPA 4WSYA 1ZMWA 4PMSA 3ORNA 3NUUA 4G3GA 4PDYA 4EC8A 1BX6A 4FICA 1FPUA 2G9XA 2R2PA 2ZV2A 3OUNB 1Q4LA 4FNZA 4FVPA 5HBHA 3FZOA 3VS0A 4USDA 3ROCA 3BU6A 4OTQA 4U3YA 2ITYA 2Y9QA 3BEGA 3PYYA 4M12A 3ZHPC 4YZCA 4C3RA 4EK3A 2W96B 3AGMA 4KUJA 4GG7A 4AU8A 4PF4A 5J9ZA 1OL5A 4I23A 4FVQA 5JRSA 4BZNA 2XCKA 1XH4A 5EHOA 2UW9A 4U81A 5CNNA 3ENHA 4DAWA 2ITVA 4CKIA 1OPKA 3OP5A 3QQGA 5IUGA 1TVOA 4IX6A 3DJ5A 3EN4A 3O50A 4KKHA 3AMBA 4UXQA 4D1XA 1P5EA 2J9MA 5KHXA 3GOPA 5BVFA 3ORPA 4XV9A 2RKUA 4MAOA 4XCUA 4YZBA 4O1PA 3OY1A 4XG3A 4EWHA 4PY1A 4ZTQA 3U9NA 4QP2A 2CGVA 2GTNA 2C0IA 3PSBA 4U5JA 2BTSA 4HZSA 4RC4A 4E6QA 2EXCX 3QXOA 5IQEA 3BV2A 5CI6A 3SKCA 2A1AB 5HZNA 5LMAA 1JKSA 3AMYA 4NCTC 5H8EA 3MA3A 3O8PA 1SVHA 4A4XA 4K11A 4GJ3A 4GIIA 4H3BA 4O1OA 2QOOA 2WTVA 5L2QA 3PVGA 4BTJA 4YTCA 5HE3A 5KHWA 3GOKA 1OGUA 5I3OA 4MQ1A 2Y6MA 4FTLA 3CQEA 5B0XA 4H39A 5AMNA 4C0TA 3UDBA 5KMLA 1YXSA 3UP2A 1B6CB 3UIBA 3WF8A 2WAJA 3DKGA 3QBNA 4NM5A 3MH2A 3VW8A 4F6UA 2QODA 4WG5A 4L42A 5M07A 5K4IA 4LM5A 3A62A 1IRKA 4MXOA 3SAYA 3V8SA 4ANLA 3BYOA 2VWBA 1OMWA 2ZVAA 2GNFA 3FSFA 3MY5A 3QUDA 3VJNA 4OTHA 2WTIA 4IZAA 2NPQA 5HLPA 2VTPA 5EM6A 4JDIA 4BDIA 4EZ7A 4CZTA 4CG9A 3KF7A 3BLQA 3K3JA 3WI6A 3G6GA 1KOBA 3OY3A 2GNHA 2DS1A 3HGKA 4RIXB 4S2ZA 3R7IA 4D2SA 2OLCA 4RIXA 5EQEA 4KS8A 4NFMA 2W99B 2XJ2A 3R2BA 3EFLA 3EQIA 4H58A 4KWPA 4OTGA 4ZJIA 3ZDIA 4BDHA 2IZTA 2C69A 2JGZA 2WQNA 4LMUA 3MH3A 2CKPA 3EL8A 2I0YA 3GI3A 5DA3A 3G51A 4RG0A 1KUTA 3PZHA 3QZIA 5JFVA 3KREA 4W8DA 3F9NA 3W2RA 3DBEA 3PIZA 4I3ZA 3UQGA 3ZZWA 1JKLA 2PE1A 3MH0A 3UNZA 4B8MA 1XBBA 1ZZLA 3FLSA 4XMOA 1MRYA 5IUHA 3H9OA 4E4LA 4YU2A 2QNJA 5BVDA 3DBQA 2HY81 4FTOA 3UO4A 3FMDA 4DITA 1H07A 1QMZA 4FTTA 3W2PA 3VJOA 2WTWA 5HESA 3VBWA 4F7LA 3DXQA 4U42A 5EHLA 4DGMA 1YRPA 3DDQA 4DINA 5L8KA 2F4JA 2YCFA 2XMYA 4M3QA 5BVKA 2VWVA 2CGXA 4O22A 3SLSA 3CJGA 3LFBA 1XO2B 4FR4A 2WFYA 1A48A 3U54A 4UXLA 2B4SB 1ZYCA 3ROYA 2CGUA 3HDMA 2BDJA 1YXUA 4ID7A 3PVBA 1R0EA 1NY3A 1ZMUA 2C1BA 3Q4UA 3UYSA 1XH8A 2XS0A 4PP9A 4DA5A 3KU2A 1CDKA 3HEGA 4FV6A 4MEDA 2IG7A 4IZYA 5DT0A 5JGAA 4IB5A 4MBIA 4WNMA 3VQUA 2PUUA 5F95A 4EJ7A 5IQBA 1Q41A 3IW4A 4GSBA 5BVOA 1BI7A 4RGJA 1ZOGA 5K3YA 4EK8A 4ZJJA 1CKJA 3V3VA 3KN6A 5EK7A 4G6NA 3P4KA 3D83A 3MB6A 2JDOA 3R00A 4O6EA 4R3CA 3A4OX 5EI2A 4E5BA 3FEGA 2YABA 3CKWA 3IS5A 4J7BA 4Y46A 1UNLA 4XOZA 1JOWB 3UBDA 4LUEA 3H9FA 4XG2A 3FLWA 4E20A 3COKA 3W8LA 1Z9XA 4BCHA 3PXZA 4JLCA 4G16A 1NT2A 4IM0A 4WHZA 5JZNA 2PZYA 3I7BA 3A7GA 2GHGA 4NSTA 5HNIX 4O81A 3BYUA 4JVGA 4CFUA 3F3TA 5DN3A 4L3JA 2QOFA 2YFXA 5IDPA 1CM8A 4C2WA 1RDQE 4C62A 4WRGA 4X2JA 4BWKA 4E3CA 2XJ1A 4XS2A 1DI8A 5HEZA 1P2AA 3PPZA 3K2LA 3U87A 3MY1A 4AP7A 5FEQA 2EU9A 3TNIA 1ZOEA 1XHAA 4FIEA 3F3ZA 5CXZA 2R7BA 5C26A 1GZNA 2UW3A 5GZAA 4O0UA 5AX9A 2BMCA 5AFVA 2O63A 3FKLA 3PXKA 3AC2A 2H96A 5EYCA 4TNDA 4BDBA 4EK5A 1H0WA 4RQKA 3PA4A 5DRDA 1ZMVA 5CVHA 4FKQA 3JR1A 5LJJA 1OBDA 4DH3A 3OTUA 4ZSLA 5B2KA 4E93A 4U44A 4ZSJA 3RAIA 3G0EA 5JQ8A 1SM2A 4LUDA 3DFAA 5DOSA 4YHJA 5AV3A 2BROA 2Y8OA 3EQBA 4L43A 5GJDA 2VWWA 3EOCA 1H08A 2BRNA 4XBRA 5HIEA 3F61A 4FZDB 4YBJA 5FRIA 3WZKA 4IAZA 3VUDA 3P5KA 4IVBA 2UVZA 1NA7A 4E7WA 4W4VA 5B2MA 5BMMA 4LI5A 3R7YA 2UZVA 4KRCA 2BR1A 2CKEA 3QCQA 4HGTA 4J97A 2QOBA 3PSDA 1NVSA 1W82A 4UMTA 1YXVA 4FMQA 4BCQA 4I6BA 3IOKA 1WBOA 1PKGA 2PVHA 4MVFA 5CI7A 3UIMA 4AZTA 5CSXA 3BQRA 5CF4A 2BRMA 1ERKA 3LE6A 2JKOA 3Q5ZA 1JNKA 2WQOA 4E6CA 5CU4A 3L1SA 3GFWA 2BCJA 3SXRA 4PMMA 2OU7A 3GCUA 4GK4A 4WG4A 5BUEA 1UNHA 4FSYA 5TKDA 4PWNA 4ANQA 4U3ZA 4GYIA 2G1TA 5K5XA 4AGDA 4AZWA 3PJ8A 2OIQA 1G8SA 4DLIA 2R3KA 2Y0AA 2Y6OA 3GC8A 2JIIA 4DGOA 2J50A 4RZWA 2B55A 2W1CA 2W1HA 3PXYA 5FG8A 2B9FA 4TKSA 3KXNA 4O82A 1IA8A 2BHHA 3CE3A 2GS2A 5AUYA 2QOHA 3CEKA 4NFNA 4F9YA 5KMNA 4MHAA 3MN3A 5ANJA 5AUUA 1WVXA 4FYOA 4GU9A 5EDQA 3T9IA 1OIQA 3Q5IA 4IVCA 4JR3A 5A14A 4F9BA 2GQRA 3QZGA 3LFNA 1CSNA 4XHKB 2X4ZA 4I93A 3QQKA 2DUVA 2WD1A 2UVXA 3F3UA 5HG9A 3VF9A 3LFFA 3BU5A 4WRSA 5EG3A 2FGIA 5FP5A 4ACCA 5IQIA 2QHNA 2YEXA 1MQBA 1ZLTA 3NR9A 5E8XA 3VBTA 3N4TA 4P4CA 4QP9A 4D4YA 5FP6A 2X9EA 4RFYA 5HO8A 3R7UA 2RL5A 3L8VA 4DGGA 4BIDA 4AWIA 5KNJA 5J95A 5D1JA 3MW1A 4CFMA 2FSLX 3GB2A 2EB3A 4KIQA 4P5ZA 5F20A 5CU0A 5HLWA 5GIOE 4AZEA 1JSVA 3VN9A 3ZONA 4AN9A 5JRQA 5LWMA 3FY2A 2OIBA 4BWXA 2JITA 5DMZA 3C5UA 3P7AA 1H1QA 5DBXA 2CPKE 2W4KA 2YCSA 3ORZA 3HV3A 3PIXA 4RJ6A 4YJOA 4FSMA 4IAAA 1PF8A 4C3PA 4QTEA 1H26A 5DR2A 3RAWA 2GCDA 2IVSA 3HA8A 3TACA 4IFGA 4II5A 2ETRA 1WCCA 3C0IA 1UU3A 2ITQA 4JL9A 3KXXA 3R9DA 4EH4A 3SX9A 3V5QA 3AD5A 4AFJA 4MKCA 4WBBB 1FGIA 3LCKA 2QR8A 1UNGA 5AADA 4CLIA 2IO6A 2VO6A 5AAFA 1R78A 3KN5A 4OR5A 1ZXEA 3KRLA 4C4HA 2VO3A 3S00A 4CZYB 3UZRA 3F2AA 4S33A 3D5UA 3F3WA 1K3AA 3QTQA 1F0QA 4TWCA 3NCZA 4CCUA 2P4IA 3NRMA 4UEUA 4JR7A 3QQUA 4DG2E 4RX8A 3VHEA 1UKHA 4K77A 4WO5A 4UMQA 2JFMA 3DA6A 2WXVA 3RINA 3UE4A 3FLNC 4FOCA 5AP6A 5KMMA 4UZHA 3C13A 4YURA 3ZO3A 4O83A 2BPMA 1MQ4A 2YLEA 3SW7A 4G3FA 5HHWA 4USFA 4ITJA 3UGCA 4S30A 3H0YA 2F57A 3ORXA 4N6ZA 3ORIA 5JFSA 5CZIA 3ZBFA 4D5KA 2OK1A 5CF8A 2X1NA 2YZLA 3GC0A 3PG1A 2BAKA 2WTDA 2YDIA 4OBOA 2WMXA 3GT8A 5DNRA 3UZTA 2C6TA 1UKIA 5CSPA 3HMPA 4EONA 3JUHA 4KSQA 4LV5A 3U9CA 3KXZA 4JOAA 4F70A 3KK8A 4FUYA 1HCKA 2EUFB 3OG7A 2HW7A 3NVKI 2J2IB 2XVDA 4P90A 2HZIA 4HYHA 2OG8A 5FDPA 5IF1A 2XNBA 3VUMA 5JN2A 5I9UA 2E9NA 1O6KA 4KBKA 1JKKA 2IZUA 2V22A 4TYJA 5BYLA 2PVRA 3KKVA 3PRFA 1FVVA 2J7TA 4KRDA 3JY9A 3FYKX 4FTAA 3R7VA 4BN1A 2B54A 1OITA 2UZNA 5AM6A 1O6YA 4G17A 4KABA 3D5WA 3UQCA 4DCEA 4F64A 4KSPA 1Q3DA 2JDSA 4EK4A 4BBEA 3DQWA 4WD5A 3ALNA 1OM1A 2CNVA 1OL1A 3N9XA 2BUJA 2WU6A 3M11A 3VO3A 2YIWA 2ITXA 4NT4A 1OPJA 4JBQA 5DR9A 2W17A 3PWDA 3BLHA 3O2MA 3R1SA 5IQFA 3G90X 3R73A 3BRBA 4HCVA 2O8YA 5D10A 2R5TA 2CKQA 5HE2A 3H10A 3ZBXA 3FMKA 4EL9A 2ZB1A 4QMTA 5HO6A 2OW3A 5AUWA 5GHVA 4A07A 4C58A 4KIOA 3MS9A 4PRJA 1H00A 3KMMA 3CR0A 4S34A 1WBPA 1ZWSA 4WG3A 3FWQA 5CZHA 3TXOA 2J0MB 5AR8A 2R9SA 2X6DA 2YAKA 4QMVA 3TZ7A 2BRBA 1J7LA 5LARA 3TDVA 3ORMA 3DGKA 2VTOA 5BX0A 2GMXA 4C33A 1XH5A 4EHZA
chains in the Genus database with same CATH superfamily
5HBJA 1BYGA 3A7HA 2EVAA 2YJSA 1LR4A 2IW8A 4S32A 4RWIA 4DEDA 5L8LA 2EXEA 4U97A 4EH6A 4XLVA 2R3HA 2JBOA 5DHJA 5K0KA 3R83A 4BRXA 2OF4A 2VWUA 2JDRA 1BKXA 2ITZA 3PZEA 3UOJA 1YW2A 4CMOA 5CASA 4FKJA 4RIOA 1IG1A 2UZOA 3OHTA 2H9VA 1FBNA 4AE9A 3HMNA 3RAKA 4EHEA 1R1WA 4EWQA 2QO2A 3CQWA 1EH4A 5AX3A 4F1TA 1WBVA 3DLZA 1QPJA 1Q99A 3S1HA 5CQWA 3L9NA 3ZDUA 1XMLA 3LCTA 2OSCA 4MNEB 5DR6A 4MNEA 5D9HA 1GNGA 3GCQA 4J1RA 2VX0A 4W4YA 5HX8A 4O84A 4O7SA 3GU5A 5IQGA 3O8TA 4AQKA 4AXCA 3PE2A 4HCTA 2HW6A 4BFMA 4XG9A 4DGLC 3R30A 1H0VA 1AGWA 4OTDA 3ZH8A 3ZM4A 3R1YA 2VWZA 2PVJA 2WMUA 3MFTA 3TKUA 4N0SA 3F5XA 3F7WA 3LM5A 3UMXA 2UV2A 3LMGA 5AIKA 4GL9A 5HKMA 4C8BA 3NNXA 1NXKA 4O27B 4L46A 1ZARA 4EI4A 4GJ2A 5M09A 3R9HA 4I22A 2GDOA 3R8UA 2C3KA 3PG3A 2QOQA 3E93A 3E88A 4U8ZA 4F09A 4JAJA 1A9UA 3KEXA 1H01A 4RC2A 5CVGA 1XBCA 3RGFA 3ZFYA 5AEPA 1YDRE 3AXWA 5CANA 4TW9A 1WVWA 2VTRA 3KXMA 4AW1A 3S2PA 4MBLA 1PJKA 2YIYA 3Q9YA 5KCVA 4JG8A 4GRBA 4L01A 5JK3A 5LOHA 1JAMA 4G34A 3BKBA 5C4LA 5ANIA 5IH4A 2ERKA 4KAOA 5CEOA 2GNJA 1MUOA 3LXNA 3NW7A 5IUIA 3W55A 3ORKA 3D5VA 3DXNA 4QMPA 4AFEA 3E7VA 3O71A 4E4XA 4JRNA 5C8KA 4RWJA 2W7XA 2YA9A 3RNYA 3ATSA 4UN0C 1ZYLA 4WOVA 4PUZA 2B52A 3NUPA 3RZFA 1WFCA 4EOSA 1UWHA 3RZBA 3MA6A 1PXJA 4NCTA 4WBOA 5CAPA 4CG8A 3UVRA 4EUTA 2XM9A 4ZS0A 2A4LA 2ETMA 5IA3A 5M4CA 3W2OA 2BRGA 2PZIA 3BPRA 3IGOA 2UZLA 2XP2A 3BZ3A 4ENXA 4BZOA 4QQJA 5FBNC 2FUMA 3ZSIA 3DZOA 1Q24A 4ZP5A 5HIBA 4RIYB 3TCPA 2PMLX 3NYXA 4WUAA 3UC3A 4H05A 5FXQA 1DM2A 1WBSA 3F5PA 3L8PA 4DEAA 1G8KA 4DBXA 2R3QA 2PMNX 3F66A 4ALUA 4XOYA 4RJ3A 3ZYAA 2IJMA 4N4SA 3NLBA 4FGRA 2GNIA 3R6XA 3CSVA 2JDTA 4PMTA 5AV4A 3F6XA 4YJNA 1PW2A 1PMUA 4ZY4A 3ZLWA 2IZRA 2JD5A 2XIXA 4R7BA 2C6MA 2BALA 3EN6A 4A7CA 2H6DA 3BEAA 2WTCA 3QZHA 4M66A 2B0QA 1GOLA 2YN8A 3C9WA 3FXXA 3QQLA 4WA9A 3AC8A 1W2FA 5ETFA 3Q60A 5BUIA 2X7FA 2PMOX 2XKCA 2V62A 3JPVA 3MYGA 3R2YA 4QPSA 4AGUA 4APCA 2BZJA 4B6LA 5IEXA 2X0PA 2HIWA 5EI6A 2AC5A 3WF9A 2VX3A 4G9RA 4ENYA 2V5QA 3FC2A 3MBLA 2VX1A 3MIAA 3NNUA 4BYJA 3FI2A 4FRFA 3IO7A 3PWYA 4M13A 2GS7A 3FQSA 5AR5A 4EQMA 4FKLA 2JKQA 5K0XA 3QTZA 1JLUE 3DB6A 3UODA 3MSSA 5A6OA 3BL9A 2OJ9A 4RBLA 3BBWA 1CMKE 2YIQA 4IXPA 2PUNA 2EB2A 2X8IA 5EOBA 1TQMA 4YLLA 1UU7A 3WF7A 3BWJA 5ETAA 2RFEA 1G8JA 2OO8X 3RHXA 2C6KA 2E2BA 1QPDA 2VGPA 1REJA 3GCSA 3NUNA 1O6LA 3Q9XA 4QTBA 2Y4IB 3R8MA 3I0OA 2CDZA 3ODYX 4GS6A 3WBLA 4GVAA 2RGPA 3P23A 4YHTA 4L3LA 4HNFA 4CXAA 2QD9A 1P4OA 2F2UA 2GPHA 4UYNA 3PP1A 4USEA 1E1VA 4NTTA 3N4VA 3NCGA 4RA5A 5HORA 2BAQA 3E3BX 4J99A 5L6OA 5DT4A 4LGGA 3C4FA 4HVDA 4IBMA 5FXRA 4DTKA 4RJ7A 4PNKA 5FTOA 4EOPA 5D7AA 3B8QA 3N51A 1GIHA 1J1BA 4AX8A 2ACXA 3QYZA 2G15A 5CALA 2I0EA 5EI8A 3VHKA 3R9RA 4JDJA 2FSTX 4CV9A 3E62A 3FDNA 3HAMA 3MJ2A 1VEBA 3BHVA 4FBXA 4FV7A 3ZLYA 2QKWB 3GEQA 4EJNA 5CAUA 1YHWA 3TUCA 4KIKB 3BHHA 4FEVA 2VTSA 2XA4A 3NAXA 4X2GA 4AZFA 3BE2A 4M0ZA 1J1CA 3ATTA 4G9CA 5H9BA 4G5PA 4UWBA 1OUKA 4PL4A 1UA2A 2QOLA 4JX3A 2PVYA 3O23A 2XKEA 3DCVA 4FOBA 2YM3A 4XP3A 5AV1A 3WF6A 3BGZA 3VWAA 1XH6A 1MRVA 4ERWA 1J7UA 3LKMA 3RWPA 2HOGA 4IWOA 5CSWA 4CFWA 5LCKA 4LL0A 2NRUA 4OGRA 3FUPA 2CLQA 3H9RA 4EH5A 4XG6A 3U6HA 4CSVA 2OXXA 2EWAA 3KXHA 4MUQA 5JKGA 4PTEA 4AGCA 1PYEA 4O91A 4EK6A 4I4EA 2B9JA 4C4FA 1KV1A 4AUAA 5AUZA 3HRFA 1MRUA 5HLNA 5AR4A 5JQ5A 3I6WA 4KKGA 4XRJA 3C4ZA 3WZJA 5CF5A 2PYWA 4BIEA 2J5EA 4IX4A 5FM2A 5EHYA 4B99A 2I1MA 4G6LA 4IAFA 5HVJA 3ZCLA 1OKVA 4X2FA 3CS9A 3QUEA 3KVXA 4QMSA 4WNPA 5E8YA 3QRUA 5ANKA 4CCBA 3ID6C 4J71A 4O0VA 4NJDA 4IAIA 4C4JA 3MPMA 4MXAA 3PUPA 3KRRA 2QQ7A 4FG8A 3ZO4A 5M44A 4FIIA 3FZSA 4QMOA 4DEEA 3KRXA 1NW1A 3K5UA 4O38A 3FZRA 2J0LA 1OL7A 3G9LX 4C4IA 4CTCA 4HVHA 3KVWA 4R7HA 3DTCA 5HU9A 2VTQA 3GU8A 4FTMA 3KRWA 4OBPA 5EOLA 5J8IA 4D2WA 5IH6A 5M4UA 2OXYA 3LFDA 5TF9A 3D5XA 4AXEA 4IVAA 2UVYA 3JY0A 2UW5A 5KZ0A 1J91A 2RG6A 3DAJA 1Q3WA 3FQEA 2OJFE 4FKOA 3TTIA 1H1WA 4AN3A 5HQ0A 3HV5A 2IVUA 3AGLA 5M55A 5F1ZA 3FMEA 3HNGA 4RMZA 4KNBA 2LGCA 3RM6A 2SRCA 2RG5A 2A0CX 3BYMA 3DTWA 4O0WA 4YUQA 2F9GA 2H34A 3RCDA 4XX9A 3LXPA 3R1QA 4XH6A 3SVVA 4TT7A 1PMNA 1PXNA 3FI3A 4CRLA 3VS4A 3EN5A 1Y8YA 3MH1A 2R7IA 3NAYA 3OW4A 5BVNA 2XNGA 3FPQA 5IG1A 3II5A 2DQ7X 4QP4A 1BLXA 3P86A 4LL5A 1IASA 3FBVA 3FY0A 3AD6A 3L9LA 1Y6AA 2J90A 4ONAA 3LLTA 3TNHA 3MTFA 1XJDA 4L44A 4Y5HA 5FBOA 5C03A 3DK6A 3R02A 3UG1A 3ACKA 3ZC6A 1T45A 4FSZA 2WELA 4O21A 3V8TA 4DFYA 4GKIA 3C4EA 2UW6A 1LEWA 2Y4IC 4HGSA 4J95A 4UB7A 4Z9LA 5IA2A 5DH3A 4ZMFA 3FMJA 2FSOX 4FV5A 3L8XA 4HYIA 2JC6A 3FI4A 3K5VA 4QMUA 1K2PA 2J51A 2V7OA 2X6EA 2W1FA 4B4LA 4BR3A 4FSNA 5TO8A 3FV8A 3F3VA 4ALVA 5M53A 5HG8A 4OT5A 2IVTA 3V5TA 5J5TA 4LOOA 3CTQA 2Y4PA 1RE8A 3V01A 1BL7A 5IQCA 1KE5A 4W9WA 4R5SA 3RK9A 2QU6A 4GT4A 4WT6A 4V0GB 4OAVB 3GUBA 4TWOA 4RVMA 4YHFA 4AW0A 4QPMA 2PVKA 4IJPA 1KE8A 4OTFA 4ORKA 3NZ0A 3V04A 2QONA 4IACA 4E6DA 5JGBA 4O96A 2PSQA 3DNEA 4P7EA 3QTWA 3ZSHA 1WBWA 2BRHA 5HVYA 3D7ZA 3RM7A 3PLSA 2UW8A 4L68A 4Y85A 2YZAA 3MDYA 4RFZA 5ETCA 3WOWA 4MH7A 5AP2A 4D2VA 4FF8A 1PXMA 4Y8DA 3HV4A 3UOKA 5DG5A 2XBAA 4JG6A 5F9EA 5HICA 2XNOA 3LCDA 3Q6WA 4I0SA 3S0OA 3TI1A 2QHMA 4AW5A 4BDFA 3OBJA 4D2PA 2E9OA 1FMOE 3GCPA 5EKOA 2QC6A 2Z7SA 4TN6A 5DE2A 1WBTA 2F7XE 1KE9A 2VTIA 3EQPA 5AP5A 4BBMA 2Q0NA 3BQCA 1OIUA 3QCYA 4C61A 3GGFA 4YZMA 5EM8A 3RPRA 4FC0A 4C36A 4NL0A 2GS6A 3UQFA 1URWA 3HP5A 5M56A 4I4FA 4V04A 3GU4A 2VV9A 2XRUA 2Z2WA 1J3HA 3I81A 4I0TA 3TV6A 2UZUE 2W5HA 4UWYA 4DBNA 3U55A 3UNJA 4TRLA 4K2RA 3D2IA 4IH8A 3C50A 1TQPA 4PL3A 3FLZA 2PVLA 3W32A 5DIAA 5M51A 5BPYA 4EYJA 3ZMMA 3A99A 4F1MA 4GYGA 3Q9WA 5J9YA 4BTMA 3QKMA 3O0GA 4F6SA 4P2KA 5IQHA 1ND4A 5FWKK 3R8LA 3HYHA 3CTJA 3BIZA 3PPKA 3RJCA 3W0OA 2R4BA 4KA3A 3KCFA 3K54A 4DLJA 5JT2A 4D4SA 3PDTA 3WYXA 3F88A 3LFEA 4ZLOA 2QLQA 3CP9A 3GQLA 4ANNA 2XARA 2X4FA 4AXFA 4FIJA 3EMGA 4YJRA 3WIGA 2C1AA 1FOTA 2X0GA 4C02A 4CVAA 3IDBA 2A19B 4FKIA 4HW7A 4YTFA 1AD5A 4QMWA 4H1JA 2I7QA 1VLRA 1I09A 4LRJA 3PJ1A 3G9NA 4FKUA 3ORTA 4OTWA 4M84A 2JBPA 4J53A 3EQFA 5D7VA 3ZZEA 1TKIA 4FV8A 1DI9A 3EB0A 4LOPA 4RWKA 4ALWA 2PVMA 2XF0A 1FGKA 2ZMCA 3HLLA 5CENA 4BB4A 5C8NA 4QP7A 4EBVA 2X2MA 2YITA 2PMIA 5B2LA 4E8AA 4E5AX 2O5KA 3WZUA 1OBGA 4BY9E 2PHKA 2PVFA 4DF3A 2P2IA 2QO7A 2PE2A 3EFKA 4YR8A 1WZYA 4Q5EA 4PL5A 3DJ7A 5HU3A 3TV7A 4I5HA 4KD1A 5D11A 3QU0A 4FG7A 4FNXA 4AT3A 4KBCA 5IU2A 3SQQA 5KBRA 4XJ0A 4C37A 3DV3A 4EOQA 4H3PA 3POOA 4B9DA 2CNQA 4YPSA 2QURA 3FSKA 2DWBA 2ZV8A 3DAKA 2B1PA 5H2UA 4AGWA 4DE4A 4I5CA 1QL6A 4L53A 3QWJA 2VO0A 1R39A 4MCVA 4X3FB 3RKBA 4EOKA 5IEYA 4AA4A 4P5QA 3R01A 4EOJA 4XG8A 4CLJA 4R3RA 1M52A 4UMRA 2JLDA 3TNWA 4DC2A 4E5WA 4FL2A 4L3PA 4QMZA 5IA5A 3TN8A 3VAPA 4Y5QA 3MVLA 2OZOA 3MV5A 4PMPA 1KOAA 2C6DA 3QD4A 2IW6A 5KMJA 4NH1A 4I6LA 5F4NA 4ZSAA 3FLYA 3MIYA 3TNPC 3I5NA 3WF5A 3C1XA 3M2WA 4CGAA 3HRCA 4Z16A 2VD5A 5LMKA 2R3PA 4I6HA 4TYHB 4FKWA 4TYHA 3BWFA 5L2TA 4FA2A 3QLGA 2VAGA 3LFAA 3OFMA 2XAOA 2C5OA 2VN9A 1WMKA 4FT7A 1VR2A 3SC1A 3MGYA 5DFPA 4X3JA 4L67A 3SOCA 3QTIA 4I20A 3QTRA 4IC7A 4MXYA 4ZAUA 4XLIA 3T3UA 4YSJA 1U5QA 1YOLA 3RPSA 4YJVA 4CEGA 4GH2A 3DKCA 4ASDA 2CLXA 2VTJA 2P55A 5I4NA 4DCAA 3EYGA 3NUYA 3KQ7A 5E92A 3UNKA 3VBXA 4D1ZA 2UZTA 4Q9SA 2O0UA 4MF1A 3SDJA 3VONA 3ZUUA 4QP6A 1F5QA 3ENMA 3MVHA 2I6LA 4I24A 4JRVA 3R8ZA 3WARA 4BL1A 4F6WA 2X8EA 3CC6A 2PULA 5D41A 2B9HA 4ZSGA 5EDPA 5ICPA 4TNBA 5K9IA 4J8MA 4RVLA 4DTBA 3E8EA 4FKTA 4IC8A 4U0IA 3M1SA 3PPJA 1OKWA 4O4EA 3RP9A 4U41A 1Q5KA 3E8DA 3ZO2A 4ACGA 5J9LA 2YERA 4O7WA 4NJ3A 3PJ3A 5GZ9A 4EH9A 4FODA 5IISA 5L3AA 3TYKA 4I94A 1OIRA 2AC3A 4C57A 1YI6A 3KMWA 2X81A 4UMUA 4JIKA 3MVMA 4CKRA 3SA0A 3AKKA 4IVDA 4GFMA 2UW7A 5L2WA 5G6VA 4QMMA 4BHNA 4FSQA 4OT6A 3EKNA 3C4XA 2YWVA 1PMVA 5EDRA 3BGPA 4HZRA 4RC3A 3ULIA 1URCA 2W0JA 4Q2AA 4BI2A 3F5UA 1V0PA 4NM7A 2VWYA 3FC1X 3M42A 3PVWA 3ZUVA 5GNKA 2R3MA 5I9ZA 3PRIA 4TY1A 2PU8A 4CNHA 5CSHA 1Q97A 2LAVA 2C4GA 4O2PA 4FZFB 3NW5A 4LRMA 4E73A 4ERKA 4CTBA 2ZDUA 1ZRZA 5AUVA 3NYNA 4W8EA 5K5NA 4ZZNA 4FTKA 2X0OA 4FTQA 2QO9A 2UZEA 4MYGA 1U4DA 1Q62A 2W4JA 3G0FA 4FKRA 4M14A 4PPAA 4YZNA 5HVKA 4EORA 5FGKA 4XNEA 5EW8A 5BNJA 3CQUA 2BKZA 3ZLXA 3AT3A 3IDCA 4CQGA 1DAYA 4YZDA 4EOIA 3UPZA 3D15A 5C4KA 3FXWA 4GV1A 4RX7A 4UY9A 3VIDA 4J98A 3B8RA 3P08A 1OL6A 2R3LA 1QCFA 3LQ3A 2XKDA 3C0GA 3C51A 4H36A 4DYMA 2ITWA 2ONLA 3BYSA 4M67A 1OKYA 2C6EA 2VTHA 2JIUA 3NIZA 4Z7GA 2FB8A 2HWPA 2BDWA 3HECA 3R71A 5L2IA 1JQHA 4FTNA 4O86A 5KUPA 3PVUA 3R8VA 4C3FA 4HVGA 2HZ0A 2G01A 2PWLA 3UOHA 5BYYA 4BKZA 2QU5A 5H8GA 5CLPA 3DZQA 3NNWA 3IDPA 5CAQA 3R7EA 5AP4A 4A4LA 4NW5A 3QALE 4FE2A 3AC3A 3ZXTA 2XIRA 3O17A 4QYGA 1PHKA 4FL1A 5C27A 3KK9A 4HGLA 3S95A 5IA0A 5E8SA 4H3QA 4C4EA 5LMKC 1H27A 3CLYA 1M7NA 3OCSA 4BI1A 5AUTA 2ITPA 2O3PA 4LGDA 1PXOA 4FI1A 4R5YA 3FMLA 5M4IA 2BIKB 4XV3A 2AUHA 3I79A 4ITIA 1SMHA 3QTXA 3WIKA 3ZEWA 4FV0A 4FKVA 1XWSA 4MD7E 3OEZA 2CSNA 4NIFB 4NEUA 4YC6A 5FLFA 3W16A 4NIFA 3D4QA 5HTCA 1YOJA 4AACA 4YJTA 4W4WA 1K9AA 5JEBA 3KGAA 5ETIA 1I44A 3OEFX 3SW4A 3WE4A 4CMTA 4GKHA 2CGWA 4QT1A 3MPAA 1IAHA 4M15A 4H1MA 1GZ8A 3HMOA 4CZUA 3SXFA 1HOWA 3OCBA 4QNAA 3TMOA 3QC9A 4EEVA 4NZWB 3IQ7A 2BHEA 5ANEA 2RF9A 5I5ZA 4FKGA 3T9TA 4LQMA 5TT7A 2XK8A 4AXDA 1ZAOA 3U6IA 4KKEA 4UMPA 4RJ4A 5AR2A 3MPTA 4F9CA 2XK6A 5HGIA 4Z55A 2VRXA 3MY0A 2Z8CA 3S4QA 3ZRMA 5DWRA 3TL8A 2IW9A 4R7IA 3UOLA 5E91A 5IQDA 2CCHA 3AT4A 2A2AA 2HK5A 4F7JA 3QWKA 2KULA 4XBUA 5CS6A 5IDNA 3EYHA 5GINE 1YI3A 5IKWA 3UIUA 4LG4A 3O7LD 2HZNA 3K3IA 3UTOA 1ATPE 4GCJA 2Z7RA 4O7LA 4XG4A 4WUNA 4X21A 4O7TA 5JZJA 5LVMA 1F3MC 4XV2A 2YM5A 4QDEA 4ANSA 2WB8A 3VUKA 1OUYA 3GNIB 2JEDA 3NYOA 3V6SA 4FV4A 4TYGA 3BLRA 5CSVA 3A60A 3LPBA 4YMJA 1IEPA 2PY3A 3ZRLA 3DY7A 3I6UA 5FDXA 2C6IA 4FZ7A 2C47A 2GHLA 3COIA 2FYSA 3ETAA 3OD6X 4D55A 4FZ6A 5EM5A 4IB3A 3UC4A 1YDSE 3PJCA 5GJGA 2W9ZB 4OTIA 1KE7A 2C30A 4RX9A 1U5RA 2P0CA 3AC1A 4U43A 4EOLA 3HMIA 3EL7A 1V1KA 4IDTA 2XIZA 3KY2A 3VNTA 4TL0A 2GNGA 4BCKA 3BCEA 4IAKA 4ASZA 4EHGA 3EKKA 4GT3A 5J5SA 1SVEA 5KX8A 3QGYA 2JAVA 2WQMA 3KXGA 3Q04A 4Y83A 3ZC5A 4BKJA 3DFCB 1S9JA 2WKMA 4QPAA 2C0TA 4O7YA 2HY0A 4CRSA 4ZZOA 3IG7A 4G2FA 3EHAA 5H3QA 3Q3BA 4GIHA 4LV8A 5KZIA 4FG9A 2I0HA 4ACMA 3CCNA 3V6RA 3IGGA 2VUWA 4RVTA 4Y72A 3PE1A 5I9YA 4O7NA 2IVVA 3EN9A 4CFFA 4AT5A 1YDTE 3PY0A 4CYIA 2VTAA 5CT7A 4C2VA 2X0QA 4IZ5A 2ONLC 2CHLA 3QL8A 4UX9A 3ERKA 3BELA 5E7RA 2RFSA 3EQGA 4O0YA 4GEOA 4D28A 4GUEA 4KBAA 2C0OA 3KFAA 3DB8A 1H1RA 1PMEA 2JIVA 4ZTNA 1H25A 5EYKA 4D5HA 1H8FA 4HVIA 2X7OA 2VTNA 3OC1A 3IONA 3OBGA 3AMAA 2R3RA 4AOIA 3G33A 3DQXA 3CPCA 4U6RA 1Q8YA 3ZLSA 4BIBA 4D9UA 2XYUA 3A2CA 3KCKA 4XP0A 5FD2A 4BDKA 2W05A 1IAJA 2YJRA 5DYJA 1AQ1A 3SXSA 5L2SA 4NW6A 4ACHA 4F0IA 1L8TA 2HXLA 3THBA 2P33A 4BDGA 4RPVA 2YM4A 4ZXTA 1YXXA 3LQ5A 3LCOA 4ZLZA 3VS1A 3R7OA 2XNPA 2Y7JA 4O0RA 4PPBA 4RIYA 4IX5A 3FZ1A 4A9TA 3TG1A 2XK9A 3TKHA 3ZXZA 2ZJWA 4QP8A 2O64A 3RK7A 3QD2B 4EKKA 5AJQA 5M57A 1H24A 4DT9A 4B8LA 2WMTA 4DEBA 3NVMB 4NU1A 3NFGB 3H0ZA 2ZV7A 4BDJA 4AW2A 2H8HA 4X2NA 1PXLA 3DOGA 2PZRA 1Q8ZA 1OPLA 2ZDTA 2Z02A 3P7BA 2WMVA 4RJ5A 3Q4CA 2C3LA 5B7VA 2GU8A 3W0MA 4W9XA 3P1AA 2XZSA 2WMRA 5CEQA 5LMBA 1X8BA 2WGJA 4QMLA 3UZPA 3LFSA 4AF3A 2VZ6A 3AC5A 3Q96A 3W2SA 4KIPA 4ZJVA 4WNKA 2XK7A 1OKZA 3HUCA 4A06A 2UZDA 2NO3A 4APPA 5KMIA 4BI0A 2GTMA 1NVQA 5CYIA 3RVGA 5LQFA 3H30A 4E4NA 4FZAB 3DKFA 4RA4A 2XEYA 4U80A 4E6AA 1FVTA 4ZEGA 5BYZA 1E1XA 2B7AA 3PA3A 4PP7A 4HPTE 5CEKA 2HYYA 3RPOA 2XM8A 2YM8A 4FGBA 3VBQA 4DH1A 3LZBA 3TUBA 4QO9A 3RI1A 4ZY6A 5E8UA 3OZ6A 5LWNA 2OH0E 4FEUA 3OTVA 1OVEA 4E4MA 4AOTA 3TIZA 4ARKA 4DH8A 3A8XA 1GIJA 5I9WA 4TYEA 4ZIMA 5T68A 3JXWA 3FXZA 2ZV9A 3TZ9A 3NYVA 2PPQA 2BVAA 3VS6A 4C38A 4CT2A 2WOUA 2QKRA 3DT1A 1KV2A 3KRJA 3LM0A 3TV4A 4CMUA 1M2RA 3HV6A 2G2IA 1P14A 3R9OA 5M08A 5JGDA 4QQTA 3QX2A 3VS2A 4L9IA 4F99A 4RJ8A 4I6FA 3WYYA 2I0VA 3KMUA 2YM6A 4IB0A 4DFUA 2OZAB 3U4UA 5IMXA 4LRKA 4GMYA 2OZAA 1W84A 2I40A 3HKOA 4M68A 5A9UA 3D9VA 4BC6A 1XQZA 4LOQA 2HXQA 4QNYA 4LMNA 5HBEA 3MESA 4YJPA 1ZYSA 5TOZA 3OF0A 3P7CA 1E9HA 3OWJA 2RFNA 2BIYA 3L8SA 4KIKA 3RTPA 4I92A 2XNNA 1W8CA 5A54A 3W0SA 1JSUA 2C5VA 4DFXE 3MB7A 3R0TA 5HNGA 3ULZA 3GP0A 3GU6A 5KO1A 4HYSA 4CKJA 3QRJA 5EW9A 1P4FA 4X6RA 3LCSA 4O0SA 3CIKA 4JS8A 2RSVA 4DG0E 3MVJA 3NFFB 2WOTA 3R1NA 4JBVA 3V5JA 2R3FA 4PNIA 4PX6A 3ORLA 3O51A 5T6KA 3W8QA 5E8WA 2WHBA 4XRLA 1KE6A 3EN7A 4QOXA 2BAJA 3EFWA 5BVWA 1UU9A 2YIXA 4ACDA 1LEZA 2NP8A 4LYNA 1L3RE 4BDCA 4CFNA 5EYDA 4ZTRA 4QP1A 3C0HA 4HOKA 1OB3A 2ITTA 4DEIA 3N4UA 3HA6A 4HJOA 5E90A 1FVRA 2YAAA 3BV3A 4YLKA 4IZ7A 4D4VA 4M69B 1Q61A 4M69A 3ZO1A 1VZOA 4K8AA 2QR7A 1Y6BA 3G5DA 3RALA 4BCMA 4F1OA 3AOXA 3CKXA 3CGFA 4RVKA 1CKIA 3KA0A 3FQHA 4YPDA 2F7ZE 3ALOA 5AP7A 1OL2A 4RT7A 5DRBA 3V8WA 4I5PA 3ZM9A 3WILA 1G8AA 3EWHA 3OWPA 4RQVA 1CKPA 2DYLA 4QTCA 5LVLA 2WTKB 5DT3A 3Q2JA 3F69A 4YGAA 2VTTA 3FAAA 4G6OA 3CBLA 3PFQA 4QRCA 4ASXA 2REIA 4BDDA 4WSQA 4EYMA 1OZ1A 3R9NA 1OGYA 5KMOA 1XKKA 4OAUC 4O7VA 4PDPA 2R3GA 4I1ZA 5CXHA 2ZMDA 4I0RA 2JKMA 3QQJA 1R3CA 3FE3A 3PXFA 3A4PA 3VVHA 4AAAA 5A4QA 2Q83A 1REKA 3LMIA 2WPAA 3QX4A 4AXAA 4Z7HA 3QTUA 1LPUA 3TZ8A 4IM2A 3ANQA 4LGHA 3VBVA 3IW8A 5AIRA 1DS5A 4BZDA 4F7NA 2C6OA 5HG7A 5IQAA 1Y91A 3IW5A 1ZY4A 4L7SA 4NM3A 4V01A 2JFLA 1PXKA 2ITUA 3DK7A 3E64A 3C5IA 4ZS4A 1ZYDA 1M17A 2YCQA 3KC3A 5GJFA 5ANGA 3FKNA 3V5PA 3HX4A 4DTAA 3DBCA 3D14A 4QTDA 3TJDA 2YM7A 3VS3A 4FIHA 5ACKA 4RWLA 3MFUA 3L9MA 2VNYA 2PUPA 3R22A 1GZKA 3BLAA 4ZTHA 3GENA 3TIYA 3W2CA 5GIPE 4TZRA 2XALA 2R0UA 4TWNA 4AZVA 1M2PA 3BHYA 5AR3A 4EH7A 3QF9A 4AA5A 4EQCA 3UJGA 4EUUA 2BTRA 4G1WA 4IEBA 5HE0A 3DS6A 4AG8A 4AOJA 5JFXA 1IR3A 3CXWA 1YWNA 3QD3A 4F9WA 4KINA 1OI9A 4NM0A 1TFFA 2RFDA 4JQ7A 4W4XA 4EH2A 3NUSA 5CNOA 4D4RA 3EJ1A 5CTPA 1SNXA 4K33A 4FEXA 3Q4ZA 3MFRA 4IHPA 4ZOGA 3VQHA 3VUGA 5J7HA 5K4JA 4DHIB 3IOPA 3HV7A 4IAYA 4QQCA 4FT3A 4DEGA 2J0JA 4FT0A 2UZWE 4YNEA 1M2QA 2WMSA 4PTGA 3TJCA 4V0GA 4DH5A 3LVPA 3R28A 4XG7A 2G2FA 3OWLA 2Q0BA 2AEGA 3LJ0A 4ANBA 3RNIA 3PP0A 3VF8A 3LXKA 4FV1A 5A4TA 3TZMA 4YP8A 3TEIA 4BICA 4DFNA 4R8QA