4GYIA

Crystal structure of the rio2 kinase-adp/mg2+-phosphoaspartate complex from chaetomium thermophilum
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
341
structure length
338
Chain Sequence
KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIARLRGGSSGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transferase
molecule keywords Rio2 kinase
total genus 106
structure length 338
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gyiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gyiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gyiA02
2BAKA 2ZJWA 2IW5A 2IZTA 4FICA 3CR0A 3TNWA 3ZEWA 3R63A 1TTYA 3JVRA 3J81K 3ABTA 3BHHA 2MC3A 1J7UA 3PXRA 2V55A 2I40A 3Q60A 3RAIA 4IFGA 4RFYA 2PZIA 1OECA 3MESA 5J1WA 1J59A 2FYSA 4G8XA 4JI9A 3WODF 1GY3A 1NVQA 3EHAA 4HVSA 3QXOA 2I6LA 4MXYA 1JWHA 3RDIA 4O7YA 3DAEA 2ZO4A 3QP5A 5CU6A 4ACCA 3PE2A 4CFVA 5LQFA 4YNEA 5HU9A 3WIKA 3R9OA 5J8FA 3NMUF 4X7QA 4TTHB 2O61A 4EH7A 3T8TA 4G5JA 4D2SA 5J9ZA 3PXYA 2BBYA 2ZM3A 3FSFA 3QWJA 2WEIA 3J80Z 1GXPA 4XNEA 2GQQA 4MX9A 4RA4A 3AD5A 4F65A 2QQBA 3F3ZA 3PFQA 3BHVA 4RG0A 3KXMA 1FY7A 3U6HA 3DLSA 4KKGA 4P96A 4DFNA 4PPCA 3C4EA 3NS9A 4TRLA 5HNGA 4ZLYA 2QO9A 3NPCA 3O2PE 1Z5MA 5CVHA 4G3EA 2J50A 1U54B 4RB1A 2UW4A 5J6XA 5IA2A 3TO9A 2OXDA 1PKGA 4IRIA 5CAVA 4BKYA 2O5KA 1O7FA 2W5BA 2YCSA 3ROYA 3R7EA 1M7QA 5LEJA 1Y6BA 2GWRA 4IRGA 4CLJA 5AFVA 4UMPA 1SMYF 1CM8A 2X9EA 4ASEA 2P33A 4HF2A 1RJBA 4KA4A 4MNUA 5D7AA 1M52A 4H39A 2DWBA 3KETA 2XS0A 2WMTA 3A60A 4L45A 3RJCA 3ZXZA 3WIGA 4IHSA 3Q04A 4ZZMA 3HA6A 2ZXJA 3WI6A 3BEGA 4R5YA 2ITWA 5E8XA 2H34A 3EB0A 5DH3A 4PP7A 4IX6A 3TKIA 2WWYA 3LE6A 5HD4A 3BYVA 3LFFA 1HSTA 3PVWA 4AF3A 4WUAA 3Q9SA 1LEBA 2FNAA 3BQCA 2YABA 4QP6A 2W4KA 2WU7A 2DYLA 4HX7A 5CEOA 2NNWB 2PUNA 4L5IA 2WMVA 4JK1X 2YM5A 3KXHA 1MJAA 5EFQA 5FWKK 5HVJA 4YZDA 3DK7A 2WMAA 3ZH8A 3C4ZA 4GXOA 3TIYA 3SG9A 2J2IB 3DNDA 3HAVA 3CTQA 2ERZE 3U55A 2VN9A 4A9TA 4XG9A 2BMCA 2JPBA 3K2ZA 4HV6A 3L00A 4QYFA 3ZM9A 3PVBA 4LGGA 4EOLA 4EHVA 2JSCA 3A8WA 5EG3A 3PLAE 4IM0A 2BZJA 4C57A 4I92A 3MB6A 2IA2A 2CDZA 2OU2A 2FSLX 3BPXA 3ULIA 3VBVA 1Y57A 2FBIA 4WXDA 1PXPA 2RFSA 3TNIA 3LFKA 4M69A 3AT4A 5CT0A 4RPVA 4FTCA 3TNHA 3ZCLA 5IU2A 2GS2A 2CO5A 1TBXA 4LL5A 2HOEA 3QPHA 4L67A 2ZKZA 2Y6MA 1ZGJA 4O21A 4AAAA 4AD9A 2X7OA 4IE9A 2ISZA 5JZNA 1JSUA 2GNLA 4FSMA 3R1SA 1ZMUA 2R3LA 4YTCA 1FGKA 1X3UA 4FV7A 2ITQA 3TUBA 4QYGA 2JEDA 3FY2A 4YZ9A 4PMMA 4XV9A 2LNBA 4PMTA 1NT2A 4EK4A 4RAYA 1YVJA 2NNYA 1R22A 3GX4X 2VBZA 2R7BA 3C9WA 3KXZA 4CZYB 3ALOA 2IW8A 4I6BA 2PMIA 4A0YA 4APPA 2XNNA 3ELKA 3W8LA 4D1SA 4KIFA 5DMZA 2OQGA 2JAVA 4O0SA 5IMEA 1FGIA 4H1MA 3OFMA 1H8FA 4U88A 3BKBA 5T68A 3ELJA 3OEFX 4JBPA 2BALA 3PQKA 1FZPB 4O7WA 3DOGA 3MPAA 2WGJA 4F9CA 2C0IA 3UOJA 3MPTA 5GZ8A 5DLSA 1PP8F 5HX8A 1B1BA 2WC2A 2XCHA 4D0PA 3NZ0A 2XIRA 4EJ7A 2A5YB 2PZRA 5DE2A 3HDMA 3GBZA 2OJ9A 1FOKA 2VTLA 4AZFA 4E8AA 3AD4A 1R39A 4K18A 3HECA 3CQWA 3FZOA 5FXSA 3ML6A 3CGOA 3FL5A 3NUNA 5M56A 5JT2A 1BLXA 3D0EA 4MWHA 4O0WA 4G6LA 3R60A 4GYGA 3UYTA 1F5TA 1MRVA 3FLSA 3KVXA 3KXXA 3I58A 2EB7A 2VOOA 3OTVA 5BX0A 3FMMA 3QTUA 3PVUA 5D5VB 4EVIA 3WZKA 4FMQA 1RE8A 1CMKE 2AC5A 5BPDA 3OT3A 3DTWA 3HV6A 4JBVA 4M12A 4MXZA 4HVHA 2OU7A 3O7LB 3BBWA 4RIWB 4ZJVA 4CZZA 2PWLA 5EW3A 4AUAA 4TW9A 4TYHB 4FV8A 4WG3A 4UV8A 4BY9E 1FPUA 5CSVA 1XN7A 4P9UA 2IZUA 3R7UA 2QG7A 4KD1A 3C50A 4YPSA 5BNJA 3F8BA 1E9HA 3TL8A 5HICA 4AP7A 5I0BA 3OUNB 2PN6A 2B1PA 4U0YA 4GU9A 5JSMA 2Y7JA 4I02A 4EH5A 5ERIA 2BVAA 5FFZA 1YXXA 1VYWA 2G9WA 3HOTA 5FLFA 4QTAA 3MY5A 4WNKA 2G9XA 3CDHA 5AM7A 2QU5A 3RI1A 4QQ5A 3LCOA 2IP2A 4IVDA 3IKAA 3PQJA 1OMIA 5HVKA 3CLOA 4G3FA 3V5WA 3OOGA 4USDA 3ZSGA 3VQUA 2XIXA 2X4ZA 3H30A 4O6LA 4DTAA 4BIBA 4DEEA 4EM2A 2HELA 4G7ZF 3P5KA 5ANIA 2I0YA 3VNTA 4FKJA 5FP5A 2OF4A 3D94A 4ESBA 2ESHA 3WTWC 2WMBA 4QP4A 2X1NA 4PRJA 3C13A 3ZS5A 5CF4A 4QPMA 3B2WA 4AWXB 2VWUA 1NY3A 2J4ZA 4QMWA 3LAUA 4P90A 4U43A 4EBWA 1GVJA 3HNGA 2P4IA 5LMBA 4G9RA 3ZOSA 1REJA 4QOXA 3E8CA 5HESA 4HW7A 4MQ9F 3JYAA 2RNJA 1B9NA 5F4NA 3KFWX 4A5NA 2X8IA 2J0LA 5I9YA 3C0IA 3P7CA 4FNYA 2G2HA 4YTFA 3RM7A 2XP2A 3TDVA 4Y17A 4XUFA 3BZ6A 3MCZA 2JIUA 3Q32A 2ITTA 5C9CA 4HV5A 3F61A 1W5SA 4OTPA 1FPQA 5GJFA 4RGRA 5EM8A 5M4IA 3PJ8A 3V8SA 4Q5HA 4BTMA 3SDJA 3NUAA 2PJPA 4HW0A 2FA5A 1PXOA 4V0GB 4G1WA 1SMTA 4R1HA 2P2IA 3DS6A 5E8SA 1IXCA 3SA0A 2LGCA 4FTIA 2QQ9A 3K1NA 4MYGA 4EJTA 1SMHA 3I7BA 1MJ9A 4IRHA 2UZTA 5EYKA 3F6VA 4W8EA 3HV3A 3VUTA 4H58A 4PF4A 4K0YA 4GIIA 4K6ZA 2MBFA 4LV5A 5D10A 4MVFA 1D3YA 2CPKE 4MH7A 4OAUC 4V04A 2WMRA 4IDVA 2EB3A 4J7BA 4JQEA 4MHGA 3R02A 2OI4X 1TNSA 1H1QA 5I9ZA 2WQBA 1Q62A 2O3FA 1D8KA 4NEUA 1ZYJA 3FMSA 3QZFA 3ERED 4TN6A 2RV8A 2XNEA 3QKKA 2HZ4A 4C36A 4WCGA 3OS3A 3M2WA 2F5CA 3GFWA 2VE8A 4QYYA 4I94A 2QNJA 3DQXA 2V22A 5IH6A 2QBYB 3R1YA 3LFQA 3QOPA 3Q6WA 5ICPA 5E8TA 2JD5A 5DV5A 2C6TA 3H0YA 4UXLA 3HRMA 1U5QA 3W32A 4HYHA 1Q8YA 4XG8A 4ZTHA 4C35A 4RVLA 4KWPA 4BF2A 2C3KA 5L2QA 4F9AA 5FQDC 4X3FB 1YOJA 5E7RA 3HYIA 3FMNA 4CV8A 2JKMA 3F7ZA 5FO5A 5H6RA 3QP6A 3T3UA 4YLJA 5CYIA 5AUUA 2JIIA 4OT6A 4C8BA 4IQ6A 5A4CA 3F6OA 2ISYA 2HY0A 5KE0A 5M53A 3M11A 1G3TA 2H9VA 1HXDA 5E20A 3TT0A 3P4KA 3ZDUA 2DU9A 3FMDA 4L7SA 4M72A 2OW3A 1PJKA 3Q9XA 4EMSA 4ZSJA 5EI2A 3V8JA 1JBPE 5LCJA 4AOTA 1Q41A 4WBOA 2X7GA 5EM5A 2F2UA 2OFVA 3EN5A 4E3CA 2PFBA 3F22A 3TZ9A 1WBVA 3DA6A 3K5UA 1XGOA 3TI1A 2UVXA 5CF8A 3D2IA 2OA4A 1H1PA 4EQCA 3ZUTA 2RL5A 3RYPA 1J2XA 3TO7A 3LSTA 1GZ8A 4I21A 3UIBA 3F82A 2RKHA 1IN8A 5K9IA 5CEMA 5AAEA 1OM1A 5T6KA 2ZDUA 2WHBA 4P5OA 2J6MA 2QG5A 3ZO3A 1QPCA 5BUJA 5CVRA 4DN5A 3P1AA 1KSWA 2H96A 5F9EA 5M57A 3KMMA 2G2IA 2AYPA 4MXOA 2R3SA 4IVNA 4YFKF 2VGPA 3ORKA 2YCFA 4C3RA 4FA2A 2OBPA 3DF8A 5L6OA 3S1HA 5BPYA 2A2AA 3ORXA 3D0SA 3KZZA 1XWSA 4AACA 4WG5A 2FXAA 3EYIA 3JAMK 4BI1A 2DUVA 3LQ3A 2MH9A 3NRVA 3K2LA 5KZIA 1BUHA 5KO1A 4BDHA 5AIRA 1XH8A 4UB7A 4ZLOA 2F9GA 3KN6A 2J0JA 5FTGA 4GH2A 3KK8A 4RRVA 2NP8A 3FXUA 5FG8A 5I9UA 3KCFA 3PLSA 3QA0A 2QU6A 3ZDIA 3O17A 1J7LA 2ITYA 2C69A 4EJOA 4XRLA 3F88A 3ISPA 2WTCA 2JDTA 5LGTA 4WNMA 4F7LA 3KP4A 1HKTA 1ON2A 5LJJA 3RZFA 4QD6A 4ARKA 5CAOA 4GYIA 1QMZA 2YPRA 1WFCA 1BL6A 4IAIA 3HUCA 2R3MA 4AFJA 1CTPE 4CFXA 1BMKA 2K4JA 3VBXA 3I81A 2X39A 4CXFA 4KICA 1OYWA 1CF7A 2O2UA 4J71A 2ZOQA 4L5JA 3PXFA 2F7ZE 3KRRA 3BJ6A 1OI9A 4BI0A 3GEQA 2M45A 3MH2A 4ENYA 3D15A 1SVEA 2P2HA 4AW5A 1WBSA 3BGZA 3ZFYA 5LGUA 4H3QA 1QBJA 4G7HF 1IRGA 3QTQA 3GC7A 4FTKA 1M14A 4MD7E 4RX9A 1SD6A 2K86A 4F9BA 4B4LA 4GKHA 2VWZA 4U42A 1SD7A 3I59A 5KKRC 1S6LA 3O2MA 2XUUA 2YM7A 2C1AA 2FSTX 3GLXA 3F69A 3TJDA 3ROCA 3GU8A 1MRYA 2XK7A 4BTJA 3MBLA 4HCTA 3WU0A 2PMOX 5K5XA 3QXPA 1FC3A 3AMBA 3N4MA 4BCHA 2V6CA 4ANOA 5TKDA 5KNJA 3IG7A 2UUEA 5FP6A 2CNQA 3R9DA 4DH5A 3B8RA 5A4TA 4LM5A 5J9YA 2FBHA 1ZRZA 3AC4A 1H0VA 4O5VA 2ZNZA 2AUHA 1HW2A 5M44A 2GNGA 3OXIA 4M6XA 1URCA 4A6DA 4U80A 4KIGA 4X2FA 2V0DA 1UU9A 1TVOA 2RGVA 3TDWA 3FWEA 2YM4A 4RSSA 4BBMA 3PA3A 2WIPA 1XQZA 1LB2A 2NRYA 3RMFA 3OOMA 5I4NA 2YAKA 3MVJA 3LW0A 1QL6A 4ZY5A 3R00A 4A4XA 4M71A 2WV0A 3H0ZA 1UV5A 5AMNA 2VTPA 4CDGA 5KBRA 4OIQF 2H6BA 2UZWE 1RI7A 4HZFA 4XLPF 3GUDA 3EFLA 3OWLA 5FD5A 2Y48A 3BOQA 2HZIA 2GHGA 4R3CA 5JQ8A 5HE0A 4YZBA 4R77A 1IZ1A 3D83A 4BCKA 1KGSA 2BPMA 1OPCA 5M09A 2OXYA 2FB8A 1YOLA 5AIKA 3FBVA 4IADA 3VJOA 5DT0A 5BYLA 1E17A 1USSA 4FZ6A 2FF4A 5GINE 4MBIA 4BYIA 4CMTA 3DQVC 2YDKA 1JE8A 5HG8A 4DINA 2VNWA 2GHLA 3LFEA 2PMHA 3AMAA 2BRBA 3QZGA 4NCTC 4L00A 3D7TA 1JSVA 1Q8TA 2HZNA 5CAUA 3OT8A 4XCUA 2PVYA 3KP7A 4ZAUA 4BCQA 1R1UA 2VNYA 1YDSE 3LHJA 5TT7A 3QU0A 2CWEA 3LA2A 3R6SA 5HLNA 1DDNA 4HDUA 3ZYAA 3D7ZA 4ALUA 5JRQA 3C7QA 3ORIA 5EI8A 1QPJA 2WIHA 4QMMA 2C6MA 2W1IA 3MVMA 1W4MA 4FIEA 3PZEA 5ED4A 1LDDA 3DDPA 3M8EA 3R4KA 3KZYA 3FMQA 3NUYA 3HSFA 5JH6A 4CZTA 3ACKA 4O3MA 4FSNA 2QVSE 1LDKB 3KKVA 3Q9YA 4FNXA 4JDKA 2PVFA 4PPAA 5CEQA 3NNWA 4NM0A 4MQVA 3U9NA 3PY1A 3U4WA 4AZVA 1JSTA 5HHWA 2WTWA 2JBOA 1RZ4A 2B52A 2XM8A 4PDKA 4Q48A 2B9IA 4L0YB 4RQVA 3OWPA 3KRLA 5J7HA 3HA8A 1HCLA 4MXAA 3IO7A 1ZAOA 3NW5A 4XS2A 3F8NA 3PYYA 4DAWA 5HIEA 2PMLX 4RB2C 5IQGA 4QP1A 1S3JA 4M73A 4F6SA 3DXJF 4IZAA 2IVUA 4FV9A 4JDIA 3EYGA 2VODA 3GC8A 4OGRA 4IHTA 3GXOA 3MFSA 4MBJA 4FSYA 3LMHA 4C33A 1H0MA 4RAZA 4R8HA 4JNWA 4CT1A 2CKPA 3C4FA 3LFSA 2C6EA 2R5TA 4Y72A 3CP9A 3GB2A 3UPXA 3U51A 4CYDA 1AWCA 4XEYA 3MY1A 4M0YA 3R9HA 4U97A 4EHZA 3BEAA 4QQTA 3IOPA 4D0WA 4CSVA 1H08A 5E1EA 2AS5F 1F5QA 3PE1A 4QMTA 3V01A 4X21A 2EFOA 2JFLA 1IG1A 4GT5A 3VF9A 5EK7A 4J97A 4A9UA 4I20A 3V51A 4GO1A 5DN3A 1R7JA 3Q9VA 5CZHA 4EOOA 4RJ4A 3A2CA 3RM6A 4EHEA 2MH2A 4FTAA 3Q3BA 1U5TC 1U5RA 1GZKA 4O7SA 4FKIA 4QMXA 4WIHA 4BGGA 3E88A 4LL0A 4XP2A 2CW0F 4EH2A 3F2AA 4CNHA 2HKXA 4XLIA 3R04A 2QZ8A 2I0EA 4G9YA 2XYNA 4O38A 2UXNA 3TQNA 3I5NA 4WSQA 3RTPA 4E26A 1UCRA 3PSDA 4DGOA 1AD5A 2NNNA 1YKRA 5EQYA 3E97A 1V0OA 5GIPE 4QQJA 4CG9A 3L9FA 4ESJA 4M9ZA 3ZONA 3WBLA 3FQSA 4Q2AA 2PLYA 5E8IA 1FBSA 2QOBA 4FF8A 3NNXA 3HTUA 2J5OA 4E73A 3GQLA 2RC4A 3O8UA 5K1YA 2JITA 4HCUA 1GAGA 1OBGA 3E92A 2VO3A 5AX9A 1ZYLA 4BHPA 4A2UA 4O83A 3GUBA 4LK1F 2PE0A 5H3QA 3RZBA 2H6DA 4MTDA 4M9SA 4FL2A 2YLFA 3F8CA 5AUVA 4PGGA 3DKOA 4GKIA 3GCVA 1ZZLA 2J0MB 4ANBA 3QUEA 2W17A 3Q4CA 3SZTA 2WTDA 2R3JA 1Y0UA 4OINF 4UZDA 4C0TA 4YJTA 1RW8A 4YHFA 3D4QA 4IIRA 2YZLA 3UP7A 1G8SA 2XNPA 4BRXA 2XIZA 3DFAA 1H01A 4IAKA 1YW2A 2PUIA 4P2KA 1O3QA 1H27A 5LVNA 2EA2A 4FTOA 3PSBA 4U7ZA 2XK4A 2OWBA 3SX9A 1R1TA 4HF0A 4DFYA 4GS6A 3JS2A 4ZTNA 3E64A 1REKA 4ZP5A 2XH5A 2VX1A 1P92A 4YUQA 4S34A 3D5XA 4CFFA 3ZSHA 3AGMA 3W2OA 3RTRA 4U3YA 2CFXA 4WWCA 4RS8A 3DTCA 5AM6A 2J9MA 3UVQA 5LHHA 5CXHA 3ET7A 1WVXA 3SXSA 4Y15A 3DBCA 3IKVA 4W9XA 1B38A 3PJ1A 3O7LD 3Q4UA 3F3UA 5IA5A 3CXWA 2QOQA 1H4LA 4E6DA 5A6OA 4Z7GA 4DHFA 2YM3A 4FSTA 5CU0A 2QHMA 4RBLA 3F2RA 3EDPA 3EYHA 3LA3A 3LWFA 2WMSA 3G33A 2PE1A 2B0QA 5TJJA 5D6FA 4ENMA 3FXRA 4DA5A 2QVOA 1YWVA 3ZHPC 5IQAA 1KU9A 5DCMB 2OSCA 2YFXA 4DGNA 2YZAA 4ZH4F 3AC5A 4TNDA 4CYIA 3M8FA 4BKJA 4TY1A 2W5AA 3QKLA 4DT9A 3K1PA 5BVDA 5TF9A 3AGLA 4S30A 5IPJA 2XNGA 3V7RA 4HYUA 3WF7A 1ZOGA 4FKVA 4IB5A 2R3RA 5ETAA 5ILUA 4EKLA 2JDRA 4LRKA 1XDUA 2DBBA 5M51A 1IEPA 5ANEA 4D2TA 4F0GA 5KMJA 3U6JA 2ZMCA 1QPMA 3MH3A 4DC2A 1OKVA 2Z7RA 4EUTA 3MVLA 5BVFA 3MPMA 3CD3A 4A5MA 2Z2WA 4F7JA 4ITHA 3RPQA 4EYMA 2PTKA 5HS7A 2AXLA 2OH0E 4O2ZA 3PPZA 4V05A 4BKZA 2K02A 2DPUA 3G6GA 3BPVA 2G7UA 5A2QK 1PXNA 3OG7A 5LWNA 2UZVA 3HMPA 5GJGA 4S33A 3RPOA 1M2RA 1JAMA 3FMKA 3QUPA 3NUSA 5F20A 2PPQA 5J9LA 1ZZ2A 2P6TA 3E6DA 4NM3A 3IWZA 1PXIA 1TW3A 2GCDA 3VVHA 2X9FA 2WTIA 3NRMA 3BY6A 2OJJA 1GIJA 1BI7A 2W1DA 5IA1A 4HLYA 4H3BA 4NHJA 1WBTA 4PTGA 1EH4A 2W9FB 3Q4ZA 4PV0A 2WPAA 3RGFA 3LCKA 2OBJA 2VC0A 3QRFF 1O7LA 1XBAA 2UW6A 4R78A 1OZ1A 5E8UA 5EOBA 3OBGA 3GWZA 5AJQA 3QTZA 4AG8A 2ITNA 3QTWA 2ZJ2A 3DEUA 3K69A 4NK9A 2BRHA 4HA8A 3P9IA 2UW9A 1VR2A 1BL7A 3P23A 1YWNA 4YO6A 1APME 1G6NA 1NXKA 3MS9A 5H8GA 1T46A 3VFZA 3ZO4A 5EEGA 4G6QA 5AP3A 5AAFA 4MQ1A 3FX3A 4IH8A 4PX6A 4X2KA 3IOKA 4KB8A 4E6AA 3WG9A 3V04A 4LB6B 3NQOA 5D8KB 1M7NA 3ECHA 1P4XA 5E8ZA 3QF9A 3CS9A 2ACXA 4AOJA 1WAKA 4I4EA 4C34A 3DNEA 5CS6A 4QLCU 3P79A 5C8KA 3RNIA 2GA2A 5ILSA 4XP0A 4HYIA 4IM3A 5EW9A 4RX5A 1UU8A 3IGOA 4AXAA 4QMPA 2ETMA 4L44A 3HP5A 1W0XC 4QPSA 2UWMA 4N4SA 5AADA 4M8TA 2M30A 2ITXA 3BPRA 5AIQA 2HCKA 1J91A 4RWKA 2R3IA 3FM5A 1P2AA 2OLCA 5FFXA 2CGVA 5DR9A 4QYHA 2M8EA 4BGQA 1YIOA 4UYAA 3NYNA 5M4CA 4UMUA 2VRXA 4C2VA 3AD6A 4FYOA 2BCJA 3R28A 3DQWA 1BI8A 5L3EA 4OTHA 2L54A 3TO6A 4BDDA 3LFCA 3GGFA 1AQ1A 2WTJA 3LLAA 4IZ5A 1OMWA 3KF4A 3BZ3A 3DFCB 3OF0A 4PMSA 2X2LA 2CKOA 2HEOA 5LMKA 2GAUA 3FYKX 2W99B 4G16A 4HNFA 4AQCA 1PF8A 1LPUA 2A68F 1Q4LA 4FYNA 1OKRA 5E9EA 5IZFA 4PDOA 2W9ZB 4EGYA 3EFKA 5C8NA 5DD8A 4LLGF 2XASA 5H20A 1J1CA 3MIYA 2ZMEB 4UUVA 4YBKA 4LYNA 3CC6A 4AZSA 3VULA 5K0KA 3LXKA 2YCQA 4IVBA 4C4GA 4DH1A 1R00A 5IT9Z 4ZZLA 3DAKA 4RIOA 3DBDA 4AZEA 4B7TA 4B6LA 2GMXA 2OFUA 3KL8A 3IDPA 5CY3A 4XG4A 2WMUA 3I71A 2P0CA 4WKQA 1P6RA 2E7WA 3HV4A 4A4LA 4MAOA 2XEZA 1UVRA 3QQGA 4AT3A 4MTAA 4D9UA 1H0WA 3SV0A 5C4LA 4JRVA 3E7OA 3GF2A 2QKRA 5FGMA 3KU2A 1ZGAA 3MY0A 1MJBA 2X7FA 5CF6A 4U81A 4F9YA 4A9YA 4KIKB 4BR3A 5FEEA 5AX3A 4L9VA 3BYMA 2W4JA 2YIQA 5EHOA 2WB8A 4H3PA 4IFCA 3PPJA 4HVIA 2PBIA 3BBTB 4QPAA 4BCPA 3PXZA 4PNIA 4TV7A 3I59B 1UNHA 4A6EA 4ENJA 4EUUA 3VUMA 1OL5A 4NFNA 2H94A 3NUPA 1B6CB 2HDCA 5A3XA 4ZK5A 1FVRA 1GJOA 5L8LA 4QTEA 4EOJA 1J0RA 4UBAA 3BQRA 4ZSGA 4EH9A 4U40A 4X3FC 3QD0A 3UODA 1XBBA 2PVHA 3OW3A 4MD9E 4ZTRA 3DXQA 2ITPA 4Q4ZF 3DJ6A 2J0KA 5HTCA 3AOXA 3BLQA 4CTCA 3F72A 3ZUUA 4ANNA 5FLXK 2ONLC 3T1BA 3AT3A 1ZY5A 2UZDA 2EFWA 3QL8A 3CUOA 2XYUA 4F99A 3MGYA 2B0LA 3OV8A 4W4XA 3QHRA 4G94A 4U79A 3RKWA 3JY9A 4CZUA 3HHHA 3QRKA 3VS1A 3LQ8A 1ND4A 4DNCA 1O9UA 2B7AA 2C68A 5AUWA 3I60A 1SNXA 5HI2A 1IN4A 3QA8A 1G3WA 1O3TA 2BUJA 1R1VA 3HRFA 4NFMA 3HGKA 3B73A 3SZPA 4AN3A 3FKLA 3F5UA 4FK6A 4PDSA 5CSHA 3QRIA 3RINA 5IH5A 1IASA 4P7EA 2HK5A 4DE4A 3BHTA 3TNPC 1IAHA 1XH4A 5JRSA 5CF5A 4JQ7A 1XO2B 2IRFG 2EV0A 3R0TA 2QWWA 5HLIA 4ZMFA 4B9DA 1BM9A 1L8TA 3BJOA 4PUZA 5I5ZA 3CQUA 4LGWA 4NU1A 3DFGA 1L0OC 2EJRA 2W25A 4CFMA 4RMZA 4QP7A 3H3CA 1FVVA 3J7AO 1CKJA 4PY1A 1PXMA 2V5QA 3RKYA 2YIWA 3QRTA 2YSRA 4A06A 1Q61A 3UNKA 3C1DA 3PSCA 3PJCA 2IT0A 5IQEA 5CX9A 5J95A 3T5XA 2FVDA 3DXNA 2UV2A 4MEXF 4F7NA 3P7NA 4EYJA 4G17A 2XIYA 4FG7A 3HRBA 4ALWA 3G0FA 2VTTA 1PYXA 1TW2A 2PUPA 3BLRA 2QQAA 2FU4A 2PHKA 2F49A 1D5VA 4J96A 2EXMA 4U44A 3RPSA 2QYOA 1OKZA 5AV1A 4LG4A 5I9VA 3IPHA 2GDOA 3LFNA 3GU5A 1K7AA 5DT3A 4HF1A 3KP3A 3P08A 2QLUA 2P8TA 3W33A 4RVMA 5KBQA 5AR8A 4R8QA 4EM0B 3ZFXA 4R79A 4QNAA 2Q2EA 2X2KA 5DG5A 3G90X 5H9BA 2UW0A 5AR7A 3FEGA 5K5NA 4UMQA 2UW7A 2PMNX 3UOHA 2WQOA 2ZM4A 2V79A 2OXXA 3MJ2A 2QCSA 3PJ3A 1R0PA 1MQBA 4RIXB 4L43A 3I79A 2W0JA 3BX5A 2R7IA 1K9AA 4GUBA 3RP9A 1GXQA 3ACJA 2A61A 1LEAA 4XRFA 5CVUA 4LFIA 3RCJA 1YOMA 5DFPA 5AAGA 5HLPA 2VTOA 1NHAA 1O6LA 1BOAA 5KUPA 2BFYA 2P4WA 3ATTA 3LXNA 4F1TA 4UVBA 1M2QA 3RAKA 4R7HA 3P7BA 4EWHA 1ON1A 1FT9A 1LEZA 2YIRA 3F3TA 3QTXA 5AONA 5K5RA 4E5AX 4O0RA 3I0QA 2ESMA 1QGPA 4JL9A 3W16A 4BWPA 3CO7C 2CGWA 4QMNA 2OZUA 2OZAA 5A4QA 3LM5A 1LJ9A 4ONAA 3HYHA 4QMVA 2YJSA 2C30A 2C5OA 3QQJA 2C0TA 2CGPA 4OTQA 4OIPF 3GOKA 3FHRA 3LMGA 4X6QC 5FDPA 3B8QA 4K2EA 2EVAA 5ETIA 3ZC6A 3SXFA 3ROUA 3TZ7A 4BZOA 3WZUA 1Z1DA 2BTRA 2P5KA 3VS0A 1KE9A 2D1HA 4M66A 5IUGA 2EV5A 2C5VA 5IDNA 3KREA 3GU6A 4JJRA 4CV9A 5HU3A 4FEWA 1TQIA 2CKQA 2OIDA 2ZMDA 2LDUA 3E5XA 4O0XA 4MWIA 3HSRA 4GFOA 1WKMA 4UVAA 1BYGA 1S29A 3K5VA 2EU9A 2VT2A 2ZV7A 4RB3C 2YWVA 3GZ6A 1MZBA 1JVPP 3LJ1A 3EN9A 1YQAA 2R3QA 4BDEA 3BROA 3FF5A 3MVHA 4IX3A 5HORA 4WO5A 2HWOA 5HDGA 5HDKA 4W4YA 2XIKA 4YC6A 4MK0A 4FVPA 3E8NA 2F2CB 2CN5A 2J5EA 4E6CA 2UW8A 3D5LA 1ZN2A 2BDWA 4R5SA 1YRPA 2XKCA 4BTKA 5HQ0A 2V7OA 2E1NA 1R78A 3BI6A 1TNTA 4G3GA 3TEIA 3KGAA 2I0VA 1U2WA 2GFSA 1BI0A 1LNWA 4BAYA 3IDCA 3N51A 1J5YA 4NSTA 1BJAA 2QD9A 2YM6A 3QZIA 3KRJA 5CI6A 3Q9ZA 3ORLA 1YWRA 3NYXA 5FD6A 3QC4A 4EL9A 4F08A 4IVCA 5C27A 4OOIA 3LKMA 1E2XA 5L8JA 3R0AA 3F5PA 2XAFA 2EWAA 4JIKA 3M9AA 1MP8A 2BKKA 1YHVA 4ORKA 5JI6A 4YHJA 1ZG5A 2Z5UA 4RX8A 4NIFA 3OY1A 3Q52A 4CGAA 2YEXA 4II5A 4E70A 3PPKA 2CG4A 1OB3A 1HBXG 1BIAA 3R30A 2W85A 5DUKA 2NO3A 5DEQA 5IQIA 2GNFA 2ZV8A 1LR4A 3EN4A 2X4FA 1HKQA 1U6GA 5AR2A 1P4AA 4ZZDA 1ONVA 1T0FA 2VBWA 2X0LA 3WILA 5E91A 2A1AB 5JGDA 1AOYA 2WTVA 4EBVA 3KXGA 2JZYA 4CD0A 4APCA 1OKYA 4I5CA 1I1SA 4HX4A 3LFAA 3C18A 1VZOA 4G3DA 4YP8A 4YURA 3HLLA 1MUOA 2WQEA 1OIQA 3K9TA 4GRBA 3TKYA 3PJ2A 1ZH5A 4C02A 3QQHA 5ANDA 4ITJA 1F9NA 1FBUA 2UZLA 4J1RA 5L2WA 2W84A 2QKWB 2KTYA 3NNVA 3VS4A 4Z2YA 4HYSA 2ZM1A 1IR3A 1FX7A 4FL1A 3BHUA 1FOTA 5AV4A 4MGRA 5LXMA 4XLVA 3ZM4A 2PQ8A 3COKA 1QNTA 3W6KB 3TGNA 2VWBA 4ZY6A 1L3RE 4Q47A 2X2MA 2XIGA 2BHHA 2ETRA 3ZQ7A 2ZB1A 1ULYA 4BWXA 1DPRA 4BICA 4GVJA 2H27A 5F64A 5B2KA 1UHMA 3U9GA 3ORTA 4XYFA 5AUTA 3KF7A 4IVAA 4LGHA 5K4JA 1Y8GA 5CALA 3KP5A 4P4CA 1WVWA 3IW7A 2FGIA 2VAGA 6PAXA 1W8CA 2FA2A 1XSDA 4I0BA 3UQFA 5J1VA 2XRNA 2VO6A 4HBLA 3PVGA 3CKXA 3UQGA 2WOUA 4O2PA 3AQVA 4FVQA 3OC1A 2YX7A 3DKGA 2BFXA 3FMJA 2HXQA 3Q2MA 4BH9A 4MCVA 3WE4A 2Q0OA 5AR3A 2EUFB 3DJ7A 3HEGA 2GSFA 4QMYA 3S3IA 3UOLA 2XKDA 2FO0A 3UIUA 2A69F 3NAYA 4WOVA 2DK8A 3D5UA 3R7OA 2A4LA 4PWNA 1HCKA 4IDTA 4HQMA 4GSBA 4NJ3A 2QI8A 3OP5A 3FWQA 4I0RA 2LKPA 4ZOGA 4QQCA 4P5ZA 3FXQA 4AOIA 4KA3A 4PCQA 1U3EM 2W1GA 3MWMA 5D5WB 2V7AA 3EUHA 3R6XA 4OTFA 4E4XA 1PY5A 3TKUA 2QOFA 1WMKA 5HLGA 3DU8A 3UO4A 1P5EA 2YDJA 1ZLJA 3DP7A 4CCUA 2I1MA 4DGGA 3TV4A 5CLPA 1E1VA 3MJ1A 4O7NA 4XSZF 2C6IA 1MRUA 2W96B 3VF8A 5JFXA 4O7TA 4ZYGA 3WU1B 3U2RA 4E4LA 3NGAA 3UO6A 4EEVA 3ZZWA 4D55A 3F6XA 4FHTA 1ZYSA 3FC1X 3EJ1A 4FTNA 1BN5A 4FEUA 4FX4A 1OVEA 4FL3A 3CQEA 2HAKA 4ANSA 5HE2A 4I0TA 3P9CA 4M7IA 4ERKA 4BCOA 4YGAA 3QTIA 4YMJA 4IZYA 5IKWA 1W7PB 4I09A 2QO7A 5KVRA 3B02A 4F63A 1JKLA 3JXWA 4YG2F 4AS0A 3FZTA 3P0MA 3OVVA 3NYVA 3ZPLA 3BV2A 2JFMA 3QCXA 4HGLA 5LVLA 4G6NA 1H00A 4GEOA 5ETCA 1BX6A 4UY9A 2CHLA 3MI9A 4FZAB 3CEKA 3VO3A 1R36A 4RGJA 3H10A 2ITOA 4GIHA 4NKSA 3A7GA 4O86A 3ULQB 3UQCA 1KYZA 2G2FA 1YHSA 4LUDA 3FLQA 4RC3A 4FUYA 4TWPA 4GU6A 5ILVA 5KZ0A 4LQMA 1H07A 1VEBA 2RFNA 4EK5A 5CYVA 4FEQA 4M9XA 3ATSA 4MTEA 4XG6A 2IZSA 3SC1A 3VB2A 5E1WA 5AA9A 3O50A 2GQGA 1PMUA 4F9WA 4WXHA 3PY0A 3D5WA 3V5JA 4O0TA 3E6CC 3LQQA 2WMWA 3PDTA 4G3CA 3E6BA 4JG8A 2BAJA 2R0IA 3DZOA 4KINA 3TG1A 2ZMEA 5BVOA 4J95A 3E62A 2EFPA 4BI2A 2RGPA 4BB4A 5E18F 4QP9A 4AT5A 4DEIA 2EB2A 3MZHA 1IXSB 4FTRA 3UC3A 4BBEA 4FIFA 2Z7QA 4IM2A 1ZHFA 4AW0A 2PVMA 4Y5QA 3N4VA 4FT9A 4FTMA 2NRUA 2YN8A 3EOCA 3UBDA 5CQWA 4JR7A 4EOSA 2K7LA 4IAAA 1YYVA 1H1RA 4D1ZA 2ETKA 2STTA 3H9RA 2O8YA 1O6KA 4O0YA 2XJ0A 4AVPA 2PVJA 3WGHA 3CY3A 4G2FA 2JDOA 1CKPA 4KSPA 4BQAA 4YFNF 3EQIA 1UWJA 4ASXA 2ZFWA 4I5MA 4B8MA 1SAXA 5IUIA 1BIBA 3BGQA 4LB5A 3DB6A 4BNCA 4UXQA 2VWXA 5IEVA 4FNWA 3GU4A 4HGTA 4JDJA 4J8NA 3WTVC 3AG9A 3SRVA 2GNJA 1Z9CA 4K1BA 3PA4A 1Z6RA 1W7PD 4EH3A 4YJOA 4XBRA 2GHMA 4UWBA 1WWXA 4NUSA 5FD2A 1ZWSA 4BIDA 2WTKC 2Y6OA 1FBNA 3TM0A 2P5VA 5L3DA 2JC6A 3H92A 4HZRA 4EJVA 3QYZA 3ANQA 3I54A 2FNPA 4U0IA 3S0OA 5IA4A 1YW8A 3WYXA 2IPXA 3V8WA 5LWMA 3FZ1A 2PEXA 4EJUA 4AGDA 4D2RA 1PXKA 4BCMA 4L8MA 3T9IA 2C6YA 3KQ7A 5CXZA 3A61A 4TYJA 4OLIA 2RN7A 4FSQA 4ACGA 3QD4A 4YJQA 1OITA 4Z7HA 5L3FA 3KP2A 3A4OX 3L9LA 5DCFA 3FE3A 2BILB 4G9CA 4MD8E 4FGRA 4PDYA 5J87A 4XP3A 2A27A 1W84A 3TZ8A 2YISA 4UZHA 1V1KA 2YCRA 4OMZA 2BE5F 5M4UA 3QQKA 5CU4A 2M1BA 3E3BX 5BVKA 4KKEA 4KFCA 4KS7A 2YIXA 1Z91A 4ZJIA 2ETHA 3FLYA 5I9WA 3REOA 4FSUA 5IMXA 3ZMZA 2WEVA 2EFNA 2A3SA 1JNKA 5D12A 4JS8A 4OTIA 4D4SA 3SAYA 4EZ7A 3OW4A 5KX8A 4L68A 1P14A 5HBJA 3O8TA 4D28A 3HMOA 2W1FA 3BU3A 3W18A 3OUKA 4ZJJA 4PTEA 4R6VA 2BZHB 1OBDA 2PL0A 3R8VA 3UG2A 4KRCA 5DD4A 3G5DA 4P55A 2W1CA 4RGSA 4NM5A 2PU8A 2WTKB 3WGGA 3GFMA 4UXNA 4FOBA 5EHLA 5JFRA 3R22A 5DR6A 5EKOA 2QLQA 4YIFA 3QTSA 1FNNA 5J8CA 4EH4A 1RNLA 1EV7A 3RCDA 4L46A 2QENA 5HOOA 2B55A 3DZQA 1Z6TA 2BYVE 4NQWA 4GK2A 2WQNA 4TZRA 4WK8F 3EQBA 2VTIA 3JSPA 2B53A 1WI9A 4O1PA 1TQMA 1F1ZA 1R1WA 3VUHA 2C4GA 2RF9A 3O3KA 4K33A 4XV3A 2C3IB 3KRWA 5HVYA 2OAZA 1OL7A 1YHWA 3FAAA 4H36A 3ERKA 5TRDA 1K79A 2Z02A 4UV9A 4ANLA 4QO9A 2BR1A 3UVRA 1O3RA 1UWHA 3R61A 1DI8A 3HRCA 3A7IA 4M67A 3I4BA 4O22A 2CJMA 1JQHA 5HLWA 2FEZA 3G9NA 3QAME 2E9VA 4DLJA 1UB9A 3BWJA 3WTZA 4BHBA 1QZYA 3VW6A 4DEGA 4M3QA 3QTRA 4J8MA 3BE2A 4WRGA 2R3GA 4PL5A 4RIXA 5EM6A 1I09A 4F0IA 5IA0A 2OIBA 3COMA 4AFEA 2XVDA 3GNIB 2D1VA 2ONLA 4L01A 2F57A 1ZRCA 3RI4A 1IAJA 5CLSA 2PVKA 4LRJA 3O51A 4OTDA 3IECA 3ZLYA 2RIOA 2GQRA 4EK3A 3U8WA 2XUBA 4GG5A 1QQIA 2FSWA 4YSMA 2J7TA 5AP7A 4DTBA 4A07A 3TN8A 3LZBA 5ACBC 3IONA 3PG1A 4FBXA 2HENA 4U41A 1H28A 2VTRA 3VRYA 1JHHA 4J98A 2VZ6A 3LLTA 2ITZA 5KMNA 3B2TA 4EOKA 3QQLA 2VONA 2DTRA 4LFUA 5CZIA 5DNRA 4U9AA 4UWYA 2HW7A 3NVKI 4OBOA 3QLGA 4OTRA 4ZZOA 1HKSA 2KJBA 2KIMA 3I64A 1U78A 5ETFA 3TXOA 3EN7A 2IVMA 3FMHA 2OJGA 4F0FA 1H9TA 2RSVA 4H1JA 4HZSA 3UTOA 3I53A 2C1BA 3ABUA 2KIUA 4CMUA 4PPBA 5CI7A 4FZFB 4L18B 2B4SB 3ZFMA 1MD0A 2VTNA 4FC0A 2V1DA 4BDCA 1ZREA 4YPDA 4PNKA 4O7ZA 2ZCWA 1G3NA 1KE8A 2JT1A 4YZCA 2K4BA 2XZSA 3BE9A 3EZVA 1KV2A 4KIKA 2CSOA 1A06A 4MEYF 3L1SA 2PZYA 5A14A 2HIWA 2YITA 3FM3A 3C4CA 3KULB 3I0OA 4IB3A 4O27B 3ZUVA 3WF9A 1KUTA 1XGSA 3A8XA 3W10A 1FYLA 3TOAA 4HLXA 3FLNC 2W5HA 4TYEA 4YR8A 5AUXA 5AV0A 4FR4A 5CVJA 3THBA 1JKKA 3TKHA 1S9IA 2IWIA 3ODYX 4ACHA 2XBJA 3NEUA 1G5SA 4YJPA 2Q0BA 3NW7A 2G15A 4ZSLA 5F1ZA 2GS6A 3AT2A 2F4JA 3DKCA 4CGZA 5GZ9A 4XOZA 3TACA 2P7VB 3NUUA 2ADUA 4UMRA 4EK6A 5AR4A 3GCUA 4AA4A 4AWIA 3E3PA 5L3AA 5C03A 3QQUA 2O6GE 1PKDA 2YACA 2XB7A 1GZOA 5L6WL 3WE2A 2W1HA 3DBQA 3CTHA 2XRWA 3RHKA 3KC3A 3HUBA 3GVAA 4GK3A 4GCVA 3DXPA 5CJ9A 3MDYA 2BZKB 3ZXTA 3L8VA 2M87A 1GIHA 4I0AA 1ZARA 3QD2B 4QMOA 2XJ2A 5AIPA 2ERKA 5AP2A 2UVYA 4FIIA 2XGXA 4I4FA 3KRXA 3I5ZA 3ANRA 2UXXA 4XG2A 5JFSA 2XHKA 5KHWA 3VBQA 5HX6A 4AE6A 3C7JA 1O6YA 4KDPA 3DV8A 1KU3A 4WA9A 5E8YA 3WE3A 1WSUA 3PFIA 1T6SA 4AU8A 3GXLA 3FUPA 2XNBA 3G6HA 4R7BA 3RWPA 3GT8A 1V0BA 4D2WA 4CQEA 2BIKB 2ITUA 4Z55A 3NUXA 3O6BB 3OBJA 3O8PA 2ZV9A 1ZG3A 4RLLA 5DYMA 3E8EA 3HP2A 5BVWA 3QU6A 1OUYA 5L8KA 5DEYA 2BRMA 4O7VA 4CCBA 1ZXEA 3ZRKA 3KY2A 2QC6A 4ITIA 5D4SA 3NLBA 5HE3A 1YQJA 4ASNA 4LUEA 4TKSA 5IEXA 4ENXA 3C1XA 2BZIB 2GNHA 3II5A 3WF5A 1A48A 4KBAA 1O57A 2R3OA 3P9JA 3RPVA 5EI6A 2DPDA 3HOSA 5CAPA 2LF8A 5GNKA 4NM7A 1PP7U 2UW5A 4L53A 4TWCA 3JUHA 4FZDB 5DIAA 4ZS0A 4JT3A 1KWPA 4KUJA 2OO8X 4Z16A 4BZDA 3PRIA 4CRSA 3A4PA 1XDSA 4ENKA 2FRHA 4AW1A 5JEBA 4GV1A 1BI2A 4OIRF 4PZJA 5HCZA 2FMYA 3HZTA 3EIDA 1U5TB 1KV1A 1YO5C 2GNIA 5A9UA 2A6HF 2ELHA 5CNNA 3BHYA 4XBFA 5IEYA 1SD4A 4KIBA 4C4EA 3W2CA 4JVGA 1WBWA 4JBOA 5IISA 3M42A 1IW7F 4WUNA 3TNQB 4NYEA 3FMLA 5LVPA 3OEZA 5FBNC 1PYEA 4M84A 4ZMEA 5AP5A 3UNZA 1MDMA 1JHFA 2JKQA 3C5IA 4E5WA 2VX3A 3GP0A 3CD8A 4IJPA 2EA4A 3LPBA 4G31A 1KE5A 4Y46A 3R8UA 4BDKA 3NYOA 3HRTA 4ERWA 4RWIA 2JGZA 4PL3A 4C3FA 2YU3A 1K6OA 3CLYA 2BV6A 2X0GA 4JX7A 3A62A 4I6QA 4M0ZA 2HWPA 5AP1A 3I7CA 1ZRFA 2Z3YA 3WE8A 2QURA 2PK9A 5HIBA 1Z9XA 4DGMA 3GU7A 5E17F 4FEVA 4YNOA 2PVNA 1GHCA 1Q3WA 2DT5A 2VWYA 3WF8A 4FKRA 3E93A 3FLWA 1AGWA 4Z3VA 2JRTA 5D11A 1Q8UA 4YJUA 3TJCA 2R7FA 3UDBA 3H9FA 3JVSA 2W24A 4IC7A 2D2WA 5K5QA 4FNZA 1J75A 3V5TA 4PTCA 2Z7SA 4TPTA 3R73A 4IW0A 3R0JA 5JQ5A 3F3VA 2B9FA 4X2JA 4EGZA 3Q5IA 4L3JA 3F8MA 3R1QA 1YW7A 4KN7X 4BFMA 4WNPA 3IGGA 3QLFA 3L8XA 4U3ZA 5HTBA 4L42A 3UPZA 3P86A 4EJWA 2WKMA 4L9JA 5E8WA 5CT7A 4UVCA 1U59A 3PTGA 2R3KA 2XNOA 5D41A 4KIOA 4LOOA 4Y85A 5D9HA 1XBCA 1ZOEA 5FM3A 4XOYA 5AWMA 3DK3A 3KN5A 2Z60A 3IRRA 1OYIA 5I3RA 3QALE 4WRSA 2XAQA 3W2SA 4V01A 4OIOF 3HV7A 1FWZA 2OH4A 1JKTA 2QM3A 4FG9A 3TCPA 3UMWA 4RFZA 4FIGA 3HMMA 4F70A 3V5PA 4D2PA 5IF1A 5B2MA 3HSEA 4FV4A 3QC9A 3EQPA 1PRYA 3RBWA 1J7KA 2WNTA 4R1VA 4CHUA 3VOEA 1UFMA 4YIIA 3TTJA 4AGWA 4P5QA 3DAJA 2W1ZA 1STCE 5FEQA 5M06A 1OIRA 4OU0A 3UG1A 1BC8C 3OZ6A 3V6RA 4IAYA 2JTVA 3FY0A 1IN5A 2O8XA 4NTTA 3WGIA 3S2PA 4HGEA 3FJQE 3Q4TA 3FHIA 2H8HA 3ZMMA 4HDVA 5H6QA 1BBYA 3KEXA 4XH6A 3RJPA 3ZN1A 1ZMWA 4IB1A 1JLUE 1UNGA 4FKSA 2CQKA 4QMZA 5DR2A 1JOWB 1Q24A 4G6OA 4KYWA 5HNBA 2BGCA 2HTSA 3FMEA 3VS5A 3O23A 3TZMA 5E92A 3WTUC 3ZMVA 3QAHA 4QT1A 2J0IA 3C3WA 2GTNA 4KNBA 2O0YA 2XRUA 3VBYA 3FXXA 5EYDA 4CKJA 3L2CA 3QCQA 4ZYDA 4DG0E 4RIYA 4UV0A 4OUCA 4JOAA 3C51A 2IJMA 4RZWA 3V3VA 1VTNC 1IA9A 4QMLA 4YU2A 3W6JB 3CTJA 3MWUA 5JFWA 4NJDA 1PMVA 5C26A 4EC9A 1FYKA 4MHAA 4ANMA 3POOA 4W9WA 5LOHA 3EQGA 4I41A 4E4NA 3C5UA 4XV2A 5HCXA 3M7GA 3ZBXA 4YZNA 3CIKA 4RJ7A 3FI4A 4IPAA 5LHIA 4NTSA 2VT3A 5ITAA 3I6WA 4HPUE 4AGCA 3PXKA 2KIFA 1H1WA 2L02A 2R9SA 3E8DA 5DI1A 1HSJA 5M08A 4CQGA 4MF0A 5DRDA 3LFBA 3F5XA 4HCVA 4EOQA 1V4RA 4PL4A 3CPCA 3F5GA 2OD5A 5DPVA 5I9XA 3FXWA 2WAJA 5EKNA 3L9MA 3FPMA 3EMGA 5IQDA 4O7LA 3SKCA 1YI6A 1MKMA 5E1ZB 4IC8A 3KLNA 4AX8A 3I6UA 5GZAA 3EQFA 5DEWA 2MA3A 3VWAA 3MZYA 3DLZA 3BLHA 3D9VA 4D2VA 5LCKA 4QRCA 4D58A 4RFMA 4LJZF 1PMEA 4KT5C 4FV0A 1A9UA 1YXVA 4EH8A 5TOZA 2WO6A 4CFWA 4MBLA 4WSYA 4OT5A 4ON0A 1XMAA 4CICA 4ANQA 2P7CB 4AW2A 2DO7A 4D4VA 4ZTQA 2VC1A 2DLLA 5AR5A 3UP2A 4LRMA 2F7XE 4LV8A 4S31A 3QFVA 4N6ZA 3ZU7A 3OCGA 1IN7A 5IT9K 3GFIA 3U9CA 3TDZC 4FI1A 1KU7A 2QUFA 3DGKA 2W57A 3ORNA 3C4XA 4UNOA 2BKZA 3CE3A 2JDVA 4B8LA 3HTSB 4FKWA 4G5PA 3EKKA 2Q8KA 5JGAA 1EH7A 5LMKC 3R7VA 3DCVA 4KS8A 1DM2A 1OL2A 2IVSA 3OTUA 2XAHA 1JPAA 4BHNA 4ZYHA 3MFKA 3HAMA 4MEDA 4IWDA 3KK9A 4FVRA 3EQCA 3KA0A 4FTUA 1P4FA 5DUIA 4I5HA 1DAWA 2QR7A 5JKGA 3QZHA 4E7WA 1UU7A 4AZTA 4FV1A 2HS5A 2XMYA 2A19B 5HVQC 5ICGA 5GJDA 4Q9ZA 4L9IA 4DBXA 3HMIA 1QPDA 1HOWA 2UZNA 2XAJA 2X81A 1CGPA 1XH6A 3BIZA 4AE9A 3BP8A 3IC7A 3GYHX 5BMMA 4IAZA 1BC7C 3Q96A 4U45A 4IZ7A 3BYUA 5HO7A 1XSVA 4UHTA 1T39A 3BGPA 1W7PA 4BCIA 5C01A 4ACMA 4P9FA 4BYYA 3SQNA 3FV8A 4RVTA 1DUXC 4FOCA 4RJ3A 1YXTA 3UMXA 3HVCA 2F5DA 2E2BA 3MFTA 2GZWA 4Q5EA 2R64A 3KLOA 1WCCA 1Y91A 5KKRB 2CGUA 2YA9A 4G7OF 3KP6A 3W1FA 4RC4A 3DPTA 2YLEA 3ZTXA 1YXSA 5FXQA 5ICFA 4NW6A 3F9NA 3SFZA 2VTQA 4E4MA 4OBPA 2C5NA 5E8GA 3ID6C 1SVHA 2L4AA 3R8LA 2QONA 5BVEA 3EL7A 3ZSIA 3ORZA 5DOSA 3COAC 1IA8A 4S32A 3ETAA 5D8LB 4FV2A 4IAFA 3OMVA 3DKWA 3SVVA 4N0SA 3QGWA 4XG3A 3VHKA 4DH3A 5JGBA 4HQEA 1Z7UA 3LVPA 5AV2A 4GCJA 2NYXA 2B54A 4DCEA 4BXUA 1T45A 4BDIA 2QOHA 1BKXA 2ZDTA 4KABA 1FLIA 2DI3A 2BEOA 1YFHA 4UMTA 4OMYA 2R3FA 4U7DA 5EHYA 3EYYA 3ZN0A 3R8PA 5LMAA 2K27A 5M55A 3AC2A 1ZOHA 5E8VA 3QU3A 3U87A 1K78B 3MH0A 4JXFA 3QUDA 5GHVA 4BDBA 4DF3A 1B9MA 1PHKA 4YJNA 1W5TA 4GL9A 4AIHA 3PRFA 4DBNA 1YDTE 4NW5A 2J51A 4Z9LA 1WQ2A 5EYCA 4NL0A 2WZJA 4EORA 2HFHA 4U0WA 5DHJA 2QOLA 4X0MA 3S95A 2WMQA 3UOKA 3KULA 3SG8A 4DEAA 5BVNA 4YC3A 2XROA 3VS7A 3O0GA 4DFLA 3FSKA 2VO0A 3SRVB 3RPYA 1CDKA 4AN2A 3OROA 1IRFA 2VWVA 3BYSA 3NSZA 3JTHA 5H2UA 4FT3A 4D4YA 4LK0F 3A99A 3MA3A 1PMNA 5HCYA 4M97A 3R7IA 5F95A 4GGGA 2O0UA 3NNUA 1QPEA 2WD1A 4A7CA 4EWQA 3PZHA 3MN3A 4I23A 4QWQA 4PP9A 3PIZA 4EOIA 2EWNA 3ZBFA 5HEZA 5HE1A 4FKLA 5JFVA 3HKOA 4F1MA 1EH8A 3RNYA 2R4BA 4H05A 5AP0A 2QR8A 1ZMVA 4N6YA 2BROA 4C7TA 3S2WA 4W8DA 2GIVA 3G73A 1XR1A 1YI4A 3PP1A 2F5FA 3IKTA 4WHZA 5B0XA 3DT1A 3O96A 1NW1A 1G3SA 2VTSA 4MNEB 4L3PA 1T38A 4BDAA 5G1XA 1I44A 2BIYA 3V7CA 2VOPA 3C0HA 3R21A 1XSXA 4FKGA 3VHEA 3ZMUA 4K11A 4BHCA 1FP1D 4IX5A 1S8NA 4EZ3A 4AA5A 1IN6A 1LDJA 5A54A 1S9JA 5LRSA 4EV0A 4DLIA 2HWVA 3AAFA 1FSHA 3CUQB 4YFXF 3TUCA 4ASDA 3KCCA 3NDMA 4FGBA 5A2QZ 4TWNA 4BBFA 1KYWA 3DV3A 3QWKA 4FTJA 5A4EA 2BDJA 4O91A 1ZYCA 2OJIA 2XNMA 4ZLZA 1UNLA 2IA0A 3CTAA 4GMYA 3T8OA 4I5PA 1ZYDA 1O3SA 3RPRA 2C5YA 5B2LA 1Q97A 4RJ6A 3VUIA 2H6CA 3GEZA 5EDQA 3SHFA 2VX0A 5EOLA 3L8SA 3MQ0A 3MAJA 3FZSA 5IQBA 3DBEA 4NB5A 4LLLA 2GPHA 2XEYA 3G9LX 4RA5A 5EH0A 4CFNA 2G1TA 4X6RA 3TV7A 4CXAA 3NCZA 2PY3A 3NW6A 5C8MA 4J53A 3RIRA 1W7HA 3IDBA 4GT4A 1XHAA 5KMKA 4EQQA 4ACDA 2X6DA 2VD5A 4XG7A 3ZEPA 2YIYA 5BQ0A 3FLZA 4MXXA 3HRUA 2F7EE 4K8AA 3WTSC 3VUDA 1WZYA 1R0EA 4I1ZA 4LLNA 1PXJA 3CJGA 4FE2A 3GCPA 4DG3E 4TWOA 3G15A 3FI8A 3UC4A 5FM2A 2ITVA 4YZMA 3T0YA 2HXLA 1LP4A 4C4FA 4BCFA 5J8IA 3BWFA 2FQ3A 3JR1A 3FZRA 2YR2A 4BHZA 3Q53A 2CN8A 3P7AA 4FTQA 3BV3A 1PDNC 5FEDA 5LVOA 3FZPA 4PGHA 5L2SA 1SD5A 2UZBA 1XGMA 3FXZA 4Q9SA 3UYSA 3ZRLA 1KQ9A 3TIZA 4QP8A 4DH7A 2AC3A 3TOBA 3F3WA 3MSSA 4KBKA 5CNOA 2HTJA 3KE2A 3BU6A 3I5UA 5EEHA 2Z33A 1YS7A 3QRUA 2EV6A 1F0QA 5BUEA 3EFJA 2XKEA 2A0CX 5D5XB 4O0VA 2C6KA 2IVTA 3DKFA 4QTDA 3SLSA 3EETA 4I98B 4EK8A 2OG8A 2HYYA 2ZVAA 3R7GA 3VJNA 3E3VA 5ANGA 2ESNA 2YM8A 2JKOA 5A4LA 3DK6A 3HL7A 3V5QA 5A46A 1HQCA 1STZA 3VODA 4IXPA 4EM1A 4C59A 5EDPA 5JHUA 3OD6X 2WTEA 1FQ1B 4EJNA 3SD0A 1I27A 3ITZA 2C3LA 4F6WA 4MF1A 4EI4A 3S00A 1H9GA 4Y8DA 1KQ8A 3T9TA 4ETSA 4ZEGA 4RT7A 2CYYA 2P55A 5CSPA 1SNUA 4BCNA 1ODDA 1YLFA 4CRLA 4J99A 4QTCA 5KMIA 2FBKA 2EFQA 2J5FA 3NVMB 5KHXA 4O96A 4DQ2A 4EC8A 1FVTA 2CNVA 2D45A 3MV5A 4IWOA 4GT3A 1DI9A 3OWKA 2X6EA 1L3LA 3E5AA 2UW3A 4NCTA 4X3JA 1WBPA 1LUFA 3LXPA 5C4KA 4DG2E 4JBAA 5ANKA 1V3FA 5D4RA 4KUMA 5L2IA 4ZXTA 5LARA 2CSNA 3T3VA 1OUKA 3FC2A 4AN9A 3VS6A 2XAGA 3J80K 5CEIA 4GJ3A 2YAAA 3HUGA 1Q5KA 4BCGA 3PXQA 4FTLA 2HYFA 4EONA 2EK5A 4D0XA 1MQ4A 4FZ7A 3ZLWA 2FUMA 1Y8YA 1Z57A 3RKXA 3BDDA 2YWPA 4JX3A 1ERKA 4X2NA 3W55A 4G6DA 3VS3A 2R0UA 3K0LA 3GCSA 1KA8A 3IS5A 4H0EA 1S7OA 3LJ0A 3V8TA 2DQLA 3NWWA 1CF7B 3IW5A 3MA6A 2UZUE 3P9KA 4WXCA 1G3YA 1W83A 1XH9A 4B8XA 4KAOA 4O6EA 3GFEA 2Y4IB 5C1QB 3RVGA 2XVCA 3FKNA 4DH8A 4OAVB 4DFUA 3QQFA 4TYGA 2TDXA 1YG2A 3ENHA 4OW8A 2XK6A 3ENMA 3BCEA 4IX4A 1B4AA 2A6EF 4FODA 4IANA 1P2FA 4HNIA 1ZYRF 2PULA 5ANOA 5L6PA 4IB0A 4S2ZA 4YC8A 3MYGA 2PVLA 4XX9A 3HRSA 3VN9A 3TDUC 3GOPA 4LG0A 2Z99A 1OIYA 3RHXA 2F5EA 3UZRA 3L9NA 4RQKA 4WNOA 4HJOA 1YXUA 2YJRA 1LEWA 5KK1A 4FT8A 2EXEA 5EDRA 4KNYA 5CU3A 2E9NA 3GFLA 4ASZA 2CCIA 2Q83A 4ZZNA 4U6RA 4DFXE 4KKHA 2XK3A 3F8FA 4FV5A 5CVVA 1T2KA 4ALVA 4ZSEA 3N9XA 3VRZA 2JLDA 4RC2A 2FH9A 2VU3A 5L4QA 2E7XA 2YX4A 4IEBA 3H9OA 3ORMA 2GFCA 5LVMA 1IAWA 2G01A 2R3NA 4EKKA 4DYMA 3BELA 4NZWB 4DFZE 1KE7A 4LOQA 4OTGA 4RIYB 1FINA 3ZMTA 4CVAA 1CKIA 2IW9A 1U54A 4F1OA 5CQUA 4AGUA 5BQTA 3ORPA 2OZOA 2C6DA 1M17A 4MQ2A 2ACJA 3UJGA 3F23A 2V62A 2VBYA 4TYIA 4A12A 5CEKA 1TQPA 2XKFA 3FMRA 3IK3A 5K3YA 2Y4IC 4YBJA 5AP4A 1XH5A 4NIFB 2VN2A 4E93A 1EH6A 4EZ5A 4L0ZB 3KEQA 1OPLA 3SQQA 4R7IA 1SFXA 5E1SA 1K2PA 2QOOA 3NIEA 3L9PA 3KCKA 5DWRA 2GA1A 5DDGA 4N0BA 2L4MA 5BS6A 2P3GX 5BMZA 1Q99A 2UZOA 4QYEA 2HZ0A 4KBCA 3VUKA 1XD7A 2GS7A 3ZP5A 3QX4A 5HLHA 2C47A 2V1XA 3U54A 4D9TA 5KCVA 4IJ9A 5AEPA 2ZBKA 2VTAA 2DW4A 1M2PA 3PY3A 3REPA 3SHEA 3DPKA 2GXBA 4S05A 3COIA 2VV9A 2OIQA 4D1XA 4HPTE 3K3IA 2NPQA 4C4IA 2NAZA 2QLZA 4AT4A 2WQMA 3NCGA 1KU2A 3IQ7A 3VEPA 2Y0AA 2HYGD 2DK5A 2DQRA 1U4DA 1Q8ZA 4U7BA 2NS0A 4HVDA 3D14A 1MDMB 1V0PA 1WBOA 1MGTA 3VQHA 5J5SA 1VYZA 5HOAA 4I3ZA 5LGNA 3HX4A 4QNYA 4XV1A 1C0WA 3BJAA 1ZLKA 3N4TA 5IG1A 5DVRA 2UVZA 4C4HA 3EH9A 3QYWA 5F94A 4RJ5A 3KFAA 4AIJA 5FLXZ 2KRFA 2C5XA 1KOBA 4R3RA 3VC4A 5JMSA 1W98A 1UKIA 2G7HA 4L7FA 3TUDA 3W2PA 2OQRA 3EWHA 4C38A 4CO8A 3Q6UA 1DS5A 4FK3A 4N9HA 1RUNA 3F66A 4A4OA 4JDHA 4I6HA 3WTTC 2O64A 5DT4A 4M68A 4FKQA 2W1EA 3RPUA 2QQ7A 1REPC 4OBQA 3EKNA 1TKIA 2XKPA 2KULA 5HZNA 4RJ8A 1OR7A 2BHEA 3RYRA 5IT3A 5TO8A 2BDFA 2MLGA 2VGOA 3AC3A 1QZZA 5HKMA 2W05A 3JPVA 2WOTA 3VUGA 3SW7A 4NKAA 5JZJA 4N57A 5CENA 4I2OA 5DRBA 3D5VA 2RG5A 4GJ2A 4E1ZA 2PUUA 5HBHA 1NVSA 2QO2A 1GOLA 4TT7A 2V9VA 3LCSA 1SZMA 5CSWA 2QODA 1J1BA 3FZVA 3OCTA 5FB2A 4QTBA 2FSMX 3CCNA 3E5UA 3V7SA 4CG8A 5TE0A 4D4RA 1SFUA 5LEKA 5D7VA 3UGCA 3SXRA 4GG7A 4BIEA 5HS8A 3RWQA 3SXYA 3UIXA 5IQHA 2E9OA 5FDXA 3EL8A 2JKKA 3S4QA 4CMOA 4GFGA 3TV6A 4JAIA 2CMWA 4K2RA 2B9HA 3UZTA 3SGCA 5CANA 4QMUA 3LIJA 3W2QA 5M07A 4FV6A 3CJNA 1UHWA 2B9JA 2RKUA 4GVAA 2RFDA 3K54A 3FHZA 3GC9A 4Y13A 4RIWA 2DS1A 3Q9WA 2COMA 4RB0A 1K78A 2HY81 3HMNA 2YHVA 2HKOA 5KMMA 2VTHA 3FQEA 1WVYA 4CTBA 4IJAA 3V4GA 4FV3A 3UNJA 4FSWA 5LBQA 1XCVA 4C4JA 4BDFA 4UN0C 3RK7A 4RWJA 3CGFA 3AC1A 4LD5A 3LQRA 2QOCA 5ICEA 2Z9OA 2FOKA 4B0GA 2R3PA 3C0GA 2HQRA 3H3UA 4U5JA 4K9YA 4BCJA 1FMOE 4B99A 1U8RA 3MIAA 1BI3A 1SM2A 1Q3DA 2JIVA 5D1JA 5TR6A 3QRJA 4DEHA 3F3XA 3UE4A 4EH6A 3SOCA 2ZB0A 3LM0A 5EQEA 5DGZA 3R7YA 4YLLA 4R1YA 3VBWA 3CKWA 3T8RA 4O6JA 4TYHA 4F7SA 1UKHA 4CKIA 3LJ2A 3OCBA 4CKRA 3PWYA 3ZO2A 3DPLC 4JG7A 4JAJA 3MB7A 1A04A 5F6FA 2GXGA 3JW4A 3WYYA 4J52A 1DAYA 4O1OA 5CAQA 3TTIA 2XBAA 1G4DA 2HGCA 3C4WA 5CVGA 5AV3A 4KIPA 5GIOE 4M14A 4DCAA 3U6IA 4MNEA 3QGYA 3LQ5A 4YTHA 2CLXA 3RK9A 1USTA 3VIDA 4RGXA 4ESFA 3POZA 3EQHA 1IRKA 2XK8A 3WZDA 4EQMA 3E63A 5FTOA 5DCMA 5CTPA 4O84A 3QCYA 2Y9QA 2STWA 2MLKA 1D8JA 1J9IA 2E9UA 2PZ5A 5FBOA 4IACA 3GCQA 5BUIA 1OL1A 5ICCA 5H8BA 2FSOX 4O7RA 3WZEA 3GQIA 2QHNA 4XRJA 5IH4A 3QPTA 2YERA 3R1NA 4C58A 5K5OA 3CJFA 3L7WA 4UEUA 1OL6A 1OKWA 2KJCA 3UIMA 5HO6A 4FX3A 2XF0A 2I7QA 5FTQA 2IZRA 2EXCX 4E6QA 2C0OA 1TLHB 4I24A 5HD7A 5D5UB 5E4HA 4DTKA 1FMKA 3DY7A 5AA8A 4AIKA 2QOIA 5KMOA 1Y6AA 1ZY4A 4FSRA 4UALA 4I01A 3QHWA 3JTGA 4TNBA 2VUWA 3LCDA 1IUYA 3GO5A 2X8DA 3G51A 3UVPA 2WMXA 3R2YA 3LFDA 3FKOA 2OGVA 1JGSA 3F2NA 3Q5ZA 2NRAC 5JK3A 5M4FA 4FX0A 4I93A 4YO4A 1XB4A 2ZAZA 3A7JA 5HG9A 2J90A 4AA0A 4L9NA 5IA3A 2OJFE 4JQFA 2RVCA 3F7WA 4KRDA 4GK4A 2WXVA 4NWMA 3WF6A 3GZ5A 1XKKA 2PE2A 3DBFA 4LMUA 4A9RA 4GW8A 5AP6A 1LQ1A 3CBLA 5H8EA 4FIJA 5LHGA 5CVFA 4FSZA 4XMOA 4IWPA 4ENNA 3OXZA 2HQNA 4Y83A 2W7XA 3KXNA 4I0SA 1XMKA 1OPJA 4DFBA 1KOAA 3V6SA 4USEA 4IHPA 5CEPA 4FT7A 2GTMA 1XH7A 4CT2A 5BOXA 3FQHA 4HOBA 4PDPA 4MXCA 5D6EA 1VJYA 2XJ1A 1H24A 3L09A 3H4JA 5CVIA 5DBXA 2CGXA 1WRJA 4E20A 4U0VA 3R9NA 1P4WA 3GFJA 2RDPA 3GW2A 3RAWA 1XJDA 3KMUA 2JAMA 4M69B 3IWFA 5L3BA 2PYWA 5LRRA 4D5HA 4CFUA 3R01A 5G6VA 4FKPA 4C62A 3UO5A 2SRCA 2Q0NA 3MW1A 4RWLA 3IW4A 4OR5A 2Y0MA 4BL1A 3BRBA 5KMLA 5IQFA 3ZMSA 2CCHA 4YJRA 2RFEA 4Y5HA 2O3PA 1LVAA 4F09A 3HDNA 2O63A 5E90A 4JRNA 4M6YA 3AMYA 2YDIA 3IRQA 2KKOA 4GFMA 3H3ZA 4YTIA 1R23A 3JAMZ 2VWWA 3P78A 1R5HA 3PA5A 4TL0A 2Z7LA 3IL2A 2JDSA 5BMSA 4DT8A 4I22A 4FUXA 2ZNYA 4JIAA 4BDGA 2VXZA 4UYNA 2WELA 2GU8A 3LCTA 1OYYA 3I4PA 1OIUA 5ACKA 4FG8A 2PG4A 3LMIA 1U46A 4A9SA 5J79A 2P5LC 2XKOA 3LAJA 2XA4A 2VTJA 2L01A 2I0HA 3I0TA 3ULZA 4A0XA 3O71A 4DEDA 4BC6A 2XCKA 1URWA 3NEWA 5ANJA 1B6AA 3IW8A 1J7IA 3R71A 1Q8WA 2E9PA 3BU5A 1HW1A 3NAXA 2IA1A 3ZZEA 4LMYA 5HGIA 5EM7A 3R2BA 5HG7A 4KIQA 4W4WA 3ZO1A 2W06A 4BGHA 1PUEE 3W2RA 3M1SA 4N70A 3E87A 5J7BA 1YS6A 5LLQA 4XLNF 4DGLC 1IXRC 3ZC5A 4R3PA 5HNIX 5EYMA 1SVGA 2W4OA 1ZLTA 4RLKA 2JBPA 3CUQC 2UZEA 2R3HA 2P6SA 4NH1A 4MNFA 2PSQA 4HVGA 4F64A 1GIIA 2IJLA 4TXCA 2WU6A 3LAPA 4C3PA 4Y95A 3E7VA 4WX9A 3L8PA 2R7DA 4IWQA 3IHUA 3MH1A 1FSEA 3E5QA 3GC0A 4HOKA 3MEXA 3EFWA 4HGSA 4JLCA 3ZLSA 5L2TA 3PWDA 5FGKA 3QCSA 2IVVA 4L3LA 3CO6C 5A6NA 4QMQA 4C37A 2VWIA 4K77A 5BYYA 1B39A 4BDJA 5HG5A 1JKSA 5HDNA 1YW9A 4LGDA 3FYJX 2WFYA 3JY0A 3UZPA 3IW6A 2JPCA 3OOPA 4N9IA 2C6OA 1RUOA 5CSXA 2QOKA 3G0EA 1KQ0A 1DPUA 4AZWA 3EZRA 3DDQA 3R8MA 4ZTSA 2XV4S 2FE3A 2MD5A 2IO6A 3PIYA 3KVWA 2GQSA 4WF2A 2LF7A 1RDQE 3RK5A 5IQCA 4JR3A 4RVKA 2J5PA 2HOGA 1IF1A 4EQUA 1R58A 4ZYEA 1S7AA 1W82A 1UA2A 3RAHA 1NA7A 2E1CA 1PW2A 5BYZA 2VE9A 1X8BA 4WD5A 4DEBA 5L3GA 4PMPA 4BN1A 2Y8OA 4YSJA 3CUQA 2Z8CA 1F4KA 2IW6A 4BTFA 1B59A 2BTSA 3OHTA 4OTWA 3DJ5A 5BPIA 3R9RA 3HIFA 4M74A 3ZLXA 4YJVA 3A7HA 2BRNA 4F4PA 2O65A 3KMWA 4F7ZA 3SW4A 1KE6A 1QO0D 4Y73A 5JN2A 4IMYA 1I6XA 3N97A 3ALNA 3GENA 3ODZX 3WARA 4UWCA 4HYEA 1DP7P 3OCSA 4LMNA 4S04A 4KMUX 4UX9A 2PI0A 5IDPA 4FKOA 3FI3A 5K0XA 4ZY4A 3U4UA 5DYJA 1F3MC 2PMUA 1R3CA 1PXLA 3FL4A 1H26A 3WTXC 3QX2A 4HX8A 2PZPA 3CSVA 3R83A 1YI3A 3WTYC 3CY2A 2IN6A 1ZG1A 2RG6A 5I3OA 4O0UA 2F2EA 2CKEA 5IUHA 5K4IA 5FUTA 1WBNA 3K1MA 3VAPA 3RALA 4YLKA 1I5ZA 4V0GA 3VBTA 5AUYA 4ZIMA 4IF4A 1Q1HA 4L52A 2X8EA 5E1XA 2HZTA 5DA3A 1QCFA 5JVTA 3G2FA 5HO8A 3FPQA 2V1UA 5EW8A 2L3DA 1XCBA 2BRGA 3PUPA 3HV5A 4ZS4A 3RKBA 4FKTA 5F1RA 2OK1A 4O82A 3NIZA 2LAVA 3EQLF 4IBMA 1FP2A 3PP0A 1CSNA 2HW6A 4FIHA 4A0ZA 1T98A 4FKUA 4QMSA 2OZ6A 2C3JA 3JSOA 5B7VA 4L9TA 1GZNA 4XBUA 4GUEA 3OWJA 5HBEA 3D7TB 4WG4A 4WBBB 3R8ZA 1JXSA 2REIA 2X4HA 4EOMA 3KEOA 4FT0A 4BYJA 4U8ZA 3NR9A 4KSQA 3EN6A 4F6UA 3PG3A 2DAOA 4M15A 4QP3A 4BVUA 3MFUA 3EQRA 2VBXA 2QBYA 4CYJA 4WT6A 2CNUA 1FBQA 3LA7A 3AXWA 4KN4X 3NX8A 3GI3A 3QBNA 2RQPA 2Y4PA 3BYOA 3I1AA 5L3CA 4XJ0A 1NVRA 2O03A 3PIXA 1RIOH 1OGUA 3Q2JA 4CLIA 4FTTA 1ATPE 4M13A 4LOPA 4X3FA 1ZRDA 1HW5A 3LXLA 3HHGA 3FDNA 3W8QA 3V5LA 2ZV2A 3U1DA 1FYMA 4BWKA 4EHGA 4CEGA 1BI1A 4ZSAA 2OF2A 3OXTA 2VO7A 2M5WA 5HIDA 2DQ7X 1H1SA 1RQQA 5AUZA 5CWZA 1YTYA 4D5KA 3COHA 3V8LA 3N4UA 4I7HA 4G34A 3VW8A 2PVRA 5JR3A 4YHTA 4O81A 4NT4A 4XHKB 1U5TA 1P4OA 4I6FA 2DFIA 4XSXF 1I1GA 3E6MA 4DITA 3ECOA 4USFA 1YDRE 1UU3A 3A7FA 4EOPA 2HR3A 1G8AA 3KB7A 5FRIA 4PQNA 1J3HA 3F21A 3FI2A 4C61A 3ZMDA 3DB8A 4JBQA 3CPBA 5J5TA 2OZAB 4LI5A 2OICA 3V8KA 2LSOA 4KMFA 2IPQX 4FT5A 3TWJA 3Q5FA 1K3AA 3SOAA 3K3JA 5HTIA 3J81Z 1E1XA 4ZTMA 4BZNA 1OPKA 3BWGA 2Y75A 3MTLA 5CU2A 2CLQA 1H25A 4RZVA 3D2KA 3WZJA 2ZYBA 3G3ZA 2XM9A 4JQ8A 3GVUA 4MKCA 2H09A 2UZKA 2BAQA 4C2WA 4IXAA 4ID7A 4B09A 4JG6A 2FMLA 4W4VA 2IG7A 4YJSA 3QD3A 4QP2A 4L6QA 2OKRA 4FEXA 1GNGA 4Q5SF 1Z05A 4RX7A 3EQDA 5FXRA 5HS9A 1SYKA 3VS2A 4ZTLA 2A07F 2XK9A 3AC8A 2VTMA 3MFRA 5CASA 3ZRMA 3QKMA 2C6LA 1SFEA 1R5GA 2R2PA 4X2GA 5T3QA 5EQPA 3OY3A 4HAMA 1XGNA 3WOWA 3MTFA 3M1EA 4E5BA 4LG0B 4RGUA 3LOKA
chains in the Genus database with same CATH superfamily
2BAKA 2ZJWA 2IW5A 2IZTA 5EJCA 4FICA 3CR0A 3TNWA 3ZEWA 3R63A 1TTYA 3JVRA 3RCOA 4BACA 3J81K 3ABTA 3BHHA 2MC3A 2DDAA 4AVZA 1J7UA 2DA7A 3PXRA 2V55A 2I40A 3Q60A 3RAIA 4IFGA 4RFYA 2PZIA 1OECA 3MESA 5J1WA 2VKVA 3BG3A 1J59A 2FYSA 4G8XA 4JI9A 3VONA 3WODF 1GY3A 1U9NA 1SC7A 1NVQA 3EHAA 4HVSA 3QXOA 2I6LA 4MXYA 1JWHA 3RDIA 2BW3A 4O7YA 3DAEA 3TBIA 2ZO4A 3QP5A 5CU6A 4ACCA 3PE2A 3BZKA 2ZJQF 4CFVA 2IGNA 4E7JA 5LQFA 4YNEA 2CQ7A 5HU9A 3WIKA 3R9OA 5J8FA 3NMUF 4X7QA 3D1NI 4TTHB 2O61A 4EH7A 3T8TA 2GM4A 4G5JA 4Y7NJ 4D2SA 5J9ZA 3PXYA 2BBYA 2ZM3A 3FSFA 3QWJA 2WEIA 1QPIA 3J80Z 1GXPA 4XNEA 2GQQA 4MX9A 4RA4A 3AD5A 4F65A 2QQBA 3F3ZA 3PFQA 1WH7A 1LFPA 2OJED 3BHVA 4RG0A 5J4VA 3KXMA 1FY7A 3U6HA 3DLSA 2ELKA 4KKGA 5HLTA 1X3ZB 4P96A 1SVLA 1W0TA 4DFNA 4PPCA 3C4EA 3NS9A 4TRLA 5HNGA 4ZLYA 2QO9A 3HOYJ 1DU6A 3NPCA 3O2PE 1Z5MA 5CVHA 4G3EA 2J50A 5HODA 2IS4A 1U54B 4RB1A 2UW4A 1WJFA 5J6XA 4IOCF 5IA2A 3TO9A 2OXDA 1PKGA 4IRIA 5CAVA 4BKYA 2VLAA 2O5KA 1O7FA 2W5BA 2YCSA 2ICWG 2NVTJ 3ROYA 3R7EA 1M7QA 5LEJA 1Y6BA 1TWCJ 2GWRA 4IRGA 4CLJA 3S1MJ 5AFVA 4UMPA 1SMYF 2XDVA 5B5EC 1CM8A 2X9EA 4ASEA 2P33A 4HF2A 1RJBA 4KA4A 4MNUA 5D7AA 1M52A 4H39A 3K4MA 4MO7A 2DWBA 3KETA 1I6HJ 2XS0A 2WMTA 3A60A 4L45A 3RJCA 3ZXZA 3WIGA 4IHSA 4OAYA 3Q04A 4ZZMA 4F78A 3HA6A 2ZXJA 1S72I 3WI6A 4BXXJ 3BEGA 4R5YA 2ITWA 5E8XA 2H34A 3EB0A 5DH3A 4PP7A 4IX6A 3OYIA 1NK2P 3TKIA 2WWYA 3LE6A 5HD4A 3BYVA 3LFFA 1HSTA 3PVWA 4AF3A 4WUAA 3RKQA 4A3KJ 3Q9SA 1LEBA 2FNAA 2O5RA 3BQCA 2YABA 3S3MA 4QP6A 2W4KA 2WU7A 2DYLA 4HX7A 2IEWA 5CEOA 2NNWB 3ZGKA 2PUNA 4L5IA 2WMVA 4JK1X 1X19A 2YM5A 3QYBA 3KXHA 1MJAA 2W00A 5EFQA 5FWKK 5HVJA 4YZDA 3DK7A 2WMAA 3ZH8A 3C4ZA 4GXOA 3TIYA 3SG9A 2J2IB 5M5WJ 3DNDA 3HAVA 3CTQA 4RAFA 2ERZE 1Z77A 4DIQA 3CMEI 3U55A 2VN9A 1YIJI 2QCOA 4A9TA 2VQHA 4XG9A 2BMCA 2JPBA 3K2ZA 4HV6A 3L00A 4QYFA 3ZM9A 3PVBA 4LGGA 4EOLA 4EHVA 2JSCA 3A8WA 1S5LC 5EG3A 3PLAE 4IM0A 1VQLI 2BZJA 2DOAA 3FISA 4C57A 4I92A 1OCPA 2M4GA 3MB6A 2IA2A 2CDZA 2OU2A 4YIRX 2FSLX 3BPXA 3ULIA 3VYSB 2HXIA 1EA3A 3VBVA 1RRJA 1RKTA 2L9NA 4X6AJ 2FBIA 1Y57A 4WXDA 1PXPA 4BJ5C 2RFSA 3TNIA 3RSNA 3LFKA 2LTPA 4M69A 3AT4A 5CT0A 4RPVA 4FTCA 3TNHA 3ZCLA 5IU2A 2GS2A 2CO5A 1TBXA 4LL5A 2HOEA 3QPHA 3FK6A 4L67A 2ZKZA 2Y6MA 1ZGJA 2E2IJ 4O21A 4AAAA 4AD9A 2X7OA 4IE9A 2ISZA 5JZNA 3J7AY 1JSUA 1WCMJ 2GNLA 4FSMA 1Z3XA 1ZMUA 3R1SA 2R3LA 3Q0UA 4YTCA 1FGKA 1X3UA 4FV7A 2ITQA 3TUBA 4QYGA 2JEDA 2XSDC 3FY2A 4YZ9A 4PMMA 1IV6A 4XV9A 2LNBA 4PMTA 1NT2A 4HG2A 4EK4A 4RAYA 1YVJA 2NNYA 1R22A 4FASD 3GX4X 2VBZA 2R7BA 3C9WA 3KXZA 4CZYB 3ALOA 2IW8A 4I6BA 2PMIA 4A0YA 4APPA 1ST0A 2XNNA 3ELKA 3W8LA 4D1SA 2A05A 4F52A 2L7ZA 4KIFA 5DMZA 2QA4I 2OQGA 2JAVA 4O0SA 5IMEA 1FGIA 4H1MA 3OFMA 1H8FA 4U88A 3BKBA 5T68A 3ELJA 4AYBA 3OEFX 3PSFA 4JBPA 2BALA 3PQKA 4E7SA 1WPKA 1FZPB 1T8IA 4O7WA 4IHWA 3DOGA 3MPAA 2WGJA 4F9CA 2C0IA 3UOJA 3MPTA 2R5YA 3W3CA 5GZ8A 5DLSA 1PP8F 5HX8A 4A3GJ 1B1BA 2WC2A 2XCHA 4FE7A 4D0PA 3NZ0A 2XIRA 4EJ7A 2A5YB 2PZRA 4LG3A 5DE2A 3AL0B 3HDMA 3GBZA 1JGGA 2OJ9A 1I3AA 1FOKA 2VTLA 4AZFA 4E8AA 3WHCA 3C2BA 4O4EA 3NFGB 3AD4A 1R39A 1P7JA 3IH4A 4K18A 3HECA 3CQWA 3FZOA 5FXSA 5GTIC 1UZCA 3ML6A 3CGOA 3FL5A 2LD5A 3NUNA 2XALA 5M56A 5JT2A 1BLXA 3D0EA 4MWHA 4O0WA 4G6LA 3R60A 4GYGA 3UYTA 5EGOB 1F5TA 1MRVA 3FLSA 3KVXA 3KXXA 3A1YA 3I58A 2EB7A 2VOOA 3OTVA 5BX0A 3FMMA 3QTUA 2R7OA 3PVUA 5D5VB 2ZXWH 4EVIA 3WZKA 2WAQN 4P1WA 4FMQA 1TWGJ 2AQEA 1RE8A 1CMKE 2AC5A 3H5NA 4DGWB 5BPDA 3OT3A 3CCSI 3OYAA 3DTWA 3HV6A 4JBVA 4M12A 4MXZA 4HVHA 2OU7A 3O7LB 4XONA 3BBWA 4RIWB 4ZJVA 4CZZA 5EG0B 2PWLA 5EW3A 3RZDJ 4AUAA 2X6WA 4TW9A 4TYHB 4FV8A 4WG3A 4UV8A 4BY9E 1FPUA 5CSVA 1XN7A 4P9UA 2IZUA 2KDZA 3R7UA 4KD1A 2QG7A 3BR5A 3C50A 4YPSA 5BNJA 3F8BA 1E9HA 3TL8A 5HICA 4AP7A 5I0BA 3OUNB 2PN6A 2B1PA 4U0YA 4GU9A 5JSMA 5CQEA 2Y7JA 4A93J 4I02A 4EH5A 3J7YJ 5ERIA 2BVAA 5FFZA 1YXXA 1VYWA 2YS9A 2G9WA 3HOTA 3PFYA 4QTAA 3MY5A 5FLFA 4WNKA 2G9XA 1YRNA 2IGKA 3CDHA 5AM7A 2QU5A 3RI1A 4QQ5A 3LCOA 2XPUA 5C3EJ 2IP2A 4IVDA 3IKAA 3PQJA 1F36A 1OMIA 5HVKA 3CLOA 4G3FA 3V5WA 3OOGA 4USDA 3ZSGA 3VQUA 2XIXA 4ANJA 2X4ZA 5CKTA 3H30A 4O6LA 4DTAA 4BIBA 4DEEA 4EM2A 1ETWA 2HELA 4G7ZF 3P5KA 4C9YA 5ANIA 2I0YA 3VNTA 2X0PA 4FKJA 5FP5A 5HNFA 2OF4A 3D94A 3CMYA 4ESBA 2ESHA 3WTWC 2WMBA 4QP4A 2X1NA 4PRJA 3C13A 3ZS5A 5CF4A 4QPMA 3B2WA 4AWXB 2VWUA 1NY3A 2J4ZA 4QMWA 1TL8A 3S15J 3PUFA 3LAUA 4P90A 2IAIA 3FDYA 4U43A 4EBWA 1GVJA 1JTYA 3HNGA 2P4IA 5LMBA 1E0EA 4G9RA 3D5SC 3ZOSA 2FD5A 1REJA 4QOXA 1VQ5I 3E8CA 5HESA 4HW7A 4MQ9F 1LE8A 3K6GA 3JYAA 2RNJA 1B9NA 5F4NA 3KFWX 4A5NA 2X8IA 2KRHA 2J0LA 5I9YA 3C0IA 3P7CA 4FNYA 2G2HA 4YTFA 4O4CA 3RM7A 2XP2A 3TDVA 4Y17A 4XUFA 3BZ6A 4O4BB 3MCZA 2JIUA 3Q32A 2K9MA 2ITTA 5C9CA 3GTLJ 3ABKH 4HV5A 3F61A 1W5SA 4OTPA 1FPQA 2CUZA 5GJFA 4RGRA 5EM8A 5M4IA 3PJ8A 3V8SA 4Q5HA 4BTMA 3SDJA 3NUAA 2Z16A 3JCUC 4HW0A 2FA5A 2PJPA 1ITYA 1PXOA 4C2TA 4V0GB 4G1WA