5HEZA

Jak2 kinase (jh1 domain) mutant p1057a in complex with tg101209
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
291
structure length
287
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSARNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSAPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Resolving TYK2 locus genotype-to-phenotype differences in autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 287
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hezA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hezA01
1QMZA 4DINA 3NVMB 4I6QA 2UZTA 5EK7A 1GZNA 3WIKA 3ZXZA 4U43A 4H3QA 1NVRA 4N0SA 4FV1A 5EYCA 3P7BA 5HE1A 5CASA 3CD3A 1J7IA 5H8BA 4LYNA 3KRWA 5J7HA 3OT8A 3ZZEA 3NNVA 5IMEA 2VWBA 1ND4A 2UW6A 5KO1A 4RFYA 2ITUA 4FC0A 2UZDA 4XV1A 2BIYA 3O7LD 5DT0A 3DB8A 4GUBA 4WIHA 5HNBA 3L9LA 1SNXA 4AE9A 4L00A 4GH2A 3QQUA 4G6OA 4OBPA 3RVGA 4L44A 3Q5IA 4UWYA 3DKCA 5HX8A 2CKOA 3K2LA 3NAXA 4D4RA 2PMLX 4IBMA 3PLAE 4JJRA 3KRJA 1QL6A 1XWSA 2PE1A 4G6NA 4ZSEA 3A8WA 2VWXA 2OLCA 1XBAA 5C1QB 1Q62A 4O0UA 2DUVA 2JC6A 3A60A 4W9WA 5KNJA 5GJDA 2WPAA 4YZDA 4RVTA 3G33A 1PXMA 4J98A 3RGFA 4ASXA 4EOSA 2WNTA 2YJSA 1CKJA 1IEPA 2HW7A 2XKCA 2QKWB 4JQ8A 3VAPA 5CENA 4ARKA 3O0GA 2BROA 3NAYA 3MYGA 2JDVA 3QD2B 4R7BA 3LIJA 4J52A 3ZBXA 4Y8DA 1H01A 3DLSA 5E7RA 4BBMA 3QLGA 5HIEA 4Y83A 3ANRA 4QMTA 4D1SA 3D5UA 4IZ7A 4KKGA 3E8EA 3NRMA 2YCSA 4K1BA 4RJ6A 4FV2A 1UNGA 3E8CA 2RFEA 5IA1A 4APPA 3A61A 4KRCA 3LFAA 1BUHA 2C6EA 3MJ1A 4G9CA 4G2FA 4X21A 4A4XA 4BWPA 2CNVA 1T45A 5CNOA 5K3YA 4IXPA 5JKGA 3TUCA 2YWPA 1XBBA 4IZAA 4B0GA 1KWPA 4C3PA 5D7AA 3S2PA 5M4FA 2WEVA 3LFDA 5C01A 5EHYA 4CTBA 1PYEA 3PVBA 4D2SA 2J7TA 2PZIA 5IH6A 4EK3A 3QKLA 3JXWA 4FI1A 4AF3A 4DGOA 4U0IA 2XF0A 3PSBA 3S0OA 3LJ1A 1IRKA 2BRHA 2XK6A 3CQWA 3LVPA 2VGOA 1UU3A 3IW8A 1V0PA 4YJSA 3E93A 4FYOA 3CLYA 2GTNA 1JKLA 5BX0A 2YIXA 4CZYB 3UVRA 3NUUA 3CD8A 4G3FA 4RJ5A 3GQIA 3MPTA 3PWDA 3QCXA 4FOBA 4FTOA 4PF4A 1LUFA 1PXOA 4EQMA 2GFSA 1DAWA 3G0FA 3Q53A 2GNJA 3GCPA 4YC3A 4AGWA 3R8UA 5AX9A 5HE2A 4GFOA 4FGRA 2UW7A 1CSNA 1G5SA 1IAJA 2VTQA 4YZMA 4O7NA 5AUUA 3C0GA 2VN9A 4RGJA 2HY81 3ORNA 5HVYA 3SXSA 4F64A 4TYGA 4ZLYA 5B2MA 3RK9A 4NM7A 1QPEA 4EYJA 1RDQE 4RFMA 2C0OA 2ONLA 3DJ6A 4E93A 2PMIA 3NLBA 3OWJA 4R1YA 4YHFA 4U42A 5AADA 1LEWA 2FH9A 2VX0A 3F3TA 3PY0A 4HVIA 3UG1A 5EKNA 4IVAA 3IOKA 3U54A 5FRIA 3VUIA 3E7OA 1KE5A 3MTFA 4I23A 2CKPA 4FIFA 4CZUA 5IG1A 4BY9E 4NYEA 4ID7A 5BVKA 3FHRA 2W5BA 3EQDA 2Z60A 4D2RA 2W1FA 3LMHA 2P3GX 3RM7A 3EMGA 4USFA 1XO2B 3QALE 3PY1A 4E4LA 3MBLA 2V62A 4GEOA 1OPJA 4AE6A 4FEUA 3NUNA 4M97A 5CLPA 3H10A 1IA9A 4GL9A 2BDFA 4AZFA 5AP2A 4PNKA 1ZMVA 3TACA 2QOLA 3TKUA 2WOUA 3QZHA 3E64A 4HYIA 3CE3A 3OROA 4RC3A 5BQ0A 3OBGA 5BVDA 5A46A 3WYXA 4Z7GA 4BCHA 3V6SA 4MKCA 4NK9A 3CY2A 4RQVA 4MF1A 4YTIA 2BAKA 1O6YA 3TDVA 1QCFA 4FKLA 2CNQA 5HESA 2WAJA 2FSMX 1PXKA 4FNXA 3F2RA 2R0UA 5HG8A 5FD2A 4KBAA 3RPRA 3QUDA 3SOCA 4X2KA 4L46A 3FHIA 3D15A 2OW3A 2QONA 4R3CA 3TJCA 2JDRA 2QR7A 3KF4A 1MP8A 5I4NA 4BCNA 1P2AA 2RFNA 2Z7QA 3QX2A 4TXCA 4O7LA 5HE0A 3HRFA 2QO2A 4I5HA 3OCGA 2XVDA 2O3PA 3ROCA 4GYIA 4XMOA 5IA0A 3SA0A 3RAKA 3DXQA 4YZBA 2GNHA 4UWBA 3RPYA 2QOQA 4TRLA 3OXZA 4I24A 3WOWA 4OBQA 5AP4A 3SG9A 4FSUA 5CSHA 2OJGA 4Q5HA 2ESMA 2Y9QA 1W0XC 4M0ZA 4FVPA 2C5XA 4G3CA 4MYGA 3MESA 4KB8A 1OPKA 5ANDA 2UVYA 3II5A 2C1BA 2GU8A 3OT3A 3EIDA 4RA4A 5L6WL 3RPSA 3PA4A 5A6NA 5J9YA 3DBQA 4QMUA 5AV2A 3RWQA 5KUPA 2YITA 4JT3A 2XRUA 5D9HA 4K0YA 4ASZA 3VBXA 4FVRA 3PA3A 5IH4A 4MD8E 4DITA 4I5MA 5M56A 1H24A 2FSOX 2Y7JA 3DKOA 3PVWA 3LLTA 4EJNA 3BGPA 4RX5A 2X8EA 5AA9A 3ALOA 3NYXA 1K3AA 4F0FA 2B4SB 3ODZX 4NJ3A 4KIPA 4B8LA 2F2UA 4CSVA 4NM3A 2W96B 5IF1A 3PTGA 1OKYA 2ZM1A 1U59A 1YDSE 2C6MA 2WTIA 2YM8A 4GK3A 4ZTSA 3R9OA 1H0WA 3WF5A 3QHRA 3KA0A 2A1AB 2PTKA 2B9IA 4NU1A 4QPSA 5L6OA 3HZTA 3OUNB 5AV1A 2CMWA 4LV5A 4UY9A 3ZUUA 3UQFA 1L8TA 2H96A 5CF6A 3D5VA 3R9DA 3RZFA 3PA5A 3LCKA 4PDYA 4Y85A 4WRGA 4FTIA 1W8CA 3R02A 4RJ8A 3VWAA 3NDMA 2YCQA 4QP6A 3JY9A 1Q5KA 4MX9A 4O7WA 4EOJA 3CKWA 3EQRA 3D0EA 3PG3A 4LUEA 5HCYA 5JH6A 4XG9A 4AGCA 3G2FA 3JUHA 4GV1A 4QQTA 3DT1A 4I0SA 4JDJA 5DIAA 4CFWA 1Z57A 4AFJA 3MI9A 3FY0A 4XG7A 4F7JA 4IX6A 2V0DA 4FSTA 3BRBA 4P4CA 3SX9A 4BZDA 4YP8A 3MFTA 2JGZA 3F5GA 4Y72A 3F82A 4HVHA 5CVFA 4IMYA 4BYIA 4BI2A 3AD5A 5CU6A 1XR1A 4O27B 4OTGA 5AP7A 2OJFE 3BEGA 3OTVA 4NJDA 4NSTA 5FTOA 3CKXA 2JIVA 2Y4IB 4C61A 3RAHA 3SVVA 2XNOA 4M3QA 4IAAA 5M07A 3OXIA 5HLNA 3ZYAA 2GSFA 2DYLA 4BGGA 4MQ1A 1BL7A 5CWZA 3PXRA 4BI1A 1CM8A 3MFRA 2WXVA 4I92A 1Q8ZA 2HAKA 3ZO1A 4B99A 3AG9A 3FMEA 4FV4A 4FEWA 3D5XA 3E8DA 4KAOA 5AUWA 4BIEA 1OUYA 4NWMA 2CGXA 3RM6A 4EOKA 4EK5A 4QNAA 2PMNX 3BU5A 4E4MA 3OW4A 4O96A 4I22A 4DFLA 3QD3A 5ANKA 4BHNA 3NCGA 4IVCA 3NGAA 5D41A 4O22A 2GQSA 4MHAA 2QLQA 3A99A 1K2PA 4UMRA 4BDCA 2QU6A 5K0XA 4YURA 2H9VA 3I6UA 5FBOA 4XBRA 2WOTA 4QP9A 2YCRA 3KXGA 4WNKA 1M17A 2BRBA 3NNXA 5CVHA 3TXOA 4C3RA 4F9AA 4ITJA 2VWVA 3COIA 5FWKK 1GZOA 3QZIA 3FZSA 4NZWB 1UNHA 4CKIA 2IW6A 5AR4A 5LARA 3OY3A 5AJQA 4GG5A 4YJQA 2W9ZB 2E9UA 4EHVA 3BHTA 5IA3A 3Q3BA 1BL6A 3FSKA 1GY3A 2IZTA 2UW8A 3GQLA 5DG5A 5JFVA 2PULA 3WZJA 4RJ4A 3HAMA 3FMDA 4ALVA 4F09A 5M51A 2HWPA 4AG8A 2IG7A 4FTAA 4ZMFA 1BX6A 2OGVA 1R0PA 2BZIB 2XNEA 4AP7A 4C62A 3FKOA 4W8EA 4L3LA 3LFCA 5AA8A 3FDNA 4YC8A 3NPCA 3HGKA 3ZDIA 2OJJA 1IA8A 1R3CA 2PK9A 4AFEA 2PWLA 1JOWB 3E63A 4R5YA 3MWUA 5HG5A 4WG5A 2BAQA 2ZV9A 4EWQA 3AMYA 2GFCA 2WMTA 2VV9A 4RX8A 4F9WA 4TY1A 3S95A 4XS2A 5AP3A 1ZYJA 2GQRA 5KCVA 5DGZA 5DR2A 5HHWA 3WE8A 4DG3E 5LMKA 2W1IA 3ZM4A 5J5SA 4NIFB 1YQJA 4JL9A 2GMXA 4ACDA 5EI6A 5EKOA 3GC8A 4ANOA 3Q9YA 4JOAA 2XIKA 3V5JA 1X8BA 4CFUA 2P0CA 2XS0A 1WAKA 4S30A 4PDSA 5LVOA 2W4KA 2WEIA 3BX5A 5IKWA 1MUOA 3RP9A 1ZXEA 4F6SA 4KKHA 3C4XA 1YDRE 1PXNA 3U8WA 3OTUA 4FYNA 2A4LA 2REIA 2XKFA 4G3DA 4RVKA 4LRKA 3MA3A 3QRKA 5BUIA 5A14A 5DLSA 3I60A 2OIDA 1A06A 3FZ1A 5CT0A 2IJMA 3I0OA 4ZTQA 4BCQA 5HIDA 4BDEA 4O82A 3EKKA 1URWA 5KMOA 1H1QA 3KXXA 3LJ0A 4U7ZA 5EM6A 1YXXA 2B55A 3G6GA 3TZMA 1REKA 3VF9A 5CXZA 2NNWB 4MXOA 2OH4A 3R7YA 5E8ZA 2R3PA 2EXMA 4H36A 4QMMA 5FM2A 5ACBC 2EU9A 4QT1A 1YI4A 4A06A 1GOLA 2QOBA 3D7ZA 5BVFA 3GCUA 4FA2A 4BF2A 4FOCA 4EH7A 4M67A 4DGLC 3B2WA 3D94A 2ZYBA 2X2LA 2YIQA 5KE0A 3VUGA 2IVSA 3TZ8A 2O2UA 3R83A 5JZJA 2I7QA 4IADA 3ZLWA 4QMLA 3MS9A 4X6RA 4C58A 3KGAA 2R7BA 3H30A 3RK5A 3KVWA 3UMXA 3BU6A 4CFXA 5ITAA 4ENXA 2ZB0A 3SXRA 3DV3A 3EQPA 3HUBA 4JG7A 2BFYA 2JDOA 4LMUA 1JKSA 4QP7A 2WMUA 4OR5A 3ZRKA 5FXQA 4EUTA 4Q9SA 3U4WA 5L8LA 5CI6A 1F5QA 4MBJA 3AD4A 4K9YA 3PXKA 2V5QA 3OCTA 5D1JA 2H6DA 2AC3A 3DFAA 3QCQA 4QPAA 2YDJA 1CMKE 4AT5A 4IWDA 4V0GB 2BALA 4BDBA 4F6WA 3ALNA 4JBPA 4MH7A 3VUDA 2OICA 4MD9E 5JQ5A 5IPJA 1OKWA 4FV6A 4XG3A 4MXCA 5DEWA 3LQ5A 1F0QA 3TG1A 2XIRA 3V5LA 4E6DA 4I41A 3AGMA 1NVSA 2AC5A 3C5IA 3TNQB 1YW2A 4OGRA 3IW7A 4PWNA 4CKJA 2ITWA 4AZEA 3EWHA 4BKZA 2OSCA 3OFMA 3KC3A 4I0RA 1R39A 4K33A 5AV4A 3ZDUA 5CF8A 4FKJA 4RWLA 5L2WA 5T6KA 3RZBA 5AP6A 4ASEA 2VWIA 2FUMA 3ORIA 4G31A 3LQ8A 3VS2A 4RG0A 5A4CA 3QX4A 4RA5A 1M52A 4N4SA 5M4CA 2WGJA 4FUXA 3QGWA 3LPBA 4HYHA 4JIKA 2NPQA 2UW0A 5CQUA 3R7IA 2BRMA 2P2HA 4EI4A 3E3BX 5CT7A 5KKRB 1VEBA 4IM3A 2J0JA 1QPCA 5J7BA 2Q83A 2E2BA 3GU5A 1JBPE 3MVMA 5CU4A 1KE9A 3PJCA 3FI2A 2R3JA 3PRIA 4AA5A 4HGSA 1OKZA 4FV8A 4X2GA 1DS5A 4O0XA 3GEQA 4IEBA 3P23A 4TPTA 2UW3A 5LCKA 4AOIA 4EOMA 3PLSA 3G9NA 1P5EA 3KN5A 1OITA 2PUIA 4XG4A 3CJFA 2R4BA 5EG3A 5BVEA 3FMMA 2W5AA 5EM8A 3UOJA 2BTRA 4JR7A 3UQCA 4J53A 4DEIA 3CXWA 4DT9A 3EQIA 2C6OA 4F1MA 2XK9A 3QWJA 5HE3A 3HDMA 4EORA 3D7TB 1U54A 3FKNA 3PXQA 4JX3A 4DC2A 4UXQA 4LMNA 3RINA 3QQHA 4BTKA 1E1XA 4QMPA 3L9NA 3R2YA 3BYUA 1LR4A 3VJOA 1PMNA 4IB5A 4XG6A 4ACCA 1H08A 1RW8A 3RI1A 4X2JA 3UPXA 4J8NA 3T3VA 4YU2A 2ERZE 4FSZA 3VUMA 5KHWA 3UO5A 1WVWA 5M09A 4AZWA 4LGGA 4U8ZA 4JAIA 2C3KA 2VNWA 2PZYA 2UZLA 2WU7A 5ANGA 3QQLA 3EOCA 5CNNA 4CRLA 5BNJA 1PRYA 3U9NA 4E4NA 3V5QA 3F5UA 3CQEA 2X2MA 3A4PA 3ZS5A 4MXYA 3V8TA 3F69A 3HKOA 2PL0A 3L8XA 3R1NA 4R1VA 5IA5A 3BI6A 4EH8A 3DBEA 3FMJA 5E8YA 2DS1A 4FMQA 5I9UA 3S00A 1FGKA 4RQKA 4EQCA 3RMFA 3C4CA 2ZOQA 4TN6A 3TV6A 4CD0A 4FTLA 4EK4A 3FQSA 5EH0A 3QRUA 3FXXA 1UV5A 4Y5QA 4DN5A 4YGAA 4FTKA 3W2OA 3KK8A 3R73A 3AXWA 2ITPA 2NP8A 4MBLA 1TVOA 3F9NA 4LL0A 5IQAA 3ZLSA 4EH4A 1ZYSA 2J6MA 4K6ZA 4TYIA 3NYVA 2ZB1A 3PVUA 4UBAA 4AUAA 5A4QA 5K4IA 3MY5A 3SRVA 3AT3A 3OWPA 4RZWA 5AR7A 4M66A 5D12A 4CKRA 4D58A 4FTUA 2WQBA 4M0YA 3FI4A 4CNHA 5AAGA 2EWAA 4WUNA 1T46A 3CPCA 5AUTA 1ZY4A 2PU8A 2A27A 2BVAA 4V01A 2OZAB 2PVLA 1UKHA 3QGYA 3LJ2A 4JIAA 3CCNA 2ITXA 3R28A 2ETRA 4FZFB 4Q2AA 3SV0A 4AZSA 4AW1A 1H00A 5K4JA 1Q61A 3UTOA 3VS0A 4FKRA 4IQ6A 5DBXA 3W2CA 1YI6A 2F9GA 3PUPA 3UZTA 3KL8A 5IQEA 2C6KA 3R21A 3TDWA 1AD5A 2W0JA 4QMXA 5H2UA 3IKAA 1U4DA 2B9JA 2XEZA 3E8NA 3ZZWA 5HNIX 4CT1A 4LOPA 5LMKC 5CY3A 5ANEA 3T8OA 4MTAA 3TNHA 1UU8A 4I6FA 3EKNA 4FTTA 5E8WA 2F4JA 3CJGA 4NTSA 3R8ZA 5L2IA 2IVUA 4FIGA 3COMA 2PVFA 4IWQA 1U54B 1G3NA 5GNKA 5HIBA 5TOZA 2CGWA 4GU6A 4JNWA 3UDBA 3VO3A 4B7TA 4BCJA 5C8KA 3Q6WA 1U46A 3QRJA 4L7SA 4O0RA 1BI8A 5AM6A 4AX8A 2Z7SA 3I7CA 2X0GA 1M7QA 5L6PA 1WZYA 3Q9XA 2RSVA 3O51A 5HNGA 4BICA 2X6DA 2VWUA 5I3RA 4X3FA 4A9YA 1OL7A 4ANNA 3TI1A 3CTQA 3HP5A 3NYNA 3VULA 3WF9A 3Q4TA 4C34A 4F1TA 4V05A 1LEZA 2WO6A 5M08A 3DJ7A 4J8MA 3NUAA 3OVVA 3MTLA 4WNPA 1MRUA 4XUFA 4D1XA 2BKZA 5FTGA 3KMWA 2XCHA 3HECA 5BUEA 1H4LA 1GZ8A 2VTMA 3QKKA 4CMTA 3FZOA 2W1HA 3P86A 4TNBA 5LVNA 2CLXA 2XJ2A 3BE9A 4KBKA 4PP9A 2HELA 4DGMA 1NA7A 1CKPA 2C5OA 4FSQA 4AS0A 4MAOA 3FQEA 5JGDA 5ETCA 4U5JA 4ZZMA 2ITOA 2EXEA 4FG8A 3M42A 2X8DA 4BDGA 4WNMA 3PJ3A 2CN8A 4FV7A 2XA4A 3I81A 4RIYA 4NCTC 4ZY6A 1Z9XA 3T9IA 1PF8A 3TUDA 4G5PA 4ANMA 3VF8A 5HU9A 5KMJA 1NY3A 3C7QA 4FZDB 3V04A 4E8AA 4F65A 4BWKA 4FEVA 2X4ZA 1MRYA 5J95A 5H9BA 3ZFMA 4O83A 3UOKA 3SRVB 2VX3A 5FXRA 3AC4A 4YO6A 4CMUA 2YM4A 2PMOX 4G34A 4PMSA 4QTBA 4ENYA 5AP1A 1XJDA 4EQUA 3FEGA 3UOHA 3OHTA 3O50A 3OCSA 4U81A 3EZVA 2YHVA 3E5AA 5F1ZA 4F7SA 4JDIA 4FK3A 2QU5A 4YJNA 3V51A 2JFMA 2XIZA 3LXLA 1SNUA 4QPMA 3C51A 3OS3A 4Z3VA 3KEXA 4RWJA 4KA3A 1ZYLA 5AUXA 3ZTXA 5BVNA 3DBCA 3PVGA 5J87A 4DTBA 4KSQA 1YOLA 3W16A 4EBVA 5GJGA 5GHVA 4AWIA 1YDTE 4YSJA 3FXZA 2WB8A 1UVRA 5LWMA 2JBOA 4ZSLA 4AXAA 5M4IA 1R78A 1WBVA 2I1MA 3F5XA 3CQUA 3LFQA 3FYKX 3JYAA 1WBWA 3CS9A 4FZ6A 4YLKA 5I9WA 4IWOA 4XP2A 4NM5A 2QOOA 2XYNA 5KBRA 4BZNA 2GTMA 1OI9A 1EH4A 5IA4A 4K2RA 5JT2A 3N4TA 4XRLA 4O7TA 3QQJA 4D4SA 4HVSA 3SHEA 4XH6A 3A4OX 3ZBFA 1A48A 5B2KA 3LCSA 3WZKA 3UNKA 1LPUA 3IECA 4E5WA 4WSQA 2JDSA 3HLLA 3I0QA 3MIYA 4TWNA 4N57A 3K5VA 4LM5A 4HCUA 3ZOSA 1J7LA 4MQ2A 2PHKA 4E5BA 2G2HA 3NYOA 3COHA 5ETFA 4YO4A 1G8AA 3R30A 4M69A 2E9NA 3EFKA 1GNGA 4K11A 3FLNC 2JFLA 4DEEA 2WQMA 4P7EA 5DR6A 5BVOA 3UYTA 4DFZE 2C1AA 4JI9A 3LMIA 5FDXA 2OWBA 3CGOA 4TKSA 3GU4A 2W17A 4IVDA 3F88A 1Q97A 2F57A 4LRJA 4DH7A 3R8LA 3ULIA 3QQFA 4L45A 4F9BA 2X1NA 3AC2A 3IS5A 4YTFA 4O6LA 5A54A 5CAUA 1UKIA 2UV2A 5AAEA 4E6CA 3S3IA 2J5FA 5JK3A 4L7FA 1J1BA 1WFCA 2E9OA 4F4PA 4ZS4A 3BGZA 2FYSA 3KMMA 3C0IA 4DA5A 5FP6A 3PXFA 4O0SA 2O64A 3G51A 4GT4A 4GUEA 2W1GA 2WKMA 3RPVA 3R00A 3NSZA 2I40A 2ERKA 3ZUTA 3C1XA 3MN3A 3ZRLA 3R6XA 2UZBA 4D4YA 2W1DA 1YI3A 2XNMA 2PZRA 2KULA 4Y46A 4ZTRA 2F7EE 2WMVA 3M2WA 1YHSA 2OG8A 3W2PA 5KX8A 3DAEA 3KRLA 3PPKA 4XG8A 3FYJX 3PPZA 3AOXA 3ELJA 5IEYA 3QYZA 1H1PA 3F3VA 3RAIA 3DK7A 4JQ7A 1OUKA 2VTNA 3PIZA 5CSWA 2HXLA 4AGDA 4F7NA 5AR8A 3VVHA 1NXKA 3H3CA 2OF2A 1SVGA 3UIXA 3KRRA 4D28A 3LFSA 3FMNA 3ACKA 1JSVA 2HK5A 1YHWA 3QQGA 4FT3A 5DVRA 2R3NA 2X8IA 4EHGA 2VO7A 3F61A 4Q5EA 3ZFXA 5ICPA 5BYYA 3ORLA 2OZOA 2P33A 3NW5A 5JRSA 3R7OA 3TT0A 2VO6A 4IAKA 3BHYA 4RVMA 5IUGA 3GCSA 1OIQA 3VS6A 3W32A 4M8TA 3KXMA 3VQUA 2ITQA 4ZSAA 4DYMA 2R3MA 2UZUE 3IG7A 4ZS0A 4WSYA 4MNFA 4D9TA 2ITZA 3DQWA 4DEGA 3E3PA 4E73A 5K5NA 1H27A 4OTWA 2BMCA 3LXKA 4XLVA 4BCFA 4RIOA 2WMWA 4R77A 4O2PA 2PY3A 1GIHA 2BFXA 4L67A 3PJ8A 3UNJA 2IZUA 4ZTHA 2VTRA 3FLYA 4DAWA 4QTCA 3NUSA 4JRNA 4ZOGA 3AQVA 4D0WA 1ZMWA 4IC8A 3JVSA 4CLJA 2VWYA 1UU9A 3EL8A 5J8IA 4L8MA 2QC6A 5IUHA 3GGFA 4WHZA 3COKA 4AA4A 3KREA 1URCA 3EQHA 4HVGA 3BLQA 2VU3A 5CU3A 4UWCA 4OTIA 1OIYA 3RKBA 4D2PA 3HV5A 4EKLA 4FV3A 3K3IA 4JX7A 4RZVA 3QCSA 4TYJA 3RALA 4LOOA 2HZIA 3A7IA 4X6QC 2VTOA 1FINA 1UWJA 4FZ7A 4C2VA 5L4QA 1XH9A 2FB8A 3DBDA 3PXZA 4LUDA 4AA0A 4BI0A 4WKQA 5CXHA 3TNWA 5E4HA 4P5QA 4X3FC 4AN2A 4IAZA 1JKTA 5CAPA 3R7VA 5E8TA 4LG4A 4UYNA 3HUCA 4ZK5A 4DEAA 2XM9A 4ALUA 1V0OA 4EYMA 2FGIA 3V5TA 5DYJA 3DY7A 5GINE 5EW9A 2H34A 4ANSA 4B6LA 2QR8A 4FKWA 1DI9A 4BB4A 3IPHA 2CDZA 5HD7A 4ZY4A 4ZXTA 4FV5A 5GZAA 4RIWA 4DTAA 3TNPC 3VW8A 1ATPE 1QPDA 4LQMA 4XV3A 2GNGA 3GU7A 1BMKA 3DJ5A 3QF9A 3KK9A 4DCAA 2ZJWA 3MH3A 4BCPA 4XHKB 2BZJA 4OT5A 3NUXA 2OO8X 2YABA 1WBSA 2W06A 3Q9WA 3VW6A 1OL1A 3W2QA 5FGKA 5HLWA 3MPMA 2J90A 2YEXA 4IAIA 5KMIA 3DOGA 5F4NA 4O0VA 1VYWA 5IQFA 3R9NA 3FSFA 4FKIA 3DXPA 3RHKA 1W84A 5IQIA 3ORKA 5CU2A 2Y8OA 4U45A 5HG7A 3FV8A 1CKIA 4WT6A 4OW8A 4DH5A 4FE2A 5CF5A 2VD5A 4QQ5A 3R1YA 4H05A 4EK6A 3SC1A 3O2MA 2VTHA 4YJUA 3AC5A 4JDHA 4K8AA 3L9MA 2J5EA 3H0ZA 5CZHA 5LVLA 1Y6AA 3TTIA 3U55A 4QRCA 1JPAA 2I0EA 4LRMA 5E9EA 3HMIA 4TT7A 3DAJA 4QYYA 2UUEA 4OTRA 3HV6A 3MGYA 3DGKA 1MQBA 2X7OA 3CBLA 1BI7A 2OKRA 4QP1A 5IQCA 5IDNA 1H26A 2C3LA 5EYKA 3PG1A 2BHHA 4WO5A 3BHHA 2PVHA 1O6KA 5E91A 4GJ2A 3ZUVA 5JEBA 2SRCA 3TN8A 2R2PA 4KUJA 3EN4A 4FEQA 4G16A 4DBNA 2PVNA 3KQ7A 1HOWA 1H07A 2IVTA 4F7LA 2J0KA 5EDQA 5H8EA 3R7GA 4I4EA 3MB6A 2V7OA 3OOGA 4XNEA 3EFJA 2ZV8A 4BCGA 4FVQA 5IA2A 3LLAA 5I9XA 3GT8A 3QFVA 1S9IA 2B9FA 4CFNA 4L52A 4BTJA 4YHTA 4DEBA 2Y4PA 4FBXA 3FLWA 2B9HA 3FE3A 3PSCA 5HBEA 4CFVA 4F70A 3BCEA 3GFWA 1OGUA 1OVEA 1ZOHA 3A62A 3F5PA 4IWPA 4M14A 3PZEA 4XOYA 5HCZA 3EN6A 1YHVA 1JAMA 1P4FA 4CV9A 1WBPA 5C8NA 2BIKB 5I0BA 2UZVA 4BDAA 1APME 4YJOA 4P5ZA 2IW9A 3ZSGA 4Y73A 3E92A 2YZLA 2VZ6A 4EHZA 2OXYA 3QTWA 1W7HA 5J9LA 5BUJA 2VTLA 4IZ5A 5ANJA 3BHUA 4WG3A 4C4IA 5IU2A 4FIEA 3HNGA 3N51A 3EYHA 3O7LB 2C4GA 3BPRA 2YAKA 2GS2A 2WTJA 3HRBA 4EONA 3B2TA 2WTKC 5LOHA 2O5KA 2WQNA 2WHBA 1Q8UA 3HDNA 4FK6A 4TTHB 2YJRA 3C4ZA 3NWWA 3BYVA 4A4LA 5IQBA 4IM0A 1SM2A 1B6CB 2JIUA 2VO3A 5LJJA 4GS6A 1IASA 1H0VA 2PUPA 3ZRMA 2PE0A 3NVKI 1PY5A 3NIEA 3LCTA 3NW6A 2W4OA 3FBVA 3HV3A 3K3JA 3PJ1A 5AM7A 5IMXA 4CG8A 5AV3A 5EQEA 2C3IB 2QKRA 3ZU7A 4ZJVA 1JLUE 1PXIA 5CEQA 5JN2A 4L01A 4ZSGA 1V1KA 3Q96A 4XBUA 4XP0A 2WMAA 4FIHA 4FUYA 5AR5A 3DKFA 3R9HA 3UZPA 4HYUA 2ZMDA 3EJ1A 4P2KA 4RX9A 3O8UA 3OC1A 4OTQA 3Q52A 4O21A 2VNYA 3I4BA 2UZWE 4QP3A 4DG0E 2PVMA 3OG7A 4IX5A 4PV0A 4ORKA 1PMVA 4DH1A 4B4LA 1FQ1B 4GT3A 2XJ0A 3CP9A 3VQHA 4DFUA 1WBTA 3MFUA 4I6BA 4LV8A 3VUTA 4NKSA 2C47A 5LVMA 1PXPA 3JR1A 2YDIA 4JR3A 1YXSA 3VUKA 4QNYA 3IGOA 2E9VA 2UVXA 2W99B 2GCDA 5CU0A 2QURA 3NMUF 4C59A 4H58A 4CLIA 3G90X 4L43A 2PZPA 3EH9A 3EQCA 4V04A 2Q0NA 3GUBA 3H9FA 4UZHA 4QQJA 3UE4A 5JGAA 3DKGA 4S2ZA 2W9FB 5EYDA 4BGQA 5IQHA 5A4LA 3BV2A 5ACKA 1M7NA 3R9RA 3UIMA 4FSYA 3CGFA 1GAGA 4LFIA 2V22A 4XG2A 2QG5A 4C02A 3QA0A 3QC9A 3S4QA 5EI2A 3ZLXA 4BKYA 4IW0A 5JQ8A 4DCEA 3GI3A 2W1ZA 2CLQA 3ENMA 3KF7A 4MBIA 4CTCA 1PXJA 2VWZA 5TKDA 5KBQA 5HVKA 3C50A 2ZV2A 3MVHA 4PUZA 2OIBA 4LGHA 4NW5A 5HBHA 4C3FA 4O7ZA 4HGEA 3FUPA 4ZLZA 3KFAA 5HI2A 4JVGA 3Q2JA 1JWHA 3F6XA 3Q2MA 4MXAA 1PKGA 5DI1A 5CALA 4HGLA 3W33A 5DT4A 3UG2A 4OTHA 5FEEA 3DAKA 4NCTA 3QA8A 3QTZA 2EB2A 4IANA 4JBVA 4WOVA 5BVWA 4F63A 4UMPA 4YUQA 5HZNA 5J79A 2F7XE 3D83A 4E20A 1ZZLA 4RFZA 5CVGA 2GHMA 2RF9A 2W05A 4NFNA 5HKMA 4NTTA 4BIBA 5G6VA 3FWQA 2YAAA 4I21A 5EFQA 2F49A 2VTPA 3DPKA 1OZ1A 2XIXA 3BEAA 2QODA 3GCQA 4IAYA 4XV9A 3M1SA 5BPYA 2BAJA 3BWFA 3PYYA 4IFCA 3P7CA 4FEXA 5HG9A 5EQYA 1Y6BA 4HJOA 4W8DA 3ORPA 2R3IA 4W4YA 1FPUA 5AUZA 3WZEA 3V3VA 2GDOA 3W2RA 1JSTA 5CF4A 4C4EA 3KXNA 4X7QA 1B38A 3VBQA 1P4OA 4YMJA 3HRCA 3RPOA 2NO3A 3VS3A 4BVUA 2HZ0A 2RIOA 4RWIA 5EW3A 5LXMA 3L8VA 2G01A 1GJOA 1ZYCA 5DOSA 2OXXA 3KULA 2JAVA 3F3WA 4HYSA 4WG4A 3REPA 3W10A 3V01A 2PVKA 4YLLA 3RK7A 5HO8A 3GCVA 2QD9A 2RGPA 4E6QA 1OL6A 4EBWA 5LVPA 5M4UA 4OUCA 3W8QA 5M06A 1Y8GA 4IDVA 2R3HA 2C3JA 3EN5A 3FC1X 4BTMA 3IW6A 3OY1A 1PMUA 3UODA 3LOKA 1DI8A 2OJ9A 1REJA 4D2TA 1ERKA 3F2AA 3DS6A 4OBOA 1GIIA 2HZ4A 3QHWA 5GZ9A 2J4ZA 4GKIA 5TR6A 4YZNA 1R0EA 3CC6A 4F9CA 2FVDA 3EFWA 3O23A 5L8KA 5E8SA 3TJDA 2PUNA 3QRTA 1XH6A 2OJIA 5L2QA 3RAWA 1WBNA 3Q60A 3WZDA 4KKEA 4RPVA 4JAJA 5JGBA 5FLFA 3WZUA 1JVPP 3C9WA 3EN7A 3W1FA 2Y6MA 5EI8A 4O38A 3SKCA 3MVLA 4AU8A 3MVJA 4FNWA 2I0YA 3RJCA 3LE6A 4CFMA 1OBGA 4FT5A 3QUEA 3TV7A 4C4GA 4M15A 2ZVAA 3O8TA 5CTPA 5K9IA 3ZEPA 1Q41A 4YR8A 5CAOA 3MIAA 4O81A 3SG8A 3V6RA 5CEIA 3GC0A 3SOAA 3W55A 3ODYX 2C6LA 3MH0A 4ZJJA 2GS6A 3RHXA 3GP0A 5DHJA 1I09A 4I6HA 5CAVA 4FKQA 3KU2A 3TEIA 3IO7A 3PJ2A 3AC8A 3DZOA 5H8GA 4TL0A 5JRQA 4EWHA 2YZAA 3GNIB 4ACGA 3AMAA 2C5YA 5KMNA 2RFSA 1DAYA 5A3XA 4PDOA 3ET7A 5AP5A 4QTAA 4ITHA 4BCIA 2IZSA 4RJ7A 3G9LX 2C5VA 4HCTA 2IZRA 2R3KA 2HOGA 3PZHA 4IACA 4KS8A 3ZH8A 1YWNA 4MNEA 2XM8A 3DU8A 3Q4UA 3LMGA 4RX7A 4B8MA 1ZAOA 4KSPA 3G15A 1CDKA 5L2SA 4NFMA 4MXXA 4UZDA 4A7CA 4PX6A 4TZRA 3A7HA 3ZMMA 2C68A 4RLLA 5HU3A 3RTPA 2V7AA 5J9ZA 2O65A 4O7SA 2PPQA 3BV3A 2J9MA 4MCVA 1XBCA 3QBNA 2R5TA 4O1OA 4YZ9A 3PPJA 3DCVA 3UVQA 4D5HA 3LZBA 4IJPA 2EB3A 4R5SA 2G1TA 3I5NA 4AT4A 4DFXE 3BELA 4YTCA 2WU6A 4BRXA 4W4XA 5ANIA 3VN9A 4BDDA 2C5NA 2CHLA 2UVZA 3LAUA 3OW3A 4PL5A 3Q5ZA 2IO6A 4FTNA 2XK4A 5DEYA 3BIZA 3BHVA 4CT2A 2CPKE 3F7WA 1MQ4A 4P90A 4BL1A 4X0MA 5KMMA 2KTYA 4H3PA 3WARA 4BDFA 4XLIA 2B53A 4JG8A 4A9UA 1B39A 3BYOA 4YLJA 3OZ6A 3C4FA 2YWVA 4L9IA 4EOQA 4FKVA 3TUBA 2ITTA 3FPMA 4GG7A 2IW8A 3UOLA 3ZONA 4H1JA 3Q32A 2ITNA 4BDKA 5K0KA 4BCMA 4EUUA 2CSNA 1FVRA 2Z7RA 3EYGA 4FT7A 4LGDA 4U9AA 3TKHA 3TZ7A 4U80A 4OAVB 2ITYA 3C4WA 3QKMA 2PVJA 3KB7A 1FOTA 1OB3A 2WMQA 3HA6A 5CEPA 3ZSHA 2HENA 4R3PA 2QNJA 4I4FA 1TQIA 2A0CX 2O0UA 3FZTA 4RJ3A 4ZTLA 4BDJA 4D5KA 4EHEA 5JSMA 1S9JA 3KY2A 1FMKA 3BWJA 3IW4A 4CYIA 1E9HA 2ZM3A 3IW5A 5CZIA 4CZTA 4BR3A 4AN3A 2YISA 5GIOE 1OPLA 4PL3A 4HPUE 2Z7LA 3VBYA 3C5UA 1UWHA 4S32A 4C2WA 1SMHA 2YM5A 5FEDA 5AP0A 1YXUA 5A4EA 4R78A 3IOPA 1KV1A 4C57A 5IDPA 5EDRA 4C7TA 4E6AA 3OMVA 4WBBB 5KMKA 4BBFA 5FEQA 2JEDA 3QTUA 5JFSA 3WF7A 3PE2A 2PSQA 3GOKA 5LWNA 3OEFX 1CTPE 3D2KA 3LFNA 5F95A 3RBWA 4ZY5A 3EQGA 2W7XA 1E1VA 5EM7A 3QXPA 3Q4CA 3HVCA 4TYHA 3JPVA 4ZLOA 4IJ9A 2G2IA 1QPJA 3ZO3A 2CNUA 3NS9A 1RQQA 2Z02A 4TYEA 2Q0BA 3CIKA 4M7IA 1NT2A 4EH3A 2OFVA 2XEYA 4YJVA 4DEDA 3CEKA 4JQEA 3LFEA 4PMMA 4WUAA 1OMWA 4NH1A 2WTVA 3G0EA 4J96A 1Q4LA 3NUYA 3PFQA 4KIKA 1XH5A 1FBNA 3AT2A 2O63A 2ETMA 2WMRA 2BRGA 4PPBA 5EM5A 4XEYA 4BDHA 2PYWA 2XRWA 3QTSA 4KIOA 4LOQA 4DH3A 1VJYA 4H1MA 1H1RA 4IM2A 1XQZA 4WA9A 2JDTA 2OU7A 3EL7A 3P7AA 5TE0A 4EH2A 4TNDA 2XZSA 3SAYA 4QYFA 3ETAA 4OAUC 2RKUA 5IUIA 3BQRA 3MDYA 4RT7A 3QWKA 3OEZA 4L6QA 2OI4X 4QMOA 5AFVA 3QL8A 2QQ7A 4I1ZA 3GU6A 4PTEA 4ALWA 2XCKA 3TCPA 4CV8A 3QXOA 3T3UA 3EHAA 2PVYA 5HEZA 1Q3WA 2JKOA 1PW2A 2RL5A 4FKPA 5BMMA 3W8LA 4C4JA 4O1PA 1G8SA 2YM3A 2JITA 4J1RA 4OTPA 4O6EA 2C30A 5E92A 4ZJIA 2XNBA 3ZLYA 2EUFB 3GFEA 3KVXA 2WTDA 3DB6A 2IWIA 5DRDA 2Y6OA 3A7JA 2CKQA 4NL0A 2BDJA 1IR3A 3NNWA 4AGUA 3GU8A 4RRVA 4O84A 2ETKA 3AGLA 2B0QA 2I0HA 4USEA 4FKGA 3NNUA 1IG1A 4HCVA 3P9JA 5DRBA 5HTCA 4UYAA 4KINA 1KUTA 2VTSA 4RC2A 4IB1A 2QOFA 3UO4A 3GVUA 2IN6A 3H9OA 4FODA 5DPVA 1YOMA 4F0IA 4JRVA 4X3FB 3PP0A 3U9CA 4EEVA 4DE4A 3DK6A 1Q8TA 2R9SA 4GFMA 4NEUA 4OT6A 3OUKA 2YACA 3LQ3A 3FQHA 4MVFA 3TL8A 4EZ3A 2YIYA 4IC7A 1FGIA 2C6IA 3AMBA 3F3ZA 3MY0A 3Q4ZA 4TYHB 5EOBA 5AEPA 3HP2A 2O8YA 2UZOA 4FTQA 3P4KA 4IX4A 4RIXA 3SDJA 3POOA 5I5ZA 5JZNA 1HCLA 1K9AA 3TWJA 5HBJA 3S1HA 4CMOA 4FGBA 4MD7E 4O86A 3SXFA 5D11A 4J7BA 4W4VA 4XOZA 2NRUA 1U5RA 2Z2WA 3VBWA 3B8RA 2R3QA 1DM2A 4CXAA 1PKDA 4EC8A 5CI7A 3EQFA 4KIKB 4U97A 2WD1A 3R04A 5FBNC 3SD0A 4RIYB 4U3YA 3O96A 4ANLA 3ZO2A 3FZRA 5IH5A 4KABA 3HA8A 4EKKA 3UIBA 1ZOEA 1STCE 4IVBA 5HGIA 4MXZA 3VS7A 4ZTMA 3I5ZA 2OXDA 3UNZA 4TWPA 3P08A 4ANQA 3Q9ZA 2PE2A 3ANQA 4ACMA 4CVAA 2GNFA 2XP2A 4I3ZA 2XK7A 2X7FA 2R7IA 4DG2E 1FMOE 4C4FA 3HV4A 4HPTE 5AR3A 4GIIA 1NW1A 2XB7A 2BKKA 4BIDA 5IQDA 4QMQA 4QO9A 5AWMA 2ZAZA 4CQEA 3IDPA 4UEUA 4UN0C 4OLIA 1L3RE 3EFLA 3QC4A 3P78A 1ZRZA 4FTCA 3HEGA 4QD6A 5HD4A 4FX3A 3TKIA 1O9UA 2P4IA 3RCJA 4ZIMA 1M2RA 4E7WA 5HLPA 3QTXA 3BU3A 4G5JA 2EXCX 2JKKA 5HQ0A 3PSDA 4AQCA 4A4OA 3ORMA 4QMZA 5DMZA 1RE8A 2HW6A 3LCOA 3OWLA 3IK3A 2QI8A 5FTQA 1GZKA 1O6LA 2BDWA 4AACA 4E1ZA 3QYWA 4FL3A 5JMSA 2BZHB 3WE4A 3ENHA 4J99A 3LW0A 5CSPA 1I44A 2BCJA 4FL1A 4FV9A 4JXFA 3MA6A 3VHKA 5IISA 4FKOA 4FNZA 1W82A 2YLFA 3F7ZA 2OBJA 5ETAA 5EW8A 3D2IA 2F7ZE 2QOKA 3WF8A 3EB0A 4MWHA 5IQGA 3P79A 1Q3DA 2R3OA 4W4WA 5M53A 2OFUA 5L2TA 4APCA 4HGTA 4NKAA 4BHZA 4XYFA 3P5KA 4M69B 2X39A 3TV4A 2ZM4A 3QCYA 1XH4A 4GSBA 4U40A 4ACHA 4Z7HA 4RIXB 5TO8A 3G5DA 4F1OA 3D9VA 1J7UA 3VHEA 3QD4A 3VC4A 2PZ5A 4CG9A 4AAAA 2WTKB 1UNLA 3SQQA 4BTFA 4U6RA 4L3JA 3ACJA 2C69A 3UBDA 5BYZA 3L8PA 5IEXA 4HNIA 3PWYA 4FF8A 2YERA 5AMNA 3VIDA 4D1ZA 5JFXA 3LKMA 1WMKA 1WVXA 3RNIA 3VBTA 2HZNA 1OECA 2XMYA 4RBLA 1M14A 1KE7A 1YVJA 4N70A 1KE8A 5KZIA 1Q8WA 3FLSA 4I5PA 2HCKA 3GC7A 3NX8A 4Y5HA 4EH5A 4UB7A 3FKLA 3UJGA 4L3PA 3R1QA 5HTBA 2WIPA 5ETIA 1PMEA 1XHAA 3LXNA 2CGUA 1W83A 3CTJA 3MJ2A 4G6LA 2YIWA 5EYMA 4BCKA 3MH2A 4F99A 2XBAA 3FLZA 2WTCA 4YTHA 4A07A 3UPZA 3DBFA 4FTMA 4M84A 1VYZA 4IB3A 4JG6A 2GHGA 4ZZNA 3U6IA 2G2FA 1OL5A 4GIHA 2GPHA 3GBZA 3R0TA 4O91A 2UZNA 2CJMA 4OTFA 3HYHA 3Q6UA 4GCJA 3B8QA 5DT3A 3R7EA 3HMOA 5GJFA 4D4VA 2WFYA 4EZ7A 2J0LA 5FXSA 1ZARA 3BLHA 3VS5A 4U79A 5J1WA 2EVAA 4I20A 3POZA 2UW4A 4C38A 4F0GA 3BZ3A 4S31A 4W9XA 4RSSA 4Z9LA 4FKSA 2YM7A 4QTDA 5CX9A 4DFBA 4R7HA 5DWRA 3VNTA 4XCUA 2YCFA 3UZRA 5DH3A 4FSRA 4FNYA 4AOJA 1F3MC 4E5AX 4K77A 5DNRA 3PIYA 4L68A 1AGWA 5DFPA 2BUJA 3THBA 2JKQA 3BYSA 4DF3A 4QOXA 2LGCA 3H4JA 5HVJA 1YOJA 5I9VA 5CEKA 4I93A 5I3OA 4AZTA 4UMQA 1YRPA 1TQPA 2QG7A 4G1WA 3LFFA 4JS8A 5M55A 2A2AA 4CQGA 4C0TA 2C0IA 2JAMA 3MPAA 3V5PA 5F9EA 3TZ9A 2VTAA 3QU0A 4DHFA 3LM5A 4Y95A 4AN9A 2JKMA 2FO0A 1KOAA 3VS4A 2OK1A 4GFGA 4PTGA 5KHXA 2A19B 2ITVA 4PL4A 4FT0A 2VO0A 4ERKA 1JQHA 3DFCB 3U6JA 5EOLA 5CQWA 4BWXA 3CR0A 4EK8A 3TIYA 1BKXA 2CCHA 4QP2A 2X2KA 4GU9A 3NUPA 4NT4A 4XX9A 3BBWA 4PRJA 2G9XA 1XH7A 4IAFA 5F20A 4UX9A 5J1VA 5GIPE 1J1CA 3HMMA 4NIFA 3ZXTA 3OCBA 5LQFA 2XNGA 5GZ8A 3RWPA 2BHEA 1IAHA 4MF0A 4BCOA 3ZC5A 4YNOA 3R8VA 3QQKA 2XJ1A 4EJ7A 3QRIA 3U4UA 5L8JA 2WMXA 3IDCA 2W5HA 2QOHA 4YPSA 4D2VA 3R8MA 5M44A 4QMYA 3ZEWA 4X2FA 4L42A 2LAVA 4FIIA 4FTRA 5C26A 4O7RA 5EQPA 5HORA 4RIWB 2JIIA 3R63A 4A9SA 3JY0A 2C0TA 2CGVA 2XK3A 1OIRA 5CANA 3T9TA 1OM1A 2C6TA 2FA2A 5E90A 5A6OA 2XBJA 4FKUA 3ERKA 3FI3A 3R71A 3KXHA 5TF9A 4F6UA 4NUSA 3FPQA 2OH0E 4FKTA 2UW5A 3BE2A 4G3GA 3AD6A 4IDTA 4TW9A 4AZVA 4FG7A 5CAQA 4JBOA 5BYLA 5AIRA 4DLIA 1WBOA 3O17A 4K18A 4I94A 3UO6A 3QTIA 1Q24A 3E62A 2X6EA 4WBOA 3DTCA 1V0BA 4AW0A 2R3FA 5I9YA 4S34A 3UMWA 4GYGA 3ZSIA 2W4JA 1OL2A 2R3LA 4YJPA 4Z55A 4WNOA 5LCJA 4II5A 5LMBA 4PP7A 1XKKA 3MW1A 2R3GA 4PPAA 3ORZA 4FTJA 2YFXA 1KOBA 4G9RA 1P14A 4XRJA 4YPDA 3PP1A 2XYUA 4EOPA 2VX1A 5HO7A 2QO7A 3WYYA 3KCKA 2JBPA 3N9XA 4ERWA 3P1AA 4GK2A 3EQBA 3OP5A 3KCFA 4FSWA 3FAAA 4NW6A 4FSMA 4BBEA 2PVRA 3DNEA 4KWPA 4USDA 4YNEA 2UW9A 4GW8A 5FDPA 4Q9ZA 1H25A 4WD5A 1ZWSA 4X3JA 5AUYA 5HICA 3QAME 3ZFYA 2P2IA 1SVHA 2RFDA 4JDKA 4V0GA 2ONLC 5HCXA 2WQEA 1A9UA 5C03A 3Q04A 2IVVA 3DLZA 3BGQA 3U87A 1Y57A 5CEOA 1AQ1A 3UQGA 3R01A 2FSTX 3FMKA 4U3ZA 3OXTA 3OWKA 1H1SA 3MY1A 4GJ3A 3NZ0A 3ULZA 2B1PA 2R0IA 3LCDA 3NEWA 4R3RA 2YIRA 3HX4A 3QLFA 4C4HA 3UC4A 3IDBA 1XH8A 1ZOGA 2HY0A 2JD5A 1VR2A 3AC3A 2R64A 3F2NA 3OOMA 4FT9A 4PY1A 4YZCA 4UMUA 1H8FA 3GXLA 3HL7A 4ZEGA 4C36A 3L8SA 4B9DA 3I6WA 3ZM9A 4U44A 4XJ0A 3RNYA 4QYEA 1Y91A 5T3QA 3A8XA 3TM0A 2RG6A 3K54A 2YN8A 4CFFA 2QHNA 3A7GA 2GNLA 5E8UA 3VRYA 2C6DA 4FSNA 3D5WA 4E26A 5C8MA 2GQGA 5IZFA 2AYPA 3PE1A 3IGGA 2WMBA 3KKVA 4KS7A 4F08A 3GENA 2GNIA 5HX6A 3I79A 4QYHA 1W98A 4UV0A 2H8HA 2I0VA 5KZ0A 2ZMCA 4O2ZA 3DZQA 4N6ZA 4FR4A 4GMYA 2X81A 3QUPA 2QHMA 3R22A 3WF6A 4TWOA 4M68A 2WQOA 4EZ5A 4KIQA 4HOKA 1PHKA 1OKVA 3FXWA 4FZAB 4IX3A 5FQDC 3F66A 1U5QA 2J0MB 1OBDA 4EC9A 4DBXA 4YJTA 3DNDA 2Y4IC 3ITZA 4CYJA 2R3RA 2XIYA 3UC3A 2VRXA 3D7TA 4YHJA 3V8SA 3V8WA 2DWBA 2XK8A 4AW5A 4U41A 5HOAA 4ONAA 4PQNA 5FM3A 4O0YA 4PMPA 3OBJA 2W1CA 2YDKA 1YWVA 3U51A 4C33A 3NCZA 1YXVA 4J97A 1PYXA 1ZZ2A 3H9RA 4RC4A 4RLKA 5C27A 5M57A 5BMSA 4R6VA 4BFMA 3SW4A 4QP4A 2WZJA 3FJQE 4EOIA 4IZYA 4RWKA 4YJRA 4N6YA 3VUHA 2GS7A 4OTDA 2BPMA 2QVSE 4IH8A 4EOLA 4KBCA 4YC6A 5CYIA 3C0HA 4DGNA 4ZP5A 3E7VA 4QP8A 4ITIA 2AUHA 5HO6A 2E9PA 3R1SA 3NR9A 5JFWA 4DFNA 5A9UA 5EHLA 1WCCA 5LMAA 4CRSA 4BN1A 4G3EA 3I1AA 4O0WA 2HXQA 2X4FA 2OIQA 3E87A 5AX3A 2WELA 3FZPA 4ZAUA 4O7VA 1YXTA 2I6LA 5A4TA 5FUTA 1PJKA 3MV5A 3M11A 2UZEA 4HNFA 2XH5A 2YLEA 2J51A 3BKBA 3GC9A 4CCUA 3NW7A 3PY3A 1UU7A 4PMTA 4QMVA 4MEDA 3ROYA 1R1WA 2ACXA 5J5TA 3PDTA 3V5WA 5D10A 2BR1A 3L9PA 3U6HA 1JNKA 3DDQA 3HMPA 3QTRA 5TT7A 2XUUA 1H1WA 4UMTA 4ZMEA 2RG5A 3LXPA 2VUWA 3OD6X 3D14A 3OF0A 5G1XA 2G15A 1M2PA 4AT3A 4EH6A 5B2LA 3HMNA 5DN3A 5AUVA 2X9FA 3GOPA 4MK0A 4CEGA 3UP2A 2J2IB 1SZMA 3PRFA 4DFYA 4PDPA 2X9EA 4FV0A 1H28A 2OZAA 5EDPA 3DK3A 4AOTA 2HYYA 3KMUA 1KSWA 4YBJA 4PPCA 3CTHA 4HVDA 3PXYA 2B52A 4RVLA 4QMNA 4ANBA 5C4LA 1JSUA 3EN9A 4BZOA 4ZTNA 4L53A 3ID6C 3CY3A 2Y0AA 3GB2A 4JBQA 3D4QA 5FG8A 5CEMA 3ATTA 4FG9A 3UIUA 5AIKA 4UXLA 2QLUA 4I5CA 3C13A 4FIJA 3SW7A 3ZC6A 2DQ7X 3SLSA 2QO9A 4KNBA 4A9TA 3DQXA 4DTKA 4D2WA 5B7VA 1RJBA 2CKEA 3K5UA 4YSMA 5CSXA 3UGCA 3F3UA 1YKRA 3UYSA 1SVEA 2XNPA 1JKKA 2V55A 2BZKB 3IONA 4GVJA 5KMLA 1M2QA 3BYMA 3HV7A 2QOCA 3N4UA 3O71A 5CS6A 3BBTB 4WRSA 3FMHA 5E8XA 3QZGA 1UA2A 1LP4A 1YWRA 4D55A 4GKHA 3VRZA 5B0XA 4GVAA 3W2SA 3LFBA 3NIZA 5H3QA 4HZSA 4QYGA 5DE2A 2HWOA 3EZRA 3DA6A 3H0YA 3WI6A 4JLCA 3WBLA 1Q8YA 4GRBA 3KULB 5ANOA 3WILA 5DR9A 4C35A 4QMSA 3BLRA 2FSLX 4O7YA 2WIHA 3MH1A 3ATSA 5HTIA 3KXZA 4I0TA 3AT4A 4QMWA 5I9ZA 1KV2A 2B7AA 3QZFA 4GK4A 3A2CA 1FVVA 1MRVA 2WMSA 3DDPA 2BRNA 4ZZOA 4NM0A 4YBKA 3DTWA 3ZCLA 2W1EA 4XP3A 5AAFA 3W18A 4BC6A 3L1SA 4BGHA 3ZO4A 3FI8A 2WTWA 3QTQA 4D9UA 3AC1A 4XV2A 3MFSA 4RMZA 4M13A 1Q99A 3JS2A 1FVTA 4G17A 4KD1A 3BQCA 4J71A 2IPXA 3HAVA 3CPBA 3MSSA 2XKEA 3VBVA 4ASDA 3FY2A 4R8QA 4AW2A 3FC2A 3ZHPC 3CSVA 4IFGA 5F94A 4BDIA 3N4VA 2BTSA 5FP5A 4IB0A 2YM6A 2XKDA 2ZV7A 1WVYA 2JLDA 4F9YA 2VGPA 5IEVA 3LHJA 4O0TA 1VZOA 2ZDTA 2NRYA 1BLXA 3R7UA 2BILB 4R7IA 1ZLTA 5C9CA 4EL9A 3DXNA 3QD0A 3R8PA 4CGAA 1J3HA 2GHLA 2VTIA 2ZDUA 1ZMUA 5DA3A 5E8VA 4PTCA 3RCDA 4HW7A 4DT8A 4E4XA 5C4KA 5E1SA 2VTJA 3VS1A 3LM0A 3SGCA 4FICA 2VTTA 4M12A 4BKJA 5E1EA 1KE6A 3KRXA 2J50A 3IQ7A 2HIWA 3FL4A 3FLQA 4ZSJA 4S33A 3VJNA 1ZYDA 3PIXA 2VAGA 1GIJA 4H39A 1ZY5A 4IIRA 1HCKA 1NVQA 2QCSA 3FL5A 4BYJA 5K5XA 2F2CB 4DEHA 4E3CA 2YA9A 4CCBA 4MNEB 1J91A 4IHPA 1OIUA 4Z16A 3UP7A 5D7VA 4H3BA 1TKIA 3FMLA 3I7BA 4X2NA 2Z8CA 3ORXA 2CCIA 1Y8YA 2P55A 4LL5A 3TNIA 5EHOA 1TQMA 1Z5MA 4MWIA 5T68A 3G6HA 1SYKA 3R2BA 4D0XA 2CN5A 4KRDA 5KKRC 4QTEA 3MB7A 5AR2A 4HZRA 3WIGA 4C8BA 4FL2A 3ORTA 5CSVA 4A9RA 2PUUA 3A7FA 2OF4A 3KN6A 4DH8A 2VWWA 2J0IA 4DLJA 4EOOA 4UALA 3TTJA 4TWCA 3TIZA 2B54A 2XNNA 4DGGA 3E88A 5L3AA 4LI5A 4C37A 1PXLA 4GT5A 5AV0A 3C4EA 4QQCA 3O8PA 3P0MA 4J95A 4EH9A 4IE9A 1BYGA 3UVPA 3JVRA 2X7GA 2QOIA 4PNIA
chains in the Genus database with same CATH superfamily
1QMZA 4DINA 3NVMB 4I6QA 2UZTA 5EK7A 1GZNA 3WIKA 3ZXZA 4U43A 4H3QA 1NVRA 4N0SA 1W2DA 4FV1A 3P7BA 5EYCA 5HE1A 3CD3A 5CASA 1J7IA 5H8BA 4LYNA 3KRWA 5J7HA 3OT8A 3ZZEA 3NNVA 5IMEA 2VWBA 1ND4A 2UW6A 5KO1A 4RFYA 2ITUA 4FC0A 2UZDA 4XV1A 2BIYA 3O7LD 5DT0A 3DB8A 4GUBA 4WIHA 5HNBA 3L9LA 1SNXA 4AE9A 4L00A 4GH2A 3QQUA 5BV3A 4G6OA 4OBPA 3RVGA 4L44A 3Q5IA 4UWYA 3DKCA 5HX8A 2CKOA 3K2LA 3NAXA 4D4RA 2PMLX 4IBMA 3PLAE 4JJRA 3KRJA 1QL6A 1XWSA 2PE1A 4G6NA 4ZSEA 3A8WA 2VWXA 2OLCA 1XBAA 5C1QB 1Q62A 4O0UA 2DUVA 2JC6A 3A60A 4W9WA 5KNJA 5GJDA 2WPAA 4YZDA 4RVTA 3G33A 1PXMA 4J98A 3RGFA 4ASXA 4EOSA 2WNTA 2YJSA 1CKJA 1IEPA 2HW7A 2XKCA 2QKWB 4JQ8A 3VAPA 5CENA 4ARKA 3O0GA 2BROA 3NAYA 3MYGA 2JDVA 3QD2B 4R7BA 3LIJA 4J52A 3ZBXA 4Y8DA 1H01A 3DLSA 5E7RA 4BBMA 3QLGA 5HIEA 4Y83A 3ANRA 4QMTA 4D1SA 3D5UA 4IZ7A 4KKGA 3UDTA 3E8EA 3NRMA 2YCSA 4K1BA 4RJ6A 4FV2A 1UNGA 3E8CA 2RFEA 5IA1A 4APPA 3A61A 4KRCA 3LFAA 1BUHA 2C6EA 3MJ1A 4G9CA 4G2FA 4X21A 4A4XA 4BWPA 2CNVA 1T45A 5CNOA 5K3YA 4IXPA 5JKGA 3TUCA 2YWPA 1XBBA 4IZAA 4B0GA 1KWPA 4C3PA 5D7AA 3S2PA 5M4FA 2WEVA 3LFDA 5C01A 5EHYA 4CTBA 1PYEA 3PVBA 4D2SA 2J7TA 2PZIA 5IH6A 4EK3A 3QKLA 4DHZA 3JXWA 4FI1A 4AF3A 4DGOA 4U0IA 2XF0A 3PSBA 3S0OA 3LJ1A 1IRKA 2BRHA 2XK6A 3CQWA 3LVPA 2VGOA 1UU3A 3IW8A 1V0PA 4YJSA 3E93A 4FYOA 3CLYA 2GTNA 1JKLA 5BX0A 2YIXA 4CZYB 3UVRA 3NUUA 3CD8A 4G3FA 4RJ5A 3GQIA 3MPTA 3PWDA 3QCXA 4FOBA 4FTOA 4PF4A 1LUFA 1PXOA 4EQMA 2GFSA 1DAWA 3G0FA 3Q53A 2GNJA 3GCPA 4YC3A 4AGWA 3R8UA 5AX9A 5HE2A 4GFOA 4FGRA 2UW7A 1CSNA 1G5SA 1IAJA 2VTQA 4YZMA 4O7NA 5AUUA 3C0GA 2VN9A 4RGJA 2HY81 3ORNA 5HVYA 3SXSA 4F64A 4TYGA 4ZLYA 5B2MA 3RK9A 4NM7A 1QPEA 4EYJA 1RDQE 4RFMA 2C0OA 2ONLA 3DJ6A 4E93A 2PMIA 3NLBA 3OWJA 4R1YA 4YHFA 4U42A 5AADA 1LEWA 3UDSA 2FH9A 2VX0A 3F3TA 3PY0A 1ST0A 4HVIA 3UG1A 5EKNA 4IVAA 3IOKA 3U54A 5FRIA 3VUIA 3E7OA 1KE5A 3MTFA 4I23A 3BLAA 2CKPA 4FIFA 4CZUA 5IG1A 4BY9E 4NYEA 4ID7A 5BVKA 3FHRA 2W5BA 3EQDA 2Z60A 4D2RA 3PUFC 2W1FA 3LMHA 2P3GX 3RM7A 3EMGA 4USFA 1XO2B 3QALE 3PY1A 4E4LA 3MBLA 2V62A 4GEOA 1OPJA 4AE6A 4FEUA 3NUNA 4M97A 5CLPA 3H10A 1IA9A 4GL9A 2BDFA 4AZFA 5AP2A 4PNKA 1ZMVA 3TACA 2QOLA 3TKUA 2WOUA 3QZHA 3E64A 4HYIA 3CE3A 3OROA 4RC3A 5BQ0A 3OBGA 5BVDA 5A46A 3WYXA 4Z7GA 4BCHA 3V6SA 4MKCA 4NK9A 3CY2A 4RQVA 4MF1A 4YTIA 2BAKA 1O6YA 3TDVA 1QCFA 4FKLA 2CNQA 5HESA 2WAJA 2FSMX 1PXKA 4FNXA 3F2RA 2R0UA 5HG8A 4FRFA 4KBAA 5FD2A 3RPRA 3QUDA 3SOCA 4X2KA 4L46A 3FHIA 3D15A 2OW3A 2QONA 4R3CA 3TJCA 2JDRA 2QR7A 3KF4A 1MP8A 5I4NA 4BCNA 1P2AA 2RFNA 2Z7QA 3QX2A 4TXCA 4O7LA 5HE0A 3HRFA 2QO2A 4I5HA 3OCGA 2XVDA 2O3PA 3ROCA 4GYIA 4XMOA 5IA0A 3SA0A 3RAKA 3DXQA 4YZBA 2GNHA 4UWBA 3RPYA 2QOQA 4TRLA 3OXZA 4I24A 3WOWA 4OBQA 5AP4A 3SG9A 4FSUA 5CSHA 2OJGA 4Q5HA 3AKLA 2ESMA 2Y9QA 1W0XC 4M0ZA 4FVPA 2C5XA 4G3CA 4MYGA 3MESA 4KB8A 1OPKA 5ANDA 2UVYA 3II5A 2C1BA 2GU8A 3OT3A 3EIDA 4RA4A 5L6WL 3RPSA 3PA4A 5A6NA 5J9YA 3DBQA 4QMUA 5AV2A 3RWQA 5KUPA 2YITA 4JT3A 2XRUA 5D9HA 4K0YA 4ASZA 3VBXA 4FVRA 3PA3A 5IH4A 4MD8E 4DITA 4I5MA 5M56A 1H24A 2FSOX 2Y7JA 3DKOA 3PVWA 3LLTA 4EJNA 3BGPA 4RX5A 2X8EA 5AA9A 3ALOA 3NYXA 1K3AA 4F0FA 2B4SB 3ODZX 4NJ3A 4KIPA 4B8LA 2F2UA 4CSVA 4NM3A 2W96B 5IF1A 3PTGA 1OKYA 2ZM1A 1U59A 1YDSE 2C6MA 2WTIA 2YM8A 4GK3A 4ZTSA 3R9OA 1H0WA 3WF5A 3QHRA 3KA0A 2A1AB 2PTKA 2B9IA 4NU1A 4QPSA 5L6OA 3HZTA 3OUNB 5AV1A 2CMWA 4LV5A 4UY9A 3ZUUA 3UQFA 1L8TA 2H96A 5CF6A 3D5VA 3R9DA 3RZFA 3PA5A 3LCKA 4PDYA 4Y85A 4WRGA 4FTIA 1W8CA 3R02A 4RJ8A 3VWAA 3NDMA 2YCQA 4QP6A 3JY9A 1Q5KA 4MX9A 4O7WA 4EOJA 3CKWA 3EQRA 3D0EA 3PG3A 4LUEA 5HCYA 5JH6A 4XG9A 4AGCA 4QEBA 3G2FA 3JUHA 4GV1A 4QQTA 3DT1A 4I0SA 4JDJA 5DIAA 4CFWA 1Z57A 4AFJA 3MI9A 2ZFYA 3FY0A 4XG7A 4F7JA 4IX6A 2V0DA 4FSTA 3BRBA 4P4CA 3SX9A 4BZDA 4YP8A 3MFTA 2JGZA 3F5GA 4Y72A 3F82A 4HVHA 2A98A 5CVFA 4IMYA 4BYIA 4BI2A 3AD5A 5CU6A 1XR1A 4O27B 4OTGA 5AP7A 2OJFE 3BEGA 3OTVA 4NJDA 4NSTA 5FTOA 3CKXA 2JIVA 2X0PA 2Y4IB 3RAHA 3SVVA 2XNOA 4M3QA 4IAAA 5M07A 3OXIA 5HLNA 3ZYAA 2GSFA 2DYLA 4BGGA 4MQ1A 1BL7A 5CWZA 3PXRA 4BI1A 1CM8A 3MFRA 2WXVA 4I92A 1Q8ZA 2HAKA 3ZO1A 4B99A 3AG9A 3FMEA 4FV4A 4FEWA 3D5XA 3E8DA 4KAOA 5AUWA 4BIEA 1OUYA 3UDZA 4NWMA 2CGXA 3RM6A 4EOKA 4EK5A 4QNAA 2PMNX 3BU5A 4E4MA 3OW4A 4O96A 4I22A 4DFLA 3QD3A 5ANKA 4BHNA 3NCGA 4IVCA 3NGAA 5D41A 4O22A 2GQSA 4MHAA 2QLQA 3A99A 1K2PA 4UMRA 4BDCA 2QU6A 5K0XA 4YURA 2H9VA 3I6UA 5FBOA 4XBRA 2WOTA 4QP9A 2YCRA 3KXGA 4WNKA 1M17A 2BRBA 3NNXA 5CVHA 3TXOA 4C3RA 4F9AA 4ITJA 2VWVA 3COIA 5FWKK 1GZOA 3QZIA 4DDIA 3FZSA 4NZWB 1UNHA 4CKIA 2IW6A 5AR4A 5LARA 3OY3A 5AJQA 4GG5A 4YJQA 2W9ZB 2E9UA 4EHVA 3BHTA 5IA3A 3Q3BA 1BL6A 3FSKA 1GY3A 2IZTA 2UW8A 3GQLA 5DG5A 5JFVA 2PULA 3WZJA 4RJ4A 3HAMA 3FMDA 4ALVA 4F09A 5M51A 2HWPA 4AG8A 2IG7A 4FTAA 4ZMFA 1BX6A 2OGVA 1R0PA 2BZIB 2XNEA 4AP7A 4C62A 3FKOA 4W8EA 4L3LA 3LFCA 5AA8A 3FDNA 4YC8A 3NPCA 3HGKA 3ZDIA 2OJJA 1IA8A 1R3CA 2PK9A 4AFEA 2PWLA 1JOWB 3E63A 4R5YA 3MWUA 5HG5A 4WG5A 2BAQA 2ZV9A 4EWQA 3AMYA 2GFCA 2WMTA 2VV9A 4RX8A 4F9WA 4TY1A 3S95A 4XS2A 5AP3A 1ZYJA 2GQRA 5KCVA 5DGZA 5DR2A 5HHWA 3WE8A 4DG3E 5LMKA 2W1IA 3ZM4A 5J5SA 4NIFB 1YQJA 4JL9A 2GMXA 4ACDA 5EI6A 5EKOA 3GC8A 4ANOA 3Q9YA 4JOAA 2XIKA 3V5JA 1X8BA 4CFUA 2P0CA 2XS0A 1WAKA 4S30A 4PDSA 5LVOA 2W4KA 2WEIA 3BX5A 5IKWA 1MUOA 3RP9A 1ZXEA 4F6SA 4KKHA 3C4XA 1YDRE 1PXNA 3U8WA 3OTUA 4FYNA 2A4LA 2REIA 2XKFA 4G3DA 4RVKA 4LRKA 3MA3A 3QRKA 5BUIA 3TYKA 5A14A 5DLSA 3I60A 2OIDA 1A06A 3FZ1A 5CT0A 2IJMA 3I0OA 4ZTQA 4BCQA 5HIDA 4BDEA 4O82A 3EKKA 1URWA 5KMOA 1H1QA 3KXXA 3LJ0A 4U7ZA 5EM6A 1YXXA 2B55A 3G6GA 3TZMA 1REKA 3VF9A 5CXZA 2NNWB 4MXOA 2OH4A 3R7YA 5E8ZA 3PFYA 2R3PA 2EXMA 4H36A 4QMMA 5FM2A 5ACBC 2EU9A 4QT1A 1YI4A 4A06A 1GOLA 2QOBA 3D7ZA 5BVFA 3GCUA 4FA2A 4BF2A 4FOCA 4EH7A 4M67A 3W0NA 4DGLC 3B2WA 3D94A 2AQXA 2ZYBA 2X2LA 2YIQA 5KE0A 3VUGA 2IVSA 3TZ8A 2O2UA 3R83A 5JZJA 2I7QA 4IADA 3ZLWA 4QMLA 3MS9A 4X6RA 4C58A 3KGAA 2R7BA 3H30A 3RK5A 3KVWA 3UMXA 3BU6A 4CFXA 5ITAA 4ENXA 2ZB0A 3SXRA 3DV3A 3EQPA 3HUBA 4JG7A 2BFYA 2JDOA 4LMUA 1JKSA 4QP7A 2WMUA 4OR5A 3ZRKA 5FXQA 4EUTA 4Q9SA 3U4WA 5L8LA 5CI6A 1F5QA 4MBJA 3AD4A 4K9YA 3PXKA 2V5QA 3OCTA 5D1JA 4AXEA 2H6DA 2AC3A 3DFAA 3QCQA 4QPAA 2YDJA 1CMKE 4AT5A 4IWDA 4V0GB 2BALA 4BDBA 4F6WA 3ALNA 4JBPA 2X0OA 4MH7A 3VUDA 2OICA 4MD9E 5JQ5A 5IPJA 1OKWA 4FV6A 4XG3A 4MXCA 5DEWA 3LQ5A 1F0QA 3TG1A 2XIRA 3V5LA 4E6DA 4I41A 3AGMA 1NVSA 2AC5A 3C5IA 3TNQB 1YW2A 4OGRA 3IW7A 4PWNA 4CKJA 2ITWA 4AZEA 3EWHA 4BKZA 2OSCA 3OFMA 3KC3A 4I0RA 1R39A 4K33A 5AV4A 3ZDUA 5CF8A 4FKJA 4RWLA 5L2WA 5T6KA 3RZBA 5AP6A 4ASEA 2VWIA 2FUMA 3ORIA 4G31A 3LQ8A 3VS2A 4RG0A 5A4CA 3QX4A 4RA5A 1M52A 4N4SA 5M4CA 2WGJA 4FUXA 3QGWA 3LPBA 4HYHA 4JIKA 2NPQA 2UW0A 5CQUA 3R7IA 2BRMA 2P2HA 4EI4A 3E3BX 5CT7A 5KKRB 1VEBA 4IM3A 2J0JA 1QPCA 5J7BA 2Q83A 2E2BA 3GU5A 1JBPE 3MVMA 5CU4A 1KE9A 3PJCA 3FI2A 2R3JA 3PRIA 4AA5A 4HGSA 1OKZA 4FV8A 4X2GA 1DS5A 4O0XA 3GEQA 4IEBA 3P23A 4TPTA 2UW3A 5LCKA 4AOIA 4EOMA 3PLSA 3G9NA 4DHIB 1P5EA 3KN5A 1OITA 2PUIA 4XG4A 3CJFA 2R4BA 5EG3A 5BVEA 3FMMA 2W5AA 5EM8A 3UOJA 2BTRA 4JR7A 3UQCA 4J53A 4DEIA 3CXWA 4DT9A 3EQIA 2C6OA 4F1MA 2XK9A 3QWJA 5HE3A 3HDMA 4EORA 3D7TB 1U54A 3FKNA 3PXQA 4JX3A 4DC2A 3AKKA 4UXQA 4LMNA 4O4CA 3RINA 3QQHA 4BTKA 1E1XA 4QMPA 3L9NA 3R2YA 3BYUA 1LR4A 3VJOA 1PMNA 4IB5A 4XG6A 4ACCA 1H08A 1RW8A 3RI1A 4X2JA 3UPXA 4J8NA 3T3VA 4YU2A 2ERZE 4FSZA 3VUMA 5KHWA 3UO5A 1WVWA 5M09A 4AZWA 4LGGA 4U8ZA 4JAIA 2C3KA 2VNWA 2PZYA 2UZLA 2WU7A 5ANGA 3QQLA 3EOCA 5CNNA 4CRLA 5BNJA 1PRYA 3U9NA 4E4NA 3V5QA 3F5UA 3CQEA 2X2MA 3A4PA 3ZS5A 4MXYA 3V8TA 3F69A 3HKOA 2PL0A 3L8XA 3R1NA 4R1VA 5IA5A 3BI6A 4EH8A 3DBEA 3FMJA 5E8YA 2DS1A 4FMQA 5I9UA 3S00A 1FGKA 4RQKA 4EQCA 3RMFA 3C4CA 2ZOQA 4TN6A 3TV6A 4CD0A 4FTLA 4EK4A 3FQSA 5EH0A 3QRUA 3FXXA 1UV5A 4Y5QA 4DN5A 4YGAA 4FTKA 3W2OA 3KK8A 3R73A 3AXWA 2ITPA 2NP8A 4MBLA 1TVOA 3F9NA 4LL0A 5IQAA 3ZLSA 4EH4A 1ZYSA 2J6MA 4K6ZA 4TYIA 3NYVA 2ZB1A 3PVUA 4UBAA 4AUAA 5A4QA 5K4IA 3MY5A 3SRVA 3AT3A 3OWPA 4RZWA 5AR7A 4M66A 5D12A 4CKRA 4D58A 4FTUA 2WQBA 4M0YA 3FI4A 4CNHA 5AAGA 2EWAA 4WUNA 1T46A 3CPCA 5AUTA 1ZY4A 2PU8A 2A27A 2BVAA 4V01A 2OZAB 2PVLA 1UKHA 3QGYA 3LJ2A 4JIAA 3CCNA 2ITXA 3R28A 2ETRA 4FZFB 4Q2AA 3SV0A 4AZSA 4AW1A 1H00A 5K4JA 1Q61A 3UTOA 3VS0A 4FKRA 4IQ6A 5DBXA 3W2CA 4O4BB 1YI6A 2F9GA 3PUPA 3UZTA 3KL8A 5IQEA 2C6KA 3R21A 3TDWA 1AD5A 2W0JA 4QMXA 5H2UA 3IKAA 1U4DA 2B9JA 2XEZA 3E8NA 3ZZWA 5HNIX 4CT1A 4LOPA 5LMKC 5CY3A 5ANEA 3T8OA 4MTAA 3TNHA 1UU8A 4I6FA 3EKNA 4FTTA 5E8WA 2F4JA 3CJGA 4NTSA 3R8ZA 5L2IA 2IVUA 4FIGA 3COMA 2PVFA 4IWQA 1U54B 1G3NA 5GNKA 5HIBA 5TOZA 2CGWA 4GU6A 4JNWA 3UDBA 3VO3A 4B7TA 4BCJA 1OGYA 5C8KA 3Q6WA 1U46A 3QRJA 4L7SA 4O0RA 1BI8A 5AM6A 4AX8A 2Z7SA 3I7CA 2X0GA 1M7QA 5L6PA 1WZYA 3Q9XA 2RSVA 3O51A 5HNGA 4BICA 2X6DA 2VWUA 5I3RA 4X3FA 4A9YA 1OL7A 4ANNA 3TI1A 3CTQA 3HP5A 3NYNA 3VULA 3WF9A 3Q4TA 4C34A 4F1TA 4V05A 1LEZA 2WO6A 5M08A 3W0QA 3DJ7A 4J8MA 3NUAA 3OVVA 3MTLA 4WNPA 1MRUA 4XUFA 4D1XA 2BKZA 5FTGA 3KMWA 2XCHA 3HECA 5BUEA 1H4LA 1GZ8A 2VTMA 3QKKA 4CMTA 3FZOA 2W1HA 3P86A 2X0QA 4TNBA 5LVNA 2CLXA 2XJ2A 3BE9A 3TMOA 4KBKA 4PP9A 2HELA 4DGMA 1NA7A 1CKPA 2C5OA 4FSQA 4AS0A 4MAOA 4AAYA 3FQEA 5JGDA 5ETCA 4U5JA 4ZZMA 2ITOA 2EXEA 4FG8A 3M42A 2X8DA 4BDGA 4WNMA 3PJ3A 2CN8A 4FV7A 2XA4A 3I81A 4RIYA 4NCTC 4ZY6A 1Z9XA 3T9IA 1PF8A 3TUDA 4G5PA 4ANMA 3VF8A 5HU9A 5KMJA 1NY3A 3C7QA 4FZDB 3V04A 4E8AA 4F65A 4BWKA 2XARA 4FEVA 2X4ZA 1MRYA 5J95A 5H9BA 3ZFMA 4O83A 3UOKA 3SRVB 2VX3A 5FXRA 3AC4A 4YO6A 4CMUA 2YM4A 2PMOX 4G34A 4PMSA 4QTBA 4ENYA 5AP1A 1XJDA 4EQUA 3FEGA 3UOHA 3OHTA 3O50A 3OCSA 4U81A 3EZVA 2YHVA 3E5AA 5F1ZA 4F7SA 3W0SA 4JDIA 4MUQA 4FK3A 2QU5A 4YJNA 3V51A 2JFMA 2XIZA 3LXLA 1SNUA 4QPMA 3C51A 3OS3A 4Z3VA 3KEXA 4RWJA 4KA3A 1ZYLA 5AUXA 3ZTXA 5BVNA 3DBCA 3PVGA 5J87A 4DTBA 4KSQA 1YOLA 3W16A 4EBVA 5GJGA 5GHVA 4AWIA 1YDTE 4YSJA 3FXZA 2WB8A 1UVRA 5LWMA 2JBOA 4ZSLA 4AXAA 5M4IA 1R78A 1WBVA 2I1MA 3F5XA 3CQUA 3LFQA 3FYKX 3JYAA 1WBWA 3CS9A 4FZ6A 4YLKA 5I9WA 4IWOA 4XP2A 4NM5A 2QOOA 2XYNA 5KBRA 4BZNA 2GTMA 1OI9A 1EH4A 5IA4A 4K2RA 5JT2A 3N4TA 4XRLA 4O7TA 3QQJA 4D4SA 4HVSA 3SHEA 3BL7A 4XH6A 3A4OX 3ZBFA 1A48A 5B2KA 3LCSA 3WZKA 3UNKA 1LPUA 3IECA 4E5WA 4WSQA 2JDSA 3HLLA 3I0QA 3MIYA 4TWNA 4N57A 3K5VA 4LM5A 4HCUA 3ZOSA 1J7LA 4MQ2A 2PHKA 4E5BA 2G2HA 3NYOA 3COHA 5ETFA 4YO4A 1G8AA 3R30A 4M69A 2E9NA 3EFKA 1GNGA 4K11A 3FLNC 2JFLA 4DEEA 2WQMA 4P7EA 5DR6A 5BVOA 3UYTA 4DFZE 2C1AA 4JI9A 3LMIA 5FDXA 2OWBA 3CGOA 4TKSA 3GU4A 2W17A 4IVDA 3F88A 1Q97A 2F57A 4LRJA 4DH7A 3R8LA 3ULIA 3QQFA 4L45A 4F9BA 2X1NA 3AC2A 3IS5A 4YTFA 4O6LA 5A54A 5CAUA 1UKIA 2UV2A 5AAEA 4E6CA 3S3IA 2J5FA 5JK3A 4L7FA 1J1BA 1WFCA 2E9OA 4F4PA 4ZS4A 3BGZA 2FYSA 3KMMA 3C0IA 4DA5A 1XMLA 5FP6A 3PXFA 2IF8A 4O0SA 2O64A 3G51A 4GT4A 4GUEA 2W1GA 2WKMA 3RPVA 3R00A 2NYAA 3NSZA 2I40A 2ERKA 3ZUTA 3C1XA 3MN3A 1W2FA 3ZRLA 3R6XA 2UZBA 4D4YA 2W1DA 1YI3A 2XNMA 2PZRA 2KULA 4Y46A 4ZTRA 2F7EE 2WMVA 3M2WA 1YHSA 2OG8A 3W2PA 5KX8A 3DAEA 3KRLA 3PPKA 4XG8A 3FYJX 3PPZA 3AOXA 3ELJA 5IEYA 3QYZA 1H1PA 3F3VA 3RAIA 3DK7A 4JQ7A 1OUKA 2VTNA 3PIZA 5CSWA 2HXLA 4AGDA 4F7NA 5AR8A 3VVHA 1NXKA 3H3CA 2OF2A 1SVGA 3UIXA 3KRRA 4D28A 3LFSA 3FMNA 3ACKA 1JSVA 2HK5A 1YHWA 3QQGA 4FT3A 5DVRA 2R3NA 2X8IA 4EHGA 2VO7A 3F61A 4Q5EA 3ZFXA 5ICPA 5BYYA 3ORLA 2OZOA 2P33A 3NW5A 5JRSA 3R7OA 3TT0A 1VLRA 2VO6A 4IAKA 3BHYA 4RVMA 5IUGA 3GCSA 1OIQA 3VS6A 3W32A 4M8TA 3KXMA 3VQUA 2ITQA 4ZSAA 4DYMA 2R3MA 2UZUE 3IG7A 4ZS0A 4WSYA 4MNFA 4D9TA 2ITZA 3DQWA 4DEGA 3E3PA 4E73A 5K5NA 1H27A 4OTWA 2BMCA 3LXKA 4XLVA 4BCFA 4RIOA 2WMWA 4R77A 4O2PA 2PY3A 1GIHA 2BFXA 4L67A 3PJ8A 3UNJA 2IZUA 4ZTHA 2VTRA 3FLYA 4DAWA 4QTCA 3NUSA 4JRNA 4ZOGA 3AQVA 4D0WA 1ZMWA 4IC8A 3JVSA 4CLJA 4I6LA 2VWYA 1UU9A 3EL8A 5J8IA 4L8MA 2QC6A 5IUHA 3GGFA 4WHZA 3COKA 4AA4A 3KREA 1URCA 3EQHA 4HVGA 3BLQA 2VU3A 5CU3A 4UWCA 4OTIA 1OIYA 3RKBA 4D2PA 3HV5A 4EKLA 4FV3A 3K3IA 4JX7A 4RZVA 3QCSA 4TYJA 3RALA 4LOOA 2HZIA 3A7IA 4X6QC 2VTOA 1FINA 1UWJA 2IEWA 4FZ7A 4C2VA 5L4QA 1XH9A 2FB8A 3DBDA 3PXZA 4LUDA 4AA0A 4BI0A 4WKQA 5CXHA 3TNWA 5E4HA 4P5QA 4X3FC 4AN2A 4IAZA 1JKTA 5CAPA 3R7VA 5E8TA 4LG4A 4UYNA 3HUCA 4ZK5A 4DEAA 2XM9A 4ALUA 1V0OA 4EYMA 2FGIA 3V5TA 5DYJA 3DY7A 5GINE 5EW9A 2H34A 4ANSA 4B6LA 2QR8A 4FKWA 1DI9A 4BB4A 3IPHA 2CDZA 5HD7A 4ZY4A 4ZXTA 4FV5A 5GZAA 4RIWA 4DTAA 3TNPC 3VW8A 1ATPE 1QPDA 4LQMA 4XV3A 2GNGA 3GU7A 1BMKA 3DJ5A 3QF9A 3KK9A 4DCAA 2ZJWA 3MH3A 4BCPA 4XHKB 2BZJA 4OT5A 3NUXA 2OO8X 2YABA 1WBSA 2W06A 3Q9WA 3VW6A 1OL1A 3W2QA 5FGKA 5HLWA 3MPMA 2J90A 2YEXA 4IAIA 5KMIA 3DOGA 5F4NA 4O0VA 1VYWA 4DDGA 3R9NA 3FSFA 5IQFA 4FKIA 3DXPA 3RHKA 1W84A 5IQIA 3ORKA 5CU2A 2Y8OA 4U45A 5HG7A 3FV8A 1CKIA 4WT6A 4OW8A 4DH5A 4FE2A 5CF5A 2VD5A 4QQ5A 3R1YA 4H05A 4EK6A 3SC1A 3O2MA 2VTHA 4YJUA 3AC5A 4JDHA 4K8AA 3L9MA 2J5EA 3H0ZA 5CZHA 5LVLA 1Y6AA 3TTIA 3U55A 4QRCA 1JPAA 2I0EA 4LRMA 5E9EA 3HMIA 4TT7A 3DAJA 4QYYA 2UUEA 4OTRA 3HV6A 3MGYA 3DGKA 1MQBA 2X7OA 3CBLA 1BI7A 2OKRA 4QP1A 5IQCA 5IDNA 1H26A 2C3LA 5EYKA 3PG1A 2BHHA 4WO5A 3BHHA 2PVHA 1O6KA 5E91A 4GJ2A 3ZUVA 5JEBA 2SRCA 3TN8A 2R2PA 4KUJA 3EN4A 4FEQA 4G16A 4DBNA 2PVNA 3KQ7A 1HOWA 1H07A 2IVTA 4F7LA 2J0KA 5EDQA 5H8EA 3R7GA 4I4EA 3MB6A 2V7OA 3OOGA 4XNEA 3EFJA 2ZV8A 4BCGA 4FVQA 5IA2A 3LLAA 5I9XA 3GT8A 3QFVA 1S9IA 2B9FA 4CFNA 4L52A 4BTJA 4YHTA 4DEBA 2Y4PA 4FBXA 3FLWA 2B9HA 3FE3A 3PSCA 5HBEA 4CFVA 4F70A 3BCEA 3GFWA 1OGUA 1OVEA 1ZOHA 3A62A 3F5PA 4IWPA 4M14A 3PZEA 4XOYA 5HCZA 3EN6A 1YHVA 1JAMA 1P4FA 4CV9A 1WBPA 5C8NA 2BIKB 5I0BA 2UZVA 4BDAA 3W0MA 1APME 4YJOA 4P5ZA 2IW9A 3ZSGA 4Y73A 3E92A 2YZLA 2VZ6A 4EHZA 2OXYA 3QTWA 1W7HA 5J9LA 5BUJA 2VTLA 4IZ5A 5ANJA 3BHUA 4WG3A 4C4IA 5IU2A 4FIEA 3HNGA 3N51A 3EYHA 3O7LB 2C4GA 3BPRA 2YAKA 2GS2A 2WTJA 3HRBA 4EONA 3B2TA 2WTKC 5LOHA 2O5KA 2WQNA 2WHBA 1Q8UA 3HDNA 4FK6A 4TTHB 2YJRA 3C4ZA 3NWWA 3BYVA 4A4LA 5IQBA 4IM0A 1SM2A 1B6CB 2JIUA 2VO3A 5LJJA 4GS6A 1IASA 1H0VA 2PUPA 3ZRMA 2PE0A 3NVKI 1PY5A 3NIEA 3LCTA 3NW6A 2W4OA