4KIQA

Crystal structure of mitogen-activated protein kinase 14 (p38-h5) complex with ethyl 6-((5-(cyclopropylcarbamoyl)-2-methylphenyl)carbamoyl)-1h-indole-1-carboxylate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
338
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title The Identification of Novel P38-Alpha Isoform Selective Kinase Inhibitors Having an Unprecedented P38-Alpha Binding Mode
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 338
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kiqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kiqA01
1FGKA 4DHFA 5I5ZA 3H9OA 1Y91A 2A2AA 4UXQA 5AAEA 5AV3A 2OH0E 5AAFA 2BIKB 4E5AX 1XJDA 3NYXA 2VWUA 3OXZA 1PMUA 1FVVA 1QL6A 2CLXA 5AIRA 4Z9LA 2PWLA 3REPA 4O22A 4YJPA 2WOTA 3RK9A 3I6UA 3BQRA 1UA2A 5HHWA 3QHRA 4BC6A 3EJ1A 2UZVA 4YR8A 4EHGA 1UU8A 5C8NA 3DAEA 2ZV2A 4PTEA 3IONA 4NT4A 5L8JA 3CSVA 5KMNA 4I21A 4YC3A 4KB8A 2Y0AA 3ZONA 5DYJA 4FNXA 3HUBA 3UNJA 3VF9A 5CF6A 3GVUA 2IVTA 3KB7A 3KRXA 2XNMA 2BAKA 1DAWA 2XRUA 4E6CA 3OZ6A 4K1BA 5DT0A 5E8SA 2BR1A 2WB8A 1XBAA 3JVSA 5EM8A 1YHWA 2I1MA 5A9UA 4I92A 3D7ZA 1V0PA 3OMVA 3ORNA 5K4JA 3HV4A 2HZNA 3RI1A 4MD9E 3R8LA 4D2PA 3R9RA 2UW5A 4F9AA 2GFCA 4S34A 4RVTA 4EC9A 3EQCA 3SVVA 3Q2MA 5HIDA 1J7LA 4ENYA 4BDCA 4QPAA 2BRGA 4BB4A 2BRBA 3UC3A 4HGLA 4DGOA 4YJQA 4A07A 4FKPA 4RIWB 5M4IA 2ZAZA 3F3UA 3FE3A 4CG8A 1JKLA 4H36A 4HPUE 3ELJA 4OTGA 4AA0A 5JZNA 3KY2A 3H0ZA 4RLLA 4UX9A 3PIYA 4W9WA 3AGLA 4FT9A 2YCFA 4DH8A 4IQ6A 1ND4A 5LOHA 4USDA 4DT9A 5KMMA 3IW5A 3OUKA 5AUXA 5J7HA 4IFGA 4UEUA 2CMWA 2Y4PA 3M1SA 3OT8A 3ZSIA 3GCQA 1ZYLA 2OKRA 2UZWE 3K3JA 2WMRA 2BDWA 3C0IA 1U5RA 2E9VA 2C6KA 3R0TA 4TNDA 4DFYA 2NP8A 3GOKA 4J1RA 3NYVA 4IZAA 3ORZA 1NA7A 4FIJA 1PXKA 4BF2A 3UZRA 2JKOA 2W06A 4FEXA 5CU2A 4XYFA 5CI6A 2RFSA 4QD6A 5IQEA 5IH6A 2UZOA 3SG8A 3C4WA 3GQIA 2Y4IB 4RIWA 5IPJA 2IO6A 5FWKK 3NUSA 3SX9A 2PMNX 2XM8A 3OEFX 2PK9A 4Y85A 3R01A 2ITXA 2WTJA 3GCSA 4MAOA 3AGMA 3E62A 3R22A 4NK9A 3R8UA 1OIUA 3ZO1A 4IAIA 4D1ZA 1QPJA 3PLAE 2YDJA 2W05A 2W0JA 5CSPA 2B9FA 3D5UA 5HTBA 2OICA 1F0QA 3HVCA 4HOKA 2R3IA 2ACXA 4XP2A 2VUWA 4JX7A 1PY5A 4IAAA 3O2MA 2C5XA 1SYKA 4AT5A 3BIZA 4GV1A 1KE6A 1JLUE 2J2IB 4UY9A 1PYXA 3COIA 2JEDA 1Q8WA 5E1EA 3EOCA 2CHLA 5DFPA 5HNGA 4ZK5A 3TNWA 3DBDA 3WZDA 2XK8A 4QQTA 2ETMA 2ITYA 2O64A 2XJ0A 2YM7A 4FOCA 2VO0A 3W18A 1ZYJA 3IOPA 4KS7A 5AP6A 5FGKA 5B7VA 3T9IA 5CF4A 3GB2A 3PJ2A 2P4IA 2BDJA 3LJ0A 4I24A 3R9DA 2F9GA 3CKXA 3PIXA 4QO9A 3G90X 2A1AB 2XIRA 5A4QA 1XR1A 3E88A 2BZKB 5EM5A 2UZLA 3RWQA 4EK4A 5BVDA 4ZY4A 2YLEA 3IO7A 1UKHA 4FTOA 3BHTA 1ZY5A 4F70A 3HMIA 3BI6A 4HCUA 3TXOA 4ANBA 5C1QB 4CFNA 3HP5A 1CKJA 4NEUA 1JNKA 1VYWA 4NZWB 4DH3A 5CALA 1FQ1B 2VV9A 3S4QA 4BDGA 5DHJA 4ZTQA 2VU3A 3UJGA 2ITUA 5CQWA 5JT2A 3QRKA 4FV7A 3ZC5A 3EWHA 3SAYA 3R2BA 3ZBFA 5GIPE 5C4LA 2WO6A 5AR2A 1VZOA 3O51A 1CDKA 3LHJA 4HPTE 4IB3A 3RAIA 3OFMA 3BGPA 4W9XA 4RPVA 4FMQA 3KRWA 1DS5A 3U87A 5AWMA 4PX6A 3AC8A 1T46A 4ZS0A 4CT1A 5A4TA 4D2VA 2B0QA 2QHMA 4UMTA 3FI4A 3DB8A 2X4FA 3PG3A 4I94A 4TKSA 5FM2A 4HGTA 4X0MA 4RJ6A 4RQVA 3PG1A 4L7FA 4CFWA 3C51A 3ZDIA 4FEQA 4FKRA 2PMIA 4RWIA 5DWRA 3HMOA 4XG3A 4L9IA 4WNPA 1ZZ2A 4ORKA 3CE3A 4BCOA 3R21A 5E8ZA 3N51A 5A4EA 2IW8A 4FTRA 3QHWA 3TZMA 4N4SA 5KMOA 1Y6AA 3BLHA 2XK6A 1NY3A 4V0GB 5AR7A 4C36A 5A14A 4GK4A 4CFUA 1STCE 2QLQA 3GQLA 3HKOA 4D4RA 3D5XA 5BVFA 2P0CA 4C3PA 2JIUA 3HA8A 3VRZA 1ZYSA 3G9LX 4FNWA 5EM6A 4GYGA 2W5AA 3LCTA 4AN9A 3SA0A 1XH6A 5J9ZA 1LR4A 3DBQA 3BPRA 2C0OA 4G3GA 3THBA 2EXCX 4W4VA 4RG0A 5LJJA 3GU7A 4YZBA 3POZA 4LV8A 5EYMA 3PY3A 5ETAA 4FV6A 3MFUA 2C4GA 4LI5A 4O96A 3TJDA 3E8CA 5L2SA 3RM7A 2X7FA 4GJ2A 4I4EA 4FK3A 5BPYA 1IG1A 3V3VA 2YN8A 3IDBA 3NYOA 1Q41A 3PUPA 3S3IA 4C2WA 4C4HA 3LXPA 2B9JA 3E8NA 4FSMA 3LJ1A 3SQQA 3QBNA 2PZYA 3I4BA 3PIZA 5JRSA 3ZUVA 1GIIA 2B55A 2VGPA 4E6AA 4EOQA 2ERZE 3DDQA 1O6KA 2C6EA 3QA8A 4S30A 4FUXA 4BCHA 4AZTA 4CVAA 2XKFA 4JLCA 4YZCA 3UOKA 3UGCA 4V0GA 4GYIA 5LVOA 1L8TA 1FPUA 1UU7A 4I0SA 3E92A 3ACKA 4G5JA 1RE8A 5LARA 4F7JA 2PULA 2E9UA 3KF7A 3MN3A 2R3JA 4YJNA 4YJRA 5T3QA 5ITAA 5EHOA 4JQ7A 4PNKA 3KFAA 3CBLA 3IPHA 4CLIA 4WG3A 3SW7A 4YZ9A 3F7WA 2VTIA 3LFSA 3NCGA 2XK3A 4JI9A 4NM7A 4O7ZA 1WBNA 3FZSA 2X9EA 4DA5A 3OD6X 3LMGA 3ZEPA 1G3NA 2JDOA 3MH0A 4KIPA 4CFXA 1H24A 2AC3A 3I79A 4CLJA 3FAAA 3LXNA 3ZO4A 3AD5A 2ONLA 5B0XA 4QP7A 3ZM9A 3NNUA 4ANQA 3ZHPC 4QMOA 4FKIA 3PJ1A 3C4CA 4GT5A 4JQ8A 5KZ0A 4H3BA 3K3IA 4YLJA 3S0OA 4BBMA 1H1RA 3P7AA 4FVQA 5DMZA 3E64A 5BVNA 5FTGA 1J3HA 1XKKA 2X7OA 4X2GA 4X3FA 5CS6A 2OSCA 5DI1A 5K0KA 3SGCA 4XJ0A 4I6BA 4F6WA 2OJFE 4UMRA 4YTHA 2PZ5A 4UYAA 3ULIA 3NIZA 2WFYA 2WPAA 5H3QA 5CTPA 3ZCLA 4BWKA 4KIKB 3ZBXA 4QQ5A 1SVEA 4NYEA 4WUNA 2GNFA 2J0KA 3E7VA 4CZYB 4PMSA 4LUEA 3G15A 4W8DA 1W84A 2GFSA 3EZVA 5EFQA 4CRSA 3OTUA 3FMMA 4U43A 4ITIA 4G9RA 5M08A 3SD0A 3LM0A 3CXWA 3QD3A 1M2QA 2REIA 3KXNA 4EOIA 4EOPA 5KMIA 1IR3A 3QQJA 4ZP5A 4BDJA 4OAVB 2QKWB 4I6FA 4LOOA 2JLDA 4AZEA 5BYLA 2YIXA 4TRLA 4MX9A 5HBEA 3RPSA 5J95A 3QRJA 4IVBA 4RVLA 1GJOA 2PUPA 4AZWA 2NPQA 2W96B 5H8EA 3A8WA 4FKOA 1Y57A 4UWYA 4XRLA 5AX3A 3UOJA 5EDQA 3DOGA 2EB2A 2OIQA 4M15A 1FMKA 1XWSA 3KVXA 4AQCA 4PL4A 4AGDA 2C5VA 3ZSGA 4CD0A 4N70A 4L43A 2QC6A 3FXWA 3PWDA 4O0VA 5CY3A 1BL6A 3PA3A 2CSNA 2W4JA 3F5PA 2X0GA 3RHKA 4A9TA 3Q2JA 5D11A 4B6LA 4C3RA 3CGFA 3I6WA 5IA4A 2O63A 2X39A 3LLAA 3PXKA 5CQUA 1U46A 4B8MA 3S2PA 3RK5A 4BGQA 3KKVA 3R71A 3D7TB 1APME 1ZYCA 3UVQA 3Q60A 5IDNA 2OJJA 3OCTA 5KNJA 2OF2A 5F1ZA 3ATTA 4XG6A 5CSHA 3GFEA 3A60A 5EI6A 1JOWB 3DBFA 3VS5A 4A4XA 4Q5HA 3OWLA 4TT7A 5E90A 4Q9SA 4AT3A 4AT4A 4C3FA 4EJNA 1ZOHA 2BFXA 2C1AA 4BI1A 1O6YA 4P7EA 2JGZA 2V5QA 3ZLWA 2OFUA 4NIFB 3TUCA 4ITHA 4NM3A 2OU7A 4E4LA 5JGDA 4XS2A 2B9IA 3R28A 4FKGA 4FV2A 2JIVA 3VS6A 3FSKA 4CSVA 4EKLA 1OL5A 4IEBA 5KZIA 5HNIX 2DQ7X 5EQPA 4P90A 4WRGA 3NPCA 4YJSA 2Z8CA 1OB3A 4CKRA 3QKMA 2YA9A 4LRJA 2RF9A 3HA6A 3HEGA 2CNQA 2H9VA 4OTHA 4QMVA 2XP2A 2BROA 1IA8A 2J0LA 4C38A 3C4FA 4ERWA 3Q5IA 3BYMA 3NNWA 4HZRA 4U41A 4WNMA 5JFVA 1H1QA 5HOAA 3DS6A 4MWHA 4XOYA 5M06A 4XRJA 3VUDA 1OMWA 4M0ZA 5FLFA 3F66A 1SNUA 4M66A 3PLSA 2GNHA 4KBCA 3O7LD 1P4OA 1H4LA 1P4FA 1K9AA 5EOLA 1YWRA 4CTBA 4YTCA 5ANEA 4NL0A 2OI4X 3H3CA 4G34A 1CSNA 4IAZA 4PY1A 4C4IA 4PNIA 4EK6A 4O84A 3M11A 2J0IA 4NIFA 4EK3A 3OW3A 2XKEA 1A9UA 3OF0A 4P4CA 2BAQA 3C4ZA 3SW4A 4FEWA 4FKLA 3UP7A 4TWNA 4Y46A 2C6IA 4NJDA 4AW5A 4DEEA 1YI6A 3UPXA 3QWKA 2PVRA 4I5CA 4JRNA 4CYIA 2GNJA 2BDFA 4FZDB 3I81A 4K6ZA 3ZO3A 5J1VA 5DR2A 2P3GX 3NNXA 3HMNA 4YJUA 5BVWA 5TE0A 4FI1A 3UQGA 3AC4A 4KRCA 4Q2AA 3FC2A 3LOKA 3FKOA 4DH7A 2WEIA 4A4OA 4QYHA 3FLZA 4BIDA 4CCBA 4K18A 4RFMA 1S9JA 1MRYA 2Y7JA 1KE8A 2VO3A 1RW8A 2HZ0A 5A3XA 3R8MA 1M2RA 3FSFA 2CGVA 2VAGA 3KK8A 5KX8A 2X81A 3RPVA 3LJ2A 4H1MA 3Q6WA 4M84A 2IZSA 1LUFA 4F08A 3ZUUA 4QTBA 4C33A 1HCLA 4M68A 4IWOA 3MA6A 3BU5A 4FTLA 5IUHA 5DRBA 2BUJA 1OL7A 1YXVA 5EYCA 3RVGA 3OG7A 3ZXZA 4BDFA 5L4QA 3R6XA 1Q97A 3R00A 3FZRA 3BHUA 2WTIA 1B38A 4DTKA 3UO5A 4HCTA 3O8UA 3KXHA 5AP4A 1GZNA 1Q8TA 5J1WA 2XH5A 4EWHA 4X2FA 3GI3A 2F7EE 3Q4UA 5LMKA 4P2KA 4RJ3A 3BV3A 2EVAA 4K8AA 2QO9A 5CVGA 3Q96A 3QZIA 2O5KA 3RCDA 1P5EA 3I0OA 2LAVA 4CYJA 3JPVA 2VWYA 3FXZA 4U40A 4QP2A 2BCJA 3CC6A 3Q52A 4D2RA 4BDKA 2X6DA 3FLYA 5KMJA 5AFVA 4IADA 3N9XA 5HTIA 3MESA 4RJ5A 2WQBA 4NCTC 3ZH8A 4JRVA 5GIOE 1FVRA 3KCFA 5IISA 3PPKA 3DA6A 4MHAA 4DT8A 2VO7A 2A0CX 3EFJA 4IHPA 5FEEA 3V8TA 5KBRA 2WQOA 4QPMA 3ACJA 4ZSEA 3R1SA 4H3QA 4U79A 3UE4A 3SV0A 3L8XA 3I60A 3PSCA 3BX5A 3ERKA 3QKKA 5K9IA 3U6IA 3TTIA 2FO0A 3A99A 3P79A 5CT7A 2OIDA 5ETFA 1BYGA 4ZJJA 4H3PA 3SG9A 2HXQA 4J7BA 2WTCA 3F7ZA 3FL4A 4WBBB 3D5VA 4JBOA 5EG3A 3OBGA 4WSYA 4JOAA 4XV1A 4YBKA 2J0JA 3L8SA 5CU3A 4BKJA 5B2MA 4NKAA 2PUUA 3V8SA 5CZHA 3WI6A 4R3PA 5LCJA 3PA5A 3K5VA 3ORPA 2XKDA 2OW3A 2X2KA 4QMTA 3TV7A 4EYJA 3B8QA 2VTQA 3W2CA 2RGPA 2C5NA 4PL5A 4RZWA 4FL3A 1H26A 3UIMA 3KXMA 4HW7A 2FB8A 3ZDUA 3VS7A 3F88A 3FLNC 2V7OA 4FVRA 5JKGA 3TTJA 4DBNA 3DXNA 3VBQA 1CMKE 1IRKA 4J71A 5EW3A 4EH2A 4ZLYA 3NMUF 2VTMA 3EHAA 2YIRA 3FKLA 4YHJA 3DZOA 1SMHA 5HCXA 3VULA 4TTHB 4CFFA 4U45A 2BPMA 3MH1A 3JUHA 5HG7A 2Q0NA 3UYSA 3TV6A 4F0IA 4FTQA 3TIYA 4ACCA 5M44A 3NUUA 3V01A 2J5EA 5BUJA 3HRBA 5LWMA 3FBVA 2Q83A 3FQEA 3ZRKA 3KXGA 5GHVA 5LMAA 4C58A 4ACHA 4I0TA 1PXPA 5KKRC 4O6EA 3HECA 5HCZA 5L8LA 4ACMA 2R9SA 3QC9A 3NUPA 4EH4A 5IG1A 5KUPA 2WQNA 3R9NA 2J7TA 1VEBA 1JKKA 3VC4A 4YO4A 4G6NA 4ZZNA 1UU3A 1H8FA 2QQ7A 2V55A 2VN9A 3DY7A 2VRXA 3CQEA 1KE7A 4CKIA 5HORA 2JC6A 4BR3A 5FBOA 4BDAA 1ZZLA 2FSOX 4NTSA 2UVXA 3LFAA 4JDHA 5EK7A 3ZTXA 3QQGA 4FV0A 3G6GA 3QRUA 3ZZEA 1FBNA 2BFYA 2E9OA 3VHKA 3DDPA 3HAVA 3MIYA 3PXZA 5H8GA 3LPBA 3UZTA 2UW6A 2YERA 3QUEA 2W4OA 5CAUA 5I9YA 5G1XA 4FZ7A 4H1JA 4I23A 3UTOA 3FV8A 3R7YA 2C6OA 4G6LA 5J9LA 3E93A 3TNQB 2ZV7A 4LGGA 2UVYA 3IW4A 3C7QA 4B8LA 3C4XA 1JPAA 5IQFA 4DC2A 3E8EA 4PWNA 2OWBA 5AP1A 3JR1A 5J5SA 3G5DA 3W1FA 3NW6A 3ZRMA 2PVJA 2I0EA 4QNYA 3QTRA 4ASXA 5EHLA 1PKDA 3SOCA 4Q5EA 5EW8A 1LEZA 5B2KA 4RVMA 3FEGA 4FSQA 3T3UA 5HD7A 2WD1A 4I20A 3QTWA 3GU8A 4AG8A 1G8AA 5AX9A 3VIDA 3QAME 4BDEA 4L45A 4QP1A 2QG5A 2B7AA 3EQDA 5AP5A 1NVSA 3WBLA 1OZ1A 4LL5A 4QOXA 5D1JA 4WO5A 1U5QA 5FDXA 5AM6A 4A9YA 1YVJA 3MSSA 4ACDA 4U81A 4V05A 4D9UA 2OZAA 3ALOA 3QXOA 4WRSA 3EQPA 4YBJA 3UNZA 4ONAA 2X2MA 2WMWA 3EQBA 3RBWA 1H01A 3H4JA 4PRJA 2DS1A 2R7BA 3KXZA 3LW0A 3PY1A 4QMLA 2OJGA 4J99A 3D9VA 1GAGA 1Q62A 4CMOA 2JDVA 5C8MA 4O0TA 2VTPA 4QP4A 3UG2A 3CJFA 1YWNA 4BGGA 3CCNA 3C0HA 4FG8A 3NS9A 5CNNA 5BMMA 3TG1A 1Q8YA 4QMXA 1IEPA 3BWFA 1Q99A 3V6RA 5DR9A 2XNEA 4Y72A 2B4SB 3I1AA 4ZMFA 2UZNA 4H05A 5EOBA 4XLIA 3UP2A 2R3GA 4L44A 4TPTA 1NVRA 5TOZA 4BDDA 3HRFA 3UG1A 3F82A 2YZAA 1UWJA 3BU3A 1AD5A 4Y5HA 2OG8A 3E7OA 3LFBA 3MIAA 4LOPA 5AR8A 4D4SA 4L00A 4RIOA 3C50A 2UW0A 3BYSA 4A4LA 5CEIA 5AV4A 2VNWA 3ZMMA 3EN5A 4MD7E 4FYOA 2H34A 3F3VA 3PPZA 2UUEA 4JAIA 3PPJA 3RK7A 3TCPA 3HGKA 4F1OA 2IW6A 4DF3A 3BU6A 3LQ3A 2QU6A 2WU6A 3HL7A 1BX6A 1WCCA 4ZTNA 2C6LA 4GVJA 4EOLA 1KE5A 3UQFA 1OPKA 3RAWA 5ACKA 1UWHA 4EBWA 1OBGA 4L8MA 4ERKA 5JFSA 2E2BA 2WU7A 3NDMA 5HVJA 5IKWA 4CFVA 3JS2A 5IH5A 3OXTA 3QUPA 4JR3A 2H8HA 4D9TA 3B8RA 2YDIA 2BZHB 2GTNA 3QALE 3SXRA 3TKUA 4I4FA 3BEGA 1XH9A 4QQJA 3ZOSA 1U59A 2F7ZE 2X6EA 3MTFA 4YTFA 4BCJA 4OTIA 5AP3A 1H1WA 3QD0A 2OH4A 3OWPA 3PP0A 4BGHA 3FMEA 5HG9A 3MJ2A 3KMMA 4D28A 5CX9A 4CXAA 3L1SA 1J7IA 3CD8A 4AACA 3P0MA 3L8VA 1Q24A 4KIOA 2XB7A 3PA4A 1URWA 3D2IA 4FIIA 1MP8A 5M07A 4YUQA 3BLQA 1UNHA 3KRRA 4UBAA 1KSWA 3BQCA 1H28A 3FHIA 5AA9A 3EQIA 5DN3A 1W98A 4TYGA 3UYTA 2B52A 3KL8A 1K2PA 4FKJA 1K3AA 2ESMA 3R1QA 3II5A 4EH9A 4UMUA 4XP3A 5IQDA 4QTEA 4KS8A 3CR0A 2F57A 3GC9A 3OUNB 3OOMA 4CV8A 4DEGA 1MQBA 3QWJA 4DG0E 3VNTA 3ZRLA 3D83A 4AW0A 3G6HA 3OP5A 1ZRZA 4FGRA 3KRJA 3ZLXA 3DNDA 4FV1A 1WBWA 3MFRA 4L3PA 2ZB0A 3U4UA 5B2LA 4YZNA 4HYSA 3AMBA 4GT3A 1H1SA 4IWDA 4BCGA 4FE2A 5KCVA 4I3ZA 3RALA 4HYIA 3TKIA 4ZLOA 3NUAA 2J51A 2A27A 2R0IA 3L9MA 5HKMA 5M4CA 4GU9A 3PJ8A 2WAJA 4X2KA 3VQHA 2C3JA 2C6MA 2YCRA 5FM3A 3Q9YA 4DFUA 5L3AA 1YHVA 4IAYA 2C1BA 4ZOGA 3LVPA 4JG7A 3U9CA 1U4DA 4CMUA 5IUIA 3GUBA 4O6LA 4BBFA 4L68A 4ANOA 4KABA 3NW7A 4G3FA 3SXSA 2QOFA 3EQGA 3OT3A 3ZU7A 2QODA 5HLWA 3FI3A 3QLGA 3W8QA 1PHKA 4ANMA 3DPKA 5FTOA 4FICA 3E8DA 2OBJA 3PXFA 3PVGA 1OKWA 3ZFMA 2Q0BA 3KULA 3LFNA 4FIGA 3VUIA 3MPTA 5CAOA 5BMSA 4IJ9A 3ZFXA 4R78A 4GRBA 2VWZA 3L9NA 4AZFA 1YXUA 1KOAA 5HESA 4CV9A 5JQ8A 4N0SA 3QCYA 3F69A 2R7IA 4NU1A 3WARA 2W1HA 3DT1A 3WOWA 5D41A 3IW8A 4H58A 1BI7A 4CKJA 4O38A 5C03A 3EL7A 4EONA 2YM4A 3FLQA 4L7SA 4M3QA 4ZJIA 4ASDA 1WBVA 4LL0A 4LOQA 2RL5A 2VTHA 2PHKA 2GCDA 1SM2A 3VJNA 2OJIA 3AOXA 4IW0A 3DLZA 3O8PA 1JBPE 4ZAUA 2XNGA 4QMMA 1WVXA 2VTNA 2VWBA 3UIXA 4C2VA 2W5HA 1R1WA 4BCKA 2IZRA 4O1OA 4E6DA 2XK7A 3IG7A 1DM2A 2VTTA 2ITQA 4M14A 3EMGA 5HZNA 3OCSA 4U97A 4P5ZA 2R3FA 4NWMA 5A6NA 5ANOA 3VRYA 4AX8A 2WTWA 4YHTA 3NVKI 4E73A 4UV0A 4E4NA 3FKNA 4FIEA 2VD5A 4BTJA 4EH8A 4XHKB 3D15A 2YEXA 2ZDUA 5C01A 5JGBA 3LMHA 2FSTX 4BKYA 5T68A 4O7VA 5AR3A 4IXPA 3Q5ZA 2FGIA 5D7VA 3VWAA 3CS9A 1UNLA 1IAJA 5ANDA 4O7YA 3AC2A 5A46A 4L53A 2PVYA 4G17A 5IEXA 2O0UA 1QPCA 4HCVA 4YO6A 4F7SA 5FXRA 4YPDA 4S33A 2YM8A 2BILB 3OCBA 2JKKA 2ITOA 4GG5A 3FLSA 3QGYA 2PVFA 2XNOA 4M0YA 5FEQA 4DTAA 2WTKB 3DAKA 5E4HA 2W9ZB 4FSZA 4MNFA 4F65A 2E9PA 4R7HA 2BKZA 4GMYA 3SRVA 1CM8A 4EOMA 3UQCA 4DE4A 4N6ZA 2ZM1A 3DK7A 2C3IB 4EZ5A 5AA8A 2WHBA 3OCGA 5I3RA 3UPZA 3FMNA 3OHTA 4MTAA 5L6OA 3LIJA 4MF1A 1URCA 1H25A 2QOLA 1QMZA 2XF0A 3ORLA 5HO8A 5KBQA 5CNOA 4DBXA 2YJRA 4C35A 4CCUA 1SNXA 4RQKA 3GCUA 2ITVA 5HE0A 4D4YA 1JAMA 3ZUTA 4FKWA 1NW1A 3IECA 4DH5A 3R9HA 4ZMEA 3CP9A 5AUUA 4AS0A 3UBDA 4FSTA 2IZTA 2QONA 3KN6A 3C13A 3QX2A 3MVHA 4GUEA 5IA2A 1NT2A 1VJYA 4Y5QA 2WIHA 3W10A 2QCSA 2RG5A 5C9CA 3F3WA 4GUBA 2AYPA 4KINA 5HTCA 5JMSA 5HD4A 3EQRA 5LVPA 4OTFA 4X3FB 2R0UA 3FQHA 4AAAA 4IIRA 3TIZA 1KV2A 4PMPA 3Q6UA 4R77A 4FIHA 5CSWA 3SDJA 5BX0A 4FKQA 4JJRA 3DNEA 1V1KA 2CCIA 2PPQA 3OEZA 2YCQA 3QCSA 1YW2A 2R3MA 4JS8A 4KRDA 2JAVA 4QYYA 4JR7A 5GZAA 3UOHA 1HOWA 1Y8YA 4FIFA 3QTXA 3UNKA 5EQYA 4HJOA 4BTMA 2XEYA 2W17A 1OVEA 4QNAA 4G9CA 3TKHA 4E93A 3U8WA 4B4LA 2GHLA 1AQ1A 4R7IA 2YAKA 3QFVA 5DEWA 3DKFA 3K2LA 3WE4A 5M51A 5EQEA 2OO8X 2O2UA 4FSRA 4RJ4A 3ORKA 1H08A 3NX8A 4O7SA 4QP6A 5LMBA 3F2RA 1F3MC 2Y4IC 2C5OA 3PWYA 3SXFA 1YDSE 2QNJA 4EQMA 2PMLX 3QQKA 4OR5A 1B6CB 5AV1A 4DEDA 3MBLA 3WIKA 4KA3A 4DGNA 4DAWA 4EUTA 2YM5A 5EDPA 5E8YA 2QO7A 2ITNA 4F9BA 2PL0A 4FL2A 2ITZA 2WNTA 3QD4A 2X9FA 2XKCA 3SKCA 2W1DA 3LKMA 5BVKA 2HENA 1J1BA 2JDRA 2PE0A 2I6LA 4IB5A 5JK3A 4AW2A 4YSJA 2VWIA 3QZGA 3RINA 3FPMA 4YNEA 4PQNA 2X2LA 3GCVA 4EOOA 2UW8A 4QTDA 2UZTA 4RIXA 3W55A 3B2WA 1OM1A 2X7GA 3O0GA 3DFAA 3E5AA 4UN0C 2XS0A 3W2OA 4F0GA 4M69B 5LVLA 3MVMA 4TWOA 2Z02A 4OBPA 2NRYA 2RKUA 1BLXA 4ZXTA 3W2QA 2X8IA 2HW7A 4IVDA 5G6VA 3WF7A 4DYMA 4BY9E 3EH9A 4GT4A 4MXAA 1OECA 2VX0A 4CNHA 3ORMA 3QTUA 5E1SA 4ZEGA 4E26A 4CZTA 2Z7LA 5K0XA 4FA2A 2YHVA 4Z7HA 4S31A 4WG5A 3C0GA 3GC8A 5M53A 4R7BA 3H9FA 3GU5A 3LQ8A 3GBZA 2CGXA 2C0IA 3NUNA 4G2FA 2WELA 3CY3A 4J8NA 4ALUA 4EQUA 5CAPA 5DGZA 3P08A 4OBQA 4RC2A 3PTGA 4XP0A 4XUFA 4C37A 4LGHA 4ZTLA 4L46A 2YABA 2BRNA 1KE9A 3NIEA 3EYHA 2HK5A 4Y73A 2XUUA 2W1EA 2R3RA 3AT4A 2XK4A 3ZXTA 2Z7SA 3TUBA 4BDBA 5HO6A 4J8MA 5GJGA 1WFCA 4M69A 3R8VA 1ZARA 4IACA 4U80A 3VQUA 4PDSA 4DINA 2QI8A 1XBCA 4FC0A 3UIBA 3QTZA 3WIGA 4BCFA 4DEBA 2PU8A 4IM2A 1I44A 3T3VA 5F95A 5JH6A 2YWVA 2X1NA 2ERKA 4F1TA 3WZJA 2BZJA 4K9YA 4WBOA 4RGJA 1OBDA 2CKQA 3RPOA 3U6JA 5EM7A 3MY5A 4L42A 4DFBA 2QR7A 3Q4ZA 4FTIA 4EBVA 4HVGA 1V0BA 4ZSLA 5I4NA 4KAOA 4GCJA 4IWPA 2HW6A 4OTQA 4PL3A 4AU8A 3IW7A 3FQSA 5L2WA 5LQFA 4YZDA 3MTLA 1REKA 5EI2A 3E63A 1FGIA 3P7CA 2UW4A 3A7IA 2HY81 2F49A 3DB6A 1SVGA 4J95A 3KEXA 4XLVA 3ZYAA 3I5NA 3AT2A 2WXVA 3MB6A 4DFNA 4FZ6A 3ZS5A 3Q04A 2WMAA 4O7NA 4FKSA 2I0VA 4DFXE 3G2FA 3FHRA 4ZIMA 3BYOA 3DBEA 4WG4A 2PMOX 3V8WA 2BAJA 4ZSAA 3DK6A 1ATPE 4ZS4A 4MBLA 3ID6C 3O8TA 3DJ7A 3ANRA 5CVHA 4EH6A 4WT6A 3BEAA 4D2SA 4ZTMA 4KUJA 3I7CA 2RFEA 5AMNA 4MK0A 5HG5A 4UYNA 4U3YA 4CEGA 4XG8A 4S32A 4EH7A 2O65A 2VGOA 3WF6A 3F5GA 2UZDA 4EHZA 1FMOE 2J6MA 2CCHA 1ZMWA 3KU2A 5CT0A 3ZO2A 3QL8A 1ZMVA 4O82A 4V04A 3MFTA 2FSMX 3CY2A 3G51A 4JQEA 4R6VA 4TNBA 4XG7A 4ZZMA 3VS0A 2WQEA 1H07A 3B2TA 1Z57A 3BZ3A 3FI2A 3BE9A 3NWWA 3Q9ZA 4O2PA 4MBIA 4QYFA 4HNFA 2R3OA 3RWPA 4BKZA 3EKNA 1BMKA 1XBBA 3E87A 5EDRA 2G01A 2QU5A 3BCEA 4D2TA 4U9AA 1ZYDA 4YSMA 2IWIA 3P4KA 5ETCA 3OROA 3U54A 4BVUA 4DFLA 2BRMA 3ODYX 4WUAA 2EB3A 1U54B 5CU6A 5DNRA 5CANA 4FV5A 4IJPA 4GK3A 2XM9A 3IW6A 1GZKA 1GIJA 3M42A 4JXFA 2HY0A 2J5FA 4DGGA 2C6TA 3LCKA 4FSNA 3T8OA 5D10A 3QRTA 3QF9A 4USFA 2OIBA 4YMJA 2BTSA 1R39A 4K11A 4Z7GA 2NNWB 3UZPA 2XYUA 2YACA 4C62A 1UVRA 4E1ZA 4EZ7A 5JGAA 2X8EA 4O0SA 5LXMA 4JBQA 4LMUA 3MB7A 4YZMA 2YAAA 1Y8GA 4ACGA 4X3JA 1YOLA 4E5WA 4NJ3A 4GH2A 3DAJA 4C57A 3GENA 3W8LA 4TWPA 4FNZA 4F9WA 5AUYA 4O86A 2ZMDA 3EZRA 4NM0A 2QR8A 2XNBA 3Q3BA 3WYXA 2R64A 3GU4A 2JIIA 3OTVA 3CPCA 3VBWA 4AGCA 4ALVA 3ETAA 2X4ZA 4ANNA 3QKLA 3Q4CA 4GFGA 4AN2A 4BCIA 5FUTA 2XNNA 2JDSA 4TZRA 3QD2B 3V5LA 5GJDA 5J8IA 5HO7A 3LCDA 1AGWA 3D2KA 2DYLA 1FINA 3BGZA 5HU3A 4U42A 1U54A 4YP8A 3HV6A 4A9UA 1LP4A 3LE6A 4UWBA 4D5HA 1DI8A 4D55A 4YJVA 4CGAA 1ERKA 4O0XA 2H96A 5EH0A 2QLUA 3PJCA 3K5UA 3OBJA 4G6OA 2OLCA 2AC5A 4WA9A 2BIYA 3QZFA 1CKPA 3D0EA 3H9RA 4E6QA 4EOSA 3FMHA 1P2AA 3D14A 2G2IA 4XOZA 2JFMA 4JBVA 2W1CA 3Q9XA 3VS1A 3ZM4A 5IMXA 5AR5A 3RKBA 1WAKA 5HEZA 3EL8A 4N6YA 3ENHA 3R02A 4X2JA 4DH1A 4EL9A 4FBXA 5BUIA 3H0YA 3R1NA 2PTKA 2ZYBA 2ETKA 4MXYA 2ZMCA 3HV7A 5E8VA 3R9OA 5M09A 3VUTA 5FXQA 4YGAA 4DGMA 1BUHA 4AUAA 4MQ1A 3O23A 5DEYA 5DT4A 4ASEA 4B99A 4R3RA 4YTIA 2VNYA 2ITTA 3TZ7A 5BQ0A 4LRMA 4GEOA 3OWKA 2YISA 4QMUA 1PF8A 3PZEA 5E8WA 2EUFB 4S2ZA 4O21A 3R30A 3TACA 2XIKA 3QTIA 5AUZA 5HLNA 3ET7A 2FH9A 3RAKA 2CLQA 5I3OA 5JFXA 1GZOA 4L3JA 2A4LA 1JSUA 4GW8A 4ZTRA 4FNYA 4JDJA 3QTQA 3R7VA 1W0XC 3KK9A 4BL1A 3TDWA 2HCKA 2ITWA 2Y8OA 1V0OA 3L8PA 4MBJA 2V22A 4XV9A 4PPCA 1RQQA 3MFSA 3O17A 4Y95A 4C8BA 5KMKA 2HZIA 4EUUA 1IA9A 4O7WA 2JKQA 1O9UA 4I6HA 3JY0A 4FVPA 5CASA 3VJOA 2QOQA 5JN2A 3V6SA 1NVQA 4AF3A 4CT2A 3BWJA 2C30A 5FBNC 5KHXA 4IM3A 4EC8A 2GSFA 2CKPA 3AC3A 3V5JA 4ANLA 2P55A 3BHHA 3HRCA 4HYUA 4MYGA 3RMFA 4BHZA 4L67A 3QA0A 3F3ZA 3LFEA 4IX6A 2VWVA 2YM6A 3FMDA 5FXSA 3HMPA 1ZOGA 4J96A 5JSMA 2QD9A 3R7EA 2Y9QA 1H0WA 4FK6A 2HAKA 1GZ8A 4JAJA 4LMNA 4O0YA 4YLKA 3UDBA 3NNVA 3Q4TA 1M14A 4WSQA 3CTJA 5E91A 4AXAA 3MH2A 2E9NA 3PSBA 3WE8A 5IQHA 4DEHA 3R04A 5AADA 1YDRE 1YI4A 4O2ZA 4Q9ZA 2CGWA 2CKOA 4FT0A 2QOCA 2BRHA 3LCSA 4LYNA 1FVTA 4IM0A 5L6WL 3N4TA 4IMYA 4R5YA 2OZAB 1CTPE 4DLIA 1DAYA 4H39A 2Z7QA 3EQFA 3GXLA 4IVCA 5CWZA 4AOTA 2WEVA 4DLJA 2WOUA 3FZPA 2KTYA 5CSXA 4UB7A 3P9JA 3DV3A 2W1GA 5CI7A 3AD4A 5A4LA 4PTCA 3P1AA 4U5JA 5E9EA 3GEQA 4F64A 4EI4A 4YURA 3ATSA 4G1WA 4E4XA 1W83A 5CEMA 1YXTA 2GNIA 4APCA 1WVYA 5F20A 4F09A 2CN5A 4JIKA 3R7IA 4RC3A 3GFWA 3KVWA 3PY0A 4M7IA 5HU9A 2G2FA 2RFDA 4M12A 4PMMA 4XG9A 5IMEA 4N57A 3HUCA 5CEQA 1H0VA 1LPUA 3KF4A 1IAHA 2IG7A 4XBUA 2PVKA 4LGDA 4FTKA 2GTMA 4CQGA 2WQMA 3AC1A 2QKRA 1PXJA 1QCFA 1OIYA 3AXWA 5E8UA 2C69A 2GPHA 1OITA 2VWXA 2Y6OA 1PJKA 2HXLA 2PY3A 2PUNA 4BIBA 1ZLTA 3PVWA 4MEDA 2VTRA 2HIWA 5IQIA 4MXXA 2I0HA 5K3YA 2R2PA 5TR6A 2UV2A 4IANA 1REJA 3VBVA 1W8CA 3NSZA 2XIZA 1L3RE 3VUMA 4QTAA 4PDPA 4RWLA 5E7RA 3HZTA 2NRUA 5FG8A 3KN5A 4R1YA 4C02A 1GNGA 2WZJA 4IDVA 4TN6A 3F2NA 3FMKA 3GT8A 3LFDA 4HZSA 2XIXA 3UODA 4AZSA 1BI8A 2W1IA 3NAYA 4JX3A 4L52A 2FUMA 4FF8A 5FD2A 5BVEA 3LXLA 4U8ZA 2P33A 3NW5A 4G5PA 2XBAA 3HV3A 3NRMA 4O7TA 4HNIA 1SVHA 4R1VA 3GP0A 2AUHA 2JBOA 3HMMA 5H2UA 5DE2A 3PE1A 3PYYA 3VVHA 3PJ3A 4UMQA 3WF8A 4X6QC 2WMTA 5IEYA 4GFMA 1PXLA 2GS2A 3R7UA 2CN8A 3S00A 4FT3A 4RIYB 4FT5A 5J5TA 3DK3A 4WIHA 1A48A 2F2CB 2YZLA 4FGBA 3P78A 2ETRA 4JIAA 4A7CA 4U7ZA 4C4FA 2YITA 4FZAB 1ZMUA 2V7AA 5CEKA 3O96A 1YWVA 4FSYA 3T9TA 3VUGA 5IA1A 4D58A 4EH3A 2JKMA 2BVAA 1PRYA 4RX9A 3MYGA 2VTOA 4FOBA 1UV5A 4F4PA 1OKYA 5EYDA 2GS6A 2W7XA 3G0EA 1UU9A 5CF8A 1PKGA 2XK9A 4NKSA 2DWBA 5A54A 4L01A 4NSTA 3G9NA 4JBPA 5F94A 3E3BX 5JQ5A 1EH4A 3C4EA 3MWUA 1ZOEA 2JFLA 3F6XA 4RWKA 4BCPA 4C34A 5I9VA 2CGUA 4IVAA 4TYHB 2G15A 3PXRA 1MRUA 4B0GA 3VN9A 4HVHA 3RCJA 5CLPA 4FKTA 2R3LA 3CPBA 3BYVA 4PPAA 4RA5A 3L9LA 3SLSA 4GKHA 4HVIA 2W1FA 3LZBA 4O27B 4TY1A 1WMKA 1T45A 4GG7A 3UVRA 2J9MA 3NLBA 4RIYA 3FYKX 4NM5A 4BI2A 4EJ7A 2XMYA 4YC6A 5TKDA 4PP7A 2QOKA 4QRCA 1M7NA 2G2HA 2Z7RA 3FWQA 3FY2A 4O0RA 3UMWA 5HNBA 5HX8A 3DCVA 4AGUA 3LMIA 3BRBA 2B54A 3S95A 4E4MA 1Q8UA 5KO1A 2OF4A 2ZV9A 3PE2A 4EOKA 3QYWA 4GSBA 4EHVA 2YJSA 5E8TA 4EYMA 4AP7A 3COKA 4KKGA 2FYSA 4UZHA 3KULB 4EK8A 3BBTB 4G3EA 4KBAA 3DXPA 1DI9A 2C6DA 2QVSE 2EXEA 3EIDA 4ANSA 3KREA 1XH5A 4GK2A 4KD1A 3A8XA 3DQXA 5D7AA 2GQRA 3A7FA 3V5PA 2QO2A 2WMVA 4LG4A 5L2QA 3EFWA 4FTUA 4J53A 4TYHA 2F2UA 4BWXA 2WMBA 1UNGA 4BN1A 3DBCA 1JKSA 4QTCA 5CU4A 1OI9A 5AP0A 4Z55A 4ENXA 3VS2A 1YQJA 2C47A 2J50A 2HWOA 4BYIA 3AQVA 1I09A 2J0MB 4AA4A 5IEVA 3EN9A 5E92A 3CQWA 2WMQA 2YLFA 4FTNA 5LVNA 1NXKA 5GNKA 5AP2A 1H1PA 4RVKA 3CD3A 4GJ3A 3A61A 3KQ7A 4OGRA 3PP1A 4MWIA 3TNPC 5IH4A 3QCQA 1LEWA 4FR4A 4RX8A 4YLLA 4RMZA 3QCXA 3TUDA 4L3LA 1CKIA 3MI9A 1JVPP 3ORIA 2WKMA 4JG6A 2XCHA 1M17A 4WNOA 4WNKA 2OXXA 3CJGA 5ETIA 2BKKA 4U6RA 4LRKA 4K0YA 4QP8A 3FZOA 3FLWA 2X8DA 4K33A 4Z3VA 2PZRA 2XYNA 2YIWA 4F6SA 3GC0A 4W8EA 2RFNA 2BALA 3NAXA 4XCUA 5GINE 1OGUA 4D2WA 4QYGA 2UW3A 3QXPA 4AOJA 4IWQA 1YOMA 5F9EA 3OVVA 3AT3A 5CAVA 2LGCA 5AV0A 3LM5A 1JSTA 2UW7A 4GFOA 5CEPA 3UO4A 3MVJA 3I5ZA 4D0WA 2GHMA 3F9NA 3EKKA 5DT3A 2ITPA 5H8BA 2VTSA 2YM3A 4GIIA 3HDMA 3HP2A 5HICA 4JDIA 4DN5A 4FL1A 2ZM3A 2UZEA 2XBJA 4FTJA 3W2SA 4C0TA 2WTVA 3F5XA 5M57A 3KA0A 4MXOA 3SRVB 2WIPA 3OOGA 3QQFA 4FSUA 4Y8DA 2W4KA 4ZZOA 3R63A 4EH5A 4BZNA 2W9FB 4IC7A 5HI2A 4PP9A 4RJ7A 4UZDA 5HE3A 4FEVA 4RJ8A 4XEYA 3PSDA 3WZUA 4CQEA 3BV2A 4RC4A 3ROYA 5J87A 3ZZWA 3IQ7A 4X2NA 3GOPA 3WF5A 4P5QA 5GJFA 3TNHA 3ZLSA 1WBSA 2GS7A 4YNOA 3OW4A 2OGVA 2P2HA 4NTTA 5EKOA 4X21A 3QU0A 3QGWA 4ASZA 4AE6A 3TL8A 3TV4A 5CVFA 3MY0A 2JD5A 4IH8A 3RHXA 5C26A 1F5QA 2IVUA 3JYAA 3IKAA 4OW8A 3U9NA 3R1YA 4E8AA 2PSQA 3PXYA 2C0TA 2HZ4A 4OTWA 3HX4A 1YXXA 4QMQA 1XH7A 4FTMA 3A4PA 4IX3A 3MS9A 5I9WA 3NUYA 2CNVA 4RX7A 3OC1A 2QOHA 3HNGA 2CJMA 5ANGA 3SC1A 1H27A 4EZ3A 3EYGA 2O8YA 4FKVA 2ZVAA 3EN4A 4PDOA 4XBRA 5J79A 4RFYA 2QOIA 4ZLZA 1IASA 1QPDA 2W99B 4X7QA 2XRWA 3GNIB 3M2WA 1P14A 1R3CA 3L9PA 2FSLX 4YU2A 3S1HA 4ID7A 4PV0A 3LFFA 3U51A 3KGAA 3FI8A 4EORA 5L2IA 1GY3A 5HBJA 5HG8A 4D0XA 2QOBA 2XZSA 4G31A 4CZUA 4LV5A 5FTQA 1WBTA 3ORTA 3OWJA 3MPMA 3CTQA 1M52A 3QYZA 4ITJA 2H6DA 4A06A 4PF4A 1MQ4A 4C4EA 1KV1A 3DXQA 1XHAA 3G0FA 5HLPA 5AV2A 5TT7A 4W4WA 4YJTA 3R2YA 4OTPA 4A9SA 5CZIA 5AUVA 4AZVA 3N4UA 2Z60A 2ZV8A 1M2PA 3DTCA 4TXCA 3R8ZA 5CF5A 2WMXA 4QMYA 4CRLA 4JG8A 2B9HA 4G16A 4BWPA 4O7LA 3P23A 2EWAA 4KKHA 2J90A 2GHGA 4AOIA 1JSVA 4ZTHA 5IA5A 2PE1A 2VX3A 3MDYA 1OIQA 4QMSA 3V5QA 5HVKA 3UC4A 3C5UA 2GNGA 4TYEA 3NR9A 2YIYA 1PMVA 3P7BA 1ZY4A 3WZEA 4MNEB 3COHA 3A7HA 2G9XA 3JY9A 2YDKA 2YFXA 3NUXA 1YXSA 5EW9A 5FP5A 1S9IA 4YJOA 2IW9A 4ZSJA 4RRVA 2XA4A 3TZ8A 4BZOA 4BZDA 4RIXB 2EU9A 2XCKA 3TM0A 3U55A 1UKIA 1BKXA 4QQCA 2V62A 3W2PA 4I0RA 4QMZA 1JKTA 3BHVA 4E20A 4K77A 4OTDA 2HWPA 1VR2A 3QRIA 4U0IA 3HV5A 3BE2A 4KIQA 4PMTA 1YRPA 2PUIA 4IZYA 2R3NA 3EN6A 4OBOA 3HLLA 4KBKA 4IAFA 3A2CA 1GOLA 3DKCA 4OUCA 3IK3A 4LUDA 5BYYA 3EN7A 4MD8E 3R83A 3VHEA 5IA0A 4QT1A 1KUTA 1B39A 3EQHA 1R78A 4DEAA 4DITA 4EEVA 2XNPA 3D4QA 3IOKA 3DTWA 5IQCA 5DR6A 3Q53A 3ZC6A 4DCEA 2OXYA 3VAPA 4JDKA 2I7QA 5J7BA 4MNEA 3RGFA 3HYHA 3HDNA 4BYJA 5A6OA 3K54A 4O83A 4D4VA 3TJCA 3PDTA 5HIBA 3FMLA 4PTGA 3D94A 1OPJA 3A4OX 5FEDA 3V5TA 4AE9A 3W16A 5I9XA 5C4KA 2F4JA 4W4YA 5KMLA 4FUYA 1WVWA 4GVAA 5IU2A 2QURA 5T6KA 3DQWA 1Z9XA 4YC8A 3MA3A 3ODZX 5IUGA 5I9UA 4F6UA 4AN3A 5AIKA 5DVRA 5LCKA 3NCZA 4NH1A 3C1XA 4XG4A 4HVSA 2PVLA 5CXZA 3F2AA 3QTSA 3ZFYA 5A4CA 1A06A 2QOOA 4A9RA 4ALWA 3C9WA 4DCAA 4QMPA 4DG3E 3MY1A 5D12A 2XJ1A 4BDHA 5K5XA 4OAUC 3RP9A 3OXIA 3ZSHA 2ZDTA 4FV3A 3GGFA 1BL7A 1E9HA 1PXMA 2BHEA 1YKRA 2IVSA 4X6RA 4C7TA 4D5KA 4E7WA 1Q3DA 5AM7A 5HE2A 5IQBA 3FXXA 1SZMA 3JVRA 3LXKA 4XX9A 5I9ZA 3IGOA 5FRIA 4E5BA 3RNYA 4GIHA 3UVPA 2V0DA 1MUOA 4BDIA 1X8BA 1XH8A 4E3CA 1XH4A 4EWQA 2RSVA 4F7NA 3VBYA 3CQUA 2O3PA 3OY3A 3A62A 4NCTA 1PXOA 2J4ZA 1FOTA 2P2IA 4I22A 4KIKA 5TF9A 4G3DA 5LWNA 3TEIA 4FZFB 4J52A 3FZ1A 4C4JA 2CPKE 4TW9A 4JNWA 3FZTA 4BCMA 1Z5MA 4GL9A 3AMAA 4LFIA 2GMXA 4IX5A 1PXNA 3RNIA 4OLIA 1TVOA 4Z16A 3R7GA 3KCKA 4M67A 4APPA 4QP3A 5EKNA 3V04A 5JZJA 1ZXEA 3NEWA 5KE0A 2HELA 4ZJVA 2JAMA 4TYIA 1KWPA 2WTKC 1VYZA 4ZY6A 4F9CA 3G33A 2WMSA 3DU8A 5FQDC 5KKRB 3QX4A 5CSVA 5FDPA 1Q5KA 3FJQE 2C3LA 3FY0A 3HAMA 5BYZA 3ENMA 4XMOA 3P86A 5HGIA 5LVMA 3VS3A 2OK1A 3QLFA 2WGJA 2B53A 1Q61A 2FVDA 1R0EA 2CKEA 1TQMA 3EB0A 2ONLC 4FV8A 3VW8A 3C5IA 5EI8A 4FV9A 3WYYA 4HYHA 4FV4A 3PFQA 3UOLA 3DFCB 4BTKA 4BIEA 4JVGA 5DRDA 3BLRA 4FSWA 5J9YA 2R3HA 1H00A 3D7TA 3A7JA 1RDQE 1YI3A 4AWIA 4BBEA 2PYWA 4FODA 5DOSA 3PXQA 3E3PA 4LM5A 4O7RA 5CU0A 4O91A 4F0FA 1YHSA 2RG6A 1W82A 1OPLA 4X3FC 2R3PA 2G1TA 4CMTA 4JL9A 5M4UA 5L8KA 3LQ5A 4FG9A 5IA3A 2YWPA 3PVUA 3ORXA 4KKEA 3NYNA 4RFZA 1J7UA 1E1VA 3SOAA 3MGYA 5C27A 1TKIA 4NUSA 4WKQA 4O1PA 4WHZA 5EYKA 2C5YA 5M55A 1W7HA 3FPQA 3D5WA 3TZ9A 3O7LB 2IPXA 4UALA 3KXXA 4WOVA 2XVDA 2PVNA 5ANKA 2PZIA 1Q3WA 3DGKA 2GU8A 2R3KA 2UVZA 3BKBA 4XV2A 3LFCA 4EKKA 5KHWA 3A7GA 1PMEA 3JXWA 3QQLA 4YHFA 4C61A 3BHYA 4IX4A 3LCOA 4UMPA 1Y6BA 3TN8A 2XIYA 1YDTE 3F3TA 4RZVA 4IAKA 1QPEA 3OY1A 3Q32A 1PXIA 1TQIA 3MH3A 2IJMA 4QYEA 4W4XA 3DZQA 5EHYA 4R8QA 4CG9A 3IGGA 4MVFA 4NFNA 5F4NA 5AR4A 4NFMA 4RSSA 3VBXA 4QMNA 1MRVA 3IS5A 4FT7A 4O0WA 5AUWA 3AD6A 2ZM4A 4AFJA 4I41A 2OJ9A 4Y83A 4IZ5A 3RJCA 3V5WA 3QQUA 5TO8A 1OUYA 5JFWA 4RWJA 3O50A 5IF1A 4FTAA 5ACBC 3RPYA 2XJ2A 4EQCA 4BTFA 1J1CA 2IZUA 5K4IA 3CTHA 3ULZA 3BYUA 3W32A 1J91A 3BGQA 2WTDA 4ZTSA 5GZ9A 1G5SA 1WBOA 1ZAOA 2NO3A 3GU6A 2OFVA 5DPVA 3MPAA 4HGSA 4XG2A 3TT0A 4CFMA 2ZJWA 4AFEA 3DJ6A 5IQAA 4IDTA 3V51A 2YCSA 2W1ZA 4V01A 2JITA 2VWWA 3CKWA 2JDTA 4WD5A 5HVYA 4R3CA 4MF0A 4NW6A 4B9DA 3UIUA 1O6LA 5BNJA 3PRFA 5HBHA 3POOA 4BCNA 4FX3A 1WZYA 4I1ZA 2EXMA 4J98A 5E8XA 3NGAA 2BMCA 4ZY5A 3GCPA 4KNBA 4AW1A 2Z2WA 1JWHA 1Q4LA 4L6QA 5DIAA 5HCYA 4I5PA 4MXCA 5HIEA 1R0PA 4DFZE 3RPRA 5BUEA 3WF9A 4OT5A 4EOJA 5ANIA 4KSPA 2GQGA 4M13A 3AMYA 3W2RA 3DKGA 5AEPA 4GU6A 1TQPA 3AC5A 4U44A 4II5A 2CDZA 4F63A 4EHEA 3TWJA 1Q8ZA 5CAQA 3BELA 3QQHA 4DGLC 4IC8A 4BFMA 2IVVA 3DLSA 4MH7A 4DEIA 4BI0A 1E1XA 2I40A 3FL5A 5DG5A 4I5HA 4IE9A 3RM6A 4MCVA 3W33A 4RLKA 4F99A 1OL1A 4FG7A 5CYIA 4BRXA 4GKIA 2C68A 3VW6A 4M8TA 4USEA 1XO2B 5L6PA 2SRCA 1RJBA 4IB1A 3AG9A 3H10A 5CXHA 2HYYA 2VTLA 4C4GA 4CTCA 4RT7A 4U3ZA 4BHNA 5HX6A 3TI1A 4FTCA 2PZPA 2OZOA 5AUTA 3IDPA 4BICA 3LFQA 4D1SA 2UZUE 3PVBA 1OL2A 2VO6A 3NZ0A 3ZLYA 2R3QA 1ZWSA 3CGOA 2OXDA 4PPBA 1KOBA 3UMXA 3ALNA 1WBPA 4TYJA 1PW2A 3FC1X 2VTJA 4O0UA 4R5SA 4BCQA 1XQZA 4KSQA 3CIKA 3PZHA 4IB0A 4KWPA 4HGEA 3QUDA 3ZEWA 4O81A 1HCKA 3GC7A 4YPSA 3NVMB 5JRQA 3R7OA 4XH6A 4HVDA 3I0QA 3SHEA 5DBXA 1GIHA 4ZSGA 3U4WA 5CEOA 4IBMA 5K5NA 4OT6A 2VX1A 4XNEA 5AP7A 4UWCA 3PRIA 1OKZA 1PYEA 3KMUA 3MJ1A 3VF8A 3BBWA 3KRLA 2GNLA 4QP9A 2QG7A 3DKOA 3DJ5A 3R73A 3H30A 3MW1A 4UXLA 2HOGA 3P5KA 2PE2A 1G8SA 4RX5A 3EFKA 3QZHA 5JEBA 2XEZA 5C8KA 3FUPA 3FDNA 4G3CA 5BVOA 5ICPA 5M4FA 5M56A 1OUKA 3U6HA 4MXZA 5L2TA 2F7XE 4FKUA 2GQSA 4MKCA 2C3KA 2I0YA 2VTAA 2BHHA 2YIQA 4IFCA 1JQHA 3VS4A 4I6QA 2WMUA 3MV5A 3ROCA 5GZ8A 1M7QA 3ITZA 3UO6A 5I0BA 2KULA 5IQGA 4MQ2A 4F9YA 5LMKC 3OS3A 4D1XA 5D9HA 2VZ6A 4JT3A 4AGWA 4DTBA 2JBPA 4EK5A 3IDCA 2QHNA 5CENA 5HE1A 3Q9WA 5DLSA 3FYJX 2IN6A 4XV3A 3VO3A 2ZB1A 3F5UA 4QPSA 3FMJA 4C59A 4B7TA 4AA5A 5IDPA 3N4VA 2BZIB 4PDYA 4F7LA 2UW9A 3RAHA 4F1MA 3KMWA 3WILA 5HQ0A 4TWCA 5AJQA 3VUHA 3CLYA 3O71A 5DH3A 2W5BA 2DUVA 1OL6A 4OTRA 4LQMA 1OKVA 4RBLA 1OIRA 5FP6A 4DG2E 3VBTA 4TL0A 4QMWA 3ANQA 2BTRA 4I93A 2ZOQA 3RZFA 2PVMA 4FEUA 2B1PA 2R4BA 2PVHA 3F61A 4FYNA 5AAGA 5IZFA 3I7BA 4K2RA 4I5MA 2A19B 2RIOA 3CEKA 3COMA 3WZKA 5H9BA 4J97A 3R8PA 4RA4A 3VUKA 3TNIA 3KC3A 3QC4A 3RZBA 5DA3A 3RTPA 3LAUA 2UZBA 2Y6MA 3MVLA 4ARKA 4PUZA 2GDOA 1YOJA 2R5TA 2CNUA 2FA2A 4FTTA 3LLTA 4M97A 4IZ7A 5ANJA 1PMNA 3TDVA 4NW5A 4GS6A 3EFLA
chains in the Genus database with same CATH superfamily
1FGKA 4DHFA 5I5ZA 3H9OA 1Y91A 2A2AA 4UXQA 5AAEA 5AV3A 2OH0E 5AAFA 2BIKB 4E5AX 1XJDA 3NYXA 2VWUA 3OXZA 1PMUA 1FVVA 1QL6A 2CLXA 4O4CA 5AIRA 2PWLA 4Z9LA 4O22A 4O4BB 2WOTA 4YJPA 3I6UA 3RK9A 3BQRA 1UA2A 5HHWA 3QHRA 4BC6A 3EJ1A 2UZVA 4YR8A 4EHGA 1UU8A 5C8NA 3DAEA 2ZV2A 1W2DA 3IONA 4PTEA 4NT4A 5L8JA 3CSVA 5KMNA 4I21A 4YC3A 4KB8A 2Y0AA 3ZONA 5DYJA 4FNXA 3HUBA 3UNJA 3VF9A 5CF6A 3GVUA 2IVTA 3KB7A 3KRXA 2XNMA 2BAKA 1DAWA 2XRUA 4E6CA 3OZ6A 4K1BA 5DT0A 5E8SA 2BR1A 2WB8A 1XBAA 3JVSA 5EM8A 1YHWA 2I1MA 5A9UA 4I92A 3D7ZA 1V0PA 3OMVA 3ORNA 5K4JA 3HV4A 2HZNA 3RI1A 4MD9E 3R8LA 4D2PA 3R9RA 2UW5A 4F9AA 2GFCA 4S34A 4RVTA 4EC9A 3EQCA 3SVVA 3Q2MA 5HIDA 1J7LA 4ENYA 4BDCA 4QPAA 2BRGA 4BB4A 2BRBA 3UC3A 4HGLA 4DGOA 4YJQA 4A07A 4FKPA 4RIWB 5M4IA 2ZAZA 3F3UA 4AAYA 3FE3A 4CG8A 1JKLA 4H36A 4HPUE 3ELJA 4OTGA 4AA0A 5JZNA 3KY2A 3H0ZA 4RLLA 4UX9A 3PIYA 4W9WA 4DDIA 3AGLA 4FT9A 2YCFA 4DH8A 4IQ6A 1ND4A 5LOHA 4USDA 4DT9A 5KMMA 3IW5A 3OUKA 4O4FA 5AUXA 5J7HA 4IFGA 4UEUA 2CMWA 2Y4PA 3M1SA 3OT8A 3ZSIA 3GCQA 1ZYLA 2OKRA 2UZWE 3K3JA 2WMRA 2BDWA 3C0IA 1U5RA 2E9VA 2C6KA 3R0TA 4TNDA 4DFYA 2NP8A 3GOKA 4J1RA 3NYVA 4IZAA 3ORZA 1NA7A 4FIJA 1PXKA 4BF2A 3UZRA 2JKOA 2W06A 4FEXA 5CU2A 4XYFA 5CI6A 2RFSA 4QD6A 3BL7A 5IQEA 5IH6A 2UZOA 3SG8A 3C4WA 3GQIA 2Y4IB 4RIWA 5IPJA 2IO6A 5FWKK 3NUSA 3SX9A 1G8KA 2PMNX 2XM8A 3OEFX 2PK9A 4Y85A 3R01A 2ITXA 2WTJA 3GCSA 4MAOA 3AGMA 3E62A 3R22A 4NK9A 3R8UA 1OIUA 3ZO1A 4IAIA 4D1ZA 1QPJA 3PLAE 2YDJA 2W05A 2W0JA 5CSPA 2B9FA 3D5UA 5HTBA 2OICA 1F0QA 3HVCA 4HOKA 3W0MA 2R3IA 2ACXA 4XP2A 2VUWA 4JX7A 1PY5A 4IAAA 3O2MA 2C5XA 1SYKA 4AT5A 3BIZA 4GV1A 1KE6A 1JLUE 2J2IB 4UY9A 1PYXA 3COIA 2JEDA 1Q8WA 5E1EA 3EOCA 2CHLA 5DFPA 5HNGA 4ZK5A 3TNWA 3DBDA 3WZDA 2XK8A 4QQTA 2ETMA 2ITYA 2O64A 2XJ0A 2YM7A 4FOCA 2VO0A 3W18A 1ZYJA 3IOPA 4KS7A 5AP6A 5FGKA 5B7VA 3T9IA 5CF4A 3GB2A 3PJ2A 2P4IA 2BDJA 3LJ0A 4I24A 3R9DA 2F9GA 3CKXA 3PIXA 4QO9A 3G90X 2A1AB 2XIRA 5A4QA 1XR1A 3E88A 2BZKB 5EM5A 4AXCA 2UZLA 3RWQA 4EK4A 5BVDA 4ZY4A 2YLEA 3IO7A 1UKHA 4FTOA 3BHTA 1ZY5A 4F70A 3HMIA 3BI6A 4HCUA 3TXOA 4ANBA 5C1QB 4CFNA 3HP5A 1CKJA 4NEUA 1JNKA 1VYWA 4NZWB 4DH3A 5CALA 1FQ1B 2VV9A 3S4QA 4BDGA 5DHJA 4ZTQA 2VU3A 3UJGA 2ITUA 5CQWA 5JT2A 3QRKA 4FV7A 3ZC5A 3EWHA 3SAYA 3R2BA 3ZBFA 5GIPE 5C4LA 2WO6A 5AR2A 1VZOA 3O51A 1CDKA 3LHJA 4HPTE 4IB3A 3RAIA 3OFMA 3BGPA 4W9XA 4RPVA 4FMQA 3KRWA 1DS5A 3U87A 5AWMA 4PX6A 3AC8A 1T46A 4ZS0A 4CT1A 5A4TA 4D2VA 2B0QA 2QHMA 4UMTA 3FI4A 3DB8A 2X4FA 3PG3A 4I94A 4TKSA 5FM2A 4HGTA 4X0MA 4RJ6A 4RQVA 3PG1A 4L7FA 4CFWA 3C51A 3ZDIA 4FEQA 4FKRA 2PMIA 4RWIA 5DWRA 3HMOA 4XG3A 4L9IA 4WNPA 1ZZ2A 4ORKA 3CE3A 4BCOA 3R21A 5E8ZA 3N51A 5A4EA 2IW8A 4FTRA 3QHWA 3TZMA 4N4SA 5KMOA 1Y6AA 3BLHA 2XK6A 1NY3A 4V0GB 5AR7A 4C36A 5A14A 4GK4A 4CFUA 1STCE 2QLQA 3GQLA 3HKOA 1W2CA 4D4RA 3D5XA 5BVFA 2P0CA 4C3PA 2JIUA 3HA8A 3VRZA 1ZYSA 3G9LX 4FNWA 5EM6A 4GYGA 2W5AA 3LCTA 4AN9A 3SA0A 1XH6A 5J9ZA 1LR4A 3DBQA 3BPRA 2C0OA 4G3GA 3THBA 4FJVA 2EXCX 4W4VA 4RG0A 5LJJA 3GU7A 4YZBA 3POZA 4LV8A 5EYMA 3PY3A 5ETAA 4FV6A 3MFUA 2C4GA 4LI5A 4O96A 3TJDA 3E8CA 5L2SA 3RM7A 2X7FA 4GJ2A 4I4EA 4FK3A 5BPYA 1IG1A 3V3VA 2YN8A 3IDBA 3NYOA 1Q41A 3PUPA 3S3IA 4C2WA 4C4HA 3LXPA 2B9JA 3E8NA 4FSMA 3LJ1A 3SQQA 3QBNA 2PZYA 3I4BA 3PIZA 5JRSA 3ZUVA 1GIIA 2B55A 2VGPA 4E6AA 4EOQA 2ERZE 3DDQA 3BLAA 1O6KA 2C6EA 3QA8A 4S30A 4FUXA 4BCHA 4AZTA 4CVAA 2XKFA 4JLCA 4YZCA 3UOKA 3UGCA 4V0GA 4GYIA 5LVOA 1L8TA 1FPUA 1UU7A 4I0SA 3E92A 3ACKA 4G5JA 1RE8A 5LARA 4F7JA 2PULA 2E9UA 3KF7A 3MN3A 2R3JA 4YJNA 4YJRA 5T3QA 5ITAA 5EHOA 4JQ7A 4PNKA 3KFAA 3CBLA 3IPHA 4CLIA 4WG3A 3SW7A 4YZ9A 3F7WA 2VTIA 3LFSA 3NCGA 2XK3A 4JI9A 4NM7A 4O7ZA 1WBNA 3FZSA 2X9EA 4DA5A 3OD6X 3LMGA 3ZEPA 1G3NA 2JDOA 3MH0A 4KIPA 4CFXA 1H24A 2AC3A 3I79A 4CLJA 3FAAA 3LXNA 3ZO4A 3AD5A 2ONLA 5B0XA 4QP7A 3ZM9A 3NNUA 4ANQA 3ZHPC 4QMOA 4FKIA 3PJ1A 3C4CA 4GT5A 4JQ8A 5KZ0A 4H3BA 3K3IA 4YLJA 3S0OA 4BBMA 1H1RA 3P7AA 4FVQA 5DMZA 4LDTA 3E64A 5BVNA 5FTGA 1J3HA 1XKKA 2X7OA 4X2GA 4X3FA 5CS6A 2OSCA 5DI1A 5K0KA 3SGCA 4XJ0A 4I6BA 4F6WA 2OJFE 4UMRA 4YTHA 2PZ5A 4UYAA 3ULIA 3NIZA 2WFYA 2WPAA 5H3QA 5CTPA 3ZCLA 4BWKA 4KIKB 3ZBXA 4QQ5A 1SVEA 4NYEA 4WUNA 2GNFA 2J0KA 3E7VA 4CZYB 4PMSA 4LUEA 3G15A 4W8DA 1W84A 2GFSA 3EZVA 5EFQA 4CRSA 3OTUA 3FMMA 4U43A 4ITIA 4G9RA 5M08A 3SD0A 3LM0A 3CXWA 3QD3A 1M2QA 2REIA 3KXNA 4EOIA 4EOPA 5KMIA 1IR3A 3QQJA 4ZP5A 4BDJA 4OAVB 2QKWB 4I6FA 4LOOA 2JLDA 4AZEA 5BYLA 2YIXA 4TRLA 4MX9A 5HBEA 3RPSA 5J95A 3QRJA 4IVBA 4RVLA 1GJOA 2PUPA 4AZWA 2NPQA 2W96B 5H8EA 3A8WA 4FKOA 1Y57A 4UWYA 4XRLA 5AX3A 3UOJA 5EDQA 3DOGA 2EB2A 2OIQA 4M15A 1FMKA 4QDEA 1XWSA 3KVXA 4AQCA 4PL4A 4AGDA 2C5VA 3ZSGA 4CD0A 4N70A 4L43A 2QC6A 3FXWA 3PWDA 4O0VA 5CY3A 1BL6A 3PA3A 2CSNA 2W4JA 3F5PA 2X0GA 3RHKA 4A9TA 3Q2JA 5D11A 4B6LA 4C3RA 3CGFA 3I6WA 5IA4A 2O63A 2X39A 3LLAA 3PXKA 5CQUA 1U46A 4B8MA 3S2PA 3RK5A 4BGQA 3KKVA 3R71A 3D7TB 1APME 1ZYCA 3UVQA 3Q60A 5IDNA 2OJJA 3OCTA 5KNJA 2OF2A 5F1ZA 3ATTA 4XG6A 5CSHA 3GFEA 3A60A 5EI6A 1JOWB 3DBFA 3VS5A 4A4XA 4Q5HA 3OWLA 4TT7A 5E90A 4Q9SA 4AT3A 4AT4A 4C3FA 4EJNA 1ZOHA 2BFXA 2C1AA 4BI1A 1O6YA 4P7EA 2JGZA 2V5QA 3ZLWA 2OFUA 4NIFB 3TUCA 4ITHA 4NM3A 2OU7A 4E4LA 5JGDA 4XS2A 2B9IA 3R28A 4FKGA 4FV2A 2JIVA 3VS6A 3FSKA 4CSVA 4EKLA 1OL5A 4IEBA 5KZIA 5HNIX 2DQ7X 5EQPA 4P90A 4WRGA 3NPCA 4YJSA 2Z8CA 1OB3A 4CKRA 3QKMA 2YA9A 4LRJA 2RF9A 3HA6A 3HEGA 2CNQA 2H9VA 4OTHA 4QMVA 2XP2A 2BROA 1IA8A 2J0LA 4C38A 3C4FA 4ERWA 3Q5IA 3BYMA 3NNWA 4HZRA 4U41A 4WNMA 5JFVA 1H1QA 5HOAA 3DS6A 4MWHA 4XOYA 5M06A 3KIOC 4XRJA 3VUDA 1OMWA 4M0ZA 5FLFA 3F66A 1SNUA 4M66A 3PLSA 2GNHA 4KBCA 3O7LD 1P4OA 1H4LA 1P4FA 1K9AA 5EOLA 1YWRA 4CTBA 4YTCA 5ANEA 4NL0A 2OI4X 3H3CA 4G34A 1CSNA 4IAZA 4PY1A 4C4IA 4PNIA 4EK6A 4O84A 3M11A 2J0IA 4NIFA 4EK3A 3OW3A 2XKEA 1A9UA 3OF0A 4P4CA 2BAQA 3C4ZA 3SW4A 4FEWA 4FKLA 3UP7A 4TWNA 4Y46A 2C6IA 4NJDA 4AW5A 4DEEA 1YI6A 3UPXA 3QWKA 2PVRA 4I5CA 4JRNA 4CYIA 2GNJA 2BDFA 4FZDB 3I81A 4K6ZA 3ZO3A 5J1VA 5DR2A 2P3GX 3NNXA 3HMNA 4YJUA 5BVWA 5TE0A 4FI1A 3UQGA 3AC4A 4KRCA 4Q2AA 3FC2A 3LOKA 3FKOA 4DH7A 2WEIA 4A4OA 4QYHA 3FLZA 4BIDA 4CCBA 4K18A 4RFMA 1S9JA 1MRYA 2Y7JA 1KE8A 2VO3A 1RW8A 2HZ0A 5A3XA 3R8MA 1M2RA 3FSFA 2CGVA 2VAGA 3UDZA 3KK8A 5KX8A 2X81A 3RPVA 3LJ2A 4H1MA 3Q6WA 4M84A 2IZSA 1LUFA 4F08A 3ZUUA 4QTBA 4C33A 1HCLA 4M68A 4IWOA 3MA6A 3BU5A 4FTLA 5IUHA 5DRBA 2BUJA 1OL7A 1YXVA 5EYCA 3RVGA 3OG7A 3ZXZA 4BDFA 5L4QA 3R6XA 1Q97A 3R00A 3FZRA 3BHUA 2WTIA 1B38A 4DTKA 3UO5A 4HCTA 3O8UA 3KXHA 5AP4A 1GZNA 1Q8TA 5J1WA 2XH5A 4EWHA 4X2FA 3GI3A 2F7EE 3Q4UA 5LMKA 4P2KA 4RJ3A 3BV3A 2EVAA 4K8AA 2QO9A 5CVGA 3Q96A 3QZIA 2O5KA 3RCDA 1P5EA 3I0OA 2LAVA 4CYJA 3JPVA 2VWYA 3FXZA 4U40A 4QP2A 2BCJA 3CC6A 3Q52A 4D2RA 4BDKA 2X6DA 3FLYA 5KMJA 5AFVA 4IADA 3N9XA 5HTIA 3MESA 4RJ5A 2WQBA 4NCTC 3ZH8A 4JRVA 5GIOE 1FVRA 3KCFA 5IISA 3PPKA 3DA6A 4MHAA 4DT8A 2VO7A 2A0CX 3EFJA 4IHPA 5FEEA 3V8TA 5KBRA 2WQOA 4QPMA 3ACJA 4ZSEA 3R1SA 4H3QA 4U79A 3UE4A 3SV0A 3L8XA 3I60A 3PSCA 3BX5A 3ERKA 3QKKA 5K9IA 3U6IA 3TTIA 2FO0A 3A99A 3P79A 5CT7A 2OIDA 5ETFA 1BYGA 4ZJJA 4H3PA 3SG9A 2HXQA 4J7BA 2WTCA 3F7ZA 3FL4A 4WBBB 3D5VA 4JBOA 5EG3A 3OBGA 4WSYA 4JOAA 4XV1A 4YBKA 2J0JA 3L8SA 5CU3A 4BKJA 5B2MA 4NKAA 2PUUA 3V8SA 5CZHA 3WI6A 4R3PA 5LCJA 3PA5A 3K5VA 3ORPA 2XKDA 2OW3A 2X2KA 4QMTA 3TV7A 4EYJA 3B8QA 2IEWA 2VTQA 3W2CA 1OGYA 2RGPA 2C5NA 4PL5A 4RZWA 4FL3A 1H26A 3UIMA 3KXMA 4HW7A 2FB8A 3ZDUA 3VS7A 3F88A 3FLNC 2V7OA 4FVRA 5JKGA 3TTJA 4DBNA 3DXNA 3VBQA 1CMKE 1IRKA 4J71A 5EW3A 4EH2A 4ZLYA 3NMUF 2VTMA 3EHAA 2YIRA 3FKLA 4YHJA 3DZOA 1SMHA 5HCXA 3VULA 4TTHB 4CFFA 4U45A 2BPMA 3MH1A 3JUHA 5HG7A 2Q0NA 3UYSA 3TV6A 4F0IA 4FTQA 3TIYA 4ACCA 5M44A 3NUUA 3V01A 2J5EA 5BUJA 3HRBA 5LWMA 3FBVA 2Q83A 3FQEA 3ZRKA 3KXGA 5GHVA 5LMAA 4C58A 4ACHA 4I0TA 2IF8A 1PXPA 5KKRC 4O6EA 3HECA 5HCZA 5L8LA 4ACMA 2R9SA 3QC9A 3NUPA 4EH4A 5IG1A 5KUPA 2WQNA 3R9NA 2J7TA 1VEBA 1JKKA 3VC4A 4YO4A 4G6NA 4ZZNA 1UU3A 1H8FA 2QQ7A 2V55A 2VN9A 3DY7A 2VRXA 3CQEA 1KE7A 4CKIA 5HORA 2JC6A 4BR3A 5FBOA 3P5JC 4BDAA 1ZZLA 2FSOX 4NTSA 2UVXA 3LFAA 4JDHA 5EK7A 3ZTXA 3QQGA 4FV0A 3G6GA 3QRUA 3ZZEA 1FBNA 2BFYA 2E9OA 3VHKA 3DDPA 3HAVA 3MIYA 2XARA 3PXZA 5H8GA 3LPBA 3UZTA 2UW6A 2YERA 3QUEA 2W4OA 5CAUA 5I9YA 5G1XA 4FZ7A 4H1JA 4I23A 3UTOA 3FV8A 3R7YA 2C6OA 4G6LA 5J9LA 3E93A 3TNQB 2ZV7A 4LGGA 2UVYA 3IW4A 3C7QA 4B8LA 3C4XA 1JPAA 5IQFA 4DC2A 3E8EA 4PWNA 2OWBA 5AP1A 3JR1A 5J5SA 3G5DA 3W1FA 3NW6A 3ZRMA 2PVJA 2I0EA 4QNYA 3QTRA 4ASXA 5EHLA 1PKDA 3SOCA 4Q5EA 5EW8A 1LEZA 5B2KA 4RVMA 3FEGA 4FSQA 3T3UA 5HD7A 2WD1A 4I20A 3QTWA 3GU8A 4AG8A 1G8AA 5AX9A 3VIDA 3QAME 4BDEA 4L45A 4QP1A 4AXDA 2QG5A 2B7AA 3EQDA 5AP5A 1NVSA 3WBLA 1OZ1A 4LL5A 4QOXA 5D1JA 4WO5A 1U5QA 5FDXA 5AM6A 4A9YA 1YVJA 3MSSA 4DHZA 4ACDA 4U81A 4V05A 4D9UA 2OZAA 3ALOA 3QXOA 4WRSA 3EQPA 4YBJA 3UNZA 4ONAA 2X2MA 2WMWA 3EQBA 3RBWA 1H01A 3H4JA 4PRJA 2DS1A 2R7BA 3KXZA 3LW0A 3PY1A 4QMLA 2OJGA 4J99A 3D9VA 1GAGA 1Q62A 4CMOA 2JDVA 5C8MA 4O0TA 2VTPA 4QP4A 3UG2A 3CJFA 1YWNA 4BGGA 3CCNA 3C0HA 4FG8A 3NS9A 5CNNA 5BMMA 3TG1A 1Q8YA 4QMXA 1IEPA 3BWFA 1Q99A 3V6RA 5DR9A 2XNEA 4Y72A 2B4SB 3I1AA 4ZMFA 2UZNA 4H05A 5EOBA 4XLIA 3UP2A 2R3GA 4L44A 4TPTA 1NVRA 5TOZA 4BDDA 3HRFA 3UG1A 3F82A 2YZAA 1UWJA 3BU3A 1AD5A 4Y5HA 2OG8A 3E7OA 3LFBA 3MIAA 4LOPA 5AR8A 4D4SA 4L00A 4RIOA 3C50A 2UW0A 3BYSA 4A4LA 5CEIA 5AV4A 2VNWA 3ZMMA 3EN5A 4MD7E 4FYOA 2H34A 3F3VA 3PPZA 2UUEA 4JAIA 3PPJA 3RK7A 3TCPA 3HGKA 4F1OA 2IW6A 4DF3A 3BU6A 3LQ3A 2QU6A 2WU6A 3HL7A 1BX6A 1WCCA 4ZTNA 2C6LA 4GVJA 4EOLA 1KE5A 3UQFA 1OPKA 3RAWA 5ACKA 4F78A 1UWHA 4EBWA 1OBGA 4L8MA 4ERKA 5JFSA 2E2BA 2WU7A 3NDMA 5HVJA 5IKWA 4CFVA 3JS2A 5IH5A 3OXTA 3QUPA 4JR3A 2H8HA 4D9TA 3B8RA 2YDIA 2BZHB 2GTNA 3QALE 3SXRA 3TKUA 4I4FA 3BEGA 1XH9A 4QQJA 3ZOSA 1U59A 2F7ZE 2X6EA 3MTFA 4YTFA 4BCJA 4OTIA 5AP3A 1H1WA 3QD0A 2OH4A 3OWPA 3PP0A 4BGHA 3FMEA 5HG9A 3MJ2A 3KMMA 4D28A 3TMOA 5CX9A 4CXAA 3L1SA 1J7IA 2A98A 3CD8A 4AACA 4AXFA 3P0MA 3L8VA 1Q24A 4KIOA 2XB7A 3PA4A 1URWA 3D2IA 4FIIA 1MP8A 5M07A 4YUQA 3BLQA 1UNHA 3KRRA 4UBAA 1KSWA 3BQCA 1H28A 3FHIA 5AA9A 3EQIA 5DN3A 1W98A 4TYGA 3UYTA 2B52A 3KL8A 1K2PA 4FKJA 1K3AA 2ESMA 3R1QA 3II5A 4EH9A 4UMUA 4XP3A 5IQDA 4QTEA 4KS8A 3CR0A 2F57A 3GC9A 3OUNB 3OOMA 4CV8A 4DEGA 1MQBA 3QWJA 4DG0E 3VNTA 3ZRLA 3D83A 4AW0A 3G6HA 3OP5A 1ZRZA 4FGRA 3KRJA 3ZLXA 3DNDA 4FV1A 1WBWA 3MFRA 4L3PA 2ZB0A 3U4UA 5B2LA 4YZNA 4HYSA 3AMBA 4GT3A 1H1SA 4IWDA 4BCGA 4FE2A 1XMLA 5KCVA 4I3ZA 3RALA 4HYIA 3TKIA 4ZLOA 3NUAA 2J51A 2A27A 2R0IA 3L9MA 5HKMA 5M4CA 4GU9A 3PJ8A 2WAJA 4X2KA 3VQHA 2C3JA 2C6MA 2YCRA 3UDTA 5FM3A 3Q9YA 4DFUA 5L3AA 1YHVA 4IAYA 2C1BA 4ZOGA 3LVPA 4JG7A 3U9CA 1U4DA 4CMUA 5IUIA 3GUBA 4O6LA 4BBFA 4L68A 4ANOA 4KABA 3NW7A 4G3FA 3SXSA 2QOFA 3EQGA 3OT3A 3ZU7A 2QODA 5HLWA 3FI3A 3QLGA 3W8QA 1PHKA 4ANMA 3DPKA 5FTOA 4FICA 3E8DA 2OBJA 3PXFA 3PVGA 1OKWA 3ZFMA 2Q0BA 3KULA 3LFNA 4FIGA 3VUIA 3MPTA 5CAOA 1VLRA 5BMSA 4IJ9A 3ZFXA 4R78A 4GRBA 2VWZA 3L9NA 4AZFA 1YXUA 1KOAA 5HESA 4BJJA 4CV9A 5JQ8A 4N0SA 3QCYA 3F69A 2R7IA 4NU1A 3WARA 2W1HA 3DT1A 3WOWA 5D41A 3IW8A 4H58A 1BI7A 4CKJA 4O38A 5C03A 3EL7A 4EONA 2YM4A 3FLQA 4L7SA 4M3QA 4ZJIA 4ASDA 1WBVA 4LL0A 4LOQA 2RL5A 2VTHA 2PHKA 2GCDA 1SM2A 3VJNA 2OJIA 3AOXA 4IW0A 3DLZA 3O8PA 1JBPE 4ZAUA 2XNGA 4QMMA 1WVXA 2VTNA 2VWBA 3UIXA 4C2VA 2W5HA 1R1WA 4BCKA 2IZRA 4O1OA 4E6DA 2XK7A 3IG7A 1DM2A 2VTTA 2XALA 2ITQA 4M14A 3EMGA 5HZNA 3OCSA 4U97A 4P5ZA 2R3FA 4NWMA 5A6NA 5ANOA 3VRYA 4AX8A 2WTWA 4YHTA 3NVKI 4E73A 4UV0A 4E4NA 3FKNA 4FIEA 2VD5A 4BTJA 4EH8A 4XHKB 3D15A 2YEXA 2ZDUA 5C01A 5JGBA 3LMHA 2FSTX 4BKYA 5T68A 4O7VA 5AR3A 4IXPA 3Q5ZA 2FGIA 5D7VA 3VWAA 3CS9A 1UNLA 1IAJA 5ANDA 4O7YA 3AC2A 5A46A 4L53A 3REPA 2PVYA 4G17A 5IEXA 2O0UA 1QPCA 4HCVA 4YO6A 4F7SA 5FXRA 4YPDA 4S33A 2YM8A 2BILB 3OCBA 2JKKA 2ITOA 4GG5A 3FLSA 3ML1A 3QGYA 2PVFA 2XNOA 4M0YA 5FEQA 4DTAA 2WTKB 3DAKA 5E4HA 2W9ZB 4FSZA 4MNFA 4F65A 2E9PA 4R7HA 2BKZA 4GMYA 3SRVA 1CM8A 4EOMA 3UQCA 4DE4A 4N6ZA 2ZM1A 3DK7A 2C3IB 4EZ5A 5AA8A 2WHBA 3OCGA 5I3RA 3UPZA 3FMNA 3OHTA 4MTAA 5L6OA 3LIJA 1G8JA 4MF1A 1URCA 1H25A 2QOLA 1QMZA 2XF0A 3ORLA 5HO8A 5KBQA 5CNOA 4DBXA 2YJRA 4C35A 4CCUA 1SNXA 4RQKA 4LV7A 3GCUA 2ITVA 5HE0A 4D4YA 1JAMA 3ZUTA 4FKWA 1NW1A 3IECA 4DH5A 3R9HA 4ZMEA 3CP9A 5AUUA 4AS0A 3UBDA 4FSTA 2IZTA 2QONA 3KN6A 3C13A 3QX2A 3MVHA 4GUEA 5IA2A 1NT2A 1VJYA 4Y5QA 2WIHA 3W10A 2QCSA 2RG5A 5C9CA 3F3WA 4GUBA 2AYPA 4KINA 5HTCA 5JMSA 5HD4A 3EQRA 5LVPA 4OTFA 4X3FB 2R0UA 3FQHA 4AAAA 4IIRA 3TIZA 1KV2A 4PMPA 3Q6UA 4R77A 4FIHA 5CSWA 3SDJA 5BX0A 4FKQA 4JJRA 3DNEA 1V1KA 2CCIA 2PPQA 3OEZA 2YCQA 3QCSA 1YW2A 2R3MA 4JS8A 4KRDA 2JAVA 4QYYA 4JR7A 5GZAA 3UOHA 1HOWA 1Y8YA 4FIFA 3QTXA 3UNKA 5EQYA 4HJOA 4BTMA 2XEYA 2W17A 1OVEA 4QNAA 4G9CA 3TKHA 4E93A 3U8WA 4B4LA 2GHLA 1AQ1A 4R7IA 2YAKA 3QFVA 5DEWA 3DKFA 3K2LA 3WE4A 5M51A 5EQEA 2OO8X 2O2UA 4FSRA 4RJ4A 3ORKA 1H08A 3NX8A 4O7SA 4QP6A 5LMBA 3F2RA 1F3MC 2Y4IC 2C5OA 3PWYA 3SXFA 1YDSE 2QNJA 4EQMA 2PMLX 3QQKA 4OR5A 1B6CB 5AV1A 4DEDA 3MBLA 3WIKA 4KA3A 4DGNA 4DAWA 4EUTA 2YM5A 5EDPA 5E8YA 2QO7A 2ITNA 4F9BA 2PL0A 4FL2A 2ITZA 2WNTA 3QD4A 2X9FA 2XKCA 3SKCA 2W1DA 3LKMA 5BVKA 2HENA 1J1BA 2JDRA 2PE0A 2I6LA 4IB5A 5JK3A 4AW2A 4YSJA 2VWIA 3QZGA 3RINA 3FPMA 4YNEA 4PQNA 2X2LA 3GCVA 4EOOA 2UW8A 4QTDA 2UZTA 4RIXA 3W55A 3B2WA 1OM1A 2X7GA 3O0GA 3DFAA 3E5AA 4UN0C 2XS0A 3W2OA 4F0GA 4M69B 5LVLA 3MVMA 4TWOA 2Z02A 4OBPA 2NRYA 2RKUA 1BLXA 4ZXTA 3W2QA 2X8IA 2HW7A 4IVDA 5G6VA 3WF7A 4DYMA 4BY9E 3EH9A 4GT4A 4MXAA 1OECA 2VX0A 4CNHA 3ORMA 3QTUA 5E1SA 4ZEGA 4E26A 4CZTA 2Z7LA 5K0XA 4FA2A 2YHVA 4Z7HA 4S31A 4WG5A 3C0GA 3GC8A 5M53A 4R7BA 3H9FA 3GU5A 3LQ8A 3GBZA 2CGXA 2C0IA 3NUNA 4G2FA 2WELA 3CY3A 4J8NA 4ALUA 4EQUA 5CAPA 2XAMA 5DGZA 3P08A 4OBQA 4RC2A 3PTGA 4XP0A 4XUFA 4C37A 4LGHA 4ZTLA 4L46A 2YABA 2BRNA 1KE9A 3NIEA 3EYHA 2HK5A 4Y73A 2XUUA 2W1EA 2R3