2IVVA

Crystal structure of phosphorylated ret tyrosine kinase domain complexed with the inhibitor pp1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
312
structure length
282
Chain Sequence
GPLSLSVDAFKIKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRLTMGDLISFAWQISQGMQYLAEMSLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and chemical inhibition of the RET tyrosine kinase domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET PRECURSO
total genus 90
structure length 282
sequence length 312
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ivvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ivvA01
2CCIA 4D4SA 3HV3A 4BVUA 5HNGA 4UV0A 5HBHA 3OEZA 3W2RA 3DFAA 3DBFA 3C4EA 2PE2A 2G01A 3HV4A 4F08A 1SYKA 2ZM4A 3RAWA 4LYNA 5FD2A 3R9HA 2OGVA 3CKXA 1BL6A 5HG5A 3DQWA 5L2TA 3BYOA 4XP2A 1YDSE 5CQUA 2W9ZB 2WQNA 2LAVA 2I40A 3H4JA 1IEPA 2EWAA 2ZYBA 4KA3A 3RTPA 3KREA 3ZRMA 2GS2A 2VO3A 4IAZA 4L7SA 5AIRA 3VBYA 3W2SA 3EL7A 3VUDA 4AT5A 3AC5A 3ZSIA 3QBNA 5IA5A 2FO0A 4X2GA 1G8SA 3C50A 2XBJA 3Q2JA 2XK7A 5G1XA 3P1AA 4FV3A 4NM3A 3NSZA 4DE4A 5IQEA 3H9RA 3DKGA 2CLXA 3MIAA 3LM5A 3P08A 3KCFA 2IZUA 3KVXA 1BKXA 4FOBA 3L8SA 4U3YA 5CI7A 5HVKA 1UKIA 2YM7A 2R3IA 3L8VA 4AZEA 3NUXA 2HXQA 4AGWA 4V01A 5M4FA 4WUNA 1JWHA 5FM3A 3FC2A 4M69B 4O0XA 2VWBA 5CAUA 4K9YA 3CTQA 2AYPA 5TO8A 5FG8A 4XX9A 3FQEA 3FMJA 5IQBA 1UNLA 3PRIA 2C6LA 3NNUA 1IG1A 4U97A 2BRBA 3TZ7A 2GQGA 4U3ZA 5K4JA 4R5YA 3QTRA 4IZ7A 4MTAA 3R63A 2ONLC 5H8EA 3TV7A 2WB8A 3NW5A 4QMLA 3M42A 2WELA 1M14A 2A1AB 3JS2A 3CSVA 4FG8A 2YIWA 3E87A 5C4LA 4DG3E 4CCUA 4RBLA 4FNYA 5CAPA 1APME 2HENA 3F7WA 5C8KA 4AS0A 4FKVA 4TYIA 3A2CA 1QCFA 3TACA 4O2ZA 3GC8A 2ZOQA 3VBXA 4DITA 3UO4A 3OCSA 3ZDUA 4FKSA 3EFJA 4P5ZA 3V3VA 4L01A 4Z7GA 5IA0A 3GVUA 4FKGA 2UW0A 5IUIA 3QQJA 4AA4A 4WBBB 5CQWA 2P2IA 4HYHA 5I5ZA 3VUKA 3TNQB 3RPYA 2QQ7A 3RGFA 3LFDA 4IAAA 2F7XE 4ZIMA 3JPVA 2C5XA 4WG4A 5J87A 3RAKA 3VW6A 4DFLA 2XJ1A 5LCJA 2WMXA 2C0TA 4J96A 2P4IA 5J8IA 1E1VA 1T45A 3KK9A 2ITPA 4PL5A 1W84A 3LHJA 3RK5A 4F7SA 3CQEA 4OT6A 3O17A 4QMUA 4YNOA 4DH3A 3QQKA 4M0YA 1H24A 5F94A 1B6CB 3DFCB 2QOKA 4MXOA 4DEBA 4IIRA 2PMNX 3NCGA 4KBKA 3TEIA 2XK4A 4FI1A 2ZDUA 3VAPA 4DFBA 5HCXA 4M69A 4ZLZA 4DT9A 3R2BA 5LCKA 4DAWA 4ZJIA 3F2RA 4MQ1A 4RWKA 5AUXA 4AT3A 5AADA 1MRUA 3OXTA 4X3JA 3RVGA 3A4OX 2E9PA 1U59A 3ALNA 3D7TB 3LMHA 2C1BA 1M52A 4JBPA 4J8MA 1O6KA 4OGRA 4U43A 3PVBA 5TOZA 2A0CX 4BWXA 3GU4A 4EI4A 1WBPA 5HG8A 5C27A 3C9WA 4QP6A 4F65A 2JD5A 2R4BA 2VWYA 3DAKA 5EYKA 1X8BA 3LQ3A 4FTTA 2FB8A 4FICA 3RAHA 3ZM4A 4AQCA 4M3QA 4FKRA 3SW4A 4QNYA 5CXZA 4FL3A 4C38A 1SVHA 3FHIA 5BMMA 5AUZA 1Z57A 2O3PA 4GT5A 4E73A 3AT4A 3LFFA 2PUIA 4CGAA 2UV2A 1YXUA 4RLLA 4CMOA 3V8SA 3VS5A 2P33A 4A06A 2QO9A 3LCDA 2OO8X 3F61A 3AC2A 4C4GA 5KHWA 2HY81 2R7IA 5DLSA 3Q4ZA 2GQSA 2X8EA 1V0BA 4WOVA 5E8ZA 3P4KA 1R3CA 2XKCA 4ZY6A 4UWCA 2EB3A 4BCKA 1OKVA 2Z02A 5E4HA 4JLCA 3F66A 3NPCA 3W18A 2RSVA 3UYSA 2UW3A 4F1OA 5IMXA 2CNVA 1QMZA 4OTWA 3N4TA 4YZ9A 3TL8A 5HNBA 3TCPA 1ZRZA 3ROCA 4C37A 5JQ5A 4A4XA 3I4BA 3I1AA 1OVEA 4H3BA 4HGEA 2VTHA 1NY3A 2VU3A 4OTPA 4IVAA 4ZY5A 2EB2A 3K2LA 4FTNA 3HRCA 4FV8A 3GBZA 1W7HA 1XH8A 4D4VA 4GJ2A 5GZ9A 5AX3A 4ZXTA 3R9RA 4D2SA 5I3OA 5K5XA 4D9TA 2YDIA 2HZ4A 2OIQA 3U6IA 3HRBA 3KMUA 4I6HA 4HCVA 4DBXA 4J95A 3MVHA 2CKQA 4LMUA 4M12A 2WTVA 3D7ZA 4QTCA 5FXRA 4JDHA 1GZOA 2JC6A 2BKZA 2JEDA 2WQOA 3CKWA 3OWKA 3F82A 3BHYA 4I5HA 4TYHB 3HUBA 5EDQA 3U4UA 4EOJA 2YAAA 4KWPA 1V0PA 3OCGA 2IG7A 5A6NA 2RKUA 5CI6A 4RIYA 5L8JA 3P0MA 3R71A 4L43A 1ERKA 2RG5A 3QXPA 1YKRA 2Z7RA 4R1YA 1WBSA 2BRHA 2IVVA 4Y85A 3E8DA 4GEOA 4NM0A 2W1FA 4D1ZA 3R9OA 3ROYA 3VBVA 3EN5A 3OCTA 4ANLA 4O27B 4DEEA 5J7BA 5K0XA 4DCAA 2XCKA 2PZYA 5ITAA 4DH8A 3LZBA 5AV2A 3NVMB 4TW9A 4EOOA 5A4QA 3CCNA 3RINA 4QQJA 5HTCA 3FUPA 3CC6A 1REJA 1Q99A 3THBA 4EZ5A 2WKMA 1I09A 4B8MA 3LMIA 4CLIA 1PXPA 5AP5A 2QNJA 5CZIA 2UZVA 2G1TA 3PE2A 5EK7A 3ANQA 5GJDA 4N6ZA 4IZAA 1OPLA 2R9SA 4GS6A 5M4UA 3KC3A 3R7VA 4G6LA 3KXXA 1IA8A 4BDBA 3GQIA 3H0YA 4FYNA 4C3PA 3JY9A 2ZAZA 4E5BA 4RJ8A 4AW0A 1Y8YA 4LG4A 3QHWA 3VQUA 5IQAA 4U6RA 4L53A 5BUIA 4DG0E 1ZYCA 3SG9A 2OXXA 1OBGA 4IJPA 5F95A 2BVAA 4I1ZA 3ZXZA 4EKLA 2UW6A 1A48A 4MBJA 2E9NA 4IACA 5CF5A 2CGUA 3BU6A 3SXFA 1XKKA 2LGCA 1IAJA 4FIGA 2X7OA 3SRVA 4EORA 1Q3DA 5EHYA 4DFYA 5M4CA 2ERKA 2G2FA 4OTGA 4AAAA 3GGFA 1JAMA 2PVYA 3LXLA 3OW3A 4MXYA 2J9MA 2VX1A 4JQEA 4CRLA 3UQCA 3OBJA 4O0UA 2C0IA 4KB8A 3HGKA 3LFEA 4MK0A 1HCKA 2X4FA 2Q0NA 5KKRC 3BI6A 3VJNA 2B9HA 5FEQA 1R78A 2O8YA 2R3MA 4IVDA 2QOLA 1YXXA 4Z3VA 4EOIA 3G9NA 2WZJA 1KOBA 2QVSE 4JDKA 5HE3A 4FZAB 4A9YA 3G0EA 3BZ3A 3PDTA 2VWIA 2OF4A 4FIJA 3I6WA 4K18A 3GT8A 2JDTA 4ANNA 4BWKA 3FJQE 1JKTA 2YITA 3A7FA 3KEXA 4R7HA 5HD4A 4OBOA 1OIYA 2W9FB 3E8EA 4PDPA 4XG7A 4D58A 3IW6A 3RNIA 1ND4A 5IQDA 2OZOA 4IDVA 2IVSA 4FTJA 4M15A 4CD0A 4L9IA 3R9NA 2RL5A 3WZUA 4O38A 4TYEA 4RX7A 2QOIA 2VWUA 4B4LA 5JKGA 4JQ8A 4QP9A 4X2FA 2YWVA 5G6VA 4EYMA 2BZJA 4FTOA 4U81A 2CHLA 1PHKA 2ITVA 5EQYA 2J2IB 2IZTA 2ZM3A 3QD0A 2B4SB 4LV5A 4MH7A 5DYJA 3RHKA 5LWNA 2C47A 3QQHA 4ENXA 1PKDA 2YAKA 4NT4A 4RX9A 3T9TA 4DFUA 4GUBA 4WSYA 1U46A 3VS1A 3MJ2A 1OZ1A 4O6EA 4RX5A 3GCPA 1UWJA 4ZSEA 2CN5A 3FHRA 1JQHA 4M97A 2O63A 2WTKB 3KVWA 3NUPA 4II5A 4IXPA 3ZUVA 4YLLA 5CX9A 4W4YA 4CFMA 4EZ3A 3C4ZA 3N4UA 4MXCA 1GOLA 4XLIA 5L6WL 4AU8A 2BAJA 3FAAA 4BHNA 3LCKA 4FZ7A 3V5PA 4TN6A 5H2UA 4NM5A 4I0TA 3UOJA 3FMLA 3P79A 3EYHA 4A9RA 5E92A 2JGZA 4FTLA 2YEXA 4DGGA 4FG9A 4C4IA 3PLAE 4DC2A 2YM8A 3A60A 3ZEPA 2R0UA 4FNWA 4CYIA 5AV4A 4FTUA 4ZTNA 3WI6A 2BKKA 3KRRA 3KFAA 4FSWA 4IC8A 3DNDA 4ANQA 3Q04A 1YVJA 2XBAA 5AP2A 4O91A 4EOQA 4YUQA 2V62A 4ZTHA 3FZPA 3UNJA 4CXAA 3U55A 3A7JA 4BRXA 2AC3A 4ARKA 3FWQA 3AT3A 5TE0A 1PMEA 4YZDA 5EOBA 3NNWA 3F2AA 3EB0A 2W7XA 4IM3A 3L9LA 4ZZNA 5HORA 2B9FA 1A06A 2I0EA 3ENMA 5BVFA 3D2KA 2HWPA 2C3KA 2C30A 4NU1A 2VNYA 4DFZE 3E3PA 4DH5A 3QTIA 2YLFA 3ACJA 1I44A 5BVWA 3KQ7A 3ZFMA 5AMNA 5L8LA 2UVYA 1ZAOA 1FBNA 3KL8A 3CLYA 5DOSA 2A2AA 3AD5A 4W4VA 4LOQA 4OLIA 4J8NA 1JLUE 4E20A 3IK3A 3NEWA 4EKKA 2RGPA 3VS2A 4G6OA 5K0KA 4MAOA 4RC3A 3G2FA 3R2YA 1YRPA 3EKNA 4AF3A 3ZCLA 4DLIA 2X6DA 2C6KA 3RWPA 4F6SA 5I4NA 5CYIA 2J5EA 4L52A 3HMIA 5AAFA 2VN9A 2V0DA 2QODA 2VTQA 4GU9A 3FXZA 3ZRKA 4R8QA 4AN2A 5AAEA 5LVMA 4HGTA 4UWYA 3F5UA 2OF2A 3W10A 5IQIA 3S0OA 4CKIA 3OMVA 4JX7A 4KKEA 5AUTA 4AZWA 3IOKA 3P7BA 5I3RA 3MPAA 4IHPA 3QC9A 2YLEA 3PA4A 5CALA 4F9WA 4O7YA 2C6TA 4RJ5A 1RE8A 2WHBA 1JVPP 2C0OA 4E4NA 4P7EA 5LVPA 4D1XA 1J1BA 1W8CA 4FSMA 4FTMA 3CP9A 5DNRA 3E5AA 4J98A 4MNEB 4QRCA 1PXOA 4NSTA 5HIBA 5EM7A 4DYMA 5B7VA 4AFJA 2GMXA 2XNPA 3AGLA 4JRVA 4BCGA 1QPEA 3CXWA 4BGGA 2G9XA 4BGHA 5E8SA 5JGBA 3G15A 2E9OA 1P5EA 1YOLA 3CD3A 3GC0A 3TUDA 2W4OA 4ZSAA 5HU9A 3V8TA 3VNTA 3IS5A 4YHTA 2I0VA 3UO6A 1IR3A 4PL3A 4RC4A 4XG3A 2R7BA 5EH0A 4I4EA 3SV0A 3V5TA 4O83A 3WYXA 2X7FA 3FMEA 3QXOA 3QZFA 4FC0A 4EH5A 3R8UA 2VO7A 3ZEWA 4UXLA 2B55A 5D7AA 3D2IA 5LARA 2WTWA 2QOQA 3A7HA 4G9RA 4JG7A 2RFNA 3ZC5A 4BCHA 3KRWA 5B2MA 2Z7SA 3QTZA 2HAKA 3KRJA 5B2LA 4QTDA 3ZLWA 5K9IA 5ANIA 3R22A 3KULB 3Q52A 4BZDA 3SC1A 1H28A 4EOPA 2UZUE 4YHJA 2JBPA 3PZHA 1QPJA 3FV8A 4O2PA 1WVYA 2VAGA 5DIAA 1K2PA 3BLQA 5T6KA 4ASXA 4CFUA 3QZHA 3NLBA 1GY3A 3PA3A 2JFMA 1XH5A 3IGOA 4N6YA 4BKZA 2Z7QA 3MGYA 4D2RA 2OFUA 4CTCA 4XUFA 4ZJJA 3FQSA 1CMKE 2YZLA 2XNEA 3U9CA 3MTFA 2JKOA 3QQFA 3BKBA 3DV3A 4JNWA 4WD5A 4F63A 4C7TA 4DN5A 3I5NA 3RK7A 3R1SA 3BEAA 2Z2WA 3E7VA 3DAEA 3LLTA 4Z9LA 3HP5A 3MVLA 4R3RA 1OI9A 1CKJA 4FTKA 1DAWA 2QR8A 3FKNA 4IM0A 5AM6A 5AR8A 4C2VA 1WVWA 4RA4A 4YR8A 5AEPA 4USEA 3SD0A 3DJ7A 3PY3A 3FQHA 4PDSA 4CLJA 2E9VA 4X2NA 5DR6A 1BI7A 3UG2A 5LOHA 3GU6A 5A4EA 3QWJA 2WIPA 3TNWA 4QP1A 2GDOA 1STCE 5DPVA 5L2QA 3R1YA 4EOKA 2Z7LA 3O23A 1H25A 1H27A 3HRFA 3MFTA 4RVMA 5CASA 5CU6A 2PPQA 3BGZA 4UB7A 3P23A 3P5KA 4HW7A 1SVEA 5EYDA 2QKWB 1NVQA 3LXKA 4QMWA 4LOPA 3RBWA 4PPBA 3NCZA 4K33A 4Y83A 3D15A 3EMGA 5ACKA 4F6WA 5HQ0A 5L2SA 4O81A 3Q2MA 3KMWA 3LLAA 4ZSJA 5CEOA 5IH4A 3QX4A 4EYJA 2QU6A 3RALA 1CM8A 3UOHA 2XEYA 3I60A 5EDRA 4BDIA 2XIYA 3PXFA 4A9TA 1MUOA 5E1SA 2EXMA 3TM0A 2X1NA 4AZSA 2YIXA 4BBFA 5TT7A 5HBJA 3U6HA 3DGKA 3TN8A 3JXWA 3NWWA 3UDBA 3LXNA 2YCFA 3BV2A 3BWFA 5ANDA 5JZJA 1HOWA 2ZV2A 3FYJX 1H1WA 5M56A 2PWLA 3PSCA 2VTPA 2C5OA 3OT8A 3ZFXA 4EBVA 4RVTA 2O65A 3DCVA 5ETAA 4C35A 4D5KA 1GIHA 4JX3A 3FZSA 3WBLA 3SGCA 3GFWA 5GJFA 4C3RA 4AP7A 3MBLA 1FVRA 5IG1A 3DXPA 3F7ZA 5E8VA 2ACXA 4LI5A 2ZDTA 1W0XC 2ZV8A 4JR3A 3ZONA 1H00A 1OUKA 3DK7A 4FVQA 5C26A 2C6MA 2IW9A 4EQMA 2QO7A 5AFVA 2BAKA 3ET7A 4O6LA 3ELJA 5FTOA 2OIDA 1PW2A 3Q32A 4NCTA 1Q24A 3OUNB 4XEYA 1V1KA 3UC3A 2CLQA 3GXLA 4BTMA 1UNHA 3VIDA 2C5NA 3EQDA 5EM8A 5ETIA 4AE6A 2ZV7A 2BPMA 4H58A 2VTOA 4CKRA 4IBMA 5J95A 4AGUA 5M51A 1XBAA 2C6DA 3GC7A 3GB2A 3I0QA 3QQLA 5EM6A 4NK9A 3D5VA 3JVRA 2YFXA 4O7LA 3LQ8A 4FGRA 5I9VA 2ETKA 2XVDA 4FYOA 4MCVA 4FKLA 4RFMA 4W8EA 4ZOGA 5FXSA 5IQFA 3UQGA 2RFEA 4HYUA 5DN3A 4PL4A 3R73A 3HMNA 4R1VA 4RIXA 2OG8A 1FGKA 1LEWA 3VS4A 4BIBA 4AA0A 3A61A 2ZVAA 4FUXA 3U6JA 3AC4A 3R83A 4J99A 4LV8A 4QP8A 5DH3A 4FT5A 4BDKA 4U42A 4ZMFA 3V5WA 2GNJA 3VO3A 3WZDA 4H05A 3ACKA 2C6EA 4FOCA 4YNEA 4X2JA 4ANMA 5IA4A 2DQ7X 2QCSA 3QC4A 4CV8A 1JNKA 1TKIA 1CTPE 3K54A 3Q60A 1Q41A 3DDQA 4QT1A 2WTCA 4NWMA 5JFWA 2J90A 3QRIA 5A6OA 4JXFA 4CNHA 5I0BA 2XIKA 2WXVA 3MWUA 4GFMA 3H0ZA 2UVXA 3MI9A 4BZOA 3W32A 4QYFA 2WU6A 1J7LA 5IZFA 1FGIA 4X0MA 2OJJA 5CVFA 2CKPA 5DEWA 4FEUA 3NZ0A 5CNOA 2WTKC 3NR9A 1XBCA 5L2WA 2IN6A 3TV6A 2WMWA 5K3YA 3QZGA 3RPRA 3WIGA 3EZRA 2QOHA 3OG7A 4L44A 4MNEA 2X2KA 3UTOA 2BHHA 4G2FA 2YCQA 4OBPA 2CSNA 3JYAA 2ONLA 1WCCA 3AC1A 2JBOA 3ORLA 3QRKA 4H1JA 4YC3A 4DGMA 4M0ZA 2BMCA 3WF5A 4JG8A 4RFZA 2QC6A 2IW6A 3QGYA 2OH4A 4M66A 4FSYA 2UZOA 4BN1A 3BYUA 4RJ4A 5EW3A 4I20A 3SRVB 3O7LB 2CNUA 5HTBA 2RG6A 2H9VA 2NRUA 1T46A 3HL7A 3P78A 4FTIA 4GIIA 2PVJA 4UALA 3V5LA 5KKRB 4F1TA 3LJ0A 1Q5KA 3DK3A 4BTJA 5KMKA 3D5XA 4KIKA 4CRSA 3BHVA 4FGBA 5DT4A 4MXZA 2BCJA 4U9AA 2ETRA 2HW7A 1UNGA 5CF4A 2BR1A 3DT1A 4TKSA 2VTAA 4C8BA 5L4QA 5AJQA 3A4PA 3LFCA 4OTHA 4FKQA 1U54B 2F9GA 3BV3A 1PF8A 2V7OA 3OUKA 2C5VA 3VS3A 4Y72A 3RJCA 2QR7A 4XOZA 3OEFX 4IH8A 2R0IA 3HEGA 4PWNA 1Y6AA 5F4NA 3UJGA 4Q9ZA 3ZDIA 4NH1A 3ZZEA 4CQGA 1XH9A 5BYLA 2G2IA 3NW7A 3PXYA 4LGDA 5JZNA 3ZO2A 4PMPA 3UIXA 3LAUA 4CEGA 1WFCA 4W9WA 3UOLA 3HV5A 5CAOA 2BZKB 1DI8A 3U87A 4D2PA 4UMRA 1FVTA 2R3HA 5JH6A 3DS6A 4D4RA 4H3PA 4ZLOA 3ID6C 4AA5A 2VO0A 3MY1A 3Q4CA 3F3VA 4RQVA 5FXQA 4M7IA 2IVUA 4LUDA 4QMOA 4UZHA 2IWIA 3DZQA 2GNLA 3TDVA 3AGMA 2WAJA 2F2CB 2XS0A 3R04A 4FX3A 1P14A 1R39A 4IB0A 4L3JA 4C58A 1CKIA 4KBAA 3MTLA 5CWZA 4RQKA 3PWDA 4HCTA 4CMUA 5JQ8A 2UZLA 2UW7A 3W16A 1Y91A 2CGXA 2O0UA 4FKTA 2XA4A 4QYHA 4CV9A 4MKCA 4AOJA 1P4OA 3PY0A 2WOTA 1PMNA 2PULA 5EQPA 3HA8A 4NYEA 4ORKA 4F99A 3FI2A 1KE5A 5HI2A 2BRMA 3OZ6A 4UEUA 2VTIA 1OECA 2I0YA 3IDBA 5BVDA 4EH2A 4A07A 2Z8CA 2J5FA 4IWDA 2JITA 4FKPA 3KU2A 3TV4A 3FXWA 2GQRA 2WEVA 5LVLA 4X6RA 3KCKA 4JT3A 3BYVA 3EZVA 4LL5A 4CFNA 5AIKA 3MFSA 3MV5A 5HIEA 3E64A 5A4TA 4FZ6A 1JKSA 4O0VA 4F64A 3R7OA 3UP2A 2GHLA 2VX3A 2BFXA 5L3AA 2GSFA 4PPAA 4BF2A 3HX4A 4FUYA 4GKHA 1RQQA 3E8NA 4YMJA 3EJ1A 1J1CA 4FTQA 3TNIA 3FSFA 4F7NA 5JN2A 4RVKA 1DS5A 3LW0A 3L9MA 4GUEA 4CCBA 5JMSA 4XV2A 3MS9A 4PMMA 2VWVA 4FV0A 1TVOA 3QKLA 3MY0A 4D2TA 2X0GA 4DFNA 4W4XA 1OIUA 5M06A 1BLXA 4O0WA 3IONA 4IMYA 5DEYA 3FDNA 2WTIA 2GTNA 5EI6A 4Z16A 5KMOA 3WE4A 3ZUUA 3DTWA 1GZNA 2DS1A 3NIEA 2GHMA 1WBVA 3WF6A 5AV1A 2OLCA 2W5AA 3TDWA 1B38A 2JDRA 4G31A 4CFFA 3L8XA 4D2WA 3DB6A 3UYTA 3F5PA 2A19B 3KB7A 1YHVA 3AMAA 4OTIA 4BFMA 3DA6A 4A7CA 3EHAA 4USDA 3ANRA 4YTFA 4BDAA 4Y46A 3U54A 1M7NA 4L46A 4IWQA 3NUNA 4C59A 3NNXA 3TJDA 4EHGA 4E5AX 1ATPE 5HGIA 4RIWA 3ULIA 3KY2A 4YPDA 3DBCA 4CTBA 2W4JA 5HCZA 4L7FA 2BZIB 3C51A 3UOKA 3EQPA 2CGWA 3TKUA 4WIHA 4G3FA 2YDKA 3DOGA 3FLNC 4H36A 5E91A 3MFRA 2PTKA 3BYSA 3LJ2A 4JBQA 4C2WA 4XBUA 4L3PA 4QPSA 3KN5A 2ZJWA 3QTXA 5HG9A 2V22A 4JDJA 4BB4A 4G34A 3H9OA 4EEVA 1BL7A 3QUDA 4S32A 5F20A 4PTGA 1DAYA 1BMKA 2YDJA 4WHZA 5T68A 4F6UA 4MQ2A 5CU2A 5A9UA 4QTAA 3NYVA 3BHUA 2W06A 3NAYA 1YDTE 4J97A 4J53A 3TT0A 4HZRA 3H3CA 3QAME 4QQCA 3OCBA 2YIYA 4E26A 1NVSA 3QTUA 1MQ4A 2PVLA 5A3XA 4FT9A 4GK2A 3RZFA 1JSVA 4QMYA 5CNNA 2XNOA 4DINA 1S9JA 5FBOA 4Y95A 1FQ1B 2OH0E 2ZB0A 3NX8A 5CF6A 4G5PA 3COMA 1OGUA 3VBQA 3KKVA 3EQHA 4WNMA 3MW1A 3DKFA 3ZLSA 2Z60A 3VJOA 2E2BA 4YO6A 1Y6BA 3G33A 5LVOA 3FZRA 5AV3A 1J91A 1OPJA 2XUUA 3FZ1A 3VUHA 4AX8A 3E3BX 1OL7A 3SXRA 4CSVA 4F9AA 5EDPA 5TF9A 5HO7A 4GSBA 4U79A 3V8WA 4KABA 2H6DA 3POOA 3OWLA 4XS2A 1WVXA 5H8BA 4I22A 4BCMA 4FIEA 1SNXA 4WNOA 1LUFA 4QPMA 5KUPA 2X39A 4KRCA 5BVKA 5HCYA 3QU0A 3EH9A 3FKOA 3AQVA 3ENHA 3IG7A 5KNJA 1ZARA 2JKQA 4RA5A 4YPSA 3TXOA 1H01A 1UU3A 2UW8A 2B0QA 3VVHA 3RPSA 3M2WA 5KZIA 1H4LA 4YZBA 4J7BA 2C6OA 2QOFA 5AUUA 3UNKA 4JVGA 4J1RA 5EG3A 1JKLA 5AR7A 4BYIA 4C34A 4K8AA 4HVGA 4DTBA 5JK3A 2YWPA 3SX9A 4UMPA 4FSRA 3MVJA 4ANOA 2ERZE 4FBXA 2VTMA 5EM5A 2EVAA 4RLKA 4E7WA 5IEYA 5J5SA 3LVPA 4NW6A 3FKLA 4FT3A 3UG1A 5DMZA 3BE2A 2BIYA 4KSQA 5AA9A 4JQ7A 4IZ5A 3MJ1A 4HVSA 3CBLA 2NRYA 4HJOA 4DBNA 2PY3A 1XR1A 2Y8OA 3PXKA 2WMBA 5C8MA 4DH1A 3HDNA 2GU8A 3RZBA 4C57A 3O2MA 2V5QA 4BI0A 2VO6A 4ACMA 1NW1A 4E4LA 2CJMA 4FSUA 3UO5A 3MY5A 4B99A 4CKJA 4FEXA 2O2UA 3BE9A 3DJ6A 3QL8A 5BYYA 2UZWE 5GIOE 3ZMMA 2W96B 3H30A 3CIKA 3OF0A 3OOGA 1BYGA 1URCA 4CT2A 3MIYA 5FRIA 2BDJA 5BUJA 1FMOE 3ODZX 4MHAA 2CMWA 3PTGA 3QGWA 4EK8A 2W99B 3CY3A 1ZMWA 2XKEA 4S30A 5TR6A 3ATSA 5HU3A 3I79A 5LMKA 2C3LA 1PMVA 5HE0A 4HVIA 4WRSA 4Q5HA 5AUWA 4TNBA 3SG8A 2C69A 5CANA 2XK6A 3RAIA 2HZIA 3FMDA 4O7TA 2PE0A 3MH3A 3R1NA 2YZAA 4TWPA 3OTUA 3C4WA 4PMSA 3TKIA 3VRYA 3IW4A 4W4WA 3LMGA 3ZZWA 3EQRA 4L42A 3FLWA 3W2CA 4FNXA 4BCPA 1ZYDA 2H34A 4Q2AA 5DE2A 4DH7A 4Q9SA 3VUTA 3CE3A 3EFKA 3GCVA 4ZTQA 4K6ZA 4ZP5A 4KAOA 3UODA 3ZO3A 3AXWA 4E6CA 5IUGA 3UZTA 5DHJA 5DG5A 2RF9A 3FLSA 2AUHA 1ZY4A 2QLUA 5IEVA 3PPKA 2R64A 2WQBA 5FTQA 4G17A 4DLJA 3N51A 2WGJA 4RMZA 1YQJA 2UW5A 2BAQA 4EHZA 3ZHPC 4IW0A 5KZ0A 3R6XA 4F9CA 1GNGA 3F3TA 4FTRA 4MX9A 2P55A 2JAVA 5A46A 1IA9A 5M07A 4A9UA 1IASA 2FSOX 2Y6MA 4HOKA 3D9VA 3C4FA 3E88A 3EQFA 4I5PA 5CTPA 3PWYA 4I3ZA 4R3CA 1YI4A 5HLWA 3NUUA 4TL0A 3LQ5A 2Y6OA 4EH7A 4RIOA 5K5NA 3EN9A 3N9XA 5HNIX 1PXIA 1GIJA 2PUPA 2UZDA 2W1ZA 3VN9A 4C62A 3LFBA 4LGHA 3VRZA 3SHEA 4FEQA 5FQDC 3NUSA 1CDKA 4AN3A 5JRQA 3BPRA 4JG6A 4AW5A 2W5HA 3COKA 4ANBA 2AC5A 3SOCA 1NT2A 5CEMA 3E92A 1YWNA 3E7OA 2PZPA 4FODA 1LPUA 1PJKA 1YXVA 3R8ZA 4HCUA 5FDXA 5EKOA 2R5TA 5LVNA 2X2LA 3SVVA 4RJ3A 2OXYA 3DBEA 4BY9E 3CJGA 4WO5A 3R7IA 3UMWA 2OJ9A 2WO6A 3Q3BA 4BCIA 1NXKA 4O0SA 3W33A 3HMOA 4TWOA 1MQBA 4AWIA 4Z55A 3PP0A 4G3CA 4IEBA 4O21A 4V0GA 5LMAA 4QTEA 4M84A 1Q8WA 4F7LA 3ZSHA 3FMKA 3R21A 4MF0A 2NNWB 5AP1A 1Q8UA 4FL1A 3MB7A 4ZSGA 2V7AA 4BTKA 3R8PA 2PUNA 2XYUA 4TWCA 3RI1A 1F5QA 3EN6A 2XNNA 3KRLA 3O50A 4G3GA 3AMYA 2PSQA 3PVWA 2O64A 2WMSA 2JIVA 2HELA 4K77A 1HCLA 2IJMA 3MFUA 4LFIA 5KMMA 1YWRA 3ALOA 3COIA 3HZTA 3M11A 4IAKA 3MDYA 2OZAA 4QYGA 5A54A 2VGOA 4QYYA 2SRCA 4EC8A 2FVDA 4CG8A 2G2HA 3OC1A 4AN9A 3GI3A 3W2PA 4TZRA 3R02A 3ZO1A 1UU7A 4EL9A 4PNKA 5IQHA 3QQUA 4XHKB 4FEWA 4AZFA 5AP6A 4APPA 1G3NA 3R8LA 2WMRA 4M14A 3TZ9A 3CY2A 3HKOA 4NTSA 4ZZOA 2B54A 4O1PA 2QI8A 3G90X 5HE2A 4AGDA 3KA0A 4QMTA 5HLPA 3CQWA 4S34A 5LWMA 5C8NA 2JKKA 3HAVA 2XB7A 2PK9A 4YJSA 2P3GX 4C33A 5LMKC 1V0OA 4EJ7A 1ZXEA 4XJ0A 4CZUA 3HV6A 5IF1A 3V51A 5EOLA 4MWHA 3ULZA 5D10A 3FI4A 5HBEA 1H1QA 3PJ3A 1H0WA 4XP0A 4RJ6A 4F0IA 4ZTSA 3WE8A 4BCOA 4FZFB 4HPUE 3IW5A 4GYIA 4EOLA 3EWHA 4O7VA 2X2MA 4NFMA 4CG9A 3TNHA 2ITTA 4UY9A 4LMNA 3HUCA 5CZHA 4XLVA 4BCNA 2J0JA 4IAFA 4MD7E 4FR4A 4FT0A 4R78A 4FKJA 5BUEA 1QPCA 1XH7A 2DYLA 3NDMA 4MWIA 2OI4X 4NTTA 4YJUA 3MA3A 2WD1A 2OSCA 3C0GA 1H1PA 3QLGA 3MPTA 1G5SA 3ZLYA 4Y5QA 4KD1A 2Y4PA 3FZOA 3PSDA 4BC6A 5BYZA 2ITUA 2G15A 3U8WA 2GNHA 5HO6A 2PZRA 4R6VA 4FV7A 2R2PA 3HDMA 5CVHA 1AD5A 3MH1A 1BI8A 2JDSA 2NO3A 1OKWA 3BCEA 3DKCA 3QCYA 4S31A 3BELA 5AR3A 3GFEA 3ORKA 2EUFB 3ETAA 3V04A 4AZVA 3ORXA 4U40A 2QU5A 1TQIA 2HIWA 4I94A 2JAMA 3Q53A 3UVQA 5AX9A 4BWPA 3PYYA 4OW8A 4ALWA 3LOKA 2YIRA 3R00A 2J0IA 3VHEA 4ACHA 4IE9A 3FMNA 5HX6A 2XKFA 4I21A 1QPDA 4B9DA 4BI2A 1OBDA 4OTQA 4U8ZA 4YHFA 1W82A 4ERWA 3EYGA 5ANKA 5IA3A 4DTAA 2XCHA 3W8LA 5C4KA 3QUPA 4C02A 4L6QA 3O71A 4I4FA 4YP8A 3S4QA 4FKOA 4R5SA 2YJRA 2J4ZA 1XHAA 2W1IA 3I7CA 5DBXA 2BROA 3RWQA 2CKEA 2GCDA 3NYOA 5HEZA 3Q96A 3GNIB 3KXNA 4GVJA 2Q83A 3TTIA 4NJ3A 2UZBA 3ZLXA 2YIQA 2F7EE 5ANJA 2Y0AA 4TYGA 3ORIA 4BKYA 5CSPA 4E4XA 1Q3WA 2ITQA 5KMIA 1JSUA 2PMIA 1M2QA 2QOBA 4FVRA 4IZYA 3WZEA 4BDGA 5FTGA 3VQHA 3AD6A 3D7TA 1H08A 4ALVA 3A7IA 2B9JA 4LM5A 4XYFA 4GJ3A 2JIUA 4F1MA 4GH2A 4BR3A 4I6QA 4CFXA 4O7ZA 5J9LA 4MXAA 4PDYA 2J0LA 4C4JA 4ZLYA 3IOPA 4DEHA 4QOXA 1Y57A 2C6IA 5KMNA 4GK3A 2Y7JA 4EH8A 2DUVA 2IZRA 3BQRA 1PXMA 3B8QA 3IDPA 3ZS5A 5I9XA 5GHVA 4YSMA 2WMTA 3QCQA 2F49A 2GFSA 3KF4A 1JBPE 2IO6A 4NJDA 4AUAA 5J79A 1ZLTA 2C68A 2I1MA 4PX6A 3MPMA 2XNGA 4X3FB 4FEVA 2PVNA 4FVPA 3NUAA 2B1PA 4EH4A 1B39A 3CTHA 4EWHA 5EHLA 5BNJA 2XK9A 3E63A 4AOIA 4U45A 2VTTA 3F5XA 4CZYB 4FTCA 5E1EA 5CU0A 4G1WA 3R7EA 3E8CA 1GJOA 3JVSA 2H96A 3LXPA 4W8DA 5EYMA 1AGWA 4KSPA 1OL6A 4RSSA 4DFXE 3D83A 5AUYA 4YSJA 5ICPA 3WOWA 3TJCA 4RWLA 1YOMA 3Q9XA 1OIRA 5DWRA 3SKCA 5DR9A 2ZB1A 2VD5A 5CSXA 1XO2B 1OITA 3PPZA 3UGCA 2VTSA 1U5QA 4JOAA 1QL6A 4UBAA 2YCRA 2QD9A 4EZ7A 4HVHA 4GG5A 4D9UA 4BI1A 4DEAA 3ORTA 3C0HA 4KIKB 4MBLA 4OTDA 4UX9A 5LXMA 2X9EA 3C7QA 3NRMA 2W1DA 1YWVA 4MD9E 4LUEA 4U80A 4QMMA 4XG8A 4YZMA 4O7WA 2J51A 4IWOA 4XG4A 1ZOEA 3IW7A 4OBQA 3R7UA 1PXKA 4E6QA 5CAQA 4EOMA 1XBBA 2XRUA 5JGAA 2R3RA 3CTJA 4NIFB 4JAIA 5C01A 3F3ZA 4E6DA 1E1XA 5FM2A 5HO8A 3FLQA 4O82A 2B9IA 4XV1A 3GOKA 4IC7A 3BGQA 4V0GB 4PTCA 3KULA 3PG3A 4ZTRA 4RIWB 3U51A 2BALA 1WMKA 2YM6A 3EQGA 3HYHA 5HVYA 2BTRA 5CLPA 2CCHA 3R0TA 3DZOA 5TKDA 5HTIA 4HVDA 3UNZA 3PIXA 1YI6A 3E62A 3V5JA 5A14A 3BHHA 2W0JA 3Q9ZA 4MBIA 5CS6A 3OP5A 3AOXA 3PFQA 3EN4A 3UZRA 3LKMA 2PVKA 3R9DA 2QHNA 5BX0A 5CT0A 3A8XA 1PXLA 3KMMA 3NUYA 4QMNA 5M57A 2Y4IB 2XK3A 2V55A 2R3JA 3AT2A 3POZA 4FT7A 4JJRA 3WARA 1PKGA 2XNBA 4PY1A 3TIZA 3W8QA 3KXHA 5AR4A 3HECA 3HA6A 4CT1A 4FZDB 3HLLA 3NS9A 1DM2A 3PXZA 2ITWA 3C5UA 4KINA 2YISA 5JFSA 2XJ0A 2QO2A 4RIYB 4EUUA 3OXIA 5HE1A 5GZ8A 1A9UA 3IO7A 3PJ2A 4PNIA 3TG1A 3MH0A 4FSTA 2NPQA 5IPJA 4YJTA 5JT2A 2W1CA 1YHWA 3A7GA 1JKKA 4EK3A 5AR2A 5DVRA 3WIKA 3DU8A 4IDTA 4ITIA 4P5QA 2FSTX 3ORNA 4IX5A 2ESMA 2R3FA 3NYXA 3LCSA 5KE0A 2HY0A 4QMQA 3QKMA 4TT7A 5E90A 5DRDA 3SXSA 2GNFA 3QWKA 4IX3A 5D11A 3FI3A 1UWHA 3TIYA 1PMUA 5C9CA 5B2KA 3VBWA 4K1BA 2WTDA 3O8UA 4G6NA 4GV1A 4QNAA 5GJGA 3ZC6A 4EOSA 4JIAA 1U5RA 4HNIA 3VWAA 3IDCA 4D4YA 2HK5A 1RW8A 3L8PA 4KIPA 4R3PA 1FOTA 5FEEA 4ENYA 3NMUF 5IU2A 2XKDA 3H9FA 5IH5A 4N57A 4BBMA 3NAXA 2PVRA 2CN8A 5CU3A 1K3AA 3CPCA 3UZPA 4I0RA 2OW3A 4RG0A 4M68A 2C3IB 3V01A 4C4HA 1P2AA 4G3DA 2R3KA 1O9UA 3OWPA 5FP6A 4GW8A 2IVTA 2XZSA 2KTYA 4CFVA 1UV5A 1IAHA 2FH9A 2W5BA 3O51A 3RP9A 3VHKA 4O86A 4AW2A 2ZMCA 3JUHA 2XJ2A 4JAJA 3QD2B 3ZYAA 4UN0C 3GUBA 4JRNA 4YJVA 4KUJA 3FMMA 4O22A 5EI2A 3G5DA 3PJ8A 1U4DA 2OJIA 2EXCX 2OFVA 4GCJA 4LOOA 4X3FA 4APCA 2IW8A 4BZNA 2GNIA 4TTHB 3QCSA 4UMQA 4ZSLA 5IEXA 4GT4A 1NA7A 4EUTA 3DPKA 4M13A 4F09A 5D9HA 5JFVA 4KIOA 4JL9A 2GS6A 3VS0A 2OBJA 3A62A 2CKOA 5IMEA 3O96A 2BUJA 4TYJA 4MF1A 4QMVA 2HZNA 3E93A 4WG3A 4JIKA 2PMLX 3ZXTA 1OMWA 5AV0A 4OAVB 3BIZA 1XH6A 4WUAA 5C03A 3QFVA 3GEQA 3QRJA 5DT3A 1MRVA 1RJBA 1U54A 2PL0A 2PUUA 4TXCA 4EK5A 5M53A 3KXGA 3QCXA 3QHRA 3K3IA 5I9WA 1FVVA 5GNKA 4A4LA 1ZZ2A 3R8VA 1ZOGA 5J1WA 3MN3A 3A99A 3Q4UA 4GK4A 1MP8A 4DT8A 1FMKA 4WSQA 3R7YA 4QP3A 3SQQA 4FL2A 2VV9A 2R3GA 4AW1A 1KSWA 4F7JA 4UMUA 3BWJA 3IW8A 4FV6A 4YTCA 3UC4A 5E8YA 2UZNA 4ALUA 1L8TA 2XIRA 3U4WA 4KNBA 5T3QA 3NYNA 4V05A 4DGNA 2J0MB 3TWJA 5D1JA 4EK6A 2QURA 3ODYX 2XNMA 5CF8A 5L2IA 3EFLA 4S33A 4TY1A 5E8WA 3NIZA 3ZFYA 2WNTA 4FKWA 4EHVA 1L3RE 1PY5A 3DNEA 3Q5ZA 3OOMA 3PJCA 4OTFA 4FIFA 4BL1A 4FF8A 4IM2A 4C0TA 5EHOA 4EH6A 4F70A 1F3MC 4C4EA 3WF7A 1OB3A 4YJRA 3OVVA 5E8XA 4DG2E 2PMOX 3DBDA 3I0OA 3VBTA 2QG7A 2GPHA 4U0IA 2BILB 5J9ZA 4CMTA 2NP8A 3V6SA 5BVEA 2YHVA 5F1ZA 2O5KA 2W1GA 3N4VA 4Y73A 2ITXA 4KIQA 4O0TA 1F0QA 2X9FA 3QALE 5L6PA 3FYKX 2PZIA 4PUZA 2WMUA 4E8AA 3QTSA 1IRKA 1FINA 5ANOA 3O8TA 4BICA 3GENA 2C1AA 4LRKA 3V5QA 3I7BA 4DHFA 3QLFA 4XRJA 3UIMA 4O0YA 3PVGA 1XJDA 3QUEA 1Q8TA 3GCSA 4U5JA 3UP7A 4YC8A 2ITNA 4RZVA 3VF9A 4EH3A 5JSMA 5M09A 2BFYA 5J9YA 2YM4A 4L8MA 3VC4A 3DB8A 2OIBA 5FLFA 4B0GA 3BRBA 4RWIA 4QD6A 3QYWA 2X8IA 3QA0A 4ASEA 4FNZA 4EWQA 4RPVA 2WIHA 4X6QC 4AE9A 5GINE 3O0GA 4NKSA 5E8UA 3KN6A 3JY0A 5DA3A 4LGGA 4YU2A 3PRFA 1Z9XA 2DWBA 1OL1A 4QP4A 2HOGA 1Q4LA 3ZBXA 3OFMA 2XMYA 4F4PA 2FGIA 4E5WA 4IB1A 4UXQA 3TTJA 2QONA 5CEIA 3VUIA 4P2KA 5DFPA 1XWSA 3P9JA 3LJ1A 3QYZA 3VUGA 5A4CA 1OKYA 4O84A 3CPBA 3CJFA 4QTBA 3G9LX 3QF9A 3C4CA 3TZ8A 2ITZA 3BQCA 3ZRLA 4FE2A 2R3QA 2HW6A 3ERKA 4XOYA 3EFWA 4FIHA 4IANA 4P90A 2GHGA 3GCQA 4M67A 4PPCA 5CSWA 4GKIA 1J7IA 1VJYA 4HYSA 3ZU7A 3R01A 3HMMA 1JOWB 4GT3A 4AXAA 4E6AA 4ZMEA 1MRYA 2OZAB 3DXQA 2R3OA 3WYYA 4L67A 2ZM1A 4KS8A 4QMZA 3HVCA 4N0SA 4ZY4A 2BDWA 4B8LA 3OROA 4N4SA 4PMTA 2W1HA 5BQ0A 1UU8A 3EL8A 2HCKA 2R3LA 3RPOA 3C5IA 1J3HA 4PRJA 3LFAA 3G51A 3OWJA 5IQGA 5HICA 2XH5A 4TPTA 3PUPA 4TNDA 4FSZA 3W2OA 4EQUA 3WZJA 2XM9A 1UVRA 4BGQA 3S00A 2J0KA 3B2TA 4HZSA 4BCFA 4GIHA 1J7UA 4RZWA 4U41A 4EC9A 4YJOA 3I5ZA 2GNGA 4HGLA 1BUHA 4USFA 1OL2A 2J6MA 1M7QA 1P4FA 2VGPA 3S95A 1SNUA 3R28A 3PVUA 3V6RA 4IQ6A 2ZMDA 4PDOA 2REIA 3MSSA 3DK6A 3OW4A 2YABA 3EQCA 5KO1A 2VZ6A 4D28A 4DCEA 2OK1A 2I6LA 4E4MA 2W05A 3ITZA 5JGDA 4O7NA 4D1SA 2VTNA 4X2KA 3PSBA 4QP2A 5HKMA 3L9NA 1LP4A 4JR7A 4XMOA 4B6LA 3IECA 4ZJVA 3AC3A 3UPZA 4KRDA 4YGAA 5IH6A 4JBVA 2WTJA 4FIIA 3CGOA 3UVRA 2WQMA 3EN7A 1PRYA 1ZZLA 4IB3A 1UKHA 4ASDA 1GAGA 3UVPA 4XV3A 4KS7A 4AACA 5CEKA 4O0RA 4C36A 4BDFA 5HD7A 4QO9A 1YHSA 3FE3A 4QQTA 5IDNA 3EKKA 5HOAA 4IB5A 4IVCA 3DQXA 3HV7A 4HYIA 3BHTA 1WBWA 4L68A 1H26A 3RNYA 3ATTA 4A9SA 5HIDA 2F7ZE 2IZSA 1Z5MA 4MEDA 3RM7A 2W17A 3EQBA 4O1OA 2KULA 4PQNA 3AD4A 4AOTA 2QOCA 3S1HA 4FMQA 3C13A 4PF4A 4EBWA 3UIBA 2RFDA 4DGOA 3B8RA 4ITHA 3ZTXA 5M44A 1H0VA 2P2HA 1Q62A 2UZTA 2JDVA 3UPXA 4RRVA 2H8HA 5AUVA 4BIDA 2PVFA 5DI1A 4F9BA 2VX0A 4QMPA 5I9YA 3QX2A 4P4CA 3VW8A 2WQEA 2QHMA 3W1FA 4N70A 4UWBA 4GMYA 3FEGA 1R0PA 3OD6X 3QKKA 4I92A 4RWJA 3R1QA 4AGCA 2JFLA 1KOAA 5IISA 2YM5A 4YTHA 3LCTA 4ASZA 2EXEA 4YURA 3TI1A 5AR5A 4BDCA 3Q4TA 2HZ0A 4HNFA 1SMHA 3UQFA 4Q5EA 1JPAA 1XH4A 3QD3A 4NM7A 4RGJA 4WT6A 3SDJA 3Q9YA 3ORMA 4ZEGA 2CNQA 2FUMA 5D41A 1REKA 4CQEA 1KE9A 4WA9A 5KBRA 4WKQA 3GU8A 4G3EA 2YACA 3ORZA 3BBTB 4FKUA 3EOCA 4H39A 3BYMA 4NKAA 3G0FA 5JRSA 3TUCA 3M1SA 1KWPA 2CDZA 3DKOA 5GIPE 3MA6A 1YW2A 2QKRA 3W2QA 3T9IA 1H07A 2PHKA 4MVFA 1VZOA 2FA2A 4FTAA 4PV0A 1W98A 2VTLA 4EQCA 4ZS0A 1K9AA 1VR2A 1ZWSA 3R7GA 5BVNA 3KXZA 4YC6A 1XQZA 3SLSA 4A4OA 3BBWA 5FUTA 3B2WA 2J50A 3JR1A 5EYCA 4EONA 3NGAA 4XV9A 5IKWA 3NW6A 1Q61A 4F9YA 5BVOA 2VWZA 3MYGA 5LQFA 2OWBA 5H8GA 3VF8A 4BCJA 5IA2A 2WFYA 4GG7A 4K0YA 4XG2A 3VS6A 3UMXA 2RFSA 4ACCA 2YN8A 4LRJA 4LL0A 5FGKA 4M8TA 4D0XA 3LFSA 3P7AA 4R77A 5H9BA 2FSLX 3S2PA 2CGVA 3CQUA 3KRXA 3QD4A 4AZTA 3GOPA 3FXXA 3OY3A 5FP5A 1YDRE 3OS3A 3RMFA 3NVKI 1H1SA 4ZTMA 5EI8A 4BDJA 2PVMA 2F2UA 4IADA 3TNPC 5KHXA 3ZOSA 1OM1A 2QLQA 3PIYA 5ETFA 5GZAA 1ZYLA 3A8WA 3WILA 1ZYSA 3AMBA 5CAVA 3PP1A 5AWMA 3PXQA 4FV5A 2PE1A 1CKPA 3VS7A 3T8OA 1BX6A 2BZHB 3Q6WA 4RC2A 5HX8A 5L6OA 4IAIA 5HESA 2WOUA 4RIXB 3HAMA 1R0EA 3O8PA 4NFNA 5LJJA 4NW5A 2X7GA 2QG5A 4X21A 3COHA 3F3UA 4I0SA 2RIOA 5F9EA 1LEZA 3LM0A 4OAUC 3HMPA 5D12A 3QA8A 2XEZA 1WBOA 4AG8A 2JDOA 2F57A 3UBDA 4DEDA 4G9CA 3MH2A 4I6BA 3K5UA 4K11A 2A27A 4BYJA 1PYXA 4C61A 3F88A 4MD8E 1R1WA 3K3JA 4BBEA 5L8KA 1PXNA 3GQLA 4X3FC 2YJSA 4RT7A 2X6EA 4GFGA 5DT0A 4F0GA 3Q6UA 4B7TA 4YJPA 3IPHA 1KE6A 4R7BA 4DEIA 5FWKK 2ITOA 5E7RA 2XRWA 4S2ZA 3R8MA 4OT5A 1NVRA 3VUMA 1PXJA 3WF9A 1OUYA 2W1EA 3SW7A 3PE1A 2X4ZA 4YO4A 4E3CA 1O6LA 1M2RA 2OU7A 1TQMA 1SVGA 4LQMA 4G5JA 4WBOA 2I7QA 4TYHA 4FKIA 5DR2A 3FLZA 2WMVA 4FSNA 3CD8A 3MESA 1M2PA 2E9UA 4D5HA 4UYAA 1H8FA 3PJ1A 4W9XA 4YJNA 3DLSA 3F6XA 1ZOHA 2B7AA 2BRGA 3FPQA 3RPVA 5CT7A 5CSHA 4C3FA 5C1QB 2WMQA 3KGAA 3IQ7A 5J7HA 3SA0A 1Q8ZA 2OJFE 3EQIA 5KMLA 5IQCA 3GU7A 3T3UA 4KKHA 3F3WA 4D0WA 4EK4A 5CEQA 4TRLA 4Y8DA 4ZZMA 3BEGA 3CGFA 3F2NA 1UU9A 4D2VA 4FG7A 5DRBA 3BU5A 3SAYA 2ETMA 3DLZA 4XG9A 5FBNC 5KMJA 2EU9A 2ZV9A 3P86A 3LCOA 1VYWA 3UIUA 2OXDA 2XYNA 3FPMA 3OXZA 3F69A 2JLDA 1LR4A 4YZNA 5M55A 3RKBA 1SM2A 3ZM9A 5KBQA 4AT4A 4FV4A 3SOAA 4ACDA 4F0FA 2Y4IC 3GC9A 4RVLA 1ZY5A 4WNPA 4D55A 1OPKA 1YOJA 1YXTA 2Q0BA 3G6HA 5CVGA 3TZMA 4H1MA 3REPA 2WPAA 4XCUA 3C4XA 5ETCA 5HVJA 4QMSA 3D4QA 4O96A 4IVBA 3LFNA 2PU8A 3OY1A 3QTWA 4NZWB 3OT3A 4WRGA 4YZCA 4AFEA 3PY1A 4L45A 4BTFA 3DY7A 4ZK5A 4C4FA 2OKRA 2QOOA 4BCQA 4CZTA 2OICA 2XIZA 5AA8A 4I23A 4J52A 4LRMA 4ZTLA 4ONAA 4BIEA 2X81A 4ZS4A 4Y5HA 3ZO4A 5EFQA 3PPJA 5AP3A 2YA9A 1OKZA 5EKNA 2UW4A 3BLRA 4MXXA 4ACGA 4FK6A 5CU4A 1KE7A 2B53A 4K2RA 4YJQA 5AM7A 5ACBC 1UA2A 3QRTA 4NIFA 2BDFA 2BHEA 3GU5A 5HLNA 1ZYJA 2UW9A 3RCDA 3CEKA 3D5WA 3F9NA 3C0IA 2OJGA 4E93A 5BPYA 3PLSA 4H3QA 4L3LA 4CVAA 3FI8A 5JEBA 5AP0A 2YM3A 4FV9A 3L1SA 4O7RA 2XK8A 4XBRA 4BKJA 1WAKA 1GZ8A 2XIXA 3U9NA 3D0EA 3FL5A 3PG1A 4V04A 2R3NA 3LE6A 2VWXA 3W55A 4GYGA 4ANSA 4EJNA 3RM6A 3AC8A 3FC1X 2GS7A 2JKMA 3HP2A 1ZMVA 2VWWA 3FSKA 4JI9A 1KE8A 3ZUTA 3BLHA 1W83A 1OL5A 3C1XA 4RX8A 3Q5IA 4ID7A 5D7VA 5HHWA 2R3PA 5EQEA 2UUEA 5IUHA 4MYGA 2VTRA 2WEIA 3TKHA 4DA5A 2Y9QA 2XP2A 2WMAA 4NEUA 4I6FA 2VRXA 4CYJA 4IAYA 4DGLC 4KKGA 4J71A 1GIIA 1KV2A 4OTRA 1Y8GA 4JS8A 3GCUA 4QP7A 3P7CA 4XNEA 4XP3A 3T3VA 1OIQA 1DI9A 2I0HA 3DXNA 3ORPA 3UE4A 5IA1A 1CSNA 5J1VA 3G6GA 3DAJA 3VULA 4UMTA 3MB6A 4JBOA 5M08A 3D94A 2FSMX 1WBTA 2GTMA 3NNVA 3TUBA 4I93A 4XH6A 5E8TA 3II5A 4X7QA 4BHZA 4ERKA 3L9PA 3PZEA 3S3IA 4WG5A 1YXSA 3FMHA 4L00A 4IX6A 5LMBA 4IFCA 4YLJA 1VYZA 3KK8A 1KUTA 4I41A 2BRNA 5KX8A 2BIKB 4PP9A 4U7ZA 1AQ1A 2BTSA 4GU6A 2CPKE 2PZ5A 4YLKA 3BGPA 4O7SA 5ANGA 3LIJA 2VNWA 1VEBA 3FBVA 3O7LD 3OHTA 3QZIA 4HPTE 1URWA 2WU7A 3IGGA 1JSTA 2XM8A 4IWPA 4I5MA 3HNGA 4ZAUA 3KF7A 4DEGA 4HGSA 5E9EA 5I9UA 1TQPA 2HXLA 4BDDA 1EH4A 2C3JA 3H10A 2C5YA 4UYNA 4G16A 5BMSA 1O6YA 2C4GA 3ZH8A 3AG9A 1Q8YA 1M17A 3RK9A 3OTVA 3LFQA 5H3QA 3EIDA 4I24A 1SZMA 1S9IA 3GP0A 4R7IA 4OUCA 5AAGA 3RHXA 3DBQA 3IKAA 4EH9A 2B52A 1H1RA 2PYWA 4PP7A 2A4LA 4E1ZA 5FDPA 2HWOA 4NUSA 5IDPA 1KV1A 3BX5A 4FV1A 3F5GA 5AP4A 3D5UA 4FV2A 3R30A 4JDIA 3BU3A 3QTQA 5EW8A 4ITJA 5KCVA 5EW9A 3K5VA 2VUWA 4XG6A 5CXHA 2X8DA 3FZTA 3DDPA 4GL9A 1E9HA 4YBKA 3DJ5A 3Q9WA 2P0CA 4CFWA 4QMXA 3WZKA 1FPUA 5A4LA 3PXRA 4U44A 3KXMA 5HG7A 5K4IA 4FA2A 1G8AA 2UVZA 2W4KA 4FK3A 4BDEA 3ZBFA 3PIZA 5DGZA 1ZMUA 1GZKA 2YCSA 2JIIA 5JFXA 3DTCA 3ZSGA 3D14A 4DF3A 4IX4A 4RJ7A 4GFOA 2YERA 5M4IA 2J7TA 3WF8A 4I5CA 4EHEA 3FY2A 2FYSA 3I6UA 1RDQE 2ITYA 4Z7HA 3OBGA 4UZDA 4QPAA 4MNFA 5CENA 4GVAA 3FL4A 4DTKA 4QQ5A 2HYYA 3MVMA 3CS9A 4IJ9A 4KBCA 5B0XA 5I9ZA 3CR0A 3FY0A 5ANEA 2IPXA 4NL0A 4YBJA 2F4JA 4IFGA 4PTEA 2GFCA 5AP7A 4NCTC 3RCJA 3LPBA 5CEPA 1Q97A 3QQGA 4FSQA 4GRBA 4RFYA 4BDHA 4YTIA 2VTJA 1PYEA 3FLYA 5FEDA 3I81A 1WZYA 3PA5A 2XF0A 5CSVA 1YI3A 4TWNA 4XRLA 2UZEA 3QRUA 2PVHA 4WNKA 5CY3A 4OR5A 5J5TA 4QYEA 5HZNA 1WBNA
chains in the Genus database with same CATH superfamily
2CCIA 4D4SA 3HV3A 4BVUA 5HNGA 4UV0A 5HBHA 3OEZA 3W2RA 3DFAA 3DBFA 2XANA 3C4EA 2PE2A 2G01A 3HV4A 4F08A 1SYKA 2ZM4A 3RAWA 4LYNA 5FD2A 3R9HA 2OGVA 3CKXA 1BL6A 5HG5A 4BJJA 3DQWA 5L2TA 3BYOA 4XP2A 1YDSE 5CQUA 2W9ZB 2WQNA 2LAVA 2I40A 3H4JA 1IEPA 2EWAA 2ZYBA 4KA3A 3RTPA 3KREA 3ZRMA 3O5AA 2GS2A 2VO3A 4IAZA 4L7SA 5AIRA 3VBYA 3W2SA 3EL7A 3VUDA 4AT5A 3AC5A 3ZSIA 3QBNA 5IA5A 2FO0A 4X2GA 1G8SA 3C50A 2XBJA 3Q2JA 2XK7A 5G1XA 3P1AA 4FV3A 4NM3A 3NSZA 4DE4A 5IQEA 3H9RA 3DKGA 2CLXA 3MIAA 3LM5A 3P08A 3KCFA 2IZUA 3KVXA 1BKXA 4FOBA 3L8SA 4U3YA 5CI7A 5HVKA 1UKIA 2YM7A 2R3IA 4QEBA 3L8VA 4AZEA 3NUXA 2HXQA 4AGWA 4V01A 5M4FA 4WUNA 1JWHA 5FM3A 3FC2A 4M69B 4O0XA 2VWBA 5CAUA 4K9YA 3CTQA 2AYPA 5TO8A 5FG8A 4XX9A 3FQEA 3FMJA 5IQBA 1UNLA 3PRIA 2C6LA 3NNUA 1IG1A 4U97A 2BRBA 3TZ7A 2GQGA 4U3ZA 5K4JA 4R5YA 3QTRA 4IZ7A 4MTAA 3R63A 2ONLC 5H8EA 3TV7A 2WB8A 3NW5A 4QMLA 3M42A 2WELA 1M14A 2A1AB 3JS2A 3CSVA 4FG8A 2YIWA 3E87A 5C4LA 4DG3E 4CCUA 4RBLA 4FNYA 5CAPA 1APME 2HENA 3F7WA 5C8KA 4AS0A 4FKVA 4TYIA 3A2CA 1QCFA 3TACA 4O2ZA 3GC8A 2ZOQA 3VBXA 4DITA 3UO4A 3W0OA 3OCSA 3ZDUA 3W0RA 4FKSA 3EFJA 4P5ZA 3V3VA 4L01A 4Z7GA 5IA0A 3GVUA 4FKGA 2UW0A 5IUIA 3QQJA 4AA4A 4WBBB 5CQWA 2P2IA 4HYHA 5I5ZA 3VUKA 3TNQB 3RPYA 2QQ7A 3RGFA 3LFDA 4IAAA 2F7XE 4ZIMA 3JPVA 2C5XA 4WG4A 5J87A 3RAKA 3VW6A 4DFLA 2XJ1A 5LCJA 2WMXA 2C0TA 4J96A 2P4IA 5J8IA 1E1VA 1T45A 3KK9A 2ITPA 4PL5A 1W84A 3LHJA 3RK5A 4F7SA 4DDGA 3CQEA 4OT6A 3O17A 4QMUA 4YNOA 4DH3A 3QQKA 4M0YA 1H24A 5F94A 1B6CB 3DFCB 2QOKA 4MXOA 4DEBA 4IIRA 2PMNX 3NCGA 4KBKA 3TEIA 2XK4A 4FI1A 2ZDUA 3VAPA 4DFBA 5HCXA 4M69A 4ZLZA 4DT9A 3R2BA 5LCKA 4DAWA 4ZJIA 3F2RA 4MQ1A 4RWKA 5AUXA 4AT3A 5AADA 1MRUA 3OXTA 4X3JA 3RVGA 3A4OX 2E9PA 1U59A 3ALNA 3D7TB 3LMHA 2C1BA 1M52A 4JBPA 4J8MA 1O6KA 4OGRA 4U43A 3PVBA 5TOZA 2A0CX 4BWXA 3GU4A 4EI4A 1WBPA 5HG8A 5C27A 3C9WA 4QP6A 4F65A 2JD5A 2R4BA 2VWYA 3DAKA 5EYKA 1X8BA 3LQ3A 4FTTA 2FB8A 4FICA 3RAHA 3ZM4A 4AQCA 4M3QA 4FKRA 3SW4A 4QNYA 5CXZA 4FL3A 4C38A 1SVHA 3FHIA 5BMMA 5AUZA 1Z57A 2O3PA 4GT5A 4E73A 3AT4A 3LFFA 2PUIA 4CGAA 2UV2A 1YXUA 4RLLA 4CMOA 3V8SA 3VS5A 2P33A 4A06A 2QO9A 3LCDA 2OO8X 3F61A 3AC2A 4C4GA 5KHWA 2HY81 2R7IA 5DLSA 3Q4ZA 2GQSA 2X8EA 1V0BA 4WOVA 5E8ZA 3P4KA 1R3CA 2XKCA 4ZY6A 4UWCA 2EB3A 2AQXA 1OKVA 4BCKA 2Z02A 4JLCA 3F66A 3NPCA 3W18A 2RSVA 3UYSA 2UW3A 4F1OA 5IMXA 2CNVA 1QMZA 4OTWA 3N4TA 4YZ9A 3TL8A 5HNBA 3TCPA 1ZRZA 3ROCA 4C37A 5JQ5A 4A4XA 3I4BA 3I1AA 1OVEA 4H3BA 4HGEA 2VTHA 1NY3A 2VU3A 4OTPA 4IVAA 4ZY5A 2EB2A 3K2LA 4FTNA 3HRCA 4FV8A 3GBZA 1W7HA 1XH8A 4D4VA 4GJ2A 5GZ9A 5AX3A 4ZXTA 3R9RA 4D2SA 5I3OA 5K5XA 4D9TA 2YDIA 2HZ4A 2OIQA 3U6IA 4MUQA 3HRBA 3KMUA 4I6HA 4HCVA 4DBXA 4J95A 3MVHA 2CKQA 4LMUA 4M12A 2WTVA 3D7ZA 4QTCA 5FXRA 4JDHA 1GZOA 2JC6A 4DHJA 2BKZA 2JEDA 2WQOA 3CKWA 3OWKA 3F82A 3BHYA 4I5HA 4TYHB 3HUBA 5EDQA 3U4UA 4EOJA 2YAAA 4KWPA 1V0PA 2X0QA 3OCGA 2IG7A 5A6NA 2RKUA 5CI6A 4RIYA 5L8JA 3P0MA 3R71A 4L43A 1ERKA 2RG5A 3QXPA 1YKRA 2Z7RA 4R1YA 4O4FA 1WBSA 2BRHA 2IVVA 4Y85A 3E8DA 4GEOA 4NM0A 2W1FA 4D1ZA 3R9OA 3ROYA 3VBVA 3EN5A 3OCTA 4ANLA 4O27B 4DEEA 5J7BA 5K0XA 4DCAA 2XCKA 2PZYA 5ITAA 4DH8A 3LZBA 5AV2A 3NVMB 4TW9A 4EOOA 5A4QA 3CCNA 3RINA 4QQJA 5HTCA 3FUPA 1G8JA 3CC6A 1REJA 1Q99A 3THBA 4EZ5A 2WKMA 1I09A 4B8MA 3LMIA 4CLIA 1PXPA 5AP5A 2QNJA 5CZIA 2UZVA 2G1TA 3PE2A 5EK7A 3ANQA 5GJDA 4N6ZA 4IZAA 1OPLA 2R9SA 4GS6A 5M4UA 3KC3A 3R7VA 4G6LA 3KXXA 1IA8A 4BDBA 3UDTA 3GQIA 3H0YA 4FYNA 4C3PA 3JY9A 2ZAZA 4E5BA 4RJ8A 4AW0A 1Y8YA 4LG4A 3QHWA 3VQUA 5IQAA 4U6RA 4L53A 5BUIA 4DG0E 1ZYCA 3SG9A 2OXXA 1OBGA 4IJPA 5F95A 2BVAA 4I1ZA 3ZXZA 4EKLA 2UW6A 1A48A 4MBJA 4JMQA 2E9NA 4IACA 5CF5A 2CGUA 3BU6A 3SXFA 1XKKA 4I6LA 2LGCA 1IAJA 4FIGA 2X7OA 3SRVA 4EORA 1Q3DA 5EHYA 4DFYA 5M4CA 2ERKA 2G2FA 4OTGA 4AAAA 3GGFA 4LV7A 1JAMA 2PVYA 3LXLA 3OW3A 4MXYA 2J9MA 2VX1A 4JQEA 4CRLA 3UQCA 3OBJA 4O0UA 2C0IA 4KB8A 3HGKA 3LFEA 4MK0A 1HCKA 2X4FA 4LDTA 2Q0NA 5KKRC 3BI6A 3VJNA 2B9HA 5FEQA 1R78A 2O8YA 2R3MA 4IVDA 2QOLA 1YXXA 4Z3VA 4EOIA 3G9NA 2WZJA 1KOBA 2QVSE 4JDKA 5HE3A 4FZAB 4A9YA 3G0EA 1TZDA 3BZ3A 3PDTA 2VWIA 2OF4A 4FIJA 3I6WA 4K18A 3GT8A 2JDTA 4ANNA 4BWKA 3FJQE 1JKTA 2YITA 3A7FA 3KEXA 4R7HA 5HD4A 4OBOA 1OIYA 2W9FB 3E8EA 4PDPA 4XG7A 4D58A 3IW6A 3RNIA 1ND4A 5IQDA 2OZOA 4IDVA 2IVSA 4FTJA 4M15A 4CD0A 4L9IA 3R9NA 2RL5A 3WZUA 4O38A 4TYEA 4RX7A 2QOIA 2VWUA 4B4LA 5JKGA 4JQ8A 4QP9A 4X2FA 2YWVA 5G6VA 4EYMA 2BZJA 4FTOA 4U81A 2CHLA 1PHKA 2ITVA 5EQYA 2J2IB 2IZTA 2ZM3A 3QD0A 2B4SB 4LV5A 4MH7A 5DYJA 3RHKA 5LWNA 2C47A 3QQHA 4ENXA 1PKDA 2YAKA 4NT4A 4RX9A 3T9TA 4DFUA 4GUBA 4WSYA 1U46A 3VS1A 3MJ2A 1OZ1A 4O6EA 4RX5A 3GCPA 1UWJA 4ZSEA 2CN5A 3FHRA 1JQHA 4M97A 2O63A 2WTKB 3KVWA 3NUPA 4II5A 4IXPA 3ZUVA 4YLLA 5CX9A 4W4YA 4CFMA 4EZ3A 3C4ZA 3N4UA 4MXCA 4AXDA 1GOLA 4XLIA 5L6WL 4AU8A 2BAJA 3FAAA 4BHNA 3LCKA 4FZ7A 3V5PA 4TN6A 5H2UA 4NM5A 4I0TA 3UOJA 3FMLA 3P79A 3EYHA 4A9RA 5E92A 2JGZA 4FTLA 2YEXA 4DGGA 4FG9A 4C4IA 3PLAE 4DC2A 2YM8A 3A60A 3ZEPA 2R0UA 4FNWA 4CYIA 5AV4A 4FTUA 4ZTNA 3WI6A 2BKKA 3KRRA 3KFAA 4FSWA 4IC8A 3DNDA 4ANQA 3Q04A 1YVJA 2XBAA 5AP2A 4O91A 4EOQA 4YUQA 2V62A 4ZTHA 3FZPA 3UNJA 4CXAA 3U55A 3A7JA 4BRXA 2AC3A 4ARKA 3FWQA 3AT3A 5TE0A 1PMEA 4YZDA 5EOBA 3NNWA 3F2AA 3EB0A 2W7XA 4IM3A 3L9LA 4ZZNA 5HORA 2B9FA 1A06A 2I0EA 3ENMA 5BVFA 3D2KA 2HWPA 2C3KA 2C30A 4NU1A 2VNYA 4DFZE 3E3PA 4DH5A 3QTIA 2YLFA 3ACJA 1I44A 5BVWA 3KQ7A 3ZFMA 5AMNA 5L8LA 2UVYA 1ZAOA 1FBNA 3KL8A 3CLYA 5DOSA 2A2AA 3AD5A 4W4VA 4LOQA 4OLIA 4J8NA 1JLUE 4E20A 3IK3A 3NEWA 4EKKA 2RGPA 3VS2A 4G6OA 5K0KA 4MAOA 4RC3A 3G2FA 3R2YA 1YRPA 3EKNA 4AF3A 3ZCLA 4DLIA 2X6DA 2C6KA 3RWPA 4F6SA 5I4NA 5CYIA 2J5EA 4L52A 3HMIA 5AAFA 2VN9A 2V0DA 2QODA 2VTQA 4GU9A 3FXZA 3ZRKA 4R8QA 4AN2A 5AAEA 5LVMA 4HGTA 4UWYA 3F5UA 2OF2A 3W10A 5IQIA 3S0OA 4CKIA 3OMVA 4JX7A 4KKEA 5AUTA 4AZWA 3IOKA 3P7BA 5I3RA 3MPAA 4IHPA 3QC9A 2YLEA 3PA4A 5CALA 4F9WA 4O7YA 2C6TA 4RJ5A 1RE8A 2WHBA 1JVPP 2C0OA 4E4NA 4P7EA 5LVPA 4D1XA 1J1BA 1W8CA 4FSMA 4FTMA 3CP9A 5DNRA 3E5AA 4J98A 4MNEB 4QRCA 1PXOA 4NSTA 5HIBA 5EM7A 4DYMA 5B7VA 4AFJA 2GMXA 2XNPA 3AGLA 4JRVA 4BCGA 1QPEA 3CXWA 4BGGA 2G9XA 4BGHA 5E8SA 5JGBA 4O4DA 2E9OA 1P5EA 1YOLA 3G15A 3CD3A 3GC0A 3TUDA 2W4OA 4ZSAA 5HU9A 3V8TA 3VNTA 3IS5A 4YHTA 2I0VA 3UO6A 1IR3A 4PL3A 4RC4A 4XG3A 2R7BA 5EH0A 4I4EA 3SV0A 3V5TA 4O83A 3WYXA 2X7FA 3FMEA 3QXOA 3QZFA 4FC0A 4EH5A 3R8UA 2VO7A 3ZEWA 4UXLA 2B55A 5D7AA 3D2IA 5LARA 2WTWA 2QOQA 3A7HA 4G9RA 4JG7A 2RFNA 3ZC5A 4BCHA 3KRWA 5B2MA 2Z7SA 3QTZA 2HAKA 3KRJA 5B2LA 4QTDA 3ZLWA 5K9IA 5ANIA 3R22A 3KULB 3Q52A 4BZDA 3SC1A 1H28A 4EOPA 2UZUE 4YHJA 2JBPA 3PZHA 1QPJA 3FV8A 4O2PA 1WVYA 2VAGA 5DIAA 1K2PA 3BLQA 5T6KA 4ASXA 4CFUA 3QZHA 3NLBA 1GY3A 3PA3A 2JFMA 1XH5A 3IGOA 4N6YA 4BKZA 2XAMA 2Z7QA 3MGYA 4D2RA 2OFUA 4CTCA 4XUFA 4ZJJA 3FQSA 1CMKE 2YZLA 2XNEA 3U9CA 3MTFA 2JKOA 3QQFA 3BKBA 3DV3A 4JNWA 4WD5A 4F63A 4C7TA 4DN5A 3I5NA 3RK7A 3R1SA 3BEAA 2Z2WA 3E7VA 3DAEA 3LLTA 4Z9LA 3HP5A 3MVLA 4R3RA 1OI9A 1CKJA 4FTKA 1DAWA 2QR8A 3FKNA 4IM0A 5AM6A 5AR8A 4C2VA 1WVWA 4RA4A 4YR8A 5AEPA 4USEA 3SD0A 3DJ7A 3PY3A 3FQHA 4PDSA 4CLJA 2E9VA 4X2NA 5DR6A 1BI7A 3UG2A 5LOHA 3GU6A 5A4EA 3QWJA 2WIPA 3TNWA 4QP1A 2GDOA 1STCE 5DPVA 5L2QA 3R1YA 4EOKA 2Z7LA 3O23A 1H25A 1H27A 3HRFA 3MFTA 4RVMA 5CASA 5CU6A 2PPQA 3BGZA 4UB7A 3P23A 3P5KA 4HW7A 1SVEA 5EYDA 2QKWB 1NVQA 3LXKA 4QMWA 4LOPA 3RBWA 4PPBA 3NCZA 4K33A 4Y83A 3D15A 3EMGA 5ACKA 4F6WA 5HQ0A 5L2SA 4O81A 3Q2MA 3KMWA 3LLAA 4ZSJA 5CEOA 5IH4A 3QX4A 4EYJA 2QU6A 3RALA 1CM8A 3UOHA 2XEYA 3I60A 5EDRA 4BDIA 2XIYA 3PXFA 4A9TA 1MUOA 5E1SA 2EXMA 3TM0A 2X1NA 4AZSA 2YIXA 4BBFA 5TT7A 5HBJA 3U6HA 3TMOA 3DGKA 3TN8A 3JXWA 3NWWA 3UDBA 3LXNA 2YCFA 3BV2A 3BWFA 5ANDA 5JZJA 1HOWA 2ZV2A 3FYJX 1H1WA 5M56A 2PWLA 3PSCA 2VTPA 2C5OA 3OT8A 3ZFXA 4EBVA 4RVTA 2O65A 3DCVA 5ETAA 4C35A 4D5KA 1GIHA 4JX3A 3FZSA 3WBLA 3SGCA 3GFWA 5GJFA 4C3RA 4AP7A 3MBLA 1FVRA 5IG1A 3DXPA 3F7ZA 5E8VA 2ACXA 4LI5A 2ZDTA 1W0XC 2ZV8A 4JR3A 3ZONA 1H00A 1OUKA 3DK7A 4FVQA 5C26A 2C6MA 2IW9A 4EQMA 2QO7A 5AFVA 2BAKA 3ET7A 4O6LA 3ELJA 5FTOA 2OIDA 1PW2A 3Q32A 4NCTA 1Q24A 3OUNB 4XEYA 1V1KA 3UC3A 2CLQA 3GXLA 4BTMA 1UNHA 3VIDA 2C5NA 3EQDA 5EM8A 5ETIA 4AE6A 2ZV7A 2BPMA 4H58A 2VTOA 4CKRA 4IBMA 5J95A 4AGUA 5M51A 1XBAA 2C6DA 3GC7A 3GB2A 3I0QA 3QQLA 5EM6A 4NK9A 3D5VA 3JVRA 2YFXA 4O7LA 3LQ8A 4FGRA 5I9VA 2ETKA 2XVDA 4FYOA 4MCVA 4FKLA 4RFMA 4W8EA 4ZOGA 5FXSA 5IQFA 3UQGA 2RFEA 4HYUA 5DN3A 4PL4A 3R73A 3HMNA 4R1VA 4RIXA 1G8KA 2OG8A 1FGKA 1LEWA 3VS4A 4BIBA 4AA0A 3A61A 2ZVAA 4FUXA 3U6JA 3AC4A 3R83A 4J99A 4LV8A 4QP8A 5DH3A 4FT5A 4BDKA 4U42A 4ZMFA 3V5WA 2GNJA 3VO3A 3WZDA 4H05A 3ACKA 2C6EA 1TFFA 4FOCA 4YNEA 4X2JA 4ANMA 5IA4A 2DQ7X 2QCSA 3QC4A 4CV8A 1JNKA 1TKIA 1CTPE 3K54A 3Q60A 1Q41A 3DDQA 4QT1A 3AKJA 2WTCA 4DHIB 4NWMA 5JFWA 2J90A 3QRIA 5A6OA 4JXFA 4CNHA 5I0BA 2XIKA 2WXVA 3MWUA 4GFMA 3H0ZA 2UVXA 3MI9A 4BZOA 3W32A 4QYFA 2WU6A 1J7LA 5IZFA 1FGIA 4X0MA 2OJJA 5CVFA 2CKPA 5DEWA 4FEUA 3NZ0A 5CNOA 2WTKC 3NR9A 1XBCA 5L2WA 2IN6A 3TV6A 2WMWA 5K3YA 3QZGA 3RPRA 4AXEA 2X0PA 3EZRA 2QOHA 3OG7A 4L44A 4MNEA 2X2KA 3UTOA 2BHHA 3WIGA 4G2FA 2YCQA 4OBPA 2CSNA 3JYAA 2ONLA 1WCCA 3AC1A 2JBOA 3ORLA 3QRKA 4H1JA 4YC3A 4DGMA 4M0ZA 2BMCA 3WF5A 4JG8A 4RFZA 2QC6A 2IW6A 3QGYA 2OH4A 4M66A 4FSYA 2UZOA 4BN1A 3BYUA 4RJ4A 5EW3A 4I20A 3SRVB 3O7LB 2CNUA 5HTBA 2RG6A 2H9VA 2NRUA 1T46A 3HL7A 3P78A 4FTIA 4GIIA 2PVJA 4UALA 3V5LA 5KKRB 4F1TA 3LJ0A 1Q5KA 3DK3A 4BTJA 5KMKA 3D5XA 4KIKA 4CRSA 3BHVA 4FGBA 5DT4A 4MXZA 2BCJA 4U9AA 2ETRA 2HW7A 1UNGA 5CF4A 2BR1A 3DT1A 4TKSA 2VTAA 4C8BA 5L4QA 5AJQA 3A4PA 3LFCA 4OTHA 4FKQA 1U54B 3AKKA 2F9GA 3BV3A 1PF8A 2V7OA 3OUKA 2C5VA 3VS3A 4Y72A 3RJCA 2QR7A 4XOZA 2A98A 3OEFX 4IH8A 2R0IA 3HEGA 4PWNA 1Y6AA 5F4NA 3UJGA 4Q9ZA 3ZDIA 4NH1A 3ZZEA 4CQGA 1XH9A 5BYLA 2G2IA 3NW7A 3PXYA 4LGDA 5JZNA 3ZO2A 4PMPA 3UIXA 3LAUA 4CEGA 1WFCA 4W9WA 3UOLA 3HV5A 5CAOA 2BZKB 1DI8A 3U87A 4D2PA 4UMRA 1FVTA 2R3HA 5JH6A 3DS6A 4D4RA 4H3PA 4ZLOA 3ID6C 4AA5A 2VO0A 3MY1A 3Q4CA 3F3VA 4RQVA 5FXQA 4M7IA 3W0QA 2IVUA 4LUDA 4QMOA 4UZHA 2IWIA 3DZQA 2GNLA 3TDVA 3AGMA 2WAJA 2F2CB 2XS0A 3R04A 4FX3A 1P14A 1R39A 4IB0A 4L3JA 4C58A 1CKIA 4KBAA 3MTLA 5CWZA 4RQKA 3PWDA 4HCTA 4CMUA 5JQ8A 2UZLA 2UW7A 3W16A 1Y91A 2CGXA 2O0UA 4FKTA 2XA4A 4QYHA 4CV9A 4MKCA 4AOJA 1P4OA 3PY0A 2WOTA 1PMNA 2PULA 5EQPA 2X0OA 3HA8A 4NYEA 4ORKA 4F99A 3FI2A 1KE5A 5HI2A 2BRMA 3OZ6A 4UEUA 2VTIA 1OECA 2I0YA 3IDBA 5BVDA 4EH2A 4A07A 2Z8CA 2J5FA 4IWDA 2JITA 4FKPA 3KU2A 3TV4A 3FXWA 2GQRA 2WEVA 5LVLA 4X6RA 3KCKA 4JT3A 3BYVA 3EZVA 4LL5A 4CFNA 5AIKA 3MFSA 3MV5A 5HIEA 3E64A 5A4TA 4FZ6A 1JKSA 4O0VA 4F64A 3R7OA 3UP2A 2GHLA 2VX3A 2BFXA 5L3AA 2GSFA 4PPAA 4BF2A 3HX4A 4FUYA 4GKHA 1RQQA 3E8NA 4YMJA 3EJ1A 1J1CA 4FTQA 3TNIA 3FSFA 4F7NA 5JN2A 4RVKA 1DS5A 3LW0A 3L9MA 4GUEA 4CCBA 5JMSA 4XV2A 3MS9A 4PMMA 2VWVA 4FV0A 1TVOA 3QKLA 3MY0A 4D2TA 2X0GA 4DFNA 4W4XA 1OIUA 5M06A 1BLXA 4O0WA 3IONA 4IMYA 5DEYA 3FDNA 2WTIA 2GTNA 5EI6A 4Z16A 5KMOA 3WE4A 3ZUUA 3DTWA 1GZNA 2DS1A 3NIEA 2GHMA 1WBVA 3WF6A 5AV1A 2OLCA 2W5AA 3TDWA 1B38A 2JDRA 4G31A 4CFFA 3L8XA 4D2WA 3DB6A 3UYTA 3F5PA 2A19B 3KB7A 1YHVA 3AMAA 4OTIA 4BFMA 3DA6A 4A7CA 3EHAA 4USDA 3ANRA 4YTFA 4BDAA 4Y46A 3U54A 1M7NA 4L46A 4IWQA 3NUNA 4C59A 3NNXA 3TJDA 4EHGA 4E5AX 1ATPE 5HGIA 4RIWA 3ULIA 3KY2A 4YPDA 3DBCA 4CTBA 2W4JA 5HCZA 4L7FA 2BZIB 3C51A 3UOKA 3EQPA 2CGWA 3TKUA 4WIHA 4G3FA 2YDKA 3DOGA 3FLNC 4H36A 5E91A 3MFRA 2PTKA 3BYSA 3LJ2A 4JBQA 4C2WA 4XBUA 4L3PA 4QPSA 3KN5A 2ZJWA 3QTXA 5HG9A 2V22A 4JDJA 4BB4A 4G34A 3H9OA 4EEVA 1BL7A 3QUDA 4S32A 3BLAA 5F20A 4PTGA 1DAYA 1BMKA 2YDJA 4WHZA 5T68A 4F6UA 4MQ2A 5CU2A 5A9UA 4QTAA 3NYVA 3BHUA 2W06A 3NAYA 1YDTE 4J97A 4J53A 3TT0A 4HZRA 3H3CA 3QAME 4QQCA 3OCBA 2YIYA 4E26A 1NVSA 3QTUA 3VONA 1MQ4A 2PVLA 5A3XA 4FT9A 4GK2A 3RZFA 1JSVA 4QMYA 5CNNA 2XNOA 4DINA 1S9JA 5FBOA 4Y95A 1FQ1B 2OH0E 2ZB0A 3NX8A 5CF6A 4G5PA 3COMA 1OGUA 3VBQA 3KKVA 3EQHA 4WNMA 3MW1A 4AXCA 3DKFA 3ZLSA 2Z60A 3VJOA 2E2BA 4YO6A 1Y6BA 3G33A 5LVOA 3FZRA 5AV3A 1J91A 1OPJA 2XUUA 3FZ1A 3VUHA 4AX8A 3E3BX 1OL7A 3SXRA 4CSVA 4F9AA 5EDPA 5TF9A 5HO7A 4GSBA 4U79A 3V8WA 4KABA 2H6DA 3POOA 3OWLA 4XS2A 1WVXA 5H8BA 4I22A 4BCMA 4FIEA 1SNXA 4WNOA 1LUFA 1XMMA 4QPMA 5KUPA 2X39A 4KRCA 5BVKA 5HCYA 3QU0A 3EH9A 3FKOA 3AQVA 1ST4A 3ENHA 3IG7A 5KNJA 1ZARA 2JKQA 4RA5A 4YPSA 3TXOA 1H01A 1UU3A 2UW8A 2B0QA 3VVHA 3RPSA 3M2WA 5KZIA 1H4LA 4YZBA 4J7BA 2C6OA 2QOFA 5AUUA 3UNKA 4JVGA 4J1RA 1OGYA 5EG3A 1JKLA 5AR7A 4BYIA 4C34A 4K8AA 4HVGA 4DTBA 5JK3A 2YWPA 3SX9A 4UMPA 4FSRA 3MVJA 3W0NA 4ANOA 2ERZE 4FBXA 2VTMA 5EM5A 2EVAA 4RLKA 4E7WA 5IEYA 5J5SA 3LVPA 4NW6A 3FKLA 4FT3A 3UG1A 5DMZA 3BE2A 2BIYA 4KSQA 5AA9A 4JQ7A 4IZ5A 3MJ1A 4HVSA 3CBLA 2NRYA 4HJOA 4DBNA 2PY3A 1XR1A 2Y8OA 3PXKA 2WMBA 5C8MA 4DH1A 3HDNA 2GU8A 3RZBA 4C57A 3O2MA 2V5QA 4BI0A 2VO6A 4ACMA 1NW1A 4E4LA 2CJMA 4FSUA 3UO5A 3MY5A 4B99A 4CKJA 4FEXA 2O2UA 3BE9A 3DJ6A 3QL8A 5BYYA 2UZWE 5GIOE 3ZMMA 2W96B 3H30A 3CIKA 3OF0A 3OOGA 1BYGA 1URCA 4CT2A 3MIYA 5FRIA 2BDJA 5BUJA 1FMOE 3ODZX 4MHAA 2CMWA 3PTGA 3QGWA 4EK8A 2W99B 3CY3A 1ZMWA 2XKEA 4S30A 3PFYA 5TR6A 3ATSA 5HU3A 3I79A 5LMKA 2C3LA 1PMVA 5HE0A 4FRFA 4HVIA 4WRSA 4Q5HA 5AUWA 4TNBA 3SG8A 2C69A 5CANA 2XK6A 3RAIA 2HZIA 3FMDA 4O7TA 2PE0A 3MH3A 3R1NA 2YZAA 4TWPA 3OTUA 3C4WA 4PMSA 3TKIA 3VRYA 3IW4A 4W4WA 3LMGA 3ZZWA 3EQRA 4L42A 3FLWA 3W2CA 4FNXA 4BCPA 1ZYDA 2H34A 4Q2AA 5DE2A 4DH7A 4Q9SA 3VUTA 3CE3A 3EFKA 3GCVA 4ZTQA 4K6ZA 4ZP5A 4KAOA 3UODA 3ZO3A 3AXWA 4E6CA 5IUGA 3UZTA 5DHJA 5DG5A 2RF9A 3FLSA 2AUHA 1ZY4A 2QLUA 5IEVA 3PPKA 2R64A 2WQBA 5FTQA 4G17A 4DLJA 3N51A 2WGJA 4RMZA 1YQJA 2UW5A 2BAQA 4EHZA 3ZHPC 4IW0A 5KZ0A 3R6XA 4F9CA 1GNGA 3F3TA 4FTRA 4MX9A 2P55A 2JAVA 5A46A 1IA9A 5M07A 4A9UA 1IASA 2FSOX 2Y6MA 4HOKA 3D9VA 3C4FA 3E88A 3EQFA 4I5PA 5CTPA 3PWYA 4I3ZA 4R3CA 1YI4A 5HLWA 3NUUA 4TL0A 3LQ5A 2Y6OA 4EH7A 4RIOA 5K5NA 3EN9A 3N9XA 5HNIX 1PXIA 1GIJA 2PUPA 2UZDA 2W1ZA 3VN9A 4C62A 3LFBA 4LGHA 3VRZA 3SHEA 4FEQA