5HEZA

Jak2 kinase (jh1 domain) mutant p1057a in complex with tg101209
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
291
structure length
287
Chain Sequence
b'TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSARNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSAPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Resolving TYK2 locus genotype-to-phenotype differences in autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 287
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hezA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hezA01
3P79A 4DTBA 1KOBA 3GOPA 1RQQA 3ZO2A 1M2RA 3FLQA 2WTVA 1M52A 1OL1A 2HWOA 5HG5A 2WNTA 3G2FA 3ZXZA 1FMOE 4EHGA 4J95A 2OI4X 2QC6A 3FY0A 4ASEA 4CMTA 5I9UA 2HXQA 3E3PA 4BDIA 4NTSA 4YTFA 5KZIA 5DT4A 2X2LA 4KIPA 4YNOA 3PTGA 3PYYA 3H9RA 4L43A 3CPCA 4OBPA 3T3VA 4EQUA 4K6ZA 3HDNA 1ZWSA 2QLQA 5FQDC 3W8LA 3UODA 3Q2JA 2ITZA 2G9XA 2XK4A 4W8DA 4MQ2A 4C33A 4OW8A 4JVGA 1OITA 4XJ0A 3EIDA 2ETRA 4FIJA 5HTCA 2BKZA 2HYYA 4ZP5A 4CYJA 5KHWA 3R8LA 4FA2A 4ITIA 3TNQB 4I0TA 1A9UA 2GQRA 3MA3A 3D5UA 3RZFA 1PXLA 2W5BA 5HE2A 1HOWA 2BRNA 2QOLA 3TJCA 4AW2A 4BHZA 5KBRA 3PDTA 4E1ZA 3PG1A 4QP4A 3WBLA 1OPKA 3MB6A 3II5A 3NCGA 4IDTA 4XP2A 2EB3A 3NLBA 4BZOA 2ZV8A 4S34A 4XV1A 5IISA 4XLIA 5IQEA 4RFYA 4APPA 5CY3A 5FXQA 4H39A 3DFCB 2J9MA 3TKUA 1S9JA 3H0ZA 5DRBA 1BUHA 2VO0A 2W1IA 5HG7A 3E8NA 3BU5A 4FT0A 3LFFA 3O7LD 4F7NA 4ZSJA 1W83A 2BAKA 2GS6A 2XKEA 3F5UA 3MVLA 5CI6A 3BZ3A 3E93A 4FE2A 1Q5KA 5L6PA 2WFYA 1ZYLA 3HRCA 3NPCA 5E8UA 5FTOA 5DA3A 2C1BA 2FSMX 3R0TA 4QTBA 3QTWA 4LGGA 1APME 4U41A 4ERWA 5K0XA 3RPRA 4E6DA 3SOCA 4QMLA 2IG7A 3SXSA 5DIAA 3VHEA 3L8VA 1KOAA 3IGGA 4WRGA 2UW9A 2QLUA 3LCOA 4RMZA 2GFSA 3LMGA 2EXMA 5I9WA 2QO2A 4XG3A 4WKQA 5CAVA 3SDJA 2NRYA 2PE2A 1SM2A 3JXWA 3UP7A 3UOJA 4BL1A 3WF8A 2UW0A 3DOGA 4IAAA 2JDVA 1QL6A 4GT3A 4EH3A 4F08A 3LM0A 3MFRA 5DN3A 4YTCA 3Q96A 2Q0NA 2XNBA 5AX9A 2XZSA 4R3PA 4X3FC 4DITA 4FYNA 3ORXA 3B2WA 5EYMA 1P4OA 5J5TA 4ZTHA 4ACHA 3D9VA 3PJ3A 4KIOA 4CSVA 1FOTA 2OH0E 3GC7A 5L2QA 2VWBA 5M4FA 4PV0A 3QQFA 5TT7A 1XH6A 3UIMA 4QYYA 5ANGA 3KN5A 4BKYA 3ULZA 4FTTA 4OAVB 5HVJA 3WOWA 3R8UA 1GAGA 2UZVA 5CX9A 3P7BA 4U3ZA 2ITQA 5BPYA 3C4EA 5HBEA 2B9IA 4EK6A 4O0VA 4TRLA 4F9YA 4EJ7A 4AAAA 5CSHA 1ZOGA 3V5LA 4I92A 3TUDA 4NJDA 1YRPA 3F3TA 2YM7A 3I5NA 3POZA 5IDPA 5IEXA 2VNWA 3HV3A 2IPXA 2QG5A 4IVBA 4L3LA 1PXPA 1ZRZA 4D58A 3O8TA 2HCKA 2PZ5A 4TYHB 4W9XA 3VQHA 3LJ0A 4GS6A 5KKRB 5CI7A 3QKMA 5AP4A 1YKRA 4JNWA 3DJ5A 2ITXA 3NR9A 4V04A 5FGKA 3RK7A 5F4NA 2C6IA 5CAUA 4O2PA 5HNBA 4FTOA 5CXHA 4U8ZA 4XCUA 4TNBA 3E62A 4RC4A 4L01A 4EUTA 1TVOA 2YJRA 3GQLA 3OCSA 2PZYA 2HOGA 2OFVA 3W16A 5HESA 4DA5A 4PPCA 2BRBA 3GU4A 3O23A 4QMMA 3TN8A 4AOTA 4AZEA 3WZKA 5LOHA 3UO6A 4FKWA 4E8AA 4A9TA 4ACGA 3UZPA 3MTFA 2PK9A 2HZIA 1P14A 4U81A 1IR3A 3PLSA 4RPVA 2W1CA 1E9HA 4NW6A 3HL7A 5EQEA 3ETAA 4GCJA 5J7BA 5IQAA 2I0VA 5DVRA 1BI8A 2CHLA 4OTRA 4ANBA 4C57A 4FT9A 1TQPA 1J91A 5BVWA 5K4IA 5AWMA 2OU7A 2QHNA 3VF9A 2IW8A 1ERKA 4AT4A 4DFZE 2X8EA 4X6QC 1ZOEA 1CKPA 4D9TA 5FEQA 3TWJA 1PRYA 4KABA 1YHVA 5JRSA 3AC5A 4RVKA 2PMNX 2XNEA 3D94A 4IB1A 1R0PA 2O5KA 2FSTX 3OT3A 4O0YA 4XV9A 3VW6A 4AZWA 4KD1A 4D55A 3VO3A 5FEDA 4ASZA 4RRVA 4RWIA 4MF1A 4EOIA 3O7LB 5L8LA 2UVXA 1GJOA 3PFQA 5L2TA 2LGCA 3D2IA 2R3PA 2GNGA 2YAAA 3D2KA 4YR8A 5A6NA 3PP1A 3AT2A 3UJGA 5LWNA 5EYKA 3THBA 4FTKA 1UNLA 3EQPA 3KMWA 3W2QA 4F6SA 5FRIA 2H34A 4RIXA 4CRSA 4G31A 2ONLA 2XEYA 4YZDA 4F1TA 1ATPE 4QP8A 3TUBA 2GNHA 5DFPA 4FMQA 3K5VA 2OO8X 5CZIA 2X2KA 3A2CA 4C36A 3C51A 4DC2A 3PA4A 4LGHA 5DR2A 4UZHA 3O8PA 4UMRA 4I41A 3BV3A 3ZO3A 4B6LA 3R1SA 2VUWA 4XX9A 2FH9A 2X8IA 4U45A 4K1BA 1PMEA 4IANA 3CTHA 4EJNA 3V5WA 5ANEA 1OIRA 3MW1A 4BCHA 3WZEA 2GQSA 4LMNA 1K2PA 3ELJA 3HUCA 4JDIA 5CVGA 4IWQA 3K3IA 2XB7A 4R1VA 1UVRA 5DWRA 2PVJA 4GFMA 3MV5A 1OECA 2W99B 4MD9E 5DR9A 4Z7GA 3NW7A 4DBXA 3Q6WA 4M7IA 5I9XA 3FZOA 3DK3A 3H30A 2QI8A 3OMVA 4FODA 3FBVA 4XG9A 5EM5A 5CNOA 4QTEA 4TN6A 4I93A 5D9HA 3PY3A 5ANOA 4BWPA 3RJCA 2R3LA 3E88A 2JIIA 5KMJA 3NYXA 4C4FA 4AW0A 4NT4A 4YJPA 2WMAA 4EOJA 1DM2A 5JQ5A 2G2IA 3NDMA 5IG1A 3QTZA 5E8SA 3UMXA 4O7TA 3BU6A 1Q8UA 4RX9A 5E8YA 5HO6A 4PPBA 4BCMA 5CEMA 4XP3A 4FNXA 3G51A 4HCUA 5AMNA 3MESA 4JDKA 1BKXA 1WBNA 3SAYA 3ZEWA 4RWJA 4QOXA 4E6CA 2B1PA 4W4VA 2O8YA 3C4ZA 4G34A 5KMOA 5M44A 4RFMA 3IG7A 1SVHA 3FZTA 2ZV2A 4Y73A 3DQWA 4U43A 4EHZA 5FP5A 5FTQA 2UW6A 1XQZA 3CKWA 3VUTA 2Z7QA 4RVTA 1JBPE 4FTNA 4AE6A 1GZNA 4KRDA 4E4MA 4EEVA 4NKAA 3BWFA 3DAEA 4I5PA 3Q53A 5HU9A 3C0GA 4CMOA 4NU1A 2JFMA 2JIUA 3PSBA 4JLCA 3NIZA 4EOKA 5EQPA 4WNOA 3QHWA 4W4WA 3UYTA 4W4YA 2WZJA 3E63A 4EH7A 4CZTA 3EFLA 2XKCA 3QKKA 3OTVA 4ZTRA 3OHTA 1KWPA 1RE8A 4J71A 4I5MA 2QQ7A 3OP5A 4FL2A 4ZTLA 3TL8A 4ARKA 3HMNA 4OLIA 4U40A 1UKIA 4AUAA 5BUIA 4CYIA 4O86A 1JVPP 5CU3A 2GNIA 4B0GA 3AC4A 3LFNA 3FV8A 4QP1A 4CNHA 4OTGA 3DKFA 3QRKA 4UV0A 4NKSA 5CSWA 5CSXA 2KULA 4O27B 3QZFA 4FG9A 2YM6A 3LOKA 3F3ZA 5L3AA 5AUXA 5AV0A 1L8TA 4AU8A 4CQEA 2Y8OA 4BCGA 5A4EA 3HYHA 4FT7A 4NIFA 5J79A 2BHEA 2IJMA 3EL7A 3FMLA 3KB7A 1YXSA 4UWCA 2ETKA 2EVAA 4FKJA 4FOCA 4DLIA 3EYHA 3MYGA 4FT3A 4LL5A 4F7SA 1J7UA 3COKA 2PWLA 3GCSA 2XNGA 2C5VA 4YBJA 3KA0A 4L46A 5AUWA 5IEYA 4H3QA 4D1XA 3ODZX 5J9YA 4O7SA 4MWIA 2HW7A 3R21A 3FXZA 3IDCA 4ZY4A 4PMSA 3G9NA 2R7IA 3ZZEA 4D2VA 3R00A 4QTAA 3FSKA 1OZ1A 2QKWB 2WMXA 2WD1A 5AAEA 5AR3A 2FGIA 5IQHA 2BR1A 3QA8A 3L9MA 2C3IB 2YEXA 3DS6A 5EYCA 5JFVA 3KXGA 3V8WA 1A06A 4FV4A 4ALUA 3L8PA 3OS3A 4AW5A 1JPAA 3VN9A 5AUVA 2R4BA 3P4KA 3QGYA 4BYIA 2B9HA 3A61A 4R5SA 3TZ8A 3OXZA 4N0SA 4DH5A 2BROA 3LMIA 4F99A 5JFXA 3C4WA 3CY2A 1FPUA 3CSVA 3V6SA 3R02A 4FV5A 4RIOA 1YDSE 2W06A 4UALA 4EOMA 5L2SA 4IWDA 3AC2A 4BZNA 5CYIA 4BDKA 4ZTMA 1H27A 3PXKA 4NEUA 3CXWA 4AT3A 2NRUA 3VNTA 3SLSA 4BDBA 3ORNA 4IZ5A 3COMA 5FUTA 2XYUA 4YNEA 2F7XE 3LFDA 4USEA 4U79A 5BX0A 5DG5A 5BQ0A 2PVYA 2JDTA 2YIXA 3CQWA 3VW8A 1Y8GA 1IAHA 4A7CA 5CEPA 3BV2A 4AWIA 4CFXA 5KX8A 4ORKA 4DCAA 4FSYA 3W55A 4YJVA 3EZRA 3UO5A 1ZYDA 4X7QA 3SA0A 4L68A 3OF0A 4YZ9A 4K77A 3UVPA 3LFSA 5A4CA 5HORA 2JIVA 3VBXA 2YM8A 1Y57A 4EZ5A 5JMSA 4UYNA 2WB8A 3LE6A 3KREA 3F9NA 3JY0A 1H1SA 4FSNA 4JX7A 5T3QA 4ANSA 2VTNA 5M07A 3MH2A 3A7HA 3PE1A 4TWNA 4PF4A 3GFWA 2GTMA 3COIA 4AA0A 3NUNA 3QQHA 5HNIX 1YI6A 4HPUE 1IEPA 2B52A 1UU7A 2RL5A 5JSMA 4L67A 5EOLA 2OXXA 2XM8A 3VBYA 1UKHA 4H3BA 5JFSA 3FI3A 2OIDA 4EC9A 4D4RA 1AQ1A 3BX5A 3DJ6A 1TQIA 3RPVA 4O6EA 5I9YA 2ESMA 5IMEA 5ITAA 4IJ9A 3HV4A 2ITUA 3MBLA 4DE4A 3ROYA 4JL9A 2W4KA 3QCQA 4MTAA 2DYLA 3PXZA 3R2YA 5CF6A 4FZDB 1K3AA 1PMVA 3F82A 4LGDA 3EHAA 2FO0A 4WNMA 1SVEA 3FXXA 3JYAA 4ZIMA 4C02A 3TNHA 2CCIA 1X8BA 3OW4A 2YA9A 4G17A 3RM6A 4BZDA 2PSQA 2X39A 1Y91A 1LR4A 5DE2A 3SVVA 5T6KA 2YIYA 4GYIA 3VUHA 4IVAA 3VS4A 4I24A 4RVMA 3IW8A 3L8SA 4LYNA 2OWBA 2EB2A 3D7TB 4M3QA 3LCDA 3OWKA 3ZSHA 3O0GA 3KVXA 2YM5A 3W18A 3NAXA 4QQJA 2YZLA 3T8OA 4EH4A 3QFVA 4G3GA 5C26A 3LKMA 2QHMA 3FLNC 2A1AB 3KRLA 4PUZA 4JBQA 4YJNA 4PP9A 4XG2A 3W1FA 1IA8A 1WBSA 2ZAZA 4GU6A 2OH4A 4QMYA 3EN9A 2UW3A 3GVUA 2IO6A 3LVPA 3SKCA 4FUXA 4F4PA 3EN4A 3R01A 4BCNA 2H96A 2VTTA 3QD3A 5I3RA 2J90A 4CLJA 2J5FA 3COHA 1Q62A 3PZEA 4FG7A 2YITA 4HYUA 4BFMA 4OTFA 1FMKA 2XIYA 3G0EA 4R7IA 2BMCA 1YI4A 4IX3A 4MNFA 4BCFA 5TKDA 4BCOA 1OBGA 3GQIA 2PUNA 3R83A 4MX9A 4G3DA 4HVGA 3NW5A 4DFYA 4CVAA 4IEBA 2Y4IB 4BDGA 5CANA 2XK8A 4IFCA 4ENXA 4AGWA 2VWIA 5DYJA 4CV8A 1IASA 4IX5A 3FLYA 4TPTA 3BEAA 5DNRA 1JQHA 2VD5A 4F09A 2HIWA 4N4SA 4WG5A 3OEZA 3TNIA 2BIKB 1Y6AA 4PDPA 3VIDA 4R1YA 4U3YA 4DBNA 4R7BA 3MH1A 2B9FA 4EBVA 4UYAA 3BHVA 5JQ8A 1H28A 1GOLA 3TZMA 3OOMA 3OROA 4RGJA 1E1XA 4F9BA 4M13A 4LMUA 4S2ZA 2XP2A 1E1VA 4YTHA 3CCNA 5AP6A 3QYWA 4H1MA 4GG7A 2C5OA 1CM8A 4CKIA 4KNBA 3WYYA 3DXPA 5BVKA 1WZYA 4DEBA 3CE3A 3FMNA 5IUGA 2OF4A 3V5QA 2Y9QA 4HNIA 4DT9A 2BRHA 1Z9XA 5CQWA 5BNJA 3F3WA 4I0RA 2CCHA 2EWAA 5AP0A 4KSQA 4ACDA 3TTJA 2X4FA 4RVLA 2YWVA 1OKVA 5M55A 4CT2A 1DI9A 3OVVA 2W1ZA 3KC3A 5LVMA 3UQCA 4DEGA 3WIKA 4O82A 4O84A 3CJFA 4IVDA 4TTHB 2P0CA 3G15A 4QPMA 3S95A 2P4IA 3UYSA 3H0YA 4IB3A 4IHPA 2YHVA 4JBVA 3ZFXA 3QTXA 3GOKA 2R3RA 4FTMA 1P4FA 2P33A 3C9WA 4JS8A 4PNIA 3M11A 4Y5QA 3FI8A 4FZAB 4EK5A 3KF4A 4N70A 3I0QA 4AA5A 1UU3A 4D4SA 4BICA 4RA4A 3NNWA 4B8LA 1OMWA 5E4HA 3BBTB 4HJOA 3PPKA 3LXNA 4KSPA 4X2JA 3PA3A 5CZHA 2F2UA 3DAKA 3KXMA 2Z02A 3U6IA 3LLAA 3AD6A 5HE0A 5BVDA 2UZEA 3QL8A 5C8KA 3LCSA 3VS7A 5FG8A 4QMOA 4ZOGA 4D4VA 1PY5A 1V0PA 4X3FA 3C0IA 3U55A 3I1AA 3VS1A 4LM5A 5J1WA 2OXYA 4IXPA 4YGAA 2H8HA 4DT8A 3RWPA 4X21A 3HMMA 3H9OA 1F3MC 2X6EA 3NZ0A 4DFNA 3BWJA 5DR6A 3ZMMA 4OR5A 1FVTA 5C1QB 2DWBA 5B2LA 5ICPA 3UZTA 2WEIA 3VUIA 2BZJA 3B2TA 5EM6A 4JBPA 4ZEGA 4CFMA 4F1OA 2ITPA 5BUEA 4F6WA 4GK4A 5D1JA 4UWYA 3WF5A 5IPJA 5CF8A 4GK3A 2C6LA 4IAFA 3REPA 3S1HA 2NNWB 3ZFMA 3OY1A 3DB6A 5CT7A 5E92A 4DG3E 3HUBA 4G5PA 2J0KA 1BX6A 5IUIA 4A07A 4WNKA 4C7TA 3KXHA 3MH0A 3PPZA 4AN9A 4X3FB 5CAOA 2ITTA 3EQCA 3RHKA 3AOXA 2A0CX 3BE2A 4ZLOA 4CEGA 3QKLA 3QF9A 2IW9A 4BHNA 3UQFA 3PLAE 1OL2A 4F7LA 4FNWA 3WZUA 5LARA 1I44A 2JAVA 3AG9A 4B99A 3FMKA 5DEYA 3UE4A 2VTHA 1CSNA 4DTKA 4YMJA 3UNKA 2SRCA 3OXTA 5IQIA 2C4GA 3LW0A 1P5EA 3I0OA 3KU2A 2I40A 4RJ7A 3MPTA 4NH1A 1Q8YA 2IZSA 4JDHA 2X7GA 2WAJA 2V0DA 3PWDA 2BKKA 4HVSA 1O6LA 5HO7A 3QWJA 2IW6A 4RBLA 4S33A 3SRVB 3R8PA 2OJIA 1H1WA 3N4VA 4M69B 3POOA 4D9UA 4UX9A 3SGCA 1OUKA 1XJDA 3GP0A 4O91A 1KE7A 4BTKA 4FUYA 1ZMWA 2R0IA 4EH6A 5K5NA 4J7BA 4J1RA 3BHHA 1CTPE 4RC2A 4AZFA 2PPQA 4HVDA 2V5QA 2W1FA 2YACA 1AD5A 4FV2A 4IW0A 4BCQA 2GDOA 4H1JA 3BGPA 4E7WA 4ZLZA 4I3ZA 2C69A 1ZY5A 2VGPA 3R28A 4K9YA 2A2AA 3V8SA 4AZVA 5IA2A 2PVKA 2PMOX 3FZ1A 3KCKA 5CALA 1U54B 2B0QA 1M7NA 1MRYA 5FWKK 5EI8A 4EH8A 1T45A 3F5XA 5BYZA 3WZJA 4Q9ZA 5K0KA 5KNJA 4ALVA 4IFGA 4GMYA 3W2OA 2LAVA 4YPDA 5ACBC 2UVZA 3IK3A 5C4LA 4CXAA 2RF9A 4Q5HA 3F3UA 4UXLA 3NRMA 2AC3A 2FSOX 3ORPA 4DFLA 4MWHA 3RPYA 2BILB 3D5XA 3DBEA 3Q4ZA 2W1EA 3E5AA 4PY1A 4BC6A 3FHIA 3DXNA 3UG1A 4MXCA 4A9YA 4OTWA 3JR1A 2VTSA 5IF1A 3VJOA 3R7IA 2ITWA 1Q24A 2J6MA 2BRGA 2HZ0A 2GPHA 3HRFA 3VJNA 3ZLWA 4O22A 3GI3A 3PJ2A 3ZYAA 4ZJVA 4I1ZA 3S3IA 3DV3A 3PXYA 4XNEA 3R8ZA 2XEZA 3DFAA 2PVFA 4RLKA 2VV9A 3E7OA 2C6OA 2GTNA 4B8MA 3IPHA 2RIOA 2Y7JA 4ID7A 3E92A 3IOPA 1YHSA 4G3FA 4XG8A 3HZTA 2YABA 1YXVA 2C47A 3PG3A 4IZAA 2XK6A 1ZYCA 4FKGA 2GU8A 3GBZA 3V3VA 2X81A 5L4QA 2O3PA 2WKMA 4DAWA 4HGSA 3GEQA 3FL4A 4JAJA 2BALA 4XRLA 5DMZA 3DBQA 2B53A 3K2LA 4NJ3A 1OBDA 4LI5A 4DEIA 3VWAA 3KK8A 2VTRA 1AGWA 2X6DA 3BLRA 2IZUA 2XNNA 5AR4A 3UTOA 4QMVA 5D12A 3W32A 5JH6A 2XYNA 1YWVA 3AC3A 3O50A 1Q41A 1DAYA 2GHMA 3DBCA 1YQJA 4I6FA 4E3CA 4BDDA 1NVQA 5CF5A 2QOBA 1OKYA 4GJ2A 5IUHA 2WTCA 3HV7A 4TYHA 1OL7A 2JAMA 3QXOA 4KIKA 3LIJA 4TWCA 4KIQA 4RA5A 1R78A 4QP6A 3QQLA 3HVCA 3HNGA 3FLSA 4O6LA 2C6EA 3DNDA 3OXIA 4J52A 3C5UA 4C0TA 4X2FA 5LCJA 1H1PA 5JT2A 4AF3A 4C37A 3ATSA 3NYNA 2J51A 4IX4A 3ZC6A 4TYJA 4D2SA 2W9FB 3ITZA 4EWHA 1O6YA 1TKIA 4QP7A 5IZFA 2JGZA 1ZARA 5EW9A 4WG4A 2PMIA 2OIBA 3FMDA 4IWOA 4EOLA 4AP7A 4QP3A 2YDIA 1SZMA 3IDPA 3QRIA 3N4TA 3R7UA 2PTKA 3SW7A 2QO7A 3BGZA 3DTWA 1ZOHA 2RGPA 3WE8A 3F7ZA 1PKGA 4HCTA 4GEOA 2UW8A 5E8TA 4KIKB 1BYGA 2OK1A 4MD7E 4RQVA 4KWPA 1GY3A 2PY3A 4IM2A 4FKPA 5A9UA 2XJ2A 3U4UA 1XO2B 3NVMB 3BGQA 3IW6A 4ZY5A 3PVGA 4KS7A 4BIBA 4O81A 3F2AA 2ZV9A 3CEKA 4PPAA 1BI7A 5HGIA 4QD6A 4Z9LA 2PYWA 2IN6A 2Y6OA 4LUEA 2R3IA 3WE4A 2KTYA 2WMWA 4ONAA 3DCVA 3IGOA 3TDVA 3QU0A 4TYIA 2Y0AA 5M53A 2BDWA 2J5EA 3FI2A 4GVJA 1YDTE 2J0IA 2WMSA 3ERKA 4IM3A 2DUVA 1KE5A 1T46A 4CTBA 2YDJA 1DS5A 4OTIA 3T9IA 2BFYA 4W4XA 5M09A 4FTRA 4O7WA 3V5PA 5E7RA 3R9RA 4CFVA 1PJKA 3AMBA 4QYHA 3MH3A 3R30A 4MD8E 3U6HA 4YZCA 4FI1A 4XRJA 4F7JA 2C0IA 3TKHA 4DEEA 4FSZA 3CR0A 4UMTA 3ZSIA 3TDWA 4TWOA 3PJ8A 4O0WA 4UB7A 2WQOA 4ZZMA 5FXSA 5EM8A 4FNZA 4DHFA 5J1VA 1GIIA 4RQKA 4FV0A 3I7CA 3CS9A 3B8RA 4DGMA 2XH5A 4HNFA 2W05A 2PVLA 4IB0A 4M66A 3ZEPA 4I94A 3R1YA 5J87A 3EFKA 5KMLA 4ACMA 5AAFA 1YXTA 3ZLYA 1Q99A 2QVSE 4CFFA 4XP0A 2I7QA 1RW8A 3BBWA 3RVGA 3DJ7A 3IKAA 4EHEA 4IACA 1XH8A 3QUDA 3R7GA 5TR6A 3TT0A 4X2NA 4TT7A 1YDRE 3R2BA 4USDA 3KN6A 3P86A 4GSBA 3ZDIA 5FXRA 3R73A 3HP2A 4GYGA 3GC8A 1VEBA 2NPQA 4I4EA 3RZBA 5AR2A 2G2FA 4JI9A 4ZY6A 4F9WA 3R7VA 2UZDA 3ZONA 3O17A 3ATTA 2V22A 4O0XA 3F6XA 4G2FA 3MGYA 1LP4A 1K9AA 4ZSGA 1V0BA 5AUZA 4JQEA 1U4DA 2HK5A 3ZU7A 2WOUA 4I0SA 3EOCA 3NUPA 3I5ZA 5IQGA 5GIOE 2EUFB 2RFDA 3OD6X 4C35A 3K5UA 3KL8A 2W1HA 5EOBA 4YJUA 4NCTC 2WQMA 1H00A 1PKDA 4QNAA 3UOKA 1YXUA 2XNPA 4AX8A 5B7VA 3BLHA 3KQ7A 3PWYA 3H9FA 1ZYJA 3GUBA 5EHYA 4GUEA 4LOOA 3DA6A 3GCUA 3VBQA 4U6RA 5C8MA 3PE2A 4FIEA 3VQUA 4OBQA 5M4UA 3ZUVA 3OT8A 4V05A 2RFEA 5LMBA 5CWZA 3PP0A 4HYIA 1Q3DA 4JT3A 1VR2A 4R3CA 4N6ZA 1JAMA 1FGIA 3P1AA 4F65A 5LMKA 3EQBA 3E7VA 3DNEA 4FKQA 4QYEA 5E8ZA 5IA0A 3QZGA 1XH4A 3KMMA 3EQRA 3HMPA 2QR7A 2W96B 3VBVA 4OT5A 2JKOA 3R6XA 2OZOA 1PW2A 3PSDA 2CNQA 2A27A 4ACCA 4X6RA 4MNEA 3BYVA 4BI2A 5B2MA 3WF9A 3Q5ZA 4KBKA 4AS0A 5I0BA 2IVVA 3F69A 4FIGA 5AUUA 4MHAA 2QCSA 2HY0A 3BHTA 1XH5A 1Q8TA 2YM3A 3OBJA 1U59A 4XEYA 4EORA 1OPJA 3KXNA 4U44A 2UW7A 3UDBA 3TKIA 3MY1A 4UN0C 4O7VA 2GNLA 5LJJA 1PYXA 2O64A 5A4TA 3G6HA 2B55A 3KMUA 2ERZE 3UNZA 2RG5A 2X7OA 4QP9A 1NA7A 4I23A 2WMRA 2E9NA 5K9IA 4O7YA 4TKSA 3DDQA 4E6AA 2EXEA 2QKRA 3AMYA 3EKKA 3FE3A 3H10A 3LFQA 4MKCA 4NZWB 2GFCA 4EZ3A 2R3KA 4HGLA 2OG8A 3CD3A 1XWSA 4MAOA 1U46A 4MNEB 4Y8DA 4FVPA 5M57A 5HU3A 3BLQA 5HEZA 4EUUA 4IMYA 5FP6A 3HRBA 3ET7A 2UZWE 4AQCA 4RLLA 3NUXA 1FVRA 4FK3A 2C0TA 2QR8A 2P2IA 4C38A 3FKOA 5CU2A 4D2WA 3LJ2A 2OJ9A 4UY9A 5GIPE 3L9LA 4IC7A 5HO8A 2WMVA 3LXKA 3RAWA 3VVHA 1KE8A 2E9VA 2ETMA 2XA4A 3FWQA 5AFVA 3KRXA 3DK7A 5I5ZA 2VX3A 5KHXA 3QD2B 4G6OA 5HD4A 5I4NA 4TZRA 3FYJX 3EQGA 4JAIA 3SQQA 2BFXA 2XK7A 4XV3A 4RJ3A 3Q6UA 1OB3A 3IO7A 3Q9XA 5ANDA 3ZUTA 4QYGA 4XH6A 3QTQA 4M15A 3L9PA 3AC1A 4MBJA 4YC6A 2WMUA 1OIUA 2HY81 4DEAA 5IEVA 3I60A 4PWNA 3E3BX 3E8DA 4FZFB 5GZ8A 2ZMDA 2ZV7A 5H8EA 1FVVA 2XBAA 3BKBA 4O21A 4GK2A 3CTJA 3GFEA 4FBXA 2WTJA 2BPMA 3R9OA 4ANOA 4WRSA 4BKZA 3R71A 1OL5A 1SNUA 4Y46A 3KGAA 4FGRA 3EB0A 5H8BA 2QNJA 4FV9A 5AV2A 3PY0A 1XBBA 2GCDA 3WIGA 5ETAA 4MXYA 4BDCA 2CN5A 4NFNA 3OFMA 5FM2A 3OCTA 5IQCA 3QGWA 2GHGA 2YIWA 3AC8A 4FTQA 2XIKA 3W2PA 3RM7A 4C34A 4RX8A 4WA9A 2G1TA 1WVXA 3D15A 4BGQA 4RX7A 1JLUE 3TXOA 2I0YA 2WMQA 3MFUA 4BGHA 2J7TA 5EDPA 4BDAA 1ZAOA 4QPSA 4O83A 3ZRLA 4P90A 2F7ZE 3TEIA 2UV2A 1XBCA 4NM3A 1V1KA 3KRWA 3TM0A 3FQHA 1J7LA 4WIHA 3QD4A 4WUNA 5IQFA 3FMHA 3HMIA 2VTLA 4R3RA 3VF8A 3DQXA 3A7FA 3OG7A 4KAOA 3WYXA 3MWUA 5DGZA 4EH2A 2Y6MA 3SX9A 3LFAA 4IWPA 3EL8A 4FSMA 4GJ3A 3BYMA 3I7BA 4DGOA 4FKLA 3D0EA 4DCEA 3V5JA 2W9ZB 5EDQA 3F88A 3KVWA 4FF8A 4MXZA 1W8CA 3C4FA 4TY1A 4ZTQA 2WMTA 3D14A 3TJDA 2WQNA 5G6VA 5AAGA 3FEGA 1WBOA 5EHLA 5ETCA 2F7EE 2JD5A 1DI8A 4C59A 3NUYA 4CFWA 4FSWA 4CV9A 5EH0A 3BPRA 3W2RA 3P7AA 3GU7A 4D0WA 1NY3A 2W17A 3D7TA 4YPSA 3RGFA 2QOFA 3G90X 4GT4A 1JKSA 2X7FA 4AFJA 5BYYA 4CKJA 2ZJWA 4NL0A 5GNKA 3ZSGA 2I0HA 3FL5A 3QRTA 5F1ZA 1H0VA 4QMQA 3MA6A 4NM5A 2VO7A 5JGBA 5HNGA 5DBXA 4ZMEA 4J96A 4CQGA 2BHHA 3RAIA 1F0QA 3NSZA 4NSTA 2CGXA 3KULB 5C9CA 4BI1A 2ZM4A 4C3PA 3HMOA 4EHVA 2XNMA 4FV8A 2XKFA 2PVRA 3EQFA 3KEXA 3QUPA 5T68A 3T3UA 3F66A 4RJ8A 4HCVA 5CNNA 4BN1A 3HA6A 2BDJA 3SG8A 4FIIA 4L44A 5IA4A 2QU5A 2JDRA 4M68A 4FL3A 3IDBA 4L7SA 5HBHA 3FPQA 4BGGA 2PVHA 4P4CA 4QPAA 4YBKA 4DLJA 3EYGA 4FNYA 4J99A 4C61A 2YDKA 4QP2A 5DT3A 2AYPA 2J0JA 4QT1A 2V7OA 5KMKA 2J0MB 4YZMA 1SYKA 1JSUA 5D7VA 2F9GA 4HZRA 1BL7A 2YN8A 4S32A 2QURA 3W2CA 4PL5A 3Q4CA 4JR7A 3JVRA 4R8QA 4IB5A 2BAQA 3RK5A 2Q83A 4O0UA 4AW1A 4C4JA 2WPAA 5DOSA 3RMFA 4F63A 3G0FA 3D5VA 2XCHA 3A99A 4ZSEA 5E91A 4C4IA 2E2BA 3FYKX 5F9EA 5JFWA 4L3JA 1NXKA 1R3CA 3EFJA 2ACXA 4MEDA 3TUCA 4ASXA 3ZO1A 3F7WA 2VTQA 5EI6A 2PULA 2R3NA 5EW8A 2OBJA 4WBOA 2W4JA 1H8FA 5M06A 3D83A 4NM7A 3V51A 3U8WA 3VS2A 3UNJA 3BQRA 3QTSA 2WIPA 4G5JA 2CGUA 4XV2A 5A54A 2WQBA 4HZSA 5AADA 4RJ4A 1YWRA 2GNJA 2HZ4A 2XVDA 2OKRA 1VZOA 2VTIA 4B4LA 5LXMA 2RKUA 4KB8A 4BF2A 4JR3A 5DH3A 3OW3A 4E4XA 4FV6A 4HW7A 2NO3A 3CD8A 4YZNA 1PYEA 3VUMA 3QCXA 2DS1A 2X0GA 4JX3A 4O0TA 5FBNC 4XYFA 4G16A 3CGFA 4K0YA 3UOLA 4MVFA 2WO6A 2Z60A 4WSQA 4CKRA 5IMXA 5TO8A 5IA5A 2F57A 4KRCA 3FKLA 4DGNA 3I6UA 1B6CB 2CSNA 1NVRA 3DGKA 4FTLA 5HLPA 1A48A 2FA2A 3R22A 4C3RA 4G3CA 5H3QA 2YIRA 3ACJA 4DGGA 5J9LA 3GU5A 3NVKI 4RSSA 3FZSA 2OSCA 1REKA 4K18A 3R9NA 3VS0A 3HDMA 3JVSA 1MP8A 4ZZNA 4XOYA 4YO6A 5CT0A 5G1XA 1R0EA 1MUOA 5ANIA 3O2MA 1OI9A 4BYJA 1Q8WA 2XIXA 4HGTA 5E1EA 4FL1A 5CQUA 2OXDA 4JXFA 4E6QA 3N4UA 4CG8A 3A7IA 3BYSA 1PXJA 2BTRA 3P5KA 3P7CA 3MSSA 4J8MA 2AUHA 2R3QA 3CGOA 3QA0A 2V62A 3R1QA 4D4YA 2XK9A 1ZXEA 3M2WA 5HLWA 5AUYA 3F5GA 2X9EA 4IM0A 3RAKA 4RJ6A 3M1SA 4DN5A 4GIIA 2GMXA 3FPMA 3P08A 3R9DA 3UC4A 4OBOA 3A4PA 5KMNA 4AN2A 3EWHA 4EKKA 2ZDTA 4EK3A 3ANQA 1OGUA 2OZAA 3RNYA 5LVOA 1H1QA 2XJ0A 2B9JA 3DAJA 5HVYA 5IA3A 4DYMA 1HCLA 2EU9A 1PF8A 3NUAA 2HENA 3FY2A 2PVNA 5D10A 5D7AA 5C8NA 3MY0A 4O0RA 4TL0A 4GT5A 4U80A 5J8IA 1CKJA 3ZBFA 3MIYA 4YSJA 1FQ1B 4KUJA 4HYHA 2XMYA 3QTUA 4E5AX 3P78A 3SG9A 4BTFA 3UVQA 3EQHA 3L1SA 3JS2A 4ERKA 5L2WA 4YLKA 2FVDA 3QTIA 4U7ZA 4MH7A 4OTHA 3ZBXA 3G5DA 4BCIA 3ZC5A 1Q61A 3D7ZA 2W7XA 3KY2A 4D1SA 1XR1A 2PZPA 3R7OA 2R3FA 4BCJA 3W33A 2WQEA 5JRQA 4L8MA 4CMUA 2ZDUA 3AGMA 3AQVA 3G9LX 4PDSA 5M4IA 4IIRA 3U9NA 4AOIA 4IQ6A 3Q9YA 2OZAB 4F9CA 1JNKA 2CPKE 2VX0A 3QZIA 4PL3A 4O0SA 2JLDA 2XK3A 1Q8ZA 2YJSA 3MPAA 4GW8A 5B0XA 3VRZA 4BWXA 2CKQA 2O2UA 2R3JA 4H58A 4OUCA 4W8EA 4UMPA 3HEGA 3MJ2A 5IU2A 2E9UA 3PXQA 3GCVA 4BDEA 4F6UA 4AACA 3QQKA 3IONA 2PL0A 4GL9A 3C13A 4J97A 4OTQA 3SXRA 4APCA 3ANRA 3I81A 3P9JA 4LFIA 4EWQA 3IS5A 3AMAA 3BYUA 3NCZA 4J98A 4FC0A 3SRVA 1WBTA 4XUFA 1QPCA 2R2PA 5BUJA 4WO5A 4M69A 3I4BA 4H36A 3VULA 4ASDA 3ZM9A 2B7AA 4NWMA 5FBOA 1XH7A 1W0XC 5HE3A 2HWPA 1PXIA 1WVYA 2C3LA 5KZ0A 4FOBA 2P3GX 3IOKA 4EC8A 3Q4TA 5JGDA 5M4CA 2W0JA 4O2ZA 4ALWA 5JZNA 4ZLYA 1O6KA 3R63A 4XBUA 3S0OA 4ZS0A 2PU8A 5KMMA 1RJBA 3NMUF 3ALOA 4ENYA 2X2MA 5HG8A 1OPLA 3UBDA 5CLPA 2OJJA 3QUEA 1QPDA 3IW5A 4IE9A 4FEVA 3BHYA 5HI2A 3AT3A 3CTQA 5F95A 5LWMA 1G8AA 4FR4A 4QMZA 4XS2A 3F3VA 1U54A 3UIUA 4EH5A 4EBWA 3QLGA 1ZY4A 2VTAA 3ODYX 4MXOA 5BVEA 3C1XA 4ZTNA 2WU7A 4DH8A 4R78A 2C68A 4Y5HA 5F20A 5AV4A 5AR5A 2RFSA 1R39A 2C1AA 3MVJA 1GIJA 1XKKA 2PUUA 4FV7A 4X2KA 5AEPA 2IVUA 2QOHA 4H05A 4KA3A 2FYSA 5TE0A 4BY9E 2C6DA 1M14A 4K11A 4QMUA 4WD5A 3RTPA 3Q5IA 3MJ1A 1WVWA 2ITVA 4GH2A 3QQJA 4CT1A 4PQNA 2C3JA 2J0LA 2FUMA 3QWKA 3K54A 5M51A 3QQGA 4QQ5A 5CTPA 4HPTE 4CG9A 3LXPA 2W1DA 2UZUE 4KKGA 4TNDA 4YHTA 4WHZA 4R6VA 3FQEA 2O63A 1QPJA 2UVYA 4JG6A 4KBAA 4G6LA 5ACKA 2Q0BA 1YWNA 1H01A 2XRUA 2XS0A 2Z7RA 3EQIA 3ORKA 4PDOA 5AV3A 4K33A 4BRXA 4FKOA 4HYSA 3PPJA 3E64A 1JKLA 2C30A 2C6KA 3ZLXA 4AGDA 4DEDA 1KE6A 3VUGA 3Q52A 3R8MA 2RFNA 1KV2A 3C4XA 3NUUA 2VWWA 3AXWA 4CCUA 1V0OA 4CZYB 3LQ8A 3KCFA 3KFAA 5DI1A 2OF2A 5CEQA 4PTCA 2UUEA 5HLNA 1PHKA 3ROCA 1UNGA 3VS3A 3WILA 2XNOA 1S9IA 3FC2A 3PIYA 3U51A 5HVKA 1H25A 5HG9A 4DG2E 5AJQA 1J3HA 5E8XA 2YCFA 1H0WA 2OICA 1LEWA 3R04A 2NP8A 4GVAA 4HOKA 4DH1A 4PNKA 4FKTA 4G9RA 2QOKA 5EQYA 4O1PA 3UO4A 2JBOA 4Y72A 3TTIA 4MCVA 2YCRA 4QNYA 4EL9A 4AGCA 2OIQA 4E5WA 3GU8A 5IDNA 3LXLA 4NCTA 4QYFA 3QHRA 5CS6A 4JDJA 1WCCA 5C27A 3BYOA 3ORIA 4DFBA 2WIHA 1STCE 3PZHA 3DLSA 2OW3A 2YWPA 5A14A 3GCPA 2JC6A 3JY9A 5CAQA 4IAYA 3BELA 3GU6A 4H3PA 3ENHA 3NUSA 5DPVA 2JEDA 2YM4A 2IWIA 3CIKA 3LQ5A 4PTGA 4N6YA 1YW2A 1R1WA 4AOJA 5CEKA 5KUPA 4DEHA 3LFBA 5ANKA 4M97A 4QTCA 2UZOA 5A4QA 4EQMA 5AIKA 4JQ8A 4FYOA 2QOCA 3IQ7A 4YJQA 1QCFA 1URCA 2XF0A 1B38A 3ZHPC 4D2RA 4YURA 1NW1A 5EYDA 3VS5A 4I6HA 5HIDA 1OM1A 4MBIA 4O1OA 3HV6A 3R9HA 4J53A 3FZRA 3OEFX 4K2RA 3PA5A 4KKEA 5AA9A 4QMNA 2CGWA 2UZNA 5M56A 3NW6A 4RX5A 4QMSA 5HCZA 3UC3A 4F0IA 5BVFA 2I6LA 3OWPA 1F5QA 4LUDA 4ZXTA 3R7YA 4C4GA 2QOIA 3ZM4A 3O8UA 5KCVA 2BIYA 3MPMA 4Q5EA 4C62A 2WMBA 1CDKA 3FAAA 4GV1A 4C8BA 5A4LA 3QCSA 4YJRA 2VWXA 4FEWA 5HIEA 2HZNA 3NNXA 4ZSAA 1ZZLA 4LRJA 5CU4A 5DLSA 3DU8A 4BIEA 5C4KA 4K8AA 1O9UA 3ZRMA 3UZRA 1QMZA 4KS8A 4YUQA 3UPZA 2W5HA 3RAHA 4NK9A 2VWVA 3F2RA 3DLZA 1KSWA 3PIZA 5J5SA 3TIZA 4EZ7A 4Z16A 5IH6A 4M0YA 4JOAA 4BVUA 3V04A 4BKJA 3A62A 3VBWA 4FKRA 5GJGA 4FV3A 1SMHA 4YJOA 3GT8A 1ZMVA 2F2CB 3PRIA 5EI2A 4BI0A 4RFZA 5GZAA 3RK9A 1OIQA 3PVBA 2IZTA 3PIXA 5FM3A 1YVJA 5L2IA 2ITNA 3RP9A 1OVEA 2WEVA 3AD5A 5IH4A 2X9FA 5H2UA 3UG2A 4BDJA 4GKHA 5H8GA 3EN6A 3H3CA 4XG7A 4I21A 4Q9SA 4F0FA 2WTWA 4MK0A 4LL0A 5K4JA 4DFUA 1FINA 4IX6A 4I22A 1G3NA 2YERA 3KKVA 4YHJA 5EDRA 5HE1A 4GG5A 4ZSLA 2ZMCA 1Y6BA 4FGBA 4AZSA 4EOOA 4UXQA 5AX3A 3TNPC 1ZMUA 4MQ1A 4DTAA 3MN3A 3QQUA 1MQ4A 2BCJA 2XRWA 4II5A 3PJCA 4ANQA 4M12A 3GC0A 5IQDA 3NX8A 1JWHA 2WU6A 4V0GA 4JG7A 4XBRA 4XHKB 2V55A 5IA1A 3MFSA 4FSTA 4ZJJA 4NTTA 2JKMA 3FMMA 1H24A 4RZVA 3RALA 3KXXA 4G9CA 3LCKA 4EYJA 5HTBA 3QBNA 2HAKA 3RINA 2B4SB 4LV8A 1G5SA 1UU8A 2CKEA 3BRBA 3FUPA 2GSFA 1JKKA 4BCPA 5L8KA 3WARA 3QCYA 3EZVA 2BZHB 2GQGA 4JQ7A 1UNHA 4FZ7A 4UEUA 4AT5A 3BCEA 5ETIA 3VBTA 2JBPA 1Q97A 4F64A 3LAUA 2XJ1A 4AGUA 1VYZA 1B39A 2I1MA 4JRVA 3ZZWA 4A4LA 3BU3A 4DINA 2CNUA 5CVFA 3MB7A 2VZ6A 5M08A 3GGFA 4DF3A 2X4ZA 5LVNA 2R5TA 3EKNA 4V0GB 4I20A 3MDYA 5JGAA 4E20A 2VTJA 1UWJA 4B7TA 5EK7A 5L8JA 3HA8A 3A7JA 3RNIA 3V6RA 5KO1A 3HAMA 2YIQA 2QOOA 4ZMFA 3NNVA 5CSVA 4ZJIA 3FLZA 3LFEA 2UZLA 1OIYA 2QU6A 4P5ZA 2A19B 3BI6A 3CY3A 4G3EA 4EI4A 3MS9A 3F2NA 4I5CA 2CMWA 4M0ZA 4O96A 3A60A 3QALE 3AD4A 4ANLA 3CQUA 1GIHA 1J1CA 2BVAA 4YO4A 2IVTA 3EMGA 4IZYA 5FEEA 4F0GA 5JZJA 2EXCX 5D41A 3ZO4A 4IAKA 3FSFA 4KKHA 4NFMA 3TV6A 1UWHA 4PX6A 4R77A 5IQBA 2VO6A 4MYGA 5CEIA 3FMEA 3SOAA 3HV5A 1OL6A 4C2WA 4BBEA 2O65A 5GHVA 2O0UA 4NM0A 2WOTA 4YJTA 2VN9A 1H08A 4ZTSA 5J9ZA 2V7AA 2F4JA 4YC3A 3EFWA 2W5AA 1Z5MA 2VO3A 4D28A 3PJ1A 2YZAA 4WUAA 5GJDA 3PXFA 2FSLX 3QX4A 1WAKA 2ITOA 4FV1A 4RIXB 3O71A 4O7RA 2E9OA 1CMKE 2R7BA 3MTLA 1ZLTA 2BDFA 2YLEA 1W82A 3ZRKA 1KV1A 3VHKA 4BTJA 1TQMA 4F1MA 4N57A 2JFLA 2J50A 3C7QA 3MIAA 4RWKA 5AIRA 3N9XA 5HZNA 5CENA 5KBQA 2X8DA 4UWBA 4B9DA 5E1SA 3G6GA 3BHUA 4U0IA 5FLFA 4LG4A 4GKIA 4HVIA 3QC9A 2VAGA 3E8CA 2PE1A 3MVMA 3EQDA 1WMKA 5DRDA 3A8XA 2PZIA 4DH7A 3H4JA 3L9NA 5KKRC 5DT0A 5KMIA 2R3OA 3OC1A 4PMTA 4FSUA 4EOSA 1XHAA 5HCYA 3HECA 3GC9A 5IH5A 1W7HA 5E90A 4CFNA 4LRMA 4L9IA 2YLFA 4O38A 4GRBA 5AP7A 5I3OA 3DB8A 1IAJA 1YOMA 1WBVA 2ZOQA 3OOGA 4RJ5A 2I0EA 2VNYA 4UBAA 3NYOA 4A9UA 5FDXA 2VWZA 5JK3A 2PZRA 3QX2A 4LOQA 4EOPA 3OUKA 4TYEA 3U9CA 4LV5A 1FGKA 3KRJA 3SHEA 5AP1A 4BCKA 4FG8A 2Z7SA 5A3XA 4D5HA 3MFTA 2P2HA 3EN7A 1GZ8A 3TZ9A 3ZDUA 4L53A 3NGAA 3FDNA 3UVRA 3WZDA 4FK6A 3R7EA 4QMPA 1UA2A 2G15A 2XIZA 2CDZA 4L3PA 4IADA 3MI9A 1VJYA 1JKTA 2PHKA 5AP2A 1NVSA 1M2QA 3Q60A 4Y83A 5DHJA 5BMMA 3AGLA 5E8WA 5LMAA 3ZLSA 2XCKA 4Y85A 1W98A 4FTJA 4ANNA 1H1RA 4FTCA 3OCGA 3OTUA 1UU9A 2C6TA 2VWYA 5AUTA 4MXXA 3WI6A 1BLXA 3FJQE 2VTMA 2R3HA 2ERKA 4NUSA 3DZQA 4QMTA 2CKPA 2WTDA 4LQMA 2BUJA 4BR3A 1W84A 4L7FA 3FXWA 4EONA 4IJPA 3D5WA 3QYZA 3O96A 3DPKA 4D2PA 3HP5A 2XUUA 5TOZA 2E9PA 3GNIB 2WHBA 1Y8YA 4FVRA 4I4FA 1PXKA 4L00A 5HHWA 3W2SA 4IAZA 3CC6A 3F61A 3Q2MA 3R8VA 4E73A 2C5XA 3QRJA 1GZOA 3CJGA 3LJ1A 4A9RA 4L45A 4CZUA 2IZRA 3LM5A 2CN8A 3V01A 4HGEA 2ZM1A 4QQCA 2PUPA 3FZPA 3ZS5A 2CNVA 3NIEA 3DXQA 1IA9A 1SNXA 2J2IB 4OT6A 3UGCA 4CRLA 4D5KA 3C5IA 2RG6A 5HCXA 4RWLA 4USFA 2JDSA 4FKIA 4FZ6A 4JBOA 1IRKA 1PMUA 3FI4A 2QOQA 5CASA 2YFXA 3DBFA 3N51A 3SW4A 3TV7A 4BB4A 3TCPA 2C3KA 2DQ7X 4NIFB 2BTSA 4LRKA 3PVUA 2QG7A 4Y95A 3VUKA 5H9BA 3ZFYA 4GU9A 5HX6A 1MQBA 4MXAA 3KK9A 5EW3A 5L6WL 4TXCA 2VTPA 2QO9A 3LLTA 5BVNA 4ITHA 2Z7LA 4JG8A 5EHOA 4S31A 3RBWA 4PMPA 4FEUA 5C03A 2GHLA 1XBAA 5CF4A 2R9SA 1PXMA 4U42A 1Q4LA 3UOHA 2HW6A 2XM9A 4U5JA 3RCDA 3KULA 4FKSA 4R7HA 1ZZ2A 2ONLC 2R3MA 2XKDA 3A4OX 2C6MA 4UMUA 3MY5A 4FX3A 4FTAA 4XMOA 1CKIA 5CVHA 5CAPA 5HICA 4RT7A 5HX8A 3QTRA 4YTIA 3HKOA 1EH4A 3VRYA 4PDYA 5AP3A 4X0MA 3Q9ZA 3NWWA 2FB8A 2X1NA 2ZYBA 4WBBB 2R0UA 1REJA 3I79A 4FKUA 3VAPA 3RWQA 2OFUA 4F70A 3SV0A 3QD0A 4TYGA 2CLXA 3S4QA 3UIXA 5I9VA 2WTIA 4C2VA 2Z2WA 4GIHA 3FKNA 4ZZOA 5FDPA 3A7GA 3QLFA 3OUNB 3A8WA 4MBLA 3ORZA 3F5PA 3FQSA 3CP9A 4PTEA 3U4WA 5LCKA 3JUHA 4EKLA 5AV1A 3ORLA 5B2KA 2CKOA 3WF6A 3K3JA 3DTCA 4RIYA 4DG0E 4F9AA 4P2KA 3ZXTA 1YOJA 4BBFA 2ITYA 3CPBA 1P2AA 4TW9A 5AP5A 2VRXA 3V5TA 4PP7A 5AA8A 4V01A 1VYWA 3S00A 5A46A 3LHJA 4QMXA 3PXRA 5I9ZA 3IW4A 3OWLA 2QD9A 3RHXA 3ENMA 3Q32A 3TZ7A 4G6NA 3IW7A 4KINA 4ANMA 4C4HA 5AR8A 5HD7A 4OAUC 4I6BA 3BE9A 4QTDA 2Z8CA 3DY7A 4I6QA 4R5YA 5LMKC 2WELA 4YJSA 4U97A 3SC1A 2A4LA 2WTKB 4OTPA 4S30A 3GENA 3FLWA 2H6DA 1MRUA 3RI1A 4HVHA 4NYEA 3EH9A 4TWPA 3ALNA 1YOLA 3O51A 3QC4A 4RIYB 5J7HA 5JKGA 4P5QA 4G1WA 5HIBA 4CD0A 4Q2AA 5ANJA 4DFXE 3RPSA 2YCSA 1KE9A 3M42A 2VWUA 2AC5A 3R1NA 4FSRA 1J1BA 1OUYA 4RG0A 4FTUA 4J8NA 3PY1A 3L8XA 2PMLX 4RZWA 3BQCA 1J7IA 3CBLA 4M8TA 4AZTA 2OGVA 2GNFA 2F49A 3Q4UA 3JPVA 4OGRA 4W9WA 1I09A 2CGVA 4YLJA 5HBJA 4M84A 1BMKA 2REIA 4AE9A 3LQ3A 1IG1A 4AFEA 4IBMA 4DGLC 3VC4A 3OZ6A 4M67A 5HOAA 4FIHA 2BAJA 3E8EA 3LPBA 4DH3A 3C50A 4A9SA 3SD0A 4PL4A 4RC3A 3LCTA 4GFGA 5HKMA 4Z3VA 2HXLA 4AA4A 1GZKA 1Q3WA 4KBCA 3HGKA 3Q04A 5CU0A 1ZYSA 4ZS4A 4JRNA 2VGOA 4RIWA 2G2HA 3HX4A 4WT6A 4BTMA 1LUFA 2WGJA 4XLVA 4QRCA 3OWJA 3VS6A 1HCKA 4BIDA 5A6OA 1YHWA 4WOVA 3P23A 5GJFA 3FHRA 4NW5A 3ORMA 5AM6A 3OY3A 2YAKA 5KE0A 3ZUUA 5D11A 4EYMA 5HTIA 3UPXA 1PXNA 1G8SA 5BVOA 5IKWA 3KRRA 3WF7A 2GS7A 2BZIB 4YP8A 3RCJA 1JSVA 4EQCA 4CTCA 1UV5A 5GZ9A 2UW5A 5AR7A 2VX1A 4AG8A 2P55A 2XBJA 3U6JA 4WSYA 2BZKB 4BWKA 2C5NA 4CGAA 1U5QA 3NYVA 3UQGA 3PRFA 3DBDA 4EOQA 4ZK5A 2C5YA 4BBMA 4RIWB 4XOZA 1LEZA 2UZTA 3DZOA 3PSCA 4L6QA 4FKVA 2XIRA 3LZBA 4XG6A 4YLLA 2PUIA 2UW4A 4QO9A 3W10A 5CSPA 1SVGA 1YI3A 4JIKA 1GNGA 4IH8A 5E9EA 3PVWA 4JIAA 3W8QA 4EK8A 4JJRA 2QODA 4AXAA 4FTIA 3ZH8A 2IVSA 4YC8A 4FIFA 1OKZA 4IC8A 4GFOA 2YISA 3S2PA 3TG1A 5EKNA 3OBGA 4PMMA 5EKOA 3DT1A 1MRVA 3ZCLA 3UP2A 3B8QA 3PUPA 1FBNA 4FEQA 3QAME 4FEXA 4GUBA 4IZ7A 4MF0A 1Z57A 2C0OA 4PRJA 3C0HA 4XG4A 3TIYA 5E8VA 5TF9A 1WFCA 3NEWA 2VU3A 3V8TA 4A4OA 5CEOA 1JSTA 2VTOA 3BIZA 3CKXA 2R64A 3EN5A 5AM7A 5FTGA 4ITJA 4QQTA 4CFUA 2B54A 3P0MA 4CCBA 4FICA 3TNWA 2BRMA 1WBPA 3U54A 2W1GA 5EM7A 3HAVA 4D2TA 3LMHA 5J95A 4AN3A 3OCBA 1ND4A 4E93A 4Z7HA 2GS2A 3DKGA 2WTKC 2Y4PA 3TACA 4CLIA 4M14A 4E5BA 4WNPA 1PMNA 2UZBA 1YXXA 3NS9A 4P7EA 3Q3BA 4Z55A 4QMWA 4FVQA 4A06A 1KUTA 1H4LA 4U9AA 3KXZA 2J4ZA 3G33A 1PXOA 5F94A 4C58A 4EH9A 5EFQA 1L3RE 3ULIA 3ID6C 5LVLA 4E26A 4FSQA 4IDVA 2OJFE 4FT5A 4I5HA 3DKCA 3MVHA 4IVCA 5EG3A 5K3YA 4YU2A 3FMJA 5K5XA 2QONA 3C4CA 3UMWA 3EJ1A 1XH9A 4L52A 4OTDA 5C01A 3CLYA 3SXFA 3IECA 5L6OA 2JKQA 4O7LA 1BL6A 5DEWA 3TV4A 4IAIA 1URWA 3NAYA 2CLQA 2RSVA 3GB2A 3QXPA 4C3FA 1H07A 4X3JA 2OJGA 5CXZA 5GINE 5BMSA 1QPEA 1NT2A 1DAWA 3RKBA 2CJMA 3D4QA 3ZTXA 4E4NA 5HQ0A 2JDOA 3KF7A 5JN2A 3ORTA 4X2GA 3E87A 4YHFA 2OLCA 3BEGA 2H9VA 3TI1A 3ZOSA 4E4LA 4O7ZA 3DK6A 2R3GA 2YCQA 1LPUA 3RPOA 4ZAUA 3U87A 4UMQA 3FC1X 5ETFA 1H26A 3DKOA 5BYLA 4EK4A 5LVPA 5LQFA 2ZM3A 2ZB0A 2W4OA 1M7QA 3UIBA 4BDHA 3HLLA 4D1ZA 2G01A 2JITA 2Y4IC 4LOPA 1RDQE 4YZBA 2JKKA 2ZVAA 4C4EA 4UZDA 1JOWB 5FD2A 2PE0A 3ACKA 4BDFA 3QRUA 2ZB1A 3T9TA 3GXLA 3CQEA 5CU6A 4YSMA 3NNUA 4A4XA 1OKWA 4O7NA 5JEBA 2PVMA 3AT4A 4L42A 3GCQA 1U5RA 4D0XA 1WBWA 2HELA 3I6WA 3QZHA 3DDPA 3LFCA 3VUDA 1M17A 2WXVA 4WG3A 1M2PA 3Q9WA
chains in the Genus database with same CATH superfamily
3P79A 4DTBA 1KOBA 3GOPA 1RQQA 3ZO2A 1M2RA 3FLQA 2WTVA 1M52A 1OL1A 2HWOA 5HG5A 2WNTA 3G2FA 3ZXZA 1FMOE 4EHGA 4J95A 2OI4X 2QC6A 3FY0A 4ASEA 4CMTA 5I9UA 2HXQA 3E3PA 4BDIA 4NTSA 4YTFA 5KZIA 5DT4A 2X2LA 4KIPA 4YNOA 3PTGA 3PYYA 3H9RA 4L43A 3CPCA 4OBPA 3T3VA 4EQUA 4K6ZA 3HDNA 1ZWSA 2QLQA 5FQDC 3W8LA 3UODA 3Q2JA 2ITZA 2G9XA 2XK4A 4W8DA 4MQ2A 4C33A 4OW8A 4JVGA 1OITA 4XJ0A 3EIDA 2ETRA 4FIJA 5HTCA 2BKZA 2HYYA 4ZP5A 4CYJA 5KHWA 3R8LA 4FA2A 4ITIA 3TNQB 4I0TA 1A9UA 2GQRA 3MA3A 3D5UA 3RZFA 1PXLA 2W5BA 5HE2A 1HOWA 2BRNA 2QOLA 3TJCA 4AW2A 4BHZA 5KBRA 3PDTA 4E1ZA 3PG1A 4QP4A 3WBLA 1OPKA 3MB6A 3II5A 3NCGA 4IDTA 4XP2A 2EB3A 3NLBA 4BZOA 2ZV8A 4S34A 4XV1A 5IISA 4XLIA 5IQEA 4RFYA 4APPA 5CY3A 5FXQA 4H39A 3DFCB 2J9MA 3TKUA 1S9JA 3H0ZA 5DRBA 1BUHA 2VO0A 2W1IA 5HG7A 3E8NA 3BU5A 4FT0A 3LFFA 3O7LD 4F7NA 4ZSJA 1W83A 2BAKA 2GS6A 2XKEA 3F5UA 3MVLA 5CI6A 3BZ3A 3E93A 4FE2A 1Q5KA 5L6PA 2WFYA 1ZYLA 3HRCA 3NPCA 5E8UA 5FTOA 5DA3A 2C1BA 2FSMX 3R0TA 4QTBA 3QTWA 4LGGA 1APME 4U41A 4ERWA 5K0XA 3RPRA 4E6DA 3SOCA 4QMLA 2IG7A 3SXSA 5DIAA 3VHEA 3L8VA 1KOAA 3IGGA 4WRGA 2UW9A 2QLUA 3LCOA 4RMZA 2GFSA 3LMGA 2EXMA 5I9WA 2QO2A 4XG3A 4WKQA 5CAVA 3SDJA 2NRYA 2PE2A 1SM2A 3JXWA 3UP7A 3UOJA 4BL1A 3WF8A 2UW0A 3DOGA 4IAAA 2JDVA 1QL6A 4GT3A 4EH3A 4F08A 3LM0A 3MFRA 5DN3A 4YTCA 3Q96A 2Q0NA 2XNBA 5AX9A 2XZSA 4R3PA 4X3FC 4DITA 4FYNA 3ORXA 3B2WA 5EYMA 1P4OA 5J5TA 4ZTHA 4ACHA 3D9VA 3PJ3A 4KIOA 4CSVA 1FOTA 2OH0E 3GC7A 5L2QA 2VWBA 5M4FA 4PV0A 3QQFA 5TT7A 1XH6A 3UIMA 4QYYA 5ANGA 3KN5A 4BKYA 3ULZA 4FTTA 4O4BB 4OAVB 5HVJA 3WOWA 3R8UA 1GAGA 2UZVA 5CX9A 3P7BA 4U3ZA 4MUQA 2ITQA 5BPYA 3C4EA 5HBEA 2B9IA 4EK6A 4O0VA 4TRLA 4F9YA 4EJ7A 4AAAA 5CSHA 1ZOGA 3V5LA 2IF8A 4I92A 4NJDA 1YRPA 3F3TA 3TUDA 2YM7A 3I5NA 3POZA 5IDPA 5IEXA 2VNWA 3HV3A 2IPXA 2QG5A 4IVBA 4L3LA 1PXPA 1ZRZA 4D58A 3O8TA 2HCKA 3AKKA 2PZ5A 4TYHB 4W9XA 3VQHA 3LJ0A 4GS6A 5KKRB 5CI7A 3QKMA 5AP4A 1YKRA 4JNWA 3DJ5A 2ITXA 3NR9A 4V04A 5FGKA 3RK7A 5F4NA 2C6IA 5CAUA 4O2PA 5HNBA 4FTOA 5CXHA 4U8ZA 4XCUA 4TNBA 3E62A 4RC4A 4L01A 4EUTA 1TVOA 2YJRA 3GQLA 3OCSA 2PZYA 2HOGA 2OFVA 3W16A 5HESA 4DA5A 1XMMA 4PPCA 2BRBA 3GU4A 3O23A 4QMMA 3TN8A 4AOTA 4AZEA 3WZKA 5LOHA 3UO6A 4FKWA 4E8AA 4A9TA 4ACGA 3UZPA 3MTFA 2PK9A 2HZIA 1P14A 4U81A 1IR3A 3PLSA 4RPVA 2W1CA 1E9HA 4NW6A 2XANA 3HL7A 5EQEA 3ETAA 4GCJA 5J7BA 5IQAA 2I0VA 4DDGA 5DVRA 1BI8A 2CHLA 4OTRA 4ANBA 4C57A 4FT9A 1TQPA 1J91A 5BVWA 5K4IA 5AWMA 2OU7A 2QHNA 3VF9A 2IW8A 1ERKA 4AT4A 4DFZE 2X8EA 4X6QC 1ZOEA 1CKPA 4D9TA 5FEQA 3TWJA 1PRYA 4KABA 1YHVA 5JRSA 3AC5A 4RVKA 2PMNX 2XNEA 3D94A 4IB1A 1R0PA 2O5KA 2FSTX 3OT3A 4O0YA 4XV9A 3VW6A 4AZWA 4KD1A 4D55A 3VO3A 5FEDA 4ASZA 4RRVA 4RWIA 4MF1A 4EOIA 3O7LB 5L8LA 2UVXA 1GJOA 3PFQA 5L2TA 2LGCA 3D2IA 2R3PA 2GNGA 2YAAA 3D2KA 4YR8A 5A6NA 3PP1A 3AT2A 3UJGA 5LWNA 5EYKA 3THBA 4FTKA 1UNLA 3EQPA 3KMWA 3W2QA 4F6SA 5FRIA 2H34A 4RIXA 4CRSA 4G31A 2ONLA 2XEYA 4YZDA 4F1TA 1ATPE 4QP8A 3TUBA 2GNHA 5DFPA 4FMQA 3K5VA 2OO8X 5CZIA 2X2KA 3A2CA 4C36A 3C51A 4DC2A 3PA4A 4LGHA 5DR2A 4UZHA 3O8PA 4UMRA 4I41A 3BV3A 3ZO3A 4B6LA 3R1SA 3W0SA 2VUWA 4XX9A 2FH9A 2X8IA 4U45A 4K1BA 1PMEA 4IANA 3CTHA 4EJNA 3V5WA 5ANEA 1OIRA 3MW1A 4BCHA 3WZEA 2GQSA 4LMNA 1K2PA 3ELJA 3HUCA 4JDIA 5CVGA 4IWQA 3K3IA 2XB7A 4R1VA 1UVRA 5DWRA 2PVJA 4GFMA 3MV5A 1OECA 2W99B 4MD9E 5DR9A 4Z7GA 3NW7A 4DBXA 3Q6WA 4M7IA 5I9XA 3FZOA 3DK3A 3H30A 2QI8A 3OMVA 4FODA 3FBVA 4XG9A 5EM5A 5CNOA 4QTEA 4TN6A 4I93A 5D9HA 3PY3A 5ANOA 4BWPA 3RJCA 2R3LA 3E88A 2JIIA 5KMJA 3NYXA 4C4FA 4AW0A 4NT4A 4YJPA 2WMAA 4EOJA 1DM2A 5JQ5A 2G2IA 3NDMA 5IG1A 3QTZA 5E8SA 3UMXA 4O7TA 3BU6A 1Q8UA 4RX9A 5E8YA 5HO6A 4PPBA 4BCMA 5CEMA 4XP3A 4FNXA 3G51A 4HCUA 5AMNA 3MESA 4JDKA 1BKXA 1WBNA 3SAYA 3ZEWA 4RWJA 4QOXA 4E6CA 2B1PA 4W4VA 2O8YA 3C4ZA 4G34A 5KMOA 5M44A 4RFMA 3IG7A 1SVHA 3FZTA 2ZV2A 4Y73A 3DQWA 4U43A 4EHZA 5FP5A 5FTQA 2UW6A 1XQZA 3CKWA 3VUTA 2Z7QA 4RVTA 1JBPE 4FTNA 4AE6A 1GZNA 4KRDA 4E4MA 4EEVA 4NKAA 3BWFA 3DAEA 4I5PA 3Q53A 5HU9A 3C0GA 4CMOA 4NU1A 2JFMA 2JIUA 3PSBA 4AAYA 4JLCA 3NIZA 4EOKA 5EQPA 4WNOA 4DHJA 3QHWA 4W4WA 3UYTA 4W4YA 2WZJA 3E63A 4EH7A 4CZTA 3EFLA 2XKCA 3QKKA 3OTVA 4ZTRA 3OHTA 1KWPA 1RE8A 4J71A 4I5MA 2QQ7A 3OP5A 4FL2A 4ZTLA 3TL8A 4ARKA 3HMNA 4OLIA 4U40A 1UKIA 4AUAA 5BUIA 4CYIA 4O86A 1JVPP 5CU3A 2GNIA 4B0GA 3AC4A 3LFNA 3FV8A 4QP1A 4CNHA 4OTGA 3DKFA 3QRKA 4UV0A 4NKSA 5CSWA 5CSXA 2KULA 4O27B 3QZFA 4FG9A 2YM6A 3LOKA 3F3ZA 5L3AA 5AUXA 4O4EA 5AV0A 1L8TA 4AU8A 4CQEA 2Y8OA 4BCGA 5A4EA 3HYHA 4FT7A 4NIFA 5J79A 2BHEA 2IJMA 3EL7A 3FMLA 3P5JC 3KB7A 1YXSA 4UWCA 2ETKA 2EVAA 4FKJA 4FOCA 4DLIA 3EYHA 3MYGA 4FT3A 4LL5A 4F7SA 1J7UA 3COKA 2PWLA 3GCSA 2XNGA 2C5VA 4YBJA 3KA0A 4L46A 5AUWA 5IEYA 4H3QA 4D1XA 3ODZX 5J9YA 4O7SA 4MWIA 2HW7A 3R21A 3FXZA 3IDCA 4ZY4A 4PMSA 3G9NA 2R7IA 3ZZEA 4D2VA 3R00A 4QTAA 3FSKA 1OZ1A 2QKWB 2WMXA 2WD1A 5AAEA 5AR3A 2FGIA 5IQHA 2BR1A 3QA8A 3L9MA 2C3IB 2YEXA 3DS6A 5EYCA 5JFVA 3KXGA 3V8WA 1A06A 4FV4A 4ALUA 3L8PA 3OS3A 4AW5A 1JPAA 3VN9A 5AUVA 2R4BA 3P4KA 3QGYA 4BJJA 4BYIA 2B9HA 3A61A 4R5SA 3TZ8A 3OXZA 4N0SA 4DH5A 2BROA 3LMIA 4F99A 5JFXA 3C4WA 3CY2A 1FPUA 3CSVA 3V6SA 3R02A 4FV5A 4RIOA 1YDSE 2W06A 4UALA 4EOMA 5L2SA 4IWDA 3AC2A 4BZNA 5CYIA 4BDKA 4ZTMA 1H27A 3PXKA 4NEUA 3CXWA 4AT3A 2NRUA 3VNTA 3SLSA 4BDBA 3ORNA 4IZ5A 3COMA 5FUTA 2XYUA 4YNEA 2F7XE 3LFDA 4USEA 4U79A 5BX0A 5DG5A 5BQ0A 2PVYA 2JDTA 2YIXA 3CQWA 3VW8A 1Y8GA 1IAHA 4A7CA 5CEPA 3BV2A 4AWIA 4CFXA 5KX8A 4ORKA 4DCAA 4FSYA 3W55A 4YJVA 3EZRA 3UO5A 1ZYDA 4X7QA 3SA0A 4L68A 3OF0A 4YZ9A 4K77A 3UVPA 3LFSA 5A4CA 5HORA 2JIVA 3VBXA 2YM8A 1Y57A 4EZ5A 5JMSA 4UYNA 2WB8A 3LE6A 3KREA 3F9NA 3JY0A 1H1SA 4FSNA 4JX7A 5T3QA 4ANSA 2VTNA 5M07A 3MH2A 3A7HA 3PE1A 4TWNA 4PF4A 3GFWA 2GTMA 3COIA 4AA0A 3NUNA 3QQHA 5HNIX 1YI6A 4HPUE 1IEPA 2B52A 1UU7A 2RL5A 5JSMA 4L67A 5EOLA 2OXXA 2XM8A 3VBYA 1UKHA 4H3BA 5JFSA 3FI3A 2OIDA 4EC9A 4D4RA 1AQ1A 3BX5A 3DJ6A 4AXFA 1TQIA 3RPVA 4O6EA 5I9YA 2ESMA 5IMEA 5ITAA 4IJ9A 3HV4A 2ITUA 3MBLA 4DE4A 3ROYA 4JL9A 2W4KA 3QCQA 4MTAA 2DYLA 3PXZA 3R2YA 5CF6A 4FZDB 1K3AA 1PMVA 3F82A 4LGDA 3EHAA 2FO0A 4WNMA 1SVEA 3FXXA 3JYAA 4ZIMA 4C02A 3TNHA 2CCIA 1X8BA 3OW4A 2YA9A 4G17A 3RM6A 4BZDA 2PSQA 2X39A 1Y91A 1LR4A 5DE2A 3SVVA 5T6KA 2YIYA 4GYIA 3VUHA 4IVAA 3VS4A 4I24A 4RVMA 3IW8A 3L8SA 4LYNA 2OWBA 2EB2A 3D7TB 4M3QA 3LCDA 3OWKA 3ZSHA 3O0GA 3KVXA 2YM5A 3W18A 3NAXA 4QQJA 2YZLA 3T8OA 4EH4A 3QFVA 4G3GA 5C26A 3PFYA 3LKMA 2QHMA 3FLNC 2A1AB 3KRLA 4PUZA 4JBQA 4YJNA 4PP9A 4XG2A 3W1FA 1IA8A 1WBSA 2ZAZA 4GU6A 2OH4A 4QMYA 3EN9A 2UW3A 3GVUA 2IO6A 3LVPA 3SKCA 4FUXA 4F4PA 3EN4A 3R01A 4BCNA 2H96A 2VTTA 3QD3A 5I3RA 2J90A 4CLJA 2J5FA 3COHA 1Q62A 3PZEA 4FG7A 2YITA 4HYUA 2A98A 4BFMA 4OTFA 1FMKA 2XIYA 3G0EA 4R7IA 2BMCA 1YI4A 4IX3A 4MNFA 4BCFA 5TKDA 4BCOA 1OBGA 3GQIA 2PUNA 3R83A 4MX9A 4G3DA 4HVGA 3NW5A 4DFYA 4CVAA 4IEBA 2Y4IB 4BDGA 5CANA 2XK8A 4IFCA 4ENXA 4AGWA 2VWIA 5DYJA 4CV8A 1IASA 4IX5A 3FLYA 4TPTA 3BEAA 5DNRA 1JQHA 2VD5A 4F09A 2HIWA 4N4SA 4WG5A 3OEZA 3TNIA 2BIKB 1Y6AA 4PDPA 3VIDA 4R1YA 4U3YA 4DBNA 4R7BA 3MH1A 2B9FA 4EBVA 4UYAA 3BHVA 5JQ8A 1H28A 1GOLA 3TZMA 3OOMA 3OROA 4RGJA 1E1XA 4F9BA 4M13A 4LMUA 4S2ZA 2XP2A 1E1VA 4YTHA 3CCNA 4O4CA 5AP6A 3QYWA 4H1MA 4GG7A 2C5OA 1CM8A 4CKIA 4KNBA 3WYYA 3DXPA 5BVKA 1WZYA 4DEBA 3CE3A 3FMNA 5IUGA 2OF4A 3V5QA 2Y9QA 4HNIA 4DT9A 2BRHA 1Z9XA 5CQWA 5BNJA 3F3WA 4I0RA 2CCHA 2EWAA 5AP0A 4KSQA 4ACDA 3TTJA 2X4FA 4RVLA 2YWVA 1OKVA 5M55A 4CT2A 1DI9A 3OVVA 2W1ZA 3KC3A 5LVMA 3UQCA 4DEGA 3WIKA 4O82A 4O84A 3CJFA 4IVDA 4TTHB 2P0CA 3G15A 4QPMA 3S95A 2P4IA 3UYSA 3H0YA 4IB3A 4IHPA 2YHVA 4JBVA 3ZFXA 3QTXA 3GOKA 2R3RA 4FTMA 1P4FA 2P33A 3C9WA 4JS8A 4PNIA 3M11A 4Y5QA 3FI8A 4FZAB 4EK5A 3KF4A 4N70A 3I0QA 4AA5A 1UU3A 4D4SA 4BICA 4RA4A 3NNWA 4B8LA 1OMWA 5E4HA 3BBTB 4HJOA 3PPKA 3LXNA 4KSPA 4X2JA 3PA3A 5CZHA 2F2UA 3DAKA 3KXMA 2Z02A 3U6IA 3LLAA 3AD6A 5HE0A 5BVDA 2UZEA 3QL8A 5C8KA 3LCSA 3VS7A 5FG8A 4QMOA 4ZOGA 4D4VA 1PY5A 1V0PA 4X3FA 3C0IA 3U55A 3I1AA 3VS1A 4LM5A 5J1WA 2OXYA 4IXPA 4YGAA 2H8HA 4DT8A 3RWPA 4X21A 3HMMA 3H9OA 1F3MC 2X6EA 3NZ0A 4DFNA 3BWJA 5DR6A 3ZMMA 4OR5A 1FVTA 5C1QB 2DWBA 3UDZA 5B2LA 5ICPA 3UZTA 2WEIA 3VUIA 2BZJA 3B2TA 5EM6A 4JBPA 4ZEGA 4CFMA 4F1OA 2ITPA 5BUEA 4F6WA 4GK4A 5D1JA 4UWYA 3WF5A 5IPJA 5CF8A 4GK3A 2C6LA 4IAFA 3REPA 3S1HA 2NNWB 3ZFMA 3OY1A 3DB6A 5CT7A 5E92A 4DG3E 3HUBA 4G5PA 2J0KA 1BX6A 5IUIA 4A07A 4WNKA 4C7TA 3KXHA 3MH0A 3PPZA 4AN9A 4X3FB 5CAOA 2ITTA 3EQCA 3RHKA 3AOXA 2A0CX 3BE2A 4ZLOA 4CEGA 3QKLA 3QF9A 2IW9A 4BHNA 3UQFA 3PLAE 1OL2A 4F7LA 4FNWA 3WZUA 5LARA 1I44A 2JAVA 3AG9A 4B99A 3FMKA 5DEYA 3UE4A 2VTHA 1CSNA 4DTKA 4YMJA 3UNKA 2SRCA 3UDSA 3OXTA 5IQIA 2C4GA 3LW0A 1P5EA 3I0OA 3KU2A 2I40A 4RJ7A 3MPTA 4NH1A 1Q8YA 2IZSA 4JDHA 2X7GA 2WAJA 2V0DA 3PWDA 2BKKA 4HVSA 1O6LA 5HO7A 3QWJA 2IW6A 4RBLA 4S33A 3SRVB 3R8PA 2OJIA 1H1WA 3N4VA 4M69B 3POOA 4D9UA 4UX9A 3SGCA 1OUKA 1XJDA 3GP0A 4O91A 1KE7A 4BTKA 4FUYA 1ZMWA 2R0IA 4EH6A 5K5NA 4J7BA 4J1RA 3BHHA 1CTPE 4RC2A 4AZFA 2PPQA 4HVDA 2V5QA 2W1FA 2YACA 1AD5A 4FV2A 4IW0A 4BCQA 2GDOA 4H1JA 3BGPA 4E7WA 4ZLZA 4I3ZA 2C69A 1ZY5A 2VGPA 3R28A 4K9YA 2A2AA 3V8SA 4AZVA 5IA2A 2PVKA 2PMOX 3FZ1A 3KCKA 5CALA 1U54B 2B0QA 1M7NA 1MRYA 5FWKK 5EI8A 4EH8A 1T45A 3F5XA 5BYZA 3WZJA 4Q9ZA 5K0KA 5KNJA 4ALVA 4IFGA 4GMYA 3W2OA 2LAVA 4YPDA 5ACBC 2UVZA 3IK3A 5C4LA 4CXAA 2RF9A 4Q5HA 2AQXA 3F3UA 4UXLA 3NRMA 2AC3A 2FSOX 4O4FA 3ORPA 4DFLA 4MWHA 3RPYA 2BILB 3D5XA 3DBEA 3Q4ZA 2W1EA 3E5AA 4PY1A 4BC6A 3FHIA 3DXNA 3UG1A 4MXCA 4A9YA 4OTWA 3JR1A 2VTSA 5IF1A 3VJOA 3R7IA 2ITWA 1Q24A 2J6MA 2BRGA 2HZ0A 2GPHA 3HRFA 3VJNA 3ZLWA 4O22A 3GI3A 3PJ2A 3ZYAA 4ZJVA 4I1ZA 3S3IA 3DV3A 3PXYA 4XNEA 3R8ZA 2XEZA 3DFAA 2PVFA 4RLKA 2VV9A 3E7OA 2C6OA 2GTNA 4B8MA 3IPHA 2RIOA 2Y7JA 4ID7A 3E92A 3IOPA 1YHSA 4G3FA 4XG8A 3HZTA 2YABA 1YXVA 2C47A 3PG3A 4IZAA 2XK6A 1ZYCA 4FKGA 2GU8A 3GBZA 3V3VA 2X81A 5L4QA 2O3PA 2WKMA 4DAWA 4HGSA 3GEQA 3FL4A 4JAJA 2BALA 4XRLA 5DMZA 3DBQA 2B53A 3K2LA 4NJ3A 1OBDA 4LI5A 4DEIA 3VWAA 3KK8A 2VTRA 1AGWA 2X6DA 3BLRA 2IZUA 2XNNA 5AR4A 3UTOA 4QMVA 5D12A 3W32A 5JH6A 2XYNA 1YWVA 3AC3A 3O50A 1Q41A 1DAYA 2GHMA 3DBCA 1YQJA 4I6FA 4E3CA 4BDDA 1NVQA 5CF5A 2QOBA 1OKYA 4GJ2A 5IUHA 2WTCA 3HV7A 4TYHA 1OL7A 2JAMA 3QXOA 4KIKA 3LIJA 4TWCA 4KIQA 4RA5A 1R78A 4QP6A 3QQLA 3HVCA 3HNGA 3FLSA 4O6LA 2C6EA 3DNDA 3OXIA 4J52A 3C5UA 4C0TA 4X2FA 5LCJA 1H1PA 5JT2A 4AF3A 4C37A 3ATSA 3NYNA 2J51A 4IX4A 3ZC6A 4TYJA 4D2SA 3KIOC 2W9FB 3ITZA 4EWHA 1O6YA 1TKIA 4QP7A 5IZFA 2JGZA 1ZARA 5EW9A 4WG4A 2PMIA 2OIBA 3FMDA 4IWOA 4EOLA 4AP7A 4QP3A 2YDIA 1SZMA 3IDPA 3QRIA 3N4TA 3R7UA 2PTKA 3SW7A 2QO7A 3BGZA 3DTWA 1ZOHA 2RGPA 3WE8A 3F7ZA 1PKGA 4HCTA 4GEOA 4FRFA 2UW8A 5E8TA 4KIKB 1BYGA 2OK1A 4MD7E 4RQVA 4KWPA 1GY3A 2PY3A 4IM2A 4FKPA 5A9UA 2XJ2A 3U4UA 1XO2B 3NVMB 3BGQA 3IW6A 4ZY5A 3PVGA 4KS7A 4BIBA 4O81A 3F2AA 2ZV9A 3CEKA 4PPAA 1BI7A 5HGIA 4QD6A 4Z9LA 2PYWA 2IN6A 2Y6OA 4LUEA 2R3IA 3WE4A 2KTYA 2WMWA 4ONAA 3DCVA 3IGOA 3TDVA 3QU0A 4TYIA 2Y0AA 5M53A 2BDWA 2J5EA 3FI2A 4GVJA 1YDTE 2J0IA 2WMSA 3ERKA 4IM3A 2DUVA 1KE5A 1T46A 4CTBA 2YDJA 1DS5A 4OTIA 3T9IA 2BFYA 4W4XA 5M09A 4FTRA 4O7WA 3V5PA 5E7RA 3R9RA 4CFVA 1PJKA 3AMBA 4QYHA 3MH3A 3R30A 4MD8E 3U6HA 4YZCA 4FI1A 4XRJA 4F7JA 2C0IA 3TKHA 4DEEA 4FSZA 3CR0A 4UMTA 3ZSIA 3TDWA 4TWOA 3PJ8A 4O0WA 4UB7A 2WQOA 4ZZMA 5FXSA 5EM8A 4FNZA 4DHFA 5J1VA 1GIIA 4RQKA 4FV0A 3I7CA 3CS9A 3B8RA 4DGMA 2XH5A 4HNFA 2W05A 2PVLA 4IB0A 4M66A 3ZEPA 4I94A 3R1YA 5J87A 3EFKA 5KMLA 4ACMA 5AAFA 1YXTA 3ZLYA 1Q99A 2QVSE 4CFFA 4XP0A 2I7QA 1RW8A 3BBWA 3RVGA 3DJ7A 3IKAA 4EHEA 4IACA 1XH8A 3QUDA 3R7GA 5TR6A 3TT0A 4X2NA 4TT7A 1YDRE 3R2BA 4USDA 3KN6A 3P86A 4GSBA 3ZDIA 5FXRA 3R73A 3HP2A 4GYGA 3GC8A 1VEBA 2NPQA 4I4EA 3RZBA 5AR2A 2G2FA 4JI9A 4ZY6A 4F9WA 3R7VA 2UZDA 3ZONA 3O17A 3ATTA 2V22A 4O0XA 3F6XA 4G2FA 3MGYA 1LP4A 1K9AA 4ZSGA 1G8KA 1V0BA 3W0RA 5AUZA 4JQEA 1U4DA 2HK5A 3ZU7A 4I6LA 2WOUA 4I0SA 3EOCA 3NUPA 3I5ZA 5IQGA 5GIOE 2EUFB 2RFDA 3OD6X 4C35A 3K5UA 3KL8A 2W1HA 5EOBA 4YJUA 4NCTC 2WQMA 1H00A 1PKDA 4QNAA 3UOKA 1YXUA 2XNPA 4AX8A 5B7VA 3BLHA 3KQ7A 3PWYA 3H9FA 1ZYJA 3GUBA 5EHYA 4GUEA 4LOOA 3DA6A 3GCUA 3VBQA 4U6RA 5C8MA 4AXEA 3PE2A 4FIEA 3VQUA 4OBQA 5M4UA 3ZUVA 3OT8A 4V05A 2RFEA 5LMBA 5CWZA 3PP0A 4HYIA 1Q3DA 4JT3A 1VR2A 4R3CA 4N6ZA 1JAMA 1FGIA 3P1AA 4F65A 5LMKA 3EQBA 3E7VA 3DNEA 4FKQA 4QYEA 5E8ZA 5IA0A 3QZGA 3UDTA 1XH4A 3KMMA 3EQRA 3HMPA 2QR7A 2W96B 3VBVA 4OT5A 2JKOA 2X0QA 2OZOA 3R6XA 1PW2A 3PSDA 2CNQA 2A27A 4ACCA 4X6RA 4MNEA 3BYVA 4BI2A 5B2MA 3WF9A 3Q5ZA 4KBKA 2XARA 4AS0A 5I0BA 2IVVA 3F69A 4FIGA 5AUUA 4MHAA 2QCSA 2HY0A 3BHTA 1XH5A 1Q8TA 2YM3A 3OBJA 2XAOA 1U59A 4XEYA 4EORA 1OPJA 3KXNA 4U44A 2UW7A 3UDBA 3TKIA 3MY1A 4UN0C 4O7VA 2GNLA 5LJJA 1PYXA 2O64A 5A4TA 3G6HA 2B55A 3KMUA 2ERZE 3UNZA 2RG5A 2X7OA 4QP9A 1NA7A 4I23A 2WMRA 2E9NA 5K9IA 4O7YA 4TKSA 3DDQA 4E6AA 2EXEA 2QKRA 3AMYA 3EKKA 3FE3A 3H10A 3LFQA 4MKCA 4NZWB 2GFCA 4EZ3A 2R3KA 4HGLA 2OG8A 3CD3A 1XWSA 4MAOA 1U46A 4MNEB 4Y8DA 4FVPA 5M57A 5HU3A 3BLQA 5HEZA 4EUUA 4IMYA 5FP6A 3ML1A 3HRBA 3ET7A 2UZWE 4AQCA 4RLLA 3NUXA 1FVRA 4FK3A 2C0TA 2QR8A 2P2IA 4C38A 3FKOA 5CU2A 4D2WA 3LJ2A 2OJ9A 4UY9A 5GIPE 3L9LA 3TMOA 4IC7A 5HO8A 2WMVA 3LXKA 3RAWA 3VVHA 1KE8A 2E9VA 2ETMA 2XA4A 3FWQA 5AFVA 3KRXA 3DK7A 5I5ZA 2VX3A 5KHXA 3QD2B 4G6OA 5HD4A 5I4NA 4TZRA 3FYJX 3EQGA 4JAIA 3SQQA 2BFXA 2XK7A 4XV3A 4AXDA 4RJ3A 3Q6UA 1OB3A 3IO7A 3Q9XA 5ANDA 3ZUTA 4QYGA 4XH6A 4DDIA 3QTQA 4M15A 3L9PA 3AC1A 4MBJA 4YC6A 2WMUA 1OIUA 2HY81 4DEAA 5IEVA 3I60A 4PWNA 3E3BX 3E8DA 4FZFB 5GZ8A 2ZMDA 2ZV7A 5H8EA 1FVVA 2XBAA 3BKBA 4O21A 4GK2A 3CTJA 3GFEA 4FBXA 2WTJA 2BPMA 3R9OA 4ANOA 4WRSA 4BKZA 3R71A 1OL5A 1SNUA 4Y46A 3KGAA 4FGRA 3EB0A 5H8BA 2QNJA 4FV9A 5AV2A 3PY0A 1XBBA 2GCDA 3WIGA 4JMQA 5ETAA 4MXYA 4BDCA 2CN5A 4NFNA 3OFMA 5FM2A 3OCTA 5IQCA 3QGWA 2GHGA 2YIWA 3AC8A 4FTQA 2XIKA 3W2PA 3RM7A 1TZDA 4RX8A 4C34A 4WA9A 2G1TA 1WVXA 3D15A 4BGQA 4RX7A 1JLUE 3TXOA 2I0YA 2WMQA 3MFUA