4GYIA

Crystal structure of the rio2 kinase-adp/mg2+-phosphoaspartate complex from chaetomium thermophilum
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
341
structure length
338
Chain Sequence
KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIARLRGGSSGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transferase
molecule keywords Rio2 kinase
total genus 106
structure length 338
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gyiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gyiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gyiA02
4O5VA 4JR7A 4RQVA 1HBXG 4EOLA 3TNQB 3ITZA 3OT3A 2NRAC 2VONA 1LJ9A 2RV8A 2W05A 3E5AA 3KA0A 4PX6A 5DG5A 5HD7A 2H94A 5EI2A 3F2RA 2W1GA 1GNGA 4HVGA 4EOJA 3P7NA 4C38A 4RJ7A 3VUGA 4DQ2A 5JKGA 4C2WA 2BCJA 4K9YA 5EG3A 4IB5A 3GNIB 1GIJA 3VS6A 1V1KA 1PXNA 3S4QA 3HSRA 4ENMA 1H9GA 4OTIA 2Z99A 3JY9A 4FX0A 2W9FB 3K3IA 2VO0A 2ZM1A 2R9SA 3W10A 1H1PA 5HDNA 4EUUA 1M7NA 5LVMA 3T8RA 2PL0A 1FWZA 1SVGA 3ZXTA 3I5UA 1HW2A 4LGGA 1IN5A 3KLOA 4XLNF 3U9NA 4ZTHA 1K9AA 3NIZA 3S3IA 2XJ2A 1YO5C 3NEUA 2ELHA 4U7DA 3OP5A 4KA4A 3DKOA 3EHAA 4D4YA 2X9EA 2F5CA 4LG4A 4GT4A 1SD6A 2CGUA 1OIQA 4YPDA 5FGKA 5DEYA 4FZAB 1T45A 3K9TA 4I2OA 1MRYA 1WMKA 4FTQA 4N6YA 3L9NA 2ONLA 1ZYDA 1GXQA 3N4TA 2ZDUA 2B9JA 4BQAA 2LGCA 2GFCA 1OUKA 4EORA 3TOBA 1FYLA 4EM0B 1DI9A 3NUSA 3QZGA 1YDTE 4FGRA 1S8NA 2RKHA 4JVGA 3DA6A 3KP6A 4OTDA 4F9AA 2HOEA 4D0XA 5HE2A 5AEPA 2F5EA 4PTEA 3VBWA 5LHIA 3BY6A 1LDJA 3PG1A 4LGWA 3E6CC 3OCSA 3CS9A 2QOKA 4UXLA 3E6MA 3VF8A 5E1WA 3MS9A 1SFUA 4V0GB 5D7AA 3NR9A 2R3JA 3ZZWA 1E2XA 3HYHA 4WRSA 1I1GA 4UMQA 1R5HA 4PDYA 1BIAA 3PJ3A 2RKUA 1IXSB 3D7ZA 3ZLXA 4MH7A 5IU2A 2CGXA 5BMMA 4F6UA 2YZLA 3DF8A 4AA0A 1KQ8A 3SKCA 1DS5A 3ZHPC 2GQGA 4RJ6A 3L9FA 1XBBA 2AUHA 4OBPA 4G17A 1UU7A 1S3JA 4X2NA 1W84A 3OCTA 2XAFA 3BYSA 4G7HF 2ERZE 5EEGA 4TKSA 5GJGA 1FP2A 4L5IA 5ETAA 1OZ1A 2L01A 5D5VB 4L9TA 4PGHA 3RWQA 2W4KA 3P1AA 1ON2A 3WTXC 3QYZA 2L02A 3A7HA 4IJPA 1OKRA 1LDKB 1CDKA 4EC8A 3GX4X 3KXHA 4GVJA 3COHA 3K0LA 3RIRA 3OCBA 4QMLA 3ZRLA 1XH7A 4KKHA 4CT1A 5CF5A 5LVOA 1KA8A 2MC3A 3R8LA 1PMUA 3Q3BA 3QQKA 4LOQA 2IZRA 3ERKA 4ACHA 2HZ4A 5HDGA 2GTNA 3AOXA 5CEMA 2WFYA 5GZAA 4XP2A 3HUCA 1MRVA 1Y57A 5I9ZA 1Y8GA 5EM7A 3QQJA 4BIEA 5AV3A 3PLAE 3C7JA 4W4VA 2CN8A 1CTPE 2YN8A 3BHTA 3KB7A 3E63A 3NCGA 3MEXA 3S00A 2GQRA 3ZZEA 1XH8A 3R7YA 4P7EA 2EK5A 1JVPP 4GKIA 1TNSA 2R0IA 2UW9A 5BUJA 4QP2A 3EYHA 2PE0A 2ACJA 3SXRA 4BY9E 3P4KA 4QMSA 4XRFA 3Q04A 1J7UA 1YHVA 2C3JA 3FPQA 5LEKA 5FXRA 2YJSA 2CN5A 3KULB 3FZSA 4JIKA 3R01A 3WOWA 4I98B 4CG8A 2EA4A 3TKYA 1KOBA 3HMPA 3ELJA 3S1HA 1J91A 3M9AA 3EN9A 3E3BX 5FUTA 4OIQF 4BF2A 2JKKA 4YO6A 3ABTA 3QHRA 2QODA 4C59A 4I41A 4XV9A 2QONA 3ZFMA 4D2SA 3PVUA 3WODF 4GK2A 2XRWA 4L3JA 1O3QA 5J8IA 4WX9A 3ZDIA 4JX7A 2QQBA 1U4DA 2VX1A 2A6EF 4QTAA 1U59A 2V9VA 2UVZA 3CPBA 3SW7A 4EYMA 2QOQA 5ANEA 4O6JA 5CZIA 4Q5EA 2L3DA 5I9YA 4BYIA 3GBZA 3FMEA 4MNFA 1UKIA 2PZPA 2H6BA 2ZMEB 5HLGA 5FLFA 3CP9A 3POOA 1CSNA 5K5OA 3ROCA 5M06A 5FLXZ 2YWPA 4FEWA 3EN6A 2IRFG 2VWZA 4E6DA 4OW8A 4BKZA 2A3SA 1R3CA 3THBA 4XRJA 4MWHA 1AQ1A 3GQLA 4QYYA 1G6NA 3DTCA 2VWUA 1V0OA 4WXDA 1PXIA 3FL4A 4HW7A 2OW3A 5HGIA 2Y48A 3AC2A 1FBSA 1RDQE 1QL6A 1J7LA 4ZAUA 1CF7B 3GZ6A 5DYJA 3ZOSA 1KWPA 4J8MA 3Q6UA 2WV0A 1LVAA 1Q97A 2B9FA 3E93A 4FZ6A 1U6GA 4FEXA 5FXSA 4WF2A 4QMQA 2R3IA 2HAKA 2WWYA 4BFMA 3R7GA 2FO0A 2O3PA 4ACCA 4Y83A 3ODZX 3JVRA 3CUOA 4BAYA 4MQ9F 1Q8YA 3PA5A 1KUTA 3V5JA 4YG2F 4FNWA 4RWJA 1E17A 4RC4A 2BDWA 2RVCA 5JT2A 1W7PA 5JRSA 3D5LA 4FKUA 3FI4A 3CJNA 1A9UA 4O96A 2O8YA 5A3XA 2QG7A 2FBHA 4X2FA 2C5OA 2OZOA 5D5UB 1H1WA 2A5YB 2BKKA 3FI8A 4FIHA 4DG0E 3K3JA 5CXZA 2C0TA 5CNNA 4CFMA 2A07F 4HYHA 3Q4ZA 3UGCA 2QR7A 1VYZA 3MW1A 3HRMA 4IAYA 4FV2A 4I22A 2ISYA 4BC6A 2WELA 2GU8A 3BKBA 5DDGA 4AD9A 2DW4A 2I1MA 3NS9A 4R77A 3WF9A 5BPIA 4K77A 3IW6A 2RGPA 3O8TA 2E7WA 5CVJA 2EU9A 3EIDA 2WD1A 4BYYA 4D58A 3ULZA 2I0EA 3P9CA 3T0YA 4CD0A 4DFNA 1BL6A 3NIEA 3TUCA 4AN9A 2PMIA 3TCPA 5CASA 3IKVA 4IVBA 5H6RA 3RPYA 3BJAA 3LJ1A 1IF1A 4IB1A 4BBEA 5E8UA 2UWMA 1QPDA 3DDQA 4L7FA 3TV4A 4BVUA 3DT1A 3PP1A 2ITPA 1QZYA 3VUKA 4AOTA 3LLAA 1TBXA 1OUYA 4ZSJA 4CV8A 4K18A 3BPXA 2NNYA 1SYKA 3JSOA 4QMZA 5A6NA 4USDA 1W7PB 3IECA 2XNPA 4ZZOA 5FEQA 3CY2A 4LV5A 3VRYA 3FMNA 4RIYA 1APME 2XCKA 2BRNA 4CV9A 3FMMA 3D5VA 4U97A 1WBWA 1OYWA 3UG1A 4M14A 4U44A 1TKIA 4OLIA 3KEXA 5E8YA 1UFMA 1BI3A 3LMGA 3C4CA 1D5VA 4QMOA 4S05A 2XK9A 2IWIA 4IIRA 4CFXA 4N9IA 4I02A 4E4LA 2FQ3A 5IEYA 4I4FA 5KMNA 1KGSA 1STCE 4QTCA 5J8FA 1IN6A 2UZWE 1BI2A 3TIYA 3R9DA 4O0XA 3QP5A 4N70A 3DFGA 4OAUC 3FEGA 5KBRA 4Y73A 4X3FC 3SXYA 3JAMK 4WWCA 4HCVA 3VBTA 3P0MA 2YM5A 5EQYA 2XBJA 5IZFA 2ZJ2A 5B2MA 1R1WA 1YW8A 3UVPA 2YWVA 2WOUA 3WTVC 3F2AA 2H09A 4I92A 1GIHA 4EJNA 5BPYA 3T9IA 3KZYA 4BWPA 5IQBA 3LAUA 1CM8A 5ICEA 4WG5A 4QMXA 4BKYA 4FV6A 4FT7A 4DH3A 2ETRA 4JR3A 4FZ7A 4B7TA 3T1BA 3ZMZA 2PWLA 2GNJA 3WF8A 2CW0F 3NAYA 3TXOA 5K1YA 4BTMA 4LMNA 2QOFA 4IZYA 4ASZA 4ANOA 4Y95A 2YPRA 1RW8A 3MGYA 1U78A 1WBTA 2XYNA 3HV7A 4G2FA 1OL7A 4PPBA 5F94A 1SVEA 5JFWA 3WZDA 2VO6A 2CMWA 4FHTA 2VZ6A 4AN3A 3TQNA 3SVVA 1U8RA 4KIOA 4BYJA 4EGYA 3V5WA 3FY2A 4G8XA 2ZAZA 1I44A 4D4VA 3WTSC 3U54A 3C9WA 3PIZA 3DXJF 1ZZ2A 3O71A 2WU7A 4CVAA 3PSBA 2IG7A 3IO7A 3IOPA 5CVGA 3I5ZA 3D2IA 1I09A 5BYZA 4G7ZF 4IXAA 3LAJA 3PJ1A 4MBIA 2UW6A 4XUFA 5H6QA 4EZ5A 4Q47A 2WMWA 3MZYA 2AYPA 5EK7A 4DBNA 4M12A 4CKJA 4YO4A 1IN4A 3TZ8A 1EH7A 2FNPA 2JDTA 3RK5A 4DH5A 1K78B 3A2CA 1WCCA 1WRJA 2VTAA 3K2ZA 4TPTA 5IA0A 3T3UA 4AT3A 2CKQA 4KNYA 3R6SA 5LBQA 2PHKA 2FSLX 4KINA 4EWQA 3KP5A 3R71A 3OS3A 5A46A 4BDDA 2HENA 2QNJA 2BHEA 1K7AA 2W57A 3RHXA 1WAKA 2WQMA 4TWOA 4O7TA 1HCLA 2QKWB 3F6VA 4IPAA 4AZTA 1V3FA 5M51A 2W1FA 4UVAA 4C35A 2C6OA 4YJRA 3MA3A 5TT7A 3R02A 5M55A 4DEHA 4CZTA 3LFKA 3FQHA 4O7RA 5AAFA 4BZDA 5HICA 3TTJA 3NEWA 5EKOA 3TNHA 5JFSA 4LLLA 1SAXA 2OZUA 3WYYA 1XHAA 4AZWA 1A04A 3VULA 5BVKA 1ZYCA 2LF8A 2P5VA 4ZYDA 4YC3A 3DY7A 1FGIA 3H92A 3UODA 3JUHA 3COIA 2HW7A 3DDPA 3RNYA 4G6OA 1OVEA 3IK3A 3C50A 5BVNA 4IVAA 2P55A 4F1OA 3VWAA 4W4WA 3R61A 5IF1A 3UC3A 4BRXA 2OBPA 3COAC 3R30A 5LVLA 2QR8A 1IRFA 4G16A 5AR3A 4ENXA 4HZSA 2EB7A 3UQCA 2WMRA 3ZXZA 3DBEA 4QP7A 3ZDUA 2F7ZE 4DTAA 3BEAA 3ROYA 2BMCA 4YJQA 3FXZA 1B6AA 1MJBA 4AXAA 4AVPA 4FTCA 1PMNA 2CSNA 4RWKA 2JBPA 3PSCA 2GQQA 4FA2A 2W1IA 2WKMA 3U8WA 4ALUA 5CAPA 1OB3A 2A0CX 1Q4LA 1OL6A 3TDVA 2WMQA 4GFMA 1OIYA 3AD6A 3KRJA 5EOBA 2XAQA 2FH9A 2NRYA 2O0UA 4HCTA 2BAJA 3A7GA 4HV6A 5D4RA 3ZBXA 2NYXA 3OCGA 5KK1A 5L2QA 3SQNA 3WILA 4MX9A 5L2SA 1XKKA 2EXMA 2PMNX 4YNOA 4NFNA 2C5NA 2XEYA 4AGDA 4OGRA 4E3CA 4M71A 5HCZA 1PYXA 4LGHA 2WQEA 1YG2A 3GLXA 2IW6A 3BWFA 1MDMB 2A68F 3FL5A 2CNUA 3I0OA 3JS2A 4BCKA 3NYXA 3BQRA 3IQ7A 3FQSA 2FBKA 3P7AA 4NCTC 1ZYSA 4IWQA 3CR0A 3P7CA 3VF9A 2C3LA 1PXKA 2YACA 5AUXA 5H3QA 4GRBA 3U55A 5E90A 4G5JA 2JDOA 2X6DA 1ON1A 4U9AA 3GT8A 3GO5A 3AGLA 3Q52A 2GQSA 5AM7A 3ENMA 3V51A 4F08A 4FZDB 3DXNA 1HOWA 2LF7A 3ECHA 4A5MA 4C62A 4BDAA 4E4MA 4PMSA 2V1XA 5C4LA 3M8FA 4KRCA 2P2IA 3J80Z 2YLEA 4XYFA 4EH8A 5CF8A 5L8LA 3I0TA 3LOKA 4FC0A 4QMNA 4BBMA 2ZM3A 5CS6A 2VWXA 3I0QA 4BWXA 3TDUC 3KFAA 3FAAA 3PRIA 3WZUA 4OT6A 3OW4A 4ANMA 2ETKA 4A0YA 3LSTA 4IFGA 1MKMA 3F3ZA 2R3RA 5HCYA 3PY1A 4FTJA 4HVSA 4M74A 1I1SA 3R1NA 4DGOA 3C1DA 4DYMA 3IW7A 1CKIA 2PVLA 1P2FA 1IN8A 4Z7HA 4XP3A 2YM8A 4DG2E 3G9LX 5ETFA 5DHJA 2CLQA 3AC4A 3RALA 5KBQA 2BFXA 4ZZDA 3NRVA 4UUVA 2GNGA 3I81A 3TN8A 1FVRA 5CALA 4EQCA 4FSWA 4KICA 5DNRA 4ZYHA 2IP2A 4WNPA 1NVSA 3Q4CA 5DN3A 1O3SA 4KS8A 1URCA 3RTRA 4O1PA 4JQ8A 3M7GA 4QMMA 4D9TA 5J1VA 3FMLA 2P5KA 3UOHA 2PU8A 5C27A 4E93A 2Z33A 3NUUA 1BI8A 4FNYA 2NO3A 2UW0A 1OBGA 4S32A 5AIQA 1S6LA 3GXLA 2VTJA 4FKLA 3OV8A 5AV1A 2P7CB 1FYKA 2EJRA 1AOYA 3O51A 5CVFA 2C6TA 4GK4A 2I7QA 4KB8A 3DAJA 1UHWA 2YM6A 4Y13A 1FSHA 5EDPA 3V8SA 4KABA 3MB7A 2YIXA 2VWWA 1YQAA 5TOZA 3FSKA 2X8IA 2C6EA 4HNFA 1ZOHA 1M7QA 4BDJA 4ITJA 4F9WA 4D2PA 3GU4A 3V01A 2IZUA 4JOAA 1FSEA 1Q24A 3E8CA 3QYWA 2GXGA 4AT4A 5HZNA 4E20A 3MDYA 4RX8A 5L8JA 2JAMA 1Z9CA 4S2ZA 5CYVA 1RUNA 4BCHA 3DXPA 2VODA 4A9TA 1TLHB 2P8TA 3KN5A 4XSZF 3T9TA 1Q5KA 3WF5A 2VTRA 2HQNA 4H58A 2UXXA 4AN2A 3UQFA 2PZ5A 2RQPA 3ZEPA 1XDUA 5CAQA 1LDDA 4RFYA 4U41A 4BIDA 2OJIA 4ASEA 2IVTA 4G6DA 4EH7A 3NYVA 5AP0A 1Q8ZA 2R7DA 5IQIA 4I94A 5IT3A 1J75A 4ZYGA 5AUVA 5TE0A 2D2WA 2QCSA 3PY3A 4YNEA 2HZNA 2GS7A 3GFMA 3VS1A 1BOAA 3G51A 2ZKZA 4EM1A 3ZUVA 4EOOA 5AP7A 3I7CA 1TQMA 2HWVA 2E9OA 5AUWA 4FV3A 4RB3C 4KIKB 2J90A 2XCHA 3AT3A 3VW8A 4FODA 2DYLA 4GH2A 1R1UA 1FT9A 5AAGA 4CHUA 1OL1A 4L67A 5IUHA 1KYWA 5FGMA 2QOLA 4MQ2A 3HRCA 4II5A 4EK3A 4GFOA 2O3FA 1VYWA 4L01A 4IX4A 5L8KA 1G5SA 3DBFA 3QU6A 4IWPA 3UVRA 3REOA 3LFCA 4DH8A 1PKGA 5HO7A 3QPHA 3RKYA 4HX7A 4YLKA 4NHJA 4CZUA 2KIUA 3HV3A 4BH9A 4OT5A 2IA2A 4DHFA 4EK8A 2F5FA 4TYGA 4G6QA 3W2OA 3QUPA 1DDNA 5DA3A 5FTGA 4DEAA 2CGVA 3W2SA 4YTIA 3UMWA 3H9OA 2O64A 5A2QK 3GU7A 3RZFA 4IVDA 1SFXA 3MJ1A 3P9IA 5K0KA 4OR5A 5FM3A 5K5RA 4BHCA 5L3AA 4EJTA 1Z6TA 3ZCLA 5J5SA 4R8QA 3CKWA 4RGSA 2L54A 1T39A 3SD0A 4MTAA 2O03A 3ZONA 3PLSA 2BAQA 4JXFA 2VGPA 4I4EA 4AF3A 4L9JA 3GFLA 5IEVA 2R5TA 2I0HA 1QPEA 5AUUA 3BGQA 3MH3A 3G6GA 5DBXA 1R00A 3E6BA 1F1ZA 2YX4A 5LRSA 3EYYA 5FM2A 5HOOA 4O0UA 4FR4A 2J4ZA 1FYMA 1YI4A 1P6RA 2H8HA 4X6QC 2UW4A 1U5TA 2AS5F 4M67A 1JKLA 3BU3A 5IQCA 2CLXA 2QWWA 5JGDA 5LWNA 4U8ZA 5FTQA 2E1CA 3IS5A 3BDDA 5DEQA 5IQAA 3NWWA 3IHUA 1PP7U 4E6CA 3E5XA 4D1XA 5K3YA 1TQPA 4N57A 3DCVA 3EKNA 4PP9A 5HS7A 4MYGA 4MHAA 1ZG1A 4IRHA 3TDWA 5LJJA 4QNYA 4YJNA 1H0WA 4F9CA 4QYFA 4C4GA 2XA4A 3MB6A 3NUYA 4W9XA 1FPQA 5KZIA 2CGPA 3ZC6A 3BQCA 3DTWA 4LLNA 4NIFB 3FWEA 4FNZA 2JTVA 2VTHA 4JAIA 4JX3A 5HE3A 2XVCA 3KXGA 5A9UA 3NW7A 3MVJA 4UXQA 3DBQA 2MBFA 3UOLA 4W4YA 3EQGA 4K11A 4H3PA 5LGTA 4PQNA 4KMFA 5HTBA 4XJ0A 4CYJA 4JS8A 4JDIA 2OXXA 5I5ZA 4RLLA 1PXOA 2XK3A 3VW6A 4PZJA 5KO1A 1EV7A 1RJBA 2C6LA 5CF4A 5LMAA 2UUEA 2WHBA 5IUGA 2QHMA 4IDTA 3NZ0A 5L6PA 1B4AA 4FKOA 4EHGA 3GCQA 3D5UA 5BX0A 2XM9A 3ZQ7A 3KC3A 2R3OA 3S95A 1A06A 3E5UA 2Y9QA 4EZ3A 3RWPA 2MH9A 4RS8A 3ENHA 3NNUA 3W8QA 1JKTA 2RSVA 5AADA 2VO3A 5I4NA 2EFNA 2BZIB 2GS6A 2VBYA 4QP3A 3IOKA 3F8BA 3D5WA 2Z7LA 4CGAA 2PE2A 3VQHA 3LW0A 5HLNA 5KMLA 3D0EA 3T5XA 5M56A 4A6DA 3TNPC 1LEAA 4A2UA 3RI4A 2OFUA 4EONA 2YITA 4N6ZA 2F2CB 4RSSA 2JKQA 4MWIA 3GU8A 5CSXA 2I0YA 4JLCA 5B7VA 4U0IA 4LLGF 1OECA 1JOWB 5CF6A 5EEHA 1J7IA 2R3KA 3O50A 3TWJA 4ETSA 3R28A 2ESMA 4ZYEA 3PUPA 3QFVA 3QRFF 4P9FA 4EH2A 2EB3A 2PQ8A 4FTTA 2PPQA 3QTXA 2ZJWA 3CE3A 2PVHA 5KNJA 3K1MA 3EQPA 2PY3A 2JEDA 2DBBA 1H1RA 3CD3A 4I0BA 2W1EA 5CJ9A 3G15A 1DPRA 3IGGA 3CY3A 2CCIA 4EJWA 3LVPA 4A4LA 2FA2A 3ZMDA 4UMRA 4HF0A 3F66A 3QWKA 2G1TA 4D5KA 2WTWA 3E3VA 2GXBA 5C01A 2X6EA 3DQWA 5B0XA 1IEPA 1R23A 1ZYLA 4RBLA 3WE8A 2HYFA 3C18A 1QMZA 5TR6A 4LI5A 2YR2A 2VN9A 3ZS5A 4Z3VA 3NVMB 5CAVA 4FTIA 3GCVA 3E6DA 1NA7A 3V5LA 1OM1A 2ERKA 1YI6A 5DVRA 3VBYA 3F23A 3KU2A 5M4UA 3M11A 4N9HA 1DAYA 1YW7A 3QCXA 5D41A 4C8BA 4ZTRA 4RIXA 5HVYA 4YBJA 3F5XA 4RGUA 4PDOA 4KBAA 4P9UA 2IVSA 3A61A 4CTBA 3RHKA 2G7HA 2M1BA 5CQWA 3D7TA 1XN7A 5IMXA 1GZ8A 3VNTA 2X7FA 4PCQA 3GYHX 4X0MA 4M3QA 4LMUA 2PMUA 3KREA 4FVRA 3H10A 3QGWA 1MDMA 3POZA 3BIZA 5A4QA 3B2WA 5DPVA 2YCQA 1NXKA 5C4KA 1H01A 3TV6A 3ZLSA 4KRDA 4OTPA 4UMTA 4YFKF 4HAMA 3UJGA 5ANGA 3UMXA 3QRJA 3TL8A 4JQFA 5JN2A 4TV7A 2VWYA 1O57A 5EQEA 2QZ8A 5LHHA 4GEOA 4Y85A 2IPQX 3EQHA 3GFWA 4K8AA 5DCMB 2P6TA 4NW5A 3O2PE 1GZNA 3BYOA 5EH0A 2F2UA 1XBAA 4TXCA 4TRLA 2D1HA 4MXZA 3DQVC 2WTIA 3FDNA 3SRVA 4BL1A 1Q61A 4A0XA 2VWVA 5JK3A 2UZOA 3ZSGA 3FLSA 4DEIA 4N0SA 1J3HA 4OMZA 4JG6A 3KL8A 2WMTA 3GC0A 3PTGA 1G3WA 2O0YA 5AR4A 5BQ0A 3R0AA 4L9IA 1PMVA 4M8TA 2DI3A 4FGBA 2RG5A 3OD6X 4NUSA 2DTRA 5FXQA 3V3VA 5HBEA 4LOPA 4ZMFA 2QQAA 3RP9A 3D4QA 1D8JA 3H30A 3NW5A 4G3EA 4ASXA 4Z9LA 4QMWA 3LWFA 4DCEA 3DKCA 3HMNA 3PXRA 3MTFA 1XQZA 2IN6A 2C1AA 4R1HA 3PVGA 2PEXA 5HBJA 3HX4A 5ANJA 5KHWA 4F0GA 5K5XA 5CANA 1ZY4A 3ZEWA 1M2RA 5CSHA 1CF7A 1L3LA 4PPCA 5DLSA 4ZLOA 4NT4A 1FMKA 4IADA 2B9HA 2PVFA 3G5DA 1J7KA 4IB3A 3E64A 3TNWA 4U7BA 3AC1A 4Y17A 4FTLA 2OK1A 3D94A 4F0IA 2C47A 4ZJIA 3VIDA 2V1DA 2Y6OA 4FYNA 5ICPA 4KIQA 3S2PA 2VX0A 4KNBA 4L45A 2Z7RA 2HS5A 4IAAA 4M9XA 2ITYA 3DS6A 3HRSA 4GO1A 5JFVA 3PWDA 2BILB 1J0RA 1XB4A 1IAWA 3MYGA 4DFXE 2ZV9A 1ZRCA 2Z60A 5ED4A 4EH9A 5AA8A 3KKVA 4OOIA 1ZG5A 5FRIA 3RYPA 4BHPA 1ATPE 4FBXA 4ACDA 4C4FA 3KMUA 3MVLA 3F3VA 3RAKA 1IAJA 4D5HA 4R6VA 3P7BA 3F3UA 4ASDA 4Y46A 3DPLC 3Q53A 3A7IA 5CVRA 3VEPA 2ETHA 3ISPA 2MD5A 5DI1A 2FBIA 4IJ9A 5IQFA 3V8LA 2BVAA 1UNLA 3RI1A 5DRBA 1WVXA 3L00A 3LA2A 4FIFA 1YRPA 4ZS4A 3B2TA 1KV1A 4ZZMA 3MH2A 2YA9A 4AZEA 3U6JA 3IDBA 3GEQA 5J5TA 3W2CA 4JJRA 3ID6C 3ECOA 4FKRA 1JPAA 4L5JA 2NNNA 2HWOA 3MTLA 1FGKA 2W5AA 3PPKA 2RG6A 3ORMA 3R21A 3MESA 4ITHA 2VTOA 1W8CA 5JFXA 3U6IA 4LUDA 3HRBA 3NQOA 2P3GX 4PTCA 1KU7A 2XNNA 1EH4A 4EQUA 3O96A 4JNWA 3A8XA 3FXRA 2QC6A 3FXWA 4E4NA 2M30A 2YLFA 2VAGA 4FOBA 3CKXA 4IAFA 5HX8A 2BGCA 3GC7A 3PYYA 2PYWA 1SD4A 2YIQA 3CC6A 1R1TA 3HKOA 4Z2YA 2VTQA 4QTDA 4CDGA 3SFZA 4LV8A 3OUNB 2ITNA 1K3AA 3QA8A 3UO4A 1R58A 4WXHA 3EOCA 3OXZA 3EL7A 2OJFE 4JG7A 5E1EA 2PI0A 4JQ7A 3JAMZ 3PQJA 3TV7A 4O22A 2BTSA 2Y4PA 2W7XA 4FKIA 2XKEA 5ANDA 3FXXA 1IUYA 4V05A 4XBUA 1XH4A 4YZNA 3I1AA 5AR7A 2B53A 4DT8A 5EQPA 2OSCA 4HZRA 1QGPA 1QO0D 5J79A 5E8GA 4CZYB 3MV5A 1Q3DA 4W8DA 1XBCA 4GT5A 5CSPA 1JGSA 4BDKA 4DGNA 2W9ZB 4RGJA 1P4FA 3A60A 4XLVA 5ETIA 1YLFA 2PK9A 3WZEA 3BHYA 4C2VA 2XZSA 3VS0A 5A4LA 3R1YA 1P92A 1SVHA 3SC1A 3DPKA 4U81A 3CLOA 5KCVA 1ZZLA 4HGSA 3OT8A 2Q0OA 5DT3A 4PWNA 1SD7A 3QOPA 2HXLA 3TO9A 3ZO2A 4LGDA 5I9UA 5L3GA 5DYMA 5HS9A 2JDSA 2PZIA 2WU6A 5IPJA 2VTLA 1H1SA 4ERKA 4BCFA 3RAIA 1KOAA 4IQ6A 5JR3A 5FEDA 4U0VA 3FLQA 4BDHA 5DCMA 3OBJA 4QYHA 3BZ6A 3BE2A 2YAKA 1BUHA 3C13A 1RE8A 1YWVA 4FT9A 2OD5A 5BPDA 2XKFA 5J9YA 2JT1A 3ERED 3IDPA 5BMSA 1ZAOA 1ZLJA 5CT0A 2VBXA 4EJOA 3N51A 5LWMA 3QUEA 4ZJJA 2CCHA 3I59B 5E8XA 5H8GA 2RN7A 1URWA 5AX3A 3EFKA 1L3RE 3I4BA 4B8LA 2VTNA 4ESFA 3LFFA 4ZZLA 3IWFA 5AJQA 3U4UA 3HA8A 1YDRE 2YZAA 1NVRA 4YFNF 3MH1A 2EWAA 3PPZA 4MVFA 1X3UA 3MIAA 5FBNC 5ERIA 5F6FA 2O8XA 1ZG3A 2YJRA 3BHVA 4GT3A 3FLYA 2H6CA 1O7FA 3HNGA 1XD7A 3R04A 5CLSA 4FX3A 5ANKA 4AU8A 5EHOA 3TGNA 3TUDA 4IAKA 4HCUA 2PVMA 5CYIA 5GIPE 2VE9A 3MFTA 3SHFA 4FIEA 4FUYA 1UNHA 4KIBA 1R39A 3T8OA 3W55A 4IC7A 5JSMA 4J99A 2LAVA 4IW0A 4WNOA 4XLPF 4YLJA 3KRXA 2PULA 2I40A 1U5RA 3WG9A 4UMPA 2DT5A 3KEQA 4YFXF 2UZNA 3I64A 1UKHA 1CKJA 2R7BA 3L1SA 5HS8A 4IAZA 3HECA 4GJ3A 2CKOA 2XIYA 2FB8A 2Q83A 1ZLTA 3KCKA 3D15A 4O81A 2OZAA 1WBSA 4XLIA 1Y0UA 4BCIA 4I3ZA 4L46A 1KV2A 5KMIA 3RAHA 1RUOA 4XG2A 3IC7A 4U80A 3AGMA 4AE6A 1DM2A 2GNFA 1Q8UA 4AW5A 2CNVA 1FBQA 2QG5A 4HPUE 4HF1A 2UXNA 4BIBA 4HYSA 3UIBA 3LMHA 1ZHFA 2YCSA 3OY3A 1JSUA 1MD0A 3FX3A 4FKSA 5IA2A 1KQ9A 5BUEA 4YC8A 2XNGA 1HKQA 3FZVA 3OOMA 2QO7A 4DH1A 5IKWA 3E3PA 1ZN2A 3ODYX 5ETCA 5BYLA 4QP8A 5IEXA 3QD0A 1XMKA 4YJSA 3BI6A 3RM6A 5AFVA 3MQ0A 5L2TA 3VS7A 4TL0A 4I5CA 4EH6A 5EDQA 1XCVA 4RJ3A 3MCZA 1ZOGA 4ENJA 4MCVA 5ANOA 3V04A 4IAIA 1H27A 2HZ0A 1JHHA 4ON0A 2YIWA 1BIBA 2OH0E 2ITOA 2X8DA 3QHWA 4W8EA 2WNTA 3MPMA 1LB2A 3KF4A 3VODA 3PA4A 3W6KB 5TF9A 4IRIA 4FKTA 1F0QA 4AX8A 1Q62A 3MY0A 4YGAA 3DZQA 3RPUA 4CT2A 3WF7A 4G31A 4M9ZA 5FQDC 4UALA 2VOOA 4P5OA 4IWDA 5J9LA 4O0SA 3DBCA 3UP7A 4E1ZA 3EB0A 5C8KA 4NWMA 4E73A 1WWXA 1H0MA 1G8SA 5AAEA 4M7IA 5HNBA 3SOCA 5FDPA 2IVUA 2FA5A 2YM4A 3DJ5A 3NPCA 5CEQA 1Z57A 2WTDA 1E9HA 4M0ZA 4HDUA 2NPQA 3W2QA 4RWIA 2F7XE 1IA9A 2V0DA 1BKXA 3HHHA 3WGIA 2QVOA 4NK9A 4EHZA 5AR2A 4UB7A 1WZYA 1SZMA 2O2UA 4BXUA 5H9BA 3PE2A 5IH6A 3MH0A 3SG8A 1VZOA 3PXZA 5IG1A 3KXMA 4QQ5A 4H36A 3ANRA 2NS0A 4WUNA 4EVIA 2VT3A 1YXTA 4KWPA 3VHEA 1IR3A 4OTHA 5FBOA 3ETAA 3W32A 4ESBA 4I6FA 3F21A 4N4SA 3MVHA 4Q4ZF 4F4PA 2XAHA 4QPAA 2XKOA 1ODDA 4CCUA 4QNAA 1ND4A 2C6MA 4RA5A 1Q41A 5AP5A 1PMEA 3I6WA 4FMQA 4Y5QA 2XVDA 3RYRA 2W85A 1UHMA 1E1XA 3TUBA 3EQLF 2PE1A 3IKTA 3EQDA 3M2WA 4L3LA 4TWNA 5G6VA 3I7BA 5CXHA 4F0FA 5K4JA 2OZ6A 5HTCA 3CQWA 5J9ZA 4QPSA 2FU4A 3IPHA 3NX8A 4A9RA 4ZSLA 1JSVA 5B2KA 2PMLX 1H25A 4C7TA 3BU5A 3O0GA 2QO9A 2QHNA 5E17F 2IW8A 4OMYA 1B39A 2G9WA 2OJ9A 2PVJA 2O63A 1YDSE 5AMNA 2EFWA 4EV0A 1UWJA 4RJ5A 4IM2A 1YYVA 3TI1A 4U88A 4ACMA 5JI6A 1USSA 4EOMA 2DQ7X 4L9VA 4QRCA 4O7LA 2XIXA 4JL9A 4C4IA 4EGZA 2NAZA 1F4KA 3LQ3A 3V6RA 4Z7GA 2W1ZA 4CGZA 4QLCU 3FLZA 3E8NA 3KE2A 3S2WA 1H1QA 4J52A 3JVSA 4RLKA 3MZHA 5E8IA 3FV8A 3BYUA 2BDFA 3TACA 1Y6BA 5EYDA 2DO7A 3ZU7A 1M52A 3FI3A 4ASNA 4CXAA 3ZMSA 1A48A 4I0RA 1JQHA 4UMUA 4FSTA 4HOKA 2KULA 2R0UA 3I58A 4CO8A 4U43A 2PLYA 3QRKA 2O6GE 2Y4IC 3LXKA 4D4SA 5I3OA 2R3LA 4NM5A 1XWSA 3ZRKA 4MGRA 4PL3A 5KMMA 4PDKA 2ITWA 4HX8A 1H07A 3QLFA 2Z7SA 3H0YA 4YJUA 4DINA 4I0AA 3V8TA 4CCBA 5DGZA 4FICA 1BYGA 3LQ5A 3ORKA 4FK3A 4KIKA 5FDXA 1K6OA 4RX7A 5CLPA 3WARA 4EEVA 4FV7A 3WZJA 5HLIA 3FMKA 4WBOA 1W4MA 5CVUA 5LGUA 5CI7A 5GZ9A 4JDKA 4CFNA 4OUCA 4WNKA 4ORKA 2BV6A 1IZ1A 2O5KA 4C4JA 1I27A 4RJ4A 5I9VA 5E92A 3LFNA 3WYXA 5FB2A 4R3RA 4CFVA 4AWXB 3OWJA 1XSDA 1SD5A 5E18F 2ZMDA 5L6OA 5GJDA 3TOAA 4FKGA 5CSVA 1UU8A 2CYYA 2OG8A 4C34A 3ZUTA 3GU6A 2R3HA 5IA3A 3KK9A 4ZY4A 3TZMA 3MFSA 2EXEA 3TIZA 4HQMA 4FTRA 4YSMA 1J9IA 1BI0A 4A9UA 4I5MA 1YOLA 2P4IA 2YDIA 4BNCA 2W17A 3QRUA 4FG8A 3S0OA 1IRGA 2ITZA 3L9LA 4S30A 4KSQA 3A4PA 3D9VA 4G6LA 2HTSA 3LXPA 2PUUA 3QX4A 1F3MC 4WSQA 1FOKA 3VS5A 1XGSA 4CTCA 4RPVA 2MA3A 5JRQA 3BU6A 3DB6A 1DP7P 4HYEA 4ANSA 4RIYB 3F8FA 4WG4A 3RPOA 5KX8A 3HVCA 5CU2A 2F9GA 2EV6A 3C3WA 4DBXA 4G9RA 4K6ZA 4BGQA 3I5NA 2ZXJA 1YXSA 4OBOA 4JBAA 4ACGA 4FT0A 3V8WA 4S33A 5H8EA 4C37A 1ZH5A 1W5TA 4IHSA 2UZVA 2DK5A 4BI2A 1M2PA 4Q5SF 3V5QA 2UZBA 3EUHA 4IWOA 3RBWA 1HCKA 3FUPA 3CO7C 5DH3A 2C5YA 3HA6A 5DMZA 2P6SA 3VUDA 3QTUA 4XBFA 3AD4A 4D0PA 3PP0A 1HW1A 4F9YA 3UNJA 1MGTA 4BCOA 4XV3A 4LJZF 3OBGA 4UVBA 3PZEA 3TO7A 2JPBA 2HOGA 2FSOX 2CHLA 4K33A 2YM3A 3QD2B 4B4LA 4FKJA 4DFZE 1J5YA 3P86A 2Y75A 5LMKC 4FKPA 4EJVA 3FYJX 5HCXA 3WTWC 4XMOA 4AG8A 1W0XC 3U9GA 5IH4A 4ZY6A 3HAVA 2C4GA 5BVEA 3V5PA 3R7EA 4AP7A 4NU1A 4O7YA 4LL0A 4F70A 3R9OA 5CSWA 2X0LA 5DOSA 2R7FA 2ITQA 3LFBA 5LVNA 2X9FA 3V7CA 1O3RA 2NRUA 3C7QA 4IFCA 3ALOA 3QKMA 1MQ4A 2P7VB 1F5QA 5CVVA 2BROA 5J7BA 4MF1A 5F4NA 2PSQA 1MJ9A 3AMAA 3M1EA 4S34A 3Q4TA 1MP8A 5CTPA 1G4DA 4CG9A 2WEIA 2W5BA 4EH4A 3BX5A 4JRVA 4YHFA 1M17A 4GXOA 4PMMA 3LZBA 3WTYC 2YERA 1JAMA 3GQIA 3CTAA 3FZPA 5C03A 5ICFA 2C30A 4FTNA 1O6KA 4U0YA 1HKSA 4MKCA 2XNEA 3UIXA 1WBOA 4EUTA 3B02A 5J6XA 2P4WA 3KRWA 2V55A 3SDJA 4TT7A 3GCSA 4EKKA 2OWBA 2ZM4A 3UPZA 2H6DA 2GNLA 4D4RA 4L8MA 2VWBA 1BBYA 4BGHA 1MUOA 2VC1A 4IC8A 5EM6A 3BGPA 4AT5A 3QKLA 5FP6A 4E70A 4O83A 3UC4A 2X2KA 2XASA 2JKMA 4YU2A 3L2CA 4HZFA 4ZH4F 1LPUA 3DAKA 4RVMA 4X2JA 4M72A 2JFMA 3K5UA 5H2UA 2BYVE 5B2LA 2O65A 2XV4S 2UZTA 1VEBA 1YHWA 5M09A 1B59A 3DK7A 2UV2A 3EQIA 1TVOA 2JD5A 3RINA 1B1BA 2E9VA 4CFFA 3BLHA 3QAME 4GYGA 2A2AA 3ORNA 4WK8F 1PXPA 4DEGA 4GS6A 4Z16A 3ZN1A 4LB6B 4MD7E 3DKWA 3DOGA 4PMTA 4I21A 4TTHB 3RM7A 3CPCA 5HKMA 3ZC5A 3CJGA 3VQUA 3AMBA 3FLWA 5FG8A 5AP2A 5D6FA 4LRMA 5FFZA 2XF0A 4K1BA 5L3DA 5JEBA 4PP7A 4AFJA 4ZJVA 4IRGA 2J5OA 3PA3A 4R7BA 4M15A 2OI4X 3COKA 2JIUA 3HL7A 4IX3A 5H8BA 4Y15A 2QLUA 4OTQA 2XBAA 4ZK5A 1J1BA 4LD5A 5HE1A 5K5NA 5I9XA 5DR6A 4X2GA 1JKKA 2K7LA 4E26A 4JT3A 5HEZA 4DFLA 4DNCA 3QU0A 3MFUA 4QMTA 4XX9A 2QOOA 1HSTA 3EYGA 5D5WB 1REKA 3R9HA 2V5QA 3BBTB 5HIDA 3QRTA 3BWJA 3RTPA 2BZHB 4GIIA 1KU3A 2FYSA 4MTDA 4M84A 2WOTA 2JFLA 4AZSA 4HGLA 3HYIA 2EV0A 4GGGA 1BMKA 3T8TA 2REIA 2F57A 3GFJA 3OOGA 2KJBA 5AIRA 4USFA 3F6XA 1WBVA 4YPSA 5AP6A 5ACBC 4L0YB 1UA2A 4CFWA 4R1VA 2J9MA 4IBMA 2XK8A 3CGOA 4ZEGA 4I93A 2XYUA 2XM8A 5KMJA 3WI6A 1FMOE 4AOJA 4BB4A 4I0SA 4JAJA 2A61A 5E1ZB 5IQHA 4O7NA 4KUJA 3RKBA 3B8QA 3V8KA 5HIBA 1R7JA 2G01A 3FKNA 3OWLA 4P96A 2ZNYA 1H00A 4EOSA 1W82A 2PVKA 2BTRA 4O7WA 2G2HA 3E8EA 1B38A 4D2TA 1OPKA 4YIFA 2XROA 3MPAA 4RVLA 1OITA 3CEKA 3JTGA 4UY9A 3HEGA 1KQ0A 3R7UA 4MXAA 4IM0A 5JZJA 4KBKA 4ALWA 5K9IA 4RIWA 2HKXA 3LFDA 4RMZA 3ZM4A 3PXQA 2E1NA 5J7HA 3VC4A 5L4QA 3NUXA 3U1DA 4B8MA 4AGWA 5AA9A 4UHTA 3QU3A 3PZHA 4EWHA 5D5XB 1SM2A 3VVHA 5LRRA 4XG6A 3JTHA 1GIIA 1TNTA 2BRBA 4AAAA 3UYTA 4XG8A 1DI8A 4F1MA 4FSUA 4BCQA 3C4WA 3SXSA 2B1PA 4ANLA 3RK7A 3R9NA 2YSRA 1LUFA 2HWPA 2RC4A 4G6NA 5TJJA 2RFNA 3TKIA 2YEXA 3DKFA 3OXIA 3CD8A 3CUQB 4NL0A 4L3PA 4ENYA 1R5GA 4CYIA 4O6EA 4OINF 3LXLA 4H39A 2X4ZA 2VNYA 1JLUE 3LHJA 3WZKA 4CRLA 5JGAA 2PVRA 1IASA 2VBWA 4O82A 2HCKA 3R6XA 3ZO3A 3MIYA 3SHEA 4U7ZA 2WMAA 4EK6A 2M5WA 3EJ1A 5IUIA 5LEJA 2FNAA 2Z3YA 1OKVA 2EA2A 2VUWA 3UDBA 1S29A 4FVQA 3WU0A 1K2PA 5JZNA 3CTJA 4V0GA 2Y6MA 3QZIA 1R22A 3CDHA 1O9UA 4TW9A 5D12A 5LLQA 4JIAA 3MA6A 5AR8A 2IA0A 3VUMA 4CNHA 3U9CA 4CMOA 1YFHA 2XMYA 2CQKA 3BELA 2LDUA 3DFCB 4GL9A 3KP2A 1S7OA 3QUDA 2YAAA 2FVDA 4CMTA 2QQ9A 4USEA 4KSPA 2VD5A 2AXLA 4WRGA 4J7BA 5E8SA 1OIUA 2A1AB 5FD6A 3HUGA 3Q32A 3F5GA 4IZAA 4N0BA 1D3YA 3DEUA 2HZIA 5HU9A 3ELKA 2IJLA 2FMLA 2G2IA 4FV1A 5IISA 1GZOA 5D11A 2C6YA 2FUMA 4ENKA 4ID7A 1M2QA 3IONA 3J81Z 4WKQA 4WHZA 3DLZA 4AACA 3NYOA 4QO9A 5HU3A 1EH6A 3FJQE 2E2BA 3UTOA 2BRMA 3RPSA 5HLWA 1NW1A 4G3DA 3N4UA 3WE2A 2RFSA 2XIZA 5M53A 3QCQA 1V0BA 2ITTA 2A19B 3AD5A 3E62A 2B54A 1MZBA 3J80K 4LM5A 2COMA 4FTMA 3QF9A 4EOKA 4ZLYA 3QTRA 4BDEA 4RB2C 1C0WA 3GVUA 1P14A 4EK4A 3IKAA 5CAOA 3BLRA 2X4FA 3QTZA 3CQEA 1I5ZA 2PG4A 4P55A 4ALVA 4O21A 2QD9A 2YFXA 4ZXTA 1FNNA 3SW4A 3RK9A 4PTGA 2HR3A 3LA7A 4LRKA 3QBNA 5JFRA 3MPTA 3NNXA 3UZRA 4DAWA 3EWHA 2I6LA 4FTAA 2H9VA 2XJ1A 4QYGA 5LOHA 2C3KA 3RKXA 3I71A 4K0YA 4XSXF 3H3ZA 5DCFA 2CSOA 1T38A 3F7ZA 4QMPA 2CKPA 2DLLA 3PXYA 2WEVA 2J0LA 2QKRA 3QKKA 2XKDA 4GVAA 1XGNA 3R63A 3CTQA 5CEKA 3KFWX 4QP9A 2QYOA 1ZRFA 4GIHA 4FL2A 3KEOA 2GHGA 3OOPA 4FSZA 4GU9A 1QPCA 4EBWA 3F5PA 1XGMA 2VXZA 3FM5A 5HI2A 1K79A 4EHVA 3FHZA 3DAEA 4QQJA 1H4LA 4XH6A 5T68A 1G3TA 4K2EA 3WTZA 4TN6A 1G3SA 3V8JA 6PAXA 2G7UA 4RFZA 3NAXA 1UWHA 3R1SA 4IZ7A 2Z2WA 4DFUA 5BYYA 4IB0A 1T6SA 3FSFA 4EC9A 2BDJA 3BHHA 3HHGA 2DQRA 4MD8E 4YLLA 4AUAA 4LB5A 4KYWA 5BVFA 2NNWB 5EFQA 3PQKA 5M57A 3RJPA 3ZRMA 3D7TB 3KXXA 2UW5A 4RB1A 2X4HA 1Q8TA 2A69F 2E7XA 2B52A 4RT7A 4H1MA 5CU3A 4ZSEA 5IMEA 4MXYA 3Q9SA 2HZTA 1BI1A 4CLIA 4RC2A 1W7PD 4NM3A 2PMHA 5HNIX 4HVIA 3LIJA 1RIOH 4O7ZA 3ACKA 1XDSA 3GEZA 2ZV2A 4UX9A 5FD5A 4U79A 4P5QA 2XJ0A 3FMSA 3HMOA 1UB9A 4X3FB 4U5JA 2R3PA 4XHKB 1GJOA 1U46A 3MY5A 4DTKA 4FSNA 5FEEA 3OXTA 3B8RA 4H3BA 3V5TA 2Y0MA 3CO6C 3DGKA 1FINA 5KVRA 3VS4A 3R1QA 4XOZA 5ILUA 1GAGA 2BRHA 4C58A 3BROA 4C3PA 4R78A 4QP4A 2XS0A 4YBKA 2PZYA 3EYIA 2PBIA 3GW2A 1YWRA 4A4OA 4LG0B 4RA4A 1PP8F 1FLIA 3G2FA 2RNJA 1U5TB 3QD3A 3GP0A 4WO5A 3TT0A 5CVIA 4TNBA 4HX4A 4O0WA 3CXWA 4UVCA 4AWIA 3RCJA 1W83A 1AD5A 3O2MA 4BTKA 3FMDA 4UYNA 4X7QA 2NP8A 5CEIA 5EI8A 4BICA 3KULA 2J50A 2C3IB 2JLDA 5LMKA 4OTFA 4R5YA 3KRLA 4CEGA 4RZVA 4A4XA 4FTOA 2FSTX 1WVWA 2FEZA 3MFKA 3NCZA 3ZLYA 1PXMA 1LEZA 3MN3A 2RGVA 4C36A 3GZ5A 2OFVA 4PF4A 4PMPA 3U51A 2ZCWA 2VTSA 4OAVB 3V6SA 4FV8A 1GOLA 3LXNA 5AP4A 5EW8A 4GW8A 4M69B 3L8PA 2OXDA 3R73A 3HP5A 2GCDA 4RVKA 3QXPA 4I6QA 3FQEA 4GK3A 4FE2A 3K2LA 2GDOA 2BRGA 3PIYA 2FF4A 2WIPA 4C57A 3MI9A 4FG7A 1GVJA 1JSTA 1KE6A 1S9JA 3EN7A 5EYMA 4O27B 2CPKE 2Q2EA 2VC0A 2V22A 2W06A 2J7TA 4X2KA 2R3FA 3Q9XA 1MRUA 1PKDA 3ZMMA 2PUNA 4F6WA 2D1VA 5GINE 3AMYA 3FMHA 1Z05A 1NY3A 4FT5A 4RAZA 3ZFXA 3MAJA 1IAHA 3ZTXA 4QWQA 4A9YA 4GFGA 3NUPA 4RGXA 3T3VA 2CO5A 4I5PA 1YW9A 2IW5A 3FZOA 4TYEA 3LQQA 5HTIA 3R2YA 3FMJA 2CFXA 2XK7A 4G9YA 4FYOA 3Q5FA 2VT2A 5J95A 2WTVA 2QENA 3EFLA 3BRBA 4NQWA 4ZSAA 4YJPA 3WTTC 3QGYA 3ZYAA 1OPJA 2VWIA 2BALA 4I01A 5ILSA 5L3FA 3ZO4A 3IW4A 5BVOA 3Q60A 4DA5A 4CQGA 4QTEA 2YU3A 3FM3A 2JSCA 5AP3A 1OGUA 3F2NA 4ITIA 2B0LA 3I59A 3C4ZA 4DLIA 3FPMA 3B73A 4FTKA 4WCGA 1P4AA 3EQBA 5CU6A 2OBJA 4IVCA 4XBRA 2HFHA 4FTUA 2HYGD 4M6XA 1YTYA 4XS2A 3NUNA 2PJPA 5DE2A 4S04A 1GXPA 2OXYA 2OO8X 5D1JA 1PUEE 4O86A 4QMYA 2WGJA 4DFBA 4D2RA 1JKSA 3H0ZA 2DS1A 4WOVA 3VS3A 5TO8A 5IH5A 4IMYA 4XG7A 3PE1A 5H20A 3KETA 2QOBA 2F5DA 1DPUA 4R3CA 2R3SA 1G3NA 2J0MB 2OF2A 5KKRC 4NFMA 3OWKA 4AW0A 2STTA 3AAFA 2J51A 4B9DA 4FEQA 4GSBA 3IGOA 2FE3A 2WTKC 3ZMVA 1H28A 4LFIA 4X21A 5M4IA 5C1QB 2K27A 1YXVA 1Q99A 3DNEA 4QP1A 3F5UA 2D45A 3VBQA 2W1CA 3EZRA 1YQJA 4I6BA 5E8ZA 4BN1A 3HIFA 2J0IA 3E88A 3VHKA 5F95A 5C9CA 2CDZA 4FZFB 2ZB1A 1BN5A 4TNDA 3AQVA 4I24A 3RPRA 4FIJA 4UEUA 2WQOA 2PTKA 4YTFA 3BPRA 5GJFA 3R9RA 2VN2A 3I79A 3RKWA 1WVYA 2VOPA 4WSYA 1I6XA 2A4LA 2Z8CA 3BJOA 5CZHA 2ESNA 3R7IA 1CGPA 3DB8A 5DR2A 5EKNA 3R8ZA 3E5QA 4UWYA 5LCJA 4MK0A 4NJ3A 2OGVA 1R78A 2GTMA 2Y8OA 4HLYA 2HEOA 5IT9Z 4ONAA 4HA8A 3K1NA 4QMUA 3QQUA 5J1WA 3TKHA 4YJOA 2DAOA 3LE6A 4M68A 3F3TA 1Z6RA 4DGGA 4YIIA 1O6YA 1ZY5A 4AQCA 4WD5A 4NEUA 4I1ZA 5BUIA 2R3QA 1U3EM 4B99A 3TZ7A 5CWZA 1H24A 3GFIA 2GA2A 1GY3A 1XH6A 3E7VA 2GHLA 2HXQA 3LFEA 1OPCA 4O0TA 2HW6A 3QCYA 3OY1A 3UIUA 3KGAA 3F8NA 4ZY5A 4AFEA 4DEBA 2B4SB 4U3ZA 1FP1D 1UVRA 1OBDA 5J8CA 4XG3A 2OAZA 5EI6A 1REJA 4QOXA 4WA9A 2W4JA 1U2WA 3ULIA 3OEFX 3JYAA 4S31A 3BV3A 4UZHA 5IDPA 1J1CA 4C33A 1XSXA 4O7SA 4OU0A 1UU9A 4NZWB 3HV6A 3KZZA 5CY3A 5CEPA 3PRFA 2WPAA 5HNGA 2GA1A 4U42A 2W24A 2WQNA 4FIGA 2P0CA 3QQFA 2VGOA 2EB2A 3QLGA 4UN0C 4PNKA 4DG3E 4I5HA 2F4JA 4UWCA 3COMA 3W18A 3ZFYA 4M69A 3KN6A 3H3UA 3DK3A 4H3QA 1IW7F 3DKGA 2C6KA 5L6WL 4OTWA 2XGXA 1OKWA 4PPAA 2HQRA 4UV0A 2E9UA 3UOKA 4C3FA 5E1XA 3R4KA 1XMAA 2GWRA 1BX6A 4MEYF 1WKMA 2OU2A 2V7OA 3O23A 4X6RA 4L43A 2WMXA 4M66A 5JQ8A 4DITA 5GZ8A 5FWKK 2OJJA 5DIAA 5A54A 2HELA 2ZO4A 2JIIA 1B9NA 3FZTA 4O2ZA 3TKUA 2TDXA 4Q2AA 4GG5A 3QC9A 4L44A 1GZKA 4FT3A 3N4MA 2R64A 1LQ1A 3QTIA 5I9WA 5HVKA 4YZDA 3HTSB 3LKMA 2CNQA 3QP6A 1FY7A 2R3NA 3SOAA 4FX4A 2SRCA 3GENA 2IJMA 3MSSA 4AW1A 2B9IA 2RIOA 5HIEA 5BVWA 3MWUA 4ZLZA 4UZDA 3EETA 2H34A 4H0EA 3FHIA 1ZOEA 1ZXEA 3LMIA 4YHTA 1Z5MA 3DZOA 2W84A 1DUXC 2ZNZA 4LK0F 4L0ZB 2JPCA 1VJYA 1MJAA 2QOCA 3WU1B 2J0KA 4LFUA 1RNLA 3UP2A 1VTNC 3QTSA 2B7AA 3UE4A 4LOOA 4Q48A 3EKKA 3OTUA 2GAUA 3F88A 4TYHB 2WMSA 4BDFA 4KN7X 1OIRA 5AX9A 2BPMA 4EI4A 4AW2A 2FSWA 4LMYA 3WGGA 2ETMA 1W98A 2HTJA 3MY1A 4P5ZA 2XEZA 2GNHA 5C26A 1QPJA 4IX5A 3RGFA 2E9PA 2HY0A 3WIKA 2VTIA 4ENNA 2YIYA 3CLYA 3F3WA 3QQGA 2B0QA 4JDJA 4J98A 2ZYBA 4E6QA 1UV5A 5IQEA 5HLHA 3CQUA 5DD8A 2KRFA 1H9TA 4RIOA 1IRKA 2VTMA 3OG7A 1LR4A 5HD4A 3R8PA 1PF8A 3ORLA 1PRYA 4ZTNA 3FXUA 4FK6A 4YTCA 2WTKB 4EH3A 2K86A 3SZPA 2ZV8A 4OTRA 3P9KA 4WBBB 5T6KA 1JWHA 2CKEA 4G3FA 3H3CA 3HTUA 1F5TA 4YZBA 3W2RA 1Y6AA 4RJ8A 4EL9A 5D9HA 4WIHA 5HVJA 1ZMWA 2Y0AA 2XP2A 2QUFA 1BL7A 4AS0A 4U40A 2GPHA 3E87A 3CBLA 2OH4A 4KT5C 4A07A 3AC8A 1R1VA 1YWNA 4WXCA 1ZRDA 3NRMA 3RZBA 4IEBA 4MTEA 3WF6A 4I6HA 5ILVA 2KTYA 3G33A 2C1BA 4GCJA 4RG0A 3SG9A 4IM3A 2AC5A 3C0IA 1R0EA 4OIPF 3UG2A 2OIQA 4QQCA 4EQQA 1WI9A 1PJKA 5EW3A 3L09A 1YIOA 2A6HF 1ZMVA 4KN4X 4ZSGA 2M87A 3VFZA 4YHJA 2WTEA 4KD1A 2ZB0A 4ANQA 4MAOA 2Z9OA 3EDPA 4MXOA 3JY0A 3NNWA 1H08A 3R22A 5CT7A 3RAWA 4L52A 4EZ7A 1K78A 2XH5A 4CKIA 5A4CA 5M07A 3C51A 5EW9A 5HG7A 2DPUA 4NYEA 3C4EA 3FZ1A 4FSMA 4XNEA 3GCPA 3HLLA 1TW3A 4XOYA 3CGFA 2YM7A 4EOPA 4EYJA 4J71A 2KJCA 2X81A 2W25A 4PL5A 4NB5A 2XKCA 4RGRA 3DU8A 3K1PA 2DFIA 4M97A 3W8LA 5ACKA 3QCSA 3EFWA 2XUUA 5EHYA 3R2BA 4IF4A 4C4HA 1QQIA 4BHBA 4V01A 5E9EA 3QTWA 5KKRB 4QP6A 4IE9A 3PFIA 4YURA 5FP5A 3L8VA 2R3MA 5E8WA 4WT6A 1FVTA 2R3GA 4JG8A 1UNGA 1P4XA 2JBOA 3PY0A 4YZCA 4NW6A 3GF2A 4YZ9A 1YI3A 4NTTA 4JBQA 2EFOA 2VTPA 4L9NA 4AOIA 3WBLA 1YXUA 2JGZA 1RI7A 1IG1A 3U2RA 2QOHA 1VR2A 3D14A 2EFPA 4J95A 1KU2A 5I3RA 3LQRA 1G3YA 2IVMA 2MLGA 2WMVA 1ZRZA 5A4TA 2FMYA 3TNIA 1OR7A 2PUPA 4UYAA 3IW8A 5D4SA 2X7GA 3G90X 2HIWA 3VRZA 2IO6A 4JI9A 5FFXA 4B8XA 2YHVA 3AXWA 4E5AX 3P08A 3DLSA 5LHGA 3NUAA 3BBWA 2P33A 4NJDA 2PUIA 1H26A 2Z7QA 4FV5A 3V7RA 2XNBA 5CX9A 3LJ2A 2XAJA 3SGCA 3DK6A 3GUBA 4FNXA 4YR8A 4GMYA 1CMKE 4ZS0A 3EQCA 2PVYA 2JDVA 3N9XA 2BUJA 1XGOA 2P2HA 4YSJA 2J5FA 3TO6A 4ZMEA 4ZIMA 4DFYA 3O8UA 1WQ2A 4XP0A 2QLQA 4BKJA 3VJNA 2OKRA 4ESJA 2J0JA 5CNOA 4R7IA 4NH1A 3QC4A 3DXQA 3D2KA 4BTFA 2BKZA 4U6RA 2YIRA 4A0ZA 3LFAA 4BZNA 4MNEA 4CICA 4BI0A 5M44A 3G73A 5LQFA 5IT9K 3C0HA 2W5HA 3KY2A 1BC8C 5IA4A 2BIKB 4HDVA 1FBNA 2DU9A 3ZSIA 3Q9YA 3ATTA 5HORA 1BM9A 5DT4A 2O61A 3LQ8A 2CJMA 1O6LA 4WNMA 1ZLKA 4MQVA 2XRUA 2V79A 3CCNA 3OWPA 4NKSA 3NDMA 5CENA 4A12A 4R5SA 4Q9ZA 4RWLA 2L4AA 4PNIA 1SNXA 3CUQC 5AIKA 3DJ7A 2YDKA 3UO6A 2UZDA 3RDIA 4ANBA 4BCJA 2W0JA 3ZM9A 4O6LA 3GC8A 3H9RA 4GU6A 3GC9A 3D83A 2ZMEA 2PN6A 3RMFA 4FKWA 5D8KB 5HG9A 4O3MA 4EMSA 4U0WA 4HOBA 4R79A 4IANA 4EBVA 2LNBA 2V62A 3NLBA 2G9XA 4HV5A 4PV0A 5ITAA 4RFMA 3AC5A 3PXFA 2UVYA 3F9NA 3BEGA 3VBXA 1KYZA 2VTTA 2Z02A 3KP4A 5IA1A 5LMBA 3VJOA 3HRUA 3O6BB 3TZ9A 3FE3A 4CRSA 5AUZA 4CKRA 2VO7A 4J8NA 4ZP5A 3A62A 4YUQA 4CMUA 4G34A 1XO2B 3IW5A 4CXFA 2ZFWA 5AONA 3CUQA 3EQFA 2JRTA 4BZOA 2OIBA 2PMOX 4D0WA 5L3BA 3LM5A 4I7HA 4EQMA 4C61A 3UYSA 2JDRA 4ANNA 1W7HA 4A5NA 4I20A 3KCFA 1WSUA 3HP2A 1HW5A 5TRDA 3SV0A 3BJ6A 3RPQA 5E8VA 3D0SA 4B0GA 4FUXA 5JMSA 5AM6A 2Q8KA 3Q5IA 2X2LA 4OIOF 5LGNA 1ULYA 2CGWA 1FOTA 4HNIA 4G3CA 4NCTA 2JITA 1JXSA 3BLQA 4KDPA 2QU5A 4LL5A 1UU3A 4RC3A 3UOJA 4MBLA 4UBAA 3U87A 1B6CB 1QNTA 3GI3A 3OEZA 4RIXB 2C69A 5IA5A 4IXPA 4UNOA 1RZ4A 4A6EA 5IQGA 4FKQA 3TTIA 2C5XA 4L7SA 3LPBA 1ZREA 2FXAA 5DT0A 1SMTA 3VN9A 3KQ7A 4EK5A 4YMJA 2XIGA 4LQMA 2BBYA 2LSOA 4L18B 3JW4A 2OIDA 5HLPA 1OPLA 1WBNA 1HKTA 4HF2A 3EZVA 2YX7A 4FEVA 3W6JB 2R7IA 4U45A 3NGAA 4UXNA 1NVQA 3MVMA 3KRRA 1ERKA 1TTYA 4AZVA 3I53A 4TYJA 1IA8A 2WO6A 4F7LA 2HY81 4D28A 2F49A 1XH5A 4OBQA 3FI2A 4BCPA 4OIRF 4G9CA 4C4EA 4BCMA 4BDBA 2EVAA 2UW3A 1PXLA 4YJTA 3QALE 1M14A 3A8WA 3FC2A 3FY0A 2IT0A 5CVHA 3ZP5A 5GNKA 2V1UA 2CG4A 3CJFA 4FV9A 5EHLA 4MEDA 3VUIA 2WMBA 3TEIA 1X8BA 3FWQA 3V7SA 3GUDA 2C0IA 1FQ1B 1USTA 4F7SA 4MQ1A 2AC3A 2WIHA 4H1JA 1T2KA 3BOQA 4F7NA 4TYIA 3QAHA 4BTJA 1HXDA 3MWMA 2X39A 5ICGA 5HDKA 2FOKA 1U54A 3KF7A 1TW2A 1OYIA 3R00A 1PY5A 3LFSA 1QPMA 3J81K 4J53A 3QTQA 1OMWA 4APPA 3R8UA 3A99A 3H4JA 4UWBA 1Y8YA 2X8EA 3PJCA 4DEDA 5JHUA 3EFJA 4A9SA 3ZMTA 5C8NA 3DFAA 2UW7A 4ZTQA 1SNUA 3M8EA 3NMUF 4IJAA 4D2VA 2F7EE 3U4WA 3BGZA 5CQUA 2YCFA 4DF3A 5KHXA 4F6SA 1FX7A 2Y4IB 5D6EA 1YVJA 3K5VA 1QCFA 4E6AA 4JK1X 3HRTA 4XCUA 4BHNA 1GHCA 3KXZA 3HGKA 3OHTA 4GUBA 3UPXA 2WTCA 3RVGA 3KP7A 4BHZA 1PDNC 2IPXA 4PUZA 2WZJA 5L3CA 2WTJA 4F99A 3OMVA 5A14A 5L2WA 4LG0A 2FGIA 3E7OA 3Q5ZA 4JRNA 4L53A 4FF8A 2XHKA 3WIGA 4JBPA 2ZMCA 4EKLA 3P5KA 2C6DA 2ITXA 4FSRA 2QO2A 4FIIA 4CLJA 4F64A 3UNZA 1P5EA 3A7JA 3BYMA 2C0OA 2F2EA 3VO3A 2QBYA 3PIXA 4QQTA 1T46A 3IDCA 4XRLA 5A4EA 1J2XA 3KCCA 4NKAA 3VB2A 3N97A 3HDNA 3Q6WA 3EQRA 4UV9A 1KE5A 2DPDA 3SQQA 3ZPLA 4NIFA 3LA3A 4E5WA 1B9MA 3W2PA 3KLNA 4W9WA 4R7HA 2ZVAA 4ARKA 2J5PA 2QI8A 3JSPA 1LEWA 1XSVA 3EH9A 4J1RA 5E91A 5BS6A 4JQEA 4ZZNA 3F69A 3IRQA 3HRFA 3A4OX 4WG3A 3REPA 4JDHA 4EJ7A 1EH8A 2ZBKA 2KIMA 1P4OA 1IN7A 3L7WA 4B09A 4YJVA 2GS2A 1V4RA 2QBYB 5CAUA 3ZO1A 3KMMA 2J2IB 5KUPA 3CIKA 4RX5A 2Q0NA 3K54A 5HG8A 4DT9A 3L9MA 3PJ8A 1KE9A 3UIMA 3FKOA 3QA0A 2BFYA 4M9SA 5JVTA 3QPTA 4BCGA 1FBUA 3C4FA 3NVKI 3LCDA 5FTOA 2EUFB 2FRHA 3PPJA 4ERWA 4X3JA 1LEBA 4FOCA 2JZYA 3SX9A 3ZLWA 3QZHA 3IRRA 1NHAA 3C1XA 4QYEA 3ABUA 3EN4A 4D1ZA 4DC2A 4YTHA 3TM0A 3WGHA 2DWBA 3BWGA 4G94A 5EDRA 3GU5A 3PSDA 4RAYA 4P4CA 5KMOA 4XV2A 2XB7A 2RFDA 3GCUA 4BWKA 1YXXA 4KIGA 3R7VA 5DV5A 2XK6A 3HMMA 3HMIA 2VBZA 4DH7A 3WE4A 4KFCA 3LFQA 3ORPA 4AZFA 5LVPA 5D7VA 2DK8A 4HVHA 1O3TA 2YCRA 4O91A 4O84A 3PVWA 3KP3A 3MJ2A 4ZTLA 4Y5HA 4M73A 2X0GA 3LCSA 3QQLA 4HYUA 1YKRA 5HG5A 4RVTA 3MBLA 3I6UA 1XH9A 2K4BA 3P23A 3KVXA 4PL4A 4FV4A 4CYDA 4G7OF 2VV9A 5E1SA 3NYNA 3UBDA 3DPTA 3LCKA 3P78A 5D10A 1BI7A 3Q9WA 4FVPA 5T3QA 3BE9A 4GKHA 4XG4A 2R2PA 1ZWSA 2EFQA 3WE3A 1W5SA 1ONVA 3G0FA 3TDZC 2KIFA 4FSQA 2W1HA 3OW3A 2BAKA 3P79A 1H0VA 3TJCA 1O7LA 3FHRA 2Q0BA 2OQRA 4P2KA 2H27A 4CSVA 3BZ3A 2EXCX 2ITVA 5AWMA 2RFEA 4F7ZA 4I23A 3HOTA 4LK1F 3F61A 2CWEA 4PDSA 4KMUX 4G5PA 4MEXF 2HDCA 1WBPA 2V7AA 2XIRA 2PVNA 2XIKA 2K02A 3E97A 1S9IA 4AGUA 5F1ZA 1L0OC 3ZBFA 1Q3WA 5HE0A 4O2PA 4F9BA 4O1OA 2JC6A 2UZLA 2J5EA 3BP8A 1H8FA 2R4BA 2B55A 2RF9A 4DE4A 5DWRA 4IH8A 3GXOA 4XV1A 3JXWA 3TJDA 4ZOGA 1JNKA 3VUHA 2IZSA 3UNKA 4M0YA 4IX6A 5EYCA 5BQTA 5E20A 3F6OA 4PDPA 4FEUA 5HVQC 3OTVA 4H05A 2FSMX 3ACJA 3SLSA 3JPVA 4P90A 1RQQA 3PJ2A 4EOQA 5D8LB 2PFBA 4MXXA 4LRJA 5E4HA 5ANIA 5HHWA 3R8MA 1Q8WA 3AG9A 3RNIA 4O0VA 4C02A 4E4XA 4V04A 2X1NA 3F82A 1KE8A 5KE0A 4O7VA 4DCAA 4BDCA 3UZTA 5IDNA 3L8XA 3NSZA 2GIVA 2IVVA 3FKLA 5AV4A 3QWJA 1QBJA 2H96A 2UZUE 2UZKA 3H9FA 3PDTA 4E8AA 5CU4A 2BHHA 3BPVA 5AUTA 3SAYA 2XRNA 3RPVA 5C8MA 4IHPA 3OUKA 3UO5A 2QQ7A 4F63A 1REPC 4BBFA 3LJ0A 4AE9A 3GVAA 4HVDA 2ACXA 4MXCA 4EOIA 3KXNA 3GOPA 3G0EA 4DEEA 5EM8A 3QD4A 4FI1A 2DQLA 4TWCA 3OF0A 5F9EA 3CSVA 2M45A 4KIFA 3F3XA 1T98A 3I60A 3C0GA 4XEYA 3FBVA 1S7AA 2IZTA 2RDPA 3NW6A 4KBCA 1U5QA 3KMWA 4KAOA 1ZGJA 4MHGA 3GGFA 1LNWA 2JIVA 2QURA 5DR9A 5GHVA 2E9NA 4AIJA 4LUEA 2XKPA 5EYKA 4Q9SA 3ALNA 4ZTMA 4I0TA 5A6OA 2XNOA 4RQKA 5AR5A 2WC2A 4AIKA 2W96B 4WUAA 3C5UA 3R83A 3DQXA 3IG7A 3FXQA 4YZMA 4D1SA 4FKVA 1V0PA 4XG9A 3EL8A 4O0RA 1WFCA 3M1SA 4TZRA 3OFMA 1F9NA 2ONLC 5L2IA 3FC1X 1SMYF 1SMHA 3I4PA 5JGBA 1ZYRF 3VAPA 1XCBA 2W99B 1NT2A 4D2WA 1JHFA 4A7CA 2XUBA 2HYYA 4EJUA 1KE7A 4RRVA 5M08A 3R8VA 4HBLA 1YHSA 3W16A 3R0JA 4DGLC 2KKOA 4B6LA 5K0XA 1ZARA 1JBPE 5EOLA 3O7LD 2RL5A 3TG1A 1HQCA 3C4XA 4BDIA 5HO6A 2V6CA 2GZWA 4CQEA 3O8PA 2C5VA 2WB8A 4E5BA 2HGCA 4E7WA 3II5A 1STZA 1YOMA 4QPMA 3VS2A 2ITUA 1PYEA 3L9PA 5DD4A 1FVVA 2UW8A 2YDJA 3HV5A 4LYNA 3WTUC 4GUEA 4FT8A 5AUYA 2EWNA 4QTBA 3ATSA 3DV3A 3QZFA 5HESA 3HAMA 5TKDA 4MD9E 1JE8A 4MF0A 2DUVA 3Q2MA 4RX9A 4RZWA 5K5QA 3FLNC 3UQGA 3LCOA 3U6HA 5DEWA 4FSYA 4A06A 3E8DA 3PVBA 4FG9A 3SXFA 4AGCA 2VE8A 1ZYJA 3AT4A 2MLKA 4BGGA 5KMKA 3FYKX 4CFUA 1YS6A 1Z9XA 3LAPA 2A27A 4F09A 4HPTE 4QD6A 1P2AA 4M13A 5AP1A 2W4OA 4GJ2A 2WMUA 1PW2A 3SA0A 4HGEA 3BHUA 4BR3A 2W1DA 4GV1A 4FL3A 4C3RA 5EM5A 5HX6A 3LM0A 4Y72A 2P5LC 1OI9A 1BJAA 2IW9A 5IQDA 3ROUA 2ZV7A 4RIWB 1LP4A 4GCVA 1ZGAA 3FF5A 2GSFA 5LXMA 1R0PA 3O3KA 3E92A 1L8TA 2XAGA 3HOSA 3EN5A 1FZPB 3Q9VA 4Y8DA 2ZOQA 3HV4A 2M8EA 4R1YA 3OROA 4D55A 3IL2A 3OZ6A 4FV0A 2EV5A 3KVWA 3ET7A 3ORXA 5LCKA 5BOXA 3K69A 5BVDA 1FC3A 2QM3A 1U5TC 3D5XA 2PZRA 2BIYA 3A7FA 4EH5A 3EMGA 3QQHA 2C68A 3C5IA 1YW2A 3AC3A 3PFQA 4O38A 3BV2A 4BI1A 2OLCA 5L3EA 5BNJA 5CEOA 4QMVA 3HSFA 5F20A 5HO8A 3SRVB 2ZDTA 3HDMA 2VX3A 2JKOA 4PRJA 3QRIA 5HBHA 3LLTA 4DTBA 5AV0A 2QOIA 4F1TA 5F64A 1BC7C 5DUKA 2K4JA 3AT2A 4G3GA 4OTGA 1XR1A 1ZMUA 4PY1A 4U3YA 4JBVA 2J6MA 2OA4A 2BE5F 5K4IA 5E8TA 1Z1DA 2MH2A 4FL1A 4EHEA 4BDGA 3ZH8A 1AGWA 4MBJA 1CKPA 4AIHA 3FMRA 5M4FA 2BR1A 1P4WA 4W4XA 3BYVA 3NNVA 2GMXA 4DN5A 4KUMA 1OL5A 3Q9ZA 2G2FA 1T0FA 2IA1A 2BZJA 4JBOA 1PXJA 2WAJA 5HOAA 2Z5UA 4YC6A 3IWZA 5I0BA 2WQBA 2UZEA 2X7OA 4IZ5A 5ICCA 4ZTSA 2BEOA 5M4CA 2WXVA 2BZKB 1Q1HA 4AA5A 3F72A 1OL2A 3ORIA 3R7OA 3RCDA 5FO5A 4CZZA 3PWYA 3O7LB 4HJOA 4QT1A 2LKPA 3QXOA 1KSWA 3ML6A 4GG7A 4HLXA 1YOJA 1PHKA 3I54A 1J59A 1DAWA 3O17A 5E7RA 5FD2A 4IVNA 2OJGA 3Q2JA 4J97A 1Z7UA 4F7JA 1OYYA 1TQIA 4M6YA 3KK8A 4KKEA 4BCNA 4F65A 3ZSHA 3GFEA 3ORTA 4R3PA 1SFEA 5CU0A 1OKYA 4HW0A 5G1XA 3V4GA 3DBDA 4HYIA 5GIOE 3VUTA 2STWA 3F22A 3Q4UA 3SZTA 3OVVA 4L00A 5AV2A 1OMIA 2QU6A 4NSTA 4J96A 3G3ZA 5LARA 3N4VA 4AA4A 4C0TA 4NTSA 4IHTA 3QL8A 1FPUA 1KU9A 2QLZA 4L42A 1QZZA 4IDVA 3VOEA 2ESHA 5FLXK 3ZUUA 4TY1A 3L8SA 4NM7A 3ORZA 3F8CA 4APCA 2YISA 2GHMA 4KS7A 4L68A 1D8KA 4PGGA 4K2RA 3GB2A 2QVSE 2HKOA 1MQBA 2OQGA 4GYIA 2YABA 4EM2A 3GWZA 3VBVA 5DFPA 3R0TA 3HUBA 3ZMUA 3GOKA 1Y91A 2Y7JA 1UCRA 5J87A 1BLXA 3PG3A 2ISZA 4O0YA 4IACA 3ANQA 4G1WA 1XJDA 5JH6A 1AWCA 2X2MA 3G9NA 1HSJA 2XK4A 4YP8A 3W33A 2OZAB 3Q96A 4D9UA 4R8HA 5BMZA 3ZN0A 4DLJA 1G8AA 4DGMA 4MNEB 4TYHA 3R60A 3F7WA 1IXCA 3RJCA 1IXRC 5DUIA 4I09A 2HK5A 2OU7A 4RB0A 1U54B 1R36A 2GFSA 4KKGA 4MNUA 2VU3A 3DP7A 4X3FA 3G6HA 5F1RA 4NM0A 1YS7A 3F8MA 3UZPA 5A2QZ 2JAVA 5JQ5A 1OKZA 2ADUA 2L4MA 2GNIA 3BCEA 3UVQA 5HQ0A 3M42A 3HZTA 5KZ0A 3DV8A 4HGTA 4KIPA 4L6QA 2OF4A 3DJ6A 4Q5HA 3QX2A 3P9JA 3JR1A 3OC1A 3FMQA 3DNDA 2G15A 3PXKA 4UV8A 3MFRA 4Z55A 2VNWA 3J7AO 2UVXA 3ULQB 1E1VA 4KA3A 3CTHA 5DRDA 5AIPA 3LCTA 3HSEA 3FZRA 3W1FA 2C6IA 4HQEA 2I0VA 2VRXA 2OICA 2XNMA 4TWPA 1Z91A 5CI6A
chains in the Genus database with same CATH superfamily
4O5VA 4JR7A 4RQVA 1HBXG 4EOLA 2VJ4A 3TNQB 3ITZA 4BE2A 2R5ZA 2W82A 3OT3A 2NRAC 2VONA 1LJ9A 2RV8A 4D5FA 2W05A 3E5AA 3KA0A 4PX6A 5DG5A 5HD7A 2H94A 5EI2A 3F2RA 2W1GA 1GNGA 4HVGA 1YX5A 4EOJA 3P7NA 4C38A 4RJ7A 3VUGA 4DQ2A 5JKGA 4C2WA 1WH7A 2BCJA 4K9YA 5EG3A 4IB5A 3GNIB 1GIJA 3VS6A 1V1KA 1PXNA 3S4QA 5EZGA 3HSRA 2UUZA 4ENMA 1H9GA 4OTIA 2Z99A 3JY9A 4FX0A 2W9FB 3K3IA 1D1CA 2VO0A 2ZM1A 2R9SA 3W10A 5FKKA 2BW3B 1H1PA 5HDNA 4EUUA 3HOYJ 1M7NA 3T8RA 2PL0A 5LVMA 1FWZA 1SVGA 2X85A 3ZXTA 3I5UA 1HW2A 4LGGA 1IN5A 3KLOA 4XLNF 3U9NA 4ZTHA 1K9AA 3NIZA 3S3IA 2XJ2A 1U9NA 1YO5C 3NEUA 2ELHA 4U7DA 3OP5A 4KA4A 3DKOA 3EHAA 4D4YA 2X9EA 2F5CA 4LG4A 4GT4A 1SD6A 2CGUA 2BY1A 1OIQA 4YPDA 5FGKA 3S1MJ 5DEYA 4FZAB 1T45A 3K9TA 4I2OA 1MRYA 1WMKA 4FTQA 4A3MJ 3ABMH 2WV1A 4N6YA 4D7NA 3L9NA 3HG9A 2ONLA 1ZYDA 1GXQA 3N4TA 2ZDUA 2B9JA 4BQAA 2LGCA 2GFCA 1OUKA 4EORA 3TOBA 1FYLA 4EM0B 1DI9A 3NUSA 3QZGA 1YDTE 4FGRA 1S8NA 2RKHA 4JVGA 3DA6A 3KP6A 4OTDA 4F9AA 2HOEA 5B1BH 4D0XA 5HE2A 5AEPA 2F5EA 4PTEA 1MMGA 3TW6A 3VBWA 5LHIA 3BY6A 1LDJA 2CUZA 1MMDA 3PG1A 4LGWA 3E6CC 3OCSA 3W0RA 3CS9A 2QOKA 1B72B 4UXLA 3HJEA 3E6MA 3VF8A 5E1WA 3MS9A 3DTKA 1SFUA 4V0GB 5D7AA 4MO7A 3NR9A 2R3JA 3ZZWA 1E2XA 3HYHA 4WRSA 1I1GA 5FRMA 4UMQA 1R5HA 4PDYA 1SAUA 1BIAA 3PJ3A 1LFUP 2RKUA 1IXSB 3D7ZA 2IXSA 3ZLXA 1JTYA 4MH7A 5IU2A 2CGXA 5BMMA 3UNGC 3CC7I 4F6UA 2YZLA 3DF8A 4AA0A 4XRSA 1KQ8A 3SKCA 2E35A 1DS5A 3ZHPC 2GQGA 4RJ6A 3L9FA 1XBBA 2AUHA 4OBPA 4G17A 1UU7A 1S3JA 4X2NA 1W84A 3BL9A 3OCTA 2XAFA 3BYSA 2GBYA 4G7HF 2ERZE 5EEGA 3MN2A 4TKSA 5GJGA 1FP2A 4L5IA 5ETAA 1OZ1A 2L01A 1TZDA 5D5VB 1YE9A 3RZOJ 4L9TA 3RCOA 4PGHA 3RWQA 2W4KA 3P1AA 3TW7A 1ON2A 3WTXC 3QYZA 5HNFA 2L02A 3A7HA 2QF7A 4IJPA 1OKRA 4UY8I 1LDKB 1CDKA 2H1KA 4EC8A 3GX4X 3KXHA 4GVJA 3COHA 4E7SA 3K0LA 3RIRA 3OCBA 4QMLA 3ZRLA 1XH7A 4KKHA 4PK4A 4CT1A 5CF5A 5LVOA 4A3DJ 1KA8A 2MC3A 3R8LA 1PMUA 3Q3BA 1QU3A 3QQKA 4LOQA 2IZRA 3ERKA 2W7NA 2W1OA 4ACHA 2HZ4A 5HDGA 2GTNA 3AOXA 5CEMA 2WFYA 5GZAA 2YUSA 4XP2A 3HUCA 1MRVA 1Y57A 3CCUI 5I9ZA 1Y8GA 5EM7A 3QQJA 4BIEA 4DOZA 5AV3A 3PLAE 3C7JA 2GOMA 1W36C 4W4VA 2CN8A 1CTPE 3QPSA 4RBOA 4FJVA 2YN8A 3BHTA 1S72I 1OGYA 3KB7A 3E63A 2OTJI 3NCGA 3MEXA 3S00A 2GQRA 2VJJA 3ZZEA 1XH8A 3R7YA 4P7EA 2EK5A 1JVPP 4GKIA 1TNSA 2R0IA 2M0CA 5FRNA 2UW9A 5BUJA 4QP2A 3EYHA 2PE0A 2CUEA 2ACJA 3SXRA 4BY9E 3P4KA 1J09A 4QMSA 3K10A 4XRFA 3Q04A 1J7UA 5IOYA 1YHVA 3A0HC 4C2TA 1KONA 2C3JA 3FPQA 5LEKA 5FXRA 2YJSA 1XS9A 2CN5A 3KULB 3FZSA 4JIKA 3R01A 3WOWA 4I98B 4CG8A 2EA4A 3TKYA 4AUXA 4I6ZA 1KOBA 3HMPA 4JX5A 1T08B 3ELJA 3S1HA 1J91A 3M9AA 3EN9A 4XKVA 2EILH 3E3BX 5FUTA 4OIQF 4BF2A 1TT0A 1HOMA 2JKKA 4YO6A 3ABTA 3QHRA 2QODA 4E7JA 4C59A 4I41A 4XV9A 2QONA 3ZFMA 4D2SA 3PVUA 3WODF 1MBJA 4Y3OA 4GK2A 2XRWA 4L3JA 3B6CA 5GAEJ 1O3QA 2DOEA 5J8IA 4WX9A 3OS1A 3ZDIA 4JX7A 4AU7A 2QQBA 1U4DA 2VX1A 2A6EF 2IGOA 4QTAA 1U59A 2V9VA 3AG1H 2UVZA 3CPBA 3SW7A 5CPRB 4EYMA 2QOQA 5ANEA 2K3FA 4O6JA 5CZIA 2JRMA 2BVMA 4Q5EA 2L3DA 3AG2H 5I9YA 4BYIA 2NOJB 3GBZA 1U8BA 2EIMH 5IYDJ 3FMEA 4MNFA 1UKIA 2PZPA 2R5YA 2JA2A 2H6BA 3H5AA 2ZMEB 5HLGA 5FLFA 3CP9A 3POOA 1CSNA 5K5OA 3ROCA 1OISA 4E7HA 5M06A 5FLXZ 2ZFUA 2FX0A 2YWPA 4FEWA 3EN6A 2IRFG 2VWZA 2E5ZA 4E6DA 4OW8A 1RR8C 4BKZA 1ETXA 2A3SA 1R3CA 1ETQA 3THBA 4XRJA 4MWHA 1AQ1A 3GQLA 4QYYA 1G6NA 3DTCA 2VWUA 1V0OA 4WXDA 1PXIA 3FL4A 4HW7A 2M0MA 2OW3A 5HGIA 2Y2ZA 2Y48A 3AC2A 1FBSA 1RDQE 1QL6A 1J7LA 4ZAUA 1CF7B 4LG3A 3GZ6A 5DYJA 3ZOSA 1KWPA 4Y33A 4J8MA 3Q6UA 1Y6IA 2WBMA 2WV0A 1LVAA 1Q97A 2B9FA 3E93A 4FZ6A 1U6GA 4FEXA 5FXSA 4WF2A 4QMQA 2R3IA 2HAKA 2KFDA 1MSFC 2WWYA 4BFMA 3R7GA 2FO0A 4IHVA 2O3PA 2DJIA 4ACCA 4Y83A 3ODZX 3JVRA 3CUOA 1I50J 4BAYA 4MQ9F 1Q8YA 3PA5A 1KUTA 2ZSIB 3V5JA 1FMWA 4YG2F 4FNWA 4RWJA 1E17A 4RC4A 2BDWA 2RVCA 5JT2A 1W7PA 3BT9A 5JRSA 3D5LA 4FKUA 1OQYA 3FI4A 2IAIA 3CJNA 1A9UA 4O96A 2DMQA 2O8YA 5A3XA 1SANA 2QG7A 2FBHA 4B44A 4X2FA 2C5OA 3G2BA 2OZOA 5D5UB 1H1WA 2A5YB 2BKKA 3FI8A 4FIHA 4DG0E 3K3JA 5CXZA 2C0TA 3KYCB 2JMWA 5CNNA 3L2QA 4CFMA 2A07F 1OJLA 4HYHA 3Q4ZA 3KYDB 3UGCA 2QR7A 1VYZA 3MW1A 2O5RA 3HRMA 4IAYA 4FV2A 4I22A 3CQZJ 2ISYA 1I6HJ 4BC6A 2WELA 2GU8A 3BKBA 5DDGA 4E7KA 4AD9A 2DW4A 3HKZN 2I1MA 3NS9A 3QPLA 2CFOA 4R77A 3KIOA 5BPIA 2EH3A 3IW6A 4K77A 3WF9A 2RGPA 3O8TA 2E7WA 5CVJA 3EIDA 2EU9A 2WD1A 3OYGA 4A3BJ 2DYRH 4BYYA 4FASD 4D58A 3ULZA 2I0EA 3E1SA 1VQ5I 3P9CA 3T0YA 1Q1VA 4CD0A 4OAZA 4DFNA 1BL6A 3NIEA 3TUCA 4AN9A 2PMIA 3TCPA 5CASA 3IKVA 4IVBA 5H6RA 3RPYA 3BJAA 3LJ1A 1IF1A 2KRCA 4IB1A 3W0PA 1NH3A 5FJ8J 5E8UA 4BBEA 2UWMA 1QPDA 3DDQA 4L7FA 3TV4A 4BVUA 3PFYA 3DT1A 3PP1A 2ITPA 2X0QA 1QZYA 3VUKA 4AOTA 3LLAA 4QDVA 1TBXA 1OUYA 4ZSJA 4CV8A 4K18A 3PL8A 3BPXA 2NNYA 1SYKA 3JSOA 4QMZA 5A6NA 4USDA 1W7PB 4M3BA 3IECA 2XNPA 4ZZOA 5FEQA 3CY2A 1TT5B 2D5VA 4LV5A 3VRYA 3FMNA 4RIYA 1APME 2XCKA 2BRNA 2MABA 4CV9A 4ZJZA 3FMMA 3D5VA 4U97A 1WBWA 3VDXA 1OYWA 3UG1A