4KIQA

Crystal structure of mitogen-activated protein kinase 14 (p38-h5) complex with ethyl 6-((5-(cyclopropylcarbamoyl)-2-methylphenyl)carbamoyl)-1h-indole-1-carboxylate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
338
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title The Identification of Novel P38-Alpha Isoform Selective Kinase Inhibitors Having an Unprecedented P38-Alpha Binding Mode
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 338
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kiqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kiqA01
4MXZA 3C7QA 5LCKA 2BRBA 4X2GA 1YHSA 2YHVA 4KB8A 3NRMA 3PXKA 1HCKA 2NO3A 3IQ7A 2O64A 4EOJA 2A19B 4O0SA 3ZDIA 4BCHA 1G3NA 4YZ9A 3TZ9A 2X8EA 2PWLA 1NXKA 4QT1A 3Q53A 2WPAA 5BPYA 3UC4A 4TKSA 5E92A 4U3ZA 2UW3A 3LMHA 5CSWA 3TV4A 4JDJA 5DT3A 2WOUA 3KF4A 5AV2A 5KMIA 4A9SA 3UZTA 3TACA 4OTRA 4XG7A 4FEVA 5A54A 3RHXA 3LFEA 5IEYA 1OBGA 3FJQE 5GZ9A 4DFLA 4BCFA 2GTMA 4TY1A 2B54A 2R3RA 4FKIA 1BUHA 2QC6A 4WNPA 5IA0A 3HAVA 2JBPA 3NMUF 3NPCA 2OWBA 4ITHA 4USFA 3LCKA 1U5QA 4BHZA 4ARKA 5HESA 4WA9A 1KWPA 4C4HA 2HXLA 2YM7A 2YZLA 2B1PA 3S4QA 4FV9A 4O91A 1ZYDA 3ERKA 4R77A 3QD4A 2ZDTA 5AUUA 4BKZA 4FT0A 3G9NA 2WGJA 4NTSA 4WNKA 4PNIA 4E5WA 2A0CX 1UWHA 2C0OA 2WQNA 4KA3A 4ZTSA 4O22A 2HAKA 3DBFA 2WNTA 4I6BA 5DRBA 2C6DA 5EOBA 4RIXB 4DLIA 4FZ7A 4D2PA 3MBLA 2UZVA 5BVKA 2YACA 5EFQA 2I0VA 3L1SA 5EI8A 5EM8A 2QO7A 3JVSA 2ETKA 1QL6A 5GHVA 5HBHA 1OI9A 4FTLA 5TKDA 1CTPE 1YQJA 2GQSA 3C13A 2ERKA 2BPMA 3OXTA 2XNOA 3RPRA 4EOOA 5HICA 5BMSA 2IZUA 4EBVA 3LVPA 3HV6A 3CQUA 3NS9A 3MV5A 1OPLA 1WVYA 5M4CA 2W17A 5DR9A 3D83A 2RFNA 4CRSA 4XV9A 3FC1X 2E9NA 4LUDA 2W1GA 4AOIA 4O1OA 4ZLOA 5L8LA 3TKHA 3LOKA 4QD6A 3BHHA 4F0FA 2PUIA 3BV3A 5LJJA 5E8VA 4ASXA 1A9UA 4C62A 3DS6A 3F3WA 3MTFA 4FICA 1H00A 3WF6A 3E3BX 3FMJA 3P7BA 4E6CA 3I0OA 3MA3A 5AWMA 4O86A 3QGWA 4H3PA 4RRVA 3DDQA 3K3IA 5DLSA 4FV3A 1YWVA 5CU2A 2BZHB 4DFYA 5LMKC 4FYOA 4FSZA 3QBNA 1JKTA 3HX4A 3LAUA 1ZWSA 3FC2A 3LZBA 5AUVA 4J8MA 3GBZA 1OECA 3KFAA 3DJ6A 3W1FA 5JZJA 3DJ5A 4IJ9A 2VTTA 2WMWA 3EQFA 4FL2A 3UNJA 5IMXA 1PKGA 3DB6A 4C7TA 3IDBA 4EK5A 3ZYAA 3FEGA 3BU6A 5EM6A 4UYAA 3FMHA 4O96A 4W4WA 1QPEA 3GU5A 4QMZA 5HEZA 3PSDA 3F3TA 2HIWA 3EWHA 4LRKA 3SG8A 4DBXA 5L6OA 5JT2A 4S33A 1Q61A 3NUNA 1W7HA 2Z02A 2WMBA 4TWOA 4WG3A 1ZY5A 3DBDA 4PL4A 4J7BA 1FMKA 4IAFA 4YP8A 1YDTE 2PULA 1H1PA 1VYZA 4ANMA 3CD3A 3FZRA 4ACMA 3MN3A 2PVRA 4NCTA 3P78A 4E1ZA 4IACA 3ZUUA 2O8YA 4IM0A 5HO7A 3ATTA 5M55A 5GNKA 2R7BA 5C03A 3R8LA 2B7AA 3LE6A 4FZDB 3FMMA 4W9WA 1JBPE 4GU9A 4EONA 3LFCA 1WBWA 3QGYA 2J6MA 3BYOA 4MTAA 4CT2A 4AZFA 4HYIA 2VWXA 4I5HA 5AR2A 4G3GA 4DYMA 4AAAA 3BKBA 2YERA 1XR1A 2XM8A 3DBEA 4E4MA 4RQVA 4P5ZA 5IQCA 4D4VA 5FDPA 4TWNA 4EH6A 3FMLA 3OUKA 4DG2E 4DGLC 4O0XA 1CDKA 2BRHA 5IH5A 4BI0A 4DGMA 5LVNA 2E9OA 1RJBA 3AD4A 1BKXA 3HLLA 3PVBA 1M7NA 4IQ6A 4OT5A 1FMOE 2YIRA 3MVJA 4ACHA 1J7LA 3EH9A 3DAKA 5JFSA 4ACDA 2J4ZA 4LM5A 5A4TA 2XCHA 4K11A 4CYIA 2WD1A 1ZMWA 3TIYA 2REIA 3UOJA 3KN6A 5EHOA 3TM0A 1XBAA 5CASA 3FYKX 5EHLA 5A3XA 5CEIA 4YC6A 3OVVA 3CY3A 4BCQA 4F6SA 5JEBA 3LHJA 2YM3A 3NYXA 5AIKA 2PMOX 2ZB0A 2JKKA 4E5BA 5HTCA 4GKIA 5HCZA 3ENMA 4L46A 4XG3A 3BU3A 1GY3A 3TV6A 3GU7A 4DTKA 4Z3VA 1JAMA 3AC5A 4FSWA 3C0HA 3IW6A 4EEVA 4F9CA 3DCVA 1IA9A 4FL1A 3UMXA 4BCIA 1J1CA 3QZFA 3HYHA 5AR8A 3DKFA 3R7VA 5AM6A 4OW8A 4WNMA 4ZOGA 1DI8A 2EB3A 5I5ZA 4IC7A 5ANOA 5FWKK 2RKUA 1PRYA 1V0BA 2YM8A 3WOWA 2ITVA 3W10A 1PJKA 1ZYLA 4WD5A 4XS2A 5C8NA 3S00A 3PPZA 3BLHA 4K77A 4NWMA 3GNIB 5HG9A 5IF1A 2IG7A 2C3JA 5ACKA 4TYHA 4QP7A 2DYLA 3ZEPA 4IVCA 4USDA 3H10A 4P5QA 5IQFA 1NVRA 1UU8A 3HV3A 4AGWA 3R21A 3G0EA 3OZ6A 3ZLWA 1KE7A 3OFMA 4KSQA 4BZNA 4K0YA 4RVKA 2ZYBA 4NZWB 3L9LA 5AUXA 4M84A 2W1HA 1ZYCA 5AAFA 4CTBA 4FTOA 5HCYA 1OL5A 5HVJA 4BDEA 4GMYA 5KMJA 3KGAA 3LIJA 2WMUA 3KRRA 2OIDA 3UQCA 3VBYA 2BDWA 4IVDA 4GK4A 3EYHA 3DQWA 3LMGA 3PG3A 4I5MA 4NW6A 3LJ0A 2E9UA 2WEIA 3CBLA 3HAMA 1R0PA 2JDVA 2XJ1A 4G3FA 4ERKA 3PA3A 4HW7A 4O27B 3S1HA 5DIAA 1OKVA 3PDTA 2YDKA 5JQ5A 4W9XA 3QKMA 4JQEA 5HE3A 2R4BA 4Z16A 1URCA 4RWLA 2QR8A 2JBOA 2XVDA 3EZRA 4JDKA 5DBXA 3RWPA 3FZSA 2W9FB 5AR7A 2XK7A 3NW5A 3U9NA 1M7QA 1O6LA 3IO7A 4FTAA 4OGRA 1LR4A 2UUEA 5IISA 3VS6A 1REJA 2DS1A 3Q60A 4R78A 4EHZA 2VWWA 4A9TA 4PP9A 5AJQA 4CLJA 4GKHA 3NAYA 3VF9A 4D2RA 4ITJA 4GEOA 3L9MA 4I6HA 1XH8A 4FE2A 4FKSA 4BYIA 4YPDA 3MESA 2I6LA 5ANKA 3PRIA 2VGPA 2OF2A 2FVDA 3HV7A 4CTCA 3LKMA 4J71A 2UZBA 4ID7A 1YXTA 2PVJA 4MXOA 4YLLA 1DS5A 1JNKA 3COIA 1WBTA 3JS2A 2O63A 3MYGA 4DT8A 4AP7A 2ZOQA 2OH0E 3PXFA 3D4QA 3E8NA 4U97A 4YSJA 3V6SA 4B99A 5A6NA 4GYIA 2RG5A 4L3JA 3COMA 4EQCA 1QMZA 4W4VA 3SV0A 1P2AA 4Z9LA 3ZC5A 3SD0A 1OM1A 4APCA 1LPUA 1PXLA 2XKFA 4OBPA 4I5PA 4FEXA 2UW7A 2WMTA 4J52A 3NEWA 4X3FA 3ZHPC 2OIBA 2UW6A 3Q9XA 4FG9A 5HQ0A 4ZJVA 1V0PA 1JWHA 2IPXA 5ETCA 3FY0A 2Y8OA 2FSOX 2JIVA 5E7RA 4FGRA 4GIHA 3WZJA 4D4YA 4I4FA 2HCKA 3FKLA 4DEEA 3U87A 3PLAE 4TN6A 1H4LA 1UU9A 2CNUA 2E9PA 3BE9A 3OXZA 1H26A 3E64A 2JGZA 5AUZA 5I9ZA 4K33A 1B6CB 2YIXA 4MD9E 3EFJA 3NR9A 5AP4A 4O2PA 3C5IA 2W0JA 3W2CA 1SNXA 3BRBA 4IC8A 3QCQA 3R9DA 3RHKA 3RVGA 1PMUA 2WAJA 3A7FA 3SLSA 4KKEA 2VX3A 3I0QA 4FL3A 3A2CA 4YTHA 3FI4A 2QOKA 3EN5A 4RJ5A 4AT5A 5FXRA 1UU3A 4XNEA 1OITA 2J9MA 5BUJA 4WBOA 3QRTA 3DLZA 5J1WA 3M42A 5CY3A 4E3CA 4X2NA 4XJ0A 4XP0A 4IJPA 4PX6A 1DM2A 3H30A 3FQEA 5BYLA 3FHIA 3HDNA 4LV8A 4NJDA 4IB5A 3R8PA 4UN0C 2PL0A 5EG3A 2QOIA 1Q41A 4PP7A 3D15A 4K1BA 3F5GA 2CLXA 2VAGA 2BROA 3KRJA 4A4XA 3ORXA 3E8CA 3R7OA 3I5ZA 4IAKA 5D1JA 4D0XA 4AGUA 3CGFA 2R3QA 3BELA 3ORNA 4I0TA 4J99A 2XEZA 1OB3A 1Y8YA 2FGIA 2C0TA 3PVWA 3PE2A 4O0RA 4MWIA 3VBTA 4ACCA 4D2VA 4D55A 4O81A 3MY0A 3Q4UA 4M69B 1BL7A 4YJQA 4EI4A 4BCNA 5J5TA 4M14A 4AACA 3C0IA 3EL8A 2C6LA 2JIUA 2VU3A 2X2KA 2Y4IB 4QNAA 3TNPC 4QYYA 3V8TA 4DH8A 2PZYA 3DZOA 4QP3A 3FMKA 4I92A 5BVNA 3PFQA 1XH9A 5FEQA 5ANDA 2YIWA 5FUTA 5L2TA 3PWDA 4YBJA 3CP9A 2ZAZA 5CWZA 3Q2MA 4JI9A 3VS0A 2X6DA 5ETIA 1B39A 3UOLA 4FSYA 4MQ1A 1Q62A 2OKRA 1LUFA 3QQHA 3ORMA 4BBMA 3E63A 2YZAA 3IW4A 4HGSA 2YITA 3DKCA 4I4EA 4R6VA 3D7ZA 3A60A 4FSTA 4K2RA 3RAHA 3BBWA 3CE3A 4QP9A 4GT4A 3UDBA 4XRLA 3ENHA 3NCZA 4NKAA 4BTMA 5FTQA 2GPHA 4UV0A 4MXAA 5KE0A 1ERKA 2VWYA 4R7BA 3B2WA 4TYEA 3CTJA 2QOQA 3SW7A 4DGGA 2BILB 2IJMA 2JFMA 2QOHA 4CFFA 4IM2A 5L2SA 1OVEA 4IVAA 4NM5A 5HNIX 1OKWA 4HYHA 4W4YA 4RIWA 3VRZA 3GCVA 3Q52A 3I7CA 1UVRA 1E1VA 1UNLA 3UGCA 4EOKA 4M97A 5K0KA 4QMUA 5CF5A 4Y95A 4WKQA 3EN7A 5CEQA 5I3RA 1OPKA 3QD2B 5J9ZA 3V5PA 3HEGA 3WZDA 4H3BA 3OOGA 5HE2A 4U0IA 1KUTA 4X6RA 4AU8A 3VBWA 3QALE 4BDFA 4H05A 1OL7A 4U80A 2V55A 1S9IA 4DEGA 4R7IA 3O71A 4RWKA 3PXYA 2GHGA 5EH0A 5E8TA 2IZRA 4BGGA 5CF6A 2VV9A 4RJ6A 4C36A 3I79A 4DFNA 3UOKA 3RKBA 3FY2A 1BL6A 2QOCA 4U8ZA 3CEKA 4NEUA 5E8SA 3UBDA 5KHWA 3PXZA 2VTPA 3E62A 4K8AA 2XIZA 3F66A 2B53A 5EM5A 3QQKA 5HHWA 1KSWA 4N57A 1URWA 3QAME 2OW3A 1GZKA 5AP7A 5EKNA 3C5UA 2OI4X 4KRDA 5J9YA 1JQHA 5HD7A 5IUGA 1PXJA 2CN5A 4I41A 3MDYA 4X2JA 1H08A 3TL8A 2P2IA 5AUTA 5I9WA 3O51A 1SVHA 5DWRA 5IEXA 5DPVA 4S30A 1U54B 4IFGA 2R3PA 4HYSA 1M2PA 3QRUA 4MX9A 2HZNA 3KRWA 2F57A 3HDMA 4ZTHA 3FL5A 4EOSA 1RW8A 2C5YA 5DE2A 2V5QA 2W1CA 1W84A 3MA6A 3QRKA 4O84A 2VTIA 4GIIA 4QP6A 4A06A 4JT3A 2CSNA 4QQTA 2IVTA 2PZ5A 5CAOA 4I1ZA 1JKLA 3R83A 4A7CA 3D7TB 4M7IA 5HI2A 2AC3A 4DEIA 4EK3A 4ZJJA 4AW0A 2R7IA 4BGQA 3FI2A 4FODA 5AP5A 5CT0A 4F65A 4C57A 3PE1A 2PMNX 3HUBA 4NSTA 4WG4A 2BZKB 2QOOA 3SHEA 5GIOE 4ZJIA 3AC1A 3MIYA 2QU6A 3SAYA 4BDAA 2Z7SA 4FT9A 3OS3A 4J53A 3VHKA 4RQKA 3ANQA 4KAOA 3UVRA 3R8UA 3HGKA 2BIYA 3FYJX 3NWWA 5HLWA 4BC6A 4MBIA 5IQGA 4RWIA 5AFVA 3Q6WA 2BIKB 3BGZA 3DGKA 3H9FA 3K54A 4LRMA 3ZS5A 4DFXE 3TKIA 3PY0A 1JLUE 2X4FA 4PRJA 5HBEA 4QNYA 4WBBB 4XP3A 3R8VA 2CKOA 1ZAOA 1PKDA 5CSPA 2J5EA 2Y4IC 3ELJA 3QYZA 4N70A 3WIKA 2R3GA 4YHJA 3R1YA 1ZRZA 3DAEA 3JVRA 1OIRA 4QTBA 2WTDA 3ZEWA 4EZ7A 3ZFYA 4DGOA 5M4UA 3BIZA 1OKYA 2PTKA 2VWBA 3KF7A 4WHZA 3OMVA 4BDGA 3R0TA 3W16A 2WTKB 4UBAA 3O8UA 4IH8A 3DT1A 3Q4CA 4FTKA 4HNFA 4OR5A 2WMQA 4M68A 4U41A 4C34A 3V6RA 2GS2A 4C58A 1UV5A 4Z55A 2R3FA 3QUEA 3VS5A 3JR1A 4D2SA 5GINE 2BKZA 5JGDA 4G3EA 3TTIA 5IPJA 5JGBA 1V0OA 4TNDA 1DI9A 4OTDA 3AT3A 5E8UA 2YA9A 3UZPA 4TWCA 3NYNA 3B8QA 1OIQA 3C51A 4F9WA 4WSQA 3I60A 2WZJA 3EYGA 5KCVA 3NW7A 4FNWA 3VBXA 3QCSA 4JIAA 4I23A 3QCYA 3GUBA 5A4QA 3BHYA 1W98A 2GNIA 4YLKA 4C02A 4E7WA 4AZWA 5IQAA 4YMJA 4IBMA 4GFGA 3KY2A 4UWCA 5KKRB 3FMNA 4RPVA 4E6QA 4EOQA 3VQHA 4OTWA 4V01A 5BX0A 2ITUA 2XBAA 4F70A 1ZOEA 2H34A 4D0WA 5HU9A 2KTYA 4AUAA 3AOXA 3GCQA 4GS6A 3CXWA 3UPZA 4XUFA 3BE2A 4MKCA 4WUNA 3GCSA 4CLIA 2GFSA 1PXKA 4AX8A 1Q3DA 4YZBA 5GZAA 1BX6A 2X8DA 2H6DA 2XK9A 3MPMA 4PTEA 4BYJA 1T45A 2HZ0A 3AQVA 1STCE 1YOMA 4JIKA 3G5DA 5FG8A 3TDWA 5A46A 4PL5A 2ERZE 3QC9A 4V0GA 3DA6A 2YCRA 3MFTA 2QI8A 3GFEA 3BYSA 4EK6A 5KMNA 1YVJA 3TNQB 3ZZEA 4BTJA 1Q8WA 3VS2A 3NNWA 2CCIA 3F61A 4OT6A 1ZZ2A 4D5KA 1UNGA 4Y5HA 5AAEA 3R9RA 4E8AA 4KABA 2C3KA 2B4SB 3CTHA 3ORPA 4N6YA 3N4UA 5M4FA 1MQ4A 4DTAA 4KBAA 5T6KA 4YR8A 1CKIA 3NCGA 2BRNA 4FX3A 4Y5QA 2G2HA 4AQCA 4Q5HA 2IVSA 1Y57A 4KWPA 5K5XA 3OWLA 5E4HA 3CD8A 5BVDA 1F0QA 4R5YA 4E4LA 1SVGA 4DE4A 3FSFA 3VS3A 1H24A 3HRCA 4LUEA 5IUIA 4NT4A 3TEIA 2R0IA 3TJDA 5HVKA 4P2KA 3ORIA 4RZVA 4U5JA 1UKHA 4EK4A 4HVHA 1MRUA 4XLIA 3WZUA 4YNEA 4KBKA 3DTWA 4IFCA 4NIFA 5F94A 1GJOA 5C01A 3AT2A 3RALA 1H07A 4GW8A 3W8QA 1SZMA 1TKIA 1BI7A 2XB7A 3RMFA 5J7HA 1SNUA 3NNUA 5HE1A 3ODYX 4B4LA 3WIGA 4A9YA 3PG1A 3C9WA 2PVHA 2FH9A 4U3YA 1WBPA 5DNRA 5EDQA 1OZ1A 2C1BA 3FZOA 3FLZA 4QPAA 1M52A 3MH2A 5FBNC 1GIIA 3W2PA 2XMYA 3KULA 5JGAA 2H9VA 4YHFA 4FKOA 3UC3A 1YI3A 4FGBA 4AFEA 5AADA 2WMSA 3IGOA 2P4IA 4FIGA 4MXCA 3ZCLA 3R2BA 4LG4A 4O83A 4HGEA 3C4CA 3ZO1A 3M11A 3AD5A 3RM6A 2RFEA 3SRVB 5J1VA 1GAGA 2RFSA 2DUVA 4H58A 5F4NA 4EH3A 3MPTA 4MAOA 3A7HA 3SX9A 2F49A 4R8QA 4Q5EA 2WTKC 3OWPA 4WIHA 5LCJA 2R3NA 4IZAA 4LGDA 2BMCA 3P79A 2CLQA 4KNBA 4Z7GA 2WOTA 1OBDA 1OUYA 3ALOA 3ZXTA 2PE2A 3LQ5A 2ZJWA 3HNGA 5HKMA 5J79A 2OLCA 3OTUA 2CN8A 4CGAA 3EQIA 4MK0A 3W32A 2DWBA 2WTIA 4AF3A 3LXNA 1Q99A 3OBGA 4FZAB 2JITA 3NIZA 3TDVA 3FZ1A 2VGOA 4JL9A 3EQCA 4ZY4A 3G15A 3C4FA 3I81A 3L8VA 2KULA 3PSBA 3ZXZA 4MXYA 3TNWA 2FSTX 3O17A 2W99B 5T68A 2B52A 2YCFA 3U6HA 4A07A 5HZNA 2J0KA 4RX9A 3V5JA 4C0TA 3SG9A 5KKRC 3T3VA 3ORKA 4YBKA 4KIKB 3IW5A 4TT7A 4XV2A 4LL0A 2OK1A 5BYZA 3T9IA 4EH8A 5FDXA 4EYMA 3CGOA 3LJ2A 3VHEA 4ZTMA 2X0GA 1MQBA 3GU8A 5FXSA 2ZM4A 5CI6A 4YZMA 4X3JA 4B7TA 3RCJA 2GNLA 4L53A 3IPHA 4RIXA 4PMTA 4BTKA 2J0LA 3EL7A 4KIOA 2HZIA 4OTGA 2VWIA 3ZZWA 3I4BA 4L67A 2CKPA 3AC4A 5HU3A 4YU2A 4DG3E 1PF8A 4L9IA 4C4EA 4E6DA 2PVLA 4EH2A 4IHPA 4YGAA 1MRYA 3ZSHA 3AG9A 2PUPA 3Q4ZA 1ZMUA 4PUZA 4RVMA 2C5NA 4ZSGA 3Q04A 4QYGA 3G0FA 3UO6A 4D5HA 2EUFB 4G3CA 3MGYA 3EKNA 3SKCA 5CT7A 4FUXA 5DH3A 3UTOA 4LV5A 2XNNA 4L45A 3R9NA 4GYGA 3KULB 3IECA 1G8SA 3LFNA 2R3HA 4RC4A 1H0WA 1K3AA 1Q8ZA 2XYUA 1NT2A 3A4OX 4FI1A 1PXNA 5DHJA 3MVLA 4DHFA 4IWPA 5JZNA 3CKWA 1JVPP 3BI6A 2QODA 3MFUA 2YCQA 5IA3A 4GG7A 3VULA 1M17A 4DEAA 4F9AA 3PWYA 4AOJA 2QKWB 2YFXA 3JXWA 3OXIA 4YJRA 1ZLTA 3O0GA 2P2HA 3QYWA 5EOLA 4X6QC 1UWJA 4GJ2A 5LVOA 3V04A 1W82A 4QTDA 2W5HA 5BMMA 4J95A 3PJ1A 3W18A 3UIBA 4PPCA 3ALNA 5TO8A 3HMMA 3QUDA 4FC0A 2CNVA 1V1KA 1UKIA 2R3MA 1IR3A 2F7ZE 3QFVA 3BEAA 3DFAA 4IWQA 4R5SA 5CU0A 4C37A 3N51A 3QLGA 1M2QA 4Y85A 4MNEA 4O82A 4JS8A 4F1MA 3UIUA 3DLSA 5F95A 2XUUA 3TNHA 4M15A 4XMOA 3B2TA 3OOMA 2OBJA 3U4WA 2YJRA 4C4GA 4FYNA 2RL5A 2YN8A 3FI3A 4RVLA 5AP0A 3WF5A 5DMZA 1JSTA 4JBVA 4ZTQA 5ICPA 3WYXA 4LMUA 4GH2A 5JKGA 1TQIA 3KL8A 2YAAA 4G16A 3DY7A 4JDIA 3KXXA 5EW3A 4AGDA 4AZTA 3WBLA 2C6EA 4GT5A 3LFFA 2BR1A 2VTAA 5IQDA 4JDHA 3I7BA 3JY9A 4FVQA 3ZFXA 4FV6A 1H1SA 1WBOA 4FKPA 5I3OA 4EL9A 2J51A 4IW0A 2OICA 5K5NA 3FLYA 2OZOA 3FPMA 1VJYA 3EZVA 2ITXA 1H27A 4Q2AA 1W0XC 1YOJA 2OJFE 1NA7A 4F4PA 5C1QB 5FBOA 1RE8A 3VS1A 4U42A 4FTJA 3MWUA 3F69A 4LOPA 3FLSA 2WQBA 4QMYA 3PJ8A 2PVMA 5CF4A 2HZ4A 3IS5A 4OTFA 1XJDA 2V62A 3L8SA 3VJOA 3QC4A 4H1JA 4GJ3A 4YJVA 3IW7A 2OJIA 2P3GX 2YIYA 2JAVA 3PP1A 5LMBA 3ZH8A 4TPTA 4I0RA 4FIEA 3NAXA 1ZYSA 3BYMA 1TQPA 3OWJA 4X2FA 4ZAUA 1CM8A 2ZV7A 5GIPE 3COHA 2O0UA 4K6ZA 4L52A 4CG9A 4FSUA 3SGCA 3RPYA 3RWQA 4KIPA 3NUXA 4AE6A 1NY3A 2O2UA 5CENA 1GZNA 1HCLA 1R78A 2BAJA 2NRUA 3GC9A 4IX4A 2CMWA 5LARA 3EN4A 2J7TA 4BCGA 4O21A 4GK3A 2VWZA 2XCKA 4FNYA 3DPKA 3QTUA 4S2ZA 1CSNA 4HJOA 4U79A 3NVKI 3U51A 2PE1A 2BUJA 3H9RA 2VTOA 4JBPA 4JQ7A 2XJ0A 2JAMA 5F9EA 5I0BA 5JFXA 3FE3A 3MFSA 2ITPA 4BRXA 5HLNA 1GZ8A 1YHWA 2OFVA 2XM9A 2XYNA 2BDFA 3QRJA 3UO4A 4FZFB 3GQLA 1U59A 5BNJA 3FXXA 3GVUA 5M56A 3RZBA 3F82A 4ZTRA 4BGHA 1XHAA 1WBNA 3R1SA 4CZYB 5CSXA 4QTCA 4WRSA 2JDTA 3KC3A 3ORTA 3ULIA 4A4LA 3HMPA 4H39A 4I3ZA 3BBTB 4QMXA 1BI8A 3TN8A 4D28A 2VWVA 4CV8A 5HNBA 4U43A 3U4UA 4CKJA 4NUSA 4TWPA 5EKOA 3R02A 3IGGA 3LXPA 2UV2A 4JX3A 4XG8A 3ID6C 3G33A 4ZTLA 1FGIA 3C4WA 4RJ7A 2NRYA 3HA8A 1BLXA 1UA2A 3MVHA 3NUUA 3U8WA 4AW1A 5HNGA 4G6OA 4DTBA 3A8WA 4A4OA 1WVXA 4F6UA 3P4KA 1XBCA 2B9JA 2YM6A 4J97A 4UMQA 2DQ7X 1XO2B 3IDCA 4QMVA 3DAJA 4FV5A 1Z9XA 4GL9A 4I5CA 5D9HA 1J91A 1GZOA 2R0UA 5EI6A 4IWOA 4DF3A 4ZSEA 3FXZA 5BUIA 4OBOA 3WZEA 2XIKA 3QD0A 3A7IA 2BFYA 1PMEA 3I5NA 5FTOA 1UNHA 2EXCX 2UZLA 4U7ZA 2QNJA 1SVEA 4I22A 5IEVA 4ALUA 1YXSA 3OY3A 1WFCA 5L2IA 4PPAA 3GC7A 1PHKA 3DU8A 4K9YA 4MVFA 4QP1A 5H9BA 3D2KA 3W2RA 4XOYA 2RF9A 3CJGA 1Q97A 4NM3A 3ZFMA 5BYYA 3LCDA 4EH9A 2H96A 3IDPA 3ETAA 5LXMA 3B8RA 5DGZA 1BMKA 2Y0AA 4F7JA 2OJGA 2OU7A 4F64A 3O96A 1CKJA 1F3MC 1O6KA 3A8XA 3WF8A 4ZSAA 4QQ5A 4AGCA 3PVGA 4H3QA 2AUHA 5AX9A 2ITWA 3PJ2A 4TYHB 2PMLX 3FUPA 3ZO2A 3GCUA 4CYJA 4BIBA 4DINA 2XP2A 1H28A 4CXAA 3A7GA 3NLBA 4D9TA 5HGIA 4UEUA 4QMLA 2VX1A 2HW6A 2XK3A 5EYCA 1WAKA 3RK7A 3Q5IA 2RGPA 4DITA 3QZIA 4RLLA 3V3VA 5ITAA 5KMLA 3MH0A 2G2FA 4BIEA 5ETFA 1P4FA 3GQIA 5TT7A 5ETAA 3CLYA 2WHBA 3GCPA 3TUBA 3E88A 2X9FA 4UMPA 5DRDA 4H1MA 3ROCA 2HOGA 5IA2A 2IZTA 4C59A 3MJ1A 4MBLA 3KB7A 5BUEA 4QPSA 4JRNA 5HX8A 4IAIA 3MW1A 3AGLA 3QQUA 2X7OA 3D9VA 3GB2A 5JQ8A 4BWPA 2QR7A 3ZRKA 4ORKA 4JR7A 4ASDA 4UZHA 4IZ7A 1PMVA 3SDJA 5EYDA 4G3DA 3NX8A 3QHRA 4EOPA 4U6RA 5IA1A 3IW8A 2W06A 3C1XA 4PDOA 3W2OA 4PDSA 4TZRA 3QHWA 4DGNA 3BHTA 4NL0A 2ZM3A 4QMPA 3ZRMA 4ZLZA 4YZNA 2C5OA 3CC6A 4F09A 3ULZA 4USEA 4M12A 3C4EA 4AOTA 4AW5A 4AZSA 4BZDA 2G1TA 4JR3A 4EORA 4HOKA 5CU3A 4Z7HA 4DCAA 3EIDA 4DFUA 3ET7A 3ZUVA 1ZOHA 3R2YA 4NCTC 1G8AA 5J95A 3TZ8A 4ENYA 2UVZA 4GFOA 5M08A 4B8MA 5A4EA 3BEGA 5G1XA 2ITNA 4QYEA 5JFWA 1ND4A 3SA0A 2W4OA 4QRCA 4R7HA 4BL1A 4N0SA 1P14A 4I6FA 2I7QA 5AMNA 4FTMA 5K4IA 5E9EA 5C4KA 2ZM1A 4E93A 1I44A 2WTJA 2G9XA 3HP5A 3MH3A 1T46A 3Q5ZA 4ITIA 5DG5A 4I21A 1DAWA 4YJTA 4DH1A 2C3IB 3KXNA 5JK3A 2YABA 4G9CA 3RI1A 4ASEA 4BKJA 3MVMA 4M0ZA 2VWUA 4L3PA 2W9ZB 5H8GA 4BFMA 2W1EA 4PMSA 4QQJA 1YDSE 5DR2A 5EM7A 1CKPA 2GHLA 4X3FB 4EKKA 4BBEA 2J0JA 5HG7A 4WUAA 4IAAA 4ZS0A 4RIYA 4TYJA 3QWKA 5M53A 4J8NA 3GU6A 5K0XA 2VTJA 5DA3A 1H1WA 5ANEA 3LM5A 3QUPA 2XRWA 4CT1A 3O7LB 4XRJA 4WT6A 3QTXA 4JOAA 4EWHA 2W1FA 3NDMA 3ZO3A 5D10A 2QG5A 3R73A 4UWYA 5FEEA 2VTRA 4HCTA 5IUHA 4EOIA 4KS7A 4DA5A 4EKLA 3UYSA 4S32A 2JDRA 2YWPA 4FK3A 4YC8A 2UZDA 4EBWA 1GNGA 4L8MA 2JDSA 4ALVA 3GOPA 5DEYA 5HORA 3UP7A 2BTSA 3L9PA 4MH7A 3I1AA 3EN9A 3Q9WA 5IQEA 3GEQA 3VJNA 4JRVA 4QMNA 2JFLA 3R9HA 3SXRA 4EH4A 5D12A 3T8OA 3ZSIA 3QKLA 1U4DA 2O3PA 3BLQA 1W8CA 1B38A 2F4JA 2PUUA 5K3YA 4NFMA 5BVFA 4ALWA 3VAPA 4FT3A 2AYPA 2XKDA 1BYGA 4FSMA 2X7GA 2YLEA 4QMMA 4W4XA 3EKKA 4XX9A 4J96A 3FQHA 2E2BA 3U9CA 4OTPA 2C5VA 3EQDA 4L7SA 3KXHA 2UW8A 4FKGA 1SYKA 2HY0A 2WKMA 5BVOA 2WQEA 4FEUA 3DFCB 3RAKA 4O7YA 5J8IA 1KV1A 5CQWA 2UZWE 3V8SA 3VS4A 1XH4A 4AXAA 5FTGA 3MTLA 3VW6A 3ACJA 4PWNA 3PJCA 5M44A 4XP2A 3CPCA 4ZSJA 3EFLA 3K5UA 3QU0A 2XKCA 1FVVA 4BCOA 3AGMA 1PXMA 3EQHA 3QX4A 3POZA 5CLPA 3TIZA 3K2LA 4GRBA 3HECA 3PY1A 1ATPE 3CQWA 1JSUA 2GFCA 4M67A 4TYGA 3KCFA 2ZV2A 5HX6A 5LVMA 2JD5A 2R3OA 1XH6A 1TQMA 3P7AA 4ANNA 4ZEGA 4CSVA 1XH7A 3R7UA 2JKMA 4AW2A 2B55A 5HOAA 2GNHA 4XEYA 5DR6A 3ORLA 2EU9A 2OJ9A 3SC1A 3UPXA 2OXDA 3KU2A 5KMKA 5TOZA 2C6MA 2PE0A 3G6GA 4S34A 4NM0A 1YI6A 2BVAA 5KNJA 4YJSA 3TWJA 3OC1A 4CEGA 2IO6A 1WBVA 2WMRA 3DNDA 3DKGA 4MQ2A 4AT4A 4OTIA 2C4GA 4RIWB 2WMVA 3VUMA 2JKOA 3G9LX 4O2ZA 3CY2A 4EQMA 1IEPA 1Q5KA 3ROYA 3ZRLA 3AD6A 3R7GA 3PJ3A 3K5VA 3MJ2A 4PPBA 3ZU7A 4EZ3A 4TW9A 4RA5A 2ZMCA 3F5PA 4P7EA 4EWQA 4UXQA 3OW4A 1ZARA 1MRVA 5AR5A 4CRLA 4C2WA 3KXGA 4FSRA 3RTPA 4F6WA 2F2UA 1YXXA 3UQFA 5AR4A 2HW7A 1XKKA 4YZDA 4RX7A 1R39A 2UW5A 2JC6A 1YWRA 2IVUA 2R2PA 3Q96A 4M0YA 4YNOA 5E8YA 4FTRA 5HO8A 5DT0A 5AP6A 3VUHA 1OKZA 2PVFA 3DK7A 4JNWA 3VWAA 1J1BA 3BU5A 4BWKA 2BZIB 2CHLA 3R71A 5JH6A 4M3QA 3DZQA 4DEBA 5CXZA 3LFBA 5I9YA 4E20A 4GUEA 3VNTA 2WU7A 4GFMA 3PPJA 4RZWA 3LW0A 4X3FC 2ITZA 3GC0A 2BAQA 4G5JA 2C6OA 3FSKA 4UMTA 3FQSA 4FVRA 5D41A 3S95A 3Q9ZA 3OP5A 5A4CA 5IQBA 1IG1A 4ANQA 2C69A 4H36A 2EWAA 4O0WA 3OUNB 1OPJA 1KE8A 3FL4A 3QLFA 3UG1A 5CZHA 2C6IA 3UP2A 4EH5A 1PXIA 3MIAA 4BF2A 2PUNA 3D5UA 4UYNA 5FLFA 3ZM4A 2J2IB 3PPKA 5E8XA 4YUQA 2PVYA 5E8WA 1Z57A 4NM7A 4X0MA 4FKWA 3TTJA 4TRLA 4AA4A 3OY1A 3KMMA 3PVUA 1PMNA 1PY5A 3C50A 4QMOA 2UZOA 1KOAA 2Z7QA 3F2AA 3NNVA 4RVTA 3NZ0A 4IAZA 2X8IA 3RM7A 4IXPA 3VW8A 4FKJA 4RJ3A 4U44A 4RG0A 4CCUA 4FKLA 2YISA 3P0MA 4RSSA 4O7RA 4YHTA 4JVGA 2GSFA 4L00A 1WVWA 3S2PA 3ZC6A 2C6TA 2I40A 2OSCA 3DK6A 3FXWA 2JDOA 2GU8A 3RGFA 3GP0A 5GJGA 3RBWA 4C8BA 2YDJA 2VNYA 2QLUA 4RFYA 2OG8A 2VO3A 3WE8A 4A9RA 2GS7A 5I4NA 1REKA 1WZYA 4HGLA 5AA8A 4EUUA 1VEBA 3H9OA 3MI9A 5M4IA 3LCOA 4YZCA 2FSMX 4MCVA 5CALA 4CFMA 3L8XA 2J50A 2PK9A 3KRLA 5CNNA 2Z60A 1JSVA 3P23A 4RT7A 5CYIA 5CU4A 4CZUA 1FVRA 2LGCA 3OCGA 4IWDA 2RSVA 4AZEA 1L3RE 4IX5A 2W5BA 4C2VA 5M09A 3QWJA 3RK9A 4QMSA 3DBQA 3KN5A 5CTPA 2XS0A 5AP2A 4N6ZA 1FINA 2WFYA 3WE4A 4PDPA 4UMUA 2WB8A 5CI7A 2GHMA 2VUWA 3KRXA 5T3QA 2LAVA 4F7SA 3V5LA 3W33A 4EH7A 2W1DA 3PIZA 4D1SA 5EQYA 3V5TA 3AMBA 5E8ZA 3ZLYA 3ZM9A 4DH5A 3P86A 4RC2A 4W8EA 3Q4TA 5EDRA 2VZ6A 3GI3A 4AA0A 2Y6OA 3F5XA 3R7IA 4KINA 5EW8A 3H3CA 4BB4A 4F0GA 4YSMA 3BX5A 3BGPA 4I20A 1OUKA 3FPQA 4BKYA 1NVSA 1P5EA 4MD8E 3QRIA 3SQQA 4EUTA 1Q8UA 2AC5A 4ANOA 2GS6A 4U9AA 4CQEA 1FBNA 5LQFA 3NNXA 3ZBXA 2YM4A 3KA0A 3OCBA 2Y9QA 4EK8A 5ANGA 3T3UA 4XHKB 2W5AA 3VVHA 4DH3A 3KCKA 4GT3A 4FA2A 4FG7A 5AIRA 4YO4A 1EH4A 3RJCA 3PUPA 4LFIA 2I0YA 2R3IA 5BQ0A 4IB0A 4WNOA 2CGWA 3EOCA 3II5A 3UIXA 3TV7A 3RK5A 4HGTA 4B6LA 2B0QA 4FSNA 4X21A 3UG2A 4D58A 5IDPA 2P33A 3EMGA 4BY9E 2ZV8A 4IADA 2QURA 4FSQA 3D2IA 3Q9YA 2X6EA 4O38A 2J0IA 3HVCA 3UJGA 1E1XA 3NUAA 4CKIA 3IKAA 4JLCA 4LQMA 5A4LA 2HWPA 3P5KA 2ZMDA 3HRFA 3OW3A 5ANJA 4CZTA 4Y72A 5JMSA 5CVFA 3TZ7A 1OIUA 2BRMA 4CFUA 2UZEA 4V0GB 1R3CA 2OO8X 3IK3A 4F63A 4CKRA 2FA2A 3AC2A 4FUYA 4I94A 4RX8A 3TT0A 4OLIA 3V5QA 3G2FA 5J9LA 4XG2A 2YCSA 2GNJA 3HP2A 5L3AA 4N4SA 4V05A 2VX0A 4JAIA 4DEDA 5H8BA 5HIDA 3D5VA 1OL1A 1CMKE 4ZXTA 4IMYA 2C0IA 3VF8A 4EOMA 3F7ZA 3OCSA 4QQCA 5J87A 4ZZNA 5KX8A 1SM2A 5DT4A 4V04A 4F99A 2GMXA 2XIRA 5CAVA 3F88A 4JXFA 2BRGA 3DBCA 2IN6A 4KIQA 3ZBFA 2XBJA 1K9AA 2QO9A 3VIDA 5B0XA 1NVQA 5DYJA 3I6UA 3P7CA 3ACKA 4UY9A 2WIHA 3F3UA 2J5FA 3QX2A 4QYHA 4BTFA 2G01A 4FTTA 4G34A 4DH7A 3WILA 4G6LA 2BTRA 3SXFA 2F7EE 3R1NA 5HG8A 3BYUA 4ZY6A 4R3PA 3VUIA 4PMPA 4I6QA 4HZRA 5CEPA 4O6LA 5M07A 1IAJA 1FOTA 3CCNA 4NIFB 1H8FA 3ANRA 3BZ3A 3QZHA 2OGVA 4WO5A 4F7NA 3KXZA 1KOBA 3TG1A 1XQZA 1OGUA 2VN9A 4BDJA 3PIYA 4DLJA 2WQOA 5B2MA 4NJ3A 5CAUA 2ITTA 4R1VA 3RPVA 3DV3A 4AFJA 4XH6A 2VD5A 3HMIA 3DXPA 3PRFA 2BHHA 2QO2A 2UZNA 2VO7A 3WZKA 5I9XA 1QPJA 2FO0A 4RJ8A 3UNKA 2B9IA 2OXYA 4BICA 3OWKA 3QCXA 4EHEA 2XNEA 5M51A 2CJMA 2C47A 4EJ7A 2A27A 2RIOA 3EFKA 4QYFA 4YC3A 4BDHA 4C3PA 2WEVA 2YDIA 4FG8A 3COKA 3P9JA 2VTMA 3DXQA 2GTNA 2H8HA 5K9IA 3U55A 2QCSA 5AR3A 4MD7E 1KE6A 3REPA 1ZOGA 2FB8A 3G51A 4PF4A 2VNWA 4J1RA 4E4NA 3DNEA 3CSVA 1FVTA 2QG7A 2CGXA 3LXKA 3QQFA 4E73A 4EC9A 5TR6A 2WELA 2YIQA 3OT3A 4IIRA 3U54A 3C4XA 4BIDA 3MY1A 1O9UA 2X81A 3QL8A 4ZZMA 3A61A 1XBBA 4O0YA 3VBQA 4Y83A 2Y4PA 4EOLA 3RCDA 3ZLSA 3F3VA 5AA9A 1JKSA 5CS6A 2ZB1A 2NPQA 4M66A 5D7VA 3JY0A 3UODA 2ITYA 2ESMA 4GU6A 5HO6A 3PXQA 5L2QA 2QOLA 2VTQA 4R3CA 3ZDUA 5CEOA 5LWNA 3D5XA 4C35A 3BWJA 3WI6A 4F08A 4YTCA 2XIYA 4B8LA 3GENA 2PZIA 4FIHA 2JIIA 3EQPA 4BI1A 3HA6A 3E8DA 2UVXA 4QP8A 4F7LA 2X2MA 3A62A 3PXRA 4D2TA 4ERWA 2HWOA 3QD3A 2BFXA 3E5AA 3SXSA 1H0VA 1F5QA 4BDBA 2I0EA 4DC2A 4MNFA 3PY3A 4OAUC 5ACBC 2IW8A 4AA5A 1H1RA 1MUOA 4JG7A 4RIOA 4JX7A 5CU6A 2BKKA 2UW9A 2WXVA 3QKKA 3QQLA 3QXPA 1L8TA 4BCMA 1W83A 4XG6A 5KBQA 3MPAA 4FEWA 1YRPA 2UW0A 4UWBA 2W05A 4O0UA 4FMQA 4YJNA 2XNPA 5L8JA 4IB3A 4WG5A 1WBSA 3BLRA 4L42A 2IZSA 3KK9A 4OBQA 1AQ1A 5M57A 3RAIA 4WRGA 4GUBA 4O7ZA 4HYUA 4BVUA 4NH1A 3TCPA 3NGAA 5HBJA 1I09A 2C30A 3F5UA 4FK6A 1Q24A 4IX3A 4LGGA 3BYVA 4LRJA 1LEZA 3VO3A 1WMKA 3AXWA 3OROA 3M2WA 3EHAA 3QA8A 2OJJA 2XZSA 4G31A 4BDIA 2ACXA 5B2LA 1KV2A 4L43A 4ZLYA 3FAAA 2W7XA 5E1EA 3W2QA 3LXLA 4IDTA 3RP9A 3MS9A 3PA5A 2XK8A 2UW4A 1OMWA 4NYEA 1ZZLA 4X7QA 2J90A 4UXLA 4FR4A 2CKEA 3IOPA 3R7EA 4BBFA 4BCJA 3BHVA 3UYTA 3VUKA 5CNOA 3VN9A 1GIHA 4DCEA 1S9JA 4YJPA 5DN3A 4ACGA 5KBRA 2XNBA 3D94A 4O6EA 4I93A 2Z7LA 4OAVB 3BV2A 4MNEB 5K4JA 3ZLXA 5A6OA 4PTCA 5LWMA 4ENXA 4FV7A 4MXXA 1R1WA 3R28A 5L6PA 5HD4A 1A06A 5BVWA 3M1SA 3LFDA 1ZXEA 3CS9A 3AC3A 2VTSA 2WMXA 3PTGA 5H3QA 3H0ZA 3RNYA 3R7YA 4ANLA 2VTNA 1VR2A 3DJ7A 3NUSA 4CFNA 3R6XA 2UVYA 4FTQA 4ZMEA 5C26A 2QOBA 3AT4A 2ZDUA 5HVYA 4U40A 1JKKA 2HELA 5AM7A 3F7WA 3Q32A 3E8EA 3EJ1A 3FZTA 4AT3A 5L8KA 3L8PA 1OIYA 3OEZA 2OIQA 3OT8A 3LJ1A 2WTVA 2ZV9A 3QTWA 4KSPA 4MYGA 2WMAA 3UNZA 5C8MA 5E1SA 2Z7RA 3JPVA 5F1ZA 5CQUA 3G90X 1FQ1B 4FTCA 5EDPA 1AD5A 3LLTA 2YJSA 4F9BA 3SOCA 3KMUA 3CPBA 5FP5A 5HIBA 3NYOA 4L44A 5EYMA 4BZOA 4F9YA 2R3KA 4NU1A 4RJ4A 2O5KA 4IVBA 2X9EA 1M2RA 3RINA 4BCPA 2Y6MA 5AV1A 2PPQA 5GJDA 5H8EA 3LFAA 4F0IA 2F7XE 3CTQA 4FTNA 5CSHA 3NSZA 3KVWA 1PYEA 3C0GA 3UVQA 3LQ8A 3NW6A 3CKXA 3DXNA 3ODZX 4KKGA 5CEMA 4FV1A 3W2SA 2NNWB 4EQUA 2XH5A 1X8BA 2YWVA 3OEFX 5FEDA 1VZOA 4GCJA 2OH4A 1H25A 2OZAA 4DFBA 3KMWA 3RZFA 2ZVAA 1KE9A 2JKQA 4O0TA 3FDNA 4FKRA 3RAWA 2WTWA 4PTGA 5AUYA 4IANA 3MB7A 5FM2A 4PMMA 2CDZA 2PZPA 2W96B 4IX6A 3PZEA 5LVLA 4C4JA 3Q3BA 1YHVA 3IOKA 3R8MA 2W1IA 3NVMB 4U45A 3AMYA 3O2MA 2WTCA 4OUCA 4HVSA 3LMIA 4HPTE 3UIMA 4W8DA 5LMAA 4EJNA 4M8TA 4BDDA 4RLKA 4IZYA 3UE4A 2IWIA 4TNBA 1YDRE 3KVXA 5HG5A 4M69A 4FV0A 3IG7A 2FUMA 3R30A 4UB7A 4DN5A 5IQIA 5EI2A 5FQDC 4CMOA 3JUHA 1A48A 4LOQA 2PHKA 4FTIA 4RBLA 5DEWA 2X1NA 5AX3A 3QF9A 4O7NA 5DOSA 3F2RA 1KE5A 3JYAA 2F9GA 4DBNA 2Q83A 4CFWA 4QMQA 4A9UA 4TXCA 4GV1A 3FKNA 4CMUA 3O7LD 2CGVA 2IVVA 1QPCA 2PVKA 1LEWA 2CCHA 4XBUA 5AV3A 3VRYA 4HVDA 3ZUTA 3O50A 2OXXA 3KEXA 4JBQA 4D1ZA 2C68A 4AG8A 2ONLA 4YLJA 1FGKA 3C4ZA 1PXPA 2P0CA 4IE9A 2R64A 3RNIA 4MBJA 1QPDA 4ZS4A 5JN2A 3GXLA 3WARA 2EXEA 5AP3A 4Y8DA 1GIJA 2WO6A 4FOCA 4G2FA 2WQMA 3E92A 5D7AA 5FGKA 3ZOSA 4DAWA 5JSMA 3TUCA 1Y6BA 4RA4A 3ZONA 4RC3A 2A1AB 2YEXA 2ITOA 5FD2A 5CF8A 5A9UA 5ANIA 4RFMA 1XH5A 4ANBA 4EZ5A 3S0OA 4RWJA 4LOOA 4PNKA 4I24A 3WYYA 1J7UA 3FLNC 3R04A 3HZTA 4FT7A 1P4OA 3FHRA 2GCDA 2OZAB 4R3RA 5CX9A 4BWXA 1Y6AA 3OD6X 4PQNA 2Q0NA 1H1QA 5A14A 3DK3A 2B9FA 4NK9A 1M14A 2X39A 1ZY4A 3QTZA 4L6QA 2R5TA 3TNIA 2C1AA 4D4SA 3D5WA 3E7VA 1LP4A 2BCJA 3E7OA 3V51A 3P08A 2EB2A 3GU4A 1IRKA 1Q3WA 2O65A 4ZTNA 1ZMVA 1SMHA 2BHEA 3V5WA 4FTUA 3H0YA 5IKWA 3ZMMA 2BAKA 5I9VA 3R22A 3W8LA 4QMTA 3ZSGA 4ZMFA 5C4LA 2XF0A 4II5A 3HV5A 3EQRA 4XG4A 4WSYA 3EB0A 3EQGA 5KMOA 3OHTA 5AUWA 5LOHA 4CQGA 3KXMA 3GOKA 3QZGA 4MF1A 4EYJA 4YPSA 2RG6A 4BN1A 3AMAA 4CCBA 3HKOA 3GC8A 2GQRA 3O23A 4JG8A 1UU7A 2V22A 1U54A 3V8WA 4D1XA 3WF7A 5HTIA 1ZYJA 2SRCA 2XIXA 4JJRA 5BVEA 5LVPA 3FLWA 1JOWB 2C3LA 5CSVA 5CAQA 4C61A 4P90A 3HRBA 3OG7A 4NFNA 1FPUA 4OTQA 2HENA 3N4TA 2X4ZA 3BCEA 4G9RA 4HNIA 3U6IA 4FIFA 4IEBA 2GQGA 4XCUA 2CKQA 3D7TA 2XEYA 4O7VA 1MP8A 5L6WL 1PYXA 5CXHA 3NUYA 4E26A 5D11A 4CMTA 5HTBA 5IA5A 3UMWA 4XYFA 4XLVA 4C38A 3FWQA 3OCTA 5B7VA 2PMIA 5E91A 3LQ3A 3LM0A 3LPBA 1WCCA 3QXOA 3THBA 2XK6A 5FRIA 4B9DA 2ETRA 4L3LA 4HVGA 4S31A 4FZ6A 4FVPA 2W4KA 4RMZA 3ORZA 5JRQA 5G6VA 5IDNA 3R1QA 3ZO4A 4F1TA 4O7SA 4Y73A 3F9NA 3NIEA 3FMDA 3MB6A 1DAYA 4FNXA 4BI2A 4AN2A 5L4QA 2P55A 2X7FA 4FEQA 3S3IA 4MHAA 5HLPA 3UO5A 5CZIA 2G2IA 1TVOA 4LGHA 2GDOA 5IU2A 5FP6A 2WU6A 2PU8A 3OF0A 5CVGA 2PYWA 2Z8CA 3E3PA 4ZZOA 2QHMA 3I6WA 3NYVA 4IZ5A 3SOAA 3VC4A 3ITZA 5C9CA 3PZHA 2QKRA 3WF9A 3U6JA 2PSQA 4ZP5A 3TKUA 1Q8YA 3F3ZA 3TI1A 4XV1A 4C4IA 5AP1A 1R0EA 1J3HA 3FV8A 3KK8A 5IQHA 3R01A 2YLFA 2QHNA 1RQQA 3KREA 4RIYB 4FKVA 1YI4A 4FNZA 5TE0A 4FBXA 4GK2A 2I0HA 3BWFA 2CPKE 2IW6A 4E6AA 4ZY5A 3RPSA 2W4JA 4FIJA 4CG8A 4ZIMA 3D14A 5I9UA 2XA4A 2XNGA 1Y91A 2X2LA 2A2AA 5L2WA 2JEDA 3KKVA 5EQPA 5DI1A 1YKRA 3BHUA 4IDVA 3LFSA 3CIKA 3DTCA 1GOLA 3PLSA 4XOZA 4FF8A 4FV4A 1AGWA 3EFWA 4PL3A 4YO6A 2UZTA 4FV2A 4QO9A 5IZFA 4DEHA 5HCXA 4ZK5A 4P4CA 4QP2A 3EN6A 2PVNA 1XWSA 4CD0A 1OL6A 1RDQE 4IAYA 3BQCA 1U5RA 4QP4A 3K3JA 4YTIA 4PDYA 2Z2WA 3F6XA 5EW9A 5C8KA 4DFZE 3O8TA 4QOXA 3UOHA 3DKOA 3T9TA 3MY5A 4C3FA 4D4RA 3VUGA 4L7FA 4Q9ZA 3Q2JA 4XBRA 4C33A 2QD9A 1Y8GA 4EC8A 4YURA 5KO1A 5FXQA 1O6YA 4YTFA 2CNQA 4GG5A 3PYYA 3VBVA 4AWIA 4RGJA 3CR0A 4ANSA 4QTEA 4I0SA 4TTHB 2V7AA 3F2NA 4GVAA 4UALA 2A4LA 3QQJA 3PSCA 4ZSLA 5EYKA 4FT5A 5AV0A 5CEKA 4KD1A 1YOLA 3LCSA 2G15A 4HCUA 4CFXA 2OFUA 4Y46A 3DB8A 3QTSA 5LMKA 3FBVA 2QU5A 5GZ8A 3QA0A 3D0EA 3EQBA 2ITQA 4LYNA 3VUDA 3HMNA 4O7WA 2UZUE 3V01A 3UZRA 4O7LA 1K2PA 1VYWA 1PXOA 2F2CB 3NUPA 4UZDA 1YW2A 3POOA 4QTAA 4CVAA 3MFRA 5F20A 3DDPA 4KS8A 4AZVA 3A7JA 3AC8A 3TUDA 4FKUA 4K18A 4CFVA 4E5AX 5EHYA 4EHGA 5IMEA 3FLQA 5KUPA 4BDCA 2ONLC 4G6NA 5EQEA 3N9XA 3OTVA 5IH6A 1Q8TA 2XK4A 3OBJA 2QQ7A 3O8PA 4KUJA 3TZMA 3UVPA 4JG6A 4D9UA 1IASA 3KQ7A 3VQUA 3UQGA 3IONA 1G5SA 1YXVA 4G5PA 5IG1A 4JAJA 1Z5MA 2Q0BA 2Y7JA 2FYSA 3HV4A 5DVRA 5DFPA 4KRCA 3TJCA 4FV8A 3PA4A 3VS7A 5AV4A 5HIEA 2BZJA 3PP0A 4BCKA 4C3RA 1JPAA 3MSSA 4RFZA 3HUCA 4GVJA 4XG9A 4X2KA 2IW9A 1APME 4KBCA 3G6HA 4TYIA 2V0DA 4FKQA 4MWHA 2VRXA 3GFWA 4LMNA 5CVHA 2XRUA 4AS0A 4D2WA 5EK7A 3QTIA 5CAPA 3Q6UA 4TL0A 3R9OA 4BR3A 2BALA 4F1OA 3R63A 5JFVA 4APPA 3LFQA 2VO6A 1J7IA 1IAHA 4L68A 4JBOA 2W1ZA 4DT9A 4CNHA 4L01A 1E9HA 5FM3A 5E90A 3SRVA 2V7OA 4ONAA 5KZIA 1HOWA 2VTHA 2OF4A 3GGFA 4B0GA 4E4XA 1NW1A 4U81A 2EVAA 4JQ8A 4O7TA 2C5XA 4J98A 4MF0A 4NKSA 5IH4A 2PZRA 2QVSE 2E9VA 4FKTA 5B2KA 3HMOA 3BQRA 2ETMA 3CQEA 3HL7A 4NTTA 5JRSA 2JLDA 2R3LA 4DG0E 5J7BA 3R8ZA 4QPMA 2NP8A 3E87A 4MEDA 3DOGA 4G1WA 4AN3A 1Q4LA 2EXMA 4OTHA 3CJFA 4BHNA 4WOVA 5KMMA 4GSBA 4Q9SA 5HE0A 4PY1A 3N4VA 3FI8A 2C6KA 4HVIA 2HXQA 3QQGA 4YJOA 5H2UA 4AE9A 4EHVA 3BPRA 5KHXA 4IM3A 2PY3A 3DQXA 3QTQA 2HYYA 3MH1A 4BDKA 2YM5A 3LLAA 1YXUA 2HK5A 4IB1A 5KZ0A 4O1PA 1QCFA 3ZTXA 4CV9A 3A99A 2QLQA 1U46A 4FOBA 4C4FA 3FZPA 2XJ2A 5AAGA 1OL2A 4HCVA 3SW4A 1H01A 2XKEA 1IA8A 3E93A 3GT8A 2QONA 2VO0A 3LCTA 4HPUE 4FIIA 4KIKA 4M13A 4RX5A 4KKHA 3ATSA 4UX9A 4NW5A 2CGUA 2R3JA 3R00A 2VTLA 2YAKA 4XV3A 5GJFA 2GNFA 3A4PA 3RPOA 4UMRA 4QMWA 4ASZA 5AEPA 2HY81 3QTRA 4LI5A 4AN9A 5TF9A 3P1AA 4O0VA 4R1YA 2R9SA 5C27A 2QOFA 3FKOA 3L9NA 5J5SA 3SVVA 5CANA 1YWNA 4YJUA 3BGQA 4G17A 3H4JA 3PIXA 2I1MA 2BDJA 5IA4A 5M06A 2GNGA 3W55A 3FMEA 4HZSA 2FSLX 2B9HA 3VUTA 4LL5A 4PV0A 3TXOA 1PW2A 2WIPA 2RFDA 2J0MB 2XNMA
chains in the Genus database with same CATH superfamily
4MXZA 3C7QA 5LCKA 2BRBA 4X2GA 1YHSA 2YHVA 4KB8A 3NRMA 3PXKA 2NYAA 1HCKA 2NO3A 3IQ7A 2O64A 4EOJA 2A19B 4O0SA 3ZDIA 4BCHA 1G3NA 4YZ9A 3TZ9A 2X8EA 2PWLA 1NXKA 4QT1A 3Q53A 2WPAA 5BPYA 3UC4A 4TKSA 5E92A 4U3ZA 2UW3A 1TFFA 3LMHA 5CSWA 3TV4A 4JDJA 5DT3A 3TMOA 2WOUA 3KF4A 5AV2A 5KMIA 4A9SA 3UZTA 3TACA 4OTRA 4XG7A 4FEVA 5A54A 3RHXA 3LFEA 5IEYA 1OBGA 3FJQE 5GZ9A 4DFLA 4BCFA 2GTMA 4TY1A 2B54A 2R3RA 4FKIA 1BUHA 2QC6A 4WNPA 5IA0A 3HAVA 2JBPA 3NMUF 3NPCA 2OWBA 4ITHA 4USFA 4O4DA 3LCKA 1U5QA 4BHZA 4ARKA 5HESA 4WA9A 1KWPA 4C4HA 2HXLA 2YM7A 2YZLA 2B1PA 3S4QA 4FV9A 4O91A 1ZYDA 3ERKA 4R77A 3QD4A 2ZDTA 5AUUA 4BKZA 4FT0A 3G9NA 2WGJA 4NTSA 4WNKA 4PNIA 4E5WA 2A0CX 1UWHA 2C0OA 2WQNA 4KA3A 4ZTSA 4O22A 2HAKA 3DBFA 2WNTA 4I6BA 5DRBA 2C6DA 5EOBA 4RIXB 4DLIA 4FZ7A 4D2PA 3MBLA 2UZVA 5BVKA 2YACA 5EFQA 2I0VA 3L1SA 5EI8A 5EM8A 2QO7A 3JVSA 2ETKA 1QL6A 5GHVA 5HBHA 1OI9A 4FTLA 5TKDA 1CTPE 1YQJA 2GQSA 3C13A 2ERKA 2BPMA 3OXTA 2XNOA 3RPRA 4EOOA 5HICA 5BMSA 2IZUA 4EBVA 3LVPA 3HV6A 3CQUA 3NS9A 3MV5A 1OPLA 1WVYA 5M4CA 2W17A 5DR9A 3D83A 2RFNA 4CRSA 4XV9A 3FC1X 2E9NA 4LUDA 2W1GA 4AOIA 4O1OA 4ZLOA 5L8LA 3TKHA 3LOKA 4QD6A 3BHHA 4F0FA 2PUIA 3BV3A 5LJJA 5E8VA 4ASXA 1A9UA 4C62A 3DS6A 3F3WA 3MTFA 4FICA 1H00A 3WF6A 3E3BX 3FMJA 3P7BA 4E6CA 3I0OA 3MA3A 5AWMA 4O86A 3QGWA 4H3PA 4RRVA 3DDQA 3K3IA 5DLSA 4FV3A 1YWVA 5CU2A 2BZHB 4DFYA 5LMKC 4FYOA 4FSZA 3QBNA 1JKTA 3HX4A 3LAUA 1ZWSA 3FC2A 3LZBA 5AUVA 4J8MA 3GBZA 1OECA 3KFAA 3DJ6A 3W1FA 4LV7A 5JZJA 3DJ5A 4IJ9A 2VTTA 2WMWA 3EQFA 4FL2A 3UNJA 5IMXA 1PKGA 3DB6A 4C7TA 3IDBA 4EK5A 3ZYAA 3FEGA 3BU6A 5EM6A 4UYAA 3FMHA 4O96A 4W4WA 1QPEA 3GU5A 4QMZA 5HEZA 3PSDA 3F3TA 2HIWA 3EWHA 4LRKA 3SG8A 4DBXA 5L6OA 5JT2A 4S33A 1Q61A 3NUNA 1W7HA 2Z02A 2WMBA 4TWOA 4WG3A 1ZY5A 3DBDA 4PL4A 4J7BA 1FMKA 4IAFA 4YP8A 1YDTE 2PULA 1H1PA 1VYZA 4ANMA 3CD3A 3FZRA 4ACMA 3MN3A 2PVRA 4NCTA 3P78A 4E1ZA 4IACA 3ZUUA 2O8YA 4IM0A 5HO7A 3ATTA 5M55A 5GNKA 4LDTA 2R7BA 5C03A 3R8LA 2B7AA 3LE6A 4FZDB 3FMMA 4W9WA 1JBPE 4GU9A 4EONA 3LFCA 1WBWA 3QGYA 2J6MA 3BYOA 4MTAA 4CT2A 4AZFA 4HYIA 2VWXA 4I5HA 5AR2A 4G3GA 4DYMA 4AAAA 3BKBA 2YERA 1XR1A 2XM8A 3DBEA 4E4MA 2X0PA 4RQVA 4P5ZA 5IQCA 4D4VA 5FDPA 4TWNA 4EH6A 3FMLA 3OUKA 4DG2E 4DGLC 4O0XA 1CDKA 2BRHA 5IH5A 4BI0A 4DGMA 5LVNA 2E9OA 1RJBA 3AD4A 1BKXA 3HLLA 3PVBA 1M7NA 4IQ6A 4OT5A 1FMOE 2YIRA 3MVJA 4ACHA 1J7LA 3EH9A 3DAKA 5JFSA 4ACDA 2J4ZA 4LM5A 5A4TA 2XCHA 4K11A 4CYIA 2WD1A 1ZMWA 3TIYA 2REIA 3UOJA 3KN6A 5EHOA 3TM0A 1XBAA 5CASA 3FYKX 5EHLA 5A3XA 5CEIA 4YC6A 3OVVA 3CY3A 4BCQA 4F6SA 5JEBA 3W0OA 3LHJA 2YM3A 3NYXA 5AIKA 2PMOX 2ZB0A 2JKKA 4E5BA 5HTCA 4GKIA 5HCZA 3ENMA 4L46A 4XG3A 3BU3A 1GY3A 3TV6A 3GU7A 4DTKA 4Z3VA 1JAMA 3AC5A 4FSWA 3C0HA 3IW6A 4EEVA 4F9CA 3DCVA 1IA9A 4FL1A 3UMXA 4BCIA 1J1CA 3QZFA 3HYHA 5AR8A 3DKFA 3R7VA 5AM6A 4OW8A 4WNMA 4ZOGA 1DI8A 2EB3A 5I5ZA 4IC7A 5ANOA 5FWKK 2RKUA 1PRYA 1V0BA 2YM8A 3WOWA 2ITVA 3W10A 1PJKA 1ZYLA 4WD5A 4XS2A 5C8NA 3S00A 3PPZA 3BLHA 4K77A 4NWMA 3GNIB 5HG9A 5IF1A 2IG7A 2C3JA 5ACKA 4TYHA 4QP7A 2DYLA 3ZEPA 4IVCA 4USDA 3H10A 4P5QA 5IQFA 1NVRA 1UU8A 3HV3A 4AGWA 3R21A 3G0EA 3OZ6A 3ZLWA 1KE7A 3OFMA 4KSQA 4BZNA 4K0YA 4RVKA 2ZYBA 4NZWB 3L9LA 2AQXA 5AUXA 4M84A 2W1HA 1ZYCA 1W2CA 5AAFA 4CTBA 4FTOA 5HCYA 1OL5A 5HVJA 4BDEA 4GMYA 5KMJA 3KGAA 3LIJA 2WMUA 3KRRA 2OIDA 3UQCA 3VBYA 2BDWA 4IVDA 4GK4A 3EYHA 3DQWA 3LMGA 3PG3A 4I5MA 4NW6A 3LJ0A 2E9UA 2WEIA 3CBLA 3HAMA 1R0PA 2JDVA 2XJ1A 4G3FA 4ERKA 3PA3A 4HW7A 4O27B 3S1HA 5DIAA 1OKVA 3PDTA 2YDKA 5JQ5A 4W9XA 3QKMA 4JQEA 5HE3A 2R4BA 4Z16A 1URCA 4RWLA 2QR8A 2JBOA 2XVDA 3EZRA 4JDKA 5DBXA 3RWPA 3FZSA 2W9FB 5AR7A 2XK7A 3NW5A 3U9NA 1M7QA 1O6LA 3IO7A 4FTAA 4OGRA 1LR4A 2UUEA 5IISA 3VS6A 1REJA 2DS1A 3Q60A 4R78A 4EHZA 2VWWA 4A9TA 4PP9A 5AJQA 1G8KA 4CLJA 4GKHA 3NAYA 3VF9A 4D2RA 4ITJA 4GEOA 3L9MA 4I6HA 1XH8A 4FE2A 4FKSA 4BYIA 4YPDA 3MESA 2I6LA 5ANKA 3PRIA 2VGPA 2OF2A 2FVDA 3HV7A 4CTCA 3LKMA 4J71A 2UZBA 4ID7A 1YXTA 2PVJA 4MXOA 4YLLA 1DS5A 1JNKA 3COIA 1WBTA 3JS2A 2O63A 3MYGA 4DT8A 4AP7A 2ZOQA 2OH0E 3PXFA 3D4QA 3E8NA 4U97A 4YSJA 3V6SA 4B99A 5A6NA 4GYIA 2RG5A 4L3JA 3COMA 4EQCA 1QMZA 4W4VA 3SV0A 1P2AA 4Z9LA 3ZC5A 3SD0A 1OM1A 4APCA 1LPUA 1PXLA 2XKFA 4OBPA 4I5PA 4FEXA 2UW7A 2WMTA 4J52A 3NEWA 4X3FA 3ZHPC 2OIBA 2UW6A 3Q9XA 4FG9A 5HQ0A 4ZJVA 1V0PA 1JWHA 2IPXA 5ETCA 3FY0A 2Y8OA 2FSOX 2JIVA 5E7RA 4FGRA 4GIHA 3WZJA 4D4YA 4I4FA 2HCKA 3FKLA 4DEEA 3U87A 3PLAE 4TN6A 1H4LA 1UU9A 2CNUA 2E9PA 3BE9A 3OXZA 1H26A 3E64A 2JGZA 5AUZA 5I9ZA 4K33A 1B6CB 2YIXA 4MD9E 3EFJA 3NR9A 5AP4A 4O2PA 3C5IA 2W0JA 3W2CA 1SNXA 3BRBA 4IC8A 3QCQA 3R9DA 3RHKA 2X0QA 1PMUA 2WAJA 3A7FA 3RVGA 4KKEA 2VX3A 3I0QA 4FL3A 3A2CA 4YTHA 3FI4A 2QOKA 4BJJB 3EN5A 4RJ5A 4AT5A 5FXRA 1UU3A 4XNEA 1OITA 2J9MA 5BUJA 4WBOA 3QRTA 3DLZA 5J1WA 3M42A 5CY3A 4E3CA 4X2NA 4XJ0A 4XP0A 4IJPA 4PX6A 1DM2A 3H30A 3FQEA 5BYLA 3FHIA 3HDNA 4LV8A 4NJDA 4IB5A 3R8PA 4UN0C 2PL0A 5EG3A 2QOIA 1Q41A 4PP7A 3D15A 4K1BA 3F5GA 2CLXA 2VAGA 2BROA 3KRJA 4A4XA 3ORXA 3P5JC 3E8CA 3R7OA 3I5ZA 4IAKA 5D1JA 4D0XA 4AGUA 3CGFA 2R3QA 3BELA 3ORNA 4I0TA 4J99A 2XEZA 1OB3A 1Y8YA 2FGIA 2C0TA 3PVWA 3PE2A 4O0RA 4MWIA 3VBTA 4ACCA 4D2VA 4D55A 4O81A 3MY0A 3Q4UA 4M69B 1BL7A 4YJQA 4EI4A 4BCNA 5J5TA 4M14A 4AACA 3C0IA 3EL8A 2C6LA 2JIUA 2VU3A 2X2KA 2Y4IB 4QNAA 3TNPC 4QYYA 3V8TA 4DH8A 2PZYA 3DZOA 4QP3A 3FMKA 4I92A 5BVNA 3PFQA 1XH9A 5FEQA 5ANDA 2YIWA 5FUTA 5L2TA 3PWDA 4YBJA 3CP9A 2ZAZA 5CWZA 3Q2MA 4JI9A 3VS0A 2X6DA 5ETIA 1B39A 3UOLA 4FSYA 4MQ1A 1Q62A 2OKRA 1LUFA 3QQHA 3ORMA 4BBMA 3E63A 2YZAA 3IW4A 4HGSA 2YITA 3DKCA 4I4EA 4R6VA 3D7ZA 3A60A 4FSTA 4K2RA 3RAHA 3BBWA 3CE3A 4QP9A 4GT4A 3UDBA 4XRLA 3ENHA 3NCZA 4NKAA 4BTMA 5FTQA 2GPHA 4UV0A 4MXAA 5KE0A 1ERKA 2VWYA 4R7BA 3B2WA 4TYEA 2QOQA 3CTJA 3SW7A 4DGGA 2BILB 2IJMA 2JFMA 2QOHA 4CFFA 4IM2A 5L2SA 1OVEA 4IVAA 4NM5A 5HNIX 1OKWA 4HYHA 4W4YA 4RIWA 3VRZA 3GCVA 3Q52A 3I7CA 1UVRA 1E1VA 1UNLA 3UGCA 4EOKA 4M97A 5K0KA 4QMUA 5CF5A 4Y95A 4WKQA 3EN7A 5CEQA 5I3RA 1OPKA 3QD2B 5J9ZA 3V5PA 3HEGA 3WZDA 4H3BA 4DHJA 3OOGA 5HE2A 4U0IA 1KUTA 4X6RA 4AU8A 3VBWA 3QALE 4BDFA 4H05A 1OL7A 4U80A 2V55A 1S9IA 4DEGA 4R7IA 3O71A 4RWKA 3PXYA 2GHGA 5EH0A 5E8TA 2IZRA 4BGGA 5CF6A 2VV9A 4RJ6A 4C36A 3I79A 4DFNA 3UOKA 3RKBA 3FY2A 1BL6A 2QOCA 4U8ZA 3CEKA 4NEUA 5E8SA 3UBDA 5KHWA 3PXZA 2VTPA 3E62A 4K8AA 2XIZA 3F66A 2B53A 5EM5A 3QQKA 5HHWA 1KSWA 4N57A 1URWA 3QAME 2OW3A 1GZKA 5AP7A 5EKNA 3C5UA 2OI4X 4KRDA 5J9YA 1JQHA 5HD7A 5IUGA 1PXJA 2CN5A 4I41A 3MDYA 4X2JA 1H08A 3TL8A 2P2IA 5AUTA 5I9WA 3O51A 1SVHA 5DWRA 5IEXA 5DPVA 4S30A 1U54B 4IFGA 2R3PA 4HYSA 1M2PA 3QRUA 4MX9A 2HZNA 3KRWA 2F57A 3HDMA 4ZTHA 3FL5A 4EOSA 1RW8A 2C5YA 5DE2A 2V5QA 2W1CA 1W84A 3MA6A 3QRKA 4O84A 2VTIA 4GIIA 4QP6A 4A06A 4JT3A 2CSNA 4QQTA 2IVTA 2PZ5A 5CAOA 4I1ZA 1JKLA 3R83A 4A7CA 3D7TB 4QDEA 4M7IA 5HI2A 2AC3A 4DEIA 4EK3A 4ZJJA 4AW0A 2R7IA 4BGQA 3FI2A 4FODA 5AP5A 5CT0A 4F65A 4C57A 3PE1A 2PMNX 3HUBA 4NSTA 4WG4A 2BZKB 2QOOA 3SHEA 5GIOE 4ZJIA 3AC1A 3MIYA 2QU6A 3SAYA 4BDAA 2Z7SA 4FT9A 3OS3A 4J53A 3VHKA 4RQKA 3ANQA 4KAOA 3UVRA 3R8UA 3HGKA 2BIYA 3FYJX 3NWWA 5HLWA 4BC6A 4MBIA 5IQGA 4RWIA 5AFVA 3Q6WA 2BIKB 3BGZA 3DGKA 3H9FA 3K54A 4LRMA 3ZS5A 4DFXE 3TKIA 3PY0A 1JLUE 2X4FA 4PRJA 5HBEA 4QNYA 2XARA 4WBBB 4XP3A 3R8VA 2CKOA 1ZAOA 1PKDA 5CSPA 2J5EA 2Y4IC 3ELJA 3QYZA 4N70A 3WIKA 2R3GA 4YHJA 3R1YA 1ZRZA 3DAEA 3JVRA 1OIRA 4QTBA 2WTDA 3ZEWA 4EZ7A 3ZFYA 4DGOA 5M4UA 3BIZA 1OKYA 2PTKA 2VWBA 3KF7A 4WHZA 3OMVA 4BDGA 3R0TA 3W16A 2WTKB 4UBAA 3O8UA 4IH8A 3DT1A 3Q4CA 4FTKA 4HNFA 4OR5A 2WMQA 4M68A 4U41A 4C34A 3V6RA 2GS2A 4C58A 1UV5A 4Z55A 2R3FA 3QUEA 3VS5A 3JR1A 4D2SA 5GINE 2BKZA 5JGDA 4G3EA 3TTIA 5IPJA 5JGBA 1V0OA 4TNDA 1DI9A 4OTDA 3AT3A 5E8UA 2YA9A 3UZPA 4TWCA 3NYNA 3B8QA 1OIQA 3C51A 4F9WA 4WSQA 3I60A 2WZJA 3EYGA 5KCVA 3NW7A 4FNWA 3VBXA 3QCSA 4JIAA 4I23A 3QCYA 3GUBA 5A4QA 3BHYA 1W98A 2GNIA 1W2DA 4YLKA 4C02A 4E7WA 4AZWA 5IQAA 4YMJA 4IBMA 4GFGA 3KY2A 4UWCA 5KKRB 3FMNA 4RPVA 4E6QA 4EOQA 3W0MA 3VQHA 4OTWA 4V01A 5BX0A 2ITUA 2XBAA 4F70A 1ZOEA 2H34A 4D0WA 5HU9A 2KTYA 4AUAA 3AOXA 3GCQA 4GS6A 3CXWA 3UPZA 4XUFA 3BE2A 4MKCA 4WUNA 3GCSA 4CLIA 2GFSA 1PXKA 4AX8A 1Q3DA 4YZBA 5GZAA 1BX6A 2X8DA 2H6DA 2XK9A 3MPMA 4PTEA 4BYJA 1T45A 2HZ0A 3AQVA 4AAYA 1STCE 1YOMA 4JIKA 3G5DA 5FG8A 3TDWA 5A46A 4PL5A 2ERZE 3QC9A 4V0GA 3DA6A 2YCRA 3MFTA 2QI8A 3GFEA 3BYSA 4EK6A 5KMNA 1YVJA 3TNQB 3ZZEA 4BTJA 1Q8WA 3VS2A 3NNWA 2CCIA 3F61A 4OT6A 1ZZ2A 4D5KA 1UNGA 4Y5HA 5AAEA 3R9RA 4E8AA 4KABA 2C3KA 2B4SB 3CTHA 3ORPA 4N6YA 3N4UA 5M4FA 1MQ4A 4DTAA 4KBAA 5T6KA 4YR8A 1CKIA 3NCGA 2BRNA 4FX3A 4Y5QA 2G2HA 4AQCA 4Q5HA 2IVSA 1Y57A 4KWPA 5K5XA 3OWLA 5E4HA 3CD8A 5BVDA 1F0QA 4R5YA 4E4LA 1SVGA 4DE4A 3FSFA 3VS3A 1H24A 3HRCA 4LUEA 5IUIA 4NT4A 3TEIA 2R0IA 3TJDA 5HVKA 4P2KA 3ORIA 4RZVA 4U5JA 1UKHA 4EK4A 4HVHA 1MRUA 4XLIA 3WZUA 4YNEA 4KBKA 3DTWA 4IFCA 4NIFA 5F94A 1GJOA 5C01A 3AT2A 3RALA 1H07A 4GW8A 3W8QA 1SZMA 1TKIA 1BI7A 2XB7A 3RMFA 5J7HA 1SNUA 3NNUA 5HE1A 3ODYX 4B4LA 3WIGA 4A9YA 3PG1A 3C9WA 2PVHA 2FH9A 4U3YA 1WBPA 5DNRA 5EDQA 1OZ1A 2C1BA 3FZOA 3FLZA 4QPAA 1M52A 3MH2A 5FBNC 1GIIA 3W2PA 2XMYA 3KULA 5JGAA 2H9VA 4YHFA 4FKOA 3UC3A 1YI3A 4FGBA 4AFEA 5AADA 2WMSA 3IGOA 2P4IA 4FIGA 4MXCA 3ZCLA 3R2BA 4LG4A 4O83A 4HGEA 3C4CA 3ZO1A 3M11A 3AD5A 3RM6A 2RFEA 3SRVB 5J1VA 1GAGA 2XAMA 2RFSA 2DUVA 4H58A 5F4NA 4EH3A 3MPTA 4MAOA 3A7HA 3SX9A 2F49A 4R8QA 4Q5EA 2WTKC 3OWPA 4WIHA 5LCJA 2R3NA 4IZAA 4LGDA 2BMCA 3P79A 2CLQA 4KNBA 4Z7GA 2WOTA 1OBDA 1OUYA 3ALOA 3ZXTA 2PE2A 3LQ5A 2ZJWA 3HNGA 5HKMA 5J79A 2OLCA 3OTUA 2CN8A 4CGAA 3EQIA 4MK0A 3W32A 2DWBA 2WTIA 4AF3A 3LXNA 1Q99A 3OBGA 4FZAB 2JITA 3NIZA 3TDVA 3FZ1A 2VGOA 4JL9A 3EQCA 4ZY4A 3G15A 3C4FA 3I81A 3L8VA 2KULA 3PSBA 3ZXZA 4MXYA 3TNWA 2FSTX 3O17A 2W99B 5T68A 2B52A 2YCFA 3U6HA 4A07A 5HZNA 2J0KA 4RX9A 3V5JA 4C0TA 3SG9A 5KKRC 3T3VA 3ORKA 4YBKA 2X0OA 4KIKB 3IW5A 4TT7A 4XV2A 4LL0A 2OK1A 5BYZA 3T9IA 4EH8A 5FDXA 4EYMA 3CGOA 3LJ2A 3VHEA 4ZTMA 2X0GA 1MQBA 3GU8A 5FXSA 2ZM4A 5CI6A 4YZMA 4X3JA 4B7TA 3RCJA 2GNLA 4L53A 3IPHA 4RIXA 4PMTA 4BTKA 2J0LA 3EL7A 4KIOA 2HZIA 4OTGA 2VWIA 3ZZWA 3I4BA 4L67A 2CKPA 3AC4A 5HU3A 4YU2A 4DG3E 1PF8A 4L9IA 4C4EA 4E6DA 2PVLA 4EH2A 4IHPA 4YGAA 1MRYA 3ZSHA 3AG9A 2PUPA 3Q4ZA 1ZMUA 4PUZA 4RVMA 2C5NA 4ZSGA 3W0RA 3Q04A 4QYGA 3G0FA 3UO6A 4D5HA 2EUFB 4G3CA 3MGYA 3EKNA 3SKCA 5CT7A 4FUXA 5DH3A 3UTOA 4DHIB 4LV5A 2XNNA 4L45A 3R9NA 4GYGA 3KULB 3IECA 1G8SA 3LFNA 2R3HA 4RC4A 1H0WA 1K3AA 1Q8ZA 2XYUA 1NT2A 3A4OX 4FI1A 1PXNA 5DHJA 3MVLA 4DHFA 4IWPA 5JZNA 3CKWA 1JVPP 3BI6A 2QODA 3MFUA 2YCQA 5IA3A 4GG7A 3VULA 1M17A 4DEAA 4F9AA 3PWYA 4AOJA 2QKWB 2YFXA 3JXWA 3OXIA 4YJRA 1ZLTA 3O0GA 2P2HA 3QYWA 5EOLA 4X6QC 1UWJA 4GJ2A 5LVOA 3V04A 1W82A 3AKKA 4QTDA 2W5HA 5BMMA 4J95A 3PJ1A 3W18A 3UIBA 4PPCA 3ALNA 5TO8A 3HMMA 2IEWA 3QUDA 4FC0A 2CNVA 1V1KA 1UKIA 2R3MA 1IR3A 2F7ZE 3QFVA 3BEAA 3DFAA 4IWQA 4R5SA 5CU0A 4C37A 3N51A 3QLGA 1M2QA 4Y85A 4MNEA 4O82A 4JS8A 4F1MA 3UIUA 3DLSA 5F95A 2XUUA 3TNHA 4M15A 4XMOA 3B2TA 3OOMA 2OBJA 3U4WA 2YJRA 4C4GA 4FYNA 2RL5A 2YN8A 3FI3A 4RVLA 5AP0A 3WF5A 5DMZA 1JSTA 4JBVA 4ZTQA 5ICPA 3WYXA 4LMUA 4GH2A 5JKGA 1TQIA 3KL8A 2YAAA 4G16A 3DY7A 4JDIA 3KXXA 5EW3A 4AGDA 4AZTA 3WBLA 2C6EA 4GT5A 3LFFA 2BR1A 2VTAA 5IQDA 4JDHA 3I7BA 3JY9A 4FVQA 3ZFXA 4FV6A 1H1SA 1WBOA 4FKPA 5I3OA 4EL9A 2J51A 4IW0A 2OICA 5K5NA 1W2FA 3FLYA 2OZOA 3FPMA 1VJYA 3EZVA 2ITXA 1H27A 4Q2AA 1W0XC 1YOJA 2OJFE 1NA7A 4F4PA 5C1QB 5FBOA 1RE8A 3VS1A 4U42A 4FTJA 3MWUA 3F69A 4LOPA 3FLSA 2WQBA 4QMYA 3PJ8A 2PVMA 5CF4A 2HZ4A 3IS5A 4OTFA 1XJDA 2V62A 3L8SA 3VJOA 3QC4A 4H1JA 4GJ3A 4YJVA 3IW7A 2OJIA 2P3GX 2YIYA 2JAVA 3PP1A 5LMBA 3ZH8A 4TPTA 4I0RA 4FIEA 3NAXA 1ZYSA 3BYMA 1TQPA 3OWJA 4X2FA 4ZAUA 1CM8A 2ZV7A 5GIPE 3COHA 2O0UA 4K6ZA 4L52A 4CG9A 4FSUA 4AXDA 3SGCA 3RPYA 3RWQA 4KIPA 3NUXA 4AE6A 1NY3A 2O2UA 5CENA 1GZNA 1HCLA 1R78A 2BAJA 2NRUA 3GC9A 4IX4A 2CMWA 5LARA 3EN4A 2J7TA 4BCGA 4O21A 4I6LA 4GK3A 2VWZA 2XCKA 4FNYA 4DHZA 3DPKA 3QTUA 4S2ZA 1CSNA 4HJOA 4U79A 3NVKI 3U51A 2PE1A 2BUJA 3H9RA 2VTOA 4JBPA 4JQ7A 2XJ0A 2JAMA 5F9EA 5I0BA 5JFXA 3FE3A 3MFSA 2ITPA 4BRXA 5HLNA 1GZ8A 1YHWA 2OFVA 2XM9A 2XYNA 2BDFA 3QRJA 3UO4A 4FZFB 3GQLA 1U59A 5BNJA 3FXXA 3GVUA 5M56A 3RZBA 3F82A 4ZTRA 4BGHA 1XHAA 1WBNA 3R1SA 4CZYB 5CSXA 4QTCA 4WRSA 2JDTA 3KC3A 3ORTA 3ULIA 4A4LA 3HMPA 4H39A 4I3ZA 3BBTB 4QMXA 1BI8A 3TN8A 4D28A 2VWVA 4CV8A 5HNBA 4U43A 3U4UA 4CKJA 4NUSA 4TWPA 5EKOA 3R02A 3IGGA 3LXPA 2UV2A 4JX3A 4XG8A 3ID6C 3G33A 4ZTLA 1FGIA 3C4WA 4RJ7A 2NRYA 3HA8A 1BLXA 1UA2A 3MVHA 3NUUA 3U8WA 4AW1A 5HNGA 4G6OA 4DTBA 3A8WA 4A4OA 1WVXA 4F6UA 3P4KA 1XBCA 2B9JA 2YM6A 4J97A 4UMQA 2DQ7X 1XO2B 3IDCA 4QMVA 4AXCA 3DAJA 4FV5A 1Z9XA 4GL9A 4I5CA 5D9HA 1J91A 1GZOA 2R0UA 5EI6A 4IWOA 4DF3A 4ZSEA 3FXZA 5BUIA 4OBOA 3WZEA 2XIKA 3QD0A 3A7IA 2BFYA 1PMEA 3I5NA 5FTOA 1UNHA 2EXCX 2UZLA 4U7ZA 2QNJA 1SVEA 4I22A 5IEVA 4ALUA 1YXSA 3OY3A 1WFCA 5L2IA 4PPAA 3GC7A 1PHKA 3DU8A 4K9YA 4MVFA 4QP1A 5H9BA 3D2KA 3W2RA 4XOYA 2RF9A 3CJGA 1Q97A 4NM3A 3ZFMA 5BYYA 3LCDA 1XMMA 4EH9A 2H96A 3IDPA 3ETAA 5LXMA 3B8RA 5DGZA 1BMKA 2Y0AA 4F7JA 2OJGA 2OU7A 4F64A 3O96A 1CKJA 1F3MC 1O6KA 3A8XA 3WF8A 4ZSAA 4QQ5A 4AGCA 3PVGA 4H3QA 2AUHA 5AX9A 2ITWA 3PJ2A 4TYHB 2PMLX 3FUPA 3ZO2A 3GCUA 4CYJA 4BIBA 4DINA 2XP2A 1H28A 4CXAA 3A7GA 3NLBA 4D9TA 5HGIA 4UEUA 4QMLA 2VX1A 2HW6A 2XK3A 5EYCA 1WAKA 3RK7A 3Q5IA 2RGPA 4DITA 3QZIA 4RLLA 3V3VA 5ITAA 5KMLA 3MH0A 2G2FA 4BIEA 5ETFA 1P4FA 3GQIA 5TT7A 4MUQA 5ETAA 3CLYA 2WHBA 3GCPA 3TUBA 3E88A 2X9FA 4UMPA 5DRDA 4H1MA 3ROCA 2HOGA 5IA2A 2IZTA 4C59A 3MJ1A 4MBLA 3KB7A 5BUEA 4QPSA 4JRNA 5HX8A 4IAIA 3MW1A 3AGLA 3QQUA 2X7OA 3D9VA 3GB2A 5JQ8A 4BWPA 2QR7A 3ZRKA 4ORKA 4JR7A 4ASDA 4UZHA 4IZ7A 1PMVA 3SDJA 5EYDA 4G3DA 3NX8A 3QHRA 4EOPA 4U6RA 4O4CA 3IW8A 5IA1A 2W06A 3C1XA 4PDOA 3W2OA 4PDSA 4TZRA 3QHWA 4DGNA 3BHTA 4NL0A 2ZM3A 4QMPA 3ZR