4GYIA

Crystal structure of the rio2 kinase-adp/mg2+-phosphoaspartate complex from chaetomium thermophilum
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
341
structure length
338
Chain Sequence
KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIARLRGGSSGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rio2 kinase
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 106
structure length 338
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gyiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gyiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gyiA02
3TV7A 3HP5A 4BHBA 1BI8A 2JGZA 4ZXTA 4KMUX 2XYNA 3COIA 3UC4A 4ACDA 2QOLA 1YWRA 4NW5A 1OYIA 2BRBA 1XSDA 4FSQA 2UZVA 1LEAA 5LMKA 4RGXA 2YSRA 1NA7A 4MEXF 5AIQA 5DRDA 3PLSA 5IQDA 4RZVA 4D9TA 1DDNA 4FOCA 4MQ2A 4ZLYA 4YLLA 2PUNA 5LMAA 4DGOA 2P2HA 3MTLA 3E7OA 3FY2A 2R7BA 4G7HF 3UG1A 4NKAA 4O0UA 3W10A 3F2AA 4AN9A 3FV8A 3WBLA 2JC6A 2A61A 5F64A 3RAIA 3C50A 5IA1A 2OFUA 4IEBA 1WBVA 2BMCA 1Z91A 4UV8A 1YTYA 3L8PA 4MEDA 4GVJA 4M84A 4XX9A 5BMMA 3OBJA 5DIAA 4KIKA 2RG6A 3EETA 4U5JA 3LFFA 4O84A 2CGVA 2W7XA 5KMLA 2KJBA 3HSRA 1IZ1A 1J3HA 1XBAA 1YXVA 4NSTA 1SD4A 5CTPA 4ENKA 5D5UB 2NNYA 2QBYB 4IRHA 5EEGA 4AFEA 4D4SA 3OUKA 3TUBA 4UALA 5HG9A 4WBBB 2Y75A 4R78A 4FA2A 2IN6A 3NLBA 4F0FA 3QPHA 3SD0A 4NFNA 2BDJA 3ZZEA 4RC3A 2HEOA 2HYFA 3CR0A 4ALVA 4CZYB 2W1IA 3W55A 4G17A 2WTEA 5CNNA 1SNUA 4NTSA 4CQEA 2J5EA 4YFKF 5JN2A 3UP7A 3OT3A 3FL5A 5F6FA 5DV5A 4UYAA 2O6GE 2VWUA 5L2TA 4QMXA 3KRXA 3QP6A 1U3EM 5AUXA 3TUDA 1P2FA 2OGVA 1ON2A 1GAGA 2YWVA 3I71A 1LDKB 4FEWA 2COMA 4AVPA 4G3EA 2QLUA 4XG3A 4LG4A 1FBNA 1OPKA 3F8MA 1ZZLA 4PZJA 3LFDA 4WRGA 1PMUA 4JIAA 4O81A 2CKPA 4C8BA 5K0KA 5CSVA 2BFXA 3ZBXA 1YWVA 4O7ZA 1SD6A 2JPCA 4U44A 1GNGA 1MRUA 5AAFA 3AGLA 4LRJA 3O8PA 2JIIA 2EB2A 2P6SA 4FSNA 1AQ1A 5CXHA 5KZ0A 4E5BA 1IR3A 5E8ZA 2DK8A 4ACHA 3EZVA 5HTCA 5L3EA 4YJQA 5E1EA 3E5AA 4OTHA 4M69B 1T2KA 2UVZA 3N4UA 4EH5A 3QQGA 3MESA 4MAOA 4JR3A 3VIDA 3R6XA 3BHTA 3VS4A 3LJ1A 4WRSA 3VJOA 1OIQA 3BRBA 3ELKA 3EFKA 3LLTA 3QZFA 1XH4A 5KKRC 4JOAA 2ZJWA 3DKFA 2Z99A 2W9ZB 4AFJA 4DCEA 2DQLA 2QG7A 2PY3A 3QUPA 3R1SA 4X3FA 2BHEA 3KVXA 1V0OA 2JPBA 3ENMA 3D14A 3D7TB 3MH0A 2PLYA 5BVEA 1GZOA 1QQIA 4NJDA 5DMZA 2XIRA 3SA0A 2ZMEB 4F4PA 3MBLA 3ZSHA 2A5YB 5HVKA 3HDMA 3DXNA 3GFJA 3G33A 3TACA 4AA0A 3WZJA 4BVUA 5E1SA 1ZMUA 3AOXA 3DU8A 4D5KA 3MTFA 4EJNA 4DH5A 1SFEA 2XNOA 3H0ZA 1SMYF 3WU1B 4ZTLA 1RIOH 3NPCA 1F5QA 3QWJA 1IUYA 4LFIA 5JSMA 3FPQA 2YACA 3H3ZA 4RAZA 5HIEA 4GCVA 3V7RA 4OT5A 2XAQA 5I9XA 1L8TA 3R7YA 2XRUA 4J95A 3WIGA 3R1QA 4CMOA 4BC6A 5AV4A 5HLIA 3QZHA 1RJBA 3TKIA 5AA8A 3LQRA 4PMTA 5A6OA 4ALUA 1NXKA 4RLLA 1BL7A 4DITA 3GQLA 4EM2A 3QP5A 4BCIA 1GVJA 4FGBA 2JKOA 4R79A 4YZCA 4WG3A 3PFQA 3UZTA 4OAUC 4YZBA 1W84A 4TYIA 4UVAA 3K69A 5FDXA 4RX8A 4S32A 4AACA 3WE3A 3R00A 1H9GA 4N6YA 5E8SA 2CYYA 5HNIX 1MQ4A 3JUHA 3EYHA 3RPVA 3NUAA 5LRSA 1AOYA 1APME 2OQRA 3M42A 5HE0A 2VODA 2B9JA 2W1ZA 1REJA 4YR8A 1WI9A 3VODA 3GFMA 4XV9A 4FT3A 4BBEA 4FL3A 4RWJA 3R8UA 2OZAA 3JAMZ 1IW7F 2DAOA 1ZN2A 5AP1A 4DA5A 2WOUA 5JGDA 3DJ6A 5IA2A 3H9FA 4J98A 4OIRF 4PRJA 4O7RA 3ZXTA 2PZ5A 4GL9A 1OGUA 5E8UA 4L9NA 2C6OA 4CYJA 4JQ8A 2F5CA 3OOGA 3VS6A 4JK1X 4NW6A 4IANA 4K18A 4I5HA 4E73A 4KABA 2R64A 2DLLA 3ALNA 5CVHA 5GZAA 2LKPA 3MSSA 2C0OA 1J7UA 5CF4A 1W7PD 4KDPA 3GF2A 2C47A 3EH9A 5LQFA 3ACKA 1SVEA 2GQGA 1HKSA 4RWIA 3NUYA 3DY7A 1FPQA 1PYXA 1GXQA 5ETIA 5E8YA 4OU0A 4FV7A 4E6AA 3TTJA 4BR3A 3ZBFA 5AP2A 4NU1A 4FK6A 4N9HA 1B9MA 3LWFA 3RPQA 4EORA 3CD3A 2NO3A 1OM1A 5LRRA 2PVRA 3SLSA 1WBOA 2BUJA 3MJ2A 5H6RA 3EL8A 4O0YA 3RI4A 1M52A 2UXXA 3BHUA 5FLFA 2VTOA 3HV6A 2ITVA 5EOLA 4CDGA 1OITA 1T98A 2F5DA 3W2RA 5M53A 3DGKA 1CKIA 4HZRA 3OFMA 4W9WA 5H20A 2JDRA 2JTVA 3QZGA 2HIWA 3ZRKA 3PVUA 3W2QA 4DGMA 3UODA 3NNWA 1J91A 3FMHA 3F3VA 3Q9VA 3P86A 1FOTA 3EDPA 3WZDA 2GZWA 3GU5A 1ZG5A 1ZXEA 3DP7A 2P55A 1K79A 1H07A 4GEOA 3JW4A 4ANLA 4BWPA 2C0IA 1H1SA 1YI3A 2VN9A 1H28A 1O6LA 2FB8A 2X4FA 2EV6A 4HYHA 3P78A 1P4FA 1IN6A 3QAME 5JRSA 1JHFA 1U5RA 3ABUA 3GUDA 3JTGA 2ZDTA 2P4IA 4BI0A 5L8KA 4XSXF 3DBDA 1S6LA 5ANEA 2P7VB 4LGGA 3ORNA 2J51A 5K0XA 3FZSA 2BGCA 3G0FA 2QOQA 3LCTA 3LIJA 2C3LA 4H3BA 1WVXA 1B59A 3B8RA 3WGGA 4AN2A 5HESA 2PZIA 3VHKA 3PWYA 1FP2A 2QOOA 1PXOA 3KZYA 2BRHA 4DT8A 3HRMA 1C0WA 4NB5A 3VEPA 1KV2A 5HORA 2VTLA 4FV3A 3QOPA 1QO0D 2GQQA 4I6FA 1BI3A 1Q61A 3PXKA 4TL0A 2EV0A 3C7JA 4F7LA 3IRRA 4A5MA 2X4HA 3ML6A 2BEOA 4HCTA 3AD6A 4FKGA 3PVWA 1KOAA 3W2OA 4U45A 2RIOA 5D8KB 5KK1A 4M7IA 1WBWA 1B9NA 3N4MA 5BVKA 5FXQA 3BI6A 3QAHA 2XKPA 5EYMA 5EM8A 2HENA 3OXIA 3JVSA 3UYSA 2HWPA 2YM7A 4II5A 4RFYA 3BWJA 3HV7A 1XKKA 4I5MA 1I1SA 4BI2A 3MIYA 3PQKA 2I0VA 4L3PA 4EK4A 3AC8A 5KZIA 4FUXA 1E1VA 1D8JA 4RFMA 3GFIA 1IXRC 5HLHA 3QTXA 3FMSA 4PPCA 3W1FA 4BCGA 4X3JA 3UNJA 2C3KA 4W4WA 3VUIA 4GV1A 4JBVA 3R0TA 4Z9LA 4P5ZA 1UU9A 3Q9SA 4Y46A 3ZQ7A 2XBAA 2XJ0A 2XVCA 3I4BA 4G6OA 3PY0A 3VQUA 2CGUA 4IAKA 2IA2A 5H8EA 5J8IA 3E5XA 2PMHA 4MNFA 5L3BA 4NM5A 4EK8A 2OWBA 3A7IA 1MDMA 3VULA 4B7TA 5E90A 1EH6A 3EQHA 4L53A 2QONA 4JAIA 4QYGA 1KQ9A 2JDOA 3UO6A 4CO8A 5IUHA 2F5EA 1O7LA 3FXUA 4QMYA 2ITNA 2YIRA 4IPAA 3T3VA 3FE3A 2VBZA 3NYVA 4I23A 2IT0A 2EFNA 2FMLA 1YG2A 3K2ZA 4ZMFA 2WNTA 2HZNA 3F7WA 1F3MC 4M9XA 3PE2A 3EB0A 5AP7A 3PA4A 5LGTA 1M17A 1O3SA 4O6EA 2FRHA 3WZEA 3IONA 4QPSA 3F21A 1HQCA 4OIQF 4KINA 5FLXK 5FD5A 5GZ8A 2DW4A 2IW6A 5A4QA 4J97A 2O3FA 4EI4A 3IK3A 3WYXA 4YIIA 5HVYA 4UXQA 3LMHA 2CNQA 3MB7A 3RTRA 1XDSA 3CKWA 4E93A 3V01A 4P4CA 4CFVA 4UX9A 2PN6A 4AWXB 4M3QA 4GIHA 4GYIA 4FKWA 4GS6A 3LFCA 2RV8A 2PZPA 4PPAA 5AJQA 4FKJA 1HW5A 1ZYDA 2CPKE 1B6CB 4WNMA 1M14A 4DHFA 2W1EA 2XIYA 4HVGA 5AA9A 5DNRA 4FZ6A 3QU0A 1H26A 5AV2A 4P9UA 1Y8GA 1E17A 3NZ0A 3E88A 2ERKA 5M55A 2M8EA 5D4SA 3KRWA 3FLQA 3HRTA 4IB0A 4CSVA 2YABA 3F3UA 3H92A 3ZUUA 4QPMA 3AMBA 4FKTA 3U8WA 4Z55A 4JBQA 4RJ4A 5AUUA 3HVCA 4A12A 1CTPE 3SXYA 3HAVA 5DD4A 2VUWA 3ODYX 2STTA 1YDTE 4WIHA 4J1RA 3SRVA 5M4FA 3G51A 3TDWA 2FOKA 4DH8A 3TO7A 2PUIA 5AM6A 1SD5A 3RHXA 4YTFA 5JH6A 3O71A 4EK5A 3F88A 4X3FC 4GCJA 3KP4A 3DQVC 4F7SA 4TPTA 2VTRA 4TYHB 3F22A 4ZSEA 1WSUA 2EXEA 2UZBA 4M0ZA 3BHHA 4U81A 4PTGA 5H8GA 3H4JA 4RJ3A 3NUPA 3F6VA 4KT5C 4YJTA 2LAVA 2P4WA 4ZIMA 4UB7A 1ZYSA 4LG0A 2EVAA 4H3QA 4JI9A 3C4FA 3Q5IA 1PP7U 2YM5A 3BV3A 4MWIA 2PI0A 4UMPA 4IH8A 1U4DA 3ZCLA 5DT0A 3ZDUA 1J7IA 3FMRA 1XR1A 5CI7A 2GCDA 4DN5A 1KE5A 5FTOA 4L7FA 4IAFA 4DTBA 3FXQA 3R9NA 5FM2A 5ILUA 1KYWA 2BAJA 3E6CC 4IAIA 4HVSA 3RCDA 4RWLA 1GIIA 2WU6A 4CFNA 3LFBA 2VTTA 2O2UA 4DFXE 4UMUA 5A4CA 3RK9A 4BCMA 2CCIA 3FZTA 3VW8A 3QTZA 2BFYA 2QOCA 3T9IA 4AG8A 3KP7A 4DFZE 2KKOA 4ACMA 3IOKA 4FX3A 3UPZA 3GFLA 2XM9A 5TJJA 2YWPA 1YW7A 4YJOA 3ZMVA 2FE3A 2HDCA 5A4TA 4KIPA 3GNIB 1UNHA 4R77A 3RWPA 3WZUA 3A8XA 4Q48A 2YCRA 4IBMA 2O61A 3D2KA 5AX9A 5BUEA 5CU2A 2WXVA 4L67A 3HL7A 2WMQA 3L9NA 1Q3DA 3D9VA 4GJ3A 3MY1A 2O3PA 3JR1A 4K11A 1FX7A 2MC3A 4HPUE 1J1CA 3KGAA 5C8KA 2H8HA 3CKXA 4RVMA 4BHCA 1OMWA 4ENYA 2J7TA 3VBWA 3GQIA 4YNOA 4V0GA 2Z60A 3KFAA 1G3TA 3AC4A 4KKEA 4DE4A 2GS7A 1T38A 4EHEA 3RPOA 4I3ZA 2BZIB 4FNZA 4C2WA 4UV9A 3RALA 2PHKA 3DF8A 1F1ZA 3WTSC 3Q4ZA 2DUVA 5CEMA 4PDKA 5CT7A 2YM6A 3ZM9A 3K5VA 1BKXA 3K0LA 4W4YA 2BHHA 3W8LA 3C4WA 5E92A 3KRJA 4OUCA 2YAKA 3MA6A 1OR7A 2WC2A 3CY3A 4J99A 4A7CA 2C3JA 4GSBA 4J71A 2ONLC 4AN3A 1MRVA 1YS6A 2VX0A 2WGJA 5JFVA 3S0OA 1DI8A 3HZTA 5C8MA 4YZMA 4XBFA 3QKMA 4FEXA 1YWNA 5DWRA 3RAKA 1BI7A 4I0RA 2J0MB 2RQPA 4UVBA 4C59A 4XV2A 3GBZA 4R8HA 3U2RA 2QODA 2R3FA 5FEDA 3KB7A 2G7UA 4ZJJA 1OPLA 3QXOA 2HY0A 4WKQA 2RL5A 3TIYA 1VTNC 4EOLA 1FZPB 3QQLA 3KEQA 3VRZA 4CRSA 4LGWA 4I5PA 3P1AA 1Z1DA 4P55A 4FI1A 4BHZA 2YM4A 3ZMDA 5AM7A 3I0TA 1WRJA 2YCSA 4L45A 3RZFA 4OINF 2BYVE 3OZ6A 4E5AX 1HSJA 5CY3A 3W2SA 4K33A 5D10A 3DXPA 1H0WA 3B2TA 2OBPA 5IA3A 5E1XA 1Y6BA 3PY3A 3TJCA 2PBIA 1URWA 1QZZA 2RSVA 1YVJA 2FNAA 2V62A 4FG9A 4RQVA 5CASA 1U5TB 3Q52A 2J5FA 4V01A 1U8RA 4CICA 1KE7A 3FYJX 4IB1A 2JFMA 4QP2A 3PZHA 1BYGA 4UZHA 3N9XA 4HVHA 2VOOA 3FKOA 4JS8A 2J0IA 3LPBA 1FBQA 3RNYA 3F72A 4A0YA 4O38A 3CTQA 2VE8A 2E1NA 4L9JA 2BDFA 3E6MA 3REOA 3TNWA 2PMNX 3BU5A 4K77A 4FG8A 2XK8A 4KFCA 5FP6A 3NVKI 2YLEA 1ZYJA 4PDPA 4L5IA 3PTGA 4FV5A 1ZYCA 4IQ6A 4ESFA 4YC8A 2BROA 3L8VA 4PUZA 4FKPA 3KCKA 1H1RA 2UW7A 1XSXA 5LBQA 3PG3A 3LM5A 4C58A 4ZMEA 1M2PA 1U46A 5DUKA 1R78A 3QCXA 3EIDA 4TKSA 1SFXA 3ZMZA 1S9JA 3JY0A 5CZHA 4IZ7A 2AC3A 1BC7C 2JIVA 2W1CA 2XIGA 3BWGA 1I44A 3AT2A 3NS9A 4YTIA 4BGQA 5DCMA 5LOHA 5ANIA 2D45A 2IZSA 5CLSA 2R3KA 4RT7A 2VC0A 1H1QA 3D5UA 4GT3A 1FYMA 2C5YA 4ZYGA 2L01A 3V7SA 1BL6A 4O0RA 1YOLA 3IRQA 3QU3A 5AP5A 3BGZA 4C4EA 3QX4A 3MS9A 4A9TA 3GU4A 5JQ5A 4YC3A 4I7HA 4EBVA 3SHEA 3IO7A 3BLHA 2PE1A 4D4VA 4QMLA 3A7FA 3BE9A 4IM2A 3T3UA 2ZV2A 4RGSA 4W4VA 3Q32A 4AD9A 4F09A 1JLUE 3QTIA 3BQCA 3BYMA 4U0IA 2P33A 4IZ5A 1YFHA 1YIOA 3F3WA 4F6UA 3QD0A 4YJRA 4ZLOA 4FTCA 4EH6A 4E1ZA 3ZSGA 4M73A 3ZPLA 1G3WA 4IJPA 3AT4A 1MJBA 3I79A 3WE4A 2B9FA 3VS5A 2A27A 5EQEA 5IDNA 3RYRA 4BCJA 4ENJA 1IAJA 5IPJA 3O7LB 4KKHA 2A6EF 3FQHA 2YPRA 3CQUA 1ZLTA 2OD5A 4H1JA 2NS0A 2W84A 3TKYA 1OKVA 3ZHPC 2X6EA 3KMUA 3S2WA 2G9XA 2XAHA 4ZTRA 2V0DA 2CJMA 3UG2A 4KS8A 2XAJA 2V9VA 4I24A 4YBKA 2MBFA 1WAKA 3GB2A 3T8TA 3W32A 2NNNA 4UXLA 1I6XA 1YO5C 4RA5A 3HA6A 3D4QA 5TKDA 4BKYA 2W5HA 1YXTA 2Z8CA 4IXAA 4IVCA 4NM3A 4EZ5A 3ULQB 3GOPA 3F5GA 2WB8A 3COKA 3EQLF 2QOIA 2EFPA 3ORZA 4UMTA 5HG5A 5HX6A 4ZZDA 3LMIA 4LGHA 3M1EA 2IW9A 2IVSA 2W1GA 3C9WA 1D3YA 1URCA 4YHTA 2HZIA 4N9IA 4PL5A 3J80K 4Q5HA 3AD4A 1XN7A 5CQUA 4TN6A 3PIYA 2RFEA 3GFWA 1G3NA 3R6SA 5I9YA 3RPSA 5CAOA 5JKGA 2VT3A 4U88A 5ANKA 3H0YA 2BALA 2DYLA 2VWVA 3GEZA 1XDUA 4OTDA 3IS5A 3EQRA 5AP6A 5L6PA 3FLWA 3NGAA 4FVQA 1IN5A 3MPMA 1T46A 2EV5A 5FLXZ 4X6QC 3EYYA 5B2LA 3HLLA 3ZH8A 2R3NA 4JBPA 2WELA 1WBNA 3R7UA 5D41A 2R0IA 5A6NA 4O0XA 3CQEA 3LQ5A 1XH8A 1JAMA 2WTDA 4KIKB 2Z7RA 1UHWA 3ETAA 4FHTA 5EOBA 5IISA 2JAVA 2E7XA 2WD1A 4LLGF 3E5UA 4J7BA 3G9LX 2VTMA 5D1JA 2RDPA 4S30A 4IRGA 2XV4S 4A07A 3UBDA 2Q0BA 3OG7A 2P6TA 1RI7A 3DDPA 2HTJA 2KRFA 3AD5A 3PPKA 3V4GA 3SOAA 2UZOA 4PL4A 3QUDA 3UJGA 4U42A 4KB8A 5ANGA 2K4BA 4LOOA 4OBQA 2XROA 1SM2A 4RJ7A 4BYJA 4KBCA 3QRJA 1JGSA 3VOEA 3CY2A 4F1OA 3VUTA 5IMXA 3F8CA 3BCEA 3D5XA 5DR9A 1FMKA 4FT7A 1QBJA 3CUQC 2YM3A 4ZTQA 4B9DA 2VWIA 2CWEA 5GIPE 2EB7A 3FZVA 4IRIA 4E70A 4BBFA 1F0QA 5DR6A 4KICA 2Q0OA 3PP0A 2VTPA 3U54A 2GXGA 2ESMA 2JITA 2UVXA 1KE8A 2DPUA 4ZK5A 1XGSA 2MH9A 4DEBA 1JXSA 3OVVA 2V7AA 2Y4IC 4EOPA 3WTTC 5HCXA 3J7AO 3L9PA 2QG5A 5IA4A 3QF9A 3GGFA 1X8BA 2HW6A 3MVHA 3W16A 3TIZA 3LW0A 4NHJA 2FNPA 4RLKA 4U97A 3G0EA 5L8JA 3RM7A 3EN4A 4ON0A 3LQ3A 4EJUA 3Q9ZA 4BICA 3BPVA 4AS0A 5IZFA 3SG8A 2OQGA 4NQWA 4RS8A 3PFIA 2GXBA 4BDCA 4A4OA 4C3RA 3EJ1A 3OWPA 4YHJA 4WD5A 2UVYA 4XLNF 4OMYA 2IRFG 3CGOA 5HVQC 3B8QA 3KXNA 3OBGA 3E97A 1XQZA 4GFMA 2A3SA 2HY81 4FKIA 3I58A 1XO2B 3VUDA 1J9IA 5IQBA 4IF4A 3HHHA 3U9NA 4MD8E 2X4ZA 3PJ8A 4EK3A 5AUTA 2R3HA 1EH7A 4X3FB 2EFQA 2CSOA 2C5XA 2FSMX 4NCTC 4R1HA 5AR7A 3CPCA 1K6OA 2WIHA 4O1PA 5HE1A 5DGZA 2E9OA 2GQRA 3H9RA 3NYOA 3NX8A 4PDSA 3L9FA 2PVMA 1PYEA 5CALA 2ZNYA 3L9MA 3F8FA 4HLXA 3K1PA 2XCHA 2VO3A 1REKA 2R3MA 3KZZA 4I6QA 2ITUA 5TR6A 4IJ9A 4WWCA 4XBRA 4A6DA 1ZZ2A 1YKRA 4DFUA 2A69F 3SXRA 5HKMA 1IA9A 1LR4A 3ELJA 3RGFA 2OZOA 2ZFWA 2VOPA 5EG3A 2H6DA 4ORKA 2XGXA 2BBYA 3NNXA 2B9HA 4QMZA 2GSFA 4ACCA 3WGHA 5DFPA 2PG4A 4FEVA 3M8EA 5T68A 4BKZA 3CUOA 3GCPA 2C6MA 4IE9A 4QQJA 5IMEA 4FODA 4O5VA 4QTAA 2C6LA 3C1XA 3DDQA 4I02A 4C35A 3KFWX 5E20A 3THBA 3QHRA 3UOKA 4EQQA 4IB3A 4YPSA 4JDJA 3UVPA 1ZWSA 4KIOA 1LEZA 1G4DA 3O2MA 2HKOA 1SMHA 2RKUA 4B99A 5CXZA 2G9WA 4BWXA 2J90A 4FKRA 5EW3A 5L2WA 2FBKA 2VD5A 1Q8WA 1Q5KA 1XBCA 2QUFA 3DPTA 5LGNA 3Q5ZA 3FX3A 1BUHA 5D6FA 3HV4A 2RGPA 4R7HA 2OH0E 3ZZWA 3DAEA 2UZUE 3UYTA 3C4ZA 3FMQA 4WSYA 3O7LD 2OZAB 1QPCA 5FO5A 1FNNA 3NYXA 4MX9A 2OW3A 2JBPA 1BN5A 3CCNA 4IWOA 2EA2A 4HYIA 2Z9OA 4EZ3A 3FLNC 3SQQA 3CJNA 2F49A 3OROA 2WMRA 5BQ0A 3G90X 3GX4X 1RUNA 4PCQA 2XNMA 2KIUA 5LVPA 1W98A 2GHMA 5L3FA 5A9UA 5HGIA 4AE6A 4FTRA 1LNWA 5L3GA 1OYWA 5E17F 5M09A 3DS6A 4MQ9F 4UZDA 3ID6C 2BTRA 5KCVA 4O7WA 4L46A 2RC4A 4MNUA 4XOZA 3HYHA 3BPRA 3F23A 3IC7A 5EI2A 5IT3A 5JFWA 3FMNA 3R8LA 4G3FA 2HZ0A 3GVUA 3DTWA 4I09A 5A2QK 4O0TA 4DBNA 1RNLA 4TXCA 3I0OA 3L8XA 3LXNA 4ENNA 3D5LA 3CO7C 3DB6A 1JSVA 4LRMA 2A4LA 4H58A 4HNIA 1I27A 3O0GA 4IFGA 3FJQE 4NH1A 4XRLA 3RAWA 4C4FA 3PXQA 5EHYA 3NIEA 1ZREA 3FI2A 3HP2A 3T1BA 1W5SA 3NSZA 2KJCA 2RF9A 3FXZA 3KP5A 2LDUA 4QP9A 3FQEA 3KXHA 3EYIA 1MRYA 1TW2A 3UOHA 1PUEE 5C1QB 4LLNA 1GXPA 3GU6A 3OCBA 2XM8A 2PVLA 2YDJA 4DINA 5DE2A 3F8NA 4FKLA 3QTUA 2IPQX 3DXJF 3DZQA 4ZP5A 3OCTA 1W7PA 4U79A 2VRXA 2EXMA 4X0MA 3ZO4A 3O50A 3PE1A 5HQ0A 4A0ZA 3V5LA 3DLZA 2YZAA 2P2IA 3IL2A 4LQMA 5GZ9A 5KUPA 1TTYA 3EQGA 4CZZA 2R3JA 4C34A 3RKXA 1CF7A 3BIZA 3Q6WA 4A2UA 3F69A 4CFXA 3EQCA 2F7XE 3PVBA 5HO7A 2G7HA 3MPTA 5LXMA 4FV4A 4ZS4A 4C3FA 4MYGA 2WMUA 3VQHA 4X2JA 4BNCA 2BAKA 2A68F 4L00A 3BJOA 5C4KA 4MKCA 3SZTA 5LVLA 3QGWA 2D2WA 5HG7A 3OUNB 3MWUA 4R6VA 4FV8A 4X2GA 1OIRA 2IG7A 3Q5FA 3R8PA 1KQ8A 4AOJA 2Q8KA 4HX4A 1F9NA 2F5FA 3MV5A 2L02A 5L3CA 3QU6A 2V5QA 2WO6A 4FV9A 3ORXA 2OXYA 1T39A 2VC1A 4R3RA 3LFSA 5C01A 3LSTA 1WBTA 1ZGAA 4ZY4A 3VUKA 2P5KA 4DG0E 3QA8A 3HECA 3SVVA 1YOMA 4CXFA 4U8ZA 4EHVA 1IAWA 4WO5A 5ANJA 4D5HA 4DGLC 3L9LA 1NT2A 4WG5A 4QP3A 3VJNA 4UWBA 4AIJA 1JNKA 4B8MA 1WZYA 1AWCA 4RVLA 4GFOA 2WMWA 3Q9XA 2XASA 1MQBA 4FVPA 4TYEA 2X6DA 2YM8A 4F63A 3F2RA 4DLJA 1XGMA 3ACJA 1YDSE 4XLVA 1NVQA 5D5WB 5HS7A 1KOBA 1UVRA 3PIZA 5CQWA 4I94A 4L18B 3EN9A 4FIIA 4BDHA 5KMJA 5LVMA 5E1WA 2UW3A 4RJ6A 2C5VA 4F7NA 1O57A 4L43A 5CVFA 5FXRA 1IN7A 3E3VA 1IASA 3FC2A 4YPDA 4G6LA 4EGZA 3WOWA 4I93A 5F1RA 4QYHA 2R3GA 2OF4A 3VS0A 4QMSA 3KKVA 4OLIA 2QQBA 3J80Z 2PYWA 4D4RA 1QZYA 3KA0A 4CYIA 3K3JA 4HZSA 3HUBA 4UMRA 3DK7A 4DH7A 4BCOA 1Z57A 5E8XA 5EDRA 1QNTA 3V5WA 4HQEA 3E93A 4UBAA 5AONA 3A61A 3QA0A 3BQRA 3KLNA 1Q41A 3TM0A 1MDMB 3ORPA 2YIYA 5CEOA 4DFYA 3NNUA 1JHHA 3DAJA 2QU5A 4FV2A 4XG2A 3R7OA 5CX9A 4LUEA 5BVOA 1OKWA 2GTMA 2QYOA 3QYWA 4G9CA 3GW2A 2ELHA 1U54A 5EHLA 4BTFA 3QPTA 1G3SA 1RE8A 1HW1A 2OXDA 1HW2A 5EM6A 3DV3A 2BDWA 4EOQA 4E5WA 4CGZA 4GG7A 2WTVA 2UW4A 1W82A 2HWOA 2UV2A 4GT5A 2WTCA 2Z3YA 4AOTA 4TYGA 5FGKA 4KIBA 5KVRA 5FEQA 5KMNA 2XIZA 4EH8A 3NDMA 2ETRA 4U43A 4LK0F 1MD0A 4JT3A 5DUIA 2KULA 3VBQA 1FGKA 3UIUA 4MXXA 4F6SA 1ON1A 5B2MA 4D28A 1W7HA 2RNJA 4AQCA 1ODDA 3LXLA 3FBVA 2X8IA 5DN3A 4PMSA 4WT6A 4HPTE 3KN5A 1P5EA 2ACXA 2CDZA 2Y0AA 4EZ7A 5FM3A 3IWZA 3MZHA 3PSDA 1MZBA 4K2EA 1JBPE 1WWXA 5CVGA 3NRVA 4QYEA 3VWAA 3PJ3A 1V3FA 4FVRA 4YTHA 2QOBA 4O7NA 2F2EA 3EYGA 1PKDA 1FINA 1O3QA 1OIUA 3P9IA 3VF8A 4OIPF 3C13A 5EQYA 2X2MA 3PRFA 3M1SA 3RK5A 1FYLA 3BYVA 3LQQA 4DFNA 3UZRA 2UZWE 2XKOA 2O8YA 2OO8X 2PEXA 4RIOA 3KE2A 2B0QA 3OOMA 3LA2A 2X1NA 4LOPA 4NKSA 4USFA 4XOYA 3SRVB 3OOPA 2EFWA 2FBIA 3KMWA 5IQEA 3E6BA 2WAJA 3QRUA 3ZEPA 5CZIA 4CT2A 4FUYA 3PQJA 4MVFA 5LWNA 2OA4A 3C0HA 4FE2A 2ITTA 3LXKA 2G1TA 3OT8A 3MVLA 4I21A 4QMNA 3IG7A 4YNEA 1Q97A 1TKIA 4EL9A 4S2ZA 2O65A 3DKWA 5I4NA 3HHGA 3V8LA 1YW8A 4TT7A 1HSTA 2GS6A 4GVAA 1OECA 2BZJA 4ZSAA 5IEVA 3EQDA 4B0GA 4F0GA 4LG0B 2BKKA 4ENMA 3ULIA 3ZUVA 4KD1A 2CLXA 5JHUA 2ZDUA 3OCSA 4FEUA 2W4JA 1OVEA 1UWJA 3KCCA 4JXFA 4MNEA 4IM0A 2W57A 5BVFA 5EEHA 2WIPA 5ICCA 4QQTA 3R21A 4EKLA 1U2WA 3KN6A 2HQNA 3DJ7A 3F3ZA 3JY9A 2UZKA 5K1YA 4EYMA 4U9AA 4A9UA 2PVYA 3G6GA 4WA9A 4IZYA 3WF7A 2L54A 5FEEA 1H01A 4HV5A 5CI6A 5B2KA 3QQUA 4D58A 3MZYA 4FKQA 3HTUA 4I6HA 4JBOA 4EOJA 2GNJA 3ZYAA 2F7EE 2IA1A 3R73A 2GNLA 2WOTA 3WILA 4S33A 1OL5A 4CCBA 4XP3A 5LHHA 1FLIA 2IVVA 3ZOSA 3D94A 2C30A 2ZCWA 1Q99A 5ETCA 1QPEA 4QOXA 4LL5A 4FZAB 4IB5A 2JRTA 3PY1A 1O3RA 2IO6A 4HOKA 4ANNA 4H3PA 4IDVA 4PF4A 2ITQA 3ZLWA 5LVOA 2R3OA 3GP0A 3BKBA 1UU8A 2C6EA 4RGUA 3UQFA 5J9LA 4V0GB 2H09A 1XGOA 2E9UA 5E8VA 3HOTA 3U9CA 2DS1A 4D0XA 5E8IA 4XH6A 4CQGA 1JSTA 4AT3A 5CSHA 4H36A 2G2HA 4XG9A 2AYPA 5J8FA 2B9IA 4JL9A 2M1BA 3MA3A 3LVPA 3DNEA 4WF2A 4J53A 2HW7A 4FR4A 3TUCA 4A4LA 4FTOA 4P96A 1YQJA 3QL8A 4QMMA 1HCLA 5D9HA 1FOKA 3DJ5A 1R7JA 1LEBA 3L8SA 3TCPA 3FKLA 3FM5A 3BJAA 4CFMA 3V5JA 3CE3A 3ZN1A 3ABTA 1Z6TA 2H34A 4OBPA 4AGCA 5ETFA 3VN9A 1ZLJA 1G8SA 5CEKA 5EYKA 3K54A 4AT5A 4ASZA 4AX8A 4ETSA 5BYZA 3WYYA 3CPBA 5K3YA 2ISYA 4DYMA 4LGDA 1F5TA 2OIBA 5GIOE 2EB3A 4MGRA 3E8EA 3FDNA 1KU7A 2B52A 4MQ1A 1CSNA 3RTPA 5A2QZ 3TV6A 4GJ2A 2VTHA 3JTHA 4ZZMA 4CMUA 2YX4A 1ULYA 3VS1A 2UXNA 3ZU7A 1KA8A 1W0XC 1PXPA 4HQMA 1WFCA 2VBWA 1OUKA 1YW2A 3VB2A 3TKHA 4F9AA 2R2PA 3E8CA 2YDIA 1H0VA 3VBTA 1BBYA 3M11A 5HDNA 1Z9CA 1LDJA 2VU3A 4ITHA 4I01A 3SXFA 1G6NA 5CVIA 2PQ8A 3POOA 4XRFA 4JR7A 1J5YA 4FX4A 3GO5A 4P9FA 2LF7A 5EKNA 2ZBKA 4LJZF 5J5SA 4HBLA 3F7ZA 4IHPA 4ZJIA 2M5WA 3TDVA 1DPRA 3FSFA 4PGHA 2NRUA 3K3IA 1AD5A 2C6DA 1JOWB 3LKMA 3E5QA 2X0LA 3SDJA 3MPAA 5JT2A 3ERED 4EMSA 1ZMVA 1GIJA 3V3VA 2ITOA 2QO7A 3DOGA 4M12A 4C33A 1OKRA 4GFGA 3VUGA 4FKSA 2J0KA 2PMOX 2VONA 4BN1A 5DEWA 3IGGA 4HX7A 5FTQA 4EQUA 4X2NA 4IVNA 2R9SA 4JQEA 4KSQA 4R8QA 3PJ2A 5DOSA 4FKOA 2JIUA 4QMOA 4D2SA 1VYZA 5JFSA 2HYGD 5J1VA 5CU3A 2C1BA 4PPBA 3F66A 3GCSA 1Y0UA 2NP8A 4DTAA 5IQCA 3KXGA 2ITYA 3LE6A 2WMTA 2MD5A 1PXMA 5DA3A 3CDHA 4FTAA 5D11A 4RC2A 3EQBA 3HUCA 3J81K 5CVUA 5F9EA 1M7NA 1JKTA 3N4TA 3LA7A 5DCMB 4Y85A 1ATPE 4ANOA 4EM0B 1TQMA 3MGYA 3UTOA 2R3IA 4MBLA 1YXXA 4AZVA 5CAQA 4WHZA 4AXAA 4CFWA 2E7WA 4HX8A 4ASEA 4HNFA 2WQMA 4FV1A 5E7RA 4CVAA 3F2NA 2EUFB 5L6WL 2FUMA 4BZDA 3JS2A 2GTNA 3U4WA 4YGAA 4KSPA 4NUSA 4OIOF 3V5QA 1XH6A 4BRXA 1R5GA 2QWWA 4EK6A 4EOIA 2OK1A 4AZTA 4OOIA 4BB4A 5ICPA 4Q5EA 4D9UA 2X7OA 4RB1A 4XUFA 4QT1A 4AIKA 1NVSA 4MHGA 2E1CA 4W8EA 3IKVA 2C4GA 3UO4A 2BAQA 3DV8A 3CEKA 4PY1A 5IU2A 3EMGA 4AW5A 2IZRA 3ZMSA 4E20A 2CQKA 4E6QA 4HF2A 1E9HA 1OKZA 4DGGA 1GZ8A 4YIFA 4BXUA 4IADA 4CFFA 2ZM3A 1YXUA 2C6IA 5CAUA 3EFJA 4BI1A 5JFXA 5CS6A 3ECHA 5LEJA 1DP7P 1TW3A 5AAEA 1V4RA 4FNXA 3GZ5A 4XLPF 4TW9A 4NK9A 4AAAA 4Y83A 4WXCA 1TVOA 2DQRA 4FT8A 3D5VA 5CF8A 4AGDA 1PMNA 3LM0A 4RB0A 4GG5A 5AUVA 4CZUA 5C4LA 1JKSA 3UOJA 3P0MA 3II5A 4FICA 5EH0A 3Q53A 4WUAA 3NUUA 4GUEA 2CN5A 3SHFA 1W5TA 4QMPA 1NW1A 4BDBA 4BHPA 1YRPA 3LFNA 4N6ZA 4CXAA 4EV0A 2OZUA 5DVRA 4H39A 4L6QA 3WF9A 5IQFA 3R63A 3LCOA 3S4QA 3P9KA 3P7BA 2MA3A 3F3TA 4G7ZF 5HLNA 3C0IA 3NUXA 4YBJA 4LMNA 4JNWA 1O6YA 4GKIA 5TOZA 4F1MA 1ZRCA 1JWHA 1Y6AA 2W5AA 5AIKA 3GZ6A 2C5NA 3HMIA 4C0TA 2OI4X 2WTKB 5GINE 2HXLA 2OBJA 2OJGA 5D4RA 3G73A 2Z7SA 5F4NA 5CANA 4EJ7A 3OTUA 2IW5A 4EC9A 4ZZNA 2W99B 2ONLA 1CGPA 5HNBA 3R04A 3ERKA 2F2UA 3E62A 1O7FA 2QI8A 3DLSA 1H00A 3BV2A 1WKMA 4ANBA 2VWXA 1BMKA 2VX1A 2Y6MA 3ET7A 2H6CA 3LHJA 2OJIA 2ISZA 3TG1A 2WFYA 4QP8A 4RWKA 1GOLA 3TL8A 2J9MA 3BWFA 5DLSA 4NIFA 3S00A 4I0TA 2R3SA 3E92A 5I3OA 3W8QA 4RQKA 1I09A 5BQTA 4TTHB 4EH2A 4BTJA 4MTAA 3NYNA 3O6BB 1LB2A 2O8XA 5M07A 4XP2A 4ZOGA 3E8NA 5D6EA 4IAAA 3VS2A 4ZS0A 1FSEA 4D2TA 1Q8UA 1KSWA 2ZYBA 4JJRA 5IT9Z 1OL2A 2GPHA 4I0AA 4RRVA 2HR3A 2R0UA 3MAJA 3UOLA 4FZDB 2DTRA 3A8WA 3N4VA 4YTCA 4DEGA 5LEKA 3ZO3A 2XK7A 4FTIA 3U4UA 4AE9A 3IW8A 4ESJA 2K27A 2J0JA 3ZP5A 1ZARA 1SZMA 1SAXA 4IHTA 4RX5A 3WF8A 4U3YA 3QLFA 3FYKX 4EVIA 4FOBA 1QPJA 4RFZA 2X7FA 5I0BA 4L3JA 5EFQA 5IF1A 1DPUA 1M7QA 4RG0A 5ERIA 2ZXJA 4FYOA 2OZ6A 4DH1A 2YX7A 2WV0A 3PXYA 4C37A 4NTTA 5HOOA 4CTCA 1R3CA 1UU3A 3C5UA 4PL3A 3ZM4A 4XG6A 4TNBA 5EQPA 2YA9A 1YQAA 3ZO1A 3G5DA 4G16A 1TBXA 4GKHA 4FZFB 3LAUA 3FI8A 4FGRA 2C1AA 1XH9A 2XRWA 4L0YB 2OAZA 3IW6A 3P9CA 3I7BA 3R9DA 1BC8C 5C9CA 1MJAA 2YFXA 4LD5A 2B54A 1E1XA 1SNXA 5DDGA 1S3JA 4Y5QA 4HGTA 1GIHA 4NYEA 3HV5A 3NW7A 3CBLA 1VZOA 5J6XA 1UNLA 4IVDA 4RJ5A 5J79A 2OICA 2IP2A 1WQ2A 4C4GA 5I9UA 2XMYA 1I1GA 4JBAA 3W18A 3V8JA 1VEBA 5ICGA 4MHAA 1T6SA 3P08A 4BCQA 1XHAA 2HELA 4JRVA 5I5ZA 3N97A 1PDNC 5L4QA 3MH3A 4ASNA 5DG5A 4F7JA 1TQIA 4IW0A 2XKEA 2HS5A 2GNGA 2DWBA 2PVFA 5FFZA 4L7SA 5AAGA 3A4PA 3EQIA 4BQAA 5HX8A 4CG8A 3CS9A 5H6QA 3EKKA 2FVDA 4AA4A 4C02A 1VYWA 2NRYA 4TNDA 2W24A 5HLPA 3NMUF 4HA8A 4CD0A 4JVGA 2IJMA 2VTJA 5ANDA 2XK4A 1GHCA 1QPMA 4ASXA 4UY9A 3IWFA 4O1OA 5CVJA 4QRCA 3Q2JA 1J75A 3ZFXA 5I3RA 1ZMWA 2W4KA 3RI1A 2HZ4A 4CCUA 2ETMA 4EHGA 5IH5A 3HKOA 3ZFMA 4RVTA 5M08A 3Q4CA 2XZSA 2BV6A 2CG4A 4AWIA 1IG1A 3TV4A 4XHKB 5FG8A 1KYZA 3DCVA 3RINA 3ALOA 4S04A 5J5TA 4HF0A 2SRCA 1IRGA 3FQSA 5IEYA 3R9OA 5A3XA 4HW7A 2PU8A 1USSA 3PSCA 1DS5A 2DI3A 2K86A 4U7BA 3PVGA 2MLKA 4C4JA 3R2BA 3ZN0A 5M51A 1H25A 2DK5A 5HHWA 2CGPA 3RZBA 4MBIA 3F5PA 4RB3C 4QTCA 2WPAA 3C5IA 4RIYA 2PULA 4XG8A 2H94A 2VTIA 5J9ZA 4QMTA 1RDQE 3HSFA 4M97A 3BGQA 3E8DA 4N70A 4C2VA 2C6YA 4JG8A 2HAKA 1H27A 2VGPA 2GIVA 4ZYHA 3R7VA 5D12A 5CAVA 3RJPA 4IVAA 2X9FA 2NYXA 3IDBA 1ZRZA 1EH4A 4YJPA 4O86A 1H9TA 1H8FA 3FWEA 3QKKA 4KS7A 2ZM4A 1WBSA 3FC1X 4O96A 3KXMA 5TRDA 4YC6A 4XSZF 1KU3A 3JYAA 3NW6A 2A2AA 5TE0A 4O3MA 4O6LA 5BMSA 3MFUA 4G8XA 1PRYA 3C18A 4LK1F 4KUMA 4FSMA 5CVVA 2IVUA 3ZMUA 4USEA 3GOKA 2W9FB 2M87A 1R1TA 4EGYA 1UCRA 3LQ8A 4ZTHA 5FP5A 2IZTA 5J7HA 5F94A 4O7LA 4PTCA 2B1PA 5LVNA 4GK3A 2YCFA 1ZLKA 1CMKE 4GK2A 4F9BA 4FKUA 4B4LA 1K78A 5EM7A 2E9PA 4QNAA 4M9ZA 5KX8A 4FIGA 5J87A 1BIBA 2JAMA 3I59A 4RX9A 4IX5A 3R4KA 5JMSA 4IXPA 3KF4A 2Y8OA 1W83A 2XJ2A 3DFCB 3ZLXA 4L8MA 4ESBA 2BCJA 3KMMA 3UIBA 2ZB1A 4BCFA 3DBQA 4CLIA 1M2RA 3RIRA 3EZRA 4E7WA 3SXSA 5BPIA 3TJDA 2J6MA 1XMAA 3SZPA 1E2XA 3AXWA 5C27A 3MW1A 3LXPA 2VO0A 3MQ0A 2P7CB 3VUHA 5FD6A 3FSKA 3U6HA 1IRFA 4MD9E 4ACGA 3MFSA 3FZRA 4FT9A 4MTEA 4BDJA 2XVDA 3AQVA 4HV6A 5LHGA 5A46A 2X2KA 2R3QA 3QC9A 5LCJA 3KEOA 2W85A 5EHOA 4J52A 4E4LA 2YIXA 3I54A 1ERKA 3CUQA 3VUMA 3DBEA 3QD4A 2F57A 3H9OA 3EHAA 1W7PB 2G2IA 4AZWA 4RC4A 3CLYA 3UC3A 1L3RE 3J81Z 4LLLA 5E18F 4P2KA 5CWZA 5K4IA 1BI1A 3TDZC 3ZSIA 3I5ZA 2QENA 3DPLC 4UYNA 2FSTX 5K4JA 1CF7B 2QHNA 3BBWA 2YDKA 4AW0A 4M68A 1DAWA 4EQCA 5HO6A 1B1BA 2QZ8A 3BY6A 4FEQA 1CKJA 3SX9A 4YP8A 3LAJA 1O6KA 1KUTA 1R1WA 1FQ1B 4IX3A 4KA4A 3R7EA 3O96A 5E8WA 3I64A 4RA4A 4FIJA 5HD4A 4FSWA 3FLYA 3UPXA 5BPYA 2WQNA 2OJJA 1DM2A 5T6KA 4R7IA 1KQ0A 4RIWA 4M72A 3IPHA 1Z6RA 3KP6A 4AIHA 2ZOQA 4D55A 4IWQA 2R7DA 5DCFA 4RIXA 5J8CA 5DEQA 5K5QA 3AC1A 4D0WA 3KP3A 5HEZA 4IJAA 3FZOA 2HCKA 3HRCA 4AZFA 1PJKA 1K3AA 4ZYDA 4LFUA 4AUAA 5KKRB 3R30A 1V0BA 4KN4X 3GC8A 4PDYA 3V8WA 5M4UA 4R3PA 2X39A 3U55A 4NCTA 5CU4A 4IX6A 2JDTA 4IM3A 3TZMA 5C03A 4KRCA 3B02A 1REPC 4XRJA 4DLIA 2GHGA 3DT1A 5AR5A 3GXOA 2AC5A 3F8BA 3BYUA 3CTHA 4R7BA 1SVGA 3CTAA 3I53A 2W1HA 5DHJA 4XLIA 4APCA 2EWAA 4F70A 4Y5HA 3BZ6A 2V1XA 5HIDA 3Q2MA 4QPAA 5AR4A 3COAC 5HCYA 3DXQA 2DBBA 5FRIA 4D1ZA 4IDTA 4PX6A 4WNPA 4S34A 2PK9A 1OZ1A 5F1ZA 1LDDA 2DQ7X 3CSVA 2RFSA 3WI6A 4TZRA 3BOQA 4WNKA 4FL1A 3KULA 1ND4A 3S3IA 4KWPA 2YJRA 3IGOA 1QMZA 5BX0A 2CO5A 3T9TA 2Q83A 3VS7A 5HLGA 5JRQA 5K5XA 2JKMA 4JX7A 1Q4LA 4WNOA 1ZYRF 4L5JA 2W5BA 4QTDA 4XS2A 4WK8F 3KRLA 1CDKA 1BM9A 5JZNA 1PXNA 4BFMA 3ZFYA 1DAYA 1BIAA 4BDEA 5B7VA 4TWNA 4AW1A 3GC9A 1ZY5A 4ZEGA 2XAGA 2XIKA 3NWWA 3LFAA 1MUOA 2V1UA 5HS8A 2W96B 5KNJA 3HRFA 4EC8A 5HI2A 2VZ6A 3WTXC 3OWLA 3UIMA 4EONA 4D2VA 1ZOGA 3W6KB 2PZRA 4O22A 5M57A 3ULZA 2QO2A 5FBNC 2YJSA 4EWQA 4UXNA 3GUBA 4AT4A 4L3LA 1ZHFA 5KO1A 1R0PA 4EQMA 1U54B 4LMUA 4CZTA 3ZC6A 4ZY5A 3C1DA 3OXZA 2FSLX 3WTYC 3UIXA 4DEHA 2OJFE 3IECA 3GI3A 3P5KA 3HRSA 2PTKA 4FMQA 4EOKA 4QQCA 4BIDA 4DAWA 3QCQA 3JSOA 1YYVA 1XCBA 4FIEA 4E26A 4ERWA 4UWYA 3DK3A 2FA5A 4YZ9A 4EJOA 1P92A 3NNVA 5J9YA 5IUIA 2YLFA 2WMVA 2DPDA 5DRBA 5IDPA 5FQDC 3M9AA 3F61A 2BRNA 4G6NA 4I20A 4BAYA 2W17A 3D2IA 4M15A 3MWMA 2BR1A 2E2BA 4HLYA 1FVVA 4UEUA 3PA3A 1ZAOA 4RBLA 4USDA 3SOCA 3H10A 5F20A 1IAHA 2OG8A 4L01A 1P4WA 3WIKA 3OS3A 1JKKA 3T0YA 2PVNA 4A6EA 4I6BA 5GNKA 3WF5A 3PWDA 1ZOHA 2XNEA 1PKGA 1XD7A 3UVQA 2OH4A 3E7VA 2XHKA 1A04A 1W8CA 4ZH4F 2VWZA 5AP4A 3E6DA 2KIMA 5CEIA 4HW0A 3A2CA 4CFUA 2C5OA 3T8OA 1JVPP 3SQNA 3IW7A 3ORKA 3I60A 4NM0A 1IRKA 3W33A 2GFCA 3V7CA 2ADUA 1WBPA 4Y15A 2CGWA 3MH1A 2VNYA 3VBYA 4M8TA 3R8MA 3FXRA 3E87A 1IXSB 3WE8A 2OU7A 4CKIA 4AA5A 2ZO4A 3VS3A 4ANSA 5LARA 4HZFA 4OTIA 1DUXC 2C0TA 2E9VA 3P23A 4DQ2A 3WTZA 1PW2A 4FTJA 2PFBA 3QTRA 3EUHA 1YI4A 1PXIA 3AGMA 4DEAA 2QR7A 3QRKA 4BHNA 1ZG3A 1Z05A 1U5TC 1P2AA 2OF2A 5FDPA 3K5UA 4U80A 2IA0A 3VFZA 4MNEB 4CKRA 3NQOA 1WVYA 4G5JA 4FL2A 4FBXA 2JKKA 3VO3A 5G1XA 1FVTA 5ICFA 4MXCA 5DT4A 4NL0A 1OKYA 3D0EA 3LCDA 4AOIA 4DBXA 2XYUA 2PSQA 2LGCA 3QBNA 1HOWA 3F5UA 4CHUA 4UHTA 3LAPA 3QFVA 3DZOA 5F95A 4OGRA 4EH9A 2WTWA 4YJSA 4ANMA 1FWZA 4QLCU 5M44A 5ED4A 5BMZA 3QD3A 3ANQA 4X21A 4PTEA 4BIBA 3NR9A 2VTQA 2J50A 5K5OA 3Q9YA 2X8DA 3TZ7A 3U6JA 4Z2YA 4A0XA 2PMIA 1Q8TA 5AIRA 4FTUA 3HTSB 4EJVA 5C26A 3I5UA 5FTGA 3WU0A 5EI6A 2ZVAA 3NUSA 3SG9A 1XH5A 4O83A 4ZJVA 5HTIA 3KK8A 3O51A 2QURA 5IEXA 2XEYA 3Q6UA 2WMAA 2FF4A 4EEVA 1YDRE 3HIFA 2UW9A 2V7OA 3C4XA 2YHVA 3QTSA 2Y0MA 4QD6A 3P7AA 4U40A 3FY0A 5LGUA 4FC0A 4OTRA 5IQGA 3NEUA 2R7FA 2YIQA 1VJYA 4YG2F 1R58A 2E9NA 4RX7A 4YUQA 4KIFA 2DFIA 3ROUA 3I1AA 4HYEA 2GS2A 3QYZA 3DQXA 5ANOA 4DNCA 4EKKA 2EU9A 3A62A 4GUBA 4FTNA 4I2OA 4TWOA 4YMJA 4MXZA 5E1ZB 3MFKA 2VV9A 1VR2A 2PPQA 3WG9A 2WMSA 1OL6A 5EM5A 2QLZA 1FBSA 4Z16A 3VF9A 4FSZA 4ZTMA 2VXZA 2OKRA 5IG1A 2ZKZA 4G3DA 2OSCA 2B53A 4Q47A 5J1WA 5FXSA 4IMYA 4G2FA 5CT0A 3PXFA 3FMLA 3O23A 3RVGA 5HG8A 2XNPA 4LM5A 1G5SA 2KTYA 1NHAA 3PG1A 2NNWB 4KKGA 2FQ3A 1RW8A 5JR3A 2Y6OA 1FPUA 2GHLA 4C62A 4M0YA 4DG2E 3I6WA 5LHIA 4Q5SF 2Q2EA 4E6DA 3EN5A 5AP0A 3A7GA 1RQQA 5EYCA 1V0PA 4G31A 2CGXA 3WTWC 4YU2A 1P4AA 1H4LA 3HGKA 2I1MA 4RPVA 1P4XA 2VBXA 3MCZA 4JIKA 4L9TA 3KLOA 4ITJA 2XK3A 4TWCA 4E3CA 2Y48A 2Z2WA 4X2KA 4DH3A 4NT4A 1BJAA 3I5NA 3GC0A 5M4CA 3KXZA 5CSPA 2CNVA 1LQ1A 4EHZA 5AUZA 3U87A 3BJ6A 2C3IB 2DO7A 4YSMA 1R23A 2FGIA 2IW8A 3BLRA 1TNSA 4FG7A 4K0YA 5JEBA 1KU9A 3LMGA 2F7ZE 1IEPA 1LEWA 4IAZA 5AEPA 1H24A 4O2ZA 5LMKC 3TZ8A 2XNGA 4MXAA 4R1VA 1QPDA 2FXAA 1UA2A 4G7OF 1ZRFA 5CF6A 3EQFA 2FU4A 3AC5A 4M6YA 2JLDA 3LFQA 1PXLA 5GJDA 2ESHA 3C4EA 3ROCA 4I4EA 3EOCA 3HRUA 4BTMA 3BPXA 3FZPA 4IAYA 4IC8A 3L09A 4AW2A 4ZYEA 3ORLA 4ZLZA 1JE8A 4R5SA 3NAYA 4C4HA 2QM3A 3RYPA 4G34A 1HBXG 1UFMA 2EK5A 5KE0A 3TN8A 2GNIA 3SW4A 5C8NA 1FY7A 5BUJA 3ZONA 2A07F 3C0GA 2C6KA 3KREA 1Q24A 1S8NA 3L7WA 3ZS5A 3V5TA 4XG7A 4MEYF 1NY3A 2WU7A 2VO7A 4WOVA 4I41A 3QD2B 4I0BA 3AMYA 3WF6A 1Y8YA 1Y91A 3R8VA 4DEEA 4G3GA 3FEGA 5ITAA 1RUOA 3GVAA 2EWNA 4F99A 1B39A 1LP4A 4YLKA 2WTJA 3I4PA 1S7AA 5D5XB 5BYYA 1UKIA 4EH4A 2RKHA 2FSOX 3AAFA 1PMVA 2HWVA 2ITZA 3LA3A 4JLCA 2UZTA 3PP1A 2BILB 4A9YA 2ZAZA 2ZM1A 3MB6A 2GNHA 4MWHA 4RMZA 3UMXA 5HS9A 5ACBC 1PHKA 1KWPA 3VRYA 3ZLSA 4DT9A 4GU6A 4KIQA 4N57A 4XV3A 4E4MA 1OYYA 1PXKA 2R5TA 4QYYA 3FM3A 2BVAA 3FMDA 1FMOE 2PVKA 2AXLA 3FLZA 5BPDA 3OY3A 3WTVC 3W2CA 3R2YA 5I9VA 2V79A 2VWYA 5K5RA 4UV0A 1SD7A 4EH3A 3UP2A 1JSUA 4DGNA 3MEXA 2GU8A 5L6OA 3RBWA 1FT9A 2M30A 3QUEA 2TDXA 3MY0A 4C61A 3R1NA 4Y73A 2XKCA 3IW5A 4KBAA 2UW5A 2XIXA 5KHXA 1KV1A 1PF8A 4O82A 1B6AA 5AFVA 1L3LA 4GXOA 2O63A 3O8UA 4FT0A 4KUJA 3FXXA 1MP8A 2FYSA 1OUYA 3TI1A 4EOSA 4P5QA 1OBGA 3HEGA 2JEDA 2Y4PA 3F9NA 3R22A 4IFCA 4WG4A 2I0HA 1UHMA 4C7TA 4LOQA 1STCE 4QTBA 1H08A 1KGSA 4YZNA 3R9RA 3NAXA 3PZEA 4IIRA 5J7BA 4GU9A 1XJDA 2RG5A 1IN8A 4KIGA 4XEYA 5KMIA 4HJOA 3NEWA 2A1AB 2WWYA 2I6LA 3ORMA 3DBCA 3NW5A 4K2RA 3R8ZA 3GEQA 1D5VA 2ITWA 3QTQA 1HCKA 2NRAC 4H0EA 3BROA 4FX0A 1OL1A 4EJWA 1Z5MA 4M66A 2OXXA 5GHVA 1LJ9A 1MKMA 3CC6A 5AR8A 2CSNA 4XCUA 4WXDA 4YJUA 4L0ZB 4EJTA 3JSPA 2ZB0A 1YHVA 2ZJ2A 1AGWA 2QR8A 2PMLX 4AF3A 3QX2A 2VT2A 2QQAA 4OTQA 1IA8A 1UWHA 2HQRA 3JXWA 4JDHA 4ASDA 3LLAA 3KCFA 3K1NA 5DH3A 5CAPA 4XJ0A 2G01A 2FEZA 4CV8A 1F4KA 4UN0C 5T3QA 4PWNA 5D5VB 3BU3A 5AR2A 1TNTA 4YZDA 1BX6A 2W1DA 4BZOA 2AS5F 3ENHA 4M13A 5JFRA 3PJ1A 4ITIA 4NIFB 1V1KA 2WMXA 3C4CA 2MLGA 1UU7A 2ETKA 2PZYA 2HK5A 3I7CA 4XP0A 3CLOA 4FKVA 4X2FA 5EI8A 4M74A 4L68A 3BYSA 4AGWA 4PMMA 3QRFF 3Q4TA 2X81A 1I5ZA 2Z33A 2RVCA 2XS0A 1R1VA 3QCSA 4W4XA 3EQPA 3S1HA 3V51A 1USTA 1OMIA 4O0SA 3QWKA 4JG6A 3K9TA 2I0YA 5HE2A 1XB4A 4DFBA 3UQGA 4BDFA 3AC2A 4DG3E 3RPYA 3TZ9A 1PY5A 5KMKA 2XH5A 3CO6C 4GIIA 2PMUA 1H1PA 3GFEA 4Y13A 1KU2A 2QNJA 4LV8A 3DFGA 4YJNA 1GZNA 4J8NA 3I6UA 2O03A 2XP2A 3V8KA 3OWKA 2WKMA 2AUHA 4LI5A 2VNWA 1R36A 3HNGA 3H30A 2Q0NA 3ZC5A 3FXWA 4OTPA 3UNKA 2GNFA 4WXHA 2QOFA 4GGGA 3GU8A 3GCQA 5E8GA 4NEUA 2QBYA 3ZLYA 3EN6A 3VW6A 4WSQA 4OBOA 1YOJA 3W6JB 2VWWA 2YZLA 5JI6A 2YCQA 4MF1A 3DPKA 2NPQA 5A54A 1WVWA 4BDGA 2IPXA 2ZNZA 3QLGA 2CCHA 2G15A 4PV0A 2GMXA 3PIXA 2WQBA 2VGOA 4BGGA 1XH7A 2YR2A 5AP3A 4M9SA 1SMTA 2JD5A 4UMQA 4P5OA 5EDPA 2O64A 3HMOA 3UVRA 2BIYA 4ID7A 3FMEA 3COMA 1U6GA 5HE3A 3BELA 4HVDA 3KK9A 4OR5A 3K1MA 3O2PE 3QQFA 3NVMB 3TNQB 3OHTA 4BTKA 4G6DA 3BGPA 3CQWA 1U78A 3FZ1A 2XKDA 4FTLA 3MVJA 5HDGA 1UB9A 4NWMA 4RAYA 1D8KA 4HYSA 5DEYA 2W06A 3KU2A 1FGIA 2JKQA 3ATTA 1TQPA 4C57A 3IHUA 3R60A 2FA2A 4XBUA 4PQNA 1DI9A 3DKCA 1SYKA 4DCAA 5CNOA 2JZYA 3RKBA 4MTDA 3MN3A 2VX3A 2B0LA 4APPA 3R83A 4RB2C 3JVRA 5DYJA 2CHLA 1R1UA 5L2SA 1A9UA 5D7AA 4O0VA 2J4ZA 3HDNA 3ZDIA 4GH2A 5EYDA 2HTSA 3FAAA 4KNBA 4B09A 3Q04A 3EL7A 4F9WA 2EA4A 3U6IA 3BZ3A 4M69A 4O0WA 2VTNA 3LCSA 3QALE 4FTKA 3DFAA 1XMKA 1XBBA 1HXDA 4L9IA 4B8LA 3MI9A 5HBHA 5FWKK 3QGYA 4U0WA 3HMNA 2X2LA 4MK0A 2R4BA 4MXOA 4UNOA 4RIYB 2W0JA 5IQIA 3UGCA 4K6ZA 3CJGA 1M2QA 2CLQA 2V6CA 2JDVA 5HDKA 4BCKA 2QO9A 5CSWA 4R5YA 2Z7QA 4Z3VA 3I81A 5BOXA 1FP1D 1J0RA 3QTWA 2D1VA 4Q2AA 3E3PA 2EXCX 4MD7E 3D7TA 3F82A 3G2FA 1QCFA 4HAMA 2CN8A 3V6RA 2GQSA 2V55A 2ZMEA 4OTGA 3SV0A 1R22A 5BVWA 5CVRA 3P9JA 4MBJA 1ZRDA 3R02A 3TNPC 3C3WA 3OC1A 2BE5F 5I9WA 4EWHA 1QGPA 5IA5A 2P3GX 1JQHA 3IKTA 3O3KA 4OMZA 3UNZA 1K7AA 4DEDA 1U59A 2QC6A 3M7GA 1JKLA 4FYNA 4JQFA 5FBOA 1IF1A 2QQ7A 2OJ9A 2X7GA 1P4OA 1XGNA 2R7IA 2HFHA 5JGAA 4RGRA 5LMBA 3PRIA 4AZSA 5HO8A 4G6QA 2B55A 2FSWA 2VBYA 3BP8A 1GY3A 3TKUA 3A99A 4PP7A 5JK3A 4V04A 5CF5A 3M2WA 1K78B 5DYMA 3HUGA 1R00A 5D8LB 4F65A 3VNTA 4I22A 5L8LA 3I59B 4R1YA 5DD8A 3TGNA 1LVAA 3VC4A 3NUNA 3EWHA 3DA6A 3QRTA 4KBKA 1OB3A 3DTCA 4RZWA 3HX4A 1R5HA 1EV7A 5L2IA 3WGIA 4CEGA 2O0YA 4EOOA 1G3YA 5TF9A 5CYIA 3TT0A 4HDVA 3G15A 2RFNA 4DTKA 3MVMA 3RPUA 4BKJA 3E63A 4MF0A 3R0AA 4J96A 1FBUA 3R61A 4BWKA 5H8BA 4M71A 3KY2A 2Z02A 4B8XA 2QD9A 3RAHA 4E4XA 4TV7A 2WQEA 2QU6A 4BCNA 3FHZA 3P7CA 3OTVA 2L3DA 1GJOA 2UZLA 2VTSA 4GK4A 3CUQB 3N51A 4TWPA 1O9UA 1YS7A 2REIA 3DBFA 4IX4A 3WARA 1MGTA 3FF5A 3R01A 2LSOA 4F9YA 3R0JA 3PXRA 3B2WA 3RWQA 5EKOA 4CLJA 3QQJA 3CD8A 4WUNA 4FSYA 4M67A 2Y4IB 3UE4A 2HYYA 5IKWA 4CTBA 4XG4A 4RGJA 2DT5A 3Q3BA 1GZKA 3OD6X 4YJVA 3R28A 5DT3A 2QQ9A 4OTWA 5HBJA 1YW9A 1OBDA 3ROYA 3MDYA 3O17A 1WMKA 3RKYA 3ISPA 3OP5A 5BNJA 4Q9SA 4XMOA 2GA2A 4AZEA 4RIWB 3DNDA 2VN2A 4HGSA 4I1ZA 2ACJA 1KE6A 4FZ7A 2Y9QA 4BYIA 4Z7HA 2QVOA 5HU3A 4L9VA 2GA1A 4FTQA 4RIXB 1JPAA 3ITZA 4XV1A 5BYLA 2HOGA 4EH7A 1S9IA 1OI9A 2BKZA 5CLPA 3OW3A 1HKQA 3FPMA 2BTSA 4KYWA 5HTBA 4KA3A 1H1WA 4OW8A 4YO6A 3WTUC 5AV0A 3MFRA 5D7VA 1Q8ZA 5IQHA 2XK9A 4HF1A 4AP7A 2BZHB 3H3UA 3R71A 3A7HA 3ORIA 4AU8A 2CKQA 4ALWA 5H3QA 2WHBA 2FH9A 2ETHA 4A5NA 1IN4A 2HZTA 3TO6A 3E3BX 4CT1A 2X9EA 3E64A 2DU9A 5BVNA 5L3AA 2O5KA 3OEFX 4FV6A 5L2QA 3NIZA 3KL8A 4M6XA 2XJ1A 2ERZE 3VBXA 1J59A 2UW8A 4F08A 4BDDA 4YSJA 2XUUA 4I98B 3TXOA 4O6JA 1MJ9A 3U1DA 3ZTXA 3LJ2A 2STWA 2A6HF 1XCVA 5AIPA 3KULB 3FL4A 4WX9A 4HVIA 3QRIA 1A48A 3EFLA 1T0FA 1OPJA 3G6HA 2J5OA 2I0EA 5HBEA 4LB5A 3UQCA 4YURA 2Z7LA 1CKPA 3RK7A 1W4MA 5FFXA 3AMAA 3Q9WA 2J5PA 3QKLA 3T8RA 3UDBA 4BIEA 4YHFA 5CJ9A 2XCKA 2OIQA 4S31A 4YO4A 4FIHA 5LCKA 3KETA 2JFLA 4ONAA 3ZMMA 3PSBA 2Z5UA 3IDCA 2P5LC 3MH2A 4QP4A 5FGMA 2IVMA 5IUGA 4FSUA 5H9BA 2R3RA 4F64A 5HVJA 3BE2A 4IZAA 3R7IA 3P4KA 3RNIA 3LZBA 3TTIA 4Q4ZF 4HGLA 2XEZA 2C68A 2RFDA 2QOKA 2VTAA 2P0CA 4QNYA 3KP2A 3ZO2A 4U3ZA 1YI6A 5L3DA 4YFNF 4F0IA 5CYVA 5HLWA 4QMUA 2IJLA 2V22A 2B7AA 3A7JA 4Y95A 3KQ7A 4O21A 5A4LA 1KE9A 4I5CA 4UWCA 3S2PA 3HRBA 5IH4A 4BDIA 2QOHA 4CNHA 4PP9A 4D2RA 3V5PA 3WZKA 2IVTA 4DEIA 4LB6B 1WCCA 3BHVA 5BUIA 2A19B 1YHWA 3GLXA 4Y17A 5B0XA 2PJPA 5DPVA 2W4OA 4A9RA 3RMFA 2ZV7A 2YERA 4Q9ZA 3RDIA 3OMVA 4X7QA 4TRLA 3HOSA 1J1BA 1CM8A 4B6LA 2BRMA 1SFUA 4Z7GA 2XRNA 4NJ3A 4ZZLA 3GT8A 2VE9A 5LJJA 3M8FA 3MY5A 3H3CA 5E9EA 4FF8A 4A06A 1S7OA 3DKOA 3TWJA 2HGCA 5JZJA 4O27B 3A60A 3ORTA 3PLAE 4I0SA 2HKXA 4F7ZA 2C6TA 4HCUA 3FHRA 3V6SA 4O7VA 5ILVA 3POZA 5J95A 3D7ZA 4PMPA 4S05A 1XSVA 4IHSA 3BYOA 4TYJA 3CXWA 3R7GA 4A9SA 2BIKB 2K02A 3PYYA 3BX5A 3B73A 2YAAA 2MH2A 1OPCA 1STZA 4EBWA 3CGFA 3VBVA 3IDPA 3D83A 4D4YA 5AADA 5H2UA 4FK3A 2FBHA 1BI2A 3G9NA 2R3PA 4M14A 2YIWA 5AX3A 1J2XA 4ZAUA 1BOAA 2CW0F 3VHEA 4G1WA 3DAKA 1SVHA 3IQ7A 2XK6A 5M4IA 2EJRA 1H0MA 3MJ1A 5HCZA 1FSHA 3LFEA 4ZTNA 5GJGA 2WTIA 3OY1A 4LV5A 4U0YA 3SAYA 3QZIA 2NAZA 2XKFA 4MXYA 5AR3A 4O91A 4QQ5A 4EOMA 4O7TA 3RHKA 3OW4A 3ZXZA 1PXJA 2JT1A 4I92A 1YHSA 4ZTSA 1YXSA 2F4JA 4V05A 4FNWA 5KHWA 3NRMA 2IWIA 3GCUA 2I7QA 3GYHX 2X8EA 3FMJA 2Y7JA 4RVKA 2WEIA 3KRRA 3G3ZA 1K9AA 1B4AA 4QYFA 2X0GA 2CKOA 3BEAA 4U0VA 2D1HA 3D0SA 3D15A 3GENA 1A06A 5AV1A 2WZJA 4U7DA 2W05A 1ZH5A 2JBOA 4GRBA 5AWMA 3BDDA 3RJCA 3GC7A 4ZSGA 2JDSA 2W25A 5ACKA 4MQVA 4JDKA 4P7EA 4IACA 2GDOA 3AC3A 3U51A 2OFVA 3TOAA 1Y57A 3K2LA 3BEGA 4C3PA 4NM7A 5JGBA 3VVHA 1O3TA 2XA4A 5AMNA 4IWDA 5EW9A 4DFLA 3S95A 3PPJA 4H1MA 3ATSA 4CGAA 5HNGA 5KMMA 4QP7A 4WCGA 5BVDA 1ONVA 3GCVA 4L52A 5K5NA 2J2IB 4LL0A 4CV9A 4E8AA 2PL0A 3MYGA 3GU7A 1PMEA 4ERKA 2LF8A 3JPVA 2A0CX 1U5QA 3L1SA 4ANQA 4X6RA 5EW8A 4TYHA 4BDKA 3VAPA 2H6BA 4LRKA 4KMFA 3QCYA 4QTEA 4NZWB 3KVWA 3R1YA 2PE2A 3TEIA 3GWZA 3AG9A 4BYYA 3SFZA 1Q8YA 4FIFA 2HXQA 4QWQA 5CEPA 2G2FA 4ZY6A 4C36A 3P79A 4RJ8A 3SGCA 4GT4A 4FTTA 3QQHA 1LPUA 3RM6A 4CG9A 3V8TA 3FMKA 3U9GA 4XNEA 5JQ8A 3PPZA 3Q4UA 4L42A 1L0OC 3FMMA 4I4FA 3SC1A 2C69A 3PJCA 2HOEA 4PDOA 3O8TA 3OV8A 5ETAA 4QO9A 3IOPA 2BPMA 1XWSA 2QKRA 5LWMA 3CIKA 4YFXF 4BF2A 1Q3WA 3F5XA 4ENXA 4QP1A 4EUUA 3P7NA 2VWBA 3OCGA 4QMQA 2OU2A 4EYJA 3D5WA 2BZKB 3OEZA 4OTFA 5BS6A 5M56A 5AV3A 2QLQA 4HCVA 4U41A 3RPRA 4LMYA 5CEQA 2PVJA 3LOKA 4QMWA 4HDUA 2I40A 3OWJA 4F1TA 3EN7A 2PWLA 3PUPA 6PAXA 4PNIA 2B4SB 3Q60A 1ZOEA 4BDAA 1FC3A 3BU6A 1YLFA 3PXZA 4N0SA 4LUDA 5IQAA 1PP8F 3KEXA 4L44A 5M06A 3ZUTA 4ARKA 2V1DA 4FNYA 4BY9E 1ZG1A 1FVRA 2CKEA 2WMBA 4HOBA 3TQNA 4K1BA 5IH6A 4AGUA 2LNBA 4D1SA 2CMWA 2OLCA 3IW4A 1P6RA 4Y72A 4KNYA 2UWMA 2XB7A 5FUTA 4JRNA 4GO1A 4PGGA 2CNUA 1T45A 2UW6A 3QXPA 5LLQA 5A4EA 3CP9A 3FLSA 2QCSA 5E8TA 2VO6A 4E4NA 4EUTA 4BCPA 5A14A 2KIFA 3OF0A 2WTKC 3RCJA 2JSCA 1UV5A 4QP6A 4LYNA 1Q62A 5ICEA 5FD2A 4FSTA 2GWRA 3LCKA 4KRDA 1EH8A 3I0QA 3DB8A 4HYUA 3V8SA 1Q1HA 3FWQA 4K8AA 3CTJA 1K2PA 1RZ4A 2VAGA 2W1FA 4PNKA 3ECOA 1QL6A 1OL7A 1R0EA 1J7LA 3ODZX 3PDTA 2XF0A 1UKHA 3L00A 3R9HA 3V04A 3JAMK 4OAVB 4JQ7A 4FV0A 3TO9A 3LJ0A 5DBXA 2UZNA 4EM1A 3HA8A 2YISA 1FYKA 4MH7A 3RKWA 4G9YA 5HU9A 4WBOA 5I9ZA 2CFXA 4U6RA 2ZV8A 4DC2A 4NFMA 1X3UA 2GFSA 4UVCA 2H27A 3UO5A 3DK6A 3FI4A 4D1XA 2UW0A 5KBQA 2YN8A 4G3CA 4HGEA 4GW8A 2PUUA 3CJFA 3F6XA 4C4IA 2XAFA 3F6OA 1U5TA 1S29A 5EDQA 2K7LA 4BBMA 3RP9A 5TT7A 4O7SA 3HMMA 4JG7A 3PA5A 3LFKA 4D2WA 3ZEWA 4QMVA 3DQWA 4G5PA 2F9GA 4KN7X 3QHWA 2ZMDA 5ILSA 3EFWA 2F2CB 5E91A 2WEVA 4CKJA 2FMYA 2XNNA 4O2PA 5E4HA 5K9IA 3REPA 3TOBA 3MIAA 4FSRA 2FO0A 5CSXA 5AUYA 2L4MA 4IVBA 1R39A 4Y8DA 3GXLA 4JX3A 4P90A 2PVHA 4FT5A 5CU0A 3FI3A 5FB2A 4GMYA 5HD7A 4TY1A 4J8MA 3FUPA 2QVSE 4GYGA 5DR2A 3BBTB 3BHYA 5G6VA 3TNHA 3BLQA 4A4XA 1B38A 4BGHA 2BRGA 5KBRA 5IT9K 4XYFA 3MFTA 1NVRA 3COHA 3HYIA 4CRLA 1HKTA 1OIYA 2ITXA 4ZZOA 5HICA 4N4SA 5IA0A 2XUBA 3T5XA 5KMOA 1TLHB 5TO8A 1J7KA 2PUPA 2QHMA 4D0PA 3Q96A 4CMTA 2PE0A 4BZNA 4KAOA 4F9CA 1BLXA 3DKGA 4BL1A 4W9XA 2P8TA 5HIBA 3F3XA 2GAUA 3KC3A 3TDUC 5HZNA 3W2PA 4N0BA 3ANRA 5EK7A 1UNGA 2K4JA 4G9RA 3WODF 5JVTA 2QKWB 5CU6A 3TNIA 4IC7A 4BCHA 2YU3A 3ZRMA 1Z9XA 4E6CA 4JDIA 3FKNA 1IXCA 2J0LA 2ESNA 2H96A 2WQOA 3C7QA 2M45A 4K9YA 3EKNA 2RN7A 2EFOA 3A4OX 1P14A 4U7ZA 1BI0A 3DEUA 2R3LA 2O0UA 1Z7UA 3KF7A 2XBJA 2RGVA 3UMWA 1LUFA 4G94A 3QQKA 2YEXA 3IKAA 3HSEA 3FHIA 2OIDA 3ZMTA 4ZSJA 3UZPA 4BH9A 4C38A 4O7YA 4YLJA 2UUEA 4H05A 3WE2A 4IWPA 2UZDA 3KXXA 4UUVA 4F6WA 3QC4A 5HOAA 4CYDA 1ZY4A 4ZSLA 3OXTA 2IZUA 3HV3A 4OT6A 2UZEA 2P5VA 4FTMA 5GJFA 3SKCA 5AUWA 3NCZA 4MCVA 4W8DA 3C51A 5CENA 1G8AA 3SW7A 2XNBA 2ITPA 4R3CA 2ZV9A 5DI1A 4DF3A 3NCGA 2ZMCA 2L4AA 4D2PA 3HAMA 3AT3A 1ZYLA 3HMPA 2YITA 3L2CA 4JAJA 2H9VA 4RSSA 3ZRLA 1ZGJA
chains in the Genus database with same CATH superfamily
3TV7A 3HP5A 4BHBA 1BI8A 2JGZA 4ZXTA 4KMUX 2XYNA 3COIA 3UC4A 4ACDA 2QOLA 1YWRA 4NW5A 1OYIA 4NC7A 4CYCA 2BRBA 1XSDA 4FSQA 2UZVA 4ZDLA 1LEAA 5LMKA 4RGXA 2KISA 2YSRA 1NA7A 2QSFX 4MEXF 5AIQA 5DRDA 3PLSA 5IQDA 4RZVA 4D9TA 1DDNA 4FOCA 4MQ2A 4ZLYA 4A3JJ 4YLLA 2PUNA 5LMAA 3W3CA 4DGOA 2P2HA 3MTLA 3E7OA 3FY2A 2X85A 3G2BA 2R7BA 1PUFA 4G7HF 3UG1A 4NKAA 3J7YJ 4O0UA 3W10A 3F2AA 4AN9A 1MBGA 3FV8A 3WBLA 4GDFA 2JC6A 2A61A 5F64A 3RAIA 3C50A 5IA1A 1D0YA 2OFUA 4IEBA 1WBVA 2BMCA 4XRSA 1T95A 1Z91A 4UV8A 1YTYA 3L8PA 4MEDA 4GVJA 4M84A 2V9PA 4XX9A 5BMMA 3OBJA 1X1CA 5DIAA 4KIKA 2RG6A 3EETA 4U5JA 3LFFA 4O84A 2CGVA 2W7XA 5KMLA 5GTHC 2KJBA 3HSRA 1IZ1A 1J3HA 1XBAA 1YXVA 1BW5A 1RESA 1SD4A 4NSTA 4ENKA 5CTPA 5D5UB 2NNYA 2QBYB 4IRHA 5EEGA 4AFEA 4D4SA 2K40A 3OUKA 3TUBA 4UALA 5F04A 5HG9A 4WBBB 2Y75A 2ID3A 4R78A 4FA2A 2IN6A 3NLBA 4F0FA 3QPHA 3SD0A 4NFNA 2BDJA 3ZZEA 4RC3A 1DU0A 2HEOA 2HYFA 3CR0A 4ALVA 4CZYB 2W1IA 3W55A 4G17A 2WTEA 5CNNA 1SNUA 4NTSA 3BCBA 2Y30A 5IY5H 4CQEA 2J5EA 2K9SA 4YFKF 5JN2A 3UP7A 3OT3A 3FL5A 1QHGA 2XPVA 5F6FA 5DV5A 3SEZA 4UYAA 2O6GE 2VWUA 5L2TA 4QMXA 3KRXA 3QP6A 1U3EM 5AUXA 1P9QC 3TUDA 1P2FA 2OGVA 1ON2A 3BTCA 1GAGA 2YWVA 3I71A 1LDKB 4FEWA 2COMA 3AG3H 4BKXA 1OCZH 4AVPA 4G3EA 2QLUA 4XG3A 4LG4A 1FBNA 1OPKA 2K9MA 2XAOA 3F8MA 2L9RA 1ZZLA 2ELKA 4PZJA 2M4KA 3A0HC 3LFDA 4WRGA 1PMUA 4JIAA 4O81A 2CKPA 4C8BA 5K0KA 1V5EA 5CSVA 2BFXA 3ZBXA 1YWVA 4O7ZA 4CCOA 2LVSA 2IGNA 1SD6A 2JPCA 4U44A 1GNGA 1MRUA 5AAFA 3AGLA 4LRJA 3O8PA 5FRMA 2JIIA 1AKHB 2EB2A 2P6SA 4FSNA 1AQ1A 2NVXJ 5CXHA 4A69C 5KZ0A 3BT9A 4E5BA 1IR3A 5E8ZA 2DK8A 4ACHA 3EZVA 5HTCA 2DJNA 5L3EA 4YJQA 5E1EA 3E5AA 3TL4X 4OTHA 5GP9A 3JRHA 4M69B 2L7MP 1T2KA 4QDEA 2UVZA 4FASD 3N4UA 1Y6IA 3QQGA 4EH5A 3MESA 4MAOA 4JR3A 3VIDA 3R6XA 3BHTA 3RZOJ 3VS4A 3LJ1A 2V26A 4WRSA 3VJOA 1OIQA 3BRBA 3ELKA 3EFKA 3LLTA 1A35A 3BTIA 3QZFA 5K7HA 1XTAA 3H5RA 1XH4A 5KKRC 4JOAA 2ZJWA 4HSTA 3DKFA 2Z99A 2W9ZB 4AFJA 4DCEA 2DQLA 2QG7A 2PY3A 3QUPA 1DGRM 2F4MB 3R1SA 4X3FA 2E1MB 1MMSA 2BHEA 3KVXA 1V0OA 2JPBA 2L7FP 3ENMA 3D14A 4JYKA 3D7TB 3MH0A 2PLYA 5BVEA 1GZOA 1QQIA 4NJDA 5DMZA 2XIRA 3SA0A 2ZMEB 1Z3XA 4F4PA 3MBLA 3ZSHA 2A5YB 5HVKA 3HDMA 3DXNA 3GFJA 4Y4RA 3G33A 3TACA 4AA0A 3WZJA 4BVUA 5E1SA 1ZMUA 3AOXA 3DU8A 4D5KA 3MTFA 4EJNA 1VQOI 4DH5A 1SFEA 2XNOA 3H0ZA 1SMYF 1VQ9I 3WU1B 2MD0A 4BQOA 4ZTLA 1RIOH 3NPCA 1F5QA 1PJRA 3QWJA 1IUYA 4LFIA 5JSMA 1G8KA 3FPQA 2LKXA 2YACA 1ERDA 3H3ZA 4RAZA 5HIEA 4GCVA 3V7RA 4OT5A 2XAQA 5I9XA 1L8TA 3R7YA 2XRUA 4J95A 3WIGA 5GPAA 3R1QA 3KYCB 4CMOA 3KEYA 4BC6A 5AV4A 5HLIA 3QZHA 1RJBA 2F48A 1IUFA 3TKIA 3HUGB 5AA8A 3LQRA 4PMTA 5A6OA 4ALUA 1NXKA 4RLLA 1BL7A 3ONQA 4DITA 3GQLA 2M2EA 4EM2A 3QP5A 4BCIA 1GVJA 4PJNA 2O5RA 2H1KA 4FGBA 2JKOA 4R79A 2LY1A 4YZCA 4WG3A 5J4YA 3PFQA 3UZTA 4OAUC 4YZBA 1W84A 4TYIA 4UVAA 3K69A 5FDXA 5JLWA 4RX8A 4S32A 4AACA 3WE3A 3R00A 1H9GA 4N6YA 5E8SA 2CYYA 5HNIX 1MQ4A 4C2UA 3JUHA 3EYHA 3RPVA 3NUAA 5LRSA 1AOYA 3HJEA 1APME 2OQRA 2K85A 3M42A 5HE0A 4PSWA 3RQ4A 2VODA 2B9JA 4D9JA 2W1ZA 1REJA 5EZHA 4YR8A 1K61A 1WI9A 3W2VA 3VODA 3GFMA 4XV9A 4FT3A 4BBEA 3UNGC 4FL3A 4RWJA 3R8UA 3E0JB 2OZAA 3JAMZ 1IW7F 2DAOA 2BY3A 3CCYA 5BNGA 3GTGJ 1ZN2A 5AP1A 4DA5A 2WOUA 5JGDA 1I39A 2V4JC 3DJ6A 5IA2A 3H9FA 1XG1A 3FHNA 3HOYJ 4J98A 4OIRF 2LBFB 4PRJA 4O7RA 2LK2A 3ZXTA 2PZ5A 3ASOH 1OGUA 4GL9A 4L9NA 2C6OA 5E8UA 4JQ8A 4CYJA 4O4CA 2F5CA 1W2DA 3OOGA 2B9SA 3VS6A 4JK1X 4NW6A 4IANA 4K18A 4I5HA 4E73A 4KABA 2R64A 2DLLA 3ALNA 5CVHA 2R5YA 5GZAA 2LKPA 3K4JA 3MSSA 2C0OA 1J7UA 3NWSA 5CF4A 1W7PD 2HZDA 4KDPA 3BR5A 3GF2A 2C47A 3EH9A 5LQFA 3ACKA 3CF5F 1SVEA 1HKSA 3OYMA 2GQGA 4RWIA 3NUYA 3DY7A 1FPQA 1PYXA 1GXQA 5ETIA 5E8YA 4OU0A 4FV7A 3AG1H 3TTJA 4E6AA 3DCFA 2XB0X 4BR3A 3ZBFA 5AP2A 4NU1A 1GUUA 4XICA 4FK6A 4N9HA 3K7AJ 1B9MA 3DTKA 4FTHA 2VJ4A 3LWFA 3RPQA 4EORA 3CD3A 4D7MA 2NO3A 1OM1A 2CH0A 5LRRA 3SDBA 2LY2A 4BBRJ 2PVRA 1XMLA 3SLSA 1WBOA 2BUJA 3MJ2A 5H6RA 3IAM2 3EL8A 3RI4A 4O0YA 1M52A 1V5FA 2CUJA 3DTIA 4HNTA 2UXXA 3BHUA 5FLFA 2VTOA 3HV6A 2ITVA 5EOLA 4CDGA 1OITA 1T98A 2F5DA 3W2RA 5M53A 3DGKA 1CKIA 4HZRA 3OFMA 4W9WA 2HPIA 5H20A 2JDRA 2JTVA 1VQLI 3QZGA 2HIWA 2HDWA 3ZRKA 3PVUA 3BTLA 2KRHA 3W2QA 4DGMA 3UODA 3NNWA 2E34A 1J91A 3FMHA 3OIOA 3F3VA 1RR7A 3Q9VA 3P86A 1FOTA 3EDPA 3WZDA 2GZWA 3GU5A 1ZG5A 1ZXEA 3DP7A 3OIQA 2P55A 2CV1A 1K79A 3H9GA 1H07A 4GEOA 2L0KA 4IOAF 3JW4A 1DQUA 1U9NA 4ANLA 4BWPA 3HOXJ 5TGTA 1WJ5A 1H1SA 2C0IA 1YI3A 2VN9A 1H28A 1O6LA 4F93B 2FB8A 2X4FA 2EV6A 4HYHA 3P78A 1P4FA 1IN6A 3QAME 5JRSA 1JHFA 1U5RA 4E7SA 3ABUA 3GUDA 3A1YA 3JTGA 2ZDTA 2P4IA 4BI0A 3BQZA 3EUAA 5L8KA 3RSNA 4XSXF 3DBDA 2LKSA 1S6LA 5ANEA 2P7VB 4LGGA 3ORNA 2J51A 3S93A 5K0XA 3L1PA 3FZSA 4JOMA 5J1YA 2BGCA 3G0FA 2QOQA 3LCTA 4F52A 1X1AA 3LIJA 2C3LA 2HVRA 4H3BA 3DPUA 1ZGWA 1WVXA 4NNJA 1B59A 2JVGA 3B8RA 4AXFA 3WGGA 4AN2A 4QTRA 5HESA 1GLNA 2X1CA 5J47A 2PZIA 3VHKA