5HEZA

Jak2 kinase (jh1 domain) mutant p1057a in complex with tg101209
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
291
structure length
287
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSARNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSAPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Resolving TYK2 locus genotype-to-phenotype differences in autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 287
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hezA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hezA01
2C5VA 3LFBA 4RJ5A 5LMKA 2ZDUA 5D12A 1BUHA 1YOMA 3C5IA 1ZOHA 4E93A 2F49A 3WE4A 3S95A 4IAKA 4V0GB 1OPKA 1H08A 1JKTA 4N6ZA 4QMXA 4EQMA 4OTFA 3E5AA 3OCBA 4ZSJA 5T3QA 1Q4LA 3VAPA 1H27A 5EOLA 1JBPE 2UW3A 5LXMA 3QXPA 4Q2AA 4UB7A 3UYTA 4PL3A 3W2QA 4P4CA 4BCKA 4NUSA 4IWOA 3SOCA 4MK0A 3TIZA 1Y6AA 2YLEA 4QMLA 1O6KA 3LXKA 3FZRA 3R8ZA 3F2NA 1IAHA 4KWPA 4H05A 1PYEA 2QVSE 4K33A 2W5BA 4HCUA 3OY1A 2R4BA 4ZAUA 3PJCA 3NCGA 3EKNA 5AR4A 3II5A 4N6YA 3DBEA 5LCKA 3QUDA 4U41A 3FSKA 3LXNA 4FZAB 3M1SA 5E1EA 3TL8A 3UE4A 1YOLA 2NP8A 4QTBA 2Z2WA 4DHFA 3HL7A 2XYUA 4FKWA 4MXZA 4D4VA 3DB8A 5A6OA 5K5XA 3PXQA 1MRVA 2VWVA 3L8PA 5TF9A 3TNIA 3ZUTA 2WFYA 2HCKA 4FNXA 4UBAA 5HORA 5I4NA 5K3YA 3CD8A 4RX5A 4D58A 1NY3A 2QLQA 2QO7A 1DAYA 3QYZA 4H3PA 2VNWA 4YLJA 3SOAA 4GK3A 2OF4A 1YHVA 2C6OA 4AW5A 4F9AA 1GY3A 1GIJA 2PULA 2V55A 5CAUA 3QD0A 5BVKA 1F3MC 3VBTA 3N9XA 3R9NA 5CSWA 4D1XA 2YM5A 4G9RA 4DFYA 1KUTA 1OL6A 3CPBA 5FD2A 1DI8A 4RA4A 3ZLSA 4EKLA 3VQHA 4XX9A 4LUEA 4BDEA 2CSNA 5GJGA 2XMYA 4WRSA 4H36A 1FVRA 4BR3A 5CVFA 4FVRA 3OCGA 3OT3A 4LGHA 4BYJA 5BUJA 3BZ3A 4H1MA 5IQBA 4AW1A 3LCKA 5IQGA 1UVRA 2JBPA 2P3GX 3ALNA 4B0GA 3P0MA 3ZU7A 4WT6A 3UOHA 4RIXA 3EFWA 4RJ3A 4C2WA 5IKWA 4E6AA 3ALOA 2PZPA 3OS3A 2PMNX 4F1MA 5ACBC 4D0WA 5AP4A 3FLYA 1NT2A 2KTYA 3NW5A 4PX6A 2ITNA 4A06A 3EL7A 5IMXA 4BIEA 2GNGA 4JQ8A 5IEVA 1ZAOA 2WO6A 4E5WA 3IW8A 4XG7A 3COMA 4A9YA 4FTIA 2QURA 3VJNA 3BEGA 2WMBA 3GC0A 2PUIA 4EOSA 5E8TA 2WTWA 3QRTA 4DBXA 3ZRKA 3C50A 5CEKA 3HV3A 3BYSA 4XLIA 4EH9A 5C1QB 2A2AA 4HYIA 4RBLA 1JKLA 3VF9A 3AGMA 4FKUA 5CNNA 3AT3A 3CIKA 4QMYA 4AW2A 4QMUA 2XIKA 3ZOSA 4CKIA 4E73A 4YBJA 2UW6A 5CVHA 5L4QA 4FV9A 1S9IA 3F66A 2OIQA 3PJ3A 3G51A 3QALE 4LGDA 3R7EA 4CFXA 4EORA 3ZHPC 3HV7A 1I44A 4PMPA 3FI4A 5EHLA 3E8EA 5ANIA 4E3CA 4FKSA 4BBFA 5GIOE 3BGPA 3NUPA 3OUKA 4HYHA 5FTQA 4DGOA 3C1XA 4DCEA 5ACKA 4PV0A 2GNIA 1VZOA 4NK9A 5ICPA 3KREA 5CSVA 3D5VA 4FBXA 4FYOA 4ENYA 4O0TA 1IRKA 4C3FA 1OKYA 1LR4A 2OG8A 4F9CA 5KBRA 1XWSA 5CS6A 2YACA 4ZZNA 5HEZA 2XZSA 2EXEA 3MV5A 4YTIA 2RFSA 4F0IA 3QCSA 1XH8A 1R0EA 2VTMA 4UMQA 3BCEA 4ACDA 4F6SA 1A06A 2B9IA 4IX6A 5CU3A 4ALWA 4AE6A 4FEVA 3KN6A 4BCFA 2UW0A 3OTVA 4G6OA 2V62A 3FQSA 5J9YA 2J5FA 3WYXA 5EI8A 3GU7A 3TNPC 4CMOA 4IFCA 2Z02A 2OJ9A 4EOIA 1GNGA 3QAME 3DDQA 3NAXA 2Z60A 4O91A 2W5AA 3SXSA 1SVGA 2X4FA 4I94A 5AM6A 4IB5A 4C3PA 3ACKA 3EJ1A 3BYMA 4LUDA 4YJQA 4D2RA 5AP2A 5AV2A 4K6ZA 3RPRA 3PLSA 2X9EA 4LV5A 1YOJA 3BPRA 4ZY6A 4NM5A 2J6MA 4EK4A 5L2TA 2QHNA 4K9YA 4FIEA 4U45A 1XBCA 3NGAA 4IM2A 4CCBA 4M69A 4GT3A 4RWIA 3WF7A 1UV5A 4C37A 3RBWA 1QPJA 2R3QA 2UZNA 4IHPA 3OG7A 5CEPA 2X9FA 3OEFX 1OPJA 2FGIA 2HOGA 4GT4A 3EFJA 4G3EA 4ASZA 4UXQA 4WSQA 3FZSA 4QYGA 4S33A 3SW7A 1H8FA 2XB7A 5JMSA 2VV9A 2IG7A 5M06A 4AF3A 4IW0A 3C5UA 3UVPA 3W2CA 4EKKA 3MY1A 3G9NA 2GU8A 3MW1A 1URCA 4LL5A 3VUGA 3PVBA 3N4TA 2VTNA 3F6XA 3DS6A 3RAIA 3IONA 3NR9A 1Q97A 2C4GA 2YIYA 3LQ3A 3QFVA 4IJPA 4C57A 1J91A 3WILA 2ETRA 4M66A 2WMUA 3NUSA 4QMSA 2XEZA 4P90A 3D14A 3D9VA 4J53A 3D0EA 1KE8A 2HXLA 3FHRA 4KIKB 3A7GA 4IWPA 4YZCA 2WTCA 3PVUA 5GNKA 4YR8A 4R78A 1PKGA 3LCDA 3PPJA 2ETKA 4FV5A 4DLIA 1ZY5A 3LQ8A 1XR1A 4FZ6A 3I4BA 4UMTA 4CRSA 4DAWA 1WAKA 4K11A 4L01A 3LFNA 3UOLA 4AE9A 2OZAA 3EB0A 5DT4A 1UU9A 4IB0A 4R1VA 3OWKA 5E8UA 3DFAA 3FY0A 4O21A 1OL2A 4JBPA 1Q8UA 2UW9A 5D9HA 3WF9A 4ASEA 4WUAA 4OBOA 1U5QA 3ENHA 3P79A 4UZDA 2REIA 2X6DA 5GZ8A 2EVAA 1IAJA 4BCMA 4MBJA 4L6QA 3SKCA 3RAKA 3NIEA 2C0IA 1Q3DA 4O96A 4X6RA 2I0HA 1U5RA 2HYYA 3DKOA 4W9XA 4USFA 2VTSA 2JBOA 4YZNA 3AMAA 4F0GA 5KZ0A 3UZTA 1OB3A 2O3PA 3CQWA 2UW8A 4RX9A 3EOCA 3ULIA 3DAJA 1XQZA 4QNAA 4V0GA 4XUFA 4DH7A 4EC8A 2WU6A 3UZPA 4BI1A 4OGRA 1BL7A 5I0BA 3R8LA 2DS1A 4FUXA 3OCSA 1HCLA 4R8QA 4AW0A 1CMKE 1NXKA 4UALA 1ZMUA 2CGWA 3RAWA 2F2UA 4XP3A 5KMLA 2CHLA 4DLJA 4L7FA 4IACA 4QMNA 2C3JA 3MWUA 2X4ZA 4IZAA 3P08A 3SVVA 3ELJA 1H24A 4LQMA 5LVMA 2UW4A 4FSTA 4L45A 4YGAA 4A9TA 2UZWE 2Z7QA 3COHA 1UU3A 4TWCA 4CYJA 1H1RA 1OVEA 3FZ1A 4FYNA 4FE2A 2X2KA 5CSHA 2J90A 1DAWA 1DM2A 2E9PA 3CP9A 4TWNA 5CF6A 1T45A 4UV0A 4A4XA 3PP0A 2W1IA 3E92A 5DHJA 4X2FA 4JAJA 3PWDA 2DUVA 4BDKA 2OH0E 3DTWA 2ERZE 4QP9A 3FLWA 3G2FA 5AV3A 5DG5A 3AC2A 4GIIA 1M2PA 5CENA 5AV0A 2R9SA 2GS2A 2VTLA 2WQMA 4FK3A 4IZ5A 2FB8A 2XK9A 3FMLA 5HCXA 4F99A 1UNHA 4O0SA 3R7VA 3BHUA 3UYSA 1PXIA 2JC6A 3OP5A 1BX6A 3POOA 1WCCA 3WARA 4WHZA 3KK8A 2WEIA 4ZZOA 1L3RE 4ZIMA 2VGPA 4F9WA 2W17A 4TWPA 3LXLA 3AOXA 4V04A 3V6RA 4MBLA 5CT7A 2B4SB 2HZIA 4YC6A 4IVAA 4ZTRA 4KIPA 4R3CA 3UIUA 2BAQA 4FEWA 3TTJA 5GZAA 4IX5A 2CKEA 2J7TA 1FMKA 3DLSA 5E9EA 2J50A 2Y6OA 5E4HA 3W16A 3DDPA 2GTNA 3MH0A 4OTWA 1WBVA 2RKUA 3P1AA 4FNYA 3WZUA 5LCJA 3RALA 4AN9A 3CBLA 2FUMA 4JIAA 2WIPA 3W8QA 5JGDA 2C0TA 2JFMA 5CU2A 1ZY4A 5F94A 3OCTA 5ETAA 5LQFA 2C6MA 1GJOA 3T9TA 1IA8A 4GV1A 4QQTA 3GNIB 3QWKA 2O8YA 2ITXA 3A62A 3U9CA 3LIJA 2XNMA 5BVEA 3PJ1A 4XG9A 4BN1A 3EQBA 5E7RA 2VTOA 4L52A 1ZMWA 4IVCA 2R3JA 4MXAA 3FL4A 5ANEA 3MFUA 4CFWA 1YDTE 1P4FA 5CSPA 3KMWA 3RCJA 1MQBA 4DFLA 4I6BA 4FTCA 2JKQA 3QTSA 3W2RA 4FKRA 5H8BA 5KMIA 2E9NA 4UZHA 2PMLX 2YJRA 5C26A 4O0VA 4O7NA 2WQBA 1HOWA 1ATPE 3CY3A 3VRZA 3DOGA 5E90A 3ORZA 3QGYA 3A7HA 3HRCA 3NPCA 5ITAA 3FXWA 4DC2A 4AGCA 3BU3A 1B38A 2IVVA 2BKZA 4M0YA 2DYLA 4QYYA 3VUKA 1W84A 3WZJA 3KU2A 4G3FA 4JS8A 5JFVA 4F1OA 3UG2A 4DTKA 4CKRA 5CYIA 3G9LX 4MNEB 5AJQA 4Y85A 5TR6A 4I3ZA 4R3PA 4TWOA 1G8SA 3O7LD 3C0HA 3CJFA 5HLPA 3HAMA 4CRLA 4F9BA 2HWPA 3ZBFA 5HTBA 3TEIA 3A61A 4AACA 1EH4A 2OFUA 4TYHB 4X21A 5E92A 3VS7A 4KIQA 4Y5QA 3IECA 3R0TA 4YLKA 2QLUA 5HG8A 4JIKA 2BROA 3MY5A 4QQJA 4BF2A 5M55A 3HP5A 4FL2A 3LFAA 1P4OA 3P5KA 4NEUA 5LOHA 3BYUA 4UX9A 3I60A 3RPYA 4IB1A 2H34A 2X2LA 3FKLA 3ITZA 4TL0A 4NIFB 1S9JA 4G5JA 2QQ7A 1H4LA 4RRVA 3ATTA 4U8ZA 3HDMA 3MFTA 2OH4A 3QZIA 3QXOA 3ORLA 4FNWA 5CF4A 2OFVA 3BU5A 4PMMA 2XIXA 4CVAA 3VS3A 5FP5A 4W4VA 3MY0A 1PMUA 2WZJA 4NWMA 3E93A 3PE2A 4F7LA 2BTSA 4ACMA 3R73A 2YZLA 3OW4A 1O9UA 4TYEA 3MIAA 3NYXA 4ZSGA 5H8GA 3PYYA 3TT0A 1BKXA 3DFCB 2ZV2A 3IGOA 3OOMA 3V5WA 3GP0A 4IX3A 4TY1A 5D7AA 5DBXA 4HW7A 3CE3A 3NNXA 2WMRA 3EN5A 3ORIA 4FMQA 2VWWA 3UP7A 4BCOA 2LGCA 4HVDA 3C0GA 3CQUA 4WKQA 4DT9A 3GU8A 4O27B 4BZOA 2XCKA 4CLJA 3U51A 5HG9A 3LOKA 3FQEA 3AMYA 3BHTA 2IW9A 5EYCA 2OIBA 4E5BA 3MA6A 2WHBA 2P0CA 3GCSA 3O50A 3ORMA 3UC4A 2R3GA 3K3IA 2GMXA 2G15A 3CTQA 4H39A 5IEXA 1G5SA 3RI1A 2WU7A 2ZMDA 5BVDA 4EL9A 2P2IA 4CLIA 1YWNA 4I0RA 1Q41A 3H9RA 2X7GA 2IZRA 3FMKA 4G9CA 1JLUE 2RIOA 4JR7A 4UYAA 2PK9A 4DYMA 2VWXA 5EKNA 5IPJA 4PP7A 2Z7LA 4IADA 2R3PA 3RJCA 3IG7A 3AC1A 3LCSA 4KIKA 5H2UA 2Y4IC 5T68A 5H9BA 2P4IA 4FV4A 2C5OA 5DT0A 2GQRA 5M53A 4ITHA 3RZFA 1PJKA 4QPMA 3KF4A 5F20A 3BI6A 3G0EA 5LVOA 3WZKA 4FTNA 3LCOA 4NFMA 3JXWA 2OGVA 4J71A 4C36A 4YHFA 4GG5A 4NCTA 4TPTA 4UYNA 5CSXA 2RG6A 1OKWA 3K5VA 5D1JA 4YU2A 2CMWA 2J0LA 3R7GA 4ZEGA 3ZSHA 5IQHA 2VTQA 2BAKA 3AT2A 4S2ZA 1UA2A 4FGBA 4QNYA 4HCVA 4JBQA 4I6QA 4M13A 5J8IA 5AUUA 4HZSA 5B7VA 3BU6A 2W4JA 3OWJA 5EYDA 4DTBA 2OXDA 3C13A 3H10A 4GVJA 4MD9E 3EYGA 4JDHA 1J7UA 2CNQA 1H26A 1TQMA 4XBRA 2GTMA 3LFQA 4K2RA 3D7TB 4MBIA 2X6EA 4FKVA 5I9VA 1QL6A 5FP6A 5DR2A 4YP8A 3S00A 1P2AA 3DBCA 2Y0AA 4EHGA 5F95A 5A4LA 2UZVA 3C4FA 3T3UA 4JG6A 3FMNA 3NSZA 5I9YA 4EOPA 2OXYA 4F6WA 2WTDA 4BCQA 1QPDA 3GT8A 5HLNA 4KINA 2AC3A 3TIYA 2Q0BA 5CAOA 4F7SA 5JGBA 1J7LA 4CV8A 4GCJA 3PPZA 3V5JA 5AX3A 3R7UA 2UW7A 1OPLA 4ANNA 5M4IA 2YM4A 2HK5A 4IH8A 2W1EA 1OIQA 4AA5A 2YA9A 1YXUA 3D5WA 3PA3A 3PY0A 2XP2A 2W1FA 3F3ZA 4OAUC 2W99B 4DG3E 3HYHA 3WF6A 2YJSA 3GCQA 3RK5A 5CZIA 3VBWA 3CD3A 3CEKA 4U6RA 2HY0A 5LMAA 3SD0A 3KRWA 2X0GA 1H1QA 2DQ7X 4IDTA 3LFFA 4KRDA 4O0WA 2VTAA 5EHOA 5KNJA 5HD4A 3TCPA 1BI8A 2VWIA 2WTKC 4JR3A 1OMWA 5GINE 4EI4A 2CN5A 2Y4PA 3VVHA 2BHHA 3DZOA 2OJJA 3FLZA 4F7NA 3PA5A 4D2SA 2WD1A 3QQKA 3UP2A 5KBQA 3MPAA 2X8EA 3NNUA 4G17A 4G3GA 4G34A 3SDJA 3VQUA 3WBLA 3AD5A 5HU9A 2ZOQA 4ZXTA 2BAJA 5HE0A 4BDIA 4ACCA 1H01A 2YCRA 1Z5MA 1O6YA 4B9DA 4KSPA 4MVFA 3LQ5A 5L8LA 1DS5A 4DFUA 2JDOA 3DK6A 3UMXA 1KE9A 2WIHA 4FTKA 5GZ9A 5H3QA 5A4EA 2B9JA 3ZM9A 3EQHA 2RGPA 4DH5A 4GFMA 1M2RA 5J79A 5DEWA 4X6QC 4FIJA 1JNKA 4BDCA 3I5NA 4MYGA 2O5KA 4LM5A 5HBJA 5AMNA 4GSBA 1IASA 5ETFA 5EM6A 5J95A 3EQFA 2C68A 1V0OA 5JRSA 4IAAA 2XM9A 3E63A 2UVXA 2V7OA 3PA4A 5FBNC 3BX5A 2BFYA 2B0QA 3MYGA 4JL9A 4BBEA 4EH4A 4XV9A 4Y83A 5AIRA 5FXSA 3T9IA 4EZ7A 3ODYX 3KXZA 1Q5KA 3I7CA 2XNPA 4I20A 4BI2A 2GQGA 2PZYA 2CGVA 3FKOA 3PXFA 5AX9A 5IDNA 1PRYA 2Z7RA 3I6UA 4N4SA 2ZV9A 5DI1A 3WYYA 4LFIA 1TKIA 3I0OA 3KMUA 1ZRZA 1H28A 2WTIA 5EH0A 5AR3A 4BL1A 3OF0A 5L8JA 3OBGA 2I40A 3H9FA 4P5ZA 2GDOA 4EHEA 4FV8A 4DITA 4MNEA 4O7VA 1Q3WA 4ANLA 3UIXA 4BYIA 4M3QA 3RK9A 4X2JA 3ENMA 3TDWA 2C30A 4KSQA 4YJVA 5DEYA 4BI0A 4XV2A 2PZIA 4EUUA 3R6XA 2R2PA 4JQEA 4TYHA 1V1KA 4Q9SA 2XK8A 4CG8A 2OICA 1U54B 1M14A 4QP6A 3TG1A 3CC6A 3A7FA 3EKKA 5BVOA 4M15A 3R1YA 2YWPA 4LL0A 4IAFA 5AUYA 2HZ4A 4D4YA 5C01A 2BDJA 2IW8A 4D9TA 4JQ7A 1YXTA 5L2WA 3HMOA 2WMSA 2C5XA 2IZUA 3Q04A 4U3ZA 4ARKA 4CQEA 3KXGA 5AIKA 2Q0NA 3QA0A 4I24A 4PTEA 3HUCA 2ITOA 4A07A 4P2KA 4O7SA 3U4UA 4YSMA 5DWRA 4IE9A 2CDZA 3FPQA 3ZO2A 5L8KA 5HIBA 4M8TA 3FDNA 3CXWA 4S31A 2I6LA 4NM3A 3VF8A 1F0QA 2XYNA 3DPKA 3OZ6A 5DE2A 2H96A 3SHEA 4F65A 3VS0A 2A4LA 1WBPA 3FC1X 5ANKA 5J87A 4FTRA 4YC3A 5AP5A 4Y73A 3VJOA 2VTIA 3Q9XA 2ITZA 4IB3A 2YZAA 5EW8A 1STCE 3SW4A 3TDVA 3H4JA 4F6UA 4QMTA 5JEBA 3IOKA 3L9MA 3F61A 3GXLA 3F88A 2PMIA 2BRMA 3MN3A 5HOAA 4DFBA 3BEAA 3KULB 4M0ZA 3AC4A 3Q2JA 3RKBA 5C8KA 5EDPA 4FTTA 1L8TA 4ZZMA 1GAGA 4R77A 3O7LB 3ZCLA 2F4JA 3HA8A 4CMUA 4BCNA 2YISA 1OBDA 3F5GA 3FZOA 5E8WA 1R3CA 3QUPA 2RFDA 4KABA 4UWCA 4E6DA 1I09A 4AZSA 4R7HA 2ZDTA 3LJ0A 3I5ZA 4FICA 4I21A 4P5QA 4ZTNA 4AZVA 4CSVA 2Y4IB 4U81A 4YHJA 1ZYJA 4DG2E 2BZKB 4L46A 3RWQA 2WTVA 1YKRA 1Q24A 4FSMA 4AGDA 2PWLA 2BR1A 2VWBA 4IXPA 4CGAA 3PJ8A 3S3IA 4TYJA 3FHIA 4NM0A 4YBKA 4DFXE 3LPBA 3L9PA 3LFDA 1ERKA 1YXXA 3DAEA 2IO6A 5A3XA 4KB8A 2YITA 1XO2B 4LMNA 5M4UA 3GC9A 3R04A 1F5QA 3VHKA 2YDIA 4C4IA 4D4SA 4RIYB 4KUJA 4O0XA 3QQFA 3ODZX 3ZUUA 4FGRA 2YWVA 4FKGA 5EI2A 3UC3A 4BHZA 4RVTA 4BKYA 2C6KA 3DTCA 4G3DA 1Y91A 5J9LA 4AZTA 4CZYB 5KO1A 4FSWA 5A9UA 1REKA 2W1GA 1ZZ2A 4TN6A 4CFUA 1B39A 4C61A 2ETMA 2OKRA 3HV4A 5HE3A 3ZBXA 2YIRA 3D7TA 3JVSA 3KMMA 5JK3A 3R2BA 4JXFA 4Q5HA 1NVSA 3VS6A 2PUPA 4IMYA 5CEIA 2C1AA 2ZB1A 1IA9A 2Y8OA 1OITA 2ZVAA 4GK2A 2XBAA 4FSNA 3C4CA 2JKKA 4S34A 1YHWA 4U42A 3H3CA 1VYWA 4G1WA 4PWNA 5AR8A 4OBPA 4ZJJA 3TNQB 2BRBA 3TACA 2E9VA 2F9GA 1JKSA 2VAGA 3QX4A 4K8AA 3SRVB 2EWAA 4FEUA 3HMNA 3NLBA 2EXMA 4C4GA 3LMGA 2IPXA 4HYUA 4LOQA 2WMXA 1E9HA 1PMVA 3MSSA 4QP1A 3DB6A 2RF9A 5HTCA 4KD1A 2YDKA 1BYGA 3QTZA 2OJFE 5KMNA 1W8CA 5DH3A 4FKPA 3DBDA 4ALVA 3ZSIA 4R7BA 5KMMA 2I0YA 2XH5A 3PG1A 4QP3A 4RX7A 4IAYA 2C0OA 1QPCA 4GYIA 4TXCA 1KOAA 3P4KA 1GIHA 2PY3A 2Z7SA 4I6HA 3EQGA 5AAEA 3IK3A 4Y8DA 2WTKB 2QKRA 5AM7A 1CSNA 2JDTA 5DFPA 3BWFA 4E1ZA 2CJMA 5DPVA 3CS9A 4RA5A 1A48A 2R64A 4XG4A 4D2VA 4UWBA 3B8QA 4L3PA 3CGOA 3FI2A 4EYJA 2WOUA 3BWJA 5EFQA 4JDKA 2QNJA 5L6WL 5CVGA 1E1XA 4Q9ZA 5TKDA 3NCZA 4QYHA 2X7FA 3PRIA 2AYPA 1J1BA 3DLZA 1UKIA 4R7IA 4C62A 4K1BA 5IUHA 3MVHA 5LMKC 3DJ5A 5A4TA 3DU8A 4PQNA 3NDMA 3G5DA 4QMQA 5EQYA 2H9VA 4YLLA 4E4LA 3Q6WA 3QU0A 2A19B 3VUMA 1PXPA 3R22A 4KRCA 2YAAA 2GHMA 1PMNA 5IQFA 3S0OA 1H07A 4YUQA 4UEUA 4BGQA 3LM5A 2Y9QA 1T46A 4DEDA 5HLWA 2X8IA 4C35A 4WD5A 5AP7A 3WZDA 5M44A 4EOOA 3IDCA 2VU3A 3BV2A 4FR4A 4FTQA 4KS8A 4RWJA 4ANBA 4DEBA 5H8EA 2CKQA 1JPAA 4FV3A 2RL5A 5AAFA 2QOFA 2OSCA 3H0YA 4XNEA 5CI7A 1R78A 3GCVA 3RNYA 2VO0A 2BPMA 3F3VA 3R28A 4NU1A 5EYKA 1YXSA 5D11A 5AUTA 1XBAA 3Q96A 4CFFA 3Q52A 4DGNA 1ZWSA 5CF5A 2WGJA 2XF0A 4MWIA 3TM0A 4S30A 5J1VA 4FT3A 4QP7A 1Y57A 2C6TA 2FSTX 4MKCA 2XA4A 1JSTA 4FL3A 5KCVA 1OL7A 3Q3BA 2O64A 5ANDA 4NW5A 2QONA 3O23A 2R3OA 5I3OA 3DK3A 4Z7HA 1VEBA 4AZEA 5LJJA 3G0FA 5C27A 2XRUA 5F4NA 1DI9A 4EQUA 4AG8A 2HY81 1MQ4A 4HPUE 4U40A 2P55A 2IW6A 2QOKA 1Z9XA 3V51A 2DWBA 4Y95A 3CLYA 2O65A 2R3KA 3BBWA 3OEZA 4LOPA 4MF1A 1Y6BA 4TNDA 4B8MA 5AADA 3GOPA 1G8AA 4HJOA 1U54A 3QC9A 4I93A 5IQDA 4F08A 4ZY4A 3QL8A 2WAJA 4D28A 2WNTA 3V6SA 4PPBA 2QC6A 3VRYA 5FBOA 3ANQA 4ZS4A 3PUPA 4NFNA 4WG3A 2ZM3A 4JJRA 4RWLA 3VUTA 2FSLX 4L67A 4NT4A 5DRDA 3D83A 3QQHA 2XCHA 3LZBA 3ORNA 3MVJA 4F09A 4RLKA 4M84A 5JRQA 3RPSA 4V05A 3FLSA 5BPYA 3JPVA 4Z7GA 4FC0A 1SVHA 3JY0A 4AGWA 4FVQA 1H1PA 1PXNA 1ZMVA 3EQRA 5ETIA 3FMEA 3HV5A 3ZM4A 4ERKA 3F2AA 4RFMA 4RIOA 2I0EA 5AP1A 4W8EA 4FIIA 3FBVA 4WOVA 5BYYA 4XJ0A 1Q8TA 5CASA 3GQIA 3QWJA 2PVJA 3ZDUA 2PPQA 4FIHA 1OI9A 5LARA 2W9ZB 5CU4A 3QA8A 3UODA 3IOPA 3P9JA 5IA5A 4I0TA 4GUBA 4IIRA 4JI9A 4ZK5A 3GU6A 4GW8A 1YWVA 3NAYA 4KBAA 4O38A 3E62A 5AUXA 3R7IA 2WMTA 3R8UA 4EJNA 1P14A 3R1NA 4D1ZA 2V0DA 3P86A 3OXIA 1XH6A 3GGFA 3MS9A 1TVOA 4M14A 4FTLA 3TZMA 4RJ7A 4YJSA 3GBZA 4WSYA 1FPUA 3RMFA 5FM3A 3SG9A 2ITPA 4E4XA 3DAKA 3JR1A 4IWQA 4RC2A 3KVWA 3Q6UA 3KULA 2X7OA 1Q61A 2OU7A 3K5UA 1FOTA 4A7CA 3KRRA 3O17A 3D4QA 4ZJIA 1PXMA 3R7YA 3FJQE 4U5JA 5HZNA 4CXAA 1E1VA 1LEWA 3C9WA 2C6IA 4FK6A 2PZRA 1XBBA 3VUDA 3T3VA 3RCDA 4LMUA 2Y7JA 5BYLA 4O1OA 3TZ9A 2UZBA 4G16A 4F9YA 3NYOA 5JGAA 3F5PA 2CNUA 2F7EE 3NEWA 2OO8X 4F63A 4MQ2A 3T8OA 4FTOA 1WZYA 2H6DA 3E87A 3EYHA 1R39A 3C0IA 4FV0A 3F5UA 2XJ1A 3KXHA 3DY7A 3AC3A 4RLLA 5AUVA 4UMUA 2BZIB 3A4OX 3EIDA 4J52A 4QRCA 5JZNA 4FEQA 3NVKI 2JGZA 2YEXA 3UO5A 2ONLA 3U9NA 4C58A 3JUHA 4L9IA 3FI8A 3L9NA 2ACXA 2JLDA 3ZUVA 4C59A 4PNIA 2PUNA 1MUOA 3R9HA 4RIYA 4UN0C 3O51A 2XBJA 4WRGA 3WZEA 4F70A 1XH9A 1CTPE 4HVHA 2PYWA 3FMDA 4OTHA 4C38A 4CD0A 2ITYA 2R7BA 3NX8A 3ANRA 4TRLA 4C8BA 1OIYA 4IDVA 4CKJA 4XG3A 3RHXA 3TN8A 4ASXA 3R00A 4H3QA 3NUAA 3QLGA 5AV4A 3ORXA 3IS5A 4BDAA 3GFWA 3O8TA 1PXKA 4BC6A 5FEEA 4XOYA 2C6EA 5A14A 2C6DA 2UZDA 4PRJA 5IQAA 2YCSA 3R02A 2OLCA 4L8MA 2YFXA 2UVZA 2QO2A 2VUWA 2YHVA 3Q4UA 4AZWA 3OT8A 5HGIA 4RIWB 3QCYA 3TNHA 2GHLA 1PF8A 5M09A 2IWIA 2W1CA 2CGXA 3EQCA 2JEDA 3MVLA 5B0XA 2BRNA 2PZ5A 2X39A 3PP1A 5CANA 4E4MA 3SLSA 5HESA 3G6HA 4GKHA 2QG5A 3FUPA 3FLNC 4ANSA 1AQ1A 3BLQA 3GVUA 5J5TA 2BILB 3E7VA 5DOSA 5CWZA 5HHWA 5AFVA 1NA7A 4WNPA 4B4LA 5KMOA 2C1BA 2WMVA 5DGZA 4DGMA 2JIIA 2XKDA 5CTPA 3NWWA 2EXCX 4O81A 4EWQA 2VTPA 1OIRA 3Q32A 4BZDA 1H1WA 1Y8GA 4FT5A 4DE4A 1U59A 2R3FA 4BKJA 3R83A 4PNKA 5L2IA 4TW9A 2J51A 4C4HA 3O2MA 3LE6A 5DRBA 5IG1A 2G9XA 3BHHA 2BFXA 4L42A 4YZMA 4Y72A 1YW2A 3AMBA 5IQEA 2JAVA 5CF8A 3VS5A 1OKZA 2CKPA 3MBLA 5D41A 3O0GA 4ONAA 4IEBA 3V8WA 4MXYA 3VW6A 3TUDA 1CDKA 2WPAA 2PVHA 4FZ7A 2NRYA 2XIZA 3FKNA 3GI3A 1FBNA 2VTHA 3NNWA 1OUYA 4B8LA 5I3RA 5CEMA 3U6IA 4C3RA 2YCFA 4APPA 2LAVA 3TV4A 4JRVA 3W2OA 4E20A 2J9MA 3HMIA 5E91A 5A4CA 5CX9A 2WKMA 3A7IA 3QRIA 2R0UA 3EN4A 2PHKA 4HVSA 3EZVA 1LP4A 2BKKA 3I79A 3LLTA 3EH9A 4IAZA 1W83A 4FV6A 4IWDA 1WVXA 2ZB0A 3GOKA 3GQLA 1LPUA 4H58A 4Y46A 4YJOA 1WBNA 3VO3A 4FT7A 4U43A 4XS2A 5AWMA 4TNBA 5KKRC 3EL8A 4HCTA 4PDPA 5HKMA 3W32A 5HNIX 2J0MB 3O8PA 3ORPA 4BZNA 3OXTA 3MJ2A 2HAKA 3DQXA 3PXYA 4EYMA 3EHAA 4OTIA 2FSMX 3FWQA 1GZ8A 4I92A 3AGLA 3MPTA 4OTGA 4XEYA 1LUFA 2C5YA 3AC8A 2V5QA 2WMAA 2R3NA 3ZMMA 3LJ2A 2OJIA 1SNXA 2PVYA 5HVJA 3SXRA 3RAHA 3CY2A 5IDPA 1BMKA 2BIKB 1WVWA 4FKOA 4GG7A 3TWJA 4DN5A 1OL5A 3G15A 3QUEA 3KXNA 4JX3A 4XLVA 3JY9A 3ZS5A 5IQCA 2BDFA 3E88A 3Q4ZA 4J8NA 5L2SA 3S1HA 3DJ6A 2C3LA 2EB3A 3SX9A 4ASDA 2CN8A 4KKHA 4RQVA 4QTEA 3QTUA 3ZRMA 5CXZA 2JAMA 1RQQA 3EWHA 3HDNA 3RVGA 2XNNA 3ZDIA 5BVFA 4DFNA 2PUUA 4IFGA 4JVGA 4MHAA 4OUCA 4O7YA 4E8AA 1JWHA 4WUNA 1TQPA 2YAKA 4MH7A 4FKJA 4RZWA 3RNIA 4O84A 2BTRA 3NUYA 5B2MA 2QG7A 2IVSA 1WBWA 3ACJA 4O6EA 4W9WA 1K2PA 2W4KA 3KRLA 3V5QA 4LRMA 4ERWA 4PP9A 3KCFA 3QD4A 4IANA 2ITVA 2J2IB 5D7VA 5ANGA 3RM6A 4O7WA 5CXHA 2B52A 5IISA 3BQCA 2SRCA 4F0FA 3DZQA 2VO3A 4TTHB 2A1AB 5IA4A 1SYKA 4XP2A 4AS0A 3D2KA 3ATSA 4FTJA 3R8VA 1YI4A 5FM2A 4O2ZA 3SC1A 5M56A 3LKMA 4ZY5A 5AV1A 3AT4A 3PIYA 4X3JA 4EEVA 3V04A 3BQRA 4NW6A 2G1TA 4RWKA 4GEOA 5L6PA 4U80A 3B2WA 5LVPA 4K18A 2WMWA 3R30A 1WBTA 1OL1A 1QMZA 1FINA 5JZJA 1SZMA 2XNBA 4ACHA 4GT5A 3AG9A 3IPHA 1UU7A 4HGTA 4D5HA 3PPKA 4QP2A 4U9AA 4AOIA 1U46A 2W9FB 3DNDA 3Q5ZA 4RSSA 3COKA 3W2SA 4AA4A 4BTMA 2WOTA 4FUYA 4HZRA 4PDYA 2VO6A 4II5A 4L68A 4S32A 2Q83A 3QRKA 4GS6A 3W1FA 3OC1A 5DR6A 3IDBA 3MB6A 3FMHA 3VNTA 3FAAA 4QMWA 5IQIA 4ALUA 4EHVA 3WI6A 4E6QA 4LRJA 1YHSA 3PFQA 4DEHA 4XG6A 4C33A 4AU8A 5KHWA 3V5PA 4CTBA 1JKKA 2C47A 5EW3A 3R9OA 4KIOA 5JFWA 3OHTA 5BVWA 3FE3A 1YRPA 4DEGA 5F9EA 4P7EA 1OIUA 3UQFA 3ULZA 5IA0A 1NVRA 4I1ZA 3VS2A 4BCHA 3QCQA 5IMEA 2J0IA 4PDOA 4D0XA 4EBWA 1OUKA 3RM7A 3F3TA 2O2UA 4O0UA 4BRXA 4DEIA 4ZTHA 4RZVA 3PDTA 3HVCA 2XNGA 5JFSA 4CFNA 2HZNA 1NVQA 3Q5IA 2VTTA 2XIRA 1YWRA 3MJ1A 3KF7A 3ROCA 4ANOA 3QF9A 4DA5A 3QKMA 5ANOA 1W0XC 4MTAA 5HD7A 2G2FA 1PHKA 2ZMCA 4CNHA 5LVNA 2QU6A 3R21A 4XYFA 4Z3VA 4JDIA 4MXXA 1H0WA 4PPAA 1RW8A 4PMSA 4RGJA 3BELA 2WEVA 3BLRA 4FV2A 4EH2A 4BDJA 3HEGA 3FL5A 5M07A 3OOGA 4XHKB 5C9CA 1ZYDA 3G90X 4YC8A 1IG1A 4C0TA 4U79A 3A2CA 3MFSA 3R1SA 3MPMA 3EQPA 3HP2A 3KC3A 1AD5A 2BZJA 3F2RA 5BNJA 2BHEA 5AAGA 5KX8A 3DA6A 3K2LA 5FDPA 4E6CA 4DGGA 4FSUA 4CV9A 3FY2A 1LEZA 5FXRA 3C4XA 2PSQA 3VUHA 3P7AA 2RFEA 2UV2A 3UOJA 3ZLYA 4RIWA 3TV7A 2RG5A 3MFRA 3ZFYA 3UQGA 3TUCA 1GIIA 2VWYA 4FV1A 5DNRA 3QRJA 4R5SA 2J5EA 4MEDA 4EOJA 4DINA 4XOZA 4DH1A 2PVKA 4NM7A 4E7WA 4O7TA 4NJDA 2O0UA 4N70A 4JX7A 4QD6A 4C34A 4DF3A 1GZKA 3HAVA 3D2IA 3QD2B 3UIMA 1XJDA 2UZUE 3BLHA 3OXZA 3QLFA 4ZSLA 3TJDA 5HX6A 2BRGA 4BCPA 2E2BA 4I41A 4EUTA 2FVDA 4FOCA 4EH5A 3MESA 3UDBA 4MD8E 4D1SA 3I1AA 1HCKA 5HE2A 4MCVA 4MX9A 2CPKE 2XEYA 4YJRA 2JKMA 3PXKA 4FSRA 3KL8A 3CGFA 4IQ6A 2X81A 4V01A 4XG8A 2EB2A 5IH6A 3U6JA 2OZAB 3NW6A 4O0RA 2XK4A 3AXWA 3WF8A 4BHNA 2GNFA 2ITUA 4NIFA 1PW2A 3RWPA 5LWNA 3L8SA 2C6LA 2WB8A 3UBDA 2FYSA 3Q9YA 3KB7A 5T6KA 3IGGA 3DKFA 5HI2A 1SMHA 3W2PA 5JKGA 4X3FC 5I9XA 3UPZA 4ZMFA 3ZO3A 2BUJA 4G31A 4O0YA 4CFMA 5JN2A 4BTKA 4JBVA 5AR2A 4EOQA 4EK6A 2OI4X 2VO7A 3DK7A 4I0SA 4R6VA 3NUUA 1KE7A 3U4WA 3R63A 3TJCA 4AFJA 4USEA 2ZM4A 4YO6A 3KA0A 4EK3A 4YURA 1SM2A 5FEQA 2GS7A 4IC8A 5CAQA 5ANJA 5FGKA 3QQGA 2FH9A 5GIPE 2BMCA 3KGAA 3PIZA 4FNZA 4LI5A 4TYGA 4EOKA 4CZUA 5AP0A 5J7HA 5K0KA 2B9FA 5KKRB 4QQCA 3PG3A 5GHVA 5CY3A 3CR0A 4HNIA 2HW7A 5KZIA 3PSDA 4YJUA 3R7OA 4D55A 4LV8A 4QMPA 3ZZEA 4C2VA 5JSMA 3UOKA 1PKDA 2B1PA 3C4EA 3PE1A 2Z8CA 4QQ5A 3TTIA 1R1WA 2OWBA 3NIZA 5C4LA 4GRBA 3ZLWA 3HZTA 3QRUA 5LVLA 3H30A 2W1DA 2YIQA 4UXLA 3ZEPA 3BV3A 3HLLA 4BDDA 4FIFA 4DCAA 4YHTA 3D15A 2OW3A 3KQ7A 3QTIA 4JG8A 4RQKA 5M57A 3Q60A 4G6LA 4BVUA 4BDBA 4E26A 1PYXA 3W8LA 4HVGA 5K5NA 2G2HA 2HXQA 4W4WA 5HE1A 2OBJA 4JT3A 5EOBA 2FO0A 5HX8A 1FGIA 2ERKA 4HPTE 3QGWA 3NMUF 2QI8A 4I6FA 4KS7A 5JQ8A 2XKFA 2QOCA 2YERA 5KE0A 5EDQA 5J7BA 5J9ZA 4JDJA 4B6LA 3NVMB 2OZOA 1GOLA 2ZV7A 3LFSA 2AC5A 2AUHA 3PY1A 4HGLA 3HGKA 4MWHA 5M51A 4FKIA 4QTDA 3BE9A 3I81A 3RZBA 4BBMA 3GENA 3ORKA 2GFSA 5M08A 1R0PA 2PE2A 5DIAA 4O22A 5E8VA 4AQCA 5E8ZA 4Z55A 4Q5EA 4FKQA 4YNOA 4HOKA 4J95A 2B54A 3OFMA 4AN3A 3LJ1A 1ZYLA 2BDWA 4RMZA 3ZO1A 5CALA 4O2PA 4EWHA 1VYZA 2OF2A 3JVRA 4I5PA 5CLPA 4OR5A 4DFZE 3QC4A 5KHXA 4EK8A 4FI1A 4D4RA 4BGGA 4KA3A 3IW6A 4QMOA 3MB7A 4G3CA 3PLAE 3QQLA 3DXNA 3ID6C 2O63A 2XNEA 4ITIA 4DH3A 2OXXA 4JNWA 1KV1A 1WBSA 1FQ1B 5FLFA 4UWYA 5HIDA 2PL0A 3AC5A 5HCZA 3H0ZA 3RPOA 3CKXA 3ZFMA 4CCUA 1ZLTA 3CJGA 3SA0A 4RVLA 5FDXA 4AAAA 4OAVB 3TUBA 1KE5A 1MP8A 2R3HA 1UU8A 2JDSA 3GCUA 4J1RA 4X2KA 4CTCA 4M7IA 3FQHA 2YCQA 4DGLC 2F2CB 3DNEA 1GZNA 3VUIA 5EQEA 5CEOA 4AFEA 4GU9A 3QHWA 1REJA 3HUBA 1Q8WA 4XCUA 4GJ2A 3Q9ZA 4PUZA 4GMYA 3KFAA 3PXZA 3ZRLA 3ZSGA 2YIXA 2QD9A 5C8NA 1OGUA 3EFLA 4GH2A 1WBOA 2BIYA 4X0MA 4EZ3A 2WELA 5EM8A 2YM7A 4DEAA 1O6LA 3OWPA 5LMBA 3U55A 4IM0A 2EU9A 4RX8A 1PXJA 4OTDA 1QCFA 1Q8YA 4JLCA 3M42A 4AT5A 4IZYA 4PF4A 4NKAA 4C4EA 3U6HA 3E3BX 2QO9A 4X2NA 4GFOA 3GEQA 5A4QA 3UO4A 3NYVA 4ZTSA 3R8MA 4FTUA 4OW8A 3RINA 3VIDA 3E8DA 4YJTA 3ZO4A 3ZXTA 5FQDC 3PZHA 3FEGA 3FMJA 4GKIA 5HO6A 4NTTA 4W4XA 4LG4A 3R8PA 2YM6A 5EG3A 4A4OA 3KXXA 3E3PA 2QR8A 1W7HA 4HGEA 2EUFB 3KXMA 4DBNA 4DG0E 4AGUA 3UIBA 3WIKA 4MNFA 2PE0A 2PMOX 1UNGA 3N4VA 4Z9LA 3RHKA 2GQSA 2HENA 3LMHA 2V7AA 2QOIA 1OECA 2UW5A 1Z57A 3CCNA 4QMVA 2VNYA 3C7QA 3P7BA 3LCTA 3GFEA 3WOWA 4RPVA 3BBTB 3TZ8A 2JIUA 3C4ZA 3HV6A 3MH1A 4L7SA 4U0IA 4D2PA 3ZLXA 2E9UA 1Y8YA 5A54A 1H25A 2OK1A 3B2TA 2R3MA 4BWPA 4C7TA 4EHZA 3ZH8A 1XH4A 3NNVA 3F7WA 4O1PA 2CKOA 1J3HA 2XJ2A 1ZYSA 4FG8A 3OROA 5TO8A 4FF8A 5L6OA 4XV1A 3FI3A 3NZ0A 3QTWA 3TKUA 4L44A 4BCJA 5EYMA 3ETAA 3ZC5A 4J7BA 2X2MA 3OD6X 3TV6A 4F4PA 3BHVA 5HIEA 5I9WA 1WFCA 5C8MA 2UZLA 5DN3A 2GNJA 4NKSA 3MTFA 2HZ0A 4YSJA 2J4ZA 4N0SA 3UG1A 5CAPA 5DA3A 3TNWA 3AD6A 4QP4A 3SGCA 4XG2A 1ZOGA 2GHGA 2PVRA 2R3RA 4N57A 4QTAA 2CLXA 2F57A 2HIWA 1WVYA 4EZ5A 3O96A 5HG5A 5KUPA 4OLIA 3TKIA 2C3KA 3LFEA 3QCXA 4EONA 4APCA 3KKVA 3MGYA 5EQPA 4I5MA 4PTCA 5EHYA 4RVKA 5BUEA 4CZTA 2G01A 4O7RA 3D5UA 4ANQA 4GL9A 4BIBA 4EH7A 4FKLA 3BGZA 4ENXA 5BMSA 3EQDA 3DCVA 3LVPA 2BCJA 5FXQA 3POZA 4AZFA 5JFXA 3LM0A 2PU8A 4QPAA 3TXOA 4J8MA 3HMPA 4DH8A 1XH7A 2OIDA 3QD3A 1FGKA 2NPQA 4X3FB 3JYAA 5HBEA 1XH5A 4FSQA 1ZZLA 3LLAA 1V0BA 3VHEA 3GUBA 4KBCA 4L00A 2XK6A 3QZFA 4QMMA 3QQUA 5EI6A 3DXQA 5CEQA 3W33A 1H0VA 3QTQA 4NSTA 2GCDA 3FPMA 3QZHA 2W4OA 5EM5A 3I7BA 4BWXA 1UWJA 4A9UA 2P33A 3DGKA 3MH2A 3WIGA 1JVPP 3EN6A 3AD4A 2B7AA 4JAIA 5CQUA 2E9OA 4KKGA 4EH8A 4UY9A 2H8HA 3M11A 2W7XA 5B2LA 4GYGA 4U97A 2JDVA 4M67A 3R9DA 4EOLA 3BYOA 2PE1A 4A4LA 5IA3A 4NYEA 4QMZA 5F1ZA 4YTFA 2CGUA 4XV3A 4D9UA 3P78A 3BKBA 3VS4A 2RSVA 4I5HA 4NL0A 5AR7A 4F7JA 1JAMA 4G6NA 3ZTXA 4TT7A 2NO3A 2W0JA 4QO9A 4BB4A 5IUGA 4BY9E 5CQWA 4YPSA 4RC4A 3UNKA 4CG9A 5CAVA 3DKGA 2B53A 5JT2A 4EH6A 3Q53A 3ZXZA 4F64A 5J1WA 4QTCA 3EMGA 1CKIA 4HYSA 5IH4A 4AT3A 1YI3A 5HNGA 1B6CB 4PL4A 2BVAA 3HA6A 4G2FA 3A4PA 4USDA 3A7JA 3PIXA 2IN6A 3P23A 3VN9A 4RFYA 4NJ3A 3D7ZA 5BUIA 2QKWB 4ID7A 5L3AA 4ZOGA 2B9HA 5KMJA 3PRFA 4E5AX 1JSUA 5IEYA 5CZHA 3OTUA 3D5XA 4W8DA 4FVPA 1U4DA 4WA9A 4XBUA 4CYIA 5FWKK 3MTLA 3Q4TA 3L8XA 2BZHB 3GB2A 1TQIA 3QX2A 4R3RA 5BYZA 3QHRA 5AUWA 3VW8A 2QOOA 5HCYA 4AT4A 5K4IA 4FTMA 2VN9A 2GNHA 4O7ZA 4BDFA 5HU3A 3PWYA 3R71A 2VTRA 4JG7A 2R5TA 2YM8A 4J97A 3CTJA 2GFCA 4WNKA 4O86A 3A8WA 3TKHA 3IW7A 3B8RA 2QOBA 1M52A 4IZ7A 3VBQA 4JBOA 4FG7A 4MAOA 4KBKA 2ITTA 3MA3A 4I4FA 1IEPA 1KOBA 4WBBB 4DT8A 4YZBA 1Q99A 3WF5A 2XVDA 4OBQA 2J0JA 1V0PA 4ANMA 5C4KA 3RGFA 2JFLA 2VX3A 3R1QA 1M2QA 2W5HA 2VZ6A 2HW6A 4L53A 3LHJA 4OTPA 3SV0A 4IAIA 4AOTA 2HWOA 4J99A 4AXAA 5K9IA 5IZFA 4RJ8A 5FTGA 4U7ZA 4I5CA 4X7QA 3U8WA 4B7TA 3NRMA 4PTGA 5E8YA 5EW9A 3UNJA 3KK9A 3P7CA 3K54A 3V5LA 4ACGA 1RE8A 5CI6A 2R3LA 5HNBA 1UKHA 4ZP5A 4ZLOA 2XIYA 3FYJX 4M97A 3GU5A 2PVNA 1A9UA 4YTHA 2C69A 3E8NA 3IQ7A 3SRVA 1K9AA 3HMMA 5IUIA 3VBVA 1OBGA 3UPXA 2JKOA 4U44A 2ZJWA 4ZSEA 4CT2A 4C4FA 2IJMA 4M68A 2FSOX 3PSCA 4WBOA 1KV2A 2IZSA 4CT1A 5KMKA 4QPSA 5HVYA 2RFNA 3HRFA 4YZ9A 4ZLYA 4O83A 4YTCA 4DTAA 2C3IB 2JITA 3MVMA 5EM7A 4ZTLA 3FLQA 4FG9A 2I0VA 5E1SA 4YJPA 4FOBA 4CMTA 4TKSA 4U3YA 2W06A 3LFCA 3PVGA 1AGWA 4YMJA 3G33A 4PY1A 3C51A 4BDHA 4FX3A 3OMVA 4BCGA 2GS6A 3RPVA 3U54A 2PVMA 5CU6A 1ZARA 1ZYCA 2XM8A 3FZTA 4OTQA 3NS9A 3BIZA 1OZ1A 2WMQA 3OW3A 1IR3A 4AWIA 1BLXA 4PL5A 4YPDA 5AEPA 5AA8A 3MI9A 5LWMA 3RP9A 3UTOA 5DMZA 2VX1A 4BTJA 3CKWA 2VGOA 3ORTA 3QKLA 5DYJA 4IX4A 1PXOA 3E7OA 3KRJA 3SG8A 4NH1A 3F3WA 2WQEA 3QTRA 3AQVA 4W4YA 1MRUA 4RC3A 4BFMA 3UO6A 3QYWA 3ZC6A 4F1TA 2UUEA 4XRLA 3PXRA 4TZRA 4GFGA 4OT6A 4OT5A 4AX8A 4RJ6A 4RVMA 5BMMA 4KAOA 3OWLA 2QODA 4WIHA 4WO5A 5E8SA 3R01A 2YIWA 3THBA 4PDSA 5AP6A 4LRKA 3U87A 4EBVA 5J5SA 3ZZWA 4LOOA 3CSVA 3H9OA 3I0QA 5AP3A 5I5ZA 3GU4A 1Q8ZA 4QOXA 4FSZA 4I23A 5HQ0A 2PVFA 3HNGA 3UVQA 4QYFA 5TT7A 2QOLA 2IVUA 3EN7A 1J1CA 3KN5A 2X8DA 3A60A 4FV7A 3W10A 1W82A 3CQEA 4BIDA 3DQWA 4CFVA 3PY3A 4J96A 2WTJA 3M2WA 4UMRA 1YVJA 1OM1A 4EC9A 4EH3A 5HTIA 1YI6A 5BQ0A 3BGQA 4YJNA 2B55A 3FMMA 4IJ9A 2P2HA 3QZGA 3EZRA 1KE6A 4A9RA 2VX0A 3MIYA 5C03A 4DEEA 4QYEA 4XP0A 1XKKA 3QTXA 4TYIA 5IA1A 5AA9A 1FMOE 2BALA 2CCHA 4J98A 5EKOA 5ETCA 3UNZA 4FODA 3A99A 4XRJA 3VBYA 3OUNB 4AP7A 5L2QA 3KVXA 3V3VA 4B99A 5IU2A 5CU0A 5I9ZA 1M7QA 1KSWA 2GNLA 3ZONA 2UZOA 3GC8A 3QKKA 3DT1A 4GJ3A 2YM3A 2ZAZA 4GK4A 5AR5A 3W55A 4WNMA 4IVBA 1PXLA 4RT7A 5A46A 2J0KA 2GSFA 5M4CA 5I9UA 1JQHA 3EFKA 4ORKA 5CT0A 2QCSA 3PZEA 1Q62A 1FVVA 2Y6MA 4GIHA 3EQIA 3KEXA 3PJ2A 4FZFB 2WQNA 2R7IA 5HG7A 2NRUA 4IC7A 3DBQA 3LXPA 4YNEA 3HRBA 3ZYAA 2JIVA 4GUEA 4C02A 4IM3A 4C4JA 1QPEA 1UNLA 2ONLC 4FT9A 4X3FA 3IDPA 3UZRA 1XHAA 3MH3A 1CKJA 4I22A 4RIXB 3BHYA 3RK7A 3LMIA 3Q2MA 4M12A 3UGCA 3F5XA 5BVNA 1PMEA 4QT1A 2CNVA 2ITWA 4D5KA 1MRYA 3IW4A 3ET7A 4JOAA 4G5PA 3F3UA 3HECA 3Q9WA 4KKEA 4WG5A 3DKCA 4KNBA 1CM8A 3ERKA 4BICA 4X2GA 3LW0A 1M17A 4BTFA 2VWZA 1ND4A 2R3IA 3A8XA 3E64A 4R1YA 5E8XA 4Y5HA 5D10A 2FA2A 2XKEA 3NW7A 3PVWA 4NZWB 5TE0A 4CQGA 4WG4A 3L8VA 2YLFA 3QQJA 4HVIA 1G3NA 3FZPA 3JS2A 2QOHA 5EDRA 5GJFA 2OJGA 3UVRA 4H1JA 4MQ1A 4FA2A 3F9NA 5G1XA 3S4QA 3UMWA 3KCKA 2XNOA 2PTKA 3TZ7A 4EJ7A 1PY5A 5FRIA 1KWPA 1ZOEA 1YDSE 3FV8A 3GCPA 1W98A 1VR2A 3PSBA 5HO8A 4ZS0A 3L1SA 2ZV8A 5IH5A 3REPA 3EN9A 1WMKA 3NUXA 4AUAA 3TI1A 5FTOA 2VTJA 5CNOA 4D2WA 4ITJA 3D94A 1H1SA 3N4UA 4H3BA 4L3JA 4ZLZA 5A6NA 3FC2A 3MDYA 4PMTA 1M7NA 4Z16A 4ZMEA 4FEXA 2W1HA 4L3LA 4OTRA 2PVLA 2NNWB 3SAYA 2CCIA 3Q4CA 4K0YA 4EK5A 1ZXEA 1JOWB 4FKTA 3PTGA 1GZOA 2YN8A 4FTAA 4HGSA 2UZEA 3FXXA 4L43A 2X1NA 2F7ZE 3K3JA 3FYKX 3NYNA 5K4JA 5B2KA 3E8CA 5JQ5A 5IF1A 3IO7A 4ZSAA 1CKPA 4RJ4A 4AA0A 3BRBA 1JSVA 3F69A 2ZYBA 4JRNA 3WE8A 1URWA 5K0XA 4WNOA 2CLQA 5TOZA 3F7ZA 4ZTMA 4YO4A 4FL1A 1YXVA 3V5TA 3CTHA 2A27A 4GU6A 3RTPA 5DVRA 2UZTA 2QU5A 1YDRE 4CEGA 1P5EA 4FZDB 5AUZA 1NW1A 4MD7E 2W96B 2W05A 5HBHA 4BWKA 2C5NA 2JD5A 3HKOA 3UJGA 1VJYA 4I4EA 2V22A 4FIGA 4MXOA 5HVKA 3VULA 3DJ7A 4MF0A 3FXZA 4O6LA 3W18A 2I1MA 4BKZA 3C4WA 3O8UA 3BE2A 3HX4A 2JDRA 4EQCA 5DT3A 3SXFA 4M69B 3IW5A 5M4FA 3VBXA 3VWAA 1UWHA 4A9SA 2VWUA 4LGGA 5G6VA 5DR9A 1RDQE 2ZM1A 3V8TA 2IZTA 3L9LA 3QBNA 5GJDA 5JH6A 3CPCA 5BX0A 4BCIA 2UVYA 3KY2A 2XK7A 1J7IA 4NTSA 4RG0A 1FVTA 5FG8A 4HNFA 4RFZA 2BRHA 2GPHA 3ROYA 3V01A 2R0IA 3LAUA 2F7XE 3DV3A 2YDJA 3V8SA 4O82A 4AOJA 2I7QA 2XRWA 3G6GA 4QP8A 2QOQA 2VRXA 2XK3A 3OY3A 2VD5A 2KULA 3KRXA 3OBJA 5EK7A 3VS1A 1BI7A 4AN2A 2XS0A 4K77A 1OKVA 4YZDA 3R9RA 2QHMA 5FUTA 4ZTQA 5DLSA 2A0CX 4PPCA 4D2TA 4EOMA 1APME 2ESMA 4IVDA 2XKCA 3VC4A 3I6WA 4R5YA 3O71A 5HO7A 2W1ZA 1RJBA 4ZJVA 3N51A 4FT0A 3R2YA 4FSYA 3S2PA 4BDGA 3UQCA 3DXPA 4O7LA 3SQQA 2WQOA 2XJ0A 2WXVA 3COIA 3OVVA 3IKAA 2XUUA 3GC7A 4MXCA 3BYVA 3DBFA 4GVAA 2QR7A 4LYNA 4XH6A 1BL6A 3FSFA 5FEDA 5HICA 4UMPA 1X8BA 4IBMA 4XMOA 2YABA 1SNUA 3NUNA 4E4NA 5IA2A 2G2IA 3F82A 2IVTA 1SVEA 1YQJA 3ZEWA 1K3AA 4BGHA 4NCTC 3ZFXA 2HELA 2ITQA 1H00A
chains in the Genus database with same CATH superfamily
2C5VA 3LFBA 4RJ5A 5LMKA 2ZDUA 5D12A 1BUHA 1YOMA 3C5IA 1ZOHA 4E93A 2F49A 3WE4A 3S95A 4IAKA 4V0GB 1OPKA 1H08A 1JKTA 4N6ZA 4QMXA 4EQMA 4OTFA 3E5AA 3OCBA 4ZSJA 5T3QA 1Q4LA 3VAPA 1H27A 5EOLA 1JBPE 2UW3A 5LXMA 3QXPA 4Q2AA 4UB7A 3UYTA 4PL3A 3W2QA 4P4CA 4BCKA 4NUSA 4IWOA 3SOCA 4MK0A 3TIZA 1Y6AA 2YLEA 4QMLA 1O6KA 3LXKA 3FZRA 3R8ZA 3F2NA 1IAHA 4KWPA 4H05A 1PYEA 2QVSE 4K33A 2W5BA 4HCUA 3OY1A 2R4BA 4ZAUA 3PJCA 3NCGA 3EKNA 5AR4A 3II5A 4N6YA 3DBEA 5LCKA 3QUDA 4U41A 3FSKA 3LXNA 4FZAB 3M1SA 5E1EA 3TL8A 3UE4A 1YOLA 2NP8A 4QTBA 2Z2WA 4DHFA 3HL7A 2XYUA 4FKWA 4MXZA 4D4VA 3DB8A 5A6OA 5K5XA 3PXQA 1MRVA 2VWVA 3L8PA 5TF9A 3TNIA 3ZUTA 2WFYA 2HCKA 4FNXA 4UBAA 5HORA 5I4NA 5K3YA 3CD8A 4RX5A 4D58A 1NY3A 2QLQA 2QO7A 1DAYA 3QYZA 4H3PA 2VNWA 4YLJA 3SOAA 4GK3A 2OF4A 1YHVA 2C6OA 4AW5A 4F9AA 1GY3A 3ML1A 1GIJA 2PULA 2V55A 5CAUA 3QD0A 5BVKA 1F3MC 3VBTA 3N9XA 3R9NA 5CSWA 4D1XA 2YM5A 4G9RA 4DFYA 1KUTA 1OL6A 3CPBA 5FD2A 1DI8A 4RA4A 3ZLSA 4EKLA 3VQHA 4XX9A 4LUEA 4BDEA 2X0QA 2CSNA 5GJGA 2XMYA 4WRSA 4H36A 1FVRA 4BR3A 5CVFA 4FVRA 3OCGA 3OT3A 4LGHA 4BYJA 5BUJA 3BZ3A 4H1MA 5IQBA 4AW1A 3LCKA 5IQGA 1UVRA 2JBPA 2P3GX 3ALNA 4B0GA 3P0MA 3ZU7A 4WT6A 3UOHA 4RIXA 3EFWA 4RJ3A 4C2WA 5IKWA 4E6AA 3ALOA 2PZPA 3OS3A 2PMNX 4F1MA 5ACBC 4D0WA 5AP4A 3PFYA 3FLYA 1NT2A 2KTYA 3NW5A 4PX6A 2ITNA 4A06A 3EL7A 5IMXA 4BIEA 2GNGA 4JQ8A 5IEVA 1ZAOA 2WO6A 4E5WA 3IW8A 4XG7A 3COMA 4A9YA 4FTIA 2QURA 3VJNA 3BEGA 2WMBA 3GC0A 2PUIA 4EOSA 5E8TA 2WTWA 3QRTA 4DBXA 3ZRKA 3C50A 5CEKA 3HV3A 3BYSA 4XLIA 4EH9A 5C1QB 2A2AA 4HYIA 4RBLA 1JKLA 3VF9A 3AGMA 4FKUA 5CNNA 3AT3A 3CIKA 4QMYA 4AW2A 4QMUA 2XIKA 3ZOSA 4CKIA 4E73A 4YBJA 2UW6A 5CVHA 5L4QA 4FV9A 1S9IA 3F66A 2OIQA 3PJ3A 3G51A 3QALE 4LGDA 3R7EA 4CFXA 4EORA 3ZHPC 3HV7A 1I44A 4PMPA 3FI4A 5EHLA 3E8EA 5ANIA 4E3CA 4FKSA 4BBFA 5GIOE 3BGPA 3NUPA 3OUKA 4HYHA 5FTQA 4DGOA 3C1XA 4DCEA 5ACKA 4PV0A 2GNIA 3AKKA 1VZOA 4NK9A 5ICPA 3KREA 5CSVA 3D5VA 4FBXA 4FYOA 4ENYA 4O0TA 1IRKA 4C3FA 1OKYA 1LR4A 2OG8A 4F9CA 5KBRA 1XWSA 5CS6A 2YACA 4ZZNA 5HEZA 2XZSA 2EXEA 3MV5A 4YTIA 2RFSA 4F0IA 3QCSA 1XH8A 1R0EA 2VTMA 4UMQA 3BCEA 4ACDA 4F6SA 1A06A 2B9IA 4IX6A 5CU3A 4ALWA 4AE6A 4FEVA 3KN6A 4BCFA 2UW0A 3OTVA 4G6OA 2V62A 3FQSA 5J9YA 1W2CA 2J5FA 3WYXA 5EI8A 3GU7A 3TNPC 4CMOA 4IFCA 2Z02A 2OJ9A 4EOIA 1GNGA 3QAME 3DDQA 3NAXA 2Z60A 4O91A 2W5AA 3SXSA 1SVGA 2X4FA 4I94A 5AM6A 4IB5A 4C3PA 3ACKA 3EJ1A 3BYMA 4LUDA 4YJQA 4D2RA 5AP2A 5AV2A 4K6ZA 3RPRA 3PLSA 2X9EA 4LV5A 1YOJA 3BPRA 4ZY6A 4NM5A 2J6MA 4EK4A 3W0NA 5L2TA 2QHNA 4K9YA 4FIEA 4U45A 1XBCA 3NGAA 4IM2A 4CCBA 4M69A 4GT3A 4RWIA 3WF7A 1UV5A 4C37A 3RBWA 1QPJA 2R3QA 2UZNA 4IHPA 3OG7A 5CEPA 2X9FA 3OEFX 1OPJA 2FGIA 2HOGA 4GT4A 3EFJA 4F78A 4G3EA 4ASZA 4UXQA 4WSQA 3FZSA 4QYGA 4S33A 3SW7A 1H8FA 2XB7A 5JMSA 2VV9A 2IG7A 5M06A 4AF3A 4IW0A 3C5UA 3UVPA 3W2CA 4EKKA 3MY1A 3G9NA 2GU8A 3MW1A 1URCA 4LL5A 3VUGA 3PVBA 3N4TA 2VTNA 3F6XA 3DS6A 3RAIA 3IONA 3NR9A 1Q97A 2C4GA 2YIYA 3LQ3A 3QFVA 4IJPA 4C57A 4MUQA 1J91A 3WILA 2ETRA 4M66A 2WMUA 3NUSA 4QMSA 2XEZA 4P90A 3D14A 3D9VA 4J53A 3D0EA 1KE8A 2HXLA 3FHRA 4KIKB 3A7GA 4IWPA 4YZCA 2WTCA 3PVUA 5GNKA 4YR8A 4R78A 1PKGA 3LCDA 3PPJA 2ETKA 4FV5A 4DLIA 1ZY5A 3LQ8A 1XR1A 4FZ6A 3I4BA 4UMTA 4CRSA 4DAWA 1WAKA 4K11A 4L01A 3LFNA 3UOLA 4AE9A 2OZAA 3EB0A 5DT4A 1UU9A 4IB0A 4R1VA 3OWKA 5E8UA 3DFAA 3FY0A 4O21A 1OL2A 4JBPA 1Q8UA 2UW9A 5D9HA 3WF9A 4ASEA 4WUAA 4OBOA 1U5QA 3ENHA 3P79A 4UZDA 2REIA 2X6DA 5GZ8A 2EVAA 1IAJA 4BCMA 4MBJA 4L6QA 3SKCA 3RAKA 3NIEA 2C0IA 1Q3DA 4O96A 4X6RA 2I0HA 1U5RA 2HYYA 3DKOA 4W9XA 4USFA 2VTSA 2JBOA 4YZNA 3AMAA 4F0GA 5KZ0A 3UZTA 1OB3A 2O3PA 3CQWA 2UW8A 4RX9A 3EOCA 3ULIA 3DAJA 1XQZA 4QNAA 4V0GA 4XUFA 4DH7A 4EC8A 2WU6A 3UZPA 4BI1A 4OGRA 1BL7A 5I0BA 3R8LA 2DS1A 4FUXA 3OCSA 1HCLA 4R8QA 4AW0A 1CMKE 1NXKA 4UALA 1ZMUA 2CGWA 3RAWA 2F2UA 4XP3A 5KMLA 2CHLA 4DLJA 4L7FA 4FRFA 4IACA 4QMNA 2C3JA 3MWUA 2X4ZA 4IZAA 3P08A 3SVVA 3ELJA 1H24A 4LQMA 5LVMA 2UW4A 4FSTA 4L45A 4YGAA 4A9TA 2UZWE 2Z7QA 3COHA 1UU3A 4TWCA 4CYJA 1H1RA 1OVEA 3FZ1A 4FYNA 4FE2A 2X2KA 5CSHA 2J90A 1DAWA 1DM2A 2E9PA 3CP9A 4TWNA 5CF6A 1T45A 4BJJB 4UV0A 4A4XA 3PP0A 2W1IA 3E92A 5DHJA 4X2FA 4JAJA 3PWDA 2DUVA 4BDKA 2OH0E 3DTWA 2ERZE 4QP9A 3FLWA 3G2FA 5AV3A 5DG5A 3AC2A 4GIIA 1M2PA 4DDIA 5CENA 5AV0A 2R9SA 2GS2A 2VTLA 2WQMA 4FK3A 4IZ5A 2FB8A 2XK9A 3FMLA 5HCXA 4F99A 1UNHA 4O0SA 3R7VA 3BHUA 3UYSA 1PXIA 2JC6A 3OP5A 1BX6A 3POOA 1WCCA 3WARA 4WHZA 3KK8A 2WEIA 4ZZOA 1L3RE 4ZIMA 2VGPA 4F9WA 2W17A 4TWPA 3LXLA 3AOXA 4V04A 3V6RA 4MBLA 5CT7A 2B4SB 4AAYA 2HZIA 4YC6A 4IVAA 4ZTRA 4KIPA 4R3CA 3UIUA 2BAQA 4FEWA 3TTJA 5GZAA 4IX5A 2CKEA 2J7TA 1FMKA 3DLSA 5E9EA 2J50A 2Y6OA 5E4HA 3W16A 3DDPA 2GTNA 3MH0A 4OTWA 1WBVA 2RKUA 3P1AA 4FNYA 3WZUA 5LCJA 3RALA 4AN9A 3CBLA 2FUMA 4JIAA 2WIPA 3W8QA 5JGDA 2C0TA 2JFMA 5CU2A 1ZY4A 5F94A 3OCTA 5ETAA 5LQFA 2C6MA 1GJOA 3T9TA 1IA8A 4GV1A 4QQTA 3GNIB 3QWKA 2O8YA 2ITXA 3A62A 3U9CA 3LIJA 2XNMA 5BVEA 3PJ1A 4XG9A 4BN1A 3EQBA 5E7RA 2VTOA 4L52A 1ZMWA 4IVCA 2R3JA 4MXAA 3FL4A 5ANEA 3MFUA 4CFWA 1YDTE 1P4FA 5CSPA 3KMWA 3RCJA 1MQBA 4DFLA 4I6BA 4FTCA 2JKQA 3QTSA 3W2RA 4FKRA 5H8BA 5KMIA 2E9NA 4UZHA 2PMLX 2YJRA 5C26A 4O0VA 4O7NA 2WQBA 1HOWA 1ATPE 3CY3A 3VRZA 3DOGA 5E90A 3ORZA 3QGYA 3A7HA 3HRCA 3NPCA 4O4BB 5ITAA 3FXWA 4DC2A 4AGCA 3BU3A 1B38A 2IVVA 2BKZA 4M0YA 2DYLA 4QYYA 3VUKA 1W84A 3WZJA 3KU2A 4G3FA 4JS8A 5JFVA 4F1OA 3UG2A 4DTKA 4CKRA 5CYIA 3G9LX 4MNEB 5AJQA 4Y85A 5TR6A 4I3ZA 4R3PA 4TWOA 1G8SA 3O7LD 3C0HA 3CJFA 5HLPA 3HAMA 4CRLA 4F9BA 2HWPA 3ZBFA 5HTBA 3TEIA 3A61A 4AACA 1EH4A 2OFUA 4O4CA 4TYHB 4X21A 5E92A 3VS7A 4KIQA 4Y5QA 3IECA 3R0TA 4YLKA 2QLUA 5HG8A 1G8JA 4JIKA 2BROA 3MY5A 4QQJA 4BF2A 5M55A 3HP5A 4FL2A 3LFAA 1P4OA 3P5KA 4NEUA 5LOHA 3BYUA 3TYKA 4UX9A 4QDVA 3I60A 3RPYA 4IB1A 2H34A 2X2LA 3FKLA 3ITZA 4TL0A 4NIFB 1S9JA 4G5JA 2QQ7A 1H4LA 4RRVA 3ATTA 4U8ZA 3HDMA 3MFTA 2OH4A 3QZIA 3QXOA 3ORLA 4FNWA 5CF4A 2OFVA 3TMOA 3BU5A 4PMMA 2XIXA 4CVAA 3VS3A 5FP5A 4W4VA 3MY0A 1PMUA 2WZJA 4NWMA 3E93A 3PE2A 4F7LA 3UDSA 2BTSA 4ACMA 3R73A 2YZLA 3OW4A 1O9UA 4TYEA 3MIAA 3NYXA 4ZSGA 5H8GA 3PYYA 3TT0A 1BKXA 3DFCB 2ZV2A 3IGOA 3OOMA 3V5WA 3GP0A 4IX3A 4TY1A 5D7AA 5DBXA 4HW7A 3CE3A 3NNXA 3AKJA 2WMRA 3EN5A 3ORIA 4FMQA 2VWWA 3UP7A 4BCOA 2LGCA 4HVDA 3C0GA 3CQUA 4WKQA 4DT9A 3GU8A 4O27B 4BZOA 2XCKA 4CLJA 3U51A 5HG9A 3LOKA 3FQEA 3AMYA 3BHTA 2IW9A 5EYCA 2OIBA 4E5BA 3MA6A 2WHBA 2P0CA 3GCSA 3O50A 3ORMA 3UC4A 2R3GA 3K3IA 2GMXA 2G15A 3CTQA 4H39A 5IEXA 1G5SA 3RI1A 2WU7A 2ZMDA 5BVDA 4EL9A 2P2IA 4CLIA 1YWNA 4I0RA 1Q41A 3H9RA 2X7GA 2IZRA 3FMKA 4G9CA 1JLUE 2RIOA 4JR7A 4UYAA 2PK9A 4DYMA 2VWXA 5EKNA 5IPJA 4PP7A 2Z7LA 4IADA 2R3PA 3RJCA 3IG7A 3AC1A 3LCSA 4KIKA 5H2UA 2Y4IC 5T68A 5H9BA 2P4IA 4FV4A 2C5OA 5DT0A 2GQRA 5M53A 4ITHA 3RZFA 1PJKA 4QPMA 3KF4A 5F20A 3BI6A 3G0EA 3UDZA 5LVOA 3WZKA 4FTNA 3LCOA 4NFMA 3JXWA 2OGVA 4J71A 4C36A 4YHFA 4GG5A 4NCTA 4TPTA 4UYNA 5CSXA 2RG6A 1OKWA 3K5VA 5D1JA 4YU2A 2CMWA 2J0LA 3R7GA 4ZEGA 3ZSHA 5IQHA 2VTQA 2BAKA 3AT2A 4S2ZA 1UA2A 4FGBA 4QNYA 4HCVA 4JBQA 4I6QA 4M13A 5J8IA 5AUUA 4HZSA 5B7VA 3BU6A 2W4JA 3OWJA 5EYDA 4DTBA 2OXDA 3C13A 3H10A 4GVJA 4MD9E 3EYGA 4JDHA 1J7UA 2CNQA 1H26A 1TQMA 4XBRA 2GTMA 3LFQA 4K2RA 3D7TB 4MBIA 2X6EA 4FKVA 5I9VA 1QL6A 5FP6A 5DR2A 4YP8A 3S00A 1P2AA 3DBCA 2Y0AA 4EHGA 5F95A 5A4LA 2UZVA 3C4FA 3T3UA 4JG6A 3FMNA 3NSZA 5I9YA 4EOPA 2OXYA 4F6WA 2WTDA 4BCQA 1QPDA 3GT8A 5HLNA 4KINA 2AC3A 3TIYA 1OGYA 2Q0BA 5CAOA 4F7SA 5JGBA 1J7LA 4CV8A 4GCJA 3PPZA 3V5JA 5AX3A 3R7UA 2UW7A 1OPLA 4ANNA 5M4IA 2YM4A 2HK5A 4IH8A 2W1EA 1OIQA 4AA5A 2YA9A 1YXUA 3D5WA 3PA3A 3PY0A 2XP2A 2W1FA 3F3ZA 4OAUC 2W99B 4DG3E 3HYHA 3WF6A 2YJSA 3GCQA 3RK5A 5CZIA 3VBWA 3CD3A 3CEKA 4U6RA 2HY0A 5LMAA 3SD0A 3KRWA 2X0GA 1H1QA 2DQ7X 4IDTA 3LFFA 4KRDA 4O0WA 2VTAA 5EHOA 5KNJA 5HD4A 3TCPA 1BI8A 2VWIA 2WTKC 3NFFB 4JR3A 1OMWA 5GINE 4EI4A 2CN5A 2Y4PA 3VVHA 2BHHA 3DZOA 2OJJA 3FLZA 4F7NA 3PA5A 4D2SA 2WD1A 3QQKA 3UP2A 5KBQA 3MPAA 2X8EA 3NNUA 4G17A 4G3GA 4G34A 3SDJA 3VQUA 3WBLA 3AD5A 5HU9A 2XAOA 2ZOQA 4ZXTA 2BAJA 5HE0A 4BDIA 4ACCA 1H01A 2YCRA 1Z5MA 1O6YA 4B9DA 4KSPA 4MVFA 3LQ5A 5L8LA 1DS5A 4DFUA 2JDOA 3DK6A 3UMXA 1KE9A 2WIHA 4FTKA 5GZ9A 5H3QA 5A4EA 2B9JA 2AEGA 3ZM9A 3EQHA 2RGPA 4DH5A 2ZFYA 4GFMA 1M2RA 5J79A 5DEWA 4X6QC 2XANA 4FIJA 1JNKA 4BDCA 3I5NA 4MYGA 2O5KA 4LM5A 5HBJA 5AMNA 4GSBA 1IASA 5ETFA 5EM6A 5J95A 3EQFA 2C68A 1V0OA 5JRSA 4IAAA 2XM9A 3E63A 2UVXA 2V7OA 3PA4A 5FBNC 3BX5A 2BFYA 2B0QA 3MYGA 4JL9A 4BBEA 4EH4A 4XV9A 4Y83A 5AIRA 5FXSA 3T9IA 4EZ7A 3ODYX 3KXZA 1Q5KA 3I7CA 2XNPA 4I20A 4BI2A 2GQGA 2PZYA 2CGVA 3FKOA 3PXFA 5AX9A 5IDNA 1PRYA 2Z7RA 3I6UA 4N4SA 2ZV9A 5DI1A 3WYYA 4LFIA 1TKIA 3I0OA 3KMUA 1ZRZA 1H28A 2WTIA 5EH0A 5AR3A 4BL1A 3OF0A 5L8JA 3OBGA 2I40A 3H9FA 4P5ZA 2GDOA 4EHEA 4FV8A 4DITA 4MNEA 4O7VA 1Q3WA 4ANLA 3UIXA 4BYIA 4M3QA 3RK9A 4X2JA 3ENMA 3TDWA 2C30A 4KSQA 4YJVA 5DEYA 4BI0A 4XV2A 2PZIA 4EUUA 3R6XA 2R2PA 4JQEA 4TYHA 1V1KA 4Q9SA 2XK8A 4CG8A 2OICA 1U54B 1M14A 4QP6A 3TG1A 3CC6A 3A7FA 3EKKA 5BVOA 4M15A 3R1YA 2YWPA 4LL0A 4IAFA 5AUYA 2HZ4A 4D4YA 5C01A 2BDJA 2IW8A 4D9TA 4JQ7A 1YXTA 5L2WA 3HMOA 2WMSA 2C5XA 2IZUA 3Q04A 4U3ZA 4ARKA 4CQEA 3KXGA 5AIKA 2Q0NA 3QA0A 4I24A 4PTEA 3HUCA 2ITOA 4A07A 4P2KA 4O7SA 3U4UA 4YSMA 5DWRA 4IE9A 2CDZA 3FPQA 3ZO2A 5L8KA 5HIBA 4M8TA 3FDNA 3CXWA 4S31A 2I6LA 4NM3A 3VF8A 1F0QA 2XYNA 3DPKA 3OZ6A 5DE2A 2H96A 3SHEA 4F65A 3VS0A 2A4LA 1WBPA 3FC1X 5ANKA 5J87A 4FTRA 4YC3A 5AP5A 4Y73A 3VJOA 2VTIA 3Q9XA 2ITZA 4IB3A 2YZAA 5EW8A 1STCE 3SW4A 3TDVA 3H4JA 4F6UA 4QMTA 5JEBA 3IOKA 3L9MA 3F61A 3GXLA 3F88A 2PMIA 2BRMA 3MN3A 4QDEA 5HOAA 4DFBA 3BEAA 3W0RA 3KULB 4M0ZA 3AC4A 3Q2JA 3RKBA 5C8KA 5EDPA 4FTTA 1L8TA 4ZZMA 1GAGA 4R77A 3O7LB 3ZCLA 2F4JA 3HA8A 4CMUA 4BCNA 2YISA 1OBDA 3F5GA 3FZOA 5E8WA 1R3CA 3QUPA 2RFDA 4KABA 4UWCA 4E6DA 1I09A 4AZSA 4R7HA 2ZDTA 3LJ0A 3I5ZA 4FICA 4I21A 4P5QA 4ZTNA 4AZVA 4CSVA 2Y4IB 4U81A 4YHJA 1ZYJA 4DG2E 2BZKB 4L46A 3RWQA 4LV7A 2WTVA 1YKRA 1Q24A 4FSMA 4AGDA 2PWLA 2BR1A 2VWBA 4IXPA 4CGAA 3PJ8A 3S3IA 4TYJA 3FHIA 4NM0A 4YBKA 4DFXE 3LPBA 3L9PA 3LFDA 1ERKA 1YXXA 3DAEA 2IO6A 5A3XA 4KB8A 2YITA 1XO2B 4LMNA 5M4UA 3GC9A 3R04A 1F5QA 3VHKA 2YDIA 4C4IA 4D4SA 4RIYB 4KUJA 4O0XA 3QQFA 3ODZX 3ZUUA 4FGRA 2YWVA 4FKGA 5EI2A 3UC3A 4BHZA 4DHZA 4RVTA 4BKYA 2C6KA 3DTCA 4G3DA 1Y91A 5J9LA 4AZTA 4CZYB 5KO1A 4FSWA 5A9UA 1REKA 2W1GA 1ZZ2A 4TN6A 4CFUA 1B39A 4C61A 2ETMA 2OKRA 3HV4A 5HE3A 3ZBXA 2YIRA 3D7TA 3JVSA 3KMMA 5JK3A 3R2BA 4JXFA 4Q5HA 1NVSA 3VS6A 2PUPA 4IMYA 5CEIA 2C1AA 2ZB1A 1IA9A 2Y8OA 1OITA 2ZVAA 4GK2A 2XBAA 4FSNA 3C4CA 2JKKA 4S34A 1YHWA 4U42A 3H3CA 1VYWA 4G1WA 4PWNA 5AR8A 4OBPA 4ZJJA 3TNQB 2BRBA 3TACA 2E9VA 2F9GA 1JKSA 2VAGA 3QX4A 4K8AA 3SRVB 2EWAA 4FEUA 3HMNA 3NLBA 2EXMA 4C4GA 3LMGA 2IPXA 4HYUA 4LOQA 2WMXA 1E9HA 1PMVA 3MSSA 4QP1A 3DB6A 2RF9A 5HTCA 4KD1A 2YDKA 1BYGA 3QTZA 2OJFE 5KMNA 1W8CA 5DH3A 4FKPA 3DBDA 4ALVA 3ZSIA 4R7BA 5KMMA 2I0YA 2XH5A 3PG1A 4QP3A 4RX7A 4IAYA 2C0OA 1QPCA 4GYIA 4TXCA 1KOAA 3P4KA 1GIHA 2PY3A 2Z7SA 4I6HA 3EQGA 5AAEA 3IK3A 4Y8DA 2WTKB 2QKRA 5AM7A 1CSNA 2X0OA 2JDTA 5DFPA 3BWFA 4E1ZA 2CJMA 5DPVA 3CS9A 3BLAA 4RA5A 1A48A 2R64A 4XG4A 4D2VA 4UWBA 3B8QA 4L3PA 3CGOA 1G8KA 3FI2A 4EYJA 2WOUA 3BWJA 5EFQA 4JDKA 2QNJA 5L6WL 5CVGA 1E1XA 4Q9ZA 5TKDA 1TZDA 3NCZA 4QYHA 2X7FA 3PRIA 2AYPA 1J1BA 3DLZA 1UKIA 4R7IA 4C62A 4K1BA 5IUHA 3MVHA 5LMKC 3DJ5A 5A4TA 3DU8A 4PQNA 3NDMA 3G5DA 4QMQA 5EQYA 2H9VA 4YLLA 4E4LA 3Q6WA 3QU0A 2A19B 3VUMA 1PXPA 3R22A 4KRCA 2YAAA 2GHMA 1PMNA 5IQFA 3S0OA 1H07A 4YUQA 4UEUA 4BGQA 3LM5A 2Y9QA 1T46A 4DEDA 5HLWA 3AKLA 2X8IA 4C35A 4WD5A 5AP7A 3WZDA 5M44A 4EOOA 3IDCA 2VU3A 3BV2A 4FR4A 4FTQA 4KS8A 4RWJA 4ANBA 4DEBA 4AXEA 5H8EA 2CKQA 1JPAA 4FV3A 2RL5A 5AAFA 2QOFA 2OSCA 3H0YA 4XNEA 5CI7A 1R78A 3GCVA 3RNYA 2VO0A 2BPMA 3F3VA 3R28A 4NU1A 5EYKA 1YXSA 5D11A 5AUTA 1XBAA 3Q96A 4CFFA 3Q52A 4DGNA 1ZWSA 5CF5A 2WGJA 2XF0A 4MWIA 3TM0A 4S30A 5J1VA 4FT3A 4QP7A 1Y57A 2C6TA 2FSTX 4MKCA 2XA4A 1JSTA 4FL3A 5KCVA 1OL7A 3Q3BA 2O64A 5ANDA 4NW5A 2QONA 3O23A 2R3OA 5I3OA 3DK3A 4Z7HA 3O5AA 1VEBA 4AZEA 5LJJA 3PUFC 3G0FA 5C27A 2XRUA 5F4NA 1DI9A 4EQUA 4AG8A 2HY81 1MQ4A 4HPUE 4LDTA 4U40A 2P55A 2IW6A 2QOKA 1Z9XA 3V51A 2DWBA 4Y95A 3CLYA 2O65A 2R3KA 3BBWA 3OEZA 4LOPA 4MF1A 1Y6BA 4O4EA 4TNDA 4B8MA 5AADA 3GOPA 1G8AA 4HJOA 1U54A 3QC9A 4I93A 5IQDA 4F08A 4ZY4A 3QL8A 2WAJA 4D28A 2WNTA 3V6SA 4PPBA 2QC6A 3VRYA 5FBOA 3ANQA 4ZS4A 3PUPA 4NFNA 4WG3A 2ZM3A 4JJRA 4RWLA 3VUTA 2FSLX 4L67A 4NT4A 5DRDA 3D83A 3QQHA 2XCHA 3LZBA 3ORNA 3MVJA 4F09A 4RLKA 4M84A 5JRQA 3RPSA 4V05A 3FLSA 5BPYA 3JPVA 4Z7GA 4FC0A 1SVHA 3JY0A 4AGWA 4FVQA 1H1PA 1PXNA 1ZMVA 3EQRA 5ETIA 3FMEA 3HV5A 3ZM4A 4ERKA 3F2AA 4RFMA 4RIOA 2I0EA 5AP1A 4W8EA 4FIIA 3FBVA 4WOVA 5BYYA 4XJ0A 1Q8TA 5CASA 3GQIA 3QWJA 2PVJA 3ZDUA 2PPQA 4FIHA 1OI9A 5LARA 2W9ZB 5CU4A 3QA8A 3UODA 3IOPA 3P9JA 5IA5A 4I0TA 4GUBA 4IIRA 4JI9A 4ZK5A 3GU6A 4GW8A 4AXCA 1YWVA 3NAYA 4KBAA 4O38A 3E62A 5AUXA 3R7IA 2WMTA 3R8UA 4EJNA 1P14A 3R1NA 4D1ZA 2V0DA 3P86A 3OXIA 1XH6A 3GGFA 3MS9A 1TVOA 4M14A 4FTLA 3TZMA 4RJ7A 4YJSA 3GBZA 4WSYA 1FPUA 3RMFA 5FM3A 3SG9A 3W0PA 2ITPA 4E4XA 3DAKA 3JR1A 4IWQA 4RC2A 3KVWA 3Q6UA 2A98A 3KULA 2X7OA 1Q61A 2OU7A 3K5UA 1FOTA 4A7CA 3KRRA 3O17A 3D4QA 4ZJIA 1PXMA 3R7YA 3FJQE 4U5JA 5HZNA 4CXAA 1E1VA 1LEWA 3C9WA 2C6IA 4FK6A 2PZRA 1XBBA 3VUDA 4DHJA 3T3VA 3RCDA 4LMUA 2Y7JA 5BYLA 4O1OA 3TZ9A 2UZBA 4G16A 4F9YA 3NYOA 5JGAA 3F5PA 2CNUA 2F7EE 3NEWA 2OO8X 4F63A 4MQ2A 3T8OA 4FTOA 1WZYA 2H6DA 3E87A 3EYHA 1R39A 3C0IA 4FV0A 3F5UA 2XJ1A 3KXHA 3DY7A 3AC3A 4RLLA 5AUVA 4UMUA 2BZIB 3A4OX 3EIDA 4J52A 4QRCA 5JZNA 4FEQA 3NVKI 2JGZA 2YEXA 3UO5A 2ONLA 3U9NA 4C58A 3JUHA 4L9IA 3FI8A 3L9NA 2ACXA 2JLDA 3ZUVA 4C59A 4PNIA 2PUNA 1MUOA 3R9HA 4RIYA 4UN0C 3O51A 2XBJA 4WRGA 3WZEA 4F70A 1XH9A 1CTPE 4HVHA 2PYWA 3FMDA 4OTHA 4C38A 4CD0A 2ITYA 2R7BA 3NX8A 3ANRA 4TRLA 4C8BA 1OIYA 4IDVA 4CKJA 4XG3A 3RHXA 3TN8A 4ASXA 3R00A 4H3QA 3NUAA 3QLGA