4GYIA

Crystal structure of the rio2 kinase-adp/mg2+-phosphoaspartate complex from chaetomium thermophilum
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
341
structure length
338
Chain Sequence
b'KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIARLRGGSSGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 kinase
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transferase
total genus 106
structure length 338
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gyiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gyiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gyiA02
4KA4A 3UZTA 4HVGA 4LI5A 3WGGA 4F9CA 3SQQA 5E9EA 3BBTB 3J81K 4UXQA 4B4LA 3QTRA 1OPKA 2XIGA 5EHYA 1K78A 4A06A 5HNGA 3MGYA 3LXKA 5B2LA 1VYWA 3F8NA 2VONA 1IAWA 4RVMA 3VS4A 2X9EA 3W8QA 3KK9A 3NEUA 4M68A 4CFNA 3UODA 3VULA 3M2WA 3R8PA 3NUAA 1RUNA 4UBAA 3L9LA 5E8WA 4UMRA 4JL9A 3EN9A 4IEBA 1KU2A 3GP0A 3FMQA 4L42A 2J0MB 4APCA 5HS9A 3QOPA 4MTAA 4BYJA 4R6VA 4QYHA 5KHXA 5TE0A 2PBIA 3PE2A 5JZJA 1WVYA 3DLZA 4AIKA 3IW5A 2YZLA 4G17A 3RK9A 2L54A 1OL2A 4RGUA 3G6HA 2NRUA 1Z9XA 3UG2A 4EC8A 2VUWA 5J95A 2ITWA 2AUHA 2R4BA 1TQIA 3EL8A 2BRMA 3NYXA 2VWBA 3AOXA 2GXGA 2DT5A 4FSUA 4RJ6A 4FIGA 2Y4IB 3PVWA 5FM3A 3MPAA 3O8PA 4MTEA 3QZFA 5ANDA 1I27A 5IQFA 4CQGA 3MIAA 5B2KA 3UOHA 2CCIA 3I54A 2XP2A 1FP2A 3MV5A 3WIKA 1JNKA 2R3PA 2H09A 2A3SA 4CCUA 2XVCA 3RAHA 4E73A 1H24A 2I0VA 2EB3A 3C50A 4XBUA 5M09A 5HE3A 5AAEA 4F0FA 5EDPA 1O7LA 5GZ9A 3KETA 3ENMA 4OLIA 3G15A 1APME 3TNIA 5JKGA 5J7HA 1DI8A 4KNBA 2OQGA 2EXEA 5ETCA 4L01A 3QD4A 1H9GA 4NH1A 4QYEA 2BALA 4ZSGA 4YLKA 4JDIA 4BICA 2IW5A 5FG8A 3WTZA 4EYMA 2A6HF 1OUYA 2UW5A 5AR8A 3FUPA 1IN4A 3EQDA 4FKVA 2G9XA 3JS2A 1YOJA 3EQGA 4Y46A 5F1RA 1YW2A 5ANJA 1SNUA 3WGHA 4LB5A 2YEXA 6PAXA 5F20A 5L2QA 3O6BB 1KA8A 4GG5A 4M69A 2M8EA 3KEQA 2ITNA 2HFHA 1PUEE 2DK5A 1G8SA 5CU2A 3BHUA 1U5TB 4FSYA 5IMXA 3P0MA 4X2GA 3HSRA 5EEHA 3VB2A 2AC5A 3ZLSA 5HD4A 3VRZA 1A48A 4EEVA 4CGAA 4DTBA 3QTXA 3PWDA 3ORKA 3QC4A 3L9MA 5T68A 3CGFA 3BBWA 3KXMA 2Y4IC 1SNXA 4XYFA 4DEAA 3QQJA 4EH6A 3I81A 3FPQA 3UQCA 4N9IA 4N6ZA 4KUMA 4YTCA 4AA0A 1P4XA 3RALA 4FUXA 4HLXA 2GQRA 2Y7JA 2P4IA 2UW4A 3SW4A 4C02A 2ESNA 3MFSA 4RLLA 1J5YA 4FG7A 2R7BA 3VFZA 4MK0A 5IG1A 5BUIA 5J5SA 4TL0A 4QP4A 1Q24A 1AGWA 2XBJA 3A99A 3QBNA 2IRFG 3HV4A 3R60A 2F49A 5HOOA 2P5LC 5HNBA 2G2FA 4CCBA 5K5RA 3WTUC 3FQHA 3BPVA 4KINA 3CUQB 5JZNA 5H20A 5CXHA 4WIHA 3TCPA 3VUDA 4U0WA 4XBRA 2ADUA 2QOKA 2PULA 4QMOA 4RLKA 1JXSA 4JLCA 3LCDA 2FNAA 3E8EA 5F95A 4A9RA 5EQYA 4DTAA 4FG9A 3T8TA 2QUFA 1R00A 3U87A 2FBHA 4CGZA 1CF7A 2PVHA 4MXZA 4KRDA 2CPKE 3IW4A 3QQKA 3DPLC 4FVRA 1U5TC 3HYHA 4G5PA 3TNPC 4PDKA 4DG2E 2Z02A 1Q8UA 3FDNA 3I53A 3EMGA 2H6BA 2X9FA 5IQCA 3GO5A 1GJOA 4TPTA 5DYMA 4Q47A 1YDRE 4A7CA 4EV0A 1NVSA 2W1FA 3KP3A 2W1ZA 4CKIA 5HTIA 4L3JA 1WCCA 5TOZA 3TEIA 4HGLA 3PQJA 2IT0A 4IWDA 1STCE 3PSBA 4F0GA 5L2WA 4CTCA 1R36A 2IJMA 3K5UA 3SV0A 2YDKA 1BI0A 1FOKA 3MESA 1PXJA 1Q3DA 2B7AA 3FWEA 4FV7A 2ZAZA 3DFCB 1XB4A 1NVQA 2UVZA 3MIYA 2YZAA 3FI3A 3T8OA 3D14A 1M2QA 4G7OF 3C7QA 3QX2A 2BEOA 2Q83A 3IGOA 4X2FA 2GQSA 2NAZA 4L52A 4S33A 1XH9A 1BC7C 3BQRA 1IA9A 4E4XA 1OL1A 1XCVA 2STWA 2ITQA 2O64A 2G7UA 4FL1A 3W8LA 1FBUA 4MGRA 5EW9A 3JY0A 3TL8A 2JTVA 3FMMA 3K3IA 2CSNA 4G6QA 1UKIA 2JPCA 2QHMA 5L3FA 1HXDA 3HHGA 2I7QA 3EFLA 4J1RA 4IZYA 3R6XA 5E92A 1GZKA 1PW2A 1M7QA 5M4UA 5E8VA 5ED4A 2YLFA 2J6MA 1WBPA 5HU3A 4FKQA 1Z6RA 3GW2A 2CN8A 4QMQA 1FBSA 4D55A 4GXOA 4JQ7A 1VZOA 2KULA 2FH9A 4I21A 3QTQA 2OH0E 1KYZA 1G3WA 4RIYA 4D5HA 2HK5A 3LAJA 2ITVA 4HGSA 2X8EA 4JG7A 4GVJA 5L3BA 3LW0A 3TXOA 4N4SA 1V3FA 3SVVA 4U41A 4G6NA 4OIQF 1MP8A 3DBQA 2H8HA 4HBLA 5LXMA 2R3FA 2PZPA 3FKOA 3ZUTA 1GZOA 2ITTA 2X8DA 2B9HA 1PP7U 4X3FB 2FA2A 1YQAA 3ZFXA 4FHTA 4ARKA 3MY1A 5HGIA 5CEOA 3FHRA 1D8JA 5CLPA 4KKHA 5LMKA 4QMYA 5DHJA 5D7AA 3R7GA 3N4TA 4UMTA 3UNKA 3MH0A 3WILA 3GU5A 2BFXA 3LM0A 5I3RA 2X7OA 3Q6WA 1Q97A 4IIRA 1Q62A 2EV5A 3PA5A 4AZTA 4B0GA 4JDJA 3WU1B 4Y17A 4GSBA 2G7HA 5DH3A 5CU4A 1W7PD 4XOYA 4FTLA 3P9IA 2GNFA 5I3OA 3ORZA 2QOBA 1TBXA 1GNGA 1DM2A 4HF0A 5AM6A 2UW6A 4M13A 1UB9A 3TNHA 1JOWB 3FLNC 1OMIA 3Q32A 2PLYA 2CDZA 4CVAA 2GXBA 2IP2A 5IT9K 5BMSA 5BVOA 5EDQA 3B2WA 1VR2A 3VIDA 3TJCA 5A6NA 3HOTA 3JAMK 4RGXA 4EJTA 2EFQA 5E8ZA 4KBAA 1ZY4A 5FBOA 4D58A 4GO1A 4DEDA 1OUKA 5C9CA 2BZHB 1LUFA 2Z5UA 4EQMA 5DWRA 1XKKA 5K5OA 4C4JA 3COKA 1YVJA 4CICA 4JBQA 4NT4A 4EBWA 5I4NA 2B0QA 1W7PB 2G1TA 2YPRA 3HAMA 3MW1A 2R9SA 2FSTX 4F63A 3D4QA 5ETAA 5CAVA 2O3PA 4CNHA 1IEPA 4FKUA 4NIFA 4C35A 1JHHA 1ZLKA 3BJOA 3GCUA 4I2OA 2WU7A 4X3FC 2OZOA 3OWKA 4EUTA 1B39A 2WAJA 2FOKA 2PPQA 2VX0A 3E3BX 5M44A 4X6QC 2YJRA 2B0LA 2P2HA 3R21A 5H6RA 2C6KA 2HYYA 4Y15A 4NFMA 2STTA 4RIXB 2K7LA 3QKKA 3D5XA 3GXOA 4EONA 2XEZA 1H00A 1FPUA 4M15A 5J8IA 1JKSA 3H9RA 1QPCA 1NVRA 5TKDA 5IDNA 4FNZA 4I93A 4TWNA 3SOCA 3L8XA 5IEVA 2VWYA 5DR6A 3L8VA 4BDFA 1T6SA 5AP5A 1WBOA 4BCNA 4F08A 5M07A 3D7TA 2RKHA 2HZTA 4B9DA 4ZP5A 4AN3A 4G1WA 2W99B 4XG2A 3R9OA 4NM0A 4HVDA 4PMSA 3F7WA 4D0WA 5LMBA 1KU9A 3QPHA 1YHWA 3R22A 3U2RA 2Q8KA 3JR1A 3HAVA 4KIGA 4IVNA 3CP9A 3KGAA 2C6DA 1IA8A 2JDRA 5CSWA 3R1SA 3ORTA 2XASA 1H08A 1OYWA 4MEXF 1JKTA 4I09A 3WARA 5HORA 4D5KA 4W4WA 2C5VA 4LMYA 4FTAA 4IM0A 3POOA 3PZEA 3NUXA 2MH9A 3R0TA 4YJVA 1QMZA 4M12A 1CKJA 4UWYA 1HCLA 1IR3A 2PMHA 3TNQB 5CQWA 3ZQ7A 5D4RA 3CIKA 3Q5FA 5IISA 4CLIA 4ZIMA 5LGNA 3BE9A 4RIOA 3FYJX 3LFAA 1PXNA 2F2EA 4RWKA 5AUUA 2LDUA 4EJ7A 1O3QA 2QLQA 1K3AA 1SFUA 3NIEA 1USSA 5AP6A 4JX3A 3EQBA 1I1SA 1ZZ2A 1T38A 3G90X 3C18A 5JGBA 1ON1A 3ZEPA 2L4MA 3P79A 2K4BA 2YM4A 3MVLA 4B8MA 3K1PA 1P14A 2X0GA 4CFWA 4IJPA 4HV6A 3UP7A 4A4LA 4L6QA 2GIVA 4CKRA 3A8WA 3VQHA 4KD1A 3ELJA 1SZMA 3UC3A 4AQCA 4BCOA 5HE0A 2CW0F 4BIEA 3IRRA 1YYVA 4E5WA 2BHHA 2VWVA 2V5QA 4HYUA 3R83A 1IAJA 1PY5A 3E64A 3Q4ZA 5AUTA 3C4FA 1O6YA 2VC0A 5JH6A 1KOAA 4L67A 4ITIA 4GK2A 4BYIA 3A7IA 3C51A 3GENA 2WTKB 2Y9QA 1TNTA 3QPTA 2WTIA 3TO7A 3TIYA 5GZ8A 2GNHA 1OBDA 5EM7A 1W98A 3K1MA 3JSPA 5ANEA 3NYOA 4L68A 2PWLA 3V8KA 2B53A 4DH3A 3A4OX 3C4WA 3MDYA 3F72A 4GFMA 4OBQA 4TKSA 1RI7A 4L46A 5D9HA 3I71A 2IA2A 3VF9A 2XYNA 4ERKA 4WA9A 3D94A 2Z8CA 3E87A 4ZTHA 4CYJA 3N4UA 1B1BA 4G9RA 3IW8A 3ZHPC 1K78B 3UIBA 4DTKA 2VN2A 1EH4A 2OSCA 4C62A 4BCFA 5HS8A 2PE1A 4HZSA 4BWXA 5CNNA 4K6ZA 3FXRA 2J4ZA 3EQHA 4WSYA 4RC3A 3O50A 3F9NA 4DYMA 3OCGA 2OIBA 1G3TA 2YX4A 4JIAA 4U40A 4CTBA 5DUIA 4IX6A 4BBEA 3DK6A 1SD5A 3W2SA 3IC7A 2XK8A 3PJ3A 4LL0A 5EM5A 3RM6A 1Q8TA 2YDJA 3C3WA 4HQMA 2CO5A 4PNIA 4P4CA 5L3CA 4PMTA 5FRIA 2UW7A 5IUGA 4O86A 4FT3A 5GHVA 4LRJA 4TYHA 3K0LA 4O7VA 4MXAA 2O8YA 3JXWA 3UZRA 3NCZA 2R7FA 4E5BA 3OT8A 5ANGA 5GINE 3OW4A 3IWFA 3PJCA 3BLQA 3M42A 5D5VB 2RGVA 4B7TA 2W84A 4WNOA 2XF0A 3IECA 4S34A 2UXNA 2K86A 4IM2A 4EK5A 4YLJA 3UZPA 4A9UA 1OR7A 4NCTC 4DN5A 4XLIA 3RPSA 4CHUA 2ETMA 5HOAA 3VODA 3GZ6A 3O2MA 1BL6A 3RJPA 1YWVA 2R3SA 3HECA 3COHA 2XB7A 1FGKA 3BLHA 2M45A 4IM3A 3QC9A 4W8DA 3SFZA 2BKZA 2NO3A 4AU8A 4RB1A 4BHBA 3ORNA 4QMPA 1YKRA 5DT3A 4F7ZA 4IQ6A 2R3NA 2PE2A 5EOLA 3U9CA 1XD7A 5K9IA 4BF2A 1F0QA 1YQJA 4KA3A 3ATTA 5LVNA 4AW5A 2YITA 3LFEA 4JIKA 1PXPA 2BAKA 1XWSA 3TOAA 1U4DA 5L3AA 1W7HA 1QZZA 3ECHA 4JQEA 5FD6A 4LGDA 5I9UA 3OUKA 3FXQA 3LFFA 1GOLA 5FGKA 4ZJIA 3EWHA 5ANKA 2HOEA 1T45A 4UY9A 3SQNA 4KABA 4X2JA 4GFGA 4YJPA 2NNNA 2ERKA 2C69A 2OJGA 4E6QA 3J81Z 2QOCA 2PI0A 4CZYB 5A2QK 3WZDA 3PE1A 3JVSA 1YOMA 1C0WA 4JR7A 1DPUA 2ETKA 3BGPA 5FTOA 4M69B 5E20A 3ENHA 2OJIA 2ZOQA 2FVDA 2ZV9A 3EQLF 5GIOE 1B9MA 2HQRA 4RJ7A 2MC3A 4U7BA 2WQNA 1S7OA 4ZY6A 4I0TA 4EC9A 3OP5A 1MUOA 2RIOA 2IW9A 4FTQA 4OTRA 3IKTA 3C4ZA 1J3HA 3HZTA 3ZDIA 4G3DA 4Y5HA 2PMIA 4I6FA 4AGUA 4ZYDA 5K3YA 3R7UA 5AV4A 4HZRA 4UXNA 4BZOA 4GIHA 2OQRA 4FV2A 2Z99A 4N6YA 5HU9A 2VTNA 3WE8A 3DZOA 2IG7A 2D1HA 4BI1A 5DCMA 2I40A 3MJ2A 1I5ZA 2X4HA 3F6VA 5AIPA 1UU8A 4PZJA 3KCFA 1NT2A 3A4PA 5E17F 2W5AA 1CDKA 4NM7A 3R00A 3V01A 5BPDA 5CEKA 4C37A 3U4WA 2E9PA 5AP3A 4EHZA 4HJOA 2RSVA 4BHZA 4G7HF 1KQ8A 3VBYA 1OI9A 1Z05A 3HV6A 2Z33A 2P6SA 5AR7A 1OIRA 2YDIA 4FT0A 2QOLA 1RDQE 4J7BA 1YO5C 4YBJA 3CBLA 1CF7B 2QG5A 5KMOA 4QQCA 5G6VA 2HGCA 1S3JA 2VWIA 2ZXJA 3PVUA 3SHEA 2YM8A 4CLJA 4E26A 2WEIA 4E4LA 1R5HA 3EN5A 5AP1A 1K6OA 4H3BA 3DNDA 3R1NA 4RRVA 3HRCA 1Q5KA 3ZU7A 3AXWA 4BGHA 3NIZA 4DFZE 4EHVA 4LOPA 4OBOA 2YACA 4ACGA 4NEUA 1HKSA 5KKRB 3R7YA 1E1VA 4YO6A 3RAKA 1DP7P 4LMUA 3CS9A 1PJKA 3WE2A 3WG9A 2IVUA 2XNMA 4O6EA 4U97A 4FV4A 3DP7A 3I0QA 2YIQA 2FMYA 2NP8A 4PWNA 3CXWA 3WI6A 5CVIA 5CVRA 5CEPA 3ACJA 1NHAA 3JVRA 2JBPA 2Y75A 4PGGA 4L7SA 3OHTA 2PEXA 3ALOA 5EOBA 3KP7A 2XKDA 3HTUA 5CVJA 4BC6A 4HCTA 4IHPA 4O3MA 3QGWA 2R3GA 3GU6A 2LNBA 5DEYA 3Q4UA 2OJFE 5IA0A 2ZV7A 2C0IA 3PPJA 4MYGA 2OWBA 2IVMA 1WBVA 1LPUA 2QCSA 2C1BA 3PJ1A 4O22A 2GNIA 4EMSA 4FSWA 3BYSA 2ZFWA 5DR9A 1H8FA 4BKJA 3WOWA 4RX7A 4U81A 2CKQA 5JFRA 5JMSA 3ZDUA 2QU6A 4HPTE 3HA8A 4H0EA 1IRGA 1J75A 2QWWA 3FC2A 4JRNA 3E63A 5KBQA 3O51A 1H1QA 5LMAA 4NU1A 2HZ4A 4Z3VA 3A7HA 5HCYA 4ZYGA 1WFCA 2GS7A 3VUMA 1D8KA 5LLQA 2UZWE 4PGHA 1ZREA 1PP8F 4M0YA 2I1MA 3A7FA 4IADA 3DV3A 4L7FA 2J5OA 2C0TA 1B6AA 3PIYA 4YPDA 3RKBA 5BPYA 4RB0A 2CWEA 5A9UA 2AYPA 2IN6A 4RIYB 4XLNF 2EWAA 2R2PA 2W4JA 4V05A 3VRYA 3PVBA 1YI3A 4TTHB 3BKBA 1UHMA 4BCHA 5KKRC 5DUKA 4FV5A 4KWPA 1M17A 5IQHA 3E5AA 4NHJA 2OFUA 4XNEA 3GX4X 4CRSA 2CCHA 5HG8A 4AZVA 3O71A 3T5XA 4S32A 4CV8A 3F3ZA 4I6BA 4P90A 1VEBA 3II5A 2WTDA 4OMYA 4G9CA 3UVPA 2WMXA 2XHKA 4OBPA 5IA2A 4BCMA 3DTWA 3C4EA 4Q5HA 1XH5A 5EYKA 3IW6A 2XIYA 3NW6A 2CGPA 4RB2C 3P5KA 4HZFA 2MA3A 3P7AA 2BTSA 4F09A 1YRPA 3RMFA 5FQDC 1AQ1A 3U6JA 4HGTA 4YC3A 1OPCA 2J0IA 2B4SB 3QKLA 4U8ZA 4CFFA 2QYOA 1UU9A 4A5MA 1IAHA 1YXUA 2I0HA 5HG7A 3BCEA 3R1QA 3C0GA 3ZMDA 4ZYHA 4M6XA 5BMZA 4AD9A 5LGUA 3G9NA 3QTZA 3E8DA 5HI2A 4IFCA 4V0GA 4YZMA 3GQLA 3U1DA 3LXLA 5AIRA 3RPUA 1YOLA 2P5KA 2A5YB 4O0XA 4HLYA 5LVLA 1ZZLA 3DQWA 3K1NA 5H3QA 2DWBA 3KB7A 4USEA 3H0ZA 4GUBA 4W9XA 4KBCA 1EH6A 3O8TA 1OIYA 5TF9A 4ZY5A 4BY9E 2A61A 2WMVA 4AIJA 3KLOA 3LKMA 5IMEA 2EXCX 3ZONA 2CGWA 4AWIA 2WMAA 1FINA 1FBNA 4FYNA 3GFEA 2PVMA 1SD6A 5AR5A 4JK1X 1FX7A 5LMKC 3E97A 4LV8A 4XG4A 2ZV8A 2C5XA 1R5GA 4BTFA 3TIZA 4G31A 3ORMA 5KMLA 3JW4A 4R77A 5C1QB 3EB0A 2J51A 4JG6A 3VS1A 3FZRA 5J9LA 4HOBA 4WO5A 2X6EA 1UWHA 3IKVA 4M14A 4O7TA 4IVCA 4KICA 3R6SA 4Q4ZF 3F5UA 2VNYA 4G6LA 2UZTA 3ZM9A 3D7TB 4FR4A 2A2AA 3I0OA 4PY1A 4IDTA 1KV1A 3H0YA 4OMZA 5D1JA 4R7IA 3EKNA 2X4FA 4W4XA 2XM9A 2V7AA 5FDXA 2DPDA 5CTPA 2JIVA 5HICA 2O5KA 2ZYBA 2W7XA 3V5QA 3HRSA 4YJQA 4XLVA 3BU3A 2EB2A 2ZNYA 2CGXA 4OR5A 2QR7A 2OJJA 5IQDA 3DXNA 3TG1A 4ZK5A 3EHAA 3HVCA 3MEXA 3HDNA 5BUEA 1SFEA 3ETAA 3M7GA 4QMZA 5CVHA 4ALWA 3MAJA 2JGZA 2ZM1A 4EZ5A 2XYUA 4AACA 5IT9Z 2Y48A 1E2XA 3MQ0A 3WZJA 1HKTA 3IG7A 4ITHA 2ZM4A 3LXNA 1DPRA 3RJCA 1Y6BA 3G6GA 5L8LA 1XGNA 4YP8A 3HUCA 4A4OA 3PWYA 4RSSA 4WNMA 4FT7A 4O96A 4IRIA 3AD5A 4BCGA 3TM0A 1BI2A 2IZTA 2PN6A 2IW6A 1BBYA 3OBGA 1R39A 4WG5A 3ZLYA 2BBYA 3UOJA 2JRTA 3E5XA 2VBXA 2WELA 4PPCA 4CKJA 1XSXA 4D4VA 3QUEA 4FL2A 2Y6MA 4O0YA 4BQAA 1YW8A 5DG5A 2QBYA 2EWNA 4LLGF 5TR6A 4YMJA 3PPKA 3RYRA 1H9TA 3BGZA 4I02A 3DBEA 2GCDA 3R7IA 4AT5A 3UOKA 5BPIA 3QALE 2RDPA 4P5ZA 3W55A 3T0YA 3NEWA 1RW8A 3ULQB 3TZ7A 3FXZA 2G9WA 3F2RA 4I5MA 1SVEA 2UZUE 3BY6A 5AUZA 5JFXA 1KSWA 3U51A 4DG3E 4DGMA 5L3DA 5TT7A 3V5TA 3NUPA 5CU6A 2VT3A 5KO1A 3HV5A 2QO2A 3HKOA 4RFZA 4JI9A 2V0DA 2OG8A 2HXQA 4BNCA 1AOYA 2J0JA 2W1CA 1O3RA 4HVSA 2X6DA 1HKQA 4FT8A 3QAHA 4QO9A 5HX8A 4CFXA 4I6HA 3MH3A 1J59A 3VW6A 4S05A 1WWXA 3R04A 4FI1A 4CFUA 2O03A 3SAYA 4GL9A 3EZVA 4O0VA 4DEBA 2XJ0A 3QZGA 4OTQA 4EOMA 5JEBA 2EVAA 4RWIA 4C4GA 3M1SA 2WC2A 4IHSA 3RIRA 2XM8A 2R3OA 3KVWA 1GY3A 4KKEA 2WV0A 2BRHA 3SXFA 4IB0A 3EYHA 1KWPA 1OKRA 2VNWA 3RKXA 4OT6A 2EU9A 3Q9XA 3MCZA 1XH6A 4JS8A 4YJRA 5EK7A 5FXQA 2FBIA 5J5TA 4K9YA 4L5JA 3F21A 3LVPA 3P7NA 5FP5A 4FTTA 4MQ9F 1FMOE 3ZC6A 2XROA 2FMLA 4ANOA 5FD5A 1K9AA 2RV8A 4O6LA 4I20A 3GQIA 4TYHB 4TYIA 5I9ZA 4R5YA 3ISPA 3CR0A 4E3CA 5JK3A 2ERZE 2XNEA 3ZFYA 5JQ5A 3OV8A 3KN6A 4A6EA 4RWJA 4E70A 3S2PA 4F65A 1TVOA 5EM6A 5H8EA 3QRJA 2V6CA 2KTYA 3EQCA 2PFBA 4F9YA 3BE2A 4J53A 3AT2A 3PQKA 4QMXA 4M72A 3COAC 1U59A 4MEDA 5AV1A 3NUUA 4I23A 2OU2A 3I60A 4HNFA 2QI8A 3BYOA 5FLXK 4DH5A 3QFVA 5HIEA 3FLQA 2GU8A 1GZNA 1ZYRF 5CVUA 5CYVA 3UYTA 5AWMA 3MH2A 3UE4A 5AADA 4FTRA 3NVMB 1CKIA 1R78A 4EGYA 2FA5A 5LCKA 5FO5A 3P9KA 3GFIA 4D9TA 3ERED 5HLNA 1H0MA 1Q41A 4YUQA 5CSVA 4AGWA 1LNWA 1T98A 2E9OA 3FXXA 2QNJA 4I41A 2YX7A 3VNTA 5LRSA 5KVRA 3JYAA 5HESA 4F1TA 4YBKA 3LFCA 4OAVB 3QTUA 4E1ZA 4MCVA 4XHKB 4O2ZA 5JFVA 5HG9A 3M1EA 4AN9A 3V7CA 3BHVA 4BHCA 4RQKA 3RTRA 4IAZA 2GNLA 5FEQA 4AGCA 4A12A 1UCRA 2R3KA 4R5SA 3E3VA 3KQ7A 2RN7A 1W83A 2ZJ2A 2V55A 4PL4A 3IONA 3F3WA 2ETHA 3R63A 4AS0A 3ECOA 2B9FA 4BIDA 1LDDA 2A68F 2WOUA 3VQUA 5I9YA 4L53A 3F8CA 2HYFA 3VWAA 3P78A 3F8FA 3FL4A 4Y8DA 4D1SA 3DB8A 1FLIA 4PPAA 2PVYA 2OF2A 1OPJA 4GFOA 5FM2A 3IDCA 3PFIA 3A61A 3FZPA 3P9JA 2W1HA 3PXFA 2UZLA 3VUTA 3GU4A 4EZ3A 2GA1A 1BM9A 4EHEA 3PDTA 4H3PA 4L9TA 3FMLA 3BEAA 1KQ9A 4HDUA 5JFSA 2XBAA 3BIZA 3LCOA 1FSHA 3U9GA 4K1BA 5DCMB 5ANOA 4QRCA 5BVWA 4K2EA 1J7LA 4MQ2A 5LRRA 4MBJA 4WCGA 4E5AX 2ZVAA 3VF8A 3WF9A 4EQUA 2QLZA 3UPXA 5D6EA 5AX9A 4HCUA 2F4JA 4ZTQA 5I0BA 1KUTA 4O0TA 3NUSA 3QD2B 4AX8A 4TWOA 2QVSE 3RWPA 3D15A 3JTHA 2WOTA 5HEZA 1T0FA 3HRBA 4QYFA 5IH5A 2GTNA 2FGIA 1R3CA 1CKPA 2GHMA 5HS7A 5CEMA 1ODDA 2VBYA 2BVAA 2HOGA 1PXKA 3DLSA 4ZOGA 4E93A 4CMOA 3Q4TA 1U46A 4NJ3A 4WG4A 3I5UA 5FB2A 3EQIA 4PTEA 3MYGA 4ZSEA 4X6RA 2PZ5A 4LYNA 3VO3A 2JAVA 4P9UA 4U3YA 1XQZA 2IVSA 4ZTSA 3F66A 3V8LA 3HP5A 1H27A 4O7ZA 5KMIA 2V9VA 3RM7A 1USTA 3IOKA 2VN9A 5A2QZ 4D4YA 1HCKA 2ZDTA 4CT2A 4NB5A 2IVTA 3RKYA 1BC8C 4CFMA 3QA0A 3JTGA 5HBEA 4Q48A 3KCKA 3AC2A 4K0YA 4FV0A 1MJ9A 3PTGA 2DAOA 4I5CA 5J7BA 2HZIA 3Q53A 3TZ8A 4PMPA 3FL5A 4ZZNA 2CG4A 1QL6A 1ZYCA 4UB7A 2ELHA 5HCXA 3FMSA 3KFWX 4D2WA 4LOOA 3H3ZA 3RTPA 2RNJA 2VD5A 4F1MA 2G01A 4M8TA 4FTIA 4EH3A 5DGZA 2B52A 4ENKA 2FSOX 4LUDA 1ZLTA 4C2WA 1H01A 5EQPA 4ZYEA 2J0LA 4IVBA 4AW0A 4RT7A 2HW7A 2A69F 4GK4A 3MFTA 4AZEA 4P5QA 1URWA 3KMUA 4IXPA 4MD7E 4FT5A 1B9NA 3QQHA 5EKOA 4UWCA 3QZIA 3KMMA 4JQ8A 2FF4A 4FICA 4WD5A 3NUYA 4EOQA 4CFVA 1OKYA 3R7EA 1IXRC 2YCSA 3G3ZA 2VTSA 3UC4A 4U45A 2FE3A 2CLQA 3PY3A 3OS3A 2DBBA 3TO9A 5B0XA 1X8BA 1TLHB 2A0CX 2JLDA 3ZC5A 5L6PA 4OTGA 1STZA 3HP2A 4R79A 4EJVA 4PL5A 4EKKA 2QO7A 4O82A 4I0RA 3R28A 4PDYA 5DBXA 3SC1A 5AP2A 3VN9A 4O7WA 5B7VA 3OFMA 3L8SA 1ERKA 1Q8WA 2RFDA 3MA3A 1KU7A 2JEDA 1P2AA 1H1RA 5ANIA 1WMKA 3N51A 2VGOA 1UV5A 3DKCA 4YO4A 4YJOA 4GV1A 4C3FA 4CSVA 2YM6A 3EN7A 3MWMA 1NA7A 5KNJA 4OAUC 2DTRA 4DITA 4IC8A 1JSTA 4BBFA 4HOKA 5ICEA 3HSFA 2V79A 3WU0A 3AQVA 2HWVA 4Y85A 2JKQA 4I4FA 4RBLA 3QQGA 5BVEA 3I5NA 1R58A 4ANNA 1H0WA 2GNJA 3BZ3A 4XSXF 4LG4A 1G6NA 3FLSA 2FU4A 4R7HA 2F2UA 5K5QA 1OYIA 2PY3A 4C34A 2YCFA 2V7OA 4XG7A 4KS8A 2TDXA 1HW1A 4L9JA 4O5VA 4EI4A 4FYOA 2H6CA 3FHIA 4HVHA 3ZUVA 4V0GB 1IN6A 4FV1A 3S4QA 4ZZMA 2RFNA 5CF8A 1IUYA 4U0YA 1JLUE 3L8PA 4TYJA 4YTIA 4ZAUA 2UW0A 5FGMA 4DHFA 4FEVA 4JBPA 4XEYA 3I58A 5HVQC 3ZRLA 3QA8A 4G3GA 4RX8A 2JKKA 5DCFA 3BHTA 4ONAA 5IF1A 3R9RA 1UFMA 2X2LA 5E90A 5IH4A 3W6KB 3UNJA 2JZYA 2C5YA 4IW0A 4K77A 2F2CB 3HEGA 3NRMA 4G5JA 2L4AA 3KFAA 4J95A 2W4KA 4ERWA 1R1VA 3F3XA 1J7IA 3VOEA 3IS5A 4FK3A 4BB4A 2R3JA 2OIQA 1Q3WA 1F5TA 5C8KA 4ZZOA 4XP0A 2Z3YA 5AM7A 2ZO4A 2P2IA 4L18B 1MDMA 3TJDA 4W4VA 1WVXA 2HY0A 1WBNA 3VHKA 1OMWA 3RGFA 3FMNA 3OVVA 5KMNA 4F9WA 1V1KA 3BU6A 4ZLYA 4BTJA 1RIOH 2F57A 1JSUA 1H1WA 1PYEA 4NTSA 3UIXA 4EH7A 1Y0UA 4ENYA 4U43A 1R0EA 4MQVA 3AAFA 4YPSA 4YHFA 2OW3A 1PMVA 3QCYA 4EGZA 3DS6A 4EHGA 2DLLA 2GNGA 4XSZF 3GFLA 4N9HA 4O38A 3O0GA 2PVLA 5F1ZA 3ROUA 3TKYA 2RG6A 3G33A 4O1OA 1R1UA 3RAWA 3HNGA 2RKUA 3TT0A 2VWZA 4K11A 2W5BA 3LFKA 5CI6A 1WQ2A 4QMWA 4AFJA 2XUBA 1KU3A 4AA5A 3DAJA 3QKMA 3WZEA 2JFLA 3LOKA 5K1YA 5E1SA 4HCVA 3FM3A 4FKJA 5K4JA 3NAYA 4O7LA 3C5IA 4UVAA 2HDCA 3MWUA 5JGAA 2FQ3A 3D5VA 2EA2A 2PZRA 3AGMA 2JT1A 4FA2A 2ZKZA 2JIUA 5J87A 1FSEA 2XK3A 4GJ2A 3ZO2A 5L2SA 4U79A 2A6EF 2ITPA 3Q2JA 2PTKA 1H28A 4PTCA 3CY3A 2DQRA 1JPAA 4KKGA 4OTPA 2EFNA 3HA6A 4QTEA 4IB5A 5CI7A 3R71A 3VC4A 2HELA 4UNOA 4M97A 2W25A 5E1WA 3MY5A 5D11A 4FZFB 1P4OA 4TWCA 5JQ8A 4FEQA 4ANMA 2KKOA 2Z9OA 3EQFA 2CKPA 3QRFF 4M0ZA 2R3RA 2B55A 4FTJA 2FO0A 3V7SA 2QBYB 3F22A 3BX5A 2PMOX 1F5QA 3PXKA 4GVAA 3SG8A 5BNJA 3WF5A 4B09A 4OTDA 4KYWA 3L1SA 1IN5A 5DRBA 4TN6A 3DEUA 4ZXTA 3VEPA 3SLSA 3TKUA 4G3CA 4IX4A 5CY3A 2EB7A 4BR3A 3CGOA 4FTCA 4CXFA 2OFVA 2OI4X 3I5ZA 3QRUA 1RNLA 4QMMA 4BWPA 5H6QA 3C1DA 3LLTA 5HTCA 1HQCA 4UYNA 3RNIA 2Q2EA 5M4FA 3WBLA 3FAAA 3KLNA 3F6XA 1PF8A 4BDDA 2VAGA 5EFQA 1O57A 1Y57A 4GU9A 3IO7A 2PHKA 4FKIA 3CTAA 2P4WA 2UZEA 3L9FA 3VUHA 2LF8A 5DT0A 5B2MA 2CHLA 3DCVA 4KIOA 4JAJA 1FT9A 3D7ZA 3ZCLA 3TQNA 2ZMDA 3LQ5A 3FMKA 4MWIA 1U3EM 3CO6C 2MD5A 2DS1A 3SDJA 3UTOA 1PMEA 5HIBA 4BL1A 3CTQA 3JSOA 4IRHA 2ITYA 3FHZA 3FSKA 4TY1A 3VHEA 2BDFA 3KMWA 1G3SA 3ABUA 3R2YA 3ZBFA 2J2IB 3LA7A 2ZBKA 4GT5A 4I01A 3WF8A 4ZSLA 2OU7A 3WE3A 4BYYA 4HVIA 3BP8A 4FKSA 3D5UA 1FQ1B 2JFMA 3WYXA 3BZ6A 4RWLA 5E8XA 2XCKA 4QP9A 4IACA 5FXSA 5G1XA 5E1EA 1XGSA 1ZOGA 2CGUA 4ZLOA 3Q3BA 1BJAA 3TZMA 3FBVA 1JSVA 4D1ZA 3E6MA 1QPEA 4YIFA 3SXYA 5EI8A 4RZVA 4O0RA 2WIPA 3PYYA 1LJ9A 3JPVA 4DCEA 1URCA 2JKOA 4AOJA 5EI6A 4U7ZA 2Z2WA 4IB1A 1MKMA 5LWMA 2BRBA 1BIBA 1BX6A 5D12A 4ZTNA 1WKMA 2CNVA 3MFUA 3TACA 1E9HA 3IKAA 5HLPA 3ZMMA 1OM1A 2A07F 1J7UA 2VODA 2XKOA 2COMA 4RGSA 4FIJA 5E8SA 3UOLA 2WPAA 4FSQA 2YA9A 3W2RA 3KXXA 4EOKA 3E3PA 2F5DA 3I6WA 3PA3A 2V1UA 3GFJA 4F99A 3QU6A 1TW2A 3Q2MA 4K8AA 1U2WA 2WU6A 4KFCA 3D2IA 3GU8A 3U8WA 3DV8A 3FYKX 5HE1A 3PIZA 4HNIA 2YIRA 3UMXA 5CWZA 4WSQA 3LM5A 4WOVA 4YR8A 2OO8X 3EFJA 4O91A 2JBOA 2W06A 5L2TA 4L8MA 5HVKA 3WF6A 4AP7A 1VJYA 5CF4A 4KNYA 2W05A 1U78A 4X21A 3OWJA 4DT8A 2MH2A 2FBKA 1KYWA 3AMAA 3V5WA 3DY7A 4J52A 2BRNA 5AAFA 5L8KA 2PQ8A 4DLJA 2WQBA 2HENA 4FZDB 4EORA 4FKWA 5CSPA 3MZHA 2ACXA 4MKCA 5FEEA 2V62A 4QD6A 1E17A 1REPC 3I64A 3LMGA 1BI1A 3S1HA 3PVGA 4LJZF 2O8XA 2PMNX 2BAJA 4KN7X 3HOSA 3ZZEA 2CJMA 2XK9A 5HHWA 2PG4A 3FKLA 2JD5A 5ICGA 3D5WA 3S2WA 5AR4A 4C57A 4EH9A 4IE9A 3HSEA 2XNOA 2MLGA 5LCJA 3NMUF 3HV3A 3QHRA 4OTIA 4LM5A 1D3YA 3O96A 3RNYA 5D8KB 3LE6A 4NZWB 5HBHA 1OB3A 5KX8A 4XG6A 5HCZA 3IGGA 3UVRA 5DEQA 1GAGA 3C9WA 3MFRA 3G5DA 5J8CA 4YGAA 4FV3A 3ZRMA 3DKWA 3JY9A 5DLSA 3R02A 3QYWA 4E6CA 2K02A 3SKCA 1F1ZA 2DI3A 5JHUA 5FLXZ 4I0BA 4UX9A 4BGQA 3KXZA 5BOXA 1IW7F 4ESJA 3N4VA 1GIHA 3N97A 3EH9A 1YXXA 4MF0A 4C33A 4RJ5A 1IN7A 4QMUA 2NNWB 4EYJA 4TV7A 4FIIA 2KJBA 3A8XA 2XRNA 5K0XA 2M30A 1QBJA 5F94A 3WTWC 3ZXTA 4DLIA 4NYEA 1ULYA 2R3LA 5GJFA 4PUZA 4OUCA 3NDMA 2M87A 2XNPA 3CPCA 5BUJA 3OT3A 5D7VA 4ZY4A 4P55A 5BMMA 2B9JA 2RGPA 5LHGA 1EH8A 3J80K 2F5EA 3HIFA 5HX6A 3RPOA 4HYEA 2HAKA 2UZNA 4FSNA 4YJUA 3T1BA 5DR2A 4R7BA 5EDRA 4QTBA 2YISA 4EJNA 1KV2A 4YFNF 4IVDA 5BVNA 4F6WA 3WTXC 5JSMA 4ANQA 3QUPA 3UIUA 3VUKA 2UUEA 1I1GA 4DFLA 2CKOA 2CFXA 2H9VA 2XKPA 3LFDA 3IQ7A 4UV9A 3KF7A 5LHIA 4I1ZA 3IL2A 2CNQA 1L3RE 3IK3A 2B54A 3SOAA 4I5HA 2GDOA 5ICFA 1YG2A 4Q5EA 2QC6A 1H1SA 4WKQA 1DAWA 3U4UA 4YFXF 2E9NA 3EJ1A 1ZRCA 3DOGA 1Z57A 4XRLA 4ANLA 4YNOA 2OF4A 4G6DA 4EQCA 4YZDA 4M9ZA 3UQFA 5IU2A 3Q9WA 3RDIA 5LARA 1OITA 4BHNA 5LHHA 5HBJA 4RVLA 4AF3A 3KXHA 2BGCA 3MFKA 1REKA 5ILVA 2ZMEA 3B02A 5HDNA 2OBJA 1U6GA 4IAYA 5KCVA 2FNPA 3A60A 5ITAA 5HNIX 4Q9SA 4E8AA 3EZRA 5IUIA 3MPTA 2HR3A 3DQVC 3FMDA 5DA3A 1PXMA 2VU3A 4ACMA 3LFSA 1EV7A 3I7CA 2F9GA 2O63A 5IQBA 1XMAA 4O0UA 2VO6A 3HV7A 4H58A 2CYYA 3F5PA 4YIIA 3BI6A 4FL3A 4EH2A 3VBTA 4TNBA 3LQQA 3ZN1A 5HLHA 3SA0A 2HS5A 4LRKA 4NM5A 5IZFA 2XKEA 3ID6C 4PDOA 5H8GA 3U9NA 3QCXA 1JGSA 3PY1A 1CGPA 4G16A 4NWMA 3GCPA 3OW3A 3ZMTA 3TNWA 4EBVA 1XBAA 4PF4A 3GCSA 5ILUA 3A62A 4ASNA 2BZJA 2WMSA 3I4BA 4GCJA 4KMUX 4RMZA 3FKNA 3I59A 3D9VA 1FNNA 4QMTA 3O3KA 2VTRA 4GJ3A 5FTGA 1SAXA 4FX0A 4KSPA 3TN8A 5H9BA 3A2CA 5M56A 4AW1A 4GG7A 4AA4A 4C59A 2BV6A 2IPXA 2J9MA 2QOQA 5AA9A 1JVPP 2R3MA 2J5EA 3L9NA 4H3QA 4BDGA 5CAQA 2F5CA 5E1XA 1P2FA 4Z7HA 1S8NA 1BYGA 3OROA 3GC9A 2W85A 3KRWA 3U54A 3W1FA 4AE6A 1G5SA 5CALA 5D5XB 4C0TA 2BAQA 4O27B 1MQ4A 4W4YA 3ZOSA 2D45A 2WMRA 2QU5A 3MB7A 2QHNA 2XRWA 1JBPE 1R22A 3VS5A 3NZ0A 4AOTA 3REOA 4GYIA 2XS0A 3O17A 4QLCU 2I6LA 5I9XA 5AA8A 4MAOA 3LWFA 2VWUA 3UJGA 2YSRA 4QP1A 4YTHA 1PXIA 5CVVA 4B8XA 4AZSA 2XRUA 3KK8A 2BCJA 5FP6A 1GHCA 3ZN0A 3VVHA 1DI9A 3H92A 4CRLA 5I9VA 3LCTA 5KHWA 1YFHA 4C4IA 3I4PA 1OKVA 5EH0A 1MGTA 4HX7A 3R9NA 1SVGA 3F3TA 2BYVE 2W9ZB 5JRSA 3JUHA 3F61A 4EK3A 3RK7A 1ZOHA 3WF7A 3OZ6A 1LEZA 4BTMA 3E6BA 4XMOA 2QOHA 2PUPA 3POZA 3GVAA 3P1AA 1IF1A 3Q9ZA 4WUAA 1OBGA 1BMKA 3OWLA 3L00A 4N0SA 3CC6A 4ASDA 1ZGJA 1FYLA 4FTNA 2MBFA 5DD4A 2V1DA 5BQTA 4MH7A 4NW5A 1MDMB 2WIHA 3AT4A 2ITXA 2FEZA 2QD9A 3DK7A 4FSRA 5E1ZB 3LJ1A 3B2TA 2HQNA 1XO2B 5D8LB 1YLFA 2X2MA 3GVUA 4KN4X 4FKOA 3VW8A 2QO9A 3MVJA 2VC1A 1O9UA 5J6XA 3WGIA 4XV2A 2P8TA 3EOCA 1Q8YA 4QPMA 2EFWA 1PMUA 2YAKA 4FTUA 1KQ0A 4FE2A 4RA4A 1I44A 2K4JA 4EM0B 4LV5A 1P6RA 1D5VA 4NW6A 2XAHA 3VJOA 5H2UA 2IWIA 2X1NA 4UWBA 3AMYA 1U54A 1ZMUA 3ZS5A 3C7JA 3CTHA 2L01A 5H8BA 2P5VA 3I6UA 4F70A 4ANBA 4ENXA 1QNTA 2JITA 5M06A 2GQQA 2CKEA 4BTKA 5AIQA 4RJ3A 2J90A 3R30A 3DAEA 3OEFX 4FSMA 5HLGA 4LGWA 4LRMA 4CZUA 3FX3A 5J8FA 3CLYA 2BIYA 3SD0A 3QU3A 4U3ZA 5KZ0A 3EFKA 3QXPA 2VTHA 2D1VA 5EW8A 4LG0A 3DBCA 3LQ3A 5TO8A 2VTMA 5C03A 3QP5A 3VUIA 1WSUA 3C1XA 4RGRA 3V8JA 4RAZA 1P4WA 1YI6A 2GS6A 3V04A 2Z7SA 2OA4A 3IDPA 4A6DA 1P4AA 4ZH4F 3HTSB 3UQGA 3GUDA 2J5PA 3SZTA 5IKWA 4C8BA 4FIFA 4BHPA 3V5JA 3OUNB 1J7KA 4HW7A 4HYIA 1ZGAA 3WZKA 4XUFA 2ESHA 5CENA 4C38A 5LGTA 3OY1A 4FKGA 4MBLA 2FSMX 1IRKA 1H4LA 3HMIA 1XJDA 3QRKA 1FYKA 4A9TA 4M71A 5A4CA 3RKWA 4XG3A 3QRIA 4XP3A 4ACHA 5CU0A 3EN4A 4U44A 4HPUE 1YI4A 4D4RA 4K33A 4CO8A 5BYYA 2H96A 2QOFA 2OXDA 3BELA 2F7ZE 2IA1A 1G8AA 3WYYA 1LEWA 4KRCA 1OPLA 3UVQA 4AE9A 3B8QA 1PMNA 1IRFA 4DFYA 2P7VB 4UZHA 3AC1A 4TRLA 2IJLA 3KA0A 2MLKA 2YR2A 4IHTA 2G2HA 1FGIA 2CGVA 3OOMA 4FOCA 3V8WA 1T39A 4ZS0A 2OZ6A 3LJ0A 1HSTA 3SRVA 3BV2A 2PVJA 4Q2AA 3TGNA 4MNEA 3A7GA 3LQRA 4FTOA 3TKIA 3KZYA 3QTWA 5CXZA 3R8ZA 3HMOA 5DNRA 4LFUA 5DVRA 3KP6A 1KE6A 1OGUA 2PVKA 1H0VA 1OECA 5DT4A 3ABTA 1TW3A 4IB3A 1IASA 5IEYA 3ZTXA 2F7XE 3NQOA 2HTJA 4IWPA 4QP7A 5EHLA 3UNZA 2RC4A 2BR1A 4TNDA 2YWVA 2Q0NA 4WRSA 4D0XA 2HIWA 4ASEA 5ERIA 2HEOA 4GT4A 5EKNA 4L9IA 3KULA 3TV7A 1YHSA 4BKZA 3ODZX 2BFYA 3N9XA 4BRXA 5J79A 4FUYA 3BYVA 4EK8A 4UHTA 2X0LA 4GCVA 2P33A 4A2UA 3HUGA 3BHHA 5FXRA 4RQVA 2IW8A 2W96B 1K2PA 4YURA 1G3NA 1S9IA 3UPZA 2FUMA 2WMQA 1J91A 3BWJA 2W9FB 3FZVA 2OICA 4R8QA 4DEIA 3HX4A 3LZBA 5EM8A 2Q0OA 4JT3A 3FLZA 3TV4A 3V51A 1BIAA 2WB8A 4MQ1A 2OGVA 2NPQA 4ESBA 4KMFA 4IC7A 4BDAA 5JT2A 3LHJA 2OKRA 1M7NA 3D0SA 2DPUA 4RJ8A 2EV0A 2W4OA 5IQEA 5AIKA 4FOBA 4EZ7A 2XIRA 4G2FA 2VOOA 5A4QA 3W18A 4AFEA 3DB6A 2DO7A 4FVQA 2BUJA 2YU3A 4H36A 4ZTMA 3FMHA 4TXCA 2EA4A 3W10A 4LFIA 3V8SA 4XV9A 4PPBA 1ZG3A 4BBMA 5A3XA 3GWZA 3KXGA 4RVKA 2O61A 3HHHA 2ITZA 3Q52A 1XDUA 4OTFA 2EUFB 3QQFA 2OZUA 4GMYA 5BVKA 1JHFA 5A54A 5DDGA 4ZZDA 4G9YA 4C4EA 3BYUA 3MSSA 2P7CB 3OD6X 3E5UA 3CUOA 3ZXZA 4MXXA 1PKDA 1ND4A 3KP5A 4P2KA 3R2BA 2GMXA 3FEGA 2YFXA 3R7VA 3LMHA 1FC3A 1WBTA 2VTJA 3Q96A 2HKOA 4ZS4A 2LGCA 2YM5A 2I0YA 3L9PA 5FBNC 4R1VA 1NW1A 2XIKA 5CT7A 1O3SA 4PL3A 1FOTA 3E88A 2Q0BA 2K27A 2VE9A 1QQIA 5DIAA 4XRJA 2V1XA 4XV3A 4FX4A 4JX7A 4CYIA 3PP1A 4AUAA 4IZAA 2C6MA 4XCUA 4HYSA 4ENJA 3REPA 4AN2A 3VBWA 2VXZA 5LVPA 2BILB 4XG8A 3DBDA 2UW8A 4R1HA 3F5GA 4XG9A 5CX9A 3FMJA 3MS9A 4X0MA 2RG5A 4O81A 4DBNA 3N4MA 4CT1A 3LAUA 3FV8A 4JNWA 3ALNA 3CKWA 3RCDA 3TDVA 3F2AA 1TKIA 3SW7A 3M8FA 5DFPA 3GC7A 4CQEA 3GB2A 3AMBA 3FQSA 4Z7GA 3CY2A 5ACKA 2JAMA 3CQEA 3ZPLA 2UV2A 3NPCA 4O7RA 3O8UA 3R1YA 4UVBA 4HF2A 4R3CA 2VTIA 1Q4LA 4LGHA 1L8TA 4FEWA 4EOOA 1S9JA 3MN3A 1B6CB 2ZNZA 2V22A 1ZMWA 5IPJA 5LOHA 1DS5A 4AZWA 4ESFA 1TTYA 3CUQC 3BQCA 3E93A 3DJ5A 1PHKA 1YS6A 3BGQA 1JKLA 5EG3A 4YHTA 2HWPA 3ACKA 2GFSA 2ZB0A 5CLSA 3VBVA 1YW9A 1UHWA 4QMVA 3ZMVA 3EQRA 4ZSJA 4GEOA 4EJUA 2OXYA 5HZNA 4I98B 1J1BA 5M08A 5ILSA 4LGGA 2LAVA 4BAYA 5BVFA 1FWZA 2W5HA 1TNSA 2QQ7A 5CU3A 3G73A 5TRDA 4FNYA 2GZWA 3NNUA 3UBDA 4IDVA 3IRQA 4MF1A 1LEAA 4F6SA 1W4MA 5CT0A 3WODF 3K9TA 1U5RA 4WT6A 3LFQA 3F7ZA 5M4IA 4F1OA 4RZWA 2C5NA 3ML6A 4W9WA 3Q9YA 4APPA 1R1TA 4KS7A 2VX3A 5IDPA 2ETRA 2X7FA 4X7QA 3U6HA 2IO6A 3KC3A 1MZBA 3KKVA 3ORXA 3GYHX 3NLBA 3RVGA 3FE3A 5C4LA 3F8BA 3DDQA 3V7RA 1RQQA 2WFYA 3PSCA 3THBA 4L9NA 3C4XA 4X3JA 2ZMEB 4J8NA 3CD8A 3PIXA 3ULZA 5CANA 3GI3A 2R3HA 4I7HA 4UEUA 3KE2A 3DA6A 5DE2A 3PZHA 3ZP5A 2RL5A 2J7TA 4YJSA 5HTBA 5CASA 5IQAA 2YCRA 2DQ7X 4EM2A 5E8UA 4PMMA 3DBFA 3CDHA 4QP2A 4WWCA 3BHYA 5AEPA 3ZMSA 4QT1A 3MJ1A 4OINF 2VWXA 4O21A 1Q1HA 2LF7A 1UU3A 4FEXA 2OIDA 2HY81 2W1IA 4KUJA 2H34A 4BDKA 4U42A 1LP4A 3ORPA 2XKCA 1PXLA 4LMNA 2P0CA 4FV6A 1FVVA 4FX3A 2NYXA 3RPYA 4F64A 4BI0A 5HIDA 4JAIA 4C3PA 1FYMA 3QLGA 4S04A 5JI6A 1ZWSA 4XLPF 4F7NA 2PJPA 2PVNA 4DCAA 3BOQA 3F82A 3W33A 1SM2A 4GRBA 5KE0A 4C2VA 3FI4A 2C6IA 4HW0A 4AWXB 5JRQA 4A9SA 5CAPA 3I59B 1KE5A 3W2PA 3J80Z 3OXTA 4P9FA 3HRUA 1OKWA 4N57A 4W8EA 4PTGA 4AGDA 1UWJA 3DFAA 4F7JA 4FZAB 1QO0D 3QD0A 1KE9A 4UYAA 4BDCA 5L8JA 4MX9A 2PU8A 3K54A 5HLWA 4BCJA 5CVFA 3GZ5A 4I4EA 1YDSE 4O6JA 4Y13A 2PYWA 3FY2A 4LLNA 4K2RA 4FV8A 2YIWA 4L0YB 3Q5ZA 1BI3A 2QENA 1UNHA 3UDBA 3VJNA 3C5UA 3E8NA 2BHEA 3NNWA 2C3IB 3FLYA 2QM3A 4CZTA 1IN8A 1S6LA 4OIRF 4Z55A 3TI1A 5HVJA 1M2PA 3MTLA 3VS6A 5F6FA 3F3VA 5AP0A 5AONA 2WNTA 4FKLA 5FDPA 4USFA 1Z6TA 1O3TA 2WTJA 4O7NA 5BQ0A 5E91A 2QQ9A 2IZUA 1ZRFA 2NS0A 2GFCA 1UA2A 4BCPA 4A07A 4L0ZB 3KU2A 1HOWA 5C26A 3K5VA 3FZ1A 4GT3A 1FBQA 5DYJA 3FI2A 4JBVA 3R9HA 4EVIA 2JC6A 5F9EA 4WRGA 3COMA 2H6DA 1QZYA 4DFBA 2C3KA 3CJFA 4YSMA 2WQOA 3AC3A 2HW6A 3NNVA 3OOGA 1ZYJA 2A27A 3DF8A 3CQWA 4UALA 2P6TA 1V0OA 5FFXA 4UVCA 4O83A 3NUNA 3MA6A 3QQUA 4G3FA 2B9IA 2HCKA 2UVXA 5IQGA 5LEKA 1SVHA 1DUXC 2R0UA 2RFEA 5AUVA 5K5NA 1A06A 2PL0A 2VBZA 2JPBA 3O23A 5E8YA 2QOOA 3QD3A 3PXYA 4WNKA 3ORIA 4IAFA 1Y8GA 1YW7A 1OVEA 4RJ4A 3I79A 5BYLA 4EOIA 4BZDA 4QPSA 4DGGA 4PNKA 3DXQA 3NGAA 5L2IA 2YIYA 4YHJA 1U54B 5ETFA 1WBSA 2ISZA 3ZSHA 5IA3A 2DW4A 4C36A 4D1XA 3GC0A 3H10A 4M6YA 4X2KA 4C58A 4RX5A 5BYZA 4CDGA 2R3QA 1CTPE 5CVGA 2XIXA 3DFGA 4IVAA 1ZG5A 2OLCA 4S30A 4GIIA 4DA5A 1R1WA 2E1CA 5DPVA 3DK3A 3TUCA 3WIGA 2F7EE 4QQ5A 5EYCA 2C47A 4LG0B 2ZJWA 4YLLA 3UO6A 3B73A 4MVFA 4D2VA 3KP2A 2VTLA 3MY0A 3ZZWA 2IA0A 3P23A 1MD0A 4R78A 4F6UA 1W5TA 2GAUA 3CCNA 4ASXA 4IX5A 2C68A 1DDNA 5AFVA 5K4IA 3UP2A 1U5QA 4DH1A 4XOZA 2EK5A 4FSTA 5CQUA 3E6CC 1QPDA 1WBWA 3NX8A 1GIIA 2E9UA 4UMUA 1B38A 4RIWA 3GFWA 4WX9A 1RE8A 4EK4A 3DPKA 3NR9A 3F3UA 5AMNA 1PXOA 2XGXA 4ZSAA 3PLSA 4QNAA 2G2IA 3I0TA 3AC4A 2JDOA 4RFMA 4HQEA 3EDPA 3ZM4A 2BRGA 4DT9A 1ZN2A 2XAGA 4G8XA 1JQHA 4OT5A 4PCQA 2AS5F 3NNXA 3KY2A 1ZHFA 1PYXA 2C4GA 4Z16A 1SMYF 3V3VA 4WF2A 2YN8A 2E7WA 3D5LA 1MJBA 1ZYDA 4J96A 4KSQA 4BCQA 5D5WB 3NCGA 1XSDA 3KP4A 4UXLA 4YC8A 4DGNA 4JXFA 5E7RA 5J9YA 1BLXA 3I1AA 3G51A 4BI2A 4WXDA 3P08A 4FKRA 1P5EA 2FB8A 3PUPA 5HE2A 3QYZA 5AV0A 4OIPF 5FTQA 2PZYA 5D10A 3ATSA 5DRDA 1F9NA 5T6KA 3SRVB 4Y73A 2XMYA 3IDBA 5CZIA 2VZ6A 3K3JA 3PG3A 4R3RA 2WTKC 1ON2A 4MNEB 3Q9VA 3LFBA 5GZAA 3L2CA 2XAQA 3CE3A 1R0PA 4F9BA 2ITUA 3FXWA 2R3IA 1ZAOA 3GCQA 3PP0A 1XBCA 2WMWA 4G6OA 3GEQA 4D9UA 3FI8A 2YM7A 5D6FA 4FIEA 1UVRA 4EJWA 3EETA 2X81A 1FMKA 2WXVA 4QTAA 1LDKB 5LEJA 5C4KA 3HRFA 1ONVA 1YWNA 2ZB1A 3GLXA 2WKMA 2PMLX 5CEQA 1LEBA 3FZSA 5L4QA 1UNGA 1H07A 4RB3C 3QZHA 4YTFA 2L3DA 1LQ1A 4FTMA 4MXOA 4D28A 3RPVA 1ZOEA 4DG0E 2X4ZA 2QQBA 4O2PA 2XKFA 4FKTA 3KULB 3MI9A 3NS9A 3FPMA 1H1PA 3EUHA 4M84A 4XV1A 5ETIA 3E7OA 1IZ1A 1FPQA 1J1CA 3PRIA 1XSVA 1FZPB 5C01A 4JG8A 2HWOA 3NWWA 4FG8A 3BWFA 2AXLA 2QQAA 3EQPA 5CJ9A 3VS0A 3LCKA 3RI4A 4H1JA 3DU8A 3HUBA 3OMVA 2FSLX 3QWJA 2WTVA 1AD5A 3RP9A 3IWZA 4PRJA 2DU9A 3MZYA 1ZRDA 1M52A 4IJAA 3G9LX 3RK5A 1S29A 5JGDA 5HQ0A 3LCSA 3VS2A 2ONLA 4ACCA 4XJ0A 4IFGA 4BDBA 2W57A 3OWPA 4EOJA 1WI9A 2WTEA 1ATPE 3E8CA 3ODYX 5L3EA 3E92A 1J0RA 1CSNA 4AXAA 2H27A 1KE8A 4YJTA 2LSOA 1B4AA 2JDSA 4C4FA 5DOSA 1Z9CA 2EFOA 3V5PA 1GIJA 2OH4A 4Z9LA 1Q8ZA 2FRHA 3PXQA 2PVFA 4DEGA 1YHVA 4WUNA 1K79A 3R8LA 2ZV2A 2RFSA 5HVYA 2OAZA 2XJ1A 4BIBA 4ZZLA 5ICPA 2HZNA 4ZJJA 3WTSC 5LJJA 4TW9A 4FT9A 5GJDA 3RI1A 3VBXA 3SXRA 1IG1A 3AD6A 4KT5C 2C6EA 4KIKA 3T8RA 1H26A 3DJ7A 2VWWA 3FLWA 3BRBA 3BJAA 3AC5A 3ZLWA 2YLEA 3BWGA 4HDVA 3ZLXA 1MJAA 3IHUA 4AW2A 5ICCA 4DF3A 3QL8A 2UW3A 5LVMA 4ALUA 3PPZA 4LB6B 3EYIA 4WBBB 1XBBA 1J2XA 2EFPA 3LPBA 3NRVA 2QLUA 4E20A 3V4GA 3NSZA 4ZLZA 4KIFA 1OIUA 2HTSA 2OBPA 3R8MA 3K69A 1MRYA 2W1EA 2A4LA 1XGMA 4QYYA 4E6AA 3NYVA 3LFNA 1WVWA 4YNEA 4L5IA 4R8HA 3W2QA 2BZIB 4JQFA 3ZH8A 3AC8A 2IVVA 3MH1A 3MTFA 2NNYA 3R8VA 2SRCA 5CNOA 4D2PA 3LIJA 2W24A 3LXPA 2A1AB 2UVYA 3OXIA 1V4RA 3LA3A 3FMEA 2R7IA 4HAMA 3S00A 4MNFA 3V5LA 2WWYA 5KZIA 5K0KA 3GOPA 5ACBC 4E4MA 4X2NA 4QQTA 4P96A 1UU7A 1TQPA 4ALVA 1I09A 2XNNA 3F88A 4DNCA 1ZH5A 3IW7A 4IAIA 3D0EA 1JKKA 1SYKA 2BDJA 2A19B 3KF4A 2UZOA 4L00A 4FZ7A 1J9IA 1T46A 2WD1A 4BCKA 4PDSA 2C6TA 2M5WA 3PJ2A 2X8IA 4EWQA 4QQJA 3V6SA 5DD8A 5AJQA 1JAMA 1XMKA 1V0BA 1L0OC 4MHAA 5A14A 1XCBA 4ENNA 1M14A 1XGOA 2F5FA 4FVPA 2BIKB 4F7SA 2JDVA 2PUUA 2C6LA 4U7DA 4DGOA 4QP6A 2C3JA 3R61A 4KIBA 1GXQA 1ZYSA 3TZ9A 2CQKA 3GU7A 5EQEA 4GGGA 1TQMA 3QXOA 2PUNA 4YC6A 2VGPA 3KREA 4MHGA 4FSZA 4OIOF 3W2CA 2VO0A 4USDA 3HMPA 4QP8A 4M66A 4YU2A 1KE7A 2DFIA 2ZM3A 2XNGA 4O0SA 4D2SA 2P3GX 2OZAA 4WK8F 2CN5A 3QTIA 3LMIA 1OZ1A 3PSDA 3Q4CA 4MXCA 2HZ0A 4CEGA 3ET7A 4XP2A 4B99A 4BDIA 4JRVA 2VTTA 2VE8A 3P7CA 1RJBA 4FKPA 2O0YA 3QCSA 2X7GA 4BDEA 4I6QA 3BDDA 1A04A 3ZMUA 2XK6A 1Y8YA 1WZYA 3RPRA 3TKHA 4BWKA 5FLFA 3DJ6A 5J1WA 3RHXA 1SD7A 3Q60A 2W1GA 2KIFA 3LJ2A 4IH8A 3V6RA 4AAAA 4N70A 4DQ2A 2I0EA 1YIOA 2E1NA 4RVTA 4E7WA 3SGCA 1YXVA 3OBJA 5T3QA 4UMQA 4ZMEA 5L6OA 2W1DA 3P9CA 4GS6A 5E8IA 4IMYA 4HX4A 2BKKA 3LQ8A 4RG0A 3WE4A 1OIQA 1Q61A 4IX3A 2EJRA 3G0FA 5M4CA 3FXUA 4PDPA 4DC2A 5AUWA 1BUHA 5DMZA 2E7XA 4OGRA 4EH5A 2YHVA 2UXXA 4RA5A 4ANSA 4MD9E 3BYMA 4C7TA 2UZKA 4GUEA 3S3IA 4FGBA 4ON0A 4QTDA 5AUYA 3T9IA 1BKXA 2O0UA 1W0XC 2W17A 3T3UA 4FODA 1ZXEA 1L3LA 4NFNA 2YM3A 3KEXA 4P7EA 1MRUA 3MB6A 2UZBA 4OW8A 2C5OA 3HDMA 2QONA 4WXCA 2BPMA 2QR8A 2R64A 4E6DA 3TUBA 5A4TA 1OYYA 2UWMA 3FY0A 4A5NA 5CSXA 5CSHA 5KBRA 2XUUA 2FYSA 3M11A 3H3UA 3AG9A 3LSTA 3BEGA 2VOPA 4XRFA 4ZMFA 3UG1A 4L45A 2ZCWA 1KOBA 1BL7A 4B8LA 1BI8A 4FNXA 4YZ9A 3QU0A 5HKMA 4NJDA 4Q5SF 5HD7A 4RX9A 3LLAA 3BLRA 2VTQA 4OU0A 2JDTA 3I7BA 4NIFB 3RBWA 4A0XA 2X39A 1WRJA 4WXHA 4J97A 3VUGA 1P92A 5FFZA 3C4CA 2D2WA 3QWKA 5EYMA 4L3LA 4CZZA 2QURA 3ZSIA 2KJCA 2GQGA 4JR3A 3R0JA 5EHOA 3EYYA 4F4PA 2YJSA 1YXSA 3EFWA 3GBZA 3DKGA 3QCQA 4NKSA 5CYIA 5A6OA 4ORKA 3CLOA 4BCIA 4RAYA 4S2ZA 4RS8A 1HBXG 4TZRA 1ZLJA 3O2PE 4D4SA 3CQUA 3DQXA 4Y72A 5C8NA 1E1XA 1Z7UA 4CV9A 4ETSA 2WQMA 3C0IA 3KVXA 4HX8A 5CZHA 2X2KA 1XN7A 3RHKA 4M67A 3OCSA 3HRMA 4JDKA 1XDSA 3IOPA 3WTTC 4M74A 5K5XA 2VRXA 4WHZA 2R0IA 2GA2A 5D41A 4II5A 1U8RA 3PXRA 3C13A 4M3QA 1OL5A 4LK0F 1YWRA 4RGJA 4HA8A 2DQLA 3SXSA 4O7SA 2W0JA 4GKIA 1IXSB 3P4KA 4BZNA 3SX9A 3OCTA 1AWCA 2GTMA 2WZJA 4I94A 2BZKB 3DKOA 3RZFA 4H1MA 3AD4A 4YJNA 4C61A 1SFXA 4FNWA 2GHLA 4I92A 4O1PA 4PP7A 4M73A 4FEUA 1Z1DA 4BGGA 4CXAA 4I5PA 4K18A 3JAMZ 3CEKA 2XK7A 3EL7A 2QG7A 2DUVA 3TUDA 3J7AO 2WTWA 1QPMA 4Q9ZA 3ULIA 4D0PA 2FXAA 3KCCA 3M9AA 1NXKA 5JN2A 2ACJA 2C30A 5M51A 3NAXA 2Y0MA 4NK9A 2BTRA 5LBQA 4IWOA 4IRGA 4TYEA 3GUBA 2KIUA 3LAPA 4QMSA 4GK3A 2GSFA 2PK9A 3BU5A 3GC8A 3HL7A 5LVOA 3GEZA 2VO7A 3GFMA 2VT2A 3ZRKA 5IH6A 2Y0AA 3QP6A 1PDNC 3KRJA 2PSQA 3Q5IA 2R7DA 4H39A 3R4KA 2BE5F 2NRYA 4U80A 4NTTA 3ANRA 3WTYC 2QKRA 3HMNA 3CJGA 1UNLA 4WBOA 1YS7A 2XA4A 4ITJA 1SMTA 3QUDA 2Y4PA 3ZYAA 5CAUA 2VV9A 3T9TA 4AG8A 4EOPA 3PRFA 1YDTE 3QRTA 4IZ7A 3ELKA 2C0OA 3PJ8A 4C3RA 3GNIB 3UMWA 1I6XA 2UZVA 2GS2A 4JBOA 3E62A 1LB2A 4KIQA 3BPRA 4R1YA 2QKWB 3EKKA 2FSWA 3ROCA 3M8EA 3FSFA 1FP1D 4IBMA 4QYGA 4U88A 2E2BA 4C4HA 2O3FA 4FBXA 3COIA 3GOKA 4A0ZA 4DFXE 1U5TA 2XNBA 2QZ8A 4HF1A 2RVCA 1Q99A 3FQEA 3BROA 4RIWB 3O7LD 4LQMA 3MVMA 3G0EA 3KN5A 1R7JA 3Q9SA 5KMMA 1EH7A 1ZG1A 2QOIA 2WTCA 4BDJA 3NVKI 5DV5A 4KIPA 3RCJA 5L6WL 4LK1F 3OC1A 1IXCA 1KGSA 3QAME 4FTKA 1ZMVA 1VYZA 4FF8A 3E7VA 1PRYA 5IUHA 5IA4A 4GU6A 4O0WA 4KAOA 3QLFA 1Y91A 3FF5A 2OK1A 3AGLA 3OF0A 4IAKA 3GGFA 2VTOA 3UGCA 1FVRA 2YAAA 4O84A 4EKLA 3E5QA 2Z60A 3ZEWA 2WGJA 2XCHA 5KMJA 3O7LB 2XJ2A 3G2FA 5AR3A 3UO5A 3D2KA 3CUQA 4EUUA 2VBWA 1QPJA 2XEYA 2WEVA 4PP9A 2HYGD 4PX6A 4ENMA 1XH4A 3HGKA 5DEWA 5EI2A 3DXJF 2PE0A 4G7ZF 5AV3A 3U6IA 5L3GA 4U9AA 4U5JA 4U6RA 3ROYA 5HO7A 1T2KA 4I24A 5E18F 1FVTA 3PY0A 4J98A 3ORLA 3PLAE 1OL7A 4NKAA 4Z2YA 1HW5A 5AAGA 3ZMZA 4JDHA 4M9SA 4LOQA 1UKHA 3CTJA 2PZIA 4XS2A 2ESMA 5HO8A 3CO7C 5AP4A 4H05A 5CAOA 4DAWA 2BROA 3FZTA 5C27A 1LDJA 4MTDA 4CG8A 4MWHA 3H9OA 5J9ZA 2WQEA 2R5TA 2XVDA 3A7JA 4L9VA 3RZBA 1S7AA 5AV2A 2OD5A 2JIIA 2UZDA 2J0KA 3TWJA 4EQQA 1GZ8A 5IQIA 5BVDA 4UN0C 4QMNA 4V01A 3SG9A 5CF6A 2C1AA 3W2OA 4RC2A 4I3ZA 5M55A 2C3LA 3IPHA 3DXPA 5JR3A 3CPBA 4QP3A 3ZBXA 4FZ6A 3S95A 5CF5A 1QGPA 4GW8A 3DKFA 3OEZA 1F3MC 2KRFA 4DEHA 4AT4A 3TDUC 4HV5A 3WTVC 3TTJA 2PMUA 4I0SA 4YFKF 1M2RA 3OG7A 4EH4A 4N0BA 4A4XA 3W6JB 4EH8A 1FY7A 3U55A 2CLXA 3DZQA 2Z7QA 4PV0A 5GJGA 3FJQE 1P4FA 1A9UA 4ZTLA 4DGLC 1R23A 4LD5A 1ZYLA 3EIDA 4J71A 4L44A 3F8MA 5KMKA 5BS6A 5A4LA 3FWQA 3VS7A 4S31A 4L43A 1CM8A 4F0IA 4BH9A 1O7FA 5TJJA 3TOBA 4YZNA 1JWHA 4AT3A 1HW2A 4L3PA 4I22A 3QX4A 3FM5A 4FMQA 4NSTA 3GXLA 4I0AA 3CSVA 1V0PA 2CNUA 1LVAA 2M1BA 2RF9A 3AT3A 4QMLA 4JJRA 3ZO3A 4J8MA 4CMTA 3FMRA 4UMPA 4D2RA 5HDGA 4BXUA 1XH7A 3ITZA 4J99A 4PQNA 5F64A 4IAAA 1BOAA 5HDKA 3OTUA 3MPMA 3R01A 3H30A 5HG5A 5JFWA 4EOSA 4RFYA 4QWQA 3Q04A 3Q6UA 2OXXA 2OJ9A 4XX9A 5CS6A 3UYSA 4BVUA 3ANQA 4UUVA 4KIKB 2J50A 2YERA 3QF9A 5C8MA 3KL8A 4A0YA 4GH2A 3OTVA 5FWKK 1GVJA 4TT7A 3RYPA 4B6LA 2O2UA 4X3FA 4IPAA 3SHFA 4EOLA 4KB8A 4E4NA 2IZRA 4DE4A 3UO4A 5F4NA 3H9FA 2VTPA 3WZUA 1Y6AA 2EV6A 2UW9A 3TO6A 1B59A 2VO3A 5AP7A 1RZ4A 1F4KA 4WG3A 2XAJA 1PKGA 3R0AA 3TDZC 3R73A 3KRXA 4ZTRA 2XH5A 2REIA 2VTAA 3QHWA 3TTIA 5IT3A 3BJ6A 3VBQA 1JE8A 3DPTA 4ZEGA 1WAKA 3F23A 1XR1A 3T3VA 3B8RA 3DNEA 2C6YA 1SD4A 5AUXA 4OOIA 3GF2A 3H3CA 2YWPA 3R9DA 1DAYA 4ASZA 2Z7LA 2WMUA 3K2LA 2ONLC 3KRLA 4Y5QA 3W32A 2YCQA 2YABA 4CD0A 2L02A 5E8TA 2XK4A 2QVOA 5D5UB 4BFMA 5CEIA 2ZDUA 4MEYF 1QCFA 3P86A 3EN6A 3NW7A 4DFUA 3F2NA 1O6LA 5LQFA 2AC3A 3D83A 2CMWA 2G15A 4AVPA 3V8TA 4NUSA 1K7AA 2XZSA 4FC0A 5LWNA 4FIHA 3R8UA 2ZMCA 1H25A 5HO6A 5EEGA 2DYLA 4ZJVA 1BI7A 2Z7RA 4CG9A 2LKPA 1W7PA 4MNUA 1BN5A 4DH8A 2IPQX 5GIPE 2P55A 4DFNA 4Y83A 3HMMA 4EL9A 2HKXA 3RWQA 3KRRA 3ZO1A 5FUTA 4KDPA 3ZUUA 1MQBA 4IJ9A 1W82A 1Z91A 5D4SA 3ZFMA 5I9WA 4DINA 3NW5A 4XBFA 1ZY5A 4IWQA 4YG2F 4LUEA 4D2TA 5FEDA 3UIMA 5A46A 4M9XA 3MBLA 3PXZA 3CD3A 3FZOA 2XAFA 1HSJA 1ZRZA 5FD2A 5IEXA 5GNKA 3P7BA 2Y8OA 2BDWA 1G4DA 2CSOA 3L09A 2OZAB 2WMTA 4RIXA 1MRVA 4HGEA 3TDWA 1ZARA 3HRTA 4R3PA 3KZZA 4IF4A 4ACDA 4UV0A 4M7IA 4QPAA 1YXTA 3RAIA 3KXNA 2XV4S 2E9VA 1Z5MA 3OCBA 3E6DA 4JBAA 4WNPA 1G3YA 4O7YA 4Y95A 4DEEA 2PVRA 4UZDA 2BMCA 5AR2A 3GCVA 4FV9A 2GWRA 2O65A 4G94A 3PG1A 5IA1A 3FC1X 4UV8A 3DT1A 4OTHA 4YSJA 3QQLA 5E8GA 3DDPA 2O6GE 4U0IA 2VX1A 1OL6A 2EXMA 4AZFA 3SZPA 4BKYA 4EJOA 4IANA 4YZBA 4ID7A 3ZO4A 3F5XA 3CKXA 4LLLA 3QTSA 4GKHA 5E4HA 4QTCA 1W5SA 5J1VA 1O6KA 4G34A 3RPQA 4KBKA 3CJNA 5BX0A 4NM3A 4BN1A 3DTCA 3C0HA 4MBIA 2HXLA 4V04A 2RQPA 4TYGA 3BPXA 2ISYA 2YIXA 2B1PA 2GHGA 1LR4A 4RPVA 5I5ZA 2WMBA 4RC4A 4EWHA 3F6OA 1CMKE 4YZCA 5DI1A 3EYGA 3NYNA 4MD8E 4U0VA 3OXZA 4BDHA 2Y6OA 4AIHA 1W8CA 3F69A 5A4EA 5JVTA 3MVHA 3PFQA 3HLLA 1X3UA 4LL5A 4QNYA 3TV6A 2GPHA 3VAPA 3PA4A 1W84A 5M57A 3LA2A 2JSCA 1OKZA 4MXYA 1REJA 4AOIA 4JOAA 2WO6A 3K2ZA 2XIZA 2DK8A 1VTNC 5AX3A 4NL0A 4EM1A 3L7WA 2QODA 4F7LA 4TWPA 4DH7A 4GYGA 2C6OA 3OOPA 1NY3A 2ITOA 5KUPA 2JKMA 3ZSGA 4IXAA 4JVGA 3DAKA 4QOXA 1XHAA 2WHBA 3DGKA 1YTYA 4A9YA 2H94A 4P5OA 2PUIA 1SMHA 4OTWA 3RINA 3R7OA 3W16A 4F9AA 5DN3A 4XH6A 3QGYA 4CYDA 3OY3A 5EW3A 3GT8A 3KEOA 5M53A 3HYIA 4NCTA 4FGRA 5IA5A 2IZSA 4HYHA 1GXPA 2NRAC 4G3EA 4EK6A 4DBXA 2J5FA 3VS3A 4FK6A 5HLIA 4NQWA 5EYDA 3S0OA 3H4JA 3BV3A 3ERKA 4CMUA 5KK1A 2KIMA 4IZ5A 1XH8A 1RUOA
chains in the Genus database with same CATH superfamily
4CCMA 4KA4A 3UZTA 4HVGA 4LI5A 1U9OA 3WGGA 4F9CA 3SQQA 3QOEA 5E9EA 3BBTB 4RMNA 3J81K 4UXQA 4B4LA 3QTRA 1OPKA 2XIGA 5EHYA 4KISA 1K78A 3JCUC 4A06A 4XICA 5HNGA 1GT0C 3LXKA 3MGYA 5B2LA 1VYWA 3F8NA 2VONA 1IC8A 1IAWA 4RVMA 3VS4A 2X9EA 3W8QA 3KK9A 3NEUA 4XK4A 4M68A 4CFNA 3UODA 3VULA 3M2WA 3FBNB 3R8PA 1ETOA 3NUAA 1RUNA 4UBAA 3L9LA 5E8WA 4UMRA 4JL9A 3EN9A 4IEBA 1KU2A 3GP0A 3FMQA 4L42A 2J0MB 4APCA 5HS9A 3QOPA 4MTAA 4BYJA 3BTIA 4R6VA 4QYHA 5KHXA 5TE0A 2PBIA 2WAFA 3DBHB 3PE2A 2HOTA 2GLOA 5JZJA 1WVYA 3DLZA 2RAEA 4AIKA 3IW5A 2YZLA 4G17A 3RK9A 2L54A 3U21A 1OL2A 4RGUA 3G6HA 2NRUA 1Z9XA 3UG2A 4EC8A 2VUWA 5J95A 3UKGA 2ITWA 2AUHA 3VSLA 2CH0A 2R4BA 1TQIA 1WJDA 3EL8A 2BRMA 3NYXA 3Q0WA 2VWBA 3AOXA 2GXGA 2DT5A 4FSUA 4RJ6A 4FIGA 2Y4IB 4F91B 3PVWA 5FM3A 5EG0B 3MPAA 3O8PA 3LSGA 4MTEA 3QZFA 3W0OA 5ANDA 1I27A 5E3LA 5IQFA 4CQGA 3MIAA 5B2KA 3UOHA 4IO9F 2YS9A 2CCIA 3I54A 2XP2A 1FP2A 3MV5A 3WIKA 1JNKA 2R3PA 2H09A 2A3SA 4CCUA 2XVCA 3RAHA 4E73A 1H24A 2I0VA 4RBOA 2EB3A 3C50A 4XBUA 1JT6A 3RKQA 3CCRI 5M09A 5HE3A 5AAEA 4F0FA 5EDPA 1O7LA 2XF7A 5GAHJ 5GZ9A 3KETA 1FEXA 3ENMA 4OLIA 3G15A 1APME 3TNIA 5JKGA 5J7HA 1DI8A 4KNBA 3LSJA 2OQGA 2EXEA 5ETCA 4L01A 3QD4A 1H9GA 4NH1A 4QYEA 2BALA 4ZSGA 4DYRA 4YLKA 4JDIA 4BICA 2IW5A 5FG8A 3WTZA 4EYMA 2A6HF 1OUYA 2UW5A 5AR8A 3FUPA 4DHJA 1IN4A 3EQDA 4FKVA 2G9XA 3JS2A 1LFUP 1YOJA 3EQGA 4Y46A 5F1RA 4J19A 2P81A 1YW2A 5ANJA 4I76A 1SNUA 3WGHA 5DM7F 4LB5A 2YEXA 1X58A 6PAXA 5F20A 5L2QA 3O6BB 1KA8A 1SC7A 4GG5A 3K4CA 1CQTA 4M69A 2M8EA 3KEQA 2ITNA 2HFHA 2VKVA 1PUEE 2DK5A 1G8SA 5CU2A 3BHUA 1GV5A 1U5TB 4FSYA 5IMXA 3IUOA 3P0MA 4X2GA 3HSRA 5EEHA 3VB2A 2AC5A 3ZLSA 5HD4A 3VRZA 1A48A 4EEVA 4CGAA 2XB5A 4DTBA 3QTXA 3PWDA 1WH7A 3ORKA 3QC4A 3L9MA 2HOAA 5T68A 3CGFA 2XAUA 3BBWA 4BUPA 3KXMA 2Y4IC 1SNXA 4XYFA 2E2JJ 4DEAA 4XIDA 3QQJA 4BACA 4EH6A 2LC2A 2NS7A 3I81A 2K9NA 4NC6A 2WAEA 3FPQA 3UQCA 4N9IA 4N6ZA 4KUMA 4YTCA 3DBRB 4AA0A 1P4XA 3RALA 4FUXA 1T33A 5H2FC 4HLXA 2GQRA 4CCKA 2Y7JA 2P4IA 2UW4A 3SW4A 4C02A 2ESNA 3MFSA 4RLLA 1J5YA 4FG7A 2R7BA 3VFZA 1IO2A 4MK0A 5IG1A 5BUIA 5J5SA 4TL0A 3L2RA 4QP4A 1Q24A 1AGWA 2XBJA 2O5RA 2B9SA 3A99A 3JRAA 2JUGA 1S72I 3QBNA 2IRFG 3HV4A 3R60A 2F49A 5HOOA 2P5LC 1FMWA 2DYSH 1APLC 2G2FA 5HNBA 4CCBA 4CCJA 5K5RA 1W2CA 2VQCA 3WTUC 3FQHA 5FLMJ 3BPVA 2KMUA 4FETA 4KINA 3CUQB 3GTOJ 4ZTJA 3UR3C 5JZNA 3CQZJ 5H20A 5CXHA 4WIHA 3TCPA 3VUDA 4U0WA 4XBRA 2ADUA 2QOKA 2L7ZA 3MD2A 2PULA 4QMOA 4RLKA 3ZQGA 1X1DA 2CMPA 1JXSA 4JLCA 3LCDA 2FNAA 3E8EA 5F95A 4A9RA 2KZGA 3HOWJ 5EQYA 4DTAA 2DCEA 4C2UA 4FG9A 3I9V2 3T8TA 2QUFA 3CDIA 1R00A 3U87A 2CV1A 2FBHA 4CGZA 1CF7A 2PVHA 4MXZA 4KRDA 2CPKE 1H8AC 3IW4A 3QQKA 1FJLA 3DPLC 4FVRA 1U5TC 1MBHA 3C2HA 3HYHA 2QKMB 4G5PA 1ACIA 3O8HA 3TNPC 4PDKA 4DG2E 2Z02A 1Q8UA 3FDNA 3I53A 2DA1A 2H6BA 3EMGA 2X9FA 5IQCA 3GO5A 1GJOA 4TPTA 5DYMA 4Q47A 3OYFA 1YDRE 4A7CA 4EV0A 4JX6A 1NVSA 2W1FA 3KP3A 2W1ZA 4CKIA 5HTIA 4L3JA 2WA0A 1WCCA 5TOZA 3TEIA 1X1BA 4IKFA 2E19A 5J1RA 4HGLA 1QZEA 3PQJA 3VYRB 2IT0A 4IWDA 1STCE 3PSBA 4NUBA 4F0GA 3VYTB 5L2WA 4CTCA 1R36A 2IJMA 4AXEA 3K5UA 3SV0A 2YDKA 1BI0A 1FOKA 3MESA 1PXJA 1Q3DA 2CFOA 3BG7A 2LY9A 2B7AA 3FWEA 4FV7A 2L2OA 2ZAZA 4BEHA 3DFCB 1XB4A 1NVQA 2UVZA 3MIYA 2IAIA 2YZAA 3FI3A 5F1JA 3T8OA 3D14A 1M2QA 4G7OF 3C7QA 3QX2A 2BEOA 2Q83A 3IGOA 4AXDA 3UNGC 4X2FA 2GQSA 2WAQN 2NAZA 4L52A 4S33A 1XH9A 1BC7C 3BQRA 1IA9A 4E4XA 4I6ZA 1OL1A 1XCVA 2STWA 2ITQA 2O64A 2G7UA 4FL1A 3W8LA 1FBUA 4MGRA 4EATA 5EW9A 3JY0A 3TL8A 5GAEJ 2JTVA 3FMMA 3K3IA 2CSNA 4G6QA 1UKIA 2JPCA 2QHMA 5L3FA 1H89C 1HXDA 3HHGA 2I7QA 5F27A 2IS2A 3EFLA 4J1RA 4IZYA 3R6XA 5E92A 1GZKA 1PW2A 1M7QA 5M4UA 2NVYJ 5E8VA 5ED4A 2YLFA 3A01B 2J6MA 1WBPA 5HU3A 4FKQA 1Z6RA 3GW2A 2CN8A 4QMQA 1FBSA 4D55A 4GXOA 4JQ7A 3BR6A 1VZOA 2KULA 1XS9A 2FH9A 4I21A 4DGWB 4Y7NJ 3QTQA 2OH0E 1KYZA 1G3WA 4RIYA 4D5HA 2HK5A 3LAJA 2ITVA 4HGSA 2X8EA 4JG7A 4GVJA 5L3BA 2M2EA 3LW0A 3TXOA 4N4SA 1V3FA 4II2A 3SVVA 4U41A 4G6NA 4OIQF 1MP8A 3DBQA 2H8HA 4HBLA 5LXMA 2R3FA 3OIPA 2PZPA 3FKOA 3ZUTA 1GZOA 2ITTA 2X8DA 2B9HA 1PP7U 4X3FB 2FA2A 1YQAA 3ZFXA 4FHTA 2JA5J 4ARKA 3MY1A 5HGIA 2VJ5A 1BR4A 2HYJA 5CEOA 4HEA2 5CQGA 3FHRA 1D8JA 5CLPA 4KKHA 5LMKA 4QMYA 5DHJA 5D7AA 3R7GA 3N4TA 2R4GA 4UMTA 3UNKA 3MH0A 3WILA 3GU5A 2BFXA 3LM0A 5I3RA 2X7OA 3Q6WA 1Q97A 4IIRA 2LG4A 1Q62A 2EV5A 3PA5A 4AZTA 4B0GA 4JDJA 2JN6A 1BA5A 3WU1B 4Y17A 2JWTA 4GSBA 2G7HA 4FCYA 5DH3A 3H5NA 5CU4A 2DDBA 1W7PD 4XOYA 4FTLA 3BLYA 3P9IA 1QHHD 2GNFA 5FRNA 5I3OA 3ORZA 2QOBA 1TBXA 1GNGA 2AEGA 1A6IA 1DM2A 4HF0A 5AM6A 3FK6A 4AUXA 2UW6A 4M13A 1UB9A 3K4LA 3TNHA 1JOWB 1MNEA 3FLNC 1OMIA 2AQXA 3Q32A 2LR8A 2PLYA 2CDZA 4CVAA 1QVTA 2GXBA 3W0MA 2IP2A 5IT9K 5BMSA 5BVOA 3GTKJ 5EDQA 3B2WA 3SEQA 1VR2A 3VIDA 3TJCA 5A6NA 3HOTA 3JAMK 4RGXA 4EJTA 2EFQA 5E8ZA 3K4BA 4KBAA 1ZY4A 5FBOA 5M5XJ 2OF7A 4D58A 4GO1A 4DEDA 3BTJA 1OUKA 5C9CA 2BZHB 1LUFA 2Z5UA