4GYIA

Crystal structure of the rio2 kinase-adp/mg2+-phosphoaspartate complex from chaetomium thermophilum
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
341
structure length
338
Chain Sequence
KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIARLRGGSSGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 kinase
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transferase
total genus 106
structure length 338
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gyiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gyiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gyiA02
5HICA 3GEQA 5A9UA 1JXSA 4IADA 4Y83A 3T0YA 2C5NA 2WQEA 3F5UA 2PVNA 1K9AA 4O22A 1SD6A 4MEDA 1ZYRF 4CFFA 4A4OA 3FYKX 1LNWA 2ZYBA 4ZZDA 3CTJA 3DY7A 4XP2A 3QQJA 2YM5A 2WIPA 4YFKF 5FLFA 3DK3A 5D8LB 3ROUA 4CVAA 1JGSA 1GIHA 3HP5A 2W1ZA 4O7RA 4NM0A 3IRRA 4CDGA 2W4OA 4F9WA 5K5XA 2W57A 1MZBA 1UU8A 2W1EA 4L0YB 1W82A 5AR2A 3RM6A 1QQIA 3IW6A 1O3QA 2EWNA 2O6GE 2VD5A 4OTWA 4DA5A 4BWXA 2BFXA 3UZPA 2OF4A 4UUVA 1H9TA 5CVRA 2HKXA 4QQCA 4C4JA 5FD6A 1Z1DA 3EKNA 5LEJA 2VTAA 2O63A 2ESHA 3LXKA 5HVYA 4D1ZA 5F94A 3J7AO 2B1PA 4ASXA 3M42A 2WQMA 3QWKA 5D1JA 1W5SA 1GY3A 3BELA 2EK5A 4JBOA 3E5XA 2VWVA 3ZO3A 3NEUA 4J71A 1F3MC 2EXCX 3K9TA 4MWIA 2ETKA 1OIYA 3W2SA 2H94A 4Y72A 3RAHA 3R04A 4IANA 2HELA 3PPZA 4PGHA 3UMWA 1J91A 3BU6A 1PY5A 4PDYA 4EONA 2QOCA 4CQGA 3UQFA 3IW4A 2RFSA 3KL8A 1IRGA 3V8TA 4DGNA 4CCBA 4PL4A 5HIBA 3WTUC 3LVPA 2ZV2A 2EFNA 2PVRA 3NRMA 3JUHA 4HCUA 3HDNA 2ITTA 5JKGA 2ZVAA 2QI8A 3OBJA 5E8SA 3BJOA 5DD4A 2QLQA 4U7BA 3KB7A 5HQ0A 3C3WA 3LOKA 4F7SA 4BZDA 4RSSA 2J0JA 5I9UA 5H8GA 3CD3A 5EFQA 1U2WA 2VO7A 4GVAA 5CSHA 4XG7A 4DTAA 5HX8A 3Q2MA 4XLIA 3RTPA 2HY81 3SQQA 2WTVA 5EM6A 3AT3A 5ANKA 3FPQA 1FVRA 2W1IA 3NUPA 4JBAA 5BVOA 2RVCA 4JRNA 3BROA 4NJ3A 3ZMZA 3LA3A 2X7GA 4H3QA 4H58A 3Q9XA 3B8QA 5IPJA 2IJMA 4JNWA 3ML6A 3ZUTA 1O3SA 1LEWA 2VGOA 1RUNA 4L9IA 5LHHA 3VUHA 3H0ZA 2A27A 3LE6A 4LRKA 2JDOA 3DU8A 2YLEA 4L5IA 3Q6UA 3VHKA 2D1HA 3WG9A 2HW6A 5L3EA 1MRUA 3RM7A 3MH2A 3S95A 3LIJA 1O6LA 3E3BX 1CSNA 3KN6A 3OOMA 1SD7A 5E20A 5AAFA 2CGXA 4JAJA 1K2PA 2JLDA 4XV3A 3VBXA 2ETHA 3D15A 4W8EA 5BOXA 4WNMA 2DLLA 2QQ7A 1R5GA 4BCOA 4RJ4A 4A06A 4CZZA 1J5YA 3E8CA 2XNOA 4PTEA 4R8HA 3U2RA 5IT9Z 3MA6A 4RIOA 5TRDA 4Y5QA 3S3IA 1C0WA 3ZSIA 4EZ3A 2V9VA 3KVWA 1BIAA 5K4JA 5M07A 3DNEA 3ERKA 5EM5A 3OOPA 3NAYA 4O6LA 5FB2A 3RHKA 2E9UA 4EJOA 2UW9A 2FA2A 3WIKA 3EN9A 2C6LA 4A0ZA 2OXDA 3CEKA 3A8WA 2JBOA 4YHFA 4RX8A 4BF2A 2ZBKA 4FGBA 5JRSA 4I6FA 3BU5A 3GFJA 5CEOA 3ELKA 4MQVA 3R9RA 5LMBA 4O3MA 2CYYA 4FG8A 4CXAA 2XAJA 5EG3A 4EYMA 3I64A 4QT1A 4FL3A 2QVSE 2NRAC 4JT3A 4HOBA 4FICA 4A4LA 4FSQA 2A6EF 3A7HA 3BPRA 5LHIA 5CAUA 2V6CA 4QMTA 2PMNX 4PL5A 4IBMA 3CSVA 3F3XA 2BRBA 1G8AA 4OU0A 3KA0A 3Q3BA 4X7QA 5CJ9A 5A2QK 1PKGA 4ENXA 4IW0A 3RK5A 1WVXA 2JKKA 3BPVA 4CZYB 1R1VA 4JRVA 3D5XA 2PN6A 3HV3A 2CKOA 3IC7A 2WEVA 4BY9E 4C8BA 3Q60A 4X2KA 1TTYA 4BYJA 5BMZA 4FTRA 2VT2A 5E8IA 1U46A 1URWA 2IG7A 4FR4A 3NW6A 3QGYA 2PUNA 3R8VA 4JS8A 1OM1A 3F2RA 3F66A 3CGFA 2OLCA 5ICEA 4QP8A 4J53A 1Z5MA 3BLRA 2OQGA 2F7EE 2W7XA 4PGGA 4KWPA 3KEQA 1YWVA 2W1HA 2VTNA 2BR1A 2K4BA 4AN3A 4B8MA 5GINE 4ACDA 4CT1A 3IK3A 2CFXA 4ESFA 4O21A 5DYJA 1R0EA 4BXUA 3OS3A 2E1NA 2RIOA 4D2RA 3IOKA 1CKIA 2KTYA 4FNWA 4ASDA 4ON0A 5CF4A 3CXWA 1YLFA 4LGHA 5HO7A 2BRHA 4R8QA 4F7NA 3NUAA 4HW7A 3AD4A 3OOGA 2DK8A 4FEQA 1U5QA 3Q6WA 4IQ6A 5AP4A 2XRNA 4C59A 5JHUA 3GFEA 1HW5A 4YJQA 3BU3A 4RBLA 4L3JA 3W2RA 4EJUA 3BV3A 3BOQA 4N9HA 1ZYLA 4ZTLA 4IACA 2NNNA 2JAVA 1GIIA 4K8AA 1W7PA 2H96A 4QTBA 3KY2A 3O7LB 3U6HA 5L8KA 4LLGF 2B53A 5M53A 2UW0A 4K18A 5J1VA 5C8NA 2ZMCA 1AOYA 1OBGA 5CSPA 3BHUA 1AQ1A 3LA2A 3RMFA 5H2UA 4V05A 2GFSA 4LMUA 4E1ZA 4QP1A 4ZLYA 1R1UA 1SNUA 4KIKA 4Y13A 2D2WA 4IWOA 5AUXA 5HE1A 4PMPA 4QYFA 2UW5A 2I40A 3HSFA 4JG7A 3BJ6A 3EQFA 3PY1A 4YG2F 4AFEA 3EQIA 1SVHA 4S04A 1UNHA 2MLKA 3F69A 2PVYA 4IZAA 5FGMA 2D45A 1V0BA 3AD5A 5E9EA 2CNQA 5BVKA 1Q3WA 4DLJA 2BVAA 2W1FA 4QP3A 4YMJA 4RX7A 2VWXA 1JLUE 1MRVA 4JQEA 4AZWA 4O0VA 3UZTA 1LQ1A 4G6OA 4IX6A 4FIHA 5HX6A 2RKUA 4GT3A 5A54A 1J3HA 4IXPA 1T38A 3LXNA 4K6ZA 2EVAA 5A4LA 4R79A 4FKJA 1P2AA 4LLNA 4E7WA 2BGCA 3FKNA 2WMVA 3E3VA 2IVMA 3CE3A 3SHFA 1WWXA 5IQAA 2CGVA 2OZOA 2FH9A 2B55A 3ZHPC 1YOJA 4WRSA 3TDVA 1UA2A 3IONA 4QP9A 3KVXA 2JAMA 2IN6A 3VF8A 3FMSA 3I4BA 3F5PA 4ZY4A 4UN0C 2HEOA 3LCTA 2Z7SA 3R8LA 2J6MA 3DJ6A 4RLKA 2YDJA 5DCFA 5EHLA 3U6IA 5E8XA 5HEZA 4LFUA 2XCKA 1Q8WA 3ZM9A 4CICA 3NYVA 1KE9A 4L9VA 1ZZ2A 4O0XA 2E7XA 3MIYA 3EZVA 4JJRA 4IRGA 4FX0A 3JTGA 4YLKA 2EU9A 3QOPA 2XKPA 4EK8A 4L68A 2OZ6A 1TBXA 5CVUA 3R1QA 3VIDA 5DUIA 2XBAA 3P7AA 4M9SA 1ZRCA 2IW8A 3VBTA 3KF7A 5E90A 3RAIA 3F9NA 3NUYA 2XEYA 4F63A 5E7RA 4BYYA 3WTZA 3OXIA 4PNKA 4D5HA 2OZAB 3GCPA 2K4JA 4FIFA 1WSUA 5DYMA 3GNIB 3QTWA 4F0IA 1SMYF 1IXRC 3R6SA 5FGKA 1BM9A 1OKYA 2QVOA 4JI9A 5JVTA 1NXKA 5TR6A 3G73A 2PJPA 4QYGA 2HENA 1YO5C 4HYIA 4N6ZA 1Y91A 5IQEA 2XUUA 2XJ1A 3UNKA 5F4NA 4YBJA 1USSA 3ORMA 4MXZA 1W0XC 3UP7A 1PW2A 5LBQA 4O7ZA 1W5TA 1SFXA 1PXNA 1E9HA 2CPKE 3P0MA 5HI2A 1M7NA 4L3LA 4YZBA 4YHJA 3JYAA 3BGZA 4EJTA 3DB8A 3MZHA 4IE9A 3ZU7A 2ZOQA 4MHGA 1U4DA 1IXCA 2YLFA 3L9NA 4C58A 3CBLA 2LF7A 4CLIA 2B4SB 3CGOA 4QQTA 3L9LA 3BPXA 5DT0A 4LL0A 5FTOA 2BZKB 4EMSA 1PMVA 3GC8A 3GP0A 4IAAA 1R23A 3FZ1A 2R0IA 5IA5A 5CZIA 4G9CA 3K5VA 4AT5A 3ENMA 4LOOA 3F2NA 1MQBA 3I6UA 5LQFA 3ZO1A 1RNLA 4JIKA 4USFA 3S00A 1ZYDA 3O8TA 2OJJA 1XH8A 5E8UA 3CUQB 1YVJA 3FY2A 5B0XA 4RAZA 2C6TA 4ONAA 4TWNA 1KV2A 3F8BA 2DI3A 3R60A 4KMUX 4M69B 3M9AA 2XKEA 5CNNA 3K5UA 3E7OA 3ANQA 2QURA 4M14A 4I41A 3PJCA 4I4EA 5AWMA 4DT9A 2OBPA 5E1EA 5E1XA 4WRGA 4EK6A 3MCZA 1T6SA 3U4UA 4RGSA 3LMIA 3AT2A 5D4SA 4PMMA 2JBPA 3FQEA 2P2HA 3O2MA 1JVPP 4E5BA 4IX3A 3UNJA 3ABUA 1USTA 3VS1A 1OIUA 4UXLA 5CENA 4FUYA 1Q8YA 1BX6A 1XR1A 4CMUA 3PA3A 1PXIA 3R7OA 1HKTA 5K5RA 3FZRA 3A7JA 3QD0A 5KVRA 4FODA 2PVKA 2DW4A 3R2YA 1RUOA 2DAOA 4K1BA 5HORA 3IKAA 3IWFA 3M8EA 4ZTHA 3M1EA 3MJ2A 5LVNA 3BLQA 3P9KA 3R61A 5CT7A 3RI4A 4I6BA 3D2KA 4DE4A 2IZUA 3R1NA 2HDCA 5EKOA 3ACKA 5BYLA 3TNPC 1P4XA 4FZFB 3R7UA 5M4IA 3GFLA 4ENNA 5L4QA 2DU9A 3LJ2A 4EQUA 4MK0A 1K7AA 2QO2A 4R3CA 4KIBA 5JT2A 2HZ4A 4WSYA 5M06A 3FY0A 3FC1X 1I1GA 1F5QA 4MAOA 5EYMA 4I6HA 4EH6A 5HLWA 2GS2A 2FSLX 3R63A 3NYOA 2WC2A 4S2ZA 4APPA 1UU7A 1MGTA 2KIFA 5I5ZA 3ZN1A 2GWRA 2YWVA 4QMZA 5EHYA 3AD6A 3GU4A 4XX9A 4KT5C 3DOGA 3LHJA 3UVPA 1FGKA 2NPQA 2ITYA 4B8LA 4M97A 1QPEA 3DAKA 5D9HA 1W8CA 1YXSA 3HHHA 5CAOA 2YM3A 2XKFA 3ETAA 5HVJA 5LVMA 4XSZF 4DITA 3EN4A 3KXZA 4GGGA 5D12A 4QMVA 1ATPE 5JSMA 4F0FA 1U6GA 4FZDB 3TNHA 5I9VA 4CHUA 5A6NA 2GTMA 3RI1A 3CY2A 2B9IA 1M14A 4CKIA 2P7VB 4RIWB 4DLIA 2RL5A 4FL1A 5EW9A 1FY7A 3HIFA 1Q97A 3E5AA 4O7SA 5KMJA 4HW0A 5HVKA 3GC0A 1NW1A 4EGYA 3C1XA 4OMYA 4A9RA 2VBWA 2ZDTA 2SRCA 4AIHA 4PCQA 2WWYA 3H3ZA 3TGNA 4RIXA 2BPMA 3GBZA 2FE3A 2JDTA 5J7BA 5C01A 3BCEA 4DEAA 4IAZA 4Z2YA 2O3PA 1UU3A 2QQ9A 4IWDA 1YOLA 1OB3A 4YTCA 4AZEA 3DNDA 3HOTA 4RGXA 2UZKA 2UZNA 2YDKA 3TO9A 4MH7A 3EQRA 2PZIA 5BVDA 2ZMEA 3MIAA 3E6BA 3P08A 4GK4A 4JDKA 4ZZMA 3QTQA 2L3DA 2HQRA 5ILVA 1XH5A 4RQKA 3TNQB 1LR4A 1GVJA 1UNLA 5AIRA 4YC6A 5CY3A 3I81A 1YQAA 3PE2A 2BZHB 4RVTA 3VHEA 4X0MA 1TNTA 2OI4X 3NVKI 3TUCA 2FYSA 5AV1A 5BVWA 4KICA 3DKOA 4FVQA 3UIXA 4EHGA 4EVIA 2Q0BA 4GCJA 4F08A 5ITAA 3ZMVA 1NT2A 1RZ4A 2XIYA 3VS7A 1G5SA 1CF7A 2PMOX 1W4MA 3QTUA 3KF4A 1Z9CA 5T68A 3GW2A 1OPKA 5K0KA 3TIYA 2RN7A 1ZY4A 3F3TA 4ANMA 1IN7A 4YJUA 2FQ3A 1KE7A 2F7ZE 5DV5A 3OZ6A 3BHTA 4NQWA 2Q0NA 5DI1A 3ZUVA 4WXCA 4G9RA 1IRFA 4R1VA 3MFUA 4LUEA 1FMOE 3IL2A 1Y8YA 4YZNA 3QTXA 5L2TA 2AUHA 3WILA 4NHJA 3ZMSA 3EN7A 1OMWA 3DBFA 2XV4S 1PMEA 3E93A 4FTKA 3DXQA 3LAPA 2O5KA 3T8TA 3HEGA 2VE9A 2IPQX 4IB5A 4HVSA 2WMBA 4EUUA 4IHTA 1YS6A 2O61A 1WVWA 1QGPA 3HUGA 2F5CA 3VBWA 3RHXA 3W33A 3G9LX 4X3FB 2QENA 5CLPA 1FP1D 3FQHA 2BHHA 3QU3A 3R21A 2P4IA 3D14A 4D4SA 4EI4A 1Z6TA 3VUGA 1Q8ZA 4BWPA 4MD7E 3LCOA 4IH8A 3Q5ZA 4D55A 4H36A 3BHYA 3F88A 4O38A 4IM3A 2QHNA 1XKKA 3DTCA 3AMBA 2RFDA 5FLXK 3MTLA 4G7ZF 3EJ1A 2A3SA 1CTPE 3Q04A 5F1RA 3JAMZ 1WVYA 3HMIA 3C5UA 5KX8A 2OU2A 2ZNYA 2VNYA 3W2QA 4M74A 5FBOA 1UU9A 3MA3A 2VOPA 2FMYA 3COKA 3VQHA 4NCTC 3HRFA 2KJBA 2XHKA 4JQ7A 3F21A 4E6QA 2NS0A 2O3FA 3QZIA 4FTTA 4HYSA 5KKRB 3MVHA 4RA5A 5D5XB 2HOEA 2RFEA 3ULIA 5K1YA 3QRIA 2PVHA 4XOYA 3DCVA 1HSTA 4XG2A 2IVUA 3SZPA 4ZYDA 3OT8A 5JI6A 4E6CA 3W32A 3QUEA 4RC4A 1M7QA 5E18F 4C2WA 5LVPA 1WMKA 4L18B 3F61A 4XS2A 1H0VA 4FKSA 4DH3A 2ESNA 4GYGA 4A5MA 3ZZWA 3IW8A 3ZO4A 2KJCA 5JR3A 3PZHA 4KIQA 2O2UA 3C4ZA 4AZSA 3RWPA 2YCRA 1BBYA 4I24A 3PQKA 4W4XA 4U45A 1PYXA 4OR5A 5M4FA 2R7IA 5IA2A 2XK3A 4MEXF 3U9NA 5IQGA 4I2OA 2VE8A 3TDZC 4FMQA 3TI1A 3V01A 1YDSE 5HLPA 3DPLC 4MVFA 3BDDA 1WRJA 1SFEA 1S9JA 2Y4IB 4YZMA 5JFVA 2J5PA 4I6QA 2GQGA 3KRWA 4MBLA 5JFRA 5BPYA 1ZG3A 2QOIA 3U8WA 5F20A 3JW4A 4PWNA 3MW1A 3HUBA 3R7IA 2CKPA 4BI2A 2Z99A 3CQWA 3H0YA 3KXXA 3BZ6A 2ONLC 3CP9A 5D5VB 2PG4A 4QMWA 4L43A 2YACA 1YS7A 3GB2A 2Z9OA 3FXQA 3A60A 3SFZA 5A4EA 5LCKA 1WAKA 2YAKA 4MGRA 2HZ0A 2VN9A 4M7IA 2HWOA 5CF6A 4RC3A 1FBQA 4M3QA 5ILSA 5ANEA 2QOKA 4J99A 4BDJA 2OIQA 4OMZA 4AE9A 2HTSA 3F8CA 4E4MA 3FV8A 2J4ZA 2OJ9A 3HSRA 2OIBA 3VFZA 1XMKA 2OW3A 4PDOA 3QCYA 5EOBA 3SW7A 2C5YA 1WBSA 3R02A 4LV8A 5LVOA 2MBFA 3EQGA 4DFYA 4FKUA 5KNJA 4PRJA 2FUMA 3O8PA 3SZTA 1LEBA 5FD5A 4CV8A 4KIFA 2ZCWA 3UOLA 2CCIA 1HKQA 4UYNA 2WB8A 4EH3A 4HJOA 3K2ZA 2IZRA 3KRLA 3VOEA 2PY3A 1UV5A 4EYJA 3QRJA 2PE2A 2VTSA 3F6OA 5C8MA 1JQHA 1BI2A 1Y6BA 2HWPA 2ZDUA 2YISA 5CAQA 3QUPA 3MGYA 2X0GA 5HE0A 1A04A 3I6WA 4MF1A 5AM7A 4DTKA 4GCVA 3EQDA 4FTUA 2JD5A 3WTYC 4E8AA 2P7CB 2X2LA 4GU9A 3DQXA 3GUBA 5BX0A 5AADA 5I4NA 4XRLA 3OTUA 2JKOA 1O57A 5CI7A 4AOIA 4CRLA 2MH2A 5L3AA 2XH5A 4BI0A 5GIPE 5H6RA 5IH6A 3CUQC 2F4JA 5ANDA 2Y8OA 5E4HA 4NW6A 3ZUUA 4ZZOA 3Q2JA 5ANJA 3QF9A 5J9ZA 4XOZA 3OUKA 3TJDA 1MRYA 2M30A 3LLTA 3FL4A 5HDKA 3MBLA 1EH7A 3O17A 2GNJA 4BGHA 3EQCA 4CKJA 2ZFWA 4M71A 1FBNA 3QZHA 4U97A 2DTRA 2PUPA 4W9XA 3N97A 5EW3A 3WU1B 1PMNA 4X6RA 4IM0A 3OCSA 2RFNA 4ZJVA 3GO5A 5HE2A 4GT5A 1DAWA 4C0TA 4JBVA 2REIA 3CY3A 1OKZA 5CVHA 1P5EA 4CLJA 4GO1A 3PSBA 4UMPA 5TT7A 1SFUA 2VTLA 4ZTSA 3UP2A 4ANSA 2Z7QA 2ITPA 2Q83A 4QLCU 4K2RA 4A9TA 3HMPA 5J8FA 1FYKA 2W05A 2OGVA 2ZM4A 2ITWA 2OICA 4BIBA 5KZ0A 3U1DA 1WBVA 3ZRMA 3ZSHA 1PP7U 4FX3A 2R3NA 4Y85A 5ICGA 3G6GA 4OTGA 2QR8A 4O7LA 4EH2A 2DPUA 3FXUA 3ANRA 3OY1A 4FSWA 3C5IA 4ZXTA 1IRKA 5BYZA 4KD1A 4QO9A 4FT5A 2GPHA 4RMZA 4MBJA 4TYHA 2XNPA 2DK5A 1ZOEA 4O7TA 2WTDA 2J5OA 2ESMA 3FXWA 3KMWA 4RIYB 4GUEA 1IN4A 5L3CA 3R8PA 4NT4A 3DKGA 5AV0A 1IASA 2RQPA 4FTCA 2OD5A 4GEOA 3V5QA 3I58A 5AV3A 2WV0A 5A4QA 3B73A 1STCE 5AA8A 3NNWA 4GJ2A 2FRHA 4EOMA 3UTOA 3WE2A 5BYYA 2QBYB 4BCQA 3EL8A 5FDPA 1XJDA 5JMSA 4FKIA 3W2OA 4XYFA 2ITQA 1D8KA 2O8XA 4QD6A 3FMEA 4D0WA 5E91A 5K4IA 3C50A 5DH3A 4LGWA 3B2TA 1PYEA 4LYNA 2V62A 3E5QA 4CQEA 4RJ6A 3ZPLA 1YXTA 5C1QB 4HGEA 2XEZA 4RWLA 1YI3A 4BRXA 2R9SA 4D2TA 4FEVA 1ZHFA 5DR2A 1W84A 2C1AA 2OXXA 3E5UA 2WQNA 4RJ5A 5JEBA 4LG0B 3LXPA 2V1XA 4UMQA 4X21A 4NSTA 2WXVA 3D9VA 2Y6MA 3R0TA 3W16A 2CHLA 3GXLA 4Z55A 4HZFA 1PRYA 4JL9A 3FQSA 5F9EA 2NO3A 2Q0OA 4I0BA 2A69F 2VONA 1QCFA 3R00A 4DQ2A 1PXJA 4Y15A 1LVAA 4IVDA 3NGAA 4D2SA 3Q4TA 3V5PA 1KA8A 4E4LA 4OTRA 3LAUA 3LFKA 2YIXA 1W98A 5JFWA 3FKLA 4HYEA 4CT2A 3VRYA 2B52A 2B9JA 2EJRA 1E2XA 1G3NA 4Q9SA 5M44A 5DCMB 3KZYA 2W1DA 4S30A 3MZYA 4L7FA 1Z9XA 4AD9A 4PMTA 4FKPA 3C4FA 5H3QA 2W5BA 4K11A 2JEDA 3CLOA 1BI0A 3TM0A 4ITJA 4D4VA 2VXZA 3ZYAA 4K9YA 4QMPA 5D4RA 2O65A 3ZRKA 2ZO4A 2HZTA 3EQHA 3E6MA 2XYUA 2OF2A 4FV0A 3KU2A 2DQ7X 4H3PA 2C0TA 4CFVA 4BVUA 2L4MA 3LFQA 4FSMA 4ZAUA 2W5HA 4UEUA 3Q32A 4R7HA 3H92A 2CDZA 1CM8A 4OT5A 3E3PA 5FXQA 4GIHA 1J0RA 3LQ5A 3CQEA 2ITXA 3PG1A 2C4GA 5J87A 2XKDA 4W9WA 1V3FA 2KIUA 2XBJA 2R64A 4Q47A 1W83A 1APME 3AC3A 3BKBA 4F9AA 3F72A 1FVVA 3AC5A 1XWSA 2QONA 3F3ZA 5ANOA 3TXOA 4AZTA 3S1HA 4FZ7A 3NMUF 3RKYA 4V0GA 3I7CA 5DEWA 5LMKA 4PQNA 4ENMA 4YO4A 5AIPA 1JKLA 4H39A 3RYPA 1ULYA 4PMSA 3RP9A 4QTEA 2WFYA 4E26A 2K02A 2TDXA 4EK4A 5A6OA 1OL5A 2QD9A 4KBKA 1PDNC 4MTDA 3FUPA 1WBOA 1LEZA 3PPJA 4XBFA 5ICPA 3WZEA 2PBIA 2HW7A 3ORPA 3F6VA 1X3UA 4JR7A 3D5WA 4UXNA 1NHAA 4JDHA 1XQZA 2ETMA 4MD8E 3RPQA 3HKOA 5BMSA 1XH7A 4MXXA 3ODZX 3J80Z 4OOIA 4FTOA 4O1OA 5FXSA 1J1BA 5BNJA 4AGWA 3T5XA 3WODF 4G8XA 3A62A 4RGRA 4QMMA 4HLYA 1OL7A 3A8XA 3TN8A 1WI9A 4I23A 3PSDA 3HUCA 1IW7F 3EFKA 2BIKB 5LWMA 4C4GA 3TACA 3BYVA 3HYHA 3F82A 4GS6A 2H09A 1S6LA 3HAVA 5LCJA 5FEDA 4TWOA 4FG7A 2AC3A 3QTIA 1REKA 2PLYA 2QOLA 2HOGA 2MLGA 2G9WA 4UWYA 3MFRA 2VGPA 1H8FA 2C1BA 1FPQA 4ANLA 2R2PA 3OW3A 3V8LA 3PXRA 2DQRA 2HK5A 2JIVA 4J7BA 1JWHA 4AGDA 4U79A 2ITUA 4XLPF 4RWIA 2C6DA 2PL0A 3KMMA 1IN5A 4Y95A 4QTCA 3LFBA 2GIVA 2PZPA 4UWCA 3QYZA 4YO6A 3VUDA 3W55A 1MJAA 5IH4A 3EN5A 1QNTA 3FI8A 3DV8A 2FF4A 3DBQA 2JIIA 3J81K 4O0UA 2CN5A 4ZJIA 2YITA 4BFMA 5CALA 1ZRZA 4G7OF 3ZFMA 3HP2A 2W96B 2JDRA 4E70A 4G6LA 5EQYA 5ETAA 2W17A 5CSXA 4F70A 4FV8A 4I5HA 1E1XA 4WUAA 1T2KA 2XF0A 4FV1A 4DFNA 2H9VA 2IRFG 3RGFA 2XK7A 2BDJA 5TO8A 4KB8A 4F99A 1GHCA 4HYHA 2PMIA 3DPTA 3WTXC 1Z57A 3SW4A 5DT3A 4ZSLA 2W4JA 3FLYA 3SKCA 3IECA 2P55A 5CT0A 5K9IA 4EHEA 5M56A 3ACJA 4OUCA 1H0WA 4DEIA 5F95A 5HLNA 2HQNA 4U88A 2IZSA 4NIFA 1DI9A 5FP6A 5ILUA 4L6QA 3ZFYA 2JDSA 4S34A 1YWRA 1LDKB 4JG8A 4C34A 2ISZA 3RKXA 3TTJA 2EFPA 4MF0A 1KOAA 4CYJA 3FSFA 4GJ3A 2LAVA 3S2WA 3HV6A 3NYXA 5EHOA 3R2BA 1O7LA 5AUVA 5JGDA 4BWKA 2R3JA 1XH9A 4BAYA 5IUHA 5AR7A 2P6SA 3HOSA 5IUGA 3JXWA 3BV2A 2QM3A 1HOWA 4I5CA 4DFXE 4L00A 3IKTA 4E6DA 2IT0A 4OAVB 3EHAA 4UMRA 3O3KA 2IVSA 3ZXZA 4BB4A 5ETFA 4DG0E 3QKKA 2YDIA 5J7HA 4EHZA 4NWMA 5CLSA 2EFOA 2YJSA 3CS9A 4IWPA 2JSCA 4JG6A 5L3FA 4E3CA 5HLHA 4FNZA 3WZKA 3I5ZA 2JKQA 1LEAA 3A61A 4QWQA 1BL6A 4K33A 4JLCA 4PZJA 2P5VA 3LFSA 1GNGA 3DF8A 3PA5A 1P2FA 3GU6A 2GMXA 5HG9A 3DQVC 4ZLZA 3JS2A 3R9HA 1SAXA 3E8DA 4WNOA 1K78A 5AR5A 2Z3YA 1QPMA 4HDVA 4A4XA 4U43A 4DCEA 3T9TA 5AP3A 2I0EA 2YIQA 3CKXA 4A6DA 3HV4A 1KV1A 3MY1A 3DKCA 2QKWB 4TYEA 3EUHA 2CWEA 4G94A 3JY9A 3D5LA 4KFCA 5LJJA 3BRBA 1QBJA 1ZGJA 4EH9A 4MCVA 2J51A 4KABA 5CTPA 1B39A 3QQFA 3SXRA 3KXHA 2MC3A 2PU8A 2I0HA 3F8FA 3EYHA 4EOIA 3DFAA 1G3WA 1RJBA 1Q8UA 1NVSA 1FOTA 3ZC6A 4N9IA 4NJDA 4MEYF 1XGNA 3RJCA 5DD8A 4IRIA 5KHXA 2C3KA 2R3LA 3BI6A 3NVMB 1IG1A 2Z2WA 4S32A 2VX0A 4U5JA 3T8OA 3S0OA 3OD6X 5DHJA 4U81A 5JFSA 5AV2A 4FTAA 1KE6A 3G0EA 4GSBA 5CYIA 4RJ3A 4QP4A 1KYWA 3MQ0A 4TY1A 2VTRA 1PXKA 1NVQA 4AT4A 4O7VA 3D7TA 4IAKA 3PIYA 2OBJA 3KN5A 4ZYGA 2C0OA 3H3CA 2P5KA 2ONLA 2YIRA 4IAYA 3QBNA 3RIRA 5BPIA 1G4DA 3NAXA 2VTIA 5EI8A 4CFXA 4AWIA 3MPTA 2G7HA 3LMHA 1R36A 2IVTA 4BZNA 3LXLA 2A2AA 3SLSA 2X9FA 2VOOA 1W7PB 4E20A 5DBXA 2WTJA 3ZDIA 3UIUA 3ZFXA 2JIUA 4PNIA 1FVTA 2WOTA 3PVUA 5KMIA 2XIRA 4FSYA 3RAWA 3VS4A 4M6XA 3QQUA 1IAJA 3DPKA 3NCZA 4V01A 4QP2A 3NDMA 3GGFA 3QQLA 4KIKB 3EOCA 5M4CA 1SNXA 1JPAA 3E63A 1M17A 4C35A 3NCGA 1G8SA 1FLIA 3C4EA 3EDPA 4RZWA 4CV9A 3VBQA 3OMVA 2B9FA 4BBEA 5GIOE 3ZH8A 2OG8A 4DFZE 2VWWA 4QRCA 5J95A 5HDNA 3T9IA 3GVUA 4YJRA 4YTHA 3JSPA 4Q5EA 3RNYA 3QGWA 5DN3A 5DR6A 1FX7A 5CQUA 2FSWA 4O0YA 3GCVA 1G3YA 2UXXA 2F7XE 2CN8A 4GFMA 3QRTA 3VF9A 3LQQA 2EB2A 2HY0A 1S3JA 4FK6A 1QZZA 3IW5A 4ORKA 3LW0A 3NYNA 3FBVA 1OZ1A 3C0HA 1YI4A 4E73A 5GNKA 4BKYA 1MD0A 1ZLJA 1MUOA 3V6RA 3MAJA 3GU8A 4M12A 4PTCA 4YR8A 5CVJA 2JPCA 1OUYA 4ERWA 3FMKA 3NRVA 4GRBA 4XBUA 2XVDA 3FHIA 4HX4A 1OKWA 3BGPA 1J9IA 1ZYCA 2VNWA 4CGZA 5TKDA 1R58A 4A0YA 2BZJA 3ORKA 3OCGA 4DAWA 4O27B 4EH8A 4QNAA 4ZH4F 2PUUA 2WKMA 4NM5A 4Y73A 3R30A 3F8NA 4LD5A 4EM1A 1GXPA 3QHWA 3GFWA 3V6SA 3NNVA 4QMXA 2G7UA 2VT3A 1FGIA 4YBKA 4ID7A 4LFIA 3FE3A 2WEIA 5CU4A 3E62A 4F1MA 4E4XA 4TTHB 2LNBA 4G17A 4FSZA 4N4SA 3KP2A 6PAXA 3ECHA 4FNXA 2JITA 5IQDA 5D10A 4D4RA 2QOOA 5C03A 3IW7A 2RDPA 3GWZA 3AMAA 3OW4A 4RVLA 3ULQB 5BQ0A 4LL5A 2QHMA 4D1SA 3RAKA 3IKVA 2OZUA 4UXQA 2V1UA 4FKLA 3M11A 3PIXA 3TT0A 1OVEA 3P7BA 3DK6A 4LB5A 2AC5A 5D6FA 5TE0A 5IQFA 1Q62A 2Z60A 2YZLA 5HZNA 3TV6A 5AIKA 4G6NA 2BRNA 2Q2EA 3RNIA 5FFZA 1IR3A 5DRBA 3DXNA 4KKEA 4WBBB 3R4KA 3BWGA 5EKNA 2EV5A 3PVGA 4KKGA 3AC8A 4CTBA 3BYUA 1H08A 3QL8A 2EB7A 4CYIA 4A9UA 1Z6RA 3FMMA 5C26A 3F5GA 1GZNA 4O6EA 4E5AX 1KU9A 3PJ2A 3TZ8A 4KINA 3VS5A 1OUKA 5HE3A 4IVNA 4QPAA 1DPUA 3FM5A 3M8FA 3AGMA 3G33A 4BGGA 4ERKA 3QP5A 4L67A 3FWEA 2F9GA 4IAIA 4DEDA 2VO0A 5HGIA 4U3ZA 1OIRA 4ENKA 5KO1A 3F8MA 2G2IA 4DHFA 4EQCA 4F6UA 3VC4A 3UMXA 1R00A 3SRVA 5CEIA 3EZRA 1RDQE 1BI8A 4O6JA 1R7JA 5FQDC 2XASA 4P90A 3QRKA 3FMLA 3WE3A 2ETRA 2XRUA 3EIDA 5KE0A 4RB3C 2GNHA 5LHGA 2O64A 4BTKA 4UVBA 3F23A 2VX1A 3K1PA 4NUSA 5AUUA 1P4AA 3GT8A 3DB6A 3UO5A 4KIPA 1J7IA 3SXSA 2WMWA 4BDEA 5AIQA 5EEGA 1RQQA 4YZ9A 2WTKC 4RB2C 4JK1X 3UPZA 3HRCA 5AP6A 4OTDA 4HVIA 5BUJA 1JBPE 3WIGA 2J7TA 1IUYA 3DT1A 3R8MA 3N4MA 4MKCA 4G1WA 4Y8DA 4EK3A 5BS6A 2PTKA 3MV5A 4P9UA 1Q8TA 4B09A 4KRCA 4UVAA 2CQKA 1R78A 1WQ2A 5AP7A 3LSTA 2HKOA 4MXAA 4KSPA 4AQCA 2J2IB 1H00A 4GT4A 4FTQA 3VUMA 1B4AA 1HBXG 2RG5A 2BILB 3BE2A 4A0XA 3LFCA 5DEYA 1V0OA 5CU6A 4P55A 4IWQA 3OWLA 2V79A 3W1FA 4R1HA 2HTJA 3RINA 2XIZA 3FWQA 4HX8A 5F6FA 1J75A 4O82A 4FTLA 3GVAA 3H9FA 2QWWA 3KK8A 4WNKA 4CFNA 4B8XA 2NNYA 2PSQA 2GHGA 5FWKK 1GAGA 2BALA 3GOPA 2PHKA 1BOAA 1ZWSA 2ACJA 4CEGA 1FZPB 3GZ6A 2OJIA 3GU7A 3N9XA 3QC4A 3U6JA 4FEWA 5I9XA 2VO6A 4X2FA 3C0GA 5DR9A 3TKIA 4FSTA 3P9IA 4EQMA 3Q52A 3Q9VA 5HCXA 1QPJA 2RG6A 2STTA 1S7AA 2XAFA 5HNIX 4QQ5A 1ZY5A 2WPAA 3Q4CA 4OINF 3FEGA 1T39A 2OH4A 4L3PA 1M2PA 1M2QA 1WBPA 3OUNB 4FIGA 1E1VA 4PV0A 2GQSA 5CVFA 2P3GX 3PTGA 4XG9A 4EWHA 1WKMA 4FKTA 4G2FA 4MQ2A 4U44A 4XEYA 3R8ZA 3L9PA 3PQJA 4C38A 4CD0A 3FXRA 2OJFE 5T3QA 4W4VA 2UZLA 3EFWA 3RBWA 3VBYA 3HTSB 4HAMA 3U4WA 2R0UA 2CKEA 1GIJA 2CNUA 1ZYSA 4TYIA 2ACXA 3DLSA 4J8MA 4FKWA 4UWBA 3FX3A 4OTPA 3ATTA 1STZA 2ZB1A 3OHTA 4C33A 4DCAA 3VO3A 1OPLA 3KMUA 4B9DA 4W4WA 3LJ0A 4H3BA 2R3HA 5LGUA 1KQ0A 4TKSA 4FV2A 4GW8A 2QOQA 4LJZF 3MWUA 4FNYA 1ONVA 4ANQA 3MJ1A 5J8CA 1LPUA 3FMQA 4GH2A 4TN6A 1HXDA 4CMOA 3EKKA 3TDWA 3R0AA 2ERZE 5CSVA 2R3OA 1O6KA 4Z9LA 5CU0A 4HF0A 4EBWA 2I1MA 3QWJA 4RIXB 4O7WA 2OO8X 2M8EA 5JZJA 3RK9A 1SVGA 3FAAA 3CO6C 4AA0A 3FYJX 5CXHA 3ITZA 2E9PA 3GCSA 1TVOA 3HVCA 4FBXA 4MNEA 4QPSA 1OYWA 4F65A 4WXDA 4IVAA 4X2GA 3D7ZA 4E93A 3ZEPA 4HGTA 4OIOF 3ECOA 2KULA 3CKWA 2VZ6A 4WUNA 3VW8A 2XCHA 2C0IA 4EQQA 1OITA 4FEXA 1UNGA 3NUXA 5AFVA 4OBPA 5C4LA 1TQMA 3AMYA 4ZYHA 1HSJA 3ZEWA 3DBDA 2G01A 4UX9A 1VJYA 4MNFA 2JDVA 1KQ8A 3FI3A 3KKVA 3JVSA 2RC4A 4YFXF 1H07A 1CF7B 3OCBA 2VWUA 4RWKA 1OYYA 2VBXA 4FOBA 2PE1A 2J0MB 3V5TA 2FMLA 4OW8A 3DDPA 2X1NA 4Q5SF 1O3TA 1YHSA 1FT9A 3V5LA 3D4QA 5GZAA 2CLQA 3UNZA 2Z33A 2QOFA 1U5TA 4HZSA 5AAGA 3ZS5A 1OPJA 3PJ8A 1DP7P 2RNJA 3JSOA 3BZ3A 4ZZNA 4D2WA 4LI5A 5IKWA 3W6KB 1DS5A 5L2QA 4IZ7A 3MH1A 5CVGA 3LM0A 4TXCA 1FC3A 2C68A 4D1XA 3TV7A 3N51A 3LCKA 3TO7A 4AIKA 4MWHA 2FVDA 2UXNA 2WMQA 3DS6A 2I0YA 3WBLA 5HBJA 4EM0B 2CG4A 3W6JB 4YJOA 1ZOHA 1YW7A 4YPDA 3ZBFA 5EH0A 3UPXA 3R6XA 5CWZA 3COHA 3V5JA 1SZMA 4F1TA 3LJ1A 1TW2A 4YP8A 4PDKA 4I21A 2XM9A 4QTAA 4EORA 2ZM3A 2YWPA 3O8UA 3JR1A 4C7TA 3SHEA 1R5HA 1ZG5A 5IMEA 2YM8A 3KLOA 4D2VA 3QQKA 3K1MA 4FV5A 5HTIA 2YSRA 3ABTA 1GZOA 1IAHA 5CXZA 1OR7A 5ANGA 4DGGA 3ORLA 3RDIA 1BN5A 3KEOA 2DWBA 2JKMA 3R9OA 4IB0A 1W7HA 3P78A 1JHFA 2GNIA 5CYVA 5CEPA 5EI2A 2DFIA 3D0SA 3ZOSA 3SOAA 2JZYA 1Q24A 1RIOH 4IHSA 1P4OA 5GHVA 4CSVA 4BDFA 5ED4A 4CNHA 4NKAA 4R6VA 4WD5A 1HW2A 4YIFA 2PZ5A 1EH8A 1J2XA 2R3QA 3BEAA 3KQ7A 3AQVA 4LM5A 5A3XA 3WYYA 5AJQA 1SYKA 4R5SA 3E87A 5GZ8A 1YOMA 3EFJA 3R9NA 2V22A 4ZSEA 4G5JA 2PE0A 5AEPA 2HFHA 4G3EA 3KCKA 3LZBA 2R4BA 4KSQA 2OK1A 3K69A 2BAQA 4MYGA 1H9GA 4BCNA 2J5FA 3VN9A 5AX9A 4ASNA 2W84A 4RFZA 2A0CX 2IVVA 3Q9SA 5IT9K 5JN2A 3ORTA 3QX4A 4PL3A 4J96A 4C57A 1UHWA 2EA4A 2I6LA 4AFJA 2G1TA 4RX5A 3HDMA 3N4UA 3GQLA 1UHMA 4YJTA 1QO0D 4RX9A 4AW0A 4YLLA 3GX4X 3PDTA 2V7AA 2D1VA 5IEYA 1L8TA 4BYIA 1KE5A 2BRMA 3HA6A 5HNBA 3RPOA 4XRFA 2WU6A 2GS7A 3O23A 2K27A 3SXFA 1O9UA 2CKQA 5JH6A 3PUPA 2FEZA 2AYPA 4BTJA 4IZ5A 5HG7A 4HVGA 3VW6A 2CLXA 1VR2A 3VVHA 2FGIA 4NKSA 2A19B 4FT3A 4L9NA 4L5JA 3R0JA 4OIQF 4DN5A 1LP4A 3H3UA 1Q3DA 4NM7A 3BYMA 4BR3A 3CIKA 4L52A 4P7EA 3Q4UA 3G15A 1H24A 1BMKA 4ZYEA 1UVRA 4TRLA 1Y8GA 1NVRA 4EOPA 3D2IA 4QP6A 2PI0A 4NYEA 3U9GA 3ZMTA 3HGKA 4GFGA 2DYLA 1ZZLA 4CFMA 4FV7A 5AP2A 3P23A 4C4FA 4FX4A 3O7LD 5DG5A 1PP8F 1J7UA 2XVCA 5HS7A 4FK3A 4PP9A 3R9DA 3CDHA 3RPVA 4AF3A 1BI7A 3WARA 2PK9A 1ON2A 5AR3A 3TTIA 2JGZA 3LPBA 4S05A 5EDQA 4LOPA 4I93A 4GKHA 1REPC 2YEXA 5AUTA 4LGDA 2IW6A 3RZBA 5J5TA 1PJKA 3FLWA 4ZTMA 2A61A 4P5ZA 3QAME 5FEQA 1DPRA 4UMUA 4ZLOA 3NNUA 3PY0A 4IEBA 4WNPA 5JRQA 5HIDA 2F2EA 4ZMFA 1O3RA 3HLLA 4AP7A 4BHCA 4HGSA 4XG6A 3L7WA 3HYIA 4KS7A 1BI1A 3U9CA 3W18A 3V8SA 1S8NA 2ZJWA 5DE2A 5EEHA 5CSWA 4DG3E 5J79A 3B02A 2CGWA 2LKPA 2VU3A 2K7LA 2QLZA 5AUYA 3V51A 2X0LA 5IEVA 1T45A 4XJ0A 4CG9A 2B0LA 2E9VA 4ASEA 4EL9A 3HV7A 3GXOA 3V7RA 1RW8A 3QQHA 2IP2A 2W24A 3EH9A 4C4IA 2VUWA 3ORZA 4CFWA 2QG5A 4AE6A 4BH9A 2DUVA 1EV7A 4NU1A 4YFNF 3BIZA 4YTFA 3Q4ZA 2DO7A 3WZUA 3UODA 4QPMA 2PQ8A 1FSHA 5IU2A 1OL6A 1JKTA 4RC2A 5E8TA 3WF9A 5HTBA 1LDDA 3MFKA 1CMKE 3BE9A 3ZP5A 1YFHA 2XK6A 4ENJA 2PMHA 3TG1A 3H30A 1E17A 4OAUC 2XNEA 5M55A 2VN2A 2C3IB 2P4WA 3ULZA 3WF8A 4PUZA 3D5UA 3II5A 4LK1F 4RJ7A 5CX9A 4ACMA 3TZ9A 4ITIA 1YG2A 4H1MA 3DK7A 3L8VA 5CI6A 3O96A 4EOSA 4NL0A 2YCQA 5IISA 2CO5A 3FJQE 5BUIA 2UW3A 2B0QA 2X8EA 4TWPA 3MTFA 5EOLA 4I20A 5A2QZ 5DOSA 2UZWE 5L6OA 2CGUA 3KP6A 2FNAA 3PXFA 3VJOA 4ZMEA 3C4WA 2YFXA 3CUOA 1YIOA 1IA8A 4J1RA 2CSOA 1JKSA 4MTEA 2JFMA 2YPRA 4CFUA 2I0VA 4OBQA 4FZ6A 4RS8A 3M2WA 1Q4LA 3KCCA 3WGHA 3OP5A 2GFCA 3PRIA 4IXAA 4AX8A 2QC6A 2XIKA 3UIBA 3I0OA 4AA5A 2FBKA 3LKMA 4LV5A 3PVWA 1TKIA 2YM7A 3JVRA 4TYHB 3KLNA 4FTJA 3IO7A 3LLAA 2FSOX 3I0TA 5JFXA 4B99A 4YC8A 1XN7A 3TZ7A 1KU3A 3P4KA 4TW9A 4X6QC 5EM7A 2VBYA 3TL8A 4I4FA 3FMRA 2ZJ2A 1T98A 3I4PA 2J0KA 3D83A 4L8MA 3QQGA 2EWAA 4HPTE 3TOAA 4BL1A 4EKKA 1B1BA 2BZIB 3NS9A 3KEXA 3SG8A 3ZBXA 1OBDA 1DI8A 2C6OA 1L3RE 4F9CA 4XP0A 1YQJA 2UZBA 2ITZA 4EBVA 4JVGA 1XGMA 4EZ7A 3QUDA 3PFQA 4O2PA 3UZRA 4AU8A 4ZS4A 3QPHA 5B2KA 2LGCA 1IZ1A 1UB9A 5E92A 5CASA 4EM2A 4M84A 3WF6A 3R83A 5IDPA 1KWPA 1F5TA 5KCVA 4IVBA 5J9YA 3A2CA 2WELA 3V7SA 5EI6A 2MD5A 2C3JA 4DGLC 2WU7A 4ZK5A 4ZSAA 2WMSA 3LFAA 1YXUA 1YRPA 5K5OA 3SX9A 4ARKA 3V3VA 1XBCA 3W10A 5D5WB 4DC2A 3F5XA 3LQ8A 2XK9A 2BROA 3WGIA 2QUFA 1JOWB 4M8TA 2NYXA 5J8IA 2STWA 2R3MA 5JGBA 4O91A 3A99A 5J9LA 1S29A 2IA1A 2EFQA 3HMMA 3D94A 1T0FA 4I98B 2X2MA 2O0YA 2IJLA 3QZFA 4D5KA 3HL7A 4EZ5A 3H4JA 3LFNA 4AAAA 2BKKA 2H6CA 4BC6A 5LRSA 5DDGA 1FINA 3PYYA 3BGQA 1VTNC 3UOHA 4FT8A 4EJ7A 3VS3A 4FKOA 4KUJA 3V8KA 5EM8A 3O6BB 5AP5A 4JQFA 5AAEA 4LQMA 2R3SA 1BLXA 3Q53A 2X8IA 4ZTRA 3U55A 2QO7A 4AACA 4JX3A 5FM3A 3IOPA 5HD7A 2GXBA 4GYIA 2Z02A 4XLVA 3ZONA 2GSFA 1MDMA 5DIAA 1NA7A 4WSQA 4XSXF 4LMYA 2NP8A 4FVRA 4GIIA 3E64A 4QYEA 3WF5A 4S33A 1PF8A 4L44A 3NQOA 2C5XA 3Q5IA 5L6WL 4I94A 1QPDA 3QP6A 4RJ8A 4CGAA 4UB7A 5AMNA 3Q9YA 4JAIA 4N0SA 4AGCA 5EYCA 3GOKA 4I92A 4DFBA 4XNEA 4DBXA 2QO9A 2GU8A 3JPVA 3O51A 1H1PA 5CVVA 3OEZA 4I0SA 1JAMA 3ENHA 4USEA 5CEKA 3MY0A 4FIEA 3I0QA 1V4RA 3QX2A 4N70A 4UV0A 4LMNA 5HO6A 4RLLA 4V0GB 3I1AA 2ITNA 3RKWA 4AGUA 5K0XA 1H1SA 2WMRA 2RGPA 1KQ9A 3EFLA 4MHAA 3GC9A 4EKLA 4D9UA 2DBBA 5EQPA 4KMFA 5LARA 1WFCA 3SV0A 3ROCA 3R71A 4WX9A 2UZUE 4R78A 5M57A 4A7CA 1U54A 2XNBA 3TO6A 4UHTA 3CD8A 3H9OA 5L8LA 2F2UA 1ODDA 3TIZA 2V55A 3UQCA 2QZ8A 2OAZA 2IO6A 5DT4A 4N6YA 2GNFA 3ZLWA 4EH5A 3L09A 3KC3A 2XNNA 2VWYA 4KKHA 4GU6A 4C4HA 3L1SA 4CYDA 4RVKA 3WE4A 4L01A 1REJA 4F6SA 4WF2A 4O86A 5IMXA 4U8ZA 3HMNA 1PXLA 5JQ8A 5H8EA 2J50A 4FKQA 4KIOA 5D6EA 1U3EM 5BVFA 5E1WA 5I9YA 3MYGA 4X2JA 4IB1A 4FE2A 1MJBA 4R5YA 4UV9A 3BQCA 4Q9ZA 4ANOA 4B4LA 3HRMA 5M08A 4O0TA 3UG1A 3HAMA 1IN6A 2RV8A 1YWNA 4AOJA 4A2UA 4F6WA 4I22A 3RZFA 3TKYA 3SG9A 1H0MA 2YERA 5J1WA 3BEGA 1YI6A 4FYNA 4CZUA 3ALNA 3FMJA 4IJ9A 4ETSA 5CEQA 3SA0A 1GXQA 3VQUA 3PWYA 4OLIA 3QC9A 1Y6AA 1KU2A 4QYYA 4DH7A 2VTQA 3DKWA 2BUJA 4KNBA 2VWIA 4JXFA 3UVQA 4EWQA 1SM2A 2H27A 4APCA 2LSOA 3NIEA 2C6EA 3GLXA 4ALVA 4ZY6A 4BTMA 1BIBA 2PWLA 3ORIA 2XJ2A 2X4FA 5JK3A 4WCGA 5HIEA 1P92A 3QCQA 2C6KA 3G0FA 2X6DA 4I5PA 3DZQA 2QYOA 5EK7A 3COMA 1QL6A 2GNLA 3PXZA 5FBNC 1YHVA 5CS6A 1U78A 2BE5F 1EH6A 4NIFB 1P14A 2NNWB 3VEPA 5DRDA 3ATSA 4C37A 4O81A 2HIWA 3EB0A 1PXOA 2XA4A 3Q9WA 1J7KA 1JE8A 4XBRA 2HZIA 4A9SA 4UNOA 4GG5A 4XCUA 4AIJA 3F7WA 1ZLTA 2FSTX 4GG7A 3CJNA 2ZKZA 4I7HA 4XG3A 3I59A 1S9IA 3FLZA 3F22A 3MFTA 1MKMA 2Y0AA 3C7QA 4RVMA 4KUMA 5L2IA 2GQRA 3AGLA 3U87A 3E8EA 1U59A 1Y57A 4MXCA 4YHTA 2IA2A 3TUBA 3ZMDA 1ZG1A 4G7HF 4HZRA 3UYTA 3RPYA 2Y4PA 4IFCA 3V5WA 2UVYA 4DEGA 3KZZA 5FRIA 5L3DA 5LRRA 2YX7A 3M1SA 4J52A 2F2CB 3I53A 2WMAA 4FOCA 2IA0A 4M13A 5IQIA 3OXZA 3S2PA 1FMKA 4BDDA 3A7FA 2OFVA 3QU0A 4ZS0A 4J8NA 5AR8A 1R22A 3OWKA 1O6YA 1JHHA 2IWIA 1K78B 5AONA 4F9YA 3BYSA 4HX7A 2XK8A 5KBRA 3P7CA 3ZLYA 2ZV7A 4O0SA 2ZMDA 3WOWA 3ZSGA 4USDA 3GUDA 3NUUA 2PEXA 3HECA 4WG3A 4FUXA 4FV4A 3PY3A 4RB0A 4WIHA 1UFMA 4UALA 1PUEE 3PIZA 4UYAA 4XG8A 4AUAA 4CG8A 5KBQA 2UW4A 5BPDA 3MWMA 3B2WA 3T3UA 3CTAA 2Y7JA 4F09A 4YLJA 4FV6A 3LM5A 4UY9A 4DTBA 1GZ8A 4DH8A 3W2PA 2BTSA 3K1NA 1Z91A 2JTVA 4L53A 4HA8A 4LB6B 3KULA 5L8JA 3EQLF 1VZOA 2J9MA 3UO6A 4M66A 2FBIA 3TDUC 3DAEA 4DH5A 3JAMK 2EB3A 4C3FA 3D5VA 1B6CB 2W0JA 3OFMA 2DQLA 1V1KA 3AG9A 2UVZA 3FHZA 2WMTA 2X9EA 4NB5A 4AS0A 3CO7C 3THBA 5K5NA 4YZCA 2WTWA 4CCUA 1D8JA 4L9JA 2A07F 4O0RA 5AX3A 5IEXA 5H8BA 3D7TB 4GFOA 1XDSA 2V5QA 2XMYA 3I60A 2ZB0A 1YXXA 2GHMA 5IQCA 3LAJA 5KMOA 4C62A 3F6XA 4RG0A 4NTTA 4Y17A 3TZMA 2OIDA 4J98A 4TWCA 1VYWA 5C4KA 3LFDA 3WF7A 4C3PA 2QOBA 2W85A 3BBTB 2LF8A 1B9MA 1I44A 4HOKA 2Y48A 2R3GA 4C02A 4AZVA 3E7VA 1LDJA 1UCRA 2J5EA 5E8ZA 3E6DA 3MESA 3R1YA 3RKBA 1UWHA 4BDBA 2P6TA 4M72A 3UGCA 4EC8A 2BDFA 2OWBA 2VTHA 1ZGAA 5F64A 4WK8F 1FYLA 4ITHA 2L01A 4BHBA 4ACGA 3TV4A 3WE8A 5D5UB 5DFPA 4ZOGA 4M9XA 2E7WA 3QKMA 1FOKA 4MXYA 3D0EA 4BCMA 3EQBA 4UZDA 1URCA 4YPSA 4IIRA 1UKIA 1TQPA 1H28A 2VTTA 1U8RA 3WTWC 4LUDA 4HVDA 4EOLA 1Q5KA 1YKRA 3HRUA 2P33A 4NTSA 5BQTA 1MJ9A 2GTNA 1CGPA 5KMLA 3LCSA 5C9CA 2WQBA 3TQNA 2EXMA 2BHEA 2ZXJA 4FI1A 3GCUA 1B6AA 3POOA 2ZV8A 2VTPA 3QFVA 1RE8A 4F9BA 5IT3A 4P96A 2GNGA 2CNVA 5I0BA 3LQ3A 4KBAA 1TNSA 1OPCA 2IPXA 3A7IA 4RB1A 1LJ9A 5D7AA 2OH0E 3K0LA 4GK3A 2BBYA 2NRUA 5T6KA 4KN4X 3SXYA 3WZJA 2OSCA 1K3AA 4CKRA 3UVRA 2YN8A 4QMQA 3BYOA 2PVLA 3P79A 4HQMA 3E92A 2XAHA 2KIMA 3GU5A 2X39A 1Z05A 5FLXZ 2Z5UA 1Z7UA 4NM3A 2VWBA 3UYSA 2MH9A 3C13A 1B38A 3FC2A 4DGOA 2UUEA 2WAJA 2AS5F 3GYHX 3F7ZA 2WTEA 3A7GA 4RRVA 5E8YA 3FDNA 4FSUA 4ENYA 4KNYA 4FC0A 3ERED 4AG8A 1F1ZA 4BN1A 4XH6A 3DP7A 2GDOA 4KRDA 2W1GA 5IA4A 3ZN0A 2P5LC 3WTTC 2B7AA 4KDPA 2CJMA 5FDXA 2ZNZA 4FT0A 5K5QA 3AC4A 4DH1A 3A4PA 4WA9A 4PX6A 4WHZA 3G3ZA 5EDPA 1Q61A 4TYGA 5LMAA 4GL9A 4DEBA 1HCKA 4AW5A 3V8JA 3BHHA 2Z7RA 2E9OA 5KMMA 4W8DA 3P1AA 2HYGD 5HOAA 1I27A 1M52A 1FP2A 1XCBA 4K0YA 4MXOA 4LRJA 5HBEA 3DQWA 2XZSA 1XSDA 1YDTE 4IAFA 4HCTA 1JSTA 1R39A 4ZJJA 4M15A 1WBNA 3Q9ZA 5M09A 5L3BA 5KZIA 4H1JA 4PP7A 3IDPA 4DYMA 4HQEA 2VO3A 4B7TA 4X3FC 3LWFA 4L9TA 5L2SA 4OTIA 4JQ8A 4OIRF 5J6XA 2ADUA 5LWNA 1U5RA 2V1DA 4FV9A 2CGPA 4FT9A 3GFMA 3IGOA 3FLNC 5B2MA 2C30A 2BDWA 2QOHA 3F3UA 3L9MA 2PVFA 3NX8A 3N4VA 3HRTA 3VUKA 3FSKA 3RCDA 1H27A 1WBTA 1G3SA 2G2FA 5KHWA 5FTGA 1A48A 3W8QA 3ID6C 3NUNA 3M7GA 4Z3VA 4BHNA 2HWVA 4F7LA 5LMKC 3BWJA 1R1WA 2FOKA 4O5VA 3SRVB 3IPHA 3IQ7A 3VRZA 3DJ5A 3I79A 3GENA 4M67A 2Y0MA 4LGGA 2XP2A 4EJWA 4DINA 1CKPA 2R3FA 4DF3A 4HV6A 1R1TA 3UJGA 3QLFA 5KKRC 4C4EA 4F4PA 1AD5A 3ORNA 4FTMA 3OF0A 4D28A 2HCKA 2ERKA 3LFEA 1SMHA 2DT5A 2BCJA 4XV1A 3RVGA 3E88A 3FZVA 1HW1A 3ZMMA 3MS9A 4LG4A 4BCJA 5HD4A 2A4LA 1HCLA 3BHVA 3QD4A 3QA0A 1YDRE 5E8VA 4P9FA 5H20A 5DGZA 3BP8A 3NNXA 3TKHA 3IDCA 4D2PA 5JGAA 3ODYX 1ZARA 4G34A 3CCNA 3MFSA 4U0VA 5HU9A 3KFWX 2MA3A 3UC4A 5DMZA 1SMTA 1OKRA 4FKRA 3POZA 2QG7A 4XHKB 1XBAA 2BV6A 1H1RA 3PPKA 3P9CA 2FA5A 2FXAA 1H1QA 4GK2A 3UQGA 2C6YA 2PVMA 1MP8A 4CRSA 4JDJA 4KA4A 1XHAA 4IC8A 2OXYA 5BUEA 3ALOA 3CJGA 1XH4A 2G15A 3CPBA 4PDPA 3UO4A 4EOJA 3E97A 4EEVA 5FUTA 4WG5A 2UVXA 1L0OC 4D58A 1P4FA 2CW0F 4BI1A 4X2NA 3RPSA 4BIEA 5HS8A 4WWCA 4HLXA 2VC1A 2I7QA 1XDUA 2M45A 2Y4IC 4ANBA 2E9NA 4HYUA 4FV3A 3VODA 1EH4A 3P86A 4MD9E 5L3GA 5CF5A 3DKFA 1OKVA 2PZRA 3IWZA 1B9NA 2HXQA 3H9RA 5HESA 3QKLA 2X7OA 4F0GA 3MEXA 1J59A 3NW5A 3KREA 4U80A 4OBOA 1YXVA 4CXFA 1YYVA 5E8WA 2GA2A 3FZOA 1Y0UA 4O2ZA 4U42A 3ZLXA 5H9BA 5DNRA 3BWFA 3I5NA 4HPUE 4NCTA 4BKJA 4CO8A 3RCJA 1YW8A 3ZQ7A 2X4ZA 4RZVA 3BBWA 3VS0A 3MVLA 3ZM4A 3HZTA 4M0YA 5IH5A 3MDYA 3FKOA 3PZEA 5ANIA 1J7LA 5K3YA 3LA7A 1KOBA 3IS5A 3L8PA 4RQVA 4GMYA 4Z16A 2QQAA 5IZFA 2WTCA 4R7IA 2XKOA 3G5DA 2XGXA 3K3JA 2X7FA 3C18A 2PUIA 3KFAA 2XNGA 4YIIA 1F0QA 2VTMA 3SQNA 4M6YA 3HX4A 4BHPA 2XAQA 4MQ1A 4EOKA 2B54A 1IXSB 2XKCA 3DGKA 1V0PA 2X6EA 3DV3A 2OKRA 3UG2A 2XS0A 5G1XA 2P2IA 2X81A 3WTSC 3L2CA 4UV8A 4FIIA 5FD2A 5H6QA 2BFYA 1ZMWA 3CQUA 4C3RA 2P8TA 2E1CA 2RKHA 1YTYA 3UE4A 4I3ZA 5CVIA 3OCTA 4BCGA 2QQBA 4Q4ZF 2C5VA 4ESJA 4FG9A 2YCSA 2FO0A 4XRJA 4MNEB 4AZFA 3DTWA 1B59A 2PYWA 4C2VA 5E1SA 3PP1A 5HU3A 4YJVA 1F4KA 3PXYA 3HTUA 3FMHA 3OY3A 2WNTA 3QPTA 3BQRA 4PF4A 3BJAA 5HNGA 3BY6A 4ZSJA 4AVPA 4HDUA 3RPRA 2W9ZB 4AW2A 1TLHB 1CDKA 4EJNA 2WTIA 1XBBA 4R1YA 2R7FA 4PTGA 1GJOA 5E8GA 3TKUA 4HNIA 2RGVA 2BIYA 5AA9A 2WHBA 3EQPA 4NEUA 3AT4A 2UW8A 3VUIA 1I6XA 3E8NA 3T1BA 3GZ5A 4EUTA 4KAOA 3OG7A 4ZTNA 3G6HA 2Y9QA 4YSJA 5HTCA 3CTHA 3QTSA 4AN2A 1P4WA 4YU2A 4AW1A 1ZMUA 1QMZA 4BDIA 4L45A 2OZAA 4G31A 1WBWA 3FZSA 4WXHA 4BDHA 4O84A 4EHVA 5KK1A 3ZC5A 3R1SA 3EYIA 1U5TB 3DJ7A 1ZN2A 2OQRA 4AT3A 4NFNA 1UKHA 1FWZA 3J80K 3I54A 3UBDA 5AP1A 4B0GA 3WGGA 4L42A 3KXNA 4R77A 3JTHA 3WU0A 4YUQA 4FHTA 1FQ1B 2OA4A 3CTQA 4E5WA 3TOBA 2A68F 4BTFA 2YHVA 2GZWA 2YZAA 4E6AA 2CSNA 3PFIA 1XO2B 1ZH5A 4G3FA 4EC9A 4H0EA 4KYWA 5EW8A 3SVVA 2QR7A 2DS1A 3PLAE 1IN8A 4U0YA 3LQRA 3P5KA 1BC8C 1VYZA 4RFMA 3EL7A 2IW9A 2F5FA 4HV5A 5I3RA 4A6EA 4NK9A 5ERIA 2ZM1A 3WZDA 2K86A 5C8KA 4G6DA 3KRRA 4LLLA 2VBZA 3L00A 3VWAA 1ZOGA 1H1WA 1XCVA 5L2WA 4HCVA 4QMUA 2C3LA 4GV1A 2YIWA 4O0WA 4QMOA 3DLZA 2YABA 4O1PA 2UZTA 4PPCA 2YM6A 1H01A 3EYYA 4K77A 3PWDA 2J90A 1FNNA 3HNGA 5L6PA 4KA3A 3FM3A 3O0GA 4G9YA 4TZRA 2WGJA 4R3PA 4BCIA 2XAGA 5CF8A 4O7NA 5CNOA 3CUQA 2W4KA 3R7VA 3KCFA 3QD3A 2UV2A 4BDCA 3IRQA 1PKDA 3R7GA 2LDUA 2XNMA 2G9XA 3VAPA 3IGGA 4EH7A 3QLGA 4HNFA 4U40A 2QODA 4M69A 2YX4A 5IUIA 3NEWA 1WZYA 2R7BA 1O7FA 5A4TA 5EQEA 3DAJA 3LMGA 2O03A 3T3VA 3R73A 4UMTA 1BL7A 3G9NA 4MTAA 4FYOA 1R0PA 3MN3A 4BDKA 2HYFA 3FPMA 3MH3A 5DVRA 1FSEA 2ITVA 4YJPA 3P9JA 4MBIA 4A07A 4U7DA 5HS9A 4F7JA 2HGCA 3QRUA 3HV5A 1YW2A 4NW5A 4IRHA 1UWJA 3FZTA 5LLQA 1OL1A 1I1SA 1H26A 5HDGA 2A6HF 2FBHA 2JFLA 3PXKA 3PP0A 1ZLKA 5DPVA 4IPAA 3NR9A 2WD1A 4Y46A 4LRMA 1ZMVA 1Q99A 3IHUA 4EH4A 5FEEA 1D5VA 4KBCA 4PDSA 2B9HA 2QU5A 1XB4A 4U7ZA 5BMMA 4YSMA 4II5A 1OECA 3PA4A 1KUTA 4XMOA 4Z7HA 3AC2A 4U0WA 3KRXA 2BAKA 4FGRA 2R5TA 1ERKA 3MY5A 2C69A 4N0BA 4BCKA 3WYXA 4FZAB 4LOQA 3OWPA 3ZRLA 3V4GA 1SD4A 5M51A 5HCYA 3O2PE 4X3JA 4GXOA 4XLNF 5DLSA 4HBLA 3L8XA 3GC7A 2HXLA 1W7PD 3G2FA 4P5QA 3U54A 3SDJA 3FXXA 5HG5A 3W8LA 5AV4A 2PVJA 5HO8A 4RGJA 3AXWA 2GQQA 5CAPA 1XSVA 4JBPA 4PY1A 4OTQA 4RGUA 3J81Z 3AAFA 4G5PA 2VAGA 4RT7A 5IDNA 1Q1HA 4BBMA 3RPUA 2HZNA 1JSUA 4IJPA 1KYZA 1S7OA 5CAVA 2QCSA 3QZGA 4D9TA 5HHWA 3PJ1A 4L46A 2EV6A 1J1CA 1GOLA 1YHWA 4RIWA 3I71A 1ND4A 4U41A 1HQCA 5FP5A 1PXMA 3SGCA 4MNUA 1QPCA 2FU4A 3ZZEA 2H6DA 5EYKA 5FTQA 2PFBA 5FO5A 1ZRFA 1ZXEA 2UZVA 4XV2A 4Q5HA 4OTHA 4TPTA 4NFMA 4BKZA 4IM2A 4D4YA 1OMIA 3VULA 4IZYA 1YW9A 2R7DA 5E17F 4C36A 2PULA 1IF1A 3RWQA 5G6VA 4FTIA 4L0ZB 4TT7A 3HRSA 2C6MA 3C7JA 4NZWB 3GI3A 4S31A 3RK7A 1FPUA 2PMLX 4O83A 3VS2A 1P6RA 3KXGA 1VEBA 3ORXA 3KP4A 2H6BA 2VTJA 2M1BA 4IDVA 4AOTA 3FL5A 1HKSA 3F3WA 5AP0A 4HF1A 5ICCA 3EN6A 4NH1A 4BCPA 4F64A 3TJCA 4EGZA 4DFUA 5E1ZB 4RA4A 2COMA 1TQIA 2WOUA 4FA2A 2O0UA 2UZEA 3PRFA 4J95A 2RSVA 3KE2A 5EYDA 1KU7A 2M5WA 3KP3A 4U9AA 2A5YB 2NRYA 4JBQA 5ETCA 2H34A 2GA1A 1A06A 2UWMA 2YM4A 2YJRA 3UDBA 4OT6A 3QTZA 2GAUA 2J0IA 4BCHA 2A1AB 5LXMA 5FG8A 4I5MA 2IW5A 3Q96A 2XIXA 3A4OX 3O50A 5BVNA 3OV8A 3GFIA 2KKOA 2EV0A 3UOKA 5ICFA 4W4YA 4ACHA 4TYJA 4G6QA 1G6NA 1LB2A 2EFWA 2QKRA 3GEZA 5IQBA 4DT8A 3C51A 3PE1A 3DEUA 4CZTA 2G2HA 4EK5A 4I1ZA 2AXLA 2F49A 3JY0A 1DM2A 5GJFA 2XM8A 2FSMX 4HGLA 4M9ZA 5DEQA 3T8RA 2PMUA 4I02A 4X3FA 4QP7A 1L3LA 4DGMA 3DXJF 4BICA 3OTVA 2R3PA 3CC6A 4YC3A 3EWHA 5CEMA 3VB2A 4UVCA 2H8HA 4A12A 1K79A 4ZEGA 4WT6A 4ZY5A 4A5NA 4CMTA 3FF5A 4BZOA 4ALWA 5DWRA 2WMUA 3KETA 4F1OA 2VX3A 3RJPA 3PSCA 4FT7A 4KIGA 2HAKA 2QNJA 4MX9A 1K6OA 2C47A 3QHRA 3DBCA 2J0LA 2Y6OA 1IAWA 2YCFA 4QMYA 5LGNA 1XGSA 3SOCA 5JZNA 3OBGA 4O7YA 1BC7C 5I9WA 4ALUA 4M0ZA 5IA0A 1XD7A 3TNIA 1ZAOA 4AN9A 3FMNA 3ET7A 3NIZA 2C6IA 4QMNA 1PMUA 5ACKA 5CU3A 2JPBA 3C4CA 3FMDA 3K3IA 3PVBA 5AUZA 4Q48A 3KK9A 2W1CA 4DEEA 4M68A 4A9YA 4QOXA 4DFLA 2ZMEB 1H4LA 4EJVA 4ZP5A 1M2RA 1IA9A 4PPAA 2WTKB 2XIGA 4R3RA 1NY3A 2XJ0A 2UZDA 4WG4A 2ZAZA 4EOQA 2HS5A 2X4HA 4WBOA 3NLBA 2DPDA 5D11A 5M4UA 1Q41A 4YGAA 3ELJA 4H05A 3R7YA 1JKKA 1OI9A 5GJDA 3MPMA 3WI6A 1XMAA 1R3CA 1QZYA 2FB8A 3BX5A 4G3CA 5D7VA 5KUPA 1FBSA 3OXTA 4AXAA 3ZCLA 5FFXA 5IQHA 3CJFA 4HVHA 1XSXA 4P4CA 2M87A 4U0IA 2V7OA 3K2LA 4WKQA 1DDNA 3KP7A 4F7ZA 4YNEA 3QAHA 2F5EA 1FYMA 3TCPA 3NSZA 4XV9A 4BGQA 4IC7A 4UBAA 4YNOA 1FBUA 3NPCA 5CU2A 3QXPA 4P2KA 3R7EA 2O8YA 3COAC 3C4XA 4MQ9F 4WOVA 2L02A 2Q8KA 4IVCA 4IF4A 4AWXB 1KE8A 4P5OA 4I01A 4FSRA 3UC3A 1AGWA 3TNWA 3DZOA 1DAYA 4Y5HA 3V8WA 3OROA 2F5DA 4ESBA 4QMSA 2PZYA 3OVVA 3OT3A 3QTRA 3IDBA 4WO5A 4U6RA 2OU7A 2R3IA 1MDMB 3L8SA 2HR3A 4IX5A 4I0RA 1SD5A 3QA8A 4XP3A 4M73A 3K54A 3MI9A 3QYWA 3Q5FA 2BKZA 3HSEA 3AOXA 4ANNA 4E4NA 2VV9A 4RFYA 2XUBA 1I09A 4JDIA 4IB3A 2R3KA 3F2AA 4D0PA 2X8DA 3VS6A 3TWJA 1DUXC 1U5TC 1BYGA 4ZSGA 4IFGA 1KSWA 4JR3A 4FKGA 5B7VA 3ZTXA 2V0DA 3REOA 2QLUA 4O96A 3CPCA 1X8BA 2QU6A 4HF2A 4ZTQA 3MVMA 4ZZLA 2CMWA 4B6LA 3G90X 3FZPA 3H10A 3PXQA 1BI3A 3V04A 4IDTA 2GS6A 1OIQA 2BAJA 2W9FB 3TUDA 2UW6A 4PPBA 5AUWA 4KN7X 5HOOA 4OIPF 2C5OA 3GF2A 3RTRA 2VTOA 3EYGA 4FVPA 3FLSA 3PJ3A 5IA3A 2EA2A 4D0XA 2YAAA 1AWCA 3HA8A 1U54B 4FKVA 3FI4A 4FSNA 4DEHA 2XB7A 5HBHA 4EV0A 3MB6A 5DUKA 2Y75A 5KMKA 1CKJA 1BKXA 2F57A 2E2BA 2W06A 4I09A 3QRFF 2JT1A 2BEOA 5EDRA 3ZXTA 3B8RA 5DA3A 5I3OA 3DFGA 1OGUA 4XUFA 4JIAA 3BLHA 4QYHA 3VBVA 5LEKA 5GJGA 4IHPA 4DG2E 4QQJA 5FXRA 5CANA 2BTRA 5A46A 1A9UA 1H25A 4K2EA 5CQWA 4J97A 1JNKA 5D8KB 3C9WA 4I0AA 3EMGA 3IG7A 2UW7A 2VRXA 3KXMA 3UOJA 3QCSA 2VWZA 2NAZA 3FXZA 2ZV9A 5HKMA 5ETIA 3KGAA 3VUTA 1ZRDA 3HHGA 2ISYA 4JX7A 4V04A 4AA4A 2XROA 2YA9A 3PG3A 3QXOA 4TV7A 3VNTA 1ZREA 4GUBA 2VC0A 5GZ9A 1GZKA 4ACCA 4BBFA 5C27A 5B2LA 2X2KA 2WZJA 4KS8A 3MH0A 2JRTA 5A4CA 1ZYJA 3ZLSA 4G3GA 4OGRA 4DNCA 5LVLA 4EOOA 1JSVA 3P7NA 1LUFA 2XK4A 3MPAA 3C0IA 5LOHA 3R8UA 3DFCB 3MVJA 3EETA 1OL2A 3TEIA 5TJJA 2WMXA 5IG1A 3HRBA 3RYRA 5FM2A 3C1DA 2GCDA 5TF9A 1F9NA 3FHRA 3PLSA 4BNCA 3DDQA 5CZHA 4QNYA 1KGSA 2YU3A 3HMOA 2OFUA 4FF8A 2R3RA 3FI2A 3FLQA 3NW7A 5HLIA 4QTDA 5HLGA 2VODA 2EXEA 3R01A 2GXGA 1SVEA 4BIDA 2XYNA 5I9ZA 4JOAA 4CTCA 4ASZA 3NUSA 4RIYA 3ISPA 4DBNA 5J5SA 1PXPA 4YURA 4GVJA 3KP5A 4IJAA 4U3YA 4BHZA 3NWWA 5HCZA 2L54A 4G3DA 4FEUA 5IA1A 5A14A 4QMLA 3WTVC 3LCDA 2GHLA 2WO6A 3DBEA 2Z7LA 4OTFA 2QBYA 2W25A 2FNPA 2W99B 3ZMUA 2JC6A 5ACBC 5TOZA 1XH6A 1T46A 4YJNA 2BRGA 2P0CA 4FL2A 4RAYA 3KRJA 4BDAA 3F3VA 3I59B 3R22A 4FTNA 3V7CA 3OEFX 4XG4A 3QU6A 1MQ4A 2EUFB 3SD0A 3I5UA 2WIHA 1ON1A 4YTIA 4BQAA 2L4AA 2BMCA 1XGOA 1TW3A 4YZDA 3MSSA 4LK0F 4UZHA 2WQOA 2UZOA 4N57A 4RWJA 5AM6A 1RI7A 1OYIA 4L7SA 5JQ5A 4LG0A 5F1ZA 2XRWA 3S4QA 3SAYA 4BCFA 4ZIMA 4TL0A 2Z8CA 3OC1A 4G16A 4TNDA 3ZO2A 1PHKA 2RF9A 5HG8A 1WCCA 1IEPA 3CLYA 2YR2A 3UIMA 4IMYA 3ROYA 3GCQA 3N4TA 1I5ZA 3SC1A 1BUHA 3DXPA 3QD2B 2W5AA 5LGTA 3E6CC 3NZ0A 3RALA 3U51A 2BYVE 4GKIA 3OWJA 3AC1A 4RPVA 5DCMA 3QCXA 3QALE 3I7BA 4FIJA 3O71A 3VJNA 4C61A 2HYYA 3CR0A 5BVEA 4YJSA 3ZDUA 4Z7GA 2OJGA 1D3YA 2YIYA 2ELHA 4TNBA 5IF1A 3LFFA 3COIA 2PPQA 1BJAA 4I0TA 2IZTA 2ITOA 3GQIA 3W2CA 3R28A 5AR4A 3DA6A 3KULB 4Q2AA 3REPA 2CCHA 3G51A 4BDGA 2KRFA 5D41A 5HVQC 4R7BA 1G3TA 3L9FA 4IX4A 3MB7A 5KMNA
chains in the Genus database with same CATH superfamily
1IRZA 5HICA 3GEQA 5A9UA 1JXSA 2HYJA 4IADA 4Y83A 3T0YA 2C5NA 2WQEA 3F5UA 2PVNA 1K9AA 4O22A 1SD6A 4MEDA 1A36A 2Z16A 1ZYRF 4CFFA 4A4OA 3FYKX 1LNWA 2ZYBA 1FEXA 4ZZDA 3CTJA 3DY7A 4XP2A 3QQJA 2YM5A 4ZDOA 2WIPA 3LSIA 4YFKF 3H9GA 3DK3A 5FLFA 5D8LB 3ROUA 4CVAA 1JGSA 1GIHA 3HP5A 2W1ZA 4O7RA 4NM0A 1BR2A 3IRRA 4CDGA 2W4OA 4F9WA 5K5XA 2W57A 2QEXI 4IQ4A 4D9JA 1MZBA 1UU8A 2W1EA 4L0YB 1W82A 5AR2A 3RM6A 1QQIA 3IW6A 1MBHA 1O3QA 2EWNA 2O6GE 2VD5A 4OTWA 4DA5A 4BWXA 2BFXA 3UZPA 4CSWA 2OF4A 4UUVA 1H9TA 5CVRA 2HKXA 4QQCA 2X6XA 4C4JA 5FD6A 2PJRA 1Z1DA 3EKNA 5LEJA 2VTAA 2O63A 2ESHA 3LXKA 5HVYA 4D1ZA 5F94A 3J7AO 2B1PA 4ASXA 3M42A 5E3NA 2WQMA 4PUSA 5F27A 3QWKA 1W5SA 5D1JA 3RQ4A 1GY3A 3BELA 2EK5A 2BW3B 4JBOA 1DGRM 3E5XA 2VWVA 3ZO3A 3NEUA 2XANA 3RZOJ 4BQOA 4HNTA 4J71A 1F3MC 3PO2J 2EXCX 3K9TA 4MWIA 2ETKA 1OIYA 3W2SA 1D0ZA 2H94A 2XGCA 4Y72A 3RAHA 3R04A 2E1MB 4IANA 2HELA 3PPZA 4PGHA 3UMWA 1J91A 3BU6A 4BBSJ 1PY5A 4XLFA 4PDYA 4EONA 2QOCA 2JN6A 4CQGA 2UUZA 3UQFA 3IW4A 2RFSA 3KL8A 1IRGA 3V8TA 4DGNA 4CCBA 4PL4A 5HIBA 3WTUC 3LVPA 3OWTA 2ZV2A 2EFNA 2PVRA 3NRMA 3JUHA 4HCUA 3HDNA 2ITTA 2B9SA 5JKGA 2ZVAA 2QI8A 3OBJA 5E8SA 3BJOA 5DD4A 2QLQA 2NVUB 4U7BA 3OY9A 3KB7A 5HQ0A 3C3WA 3F9KA 2HXOA 3LOKA 2LRDA 4F7SA 4BZDA 4RSSA 2J0JA 5I9UA 1V55H 5H8GA 2WAFA 5JVGF 3CD3A 3K4LA 1U2WA 5EFQA 2VO7A 4GVAA 3SEQA 4HG2A 2ZMEC 5CSHA 4XG7A 4DTAA 4LV7A 5HX8A 3Q2MA 4XLIA 3RTPA 2HY81 3SQQA 2WTVA 5CQEA 3AT3A 5ANKA 5EM6A 3FPQA 2WAQN 1FVRA 2W1IA 3NUPA 4JBAA 5BVOA 2RVCA 4JRNA 3BROA 4NJ3A 3ZMZA 3LA3A 3OYNA 2X7GA 4H3QA 4H58A 3Q9XA 3DTEA 1SAUA 3B8QA 5IPJA 1PUFB 4A3BJ 2IJMA 4JNWA 3ML6A 3ZUTA 1O3SA 4FISA 1LEWA 2QSHX 2VGOA 1RUNA 4L9IA 5LHHA 3VUHA 3H0ZA 2A27A 3FKJA 3LE6A 4LRKA 2JDOA 3DU8A 3OYJA 2YLEA 4L5IA 3Q6UA 3VHKA 1OGYA 2D1HA 3WG9A 1MH3A 2HW6A 5L3EA 1MRUA 1VQLI 3RM7A 3MH2A 3S95A 3LIJA 1O6LA 3E3BX 1CSNA 2HXIA 3KN6A 3OOMA 1SD7A 5E20A 5AAFA 2CGXA 4JAJA 1K2PA 3LSRA 2JLDA 3CJRB 4XV3A 3VBXA 2ETHA 4F3QA 3D15A 4RMNA 3JRIA 4W8EA 5BOXA 4WNMA 2DLLA 2QQ7A 1R5GA 4BCOA 4RJ4A 4A06A 2M3AA 2V7FA 4CZZA 2V26A 1J5YA 3E8CA 2XNOA 4PTEA 4R8HA 3U2RA 5IT9Z 1IO2A 3MA6A 4RIOA 5TRDA 4ZYAA 3CZ6A 4ZTFA 4Y5QA 3S3IA 1C0WA 3ZSIA 4EZ3A 2V9VA 3Q0UA 3KVWA 1BIAA 5K4JA 5M07A 3DNEA 3ERKA 5EM5A 3OOPA 3NAYA 1RETA 4O6LA 5FB2A 3RHKA 2E9UA 2LMDA 4EJOA 2UW9A 4C30A 2FA2A 3WIKA 4MLOA 5J47A 3EN9A 2C6LA 4A0ZA 2OXDA 3CEKA 3A8WA 2JBOA 4YHFA 2IS4A 4RX8A 4BF2A 4YELA 2ZBKA 4FGBA 5JRSA 4I6FA 3BU5A 3GFJA 5CEOA 3ELKA 4MQVA 3R9RA 5LMBA 4O3MA 2CYYA 1SANA 1AA7A 4FG8A 4CXAA 2XAJA 5EG3A 4EYMA 3NARA 2VUMJ 2AEGA 3I64A 3HKZA 4QT1A 4FL3A 5GAEJ 2QVSE 2NRAC 4JT3A 4HOBA 4FICA 1W0TA 4A4LA 4FSQA 2A6EF 3A7HA 3BPRA 3A03A 5LHIA 5CAUA 2V6CA 4QMTA 2PMNX 4QEBA 4PL5A 4X0GA 4IBMA 3CSVA 3F3XA 4DHIB 2BRBA 1G8AA 3SJMA 1WJFA 1Y56A 4OU0A 3KA0A 3SYTA 3Q3BA 4X7QA 2NYAA 5CJ9A 5A2QK 1PKGA 4ENXA 4IW0A 3RK5A 1WVXA 2JKKA 3BPVA 4CZYB 1R1VA 4JRVA 4XLEA 3D5XA 1LUJB 2PN6A 4AQKA 3HV3A 4O4CA 2CKOA 2JUCA 3IC7A 2WEVA 4BY9E 1X3ZB 3Q60A 4X2KA 1TTYA 4C8BA 4BYJA 5BMZA 1WPKA 4XR6A 4FTRA 2VT2A 5E8IA 1U46A 1URWA 2IG7A 4FR4A 3NW6A 4OAYA 3QGYA 2PUNA 3R8VA 4JS8A 1OM1A 3F2RA 3F66A 3CGFA 2OLCA 1R5ID 5ICEA 4J53A 4QP8A 1Z5MA 3BLRA 2OQGA 2F7EE 2VKVA 2W7XA 3AG4H 4PGGA 4KWPA 1FIAA 3CC2I 3KEQA 1YWVA 2W1HA 2VTNA 2BR1A 2COBA 2K4BA 2X0OA 4AN3A 4B8MA 3ZQGA 5GINE 4ACDA 3PNYA 4CT1A 4PJJA 3IK3A 3D5SC 2CFXA 4ESFA 2KRHA 1G59A 4O21A 5DYJA 2FD5A 1R0EA 3TEDA 4BXUA 3OS3A 2E1NA 3W0RA 2RIOA 4D2RA 2XB5A 3IOKA 1CKIA 2KTYA 3E1SA 4FNWA 4ASDA 3HPGA 4ON0A 5CF4A 3CXWA 1YLFA 4LGHA 5HO7A 2BRHA 4R8QA 4XNFA 2VLAA 4F7NA 3NUAA 4HW7A 4B4CA 3AD4A 3OOGA 2DK8A 4FEQA 1U5QA 3Q6WA 4IQ6A 5AP4A 3O8HA 3KYLA 1EA3A 2XRNA 4C59A 5JHUA 3GFEA 1HW5A 4YJQA 3BU3A 4RBLA 1D5YA 4L3JA 5E3MA 3W2RA 4EJUA 3BV3A 3BOQA 4N9HA 1ZYLA 2ZXIA 4ZTLA 4IACA 2NNNA 2JAVA 2V4JC 1GIIA 4K8AA 1W7PA 2H96A 4QTBA 3KY2A 1V5EA 3O7LB 3U6HA 5L8KA 4LLGF 2B53A 5M53A 2UW0A 4K18A 5J1VA 5C8NA 2ZMCA 1ACIA 1AOYA 1OBGA 5CSPA 2DFFA 2EIMH 3PSFA 2H1LA 2HDDA 3BHUA 1Y6IA 1AQ1A 3LA2A 3RMFA 1WI3A 5H2UA 4V05A 2GFSA 4LMUA 4E1ZA 4QP1A 2QCOA 2K5CA 4ZLYA 1R1UA 1SNUA 4KIKA 4Y13A 2D2WA 4IWOA 5AUXA 3LSHA 2PMZN 3VWBA 5HE1A 2VPRA 4PMPA 3BR6A 4QYFA 2Z1DA 5IP6A 2UW5A 2I40A 3HSFA 4JG7A 3BJ6A 3EQFA 1WGXA 3PY1A 4YG2F 2IS2A 1X3WB 4AFEA 2BHYA 3EQIA 2QKLB 1SVHA 1SVLA 4S04A 1UNHA 2MLKA 3F69A 2UV1A 1TZDA 2HOAA 2PVYA 3S32A 4II3A 4IZAA 4UB8C 5FGMA 2D45A 1V0BA 3AD5A 5E3OA 5E9EA 2CNQA 5BVKA 1Q3WA 4DLJA 2BVAA 2W1FA 3I3LA 4QP3A 4YMJA 4RX7A 2VWXA 1JLUE 1MRVA 4JQEA 4AZWA 4O0VA 3UZTA 1LQ1A 2F5VA 4G6OA 4IX6A 3ZQFA 4FIHA 5HX6A 2RKUA 4GT3A 5A54A 1J3HA 4IXPA 1ERDA 1T38A 3LXNA 4K6ZA 2EVAA 5A4LA 1WHUA 4R79A 4HRIA 4FKJA 1P2AA 3HG9A 4CCNA 2DT7B 3S93A 2F4IA 3MKZA 4LLNA 4AU7A 3BCAA 2L0KA 4E7WA 2BGCA 3FKNA 1I50J 2WMVA 3E3VA 2IVMA 3CE3A 3SHFA 1WWXA 5IQAA 2CGVA 2OZOA 2FH9A 2B55A 3ZHPC 4ITVA 1YOJA 1GV2A 4WRSA 1W0UA