4GYIA

Crystal structure of the rio2 kinase-adp/mg2+-phosphoaspartate complex from chaetomium thermophilum
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
341
structure length
338
Chain Sequence
KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIARLRGGSSGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transferase
molecule keywords Rio2 kinase
total genus 106
structure length 338
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gyiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gyiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gyiA02
3FPMA 3BJAA 4YJQA 4F0IA 2W4KA 2YIYA 3ZRLA 4BHBA 1MD0A 4UYNA 3FF5A 5HIBA 5BQ0A 1PXOA 1YTYA 1R00A 3FY0A 4IWQA 1OB3A 4FSMA 3OS3A 4GV1A 4JL9A 4AUAA 4CV9A 2OD5A 3V01A 4ANSA 3P4KA 3JXWA 4I98B 3SC1A 4B9DA 3QKMA 4DN5A 5HVJA 2PYWA 3QA8A 2PVYA 1HW1A 3LJ1A 5CNOA 3L7WA 5L8LA 2A69F 4P90A 4FX3A 2IRFG 2PZIA 1JKTA 3DDQA 4HNIA 2XAFA 3FSFA 4F6SA 3CD8A 4A2UA 4AOJA 5HX8A 3DXJF 4G34A 5E1XA 1YO5C 2C1AA 5HU9A 1IF1A 3FLYA 4MEYF 4ZZMA 3IDPA 2P5LC 3LAUA 1IXRC 1QPMA 4FSYA 4ZTLA 4O6JA 3C18A 2GQGA 3K5UA 5M44A 1ZLTA 1J7IA 3BU5A 1RE8A 2W99B 3CUQA 1E9HA 4JIAA 2J5PA 3QC9A 4GK4A 2IWIA 1IG1A 2XKCA 3F3TA 3T0YA 4TYEA 3Q4CA 4D2RA 4HF2A 1SM2A 4L67A 4QYYA 3KXMA 3R83A 4WK8F 3FBVA 5J9YA 2Y75A 3EFJA 2WIHA 3ULZA 5CI6A 3RAHA 4KNYA 5HBEA 2QONA 2IZSA 5CU2A 4D0PA 4CICA 4XG9A 5DOSA 4OTIA 1D5VA 1T38A 3W8LA 4AU8A 1NVSA 4LGHA 3PUPA 2H09A 4EH2A 4PGHA 3K2LA 4R7BA 4LGGA 3HV5A 4FTLA 2QOHA 3E93A 5DE2A 2B4SB 3TNHA 3SOAA 3MSSA 4U43A 5AA8A 2P4WA 5A3XA 3LFDA 1PXNA 3S2PA 1QPEA 5HCZA 4OLIA 2BDFA 2GTNA 2RFEA 4RC4A 1PF8A 3UO6A 4R79A 4RJ6A 1J7KA 4J53A 4EH9A 3RKXA 3DFGA 4CKIA 4IVBA 4RQKA 2VTJA 2UW6A 4YZCA 5E8XA 4ASNA 4Z7HA 2J6MA 3CBLA 3QU0A 2M45A 5CENA 2XAQA 4KSQA 3WF9A 2C0IA 2ISZA 3HL7A 1GHCA 2FUMA 4CKJA 2E1CA 4XV1A 4IJAA 1B6AA 4FT5A 2XAHA 2QUFA 4E4XA 4LFIA 2EXCX 3EHAA 1OGUA 4MBIA 5AUYA 4B8MA 4GYGA 3PLAE 1NT2A 2KIMA 3PFIA 2CW0F 4L0ZB 4EI4A 3MQ0A 4ZLZA 4GVAA 2ZV8A 4MQ1A 4BCFA 2OXDA 1YDTE 3TIZA 5E1WA 2C6DA 4BNCA 3LJ0A 3S0OA 5J5SA 1I5ZA 4AWIA 2IVUA 3UDBA 3AT2A 4XBRA 3ZSGA 4N0SA 1ZGAA 4QYHA 1W7PB 3A7GA 4USDA 3QXPA 2J0JA 2V6CA 2HYYA 3SXYA 1Z57A 3JVSA 4ZSEA 3RTPA 2EFQA 2X7GA 4HLYA 4N4SA 3KQ7A 5CZHA 4I09A 4A12A 4R3CA 3ZO4A 4QPSA 2BZKB 3KETA 2RGPA 3JS2A 1CM8A 2XHKA 3EYHA 1MRYA 4BHCA 3PQKA 3PPKA 2CSNA 4JBOA 2QM3A 3S00A 3COMA 3EMGA 1R36A 4I4EA 5M06A 4EUUA 3ERED 3PE1A 4R8HA 2VGPA 4CO8A 1M7QA 3BPXA 4IRGA 3VBQA 4JXFA 4WSYA 2ESMA 2CMWA 1TNTA 4TNDA 3SDJA 3OEFX 2XBJA 3BKBA 4A9UA 4XP0A 2D1VA 5FLXK 3A8WA 5BMSA 3J80K 5IISA 4ZSLA 1KE8A 5HICA 2Y6OA 1VYZA 2PHKA 1SD7A 4TL0A 4ZXTA 1YG2A 3OZ6A 5AIKA 3UNKA 3E3VA 4CG8A 4FV7A 5IUHA 4CMUA 5HNIX 2ITUA 1FT9A 2WTIA 2VBZA 2XMYA 4OIOF 4FTJA 4L5IA 2CLQA 4IBMA 3WODF 2UZOA 3TNIA 5L3BA 1MJAA 2UW5A 4OTQA 5FP6A 5TO8A 3PXQA 5IUGA 5D11A 1SFEA 2C6TA 3GI3A 4RFYA 5KMIA 3IC7A 4KBCA 2QOOA 4WBOA 1UHWA 4RJ7A 3ZMTA 4QMPA 4KDPA 4G6DA 3UIMA 4ACGA 4IIRA 3GXOA 4GS6A 3W2SA 1Q5KA 4UALA 4D58A 3BPRA 3I59B 3JTGA 2YM7A 5DI1A 5B7VA 4NSTA 3ANRA 3AD6A 3ROYA 4R3RA 5KZ0A 1GIHA 3FC2A 1LEAA 4BFMA 4E5AX 5CVVA 3O8UA 1H1QA 3OXZA 5J1VA 4Y17A 3DP7A 4D4SA 4ZY5A 2RGVA 4KKEA 4CMOA 1GIIA 4U8ZA 1BI2A 3FSKA 5ILVA 3V5QA 4F7ZA 3QRIA 2R7IA 4FKSA 3B73A 5FD6A 5F64A 1ZRZA 5KNJA 3MB6A 5LWNA 3BI6A 3UVPA 2FMLA 2V5QA 1Q61A 3KXGA 4M69A 3R1QA 4MD8E 3MY0A 3COIA 4YJSA 1OI9A 2W84A 4Y83A 3R9OA 2X2KA 1QL6A 1TW3A 2CFXA 1VYWA 4IQ6A 4WG3A 1IA9A 3I1AA 4PUZA 3WARA 1JKKA 2J0IA 3TUBA 2OJGA 4KWPA 4ZSJA 4UXQA 1MDMA 4D1SA 3OOMA 5TKDA 4FICA 3QCQA 4YP8A 5IA0A 2QKWB 5CEKA 1QPJA 2EWAA 3EFKA 4K8AA 1S8NA 3U54A 3NSZA 2QQBA 4ITIA 3C4WA 4O7ZA 5EG3A 4YHTA 2XK3A 3R7GA 2OJFE 5CXZA 4DG2E 2IVTA 2MA3A 2XVDA 5AR2A 4HCTA 4D9UA 5CALA 4IWOA 4ACCA 5AJQA 3PVWA 5DYMA 4HPTE 3T3VA 4F70A 4C33A 5KCVA 4ON0A 2PULA 2GNJA 3IGOA 4ENJA 5GINE 4LV8A 4CDGA 3LQ5A 4FEUA 1J9IA 3I6UA 4EBVA 3H9OA 3F3XA 3VO3A 1JHFA 2YSRA 3TXOA 3D5UA 3L9MA 5HLWA 2HQNA 2BMCA 1BL6A 3QAHA 1BLXA 2CJMA 2OI4X 3GGFA 2OIBA 2XK6A 3ROUA 1JSTA 1LUFA 3D0SA 1PMEA 3AGLA 5K5QA 4I0RA 4JBPA 1BN5A 3P5KA 3OWPA 2AC3A 2GQQA 4J96A 3G51A 4C36A 4MF1A 3OUNB 3J80Z 4FKPA 4QMLA 4ZTQA 2F7XE 5K5OA 3LQRA 3CJGA 4YGAA 2IA0A 4RVMA 4O91A 3RJCA 1XWSA 4QTEA 4XG4A 4D1XA 5E92A 2OH4A 2B0LA 4XCUA 3ZQ7A 2XIKA 3K2ZA 1BBYA 3BJOA 4TXCA 4H1MA 1YVJA 3PXZA 4C3RA 2JKKA 3BQRA 2DO7A 5HE2A 4HX7A 4D2PA 5EW3A 3TEIA 5AV1A 3MTFA 4FE2A 4A6EA 4LFUA 1JKLA 3I6WA 4Y8DA 4MQ9F 4PCQA 3VS6A 1UVRA 3PIZA 2IO6A 1Y6AA 3W2RA 1IN4A 3LA2A 4LJZF 2O8XA 2W24A 2VTHA 2HEOA 1K6OA 3P08A 3NUYA 3ORNA 3UNZA 3E8EA 2WAJA 1K78B 3BYMA 4ACHA 2FRHA 5JKGA 1ZYSA 5L3GA 3ZLXA 4R7HA 4YSMA 3N97A 2JIIA 4M7IA 5M08A 2FE3A 3QRFF 1OYWA 5LHGA 3ZMSA 3G90X 3FMNA 4MX9A 1O7LA 1PXIA 1CDKA 2XYNA 4QP1A 5AV2A 3FKOA 3GW2A 4KIOA 4U6RA 4IX3A 1SAXA 3F21A 3BWFA 3LQ8A 2XZSA 4W4XA 1U5RA 2VX1A 5EOBA 3J7AO 3UP2A 2VT2A 4M8TA 2NP8A 4G16A 2PPQA 3H0YA 5KMLA 4OT6A 2CGWA 3D7ZA 4S04A 2A1AB 5IQFA 2GNIA 5CSVA 3DK7A 3LXLA 4L01A 5B0XA 1UU8A 4MVFA 5TR6A 5L2IA 4RLKA 3IRRA 1H1SA 3WIGA 1ZRDA 5K4IA 1ZXEA 4P7EA 4EJTA 4I3ZA 2ITTA 4QTBA 4MF0A 4FKUA 4W9XA 4ZJVA 4YJRA 2QZ8A 4LB6B 3V6SA 1GOLA 3W2CA 4DQ2A 3QX4A 4O0TA 3ECOA 4UV8A 3OWLA 2XIYA 3KY2A 1QCFA 3PFQA 4EUTA 2G7HA 2AS5F 4OBQA 5BMZA 1ONVA 1E1XA 1IRGA 4CT1A 5ICEA 3PDTA 4OTHA 2ETKA 5JRSA 3JVRA 1STCE 1JHHA 3KRJA 3QQJA 3C50A 4F1OA 2Q8KA 4PTCA 4Y5HA 4YZNA 1A9UA 4L43A 4C02A 3LFAA 4GUBA 4LOPA 2PN6A 4JDHA 2OBPA 2JRTA 3TZ8A 4E5BA 3O8TA 3PYYA 3HDNA 3QYZA 4ENKA 3V51A 1EH7A 3R21A 4JQEA 1T6SA 4IVNA 2PVNA 4YLLA 2YM3A 3REPA 3MWUA 3VS7A 4HDUA 4X3FB 4AT4A 4NCTC 2O3PA 3LCKA 2G7UA 2VXZA 2UVZA 3WE4A 4ZEGA 1MGTA 4D5KA 5JH6A 4UEUA 3LAPA 4KA4A 3C1DA 4BIEA 3GUDA 3MVLA 3KXHA 2C6LA 4BVUA 3ZBFA 3ZZEA 1BX6A 5JRQA 2XEZA 4N6YA 4BZOA 1FVRA 2ZOQA 1FGIA 3MVJA 4O7WA 1YXXA 1IUYA 3NUUA 2WD1A 4EQMA 2K86A 2M5WA 3Q9VA 4F9BA 2ACJA 2G1TA 2JIVA 3LFBA 2VTRA 4X7QA 1JSUA 4K11A 3E8NA 2FMYA 2Q83A 3HSRA 2VTOA 4C37A 3LCDA 4BTMA 4FK6A 2KJBA 4DT8A 2R7DA 2H94A 2BTRA 2O6GE 5FD5A 3OTUA 2J5FA 3BOQA 4KA3A 4XG6A 2BRHA 1D8KA 3KCFA 2VWWA 3KVWA 4JG7A 3OOPA 5EM6A 5FQDC 5FUTA 3QTSA 2JDRA 1LR4A 3NW5A 3IKAA 5G1XA 1KV1A 3DXPA 4MH7A 3FKLA 3F8MA 4Q9ZA 2JBOA 2A5YB 4Y46A 2HFHA 2L01A 5KKRC 5HO7A 2PQ8A 1RNLA 3DBDA 4PPAA 1PYEA 1A04A 2W05A 3DJ5A 4Z7GA 4QNYA 2PSQA 1S9JA 1ZOEA 1D8JA 1H9TA 5CU4A 1S6LA 3HOTA 4FKQA 2O3FA 1HKSA 1XH7A 3G3ZA 3FWQA 1H25A 3DQVC 4BDCA 3HRBA 5IA2A 3IQ7A 2PUUA 3R2YA 3RK7A 3GCPA 4S31A 5CNNA 5FTQA 5D8LB 4HF0A 2WTKB 5FFZA 3HTUA 3CKWA 3NZ0A 5HLPA 4F7NA 3F3ZA 3IGGA 4I7HA 3PSCA 1ZOHA 5JFRA 5ETFA 4FSNA 4FGBA 3V7CA 5I3RA 3QUEA 3OROA 3E64A 3HA6A 3KULA 4FL3A 3DY7A 3IW8A 5IQGA 3NNXA 3PJ1A 3C1XA 3I79A 4V04A 5HLNA 2XAJA 4F9AA 4MTAA 1WBSA 4FODA 2ZMDA 4BCQA 5E18F 5LWMA 1LDDA 4DFYA 3R8MA 4DBXA 1P4XA 2HR3A 5H6RA 2FA2A 5M4UA 3GX4X 1DUXC 4CZZA 2ZB1A 5EHOA 5D5XB 5E8VA 2IVSA 1YQAA 5IEXA 5HE3A 4UYAA 1BI0A 1AOYA 4DFXE 3MB7A 4TRLA 4LLGF 5C03A 4YMJA 1Y57A 4JG6A 2GNGA 1V0BA 2W06A 4IAAA 3F8FA 4QMUA 4AX8A 1XMKA 2V55A 4KS7A 2UZEA 2DPUA 4JBAA 3E62A 4IANA 3QC4A 1R58A 1NY3A 5LGTA 2B55A 2QU5A 2XBAA 2BIYA 3RPOA 4LGDA 1XH8A 5JVTA 1YW9A 4GJ2A 1SVHA 4FG9A 4EORA 4FKVA 3Q53A 3VS1A 5CVFA 4JBVA 2O0UA 4KUJA 1XB4A 3I53A 1Z91A 4UMTA 3H9FA 4Y13A 5J5TA 2C6MA 3CPCA 4IADA 3M9AA 2YM4A 4TNBA 4FIIA 3CTJA 5H6QA 3CJNA 5ICFA 1WBNA 4FTCA 1FBUA 5EYCA 4UMPA 2EXMA 2HGCA 3EQDA 3I7CA 3TKHA 3W10A 2CN8A 3UZRA 4V01A 4FV3A 1G8AA 2XVCA 2D1HA 4FEWA 4KIGA 4IAFA 2B1PA 2XIXA 2OU7A 3GQLA 3R0AA 3NNUA 4F7JA 4FKIA 2IZRA 5LVLA 4RGRA 1MRVA 3LLAA 4W9WA 5DEWA 2VTSA 4LRMA 5AR8A 4TW9A 5E8TA 5AWMA 1ZRFA 3M8EA 1JPAA 4IPAA 2Y0AA 4QD6A 3ENHA 4ACDA 3OV8A 3KB7A 4NKAA 3FQHA 4YPDA 5FDXA 1YHVA 3M11A 4GH2A 4R7IA 3CPBA 4NL0A 3A2CA 2C5VA 2O64A 3NYXA 2YDIA 2BIKB 4BCKA 4M74A 1A48A 1YXVA 4GIHA 2VNYA 4HV5A 3A62A 2F9GA 4Q48A 3A4OX 4NM0A 2QVOA 2UW3A 4GU9A 1W8CA 2C3KA 5IQCA 5KMOA 3AXWA 5A46A 1W82A 3CTAA 3L1SA 2ETRA 4V0GA 4DTKA 2J7TA 2DLLA 2ITPA 4ZTMA 2F5EA 1ZN2A 5KZIA 3BU3A 5EW8A 1GNGA 3QD4A 3ZHPC 3LCSA 2WKMA 3ML6A 3PP0A 4CGZA 3MAJA 3TV6A 4EEVA 3DXQA 3BBTB 1M2PA 2C6EA 2X0LA 1O3QA 4ASXA 1RDQE 1K2PA 2C5OA 2LGCA 3KEXA 4PDOA 3RYPA 4O1OA 1FGKA 2XJ0A 2XS0A 4CV8A 3I4PA 3MW1A 3QTIA 1WSUA 4PWNA 4IB3A 4RB1A 3EN7A 3QYWA 3VUMA 4YUQA 5KMKA 5DEQA 3PG3A 1V0PA 1RZ4A 1YQJA 2HTJA 4XNEA 4WNMA 3C3WA 3DTWA 4MK0A 3UQGA 4NW5A 4G6NA 3SQNA 5LARA 4WNPA 2ISYA 4RWLA 2V7OA 4M68A 1YXTA 4WO5A 3SRVA 3B2WA 4L52A 2HXLA 3VQHA 3JW4A 1OKYA 3F8CA 3L9LA 5EDPA 5BYLA 4RG0A 3OWJA 1OL1A 4IDVA 4K77A 3ZTXA 4DBNA 3BYOA 2GA2A 2P6TA 5A2QZ 3WBLA 1HKQA 1G4DA 3E5AA 2JC6A 4ZP5A 1CF7B 3GFEA 3O71A 4JT3A 1V4RA 4C2VA 4A4XA 2OF2A 4G3EA 3O7LB 4AE9A 5JQ8A 3F82A 3OT8A 1KE9A 3QLFA 2YCSA 4RWKA 1V1KA 3L2CA 5HQ0A 2W17A 3VF9A 2ZM1A 4DT9A 4CRLA 5KMJA 2C0TA 4CLIA 3AMBA 4AD9A 1MRUA 2QG5A 4I94A 3HRSA 3NMUF 4GT3A 4MXYA 3HMOA 3OBGA 3V8KA 3ZYAA 1AD5A 4MD7E 4YHJA 3C0GA 1LEWA 4EGZA 5CSXA 3UC4A 1OBDA 3A7HA 4JRNA 4D2WA 3ZDIA 3HVCA 5AMNA 2PVMA 2WMRA 5IH4A 5A4QA 4LMUA 1WBTA 3BV3A 1TQIA 1W5SA 3REOA 3GU7A 5A4LA 5I9WA 2X8DA 2HZTA 4GFOA 4L53A 5L6OA 3TDVA 4N9IA 4ZMFA 5CF5A 2WOTA 1C0WA 5EI2A 2HZNA 4CZTA 4O3MA 4RGXA 1TKIA 4C58A 3QOPA 1V3FA 4KIQA 2HWVA 3TM0A 3ZO3A 4AZSA 4LOOA 2ZMEB 5LGNA 2K4JA 5AIQA 4ZH4F 4IFCA 1UKHA 3NUPA 4K18A 5CEMA 2QODA 3BLHA 3I0QA 3WTYC 2FSLX 1TQPA 3HLLA 5C8KA 3JUHA 3MIAA 4IW0A 4C2WA 3FEGA 3V7SA 3AC1A 5LCJA 2HCKA 2YJSA 3WF6A 1OPCA 3DEUA 2EV5A 5I4NA 3TG1A 5KO1A 3ZC6A 4HJOA 5AUWA 1YWRA 3KC3A 2FVDA 5HIDA 5LMKC 3S3IA 4LUEA 3FI8A 5HO8A 1RUNA 3KMMA 3QQHA 2XKFA 5ICPA 1SNXA 4A9YA 4O83A 4HOBA 5LMBA 2WQNA 4E70A 3W55A 3DKWA 3WGIA 3RPQA 2JKOA 4HNFA 4XLNF 4BCOA 3O51A 2NPQA 3E88A 3CIKA 4O2ZA 1R22A 2X2LA 2YDKA 4XSXF 4FI1A 3CC6A 5DBXA 5C8NA 1KQ8A 1MJ9A 4IJPA 4B09A 4YBJA 4ZOGA 3QAME 4JG8A 4NWMA 2BE5F 4U44A 1FP2A 3FL5A 3PJ8A 4DFZE 4I5HA 4K9YA 3QD3A 4A9SA 4RT7A 1DDNA 4U41A 3LAJA 3C0IA 1ON2A 4L7FA 3E5XA 1SMHA 4L0YB 1FMKA 4FZFB 3PQJA 3F88A 4CSVA 2X81A 2O63A 4CFWA 5CQUA 4UVCA 1S7AA 5BOXA 5HNGA 3R7UA 4QP3A 5D6EA 2Q0BA 4DG0E 5FLFA 1FPUA 3GEZA 2BZJA 4FTAA 3THBA 3ZEWA 2XM8A 2VBYA 2R3KA 3FXRA 4FKRA 5DN3A 3FLZA 4EM2A 5LBQA 4YFNF 1LQ1A 3Q60A 3U2RA 2F49A 5CT0A 3CS9A 3DK3A 3R8VA 2XNOA 1QQIA 2O5KA 5C27A 5AP6A 2YX7A 3IW5A 3ZSIA 3DNEA 1EH8A 4QLCU 4I6FA 5AR5A 3FZ1A 1LVAA 2C47A 1KOBA 3DLZA 2YAKA 3MZYA 4Y85A 4PPCA 5DWRA 4IM2A 5F20A 3CSVA 4O21A 4AZFA 4X6RA 3MFTA 4DITA 4D2TA 1L0OC 3VUIA 4PDPA 4E4MA 4QMXA 4RIYB 3WTZA 3R63A 2I0HA 5DVRA 2XKOA 1XN7A 2FSWA 1LDJA 3B2TA 4HOKA 1H28A 2GS7A 2QLQA 1FC3A 1H08A 5FBNC 2IPQX 3BWJA 5DNRA 2PK9A 3LFFA 3T8OA 3GF2A 4IF4A 3LM5A 4XG2A 1PJKA 3OT3A 5DR9A 2YR2A 4F9YA 2WMVA 4CFFA 1T98A 2NAZA 5HVYA 4OTFA 2HYGD 2FEZA 2HDCA 2PVFA 4AW5A 3FI3A 2R3HA 5KE0A 1OIQA 1KE5A 4MXOA 4KBAA 4EJNA 4IAZA 1J1CA 4D4YA 4XRLA 3O8PA 1OIUA 4ZZOA 3LKMA 4RIOA 3UIUA 5AAEA 3TT0A 4O0VA 5K5XA 5I9VA 2QR7A 3R71A 3PSBA 5J9LA 4TWOA 3UNJA 3DKCA 1ZY4A 3F3VA 5AV3A 4BBMA 4FL1A 2DW4A 4E4LA 4J8MA 4M67A 1W84A 4AIHA 2JDVA 2VU3A 4FGRA 2QOBA 3QPTA 4BYJA 5FBOA 2R0UA 2KJCA 3IPHA 4II5A 5TF9A 5TJJA 1JSVA 1BUHA 3P23A 3K1NA 4E20A 5HCXA 2P3GX 3EFWA 3EN4A 3NIEA 3Q9SA 2D45A 1UWHA 4O0XA 3UOLA 2KULA 4XV9A 1QMZA 3L8VA 4NYEA 4OAUC 4U80A 4QO9A 3UZPA 3OG7A 1KE6A 4WOVA 3UOJA 3O50A 5DYJA 2WMXA 5D10A 4BDEA 2E9OA 5ILUA 3RIRA 3EQCA 2A07F 2CHLA 5KBRA 4G5JA 1XBBA 3ZONA 5M57A 2EA4A 3GP0A 3DS6A 1H0WA 5D6FA 4ANBA 1HOWA 3Q9WA 3QCYA 3KLOA 4W4WA 1Q62A 5E1SA 4QQ5A 4ANOA 4KN7X 4NZWB 1PHKA 3C5UA 4D1ZA 3U6IA 5F9EA 4BCMA 3ZFXA 1MJBA 1EV7A 5KUPA 3GFJA 4TWNA 4MXAA 1ULYA 4M0ZA 5CLSA 3D7TA 1JKSA 2L02A 3BY6A 3VS3A 4P9UA 3II5A 4PP9A 4MWHA 3IDCA 4I0AA 1XDUA 2PE0A 4PDKA 3FJQE 3SW4A 1PXPA 3LVPA 5HS8A 3EQRA 2EFPA 5E1EA 5FEQA 2JTVA 1OYIA 4A0ZA 1RUOA 4AQCA 3NEWA 1KE7A 4FV5A 1Z9CA 4LMYA 4BGGA 3KRRA 2QVSE 4LMNA 5AUZA 4U5JA 1KU3A 1JLUE 3ORZA 3F66A 4FBXA 4AA5A 4WXCA 2EJRA 4BY9E 3LW0A 3MZHA 4GT5A 3NNWA 2QQAA 5IEYA 3QTWA 3LXKA 4FL2A 1I44A 3VS0A 2VC1A 4TYJA 2XNGA 1U46A 1QZZA 3OEZA 2QO2A 1YIOA 5D4SA 3UIBA 3OW4A 4PTEA 5CYVA 3KXZA 4I20A 1S7OA 1U5TB 5AP7A 2YFXA 1WBOA 2PG4A 4QP9A 3HAVA 2CGPA 2GSFA 1ZYJA 4J95A 2B0QA 3Q4UA 4O81A 2K02A 4YR8A 5LHHA 4LL5A 4ZZLA 4C38A 3ZDUA 3QRKA 2F2UA 2VTPA 3RWPA 5JGBA 2UWMA 2PMUA 3COAC 2PUIA 4TYHB 3FXZA 2VD5A 4KIBA 1YKRA 1Q8YA 4OMYA 3G2FA 2IG7A 4EGYA 3ID6C 3HEGA 3CUOA 3UE4A 3F8BA 4GFMA 4JJRA 1R39A 2V79A 3RDIA 3RK9A 3MWMA 3KF4A 5ICGA 2R3IA 4ESJA 3ZP5A 3V3VA 2I0VA 4I24A 2UZKA 2R3RA 4J52A 2QLUA 4FT7A 3PPJA 4O0SA 4U9AA 1OMWA 4L68A 5CLPA 4YJPA 4C4GA 4HGEA 4D4VA 5LVOA 4EK6A 2PZPA 3RPVA 3UBDA 3FZVA 2FSMX 2QCSA 2KIFA 4BC6A 1H1PA 4UMQA 1FSEA 3R9NA 2JIUA 3LJ2A 5DLSA 3BZ6A 3L8XA 5D7AA 4FV4A 3ZN0A 3DBEA 5HIEA 4F64A 3M8FA 5FXSA 1H1WA 4DEAA 3EYYA 3NVKI 3FMSA 3L9NA 3QWKA 4JI9A 2VO6A 3MH2A 5C8MA 3VS5A 3H4JA 5FXRA 4EK5A 3HUCA 1FZPB 4F7SA 5IQHA 3M42A 1FSHA 4EC9A 4MXCA 3ZLYA 4JDKA 5DIAA 1Q1HA 5DGZA 4YHFA 1Q8WA 2C6YA 3ZO1A 3AG9A 3EZRA 2IW5A 2GS2A 2XNBA 2XROA 3W2QA 3C4EA 3KU2A 3LFNA 3VF8A 5E8UA 5A6OA 4GL9A 2XUBA 5EM7A 3RAIA 3MTLA 2ZJ2A 3R02A 3DT1A 4DH7A 5A54A 3JY9A 2ZV2A 2UZVA 4CXAA 3OOGA 2ITVA 2R7FA 3HV6A 4YIIA 3OVVA 1Q3WA 4G2FA 3DZOA 4IXAA 5FM3A 3WG9A 4AGUA 3OUKA 4HX8A 1DI9A 2BZIB 4U88A 4A06A 5FEEA 3MPTA 1NVRA 1L8TA 2Z33A 2AXLA 4USFA 3EQIA 2CDZA 4A6DA 3IO7A 2FXAA 1JE8A 4AGCA 1SMYF 2ITZA 4BYIA 2QC6A 1YDRE 2X7FA 4IC8A 3MCZA 3SHFA 2HZ4A 4BI0A 1OMIA 2RV8A 3UYSA 4GMYA 5E8SA 4BBEA 3NRMA 2W4OA 2OW3A 3ORPA 4NM7A 3LOKA 3ORXA 1F0QA 3F5GA 5D5VB 3SAYA 3T5XA 4IACA 3RZFA 4A9RA 3U6HA 4IB1A 5BPDA 5JR3A 4FOBA 2F4JA 4UWYA 2R7BA 4F9WA 5ANIA 4P55A 3GUBA 2XJ2A 3FKNA 5L8KA 5DHJA 2BRBA 3A4PA 2J90A 2F57A 2VODA 3ETAA 5D8KB 4DH1A 3PJ3A 3LE6A 1M17A 3VRYA 1YOLA 3ZUTA 4IAYA 2YIXA 5CS6A 4IVAA 5HE0A 1GZOA 2M8EA 5LGUA 2VX0A 1H26A 3SRVB 3ZM4A 3V5LA 2JDOA 3SLSA 4DINA 2ZJWA 1GXQA 3F6VA 5AUVA 2O0YA 2JBPA 4LGWA 2DAOA 4LG0A 3FQEA 2HZIA 3MGYA 5H8EA 4DA5A 5CVJA 1J3HA 3FE3A 2QU6A 4UX9A 3OHTA 4YURA 2IW8A 3I64A 3T9TA 1B9MA 3WI6A 5DT4A 1ZREA 4Y73A 2B7AA 1OPJA 3HIFA 2VTLA 4HVSA 1OL7A 4JQ7A 4QMMA 2ETHA 3S1HA 3EN5A 2R3PA 2DFIA 2E2BA 1XSVA 3T9IA 4EZ5A 5ANJA 3FC1X 3F5XA 3NYNA 4O0YA 2Q0OA 4FVPA 2I1MA 2YITA 1YI6A 3LXNA 2OG8A 4X3FA 5IG1A 4FF8A 3ORKA 3FXUA 5CVGA 1Z9XA 4IXPA 3PE2A 2Z7LA 3UQCA 4JS8A 1CGPA 5GZ8A 4YJVA 4PY1A 3VW6A 3IRQA 1TBXA 5EHLA 3NW7A 5CVRA 4O7RA 2RQPA 4M6XA 3VN9A 4BIBA 4OAVB 4QMYA 3M1EA 2I0EA 3SG9A 1YS6A 2GDOA 2Y4IC 4O27B 5D5UB 3A61A 5IT9K 2QOQA 4FK3A 2GFCA 4CFNA 4KMUX 3PA3A 1ATPE 4IZAA 3KXNA 3BYUA 3WYXA 5CU0A 4FHTA 3ZMUA 3LQQA 3GB2A 3GVUA 4RX9A 1PUEE 3P7CA 4QTDA 5HG9A 4E7WA 3HGKA 2DQRA 4PL3A 4HLXA 2XB7A 3FLSA 3DK6A 5IQEA 2B9FA 4FKWA 4HW7A 2E9PA 4KNBA 4R8QA 5HCYA 3RWQA 2VN2A 3CE3A 4AN2A 1OUKA 4E4NA 2YM6A 4I22A 2UXNA 2C3LA 3KK8A 4L3PA 5L2WA 2ZAZA 2WMWA 3BIZA 5DR6A 2QOLA 1FX7A 3E3BX 3F5UA 3HMNA 4PL5A 2QQ7A 4I92A 3V5PA 3GLXA 3RZBA 4A0XA 2OIDA 3SXRA 4YU2A 4RWIA 2X7OA 6PAXA 3LFEA 4EOIA 4GJ3A 4GSBA 4UWBA 4RPVA 3QRJA 4E1ZA 5CSHA 3CTHA 4HYEA 4FV1A 2ITNA 3DU8A 4L8MA 5ITAA 5K0XA 4MYGA 3UZTA 2HTSA 3LPBA 3GBZA 3VBVA 4FUXA 1WWXA 2IA2A 4L18B 3HOSA 4UB7A 4O0RA 4Q5SF 3LCTA 1Y0UA 4WNKA 2EXEA 2YPRA 1U54B 2VWZA 5J1WA 4CHUA 5B2LA 2H6BA 4FKTA 4GGGA 4LUDA 4BHZA 4WD5A 4FEVA 1Y8GA 5EYDA 2X6DA 3V8SA 4XBUA 2QR8A 4L3LA 3ZMMA 5JZNA 3IOKA 1KU2A 1MDMB 4XRJA 4N70A 3TZ7A 3K5VA 1MUOA 3N4MA 4I2OA 2P2HA 2W0JA 4ZLYA 2HOGA 2ZB0A 2KRFA 3WTTC 3DZQA 2GPHA 5ANOA 3EDPA 2QOKA 3FMDA 5E4HA 4ANNA 2JITA 1JAMA 1PKDA 1XGMA 1SFXA 4I02A 2W1HA 2OZOA 4DEBA 4ZY4A 3LMIA 3PY1A 5JFWA 1XGOA 5K1YA 5HBJA 5LQFA 4BXUA 3Q4TA 4APPA 3E92A 2LF8A 4EK8A 2QKRA 3WTXC 4WCGA 4O7YA 3PJCA 5I3OA 1IXSB 1XQZA 5CEIA 5HZNA 4FV0A 3BLQA 2WTDA 3N4VA 2IPXA 3RPUA 5KMMA 3MPAA 5I5ZA 2JZYA 3WE2A 1I1GA 3TO7A 4ESFA 4CFUA 3DFAA 2BYVE 3P7NA 3ACJA 3ORIA 4KT5C 2BFYA 4LRKA 5GZ9A 4FKOA 2L54A 5E8ZA 4BDJA 2CYYA 3I81A 1ZG5A 2WQEA 5LEJA 3SXSA 4D2SA 3BE9A 5ANDA 3RYRA 4IZ7A 3E97A 2UZTA 2JAVA 4G9CA 2QENA 5FO5A 4QTCA 4JRVA 4J8NA 3RALA 4E6AA 4OTWA 4QPAA 4LL0A 1KU7A 5CYIA 2QOFA 2EU9A 4TTHB 2YZAA 4HZSA 3ABTA 3JAMK 3FMJA 3SX9A 4OUCA 4I23A 1FP1D 2ZMCA 5IQDA 3R8UA 4A7CA 4LLNA 3ZM9A 2G2HA 3F2NA 1I6XA 3P9CA 3UVQA 5FG8A 1AQ1A 3DB8A 3OW3A 1K7AA 4HPUE 4FSRA 4EJ7A 2V22A 1H00A 1PW2A 4C62A 4HYHA 1E17A 4ITJA 5EQYA 3P0MA 2HENA 4BCJA 1R0EA 5ANEA 3C7QA 2CGVA 2OA4A 2RSVA 2X8IA 3D5LA 1LEZA 3JYAA 5HX6A 4WRGA 2B52A 1O3RA 5A4TA 2EV0A 3O96A 1BM9A 4RQVA 3QBNA 2B9HA 1YI4A 4K2EA 5HORA 4YZMA 3HRUA 3MN3A 4L5JA 1V0OA 2YEXA 2ONLA 5L3DA 2R3GA 3VHEA 3TL8A 3UO5A 5IA3A 3D14A 1WCCA 4MNEA 2XK9A 3K54A 2OAZA 4G6LA 2FSOX 3PRFA 3R0JA 4FKJA 2L4AA 3IW7A 1K9AA 4QMVA 3EQHA 3Q9XA 4CYDA 3FXXA 4IE9A 3W8QA 2VTMA 3C5IA 3NUAA 4EOLA 1ZRCA 4HCUA 4MQ2A 4YO6A 4RC2A 1IEPA 2UVXA 4W4YA 4WBBB 4JAIA 2J5OA 1XO2B 3F72A 1OL2A 3KP2A 4QP4A 2RIOA 1GZNA 1IN7A 2GXBA 2W1IA 2Q2EA 5I0BA 4ZAUA 3KK9A 5I9ZA 3GCSA 4CLJA 2GFSA 3TOBA 3GFWA 2ZKZA 4BCPA 2AC5A 5AADA 3KLNA 5D5WB 1K3AA 3WYYA 5J79A 2WPAA 3P7AA 2IJLA 2ZVAA 5B2KA 3LA7A 4M71A 2ERKA 4IX6A 2ZNYA 4F99A 3HUGA 1H4LA 4AN3A 4CFVA 2PFBA 4WA9A 4ASEA 3IL2A 4I0TA 3E5UA 4MTEA 4M3QA 4WUNA 2DPDA 3NYOA 2Y6MA 2EB3A 5JFSA 3TWJA 1GY3A 3CD3A 4CG9A 3N9XA 2XM9A 4NK9A 3EQPA 1LB2A 5LCKA 3R7EA 4FTRA 2H8HA 2ITWA 1M14A 3O23A 4K2RA 2ZXJA 3PLSA 5TE0A 4IRIA 3V8TA 3WF8A 2W4JA 4OBPA 3DPLC 4G6QA 1M2QA 4XBFA 3DAJA 3AT3A 4X2GA 1HSJA 1WBVA 4JQFA 2F7ZE 4LK0F 3PJ2A 1XCVA 1FBQA 3WF7A 5HKMA 3TDUC 1HBXG 4A9TA 2FOKA 2JT1A 2GTMA 5EI6A 3G5DA 4FNYA 2M30A 4KIFA 2QO9A 3ORTA 3T8RA 4H3PA 4BDDA 4W4VA 5FTOA 1JVPP 2F2CB 2DK5A 5HESA 1EH6A 3GZ6A 1QO0D 4ESBA 3C0HA 3BGPA 2QNJA 4ZTNA 3BHYA 3RMFA 4MHAA 4EMSA 4AS0A 4OOIA 5FB2A 2OJIA 2XCKA 3E5QA 2DU9A 2VT3A 4YJUA 3R6XA 4PZJA 4ALUA 4F6WA 5FDPA 3GO5A 4GXOA 4R6VA 4IFGA 2EK5A 3VODA 2BFXA 1B39A 4G17A 3PA4A 3FV8A 2PUNA 4ERKA 2RKUA 3WTUC 1U5TC 4FNWA 3CP9A 5BVWA 4OINF 4KBKA 4E6DA 3R9DA 3R8ZA 4H39A 3PXKA 4QYGA 3KN5A 3BHTA 2QWWA 5GJFA 4EOQA 1OIYA 1B1BA 1ON1A 4NCTA 5AAGA 4FZ7A 1Z6TA 4F1TA 2B9IA 4WXDA 3I58A 3ODZX 4CTBA 1XGSA 4C61A 1DPRA 1MQBA 4G31A 3RINA 3CCNA 4UN0C 5A6NA 2R4BA 4DCEA 2PE1A 2W5BA 4RLLA 5AEPA 2OQGA 3EN6A 4G6OA 3EYGA 5F94A 5E8GA 4A5NA 3PY0A 4BHNA 3NDMA 4FTNA 4L42A 3QX2A 5H2UA 5CY3A 1RW8A 5CT7A 4I0SA 4DC2A 5CASA 3GU8A 2HQRA 2YWVA 3E6BA 2FU4A 3P86A 2UZWE 4NTTA 4FR4A 2UW9A 4GT4A 4XOYA 1YXUA 1W83A 3IECA 3AAFA 3DXNA 1WBPA 4EONA 2DT5A 4AA4A 2HAKA 4AXAA 3L8SA 3LMGA 5AIRA 5DG5A 5HS9A 5ETIA 5I9XA 4FNXA 2GHGA 2NNYA 3QP5A 2FA5A 2V62A 3DAKA 4FIGA 4M66A 4XEYA 3SHEA 3VW8A 3QQLA 3OP5A 4U7ZA 4ZSGA 2Y7JA 4R1YA 4E73A 4DFNA 2JEDA 1Y91A 4J99A 1F4KA 4PX6A 1TQMA 3QQFA 2L4MA 5ED4A 3ZU7A 4DEEA 3O3KA 4FT8A 1R3CA 3WZEA 4YJNA 1E2XA 5EYKA 4FEQA 2B54A 4G3FA 4OIQF 4QQJA 2P5VA 3W6KB 2RFDA 3VNTA 1DM2A 3HYHA 4YBKA 3NAXA 1P4AA 3TTJA 2LAVA 3U1DA 4U45A 4BWKA 3LCOA 3V5TA 1WAKA 2GHLA 2ZDTA 3UG2A 4I6BA 3W32A 3VC4A 5ERIA 3F8NA 3F22A 1IZ1A 2R64A 4U3YA 1FY7A 2FGIA 2P5KA 4HDVA 2W9FB 2OFUA 3R73A 4DAWA 3PVBA 2MH2A 1KYZA 4O82A 3PXYA 1DAYA 1U3EM 1IRKA 2XNPA 4L00A 3E63A 1GZ8A 5HO6A 3MIYA 4DNCA 1S3JA 2CCHA 3GZ5A 1TNSA 3DKFA 2XV4S 1OPLA 4FSWA 5AM6A 3RJPA 4AG8A 1FMOE 1KYWA 3WE3A 1WKMA 3AT4A 5CAQA 5HDGA 5EKNA 5AV4A 2OIQA 4EV0A 4FKLA 4XV2A 3R4KA 3BHUA 4BKJA 3FLQA 2LSOA 4IZYA 3R9HA 3PZHA 2WQBA 4G1WA 1UFMA 3TCPA 2DUVA 5E91A 2XF0A 2CQKA 1IA8A 1A06A 5M53A 2HWPA 3KFAA 3POOA 3HRCA 4JR3A 4O7LA 1XD7A 4X21A 4XG8A 5J8FA 4ITHA 3MJ1A 1BJAA 4XOZA 5E7RA 2H34A 3K9TA 4EOOA 1HCKA 2GQRA 3CR0A 4F1MA 4EWQA 4BCGA 1TTYA 4JIKA 3RI4A 2VWYA 3ZS5A 3GOPA 2IVMA 3GFMA 3Q52A 4UNOA 1ZGJA 1U5TA 3MFUA 2K7LA 3FMMA 4RZVA 1W4MA 4QTAA 3SFZA 5JI6A 3ZMVA 2G2IA 4MD9E 3TKUA 3MVMA 4BKYA 5CAVA 2BCJA 3U9CA 3BPVA 4MEXF 1UCRA 4RB2C 2PL0A 4D55A 2H6CA 2R3MA 5IMEA 4IWPA 3TJCA 1BMKA 3LA3A 2P55A 4YJOA 4BR3A 3E6CC 4UVBA 3E7OA 3F7WA 4XLVA 3VIDA 5AUXA 2PVKA 3W6JB 3DKOA 4EZ7A 3QU6A 3M2WA 1FLIA 2L3DA 4EH7A 4C59A 2HY81 2HW6A 5H20A 3LHJA 3NUNA 3TV7A 4CMTA 3COHA 1JXSA 3U51A 4FIEA 1E1VA 3AC2A 3B8RA 1SD5A 3IWFA 4BAYA 3E6DA 4BWXA 2PBIA 2VX3A 2QO7A 3PP1A 2PLYA 4ZY6A 5D4RA 1KOAA 5FFXA 2WQOA 2STTA 4GCVA 2YA9A 3VJOA 1ERKA 4JOAA 4MBJA 1X3UA 4UY9A 4AZWA 3CO6C 1LEBA 3WZUA 3PRIA 4UHTA 1FYMA 3R6SA 1P4FA 2WTWA 2WELA 5FXQA 4ENXA 5JQ5A 3ZFYA 2C3IB 1G6NA 2X4FA 1HQCA 4V0GB 4Y5QA 3RI1A 1WBWA 3GENA 3O7LD 2IVVA 3E3PA 4BIDA 2WWYA 4EC8A 2OZUA 2QHMA 3VS2A 2MD5A 3I5NA 3ODYX 5A4CA 3KCKA 2EUFB 3KZYA 3NUSA 5EEHA 4EHVA 5DD4A 2C1BA 3QKLA 2EB2A 5LEKA 3KGAA 4EYMA 2WO6A 2H96A 5M55A 1BL7A 2Z02A 4KICA 1R5HA 3TO6A 3MPMA 2WZJA 1G3NA 4WT6A 3GFIA 2IJMA 2FNAA 4KKHA 1X8BA 3VULA 4YG2F 2VO3A 4C4FA 4WHZA 4CZUA 4QNAA 4IDTA 2FQ3A 1Z05A 5FRIA 4CKRA 3R22A 2LKPA 3G33A 3ZRKA 2QG7A 1CSNA 3BYSA 3U9GA 3RM7A 5K9IA 1R1UA 5EW9A 2X9FA 3DCVA 1BC7C 2OFVA 2V7AA 1B4AA 5M56A 4P9FA 3F6XA 1P92A 3IG7A 3ROCA 3DTCA 4NU1A 3FHRA 2WU6A 2RDPA 1G5SA 4FT3A 4S2ZA 2WV0A 2UV2A 2RN7A 4HX4A 1YDSE 5IA4A 5DD8A 4YTIA 5LXMA 4R3PA 4LYNA 3LSTA 3RAKA 4TWCA 4AW0A 3D2KA 5LVPA 4ERWA 2JKMA 3KFWX 2Y4PA 3P9KA 4H36A 5IPJA 5JGDA 2WIPA 1U78A 3ORMA 2YLFA 3RNIA 4WNOA 2R3NA 3N4TA 3ZN1A 5JHUA 4F65A 2J9MA 2DTRA 2P2IA 3MDYA 5DA3A 4DF3A 4AACA 3C7JA 4HVDA 3IK3A 4DH3A 2C4GA 5IA5A 4QT1A 2YACA 3CQWA 3D5VA 4FV9A 3G0EA 4CFXA 2EVAA 1KA8A 4NJDA 1FPQA 3DPTA 3LXPA 2IW9A 1P14A 3GC7A 4IH8A 2BKZA 3CGFA 3SG8A 4OTGA 4FNZA 1BIBA 4HV6A 3A60A 5BPYA 4ZZDA 4AW1A 4FVQA 4IC7A 5AR7A 3R2BA 4J98A 1KWPA 3AC4A 1XR1A 4PMMA 5IH5A 4K0YA 4MQVA 3TIYA 2X0GA 2Y9QA 1J91A 1I1SA 4DGLC 3IW6A 4JLCA 3GCVA 4FV8A 2W9ZB 5BVKA 1ZMVA 2Y8OA 5FP5A 3R01A 3RVGA 2RG6A 3FLWA 4JQ8A 3HHGA 1IW7F 4FG8A 1HXDA 4G94A 2XIZA 4U0IA 4HF1A 2OSCA 3I54A 3AC5A 4H05A 5AP1A 3M7GA 3EB0A 1Z1DA 2D2WA 2DS1A 4RVTA 1M52A 1H0MA 2F5FA 1IRFA 3LMHA 1UNGA 2E9NA 2IZTA 2WTEA 4DH5A 1SZMA 4NQWA 3SXFA 2BV6A 2UUEA 2VE8A 2PE2A 3NYVA 3UMXA 2GA1A 5A2QK 4TYIA 4KSPA 4BBFA 2VOOA 3DKGA 4FIFA 3WZDA 4DGMA 5L3FA 5IQAA 5IMXA 1WI9A 3MH1A 4FTTA 4G7ZF 2J4ZA 3FZOA 2GIVA 3ELJA 2W85A 4TY1A 4YIFA 4E3CA 2H6DA 2DQLA 4M9ZA 5M4IA 2XASA 1P4WA 4RJ4A 5JFXA 3QZIA 5M09A 3GC9A 5LMKA 3OCSA 3RPRA 1PRYA 4C3PA 4KIKB 2A3SA 3AC8A 4CYJA 4QOXA 2PVLA 4H58A 2JAMA 4WRSA 4M9XA 4EH5A 4RIWB 4Q47A 3D2IA 4EJWA 3TACA 3UYTA 4JNWA 5AP3A 3QZFA 2C69A 3WGHA 4B6LA 1P4OA 3E87A 4DCAA 3RHXA 4O2PA 1QBJA 3FL4A 1XGNA 4UZHA 2CGUA 4JAJA 3Q32A 3BYVA 3IHUA 3BEAA 2Y48A 4TWPA 3ALOA 1OECA 3FHZA 3H3ZA 4WWCA 3OY1A 4HA8A 3PXRA 2HS5A 4O1PA 3DFCB 2G2FA 3VUTA 3V8LA 5HBHA 2VTNA 1ZLJA 2R0IA 2OXYA 2VTTA 2E1NA 3JAMZ 4H3BA 3AMAA 3ISPA 4U0VA 4WG4A 4IM0A 1S9IA 5GZAA 3EQFA 1F1ZA 4HAMA 2A6HF 3LLTA 5F95A 4PMSA 3WU0A 4D28A 3VRZA 2DBBA 4X6QC 3I5UA 4AIJA 4RSSA 3FXWA 4M14A 4FX4A 3DJ6A 3F69A 4U81A 3HSEA 4A0YA 3KKVA 3UP7A 1AWCA 5HG8A 4RB0A 2XNEA 2YIWA 3ULIA 4D4RA 3P78A 1XKKA 2DYLA 2YLEA 4LRJA 4L9NA 2PEXA 3QXOA 2YM5A 1QPDA 1USTA 4M13A 2CNVA 2FYSA 2XYUA 2CO5A 5CAPA 1SD6A 2BKKA 3BJ6A 3C4CA 2MH9A 4NIFB 5CU3A 1REPC 5ETAA 2HZ0A 2NRUA 1OKRA 4GKHA 4FSTA 4E8AA 5IT3A 1B59A 4RX8A 3QGYA 5AUTA 2WXVA 3ZMDA 2A19B 1YFHA 4C34A 2WEVA 5EHYA 3BDDA 3QUDA 4EOSA 4BWPA 4FX0A 2Z2WA 3BELA 4FC0A 2ITXA 1CKIA 3EUHA 4BHPA 5TT7A 1UNLA 1M2RA 2BVAA 3OTVA 3ZSHA 4ZTSA 1SNUA 4A5MA 4NB5A 5L3AA 5GIPE 4U3ZA 4DGGA 4D2VA 5EQEA 1TLHB 4RAYA 4S32A 3ERKA 2BGCA 3U55A 5AP2A 4Z3VA 4XHKB 3LM0A 3FDNA 4S30A 1BIAA 2PVRA 3SVVA 4OTRA 2ZNZA 3TUCA 1URWA 2VZ6A 2R3JA 4HYIA 5CF6A 3QRUA 3SA0A 4P2KA 3FPQA 3DBQA 5T68A 4O22A 4EL9A 2OLCA 1BOAA 3A7FA 1DP7P 1IXCA 4YNEA 5E8YA 2UW0A 4UXNA 2ZYBA 4YSJA 5BS6A 4E93A 1UA2A 2AYPA 2GNHA 4EJUA 4KKGA 1GIJA 4YLJA 1WVYA 4PGGA 3K3JA 5DCMA 3KZZA 2Z8CA 3FMEA 5M4CA 3DLSA 5A14A 3R28A 5AP5A 3MA6A 2ZM4A 4AGWA 2FNPA 2XKPA 2RFSA 3DAEA 4USEA 3D15A 2HY0A 4C7TA 2QOIA 3RKWA 2XIGA 1Q99A 1K78A 3TI1A 2J50A 5BVEA 4KN4X 5G6VA 3PY3A 4YC8A 3H9RA 1NW1A 2GS6A 2A6EF 3ET7A 3EOCA 2P4IA 4BH9A 3S2WA 1JGSA 2OJ9A 3P1AA 3UPXA 4NKSA 3D9VA 3ZO2A 5EM5A 3V6RA 4DG3E 1IAHA 3Q2MA 3KEOA 1UHMA 2PUPA 3FQSA 3OXTA 2EFNA 3H3UA 2NRYA 3L8PA 1K79A 3NRVA 3ZPLA 3VB2A 3O2MA 2YHVA 1BI3A 1FBSA 3WTVC 1ZOGA 4D5HA 5F1RA 4X3FC 4OU0A 3VBYA 4F0FA 3EQLF 3T1BA 4EYJA 2VWXA 3K3IA 3GC0A 2DI3A 5GHVA 5DRDA 3PWDA 2PMLX 4KIPA 5DUKA 4U42A 5M07A 3JY0A 3QQGA 1VR2A 1YWNA 1ZG1A 2TDXA 4GEOA 4D0WA 2LF7A 4KABA 2KTYA 1T39A 3O2PE 2WGJA 4LG4A 2OBJA 5BVDA 4DTAA 3CGOA 3F3UA 4FUYA 1KSWA 2OXXA 3UVRA 1XDSA 2DQ7X 4EH4A 5IKWA 4DEGA 4XH6A 1ZYLA 4RIWA 4FSZA 2EFOA 3SW7A 4AN9A 3TTIA 4FV6A 3QA0A 1URCA 3LQ3A 3P79A 5HI2A 4ZYHA 4BF2A 2STWA 4NHJA 4AFEA 4M15A 5GJGA 2FBIA 4XLPF 4ZLOA 3IW4A 3PIYA 1WFCA 1YW2A 1H27A 5DR2A 3KE2A 4AZEA 1GZKA 2A68F 4FTUA 2Z9OA 4CQEA 4CVAA 2XK7A 2OKRA 2EFWA 5AIPA 3FY2A 5H9BA 1QNTA 1ZYRF 2COMA 4N0BA 4P5OA 4X0MA 3ECHA 3Q6WA 1G8SA 4GG7A 5E1ZB 3W2PA 4BCIA 2R3FA 1YXSA 4PP7A 3D5WA 4HVHA 3HA8A 1U2WA 3T8TA 1QPCA 2C6KA 4GIIA 3IWZA 3C51A 5CAOA 3RAWA 3O6BB 1ZMWA 4O84A 3UODA 1F9NA 3BROA 1B38A 3VHKA 4XX9A 3IONA 1KQ9A 5CSPA 3EN9A 3FZSA 2HWOA 4DFLA 4HW0A 2LDUA 1R7JA 3U9NA 4G3DA 5GNKA 4EQCA 5EM8A 5JN2A 1JWHA 3EQBA 4X3JA 5CJ9A 2JDSA 3V8WA 2C68A 2IZUA 1IN6A 1YYVA 5HG5A 2WNTA 4Q9SA 2QYOA 3D0EA 5J8CA 1P2FA 4F0GA 3CUQC 1FNNA 2GNLA 4KIKA 4QQCA 3CEKA 4QMSA 3R9RA 3QCSA 4XP2A 3U6JA 4BDHA 3N51A 4Q2AA 2WOUA 4DGNA 2XK4A 2WC2A 2XNMA 1ZYDA 1KUTA 3V5WA 4XRFA 5CX9A 2GZWA 5JT2A 4L6QA 1F3MC 2Z7RA 5ETCA 3TN8A 1OIRA 3PTGA 4XV3A 3UGCA 1R1VA 4S05A 5CU6A 1LNWA 1DPUA 5LHIA 4C4EA 5IA1A 3P9JA 4JDJA 3OCTA 4QP8A 5IEVA 3H10A 4CZYB 2CKPA 3BHHA 3I7BA 4RIXB 5EH0A 3AOXA 3QFVA 1L3RE 5BUEA 4EH6A 3EQGA 4LOQA 2VWVA 5E17F 5ILSA 4ASDA 3POZA 4HCVA 3IS5A 3C9WA 4ANQA 3Q2JA 4OIRF 3ORLA 3U8WA 5CANA 2WMAA 1O6YA 4EM1A 5CI7A 3NS9A 3FLNC 4M0YA 2Q0NA 3HMIA 5AA9A 2XP2A 2YZLA 1UKIA 3NAYA 1SFUA 1ZG3A 4I5MA 5F1ZA 5A9UA 3R0TA 2GHMA 1YWVA 5F4NA 2IP2A 2YN8A 4I1ZA 4U97A 4R5YA 3EJ1A 5KMNA 1KV2A 4H0EA 2VWIA 2DK8A 1Z7UA 2JDTA 4BDGA 4DH8A 3UOHA 3C4ZA 4OGRA 5L3CA 4ARKA 4LG0B 4HBLA 4YLKA 2YU3A 2HELA 4TPTA 4O7NA 3F9NA 2YCRA 3V04A 5DCFA 2CKOA 4ZYGA 4IX4A 2GXGA 4XUFA 5L2QA 4I4FA 5J8IA 5DV5A 4IMYA 1H9GA 2BILB 2VUWA 2XH5A 2J5EA 4GVJA 3ZRMA 4PV0A 2YDJA 2IW6A 5BNJA 1PXKA 4QQTA 2PZ5A 2R3LA 3CJFA 3KMWA 3ATSA 4OIPF 3TGNA 4KYWA 3HSFA 2PJPA 4XJ0A 4G5PA 5K5NA 4MHGA 2BUJA 3ABUA 3DA6A 3R1SA 5J87A 2X8EA 4YZ9A 5AONA 3UPZA 3VAPA 4EZ3A 1QZYA 1REKA 4PNKA 3NGAA 4U0WA 5JMSA 4GUEA 2CSOA 1I27A 4PTGA 4ZS4A 1Q8UA 4ZK5A 3VBWA 5IZFA 5AP4A 4O6EA 3HTSB 2GU8A 4RA5A 4CNHA 5IQBA 3QRTA 2E9VA 2XCHA 2AUHA 4L46A 5IDNA 4FIJA 4Q5HA 1PXJA 4H3QA 1UU9A 4XMOA 3F7ZA 3GU5A 2PY3A 4FA2A 4O0WA 5GIOE 4A07A 2OQRA 3J81K 2Z5UA 4M97A 3NLBA 2P7CB 4OTPA 4O96A 3EIDA 4YTHA 3WZKA 5TRDA 4MNFA 2UZBA 1DAWA 4IAIA 5E8WA 2CN5A 1OVEA 3FI4A 3UO4A 4B0GA 4AOTA 2X2MA 2JKQA 4BI2A 4C35A 4CTCA 3UIXA 4EK4A 2C5XA 3MEXA 1W7PD 3QGWA 4ORKA 2H9VA 3WZJA 4Y72A 3KP5A 1WRJA 3KF7A 2QURA 1UB9A 4ALVA 2YCFA 3GEQA 4FYOA 4ALWA 2VO7A 4NFNA 4J97A 3AMYA 2PZRA 2VNWA 4P5ZA 1RQQA 1XH5A 3A8XA 4HYUA 4CCUA 4ZJJA 2I6LA 1JBPE 4UXLA 3KEQA 5DEYA 5L6WL 4GYIA 4K33A 4PL4A 4U7BA 3ZH8A 3FZPA 3PIXA 3BQCA 3HHHA 3PPZA 5AR3A 1GJOA 3R61A 3RHKA 4XP3A 3CUQB 3K69A 3QHWA 2CGXA 5CSWA 4APCA 3TDZC 2C30A 4EKLA 4UVAA 3I4BA 4EJVA 2W1EA 3AQVA 5D12A 3BGQA 3FMHA 3QWJA 5HDKA 4PMPA 4DYMA 3TJDA 2HYFA 1IAJA 2XRWA 3C13A 2BHEA 4N6ZA 4DEIA 2V0DA 3GOKA 4FG7A 3WF5A 3Q6UA 2WMTA 4GRBA 1BYGA 3AD4A 4ID7A 2CWEA 3KXXA 5L3EA 5KK1A 1Q24A 4O7TA 1JQHA 4BTFA 3Q04A 2VV9A 4IZ5A 1KGSA 1H1RA 1ZZ2A 3WTWC 5CVIA 1OR7A 5HOOA 2PZYA 2WMUA 3GVAA 3QTRA 3G9LX 4AOIA 2O2UA 4MNUA 5HLHA 4U0YA 2BTSA 3KRLA 5EI8A 2E9UA 2UZLA 2P6SA 1ODDA 3Q3BA 4PRJA 5H3QA 4RWJA 4DGOA 5BX0A 3G6HA 2WTJA 3QF9A 5LRRA 3DGKA 2XKEA 3PXFA 4DFUA 2HXQA 3TQNA 1APME 3R00A 3Q96A 4NM5A 5C1QB 1HW5A 3FMKA 4R5SA 2VE9A 3DPKA 4XS2A 1O57A 4FT0A 1FINA 2RL5A 5EDQA 4UWCA 3FXQA 3WU1B 2XAGA 3I0OA 3MV5A 5AFVA 3F6OA 3K1PA 2VRXA 3ZXZA 2R5TA 4FTOA 4YJTA 4MKCA 1BC8C 3R7YA 1Q97A 2M87A 2X4ZA 5LVNA 1J7UA 4QP6A 5HHWA 4RGUA 3MY1A 5CEOA 2G15A 3SV0A 1R5GA 1U6GA 4IWDA 5DFPA 1J59A 5CEQA 3NR9A 4RA4A 4ZSAA 2V1DA 3MY5A 3NCZA 3F61A 3QU3A 4RS8A 4C0TA 3QQUA 2BDJA 5C01A 4QMQA 4YTCA 5DT0A 3VUHA 5LOHA 2ITOA 4FEXA 3UMWA 2ZCWA 3SD0A 5TOZA 4B4LA 4HYSA 1P5EA 4ZTHA 3DB6A 4C3FA 4OW8A 5IT9Z 3S4QA 4RBLA 2XK8A 1ZHFA 4KMFA 3SQQA 1XH9A 2V9VA 1WQ2A 3L9FA 1J75A 2G9XA 3BCEA 3MFKA 4BGHA 5D9HA 5CZIA 1H8FA 5T3QA 5T6KA 2WTKC 2RFNA 4GFGA 4F7LA 5BVFA 4FIHA 5FEDA 3FZRA 4EOJA 4R1HA 3F2AA 4H1JA 4BB4A 5B2MA 3FWEA 2Z60A 3CY3A 2I0YA 4B8XA 1OL5A 2ZBKA 3G73A 2A27A 4M69B 2CPKE 1QGPA 2GCDA 3NWWA 2RNJA 5HLIA 3VVHA 4DFBA 4CXFA 4ZS0A 3KREA 4ZYEA 3FX3A 2YIRA 5J7HA 4QMOA 1ZYCA 3GC8A 3HDMA 3DJ7A 2QI8A 3HECA 1YOMA 4AVPA 1ZH5A 1H01A 3BLRA 4CFMA 3IKTA 3DNDA 3E7VA 3SZPA 4I5CA 2NNNA 1W7HA 4HVGA 3NQOA 5KHWA 1ZWSA 2VBXA 2UW8A 1FWZA 2WQMA 5LJJA 4YZDA 1GVJA 4JR7A 1R1TA 2C6OA 4UMUA 1XHAA 5EYMA 5BUJA 4EBWA 3QL8A 1Y6BA 3N4UA 4KS8A 2J0KA 2XKDA 3ELKA 1ZMUA 3GU4A 5DPVA 1MQ4A 2EWNA 2UW4A 3R60A 4O7VA 4F9CA 4XLIA 1Z6RA 3L09A 3I60A 4PPBA 4QMZA 1CKPA 4F4PA 5K3YA 2XRNA 2A0CX 1HW2A 1VZOA 2WEIA 4M9SA 5DRBA 3R8LA 1I09A 4AFJA 1AGWA 4MAOA 3HV7A 4AZVA 1OZ1A 4S34A 3OXIA 3E8CA 1PP8F 4QRCA 5L4QA 1P6RA 2BRMA 3HMMA 2JFMA 3QALE 1VTNC 2W57A 5AAFA 3MA3A 1O7FA 3W16A 5HLGA 1XCBA 5BMMA 1WMKA 4DE4A 2Z7SA 3OCBA 3QKKA 3Q5IA 3KMUA 3NNVA 3W2OA 4F08A 2PMOX 4FVRA 3RBWA 3EZVA 3MFRA 5EOLA 3NPCA 4BYYA 5FD2A 1G3SA 4RGJA 1UNHA 3GXLA 1JNKA 4Q5EA 4I0BA 4JBQA 3EFLA 1IASA 4IHPA 2RG5A 4WG5A 5BUIA 3JSPA 3V5JA 3MBLA 1XSXA 2OWBA 1M7NA 3K1MA 4EJOA 1H0VA 4R77A 2QBYA 3QCXA 3RKBA 2UZUE 4L3JA 2QHNA 5J95A 3QTXA 2NO3A 5EKOA 1RJBA 4YFKF 2RVCA 5HDNA 3F23A 2WHBA 4UMRA 2FF4A 4C8BA 3BWGA 4LLLA 1YRPA 2OZAB 3QZHA 3KP6A 3TNPC 3U4WA 3FHIA 3Q5FA 1T45A 5FLXZ 5HS7A 2K4BA 2XJ1A 5AX3A 3J81Z 1T2KA 4ACMA 4X2NA 1FOKA 4AE6A 1IN8A 3CQUA 1LDKB 4IB0A 1Q8TA 4BDIA 4G7OF 3ZCLA 4U40A 3PA5A 2VBWA 4XG7A 3FUPA 1CTPE 2VWBA 3HX4A 4KFCA 3EYIA 2J2IB 3KA0A 1PP7U 3F5PA 3MYGA 1R1WA 4OTDA 2J0LA 4YFXF 2CNQA 3D83A 3CDHA 5ANKA 5KBQA 1U59A 2W1ZA 4G9YA 5ACKA 5AV0A 1WVXA 2ZO4A 2A2AA 5EQPA 4L45A 4C4JA 1YHWA 1ZY5A 4C57A 5CEPA 4GW8A 5DH3A 4XSZF 4U7DA 1Q3DA 2JPBA 4EHZA 2F5CA 3VOEA 1XH6A 2W5HA 1EH4A 2O03A 2NNWB 4E5WA 1J1BA 5CF4A 5HTBA 3ATTA 4TT7A 4BGQA 1R78A 3LFKA 4EM0B 1OM1A 5KKRB 4YZBA 3O0GA 4L44A 3PG1A 5M51A 2P7VB 2WTCA 4I6QA 3VEPA 3WOWA 4DEDA 2C5NA 4AIKA 5E90A 3ULQB 4RIYA 2J0MB 5AUUA 3D7TB 2I40A 4BICA 2YERA 4HZRA 5ACBC 3BV2A 3CTQA 3ZEPA 2HOEA 4RX5A 2ITYA 4G7HF 3QHRA 3PVGA 1UWJA 3DQXA 4PDYA 2XUUA 5IU2A 3Q5ZA 5EK7A 4DLJA 4FSQA 4BCHA 2RC4A 3RNYA 3WTSC 1YW8A 3EL7A 3G0FA 5LVMA 1FVVA 4BN1A 3GFLA 2QQ9A 2VGOA 4AT5A 3I59A 1PKGA 3QTUA 4P4CA 4LV5A 1YW7A 4IM3A 3OMVA 4C4IA 5JEBA 1BI1A 4JX3A 4WXHA 1Q41A 3WIKA 2UVYA 4O0UA 3DOGA 5FWKK 4NM3A 3ZBXA 2ZM3A 4PNIA 4FZDB 2VONA 3BBWA 4NFMA 3DF8A 1XSDA 5KX8A 4F6UA 3TUDA 3KP3A 2ZMEA 4BZDA 4PQNA 4TKSA 4GCJA 5HU3A 3FM5A 1RIOH 5E8IA 4ANLA 4BDBA 1NA7A 5L2SA 4QMTA 3RM6A 2BHHA 5K0KA 2X4HA 2JD5A 3TO9A 4UZDA 3VUGA 5I9YA 3LFQA 3ZLWA 3MFSA 2ESNA 2QOCA 5C4KA 3W18A 3GCQA 4ENYA 3OBJA 5LLQA 1U4DA 3OF0A 2UXXA 3HKOA 3DBCA 4IHSA 3KRXA 3RTRA 4UV0A 4O38A 4GKIA 3FAAA 2Y4IB 1FQ1B 4EQQA 3HMPA 3I0TA 4HQEA 4LD5A 2BROA 4BQAA 3DDPA 3NEUA 2W25A 4YO4A 3H0ZA 2JGZA 3Q9ZA 3KN6A 1IN5A 3LFCA 1PXMA 3S95A 3FM3A 4UUVA 5CAUA 5E9EA 4RGSA 4B99A 3L9PA 5H8BA 5JSMA 5JZJA 5FGMA 3NW6A 1OYYA 2W1GA 2FBHA 5HE1A 1P2AA 3RK5A 5IH6A 4AGDA 4W8EA 5C4LA 5HTIA 4FT9A 1YLFA 3FMQA 4RFMA 4FOCA 4DLIA 4AZTA 2OJJA 2WFYA 3BGZA 5IUIA 2WMQA 4CD0A 4DEHA 3KP7A 4YC3A 2ZFWA 1DI8A 4RB3C 2MLKA 3QQKA 4RFZA 3KULB 3E6MA 5D41A 4JX7A 3DV8A 3AC3A 3WGGA 5HD4A 2EB7A 4N57A 4BCNA 2P0CA 1YS7A 2JSCA 1PMNA 3EKKA 2BAQA 3A7JA 4ETSA 4PDSA 4WSQA 3IDBA 3P7BA 4AF3A 2PMNX 3OY3A 1PDNC 4AP7A 4I41A 4WX9A 2CG4A 2PU8A 4RX7A 5DUIA 5AM7A 1U5QA 2A61A 4QYFA 4KD1A 3RKYA 5CVUA 1UU3A 4K1BA 1IR3A 2Z3YA 3CLYA 4R1VA 4Y95A 4KRDA 2OK1A 4IB5A 4C4HA 2YM8A 1KU9A 2X1NA 4FTMA 1NXKA 3JR1A 5DCMB 2KKOA 4MXZA 3M1SA 4ZYDA 5KHXA 1U54A 4JVGA 3QTZA 2QLZA 3SGCA 2ONLC 2VTIA 1H24A 4E6CA 1CF7A 3EH9A 1RI7A 1TVOA 3MVHA 1W0XC 3RCDA 3LWFA 4M84A 5GJDA 1OKVA 2PVHA 1R23A 5HVKA 4Z9LA 3VS4A 4GK3A 3L00A 4ONAA 1XJDA 3GWZA 2R2PA 4FZ6A 2R3QA 5JK3A 1LPUA 3BZ3A 4CCBA 2CLXA 1STZA 4KAOA 3QP6A 2VWUA 2BRGA 4DTBA 2R9SA 3E8DA 4IRHA 3T3UA 3H92A 2OZ6A 2PMHA 2GNFA 5FM2A 1TW2A 4EWHA 3R7IA 1G3TA 4S33A 1HSTA 4CRSA 2YJRA 4JDIA 3ZMZA 3EKNA 2LNBA 4ANMA 2REIA 3FMRA 2HW7A 2XNNA 4ASZA 4I5PA 4BDFA 4XYFA 2NYXA 4AT3A 4L9VA 5BQTA 3TKIA 4YTFA 4WIHA 2BZHB 2IN6A 5HNBA 2RKHA 2CKEA 4L9IA 4K6ZA 3B8QA 5EFQA 3G15A 4J71A 3C4XA 4AW2A 5DMZA 4P96A 4CYIA 3ENMA 3NX8A 2I7QA 2UW7A 2FO0A 1D3YA 4O86A 2X6EA 4NIFA 2Z99A 3R7VA 1Q4LA 1FYLA 1FOTA 1ND4A 5HD7A 2PMIA 2GQSA 4KUMA 1OKZA 1JOWB 4TYGA 2V1UA 4Q4ZF 5A4EA 3NUXA 1PXLA 3ZLSA 1SVEA 4B7TA 3PWYA 3LFSA 3CKXA 3VUDA 2OO8X 3FMLA 4IAKA 4O6LA 1SVGA 3ZUVA 1W98A 1XH4A 4LQMA 5J6XA 5HOAA 2CNUA 2BDWA 2YWPA 5CTPA 3VFZA 4HGLA 4RVLA 4JK1X 1MP8A 4W8DA 2ITQA 2WMSA 1PYXA 1ZARA 2O65A 3G6GA 3Q4ZA 2P8TA 2B9JA 4E6QA 4LK1F 3UJGA 5L6PA 2XEYA 4CT2A 1OL6A 3CO7C 3HRTA 3ZC5A 4EQUA 2FBKA 2YAAA 4HZFA 4LM5A 2OICA 5L2TA 4OBOA 3BEGA 2XRUA 5D7VA 2VTQA 4E26A 4WUAA 4U79A 1XBCA 2OH0E 3RP9A 5DT3A 4FV2A 3DQWA 3TV4A 4MXXA 2UZNA 4BI1A 3EWHA 3R8PA 2BALA 2Z7QA 4YC6A 2IT0A 5HEZA 4RRVA 3B02A 4EOMA 5BVOA 4LB5A 3C4FA 1OITA 3F2RA 3P9IA 5IQIA 1BKXA 4L9TA 4QYEA 3CQEA 4F09A 1B6CB 1O9UA 3U87A 3A99A 4FTQA 2YIQA 3TNWA 4NEUA 4KB8A 4OMZA 3ITZA 4RMZA 5JFVA 2UZDA 3VBXA 4BL1A 3BP8A 4RJ8A 3R30A 3QZGA 4N9HA 3BE2A 3UC3A 1OBGA 3COKA 3LZBA 4XG3A 4GO1A 2VTAA 3KCCA 4EH3A 2ETMA 3K0LA 4YNOA 5LRSA 3FYJX 4EOPA 2BRNA 4YPSA 3D5XA 1Q8ZA 2JFLA 2YISA 1CMKE 2YX4A 3Q9YA 4OR5A 4M6YA 1LP4A 3HV3A 2C0OA 3GT8A 5KVRA 5J9ZA 3SOCA 4FSUA 4AWXB 4IJ9A 1L3LA 1J0RA 2OGVA 3ZOSA 4UV9A 1O6LA 2W96B 2K27A 2M1BA 4HQMA 1SD4A 1UU7A 3HNGA 2FB8A 1ZAOA 2ACXA 4A4OA 3DV3A 3KRWA 5D1JA 2OZAA 3FI2A 3V8JA 4PF4A 2E7WA 3RGFA 4RC3A 1LJ9A 4TV7A 3AGMA 4O5VA 4EK3A 4R78A 4BDAA 1DS5A 3R1YA 2ELHA 4NUSA 5L8JA 2F5DA 1FYKA 3UQFA 3HRMA 3PZEA 1BI7A 4FKGA 2ZDUA 1S29A 3JPVA 2PWLA 3D4QA 4BTJA 4D0XA 1G3YA 3BHVA 3HRFA 3MS9A 4BZNA 5BVNA 3G9NA 5AR4A 3R7OA 3JSOA 4ZIMA 5J7BA 3TKYA 4RIXA 4I21A 3AD5A 3I5ZA 1YHSA 1SYKA 1USSA 2XA4A 3WE8A 4M12A 3I71A 2PI0A 3NIZA 1NHAA 2EV6A 4BRXA 1MKMA 5ANGA 3FZTA 5AX9A 4MWIA 4D9TA 4MEDA 1XMAA 2BPMA 3OC1A 3NCGA 1YOJA 2QD9A 4X2JA 4FMQA 1GAGA 4Z16A 2BR1A 5ICCA 4I01A 3BX5A 3UOKA 3GYHX 5I9UA 4NT4A 5JGAA 4BTKA 1H07A 1NVQA 3TZ9A 3O17A 5FGKA 4QPMA 3CY2A 3EL8A 4HVIA 4KINA 3KVXA 5HTCA 3D94A 2GAUA 3QLGA 3TDWA 2F7EE 3HUBA 4FTIA 2W1FA 4AAAA 4IVDA 3QTQA 3VBTA 2O8YA 4G3GA 3LIJA 4TN6A 3RPSA 3RPYA 2VO0A 2E7XA 2YABA 4NJ3A 3H3CA 1IAWA 1HCLA 3UG1A 1OPKA 4B8LA 2PTKA 3KL8A 2W1CA 2DWBA 4MNEB 5BYYA 3H30A 4IX5A 4RJ3A 3KP4A 4FYNA 4ZTRA 4ENNA 2G9WA 2F2EA 2XGXA 3CLOA 4MGRA 2C3JA 4RAZA 2W7XA 4X2KA 4WKQA 1O6KA 2R3SA 3HZTA 3R04A 3ZFMA 2MBFA 3OD6X 3ZZWA 2C5YA 3NVMB 1ZLKA 3VJNA 1PY5A 3BU6A 4M73A 3SZTA 4EH8A 4Z55A 3PVUA 4O7SA 5CF8A 2B53A 3VUKA 2A4LA 3TOAA 2VC0A 1KQ0A 5K4JA 3WILA 1PMUA 1PMVA 4QMWA 5C26A 4EVIA 5LMAA 4QP2A 2QBYB 3HYIA 3EETA 2VAGA 2Y0MA 4NTSA 3BRBA 5HGIA 4MBLA 4RVKA 2MLGA 2BAJA 3V7RA 4J7BA 5M4FA 4CGAA 1F5QA 5IF1A 4L7SA 3MH0A 4ENMA 1J5YA 4GU6A 2BEOA 3ALNA 2EA2A 4G9RA 3HV4A 4GG5A 3VWAA 2H27A 1MZBA 1B9NA 2OF4A 4HGTA 2YCQA 1W5TA 4IHTA 4F63A 4IVCA 1SMTA 3MI9A 4X2FA 4ZMEA 4QWQA 2OU2A 5C9CA 4CQGA 2SRCA 2J51A 3GNIB 3QD0A 1GXPA 2W5AA 2HKXA 2W1DA 3MJ2A 3TZMA 2ESHA 3VQUA 1BI8A 1O3TA 4NW6A 4EHEA 4DHFA 4AA0A 3W1FA 2KIUA 5E20A 2G01A 3GQIA 4FTKA 4NH1A 1T46A 4UBAA 2FH9A 1FVTA 1T0FA 4M72A 3IKVA 1F5TA 4TYHA 5AP0A 2X39A 4LI5A 1G3WA 2NRAC 1XBAA 1CKJA 1ZZLA 2ZV7A 3QUPA 2HK5A 3DBFA 3OCGA 4OT5A 5BPIA 3HP5A 5HVQC 2ERZE 3UTOA 3U4UA 4FZAB 5FTGA 4WF2A 3MESA 4G8XA 2CCIA 3W33A 3A7IA 1J7LA 4BKZA 5HG7A 4BDKA 1O3SA 3HP2A 4V05A 5EDRA 5EEGA 2VN9A 3ANQA 2NS0A 2VOPA 2MC3A 5CXHA 3ZXTA 4I6HA 1R0PA 2RF9A 4G3CA 3OWKA 4Z2YA 5BYZA 1WVWA 2IA1A 3TNQB 4HGSA 2CKQA 4L9JA 3CXWA 2P33A 3PSDA 3R1NA 1OKWA 5F6FA 4J1RA 4QP7A 2BBYA 4A4LA 2JLDA 5CWZA 3GCUA 2V1XA 5IDPA 1Y8YA 4Y15A 2ZV9A 2FSTX 1VEBA 5DDGA 4I93A 2WMBA 4EKKA 2GWRA 4PMTA 2PVJA 4RJ5A 5K5RA 4TZRA 2HIWA 4ZJIA 3SKCA 2R3OA 4KRCA 3RCJA 2X9EA 4MCVA 3QPHA 4RZWA 3F3WA 4EHGA 2GMXA 2WB8A 2BAKA 1WZYA 4GK2A 1UV5A 5CVHA 4QMNA 3IOPA 1HKTA 1Z5MA 2C6IA 2WTVA 1J2XA 4CEGA 1REJA 1VJYA 2ADUA 5CQWA 3ZUUA 3QD2B 3JTHA 2O61A 2XIRA 2JPCA 1W7PA 4ZZNA 1YI3A 3HAMA 2HKOA 3MH3A 1U8RA 1OUYA 2WU7A 3FYKX 3OFMA 4EOKA 4P5QA 1FBNA 4MTDA 3V4GA 4IEBA 3GU6A 5H8GA 3ACKA
chains in the Genus database with same CATH superfamily
3FPMA 3BJAA 4YJQA 4F0IA 2W4KA 2X0QA 2YIYA 3ZRLA 5JHFA 1OCRH 4BHBA 1MD0A 5F0CA 4UYNA 1FMWA 3FF5A 5HIBA 2E5ZA 3AG2H 5BQ0A 1PXOA 1YTYA 1R00A 4IWQA 3FY0A 1OB3A 4FSMA 3OS3A 4GV1A 4JL9A 4AUAA 4CV9A 4AXEA 2OD5A 3V01A 4ANSA 2JVGA 3P4KA 3JXWA 4I98B 3SC1A 4B9DA 3QKMA 4DN5A 5HVJA 2JRMA 2PYWA 3QA8A 2PVYA 1HW1A 2XB0X 3IH3A 2R7UA 3LJ1A 5CNOA 3L7WA 2DMNA 5L8LA 2A69F 5JLWA 4P90A 4FX3A 2IRFG 2JN6A 2PZIA 1JKTA 3S32A 3DDQA 3SEQA 3CCQI 4HNIA 2XAFA 3FSFA 4F6SA 3CD8A 4A2UA 2E60A 4AOJA 5HX8A 3DXJF 4G34A 5E1XA 1YO5C 2C1AA 5HU9A 1IF1A 2XC7A 2CQXA 1LKXA 3FLYA 4MEYF 4ZZMA 3BQZA 3IDPA 2P5LC 3LAUA 1IXRC 1QPMA 4FSYA 4ZTLA 4O6JA 3C18A 2GQGA 3K5UA 5M44A 1ZLTA 1J7IA 3BU5A 1RE8A 2W99B 3CUQA 1E9HA 1MIJA 2CU7A 4JIAA 2J5PA 3QC9A 4GK4A 2IWIA 1IG1A 2XKCA 3RZDJ 3F3TA 3T0YA 5LFAA 4TYEA 2R7QA 3Q4CA 1WH7A 4D2RA 4HF2A 1SM2A 4L67A 4QYYA 3KXMA 3R83A 4WK8F 3FBVA 5J9YA 2Y75A 3EFJA 1Q1VA 4FQGA 2WIHA 3ULZA 1YIJI 5CI6A 3RAHA 4KNYA 5HBEA 2QONA 1ZELA 2IZSA 5CU2A 4D0PA 1GV2A 4CICA 4XG9A 5DOSA 4OTIA 1D5VA 1T38A 3W8LA 4AU8A 4BEHA 1NVSA 4LGHA 3PUPA 2H09A 4EH2A 4PGHA 3H5NA 2IS2A 3K2LA 3CCJI 4R7BA 3AKZA 4LGGA 4C3IJ 3HV5A 4FTLA 2QOHA 3E93A 5DE2A 2B4SB 3TNHA 3SOAA 3MSSA 4U43A 5AA8A 2P4WA 5A3XA 3LFDA 1PXNA 3S2PA 1QPEA 5HCZA 4OLIA 2BDFA 4XORA 2GTNA 2RFEA 1FOYA 4RC4A 1PF8A 3UO6A 4R79A 2MG4A 4RJ6A 1J7KA 4J53A 4EH9A 3RKXA 3DFGA 4DBQA 4CKIA 4IVBA 4RQKA 2VTJA 2UW6A 4YZCA 5E8XA 4ASNA 3I55I 4O4EA 4Z7HA 2J6MA 3CBLA 4XONA 3QU0A 2M45A 2Z16A 5CENA 2XAQA 4KSQA 3WF9A 2C0IA 2ISZA 3HL7A 1GHCA 2FUMA 4CKJA 2E1CA 4XV1A 4IJAA 1B6AA 4FT5A 2XAHA 2QUFA 4E4XA 4LFIA 2EXCX 3EHAA 1OGUA 5J3LA 4MBIA 5AUYA 4B8MA 4GYGA 1MBEA 3PLAE 1NT2A 2KIMA 3PFIA 2CW0F 4L0ZB 4EI4A 3I56I 3MQ0A 4ZLZA 4GVAA 2ZV8A 4MQ1A 3QODA 4BCFA 2OXDA 4LDTA 2EZKA 1YDTE 3TIZA 5E1WA 2C6DA 4BNCA 3LJ0A 3S0OA 1OQYA 1QVUA 5J5SA 1I5ZA 4AWIA 2IVUA 3UDBA 3AT2A 4XBRA 3ZSGA 4E6KG 4N0SA 1ZGAA 4QYHA 1W7PB 1IRZA 3A7GA 4USDA 3QXPA 2J0JA 2V6CA 2HYYA 3SXYA 1Z57A 3JVSA 4ZSEA 2DYRH 3RTPA 2QSHX 2EFQA 1WJ5A 2X7GA 4HLYA 4N4SA 3KQ7A 5CZHA 4I09A 4A12A 4R3CA 3ZO4A 4I6ZA 4QPSA 2BZKB 3KETA 2RGPA 3JS2A 4RM2A 1CM8A 1O4XA 2XHKA 3EYHA 1MRYA 4BHCA 3OIQA 3PQKA 3PPKA 2CSNA 4JBOA 2QM3A 3S00A 3COMA 3EMGA 1BA5A 1R36A 4I4EA 1Y8RB 5M06A 4EUUA 3ERED 3PE1A 4R8HA 2VGPA 4CO8A 1M7QA 3BPXA 3OYAA 4IRGA 3VBQA 4JXFA 4WSYA 3BR1A 2ESMA 2CMWA 1TNTA 4TNDA 3GBGA 1FOXA 3SDJA 3OEFX 2XBJA 3BKBA 1KONA 4A9UA 4XP0A 2D1VA 3MKZA 5FLXK 3A8WA 5BMSA 3J80K 3HBLA 5IISA 4ZSLA 2BZTA 3ASNH 1KE8A 5HICA 2Y6OA 4DOZA 1VYZA 2PHKA 1SD7A 4TL0A 3GTKJ 4ZXTA 2X6WA 1APLC 1FIPA 1YG2A 3OZ6A 1TT5B 5AIKA 3UNKA 3E3VA 4KITB 4CG8A 4FV7A 3CP2A 5IUHA 4CMUA 5HNIX 2ITUA 5CPRB 1FT9A 3FK7A 2WTIA 2VBZA 2XMYA 4M3FA 4OIOF 4FTJA 4L5IA 2CLQA 4BDZA 4IBMA 3WODF 2VQGA 1XPXA 2UZOA 3TNIA 5L3BA 1MJAA 4IO9F 2UW5A 3HUGB 4OTQA 5FP6A 3PXQA 5TO8A 5IUGA 5D11A 1SFEA 3OYJA 2C6TA 3GI3A 4RFYA 5KMIA 3IC7A 4KBCA 3IUOA 2QOOA 1UHWA 4RJ7A 4WBOA 3ZMTA 4QMPA 4KDPA 4G6DA 2JA2A 3UIMA 4ACGA 4IIRA 3GXOA 4IX7A 2BY3A 4GS6A 3W2SA 1Q5KA 4XIDA 5J4VA 4UALA 4D58A 3BPRA 3I59B 3JTGA 2YM7A 5DI1A 5B7VA 4NSTA 3ANRA 2OPTA 3BR3A 3AD6A 1ETVA 3ROYA 2MABA 4II3A 4R3RA 4G12A 5KZ0A 5F1JA 1GIHA 3FC2A 1LEAA 4BFMA 4E5AX 5CVVA 3O8UA 1H1QA 3OXZA 5J1VA 4Y17A 3DP7A 3ZQIA 4D4SA 4ZY5A 2RGVA 4KKEA 4C9YA 3OY9A 4CMOA 1GIIA 4U8ZA 1BI2A 5FKNA 3FSKA 5ILVA 2K3PA 3V5QA 1WPKA 4F7ZA 3QRIA 2R7IA 4FKSA 3B73A 5FD6A 1MMDA 5F64A 4DHJA 1ZRZA 5KNJA 3MB6A 3QQAA 5LWNA 3BI6A 4BBRJ 2V7FA 3UVPA 2FMLA 2V5QA 1Q61A 3KXGA 4M69A 2ZSHB 3R1QA 4HNUA 4MD8E 3MY0A 3FKJA 1PUFA 3COIA 3CJTB 4O4CA 3DLAA 4YJSA 1OI9A 2W84A 4Y83A 3R9OA 2X2KA 1MH3A 3HOVJ 1QL6A 1TW3A 1G8XA 2CFXA 1VYWA 4IQ6A 5BNGA 4WG3A 1IA9A 3I1AA 4PUZA 3WARA 1JKPC 3QPLA 1JKKA 2J0IA 1W36D 3TUBA 2OJGA 2WADA 4KWPA 4ZSJA 4UXQA 1MDMA 1ST0A 4D1SA 3OOMA 3EUKL 3LSRA 4IZZA 5TKDA 4FICA 3QCQA 4YP8A 5IA0A 3DBLB 2M4GA 2QKWB 5CEKA 1QPJA 5EF6A 2EWAA 3EFKA 5GADJ 1U9NA 2XF5A 4K8AA 1S8NA 3U54A 2G0EA 3NSZA 2R7RA 2QQBA 4ITIA 3C4WA 4O7ZA 5EG3A 4YHTA 2XK3A 3R7GA 2OJFE 4A3LJ 5CXZA 4DG2E 2IVTA 3DLLF 4MO7A 2MA3A 2XVDA 5AR2A 3JRAA 4HCTA 4D9UA 5CALA 1WGXA 3E1SA 4IWOA 1KZHA 4ACCA 5AJQA 3PVWA 4E7KA 5DYMA 4HPTE 3T3VA 4F70A 4C33A 5KCVA 4ON0A 2PULA 2GNJA 5DM6F 3IGOA 4ENJA 5GINE 4LV8A 4CDGA 1IRXA 3LQ5A 4M6VA 4FEUA 4M3DA 1J9IA 3I6UA 4EBVA 3H9OA 1IDYA 3F3XA 3VO3A 1MBGA 3ABKH 1JHFA 2YSRA 2QSGX 3TXOA 3LSJA 2CW8A 3D5UA 3L9MA 2QQ8A 5HLWA 3DTIA 2HQNA 2BMCA 1BL6A 3QAHA 1BLXA 2DCEA 1AKHA 2CJMA 2OI4X 4A3FJ 3GGFA 3K2AA 2OIBA 2XK6A 3QWLA 3ROUA 1JSTA 1LUFA 3D0SA 1PMEA 4AYBN 3I9V2 3AGLA 5K5QA 4I0RA 4JBPA 1BN5A 3P5KA 2E1MB 3OWPA 2AC3A 2GQQA 4J96A 3G51A 5FLMJ 4C36A 3NFFB 4MF1A 3OUNB 3J80Z 4FKPA 4QMLA 4ZTQA 2F7XE 5K5OA 3LQRA 3CJGA 4YGAA 2IA0A 4RVMA 4O91A 3RJCA 1XWSA 4QTEA 4XG4A 4D1XA 2VJ4A 5E92A 1SVOA 2OH4A 2WAFA 2B0LA 4XCUA 3ZQ7A 2XIKA 3K2ZA 1VLRA 1BBYA 3BJOA 4TXCA 4H1MA 1YVJA 3PXZA 4C3RA 2JKKA