2IZSA

Structure of casein kinase gamma 3 in complex with inhibitor
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
298
structure length
298
Chain Sequence
VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFALAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CASEIN KINASE I ISOFORM GAMMA-3
publication title Inhibitor Binding by Casein Kinases
rcsb
source organism Homo sapiens
total genus 102
structure length 298
sequence length 298
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2izsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2izsA01
4DFBA 2XK9A 5EW8A 3TCPA 5IA4A 4JAIA 3ZDIA 2XIZA 4L7FA 3FKNA 3QRJA 5CSWA 5H8BA 3CJFA 2O63A 3S00A 2O64A 2R3KA 3FWQA 5K4IA 3C5IA 2E9NA 3MFUA 4BGHA 4YNOA 2J0KA 2JIIA 3UBDA 4RVTA 4CQGA 4RVMA 3MESA 1CTPE 4D2SA 4C3RA 4GL9A 4S32A 3RPSA 4UZDA 4FYNA 3UNZA 2C6IA 2Y0AA 4HGEA 1JKKA 1XH4A 4FT7A 3HP2A 3QRUA 5FM3A 5HG8A 3TTJA 1QPDA 3SV0A 4I0SA 4L8MA 4K1BA 2W9ZB 3JPVA 3POOA 3FLYA 5KX8A 1XQZA 2PY3A 2Y4PA 3LM5A 2G2FA 3I7BA 4FIEA 5L6WL 2B54A 3DB8A 3D7TB 3E64A 3R63A 4W4XA 2CPKE 3VS4A 2ERKA 3PZEA 4ANOA 1MRUA 3L1SA 3ZFYA 2R3PA 3C4CA 4I6FA 3POZA 3VHKA 2HIWA 1ZWSA 4I21A 3UPXA 5AUWA 4UXLA 2QOOA 5IEXA 2HW7A 4ZS0A 2WHBA 4FK6A 1M2PA 3O8UA 3OEFX 3S95A 4GS6A 2W1ZA 4D5HA 2OU7A 1VR2A 4CTBA 3ZLWA 4EBWA 4Y5QA 4FV1A 4GUEA 4W8EA 2H9VA 1ZMVA 1M14A 3ODYX 5BMMA 3RBWA 2WIHA 4O2ZA 3AT3A 4WOVA 4L3LA 1L3RE 5KO1A 3UPZA 4CG9A 4DH8A 4U9AA 4J53A 2V62A 4G9RA 2YJSA 4FGBA 4AF3A 3OEZA 3TXOA 2HWOA 4HYSA 4I6QA 5EDQA 4PDPA 5M4IA 2IWIA 4F0FA 1H1WA 3R2BA 2XK4A 3GGFA 2C3IB 4G3DA 3V5WA 3NS9A 1E1XA 1M2QA 4U3ZA 1OL7A 3CD3A 3KF7A 3NW7A 4ZTSA 3CTHA 3FZSA 4J8MA 2QO7A 5EI2A 3ORNA 5HIEA 3ZHPC 5FQDC 4NWMA 3Q4CA 4Q5HA 3W33A 1XJDA 5JQ5A 4XP0A 1WAKA 4IAKA 5AUXA 3RK5A 4A9RA 4BDEA 4F7SA 4E8AA 2V22A 1YXTA 3PJCA 4IH8A 4QP4A 2E9PA 2IO6A 3DQWA 4DBXA 2ZB0A 1VZOA 1ZARA 4FV9A 4EOMA 3GQLA 1Q4LA 4C62A 4AZSA 5KMLA 3BGPA 2PMNX 4ZJVA 5HESA 4QMPA 2X7GA 3BQRA 3RAIA 2WTKB 3VS0A 4XOZA 2DYLA 3EB0A 2OBJA 4C2WA 2AC5A 3ZLYA 4DH7A 4G3FA 4YJQA 3VS1A 4C4FA 1PYEA 2RL5A 5IQBA 2C6EA 3AOXA 3QCXA 4X0MA 4D0WA 4AA4A 3DJ6A 3P7BA 3A7GA 4ZZMA 4F1OA 1OM1A 5F9EA 4HW7A 3F61A 4I20A 1WVWA 3EN4A 3R02A 3LVPA 2A4LA 2YM8A 1SVEA 2EU9A 4C4GA 5AAGA 4QMWA 2Z7LA 5JKGA 3QQKA 2Z02A 4CZUA 4F9CA 1PXNA 1IA9A 3UGCA 2DQ7X 3NAXA 4FF8A 3FLNC 3LCTA 3U4WA 3RM7A 4MBJA 3TJCA 4QYFA 5IU2A 4Q9SA 4RIXA 4BGQA 3R1QA 4Y8DA 3R9RA 3SXSA 5BVWA 4KS8A 2IZUA 4EUTA 4NTSA 1GOLA 1QPEA 4JDIA 2VTSA 2DUVA 4CT1A 4G5JA 2W96B 5LMKA 2RSVA 5AX3A 4M12A 3GCQA 3DQXA 3P9JA 2XP2A 4QP8A 4TWNA 1Q8WA 1XBAA 2EVAA 4IDVA 4J99A 5C01A 5M09A 5DWRA 2VTHA 4QMQA 2B55A 4HCUA 2FO0A 4Y73A 3WZJA 3I5NA 3NEWA 3KXGA 4Z55A 4WKQA 2QOIA 3MVHA 4O0UA 5IF1A 2IZSA 5I9XA 5L2WA 2ITOA 3QD0A 4G5PA 2ZOQA 2A1AB 1M17A 3F88A 4FEQA 5GINE 3SXFA 3LXNA 3FMDA 4ZTMA 1SZMA 2ZJWA 2VWYA 3L9NA 2W1GA 2IN6A 2OJFE 2PVJA 2C6MA 4LGHA 4ZY5A 5IH4A 5HHWA 2JLDA 4IADA 1H24A 3LLTA 3OW4A 4ZTQA 4ACDA 4BCJA 4RLLA 3FI2A 4BIDA 4QT1A 3E87A 5EFQA 1MQBA 2VTPA 4C33A 3Q2MA 4PRJA 1H08A 3QYWA 3ODZX 4CFWA 1XH9A 5LVNA 4DLIA 4RSSA 4USDA 5EKOA 4NTTA 3OUNB 1OBDA 2XKDA 3GC7A 4DG2E 3K3JA 3O23A 3CPBA 4TPTA 3VWAA 1JLUE 5HO7A 3Q4UA 3NGAA 3TUDA 1MP8A 2OGVA 3AMYA 3Q4TA 3FMEA 2WO6A 4I1ZA 4J8NA 4RIWB 3COMA 1ZYLA 3SX9A 4HPUE 1A06A 2BFXA 2XIXA 3KVXA 1IR3A 4BDJA 3W8QA 5HORA 3IKAA 4QMXA 1DI9A 4XUFA 4OLIA 4U80A 2QURA 3KL8A 3UJGA 4CYIA 5FP5A 1YXSA 3MJ2A 4IJPA 2OJGA 2CHLA 2R5TA 3K54A 3D4QA 3NW6A 4YHTA 5E8WA 5AV2A 3UOKA 3VBTA 4C59A 3VQHA 3GFEA 2C0IA 5CVFA 3ZEPA 4BYIA 4R6VA 1V0OA 3ACKA 1APME 3FI3A 4CZTA 4KKEA 1YHSA 4QQJA 5J87A 4ARKA 3BYOA 1YQJA 2QOBA 2P33A 4NZWB 5H8EA 3NRMA 4YURA 3P23A 5LARA 1OGUA 5LMAA 5E8SA 4KIPA 1UNLA 3KMUA 3LFNA 5K9IA 2QOHA 3EQCA 4IX5A 2X2KA 5B2KA 3CEKA 5FDXA 5JZNA 2PVRA 4AA0A 1J1BA 4ASEA 2QVSE 3HUBA 3LPBA 3KCKA 3BEGA 3VS2A 4G6OA 2HW6A 3QX2A 2OICA 2Y6MA 4FI1A 4CZYB 2REIA 3C4FA 4TN6A 2YZAA 3ZYAA 4KWPA 4MD9E 3TN8A 4E5WA 1T46A 2F4JA 2B0QA 3ULZA 4RZVA 4IQ6A 1FMOE 1HOWA 2BRNA 3MH0A 4WNKA 3BLQA 4EONA 4C0TA 2C6LA 4ASZA 4XG4A 3HRFA 5CU6A 3R8VA 3UVRA 1H1RA 3EFKA 4XEYA 3CLYA 2Y4IC 4C35A 1WCCA 4PL5A 2UV2A 2VGOA 3BX5A 4AA5A 2V55A 2YCRA 3CKXA 3LFBA 5DMZA 3VS3A 1PMUA 1UWHA 3BYSA 4YJNA 3W2OA 2OI4X 5AADA 3LLAA 4RA5A 3MDYA 4FKVA 4J96A 4IWQA 1H07A 3FC2A 4RWIA 4BTKA 2Z7QA 4UYAA 5LJJA 3BV3A 2PPQA 4U45A 1OZ1A 2ONLA 5KKRB 3UZTA 3TV6A 3SHEA 3NCZA 5BUIA 3HL7A 2QHMA 2VTNA 4TYIA 1LUFA 2B9FA 2BHEA 3FZRA 3ZUVA 4MBLA 4QMZA 3P7CA 3F82A 4ZLYA 5LMBA 4HZSA 3TNHA 4EHZA 5FUTA 3NAYA 3LQ5A 3QTQA 4RMZA 3E7OA 5HGIA 5AR3A 3ZC5A 5LCKA 2WMWA 2XA4A 2XK8A 1OL1A 3FYKX 4ORKA 1NVQA 3JS2A 4NM3A 3II5A 2JKMA 2J2IB 3PG3A 3JVSA 4G17A 2WPAA 4J1RA 2HENA 5DGZA 3TIZA 5HCXA 5IISA 1SNXA 2UW4A 3IW7A 4A07A 4O27B 2QI8A 2HCKA 3KXXA 3W2QA 5FD2A 4FK3A 4AZFA 5IEYA 1WBVA 5BNJA 3EH9A 5AV3A 1J1CA 2XNMA 4GT5A 4NFNA 3W2SA 2WMXA 2ZV9A 3FXXA 3V8WA 2R3JA 5AR7A 4GT4A 3CGFA 4U8ZA 5LWNA 3PRIA 3C0GA 3D5VA 4ZLOA 1Y8GA 2XNEA 4U44A 4F6UA 3NCGA 4G1WA 4I41A 3RK9A 2JIVA 3DKFA 1R39A 3MFSA 3NNVA 3DB6A 3IW8A 4U0IA 3I60A 2WKMA 4MQ2A 3T3UA 4EYMA 2WOUA 4R5YA 4EH3A 5A4QA 4ERWA 1Y91A 1YRPA 3HV5A 3OWLA 4JR7A 4A9YA 3BEAA 2VN9A 2GFCA 4MAOA 2C3JA 4D1SA 2CMWA 3I0QA 2HY81 3QLGA 2WTVA 3OHTA 3R0TA 4YJVA 3R1NA 4ZTNA 5HLWA 2YM5A 4JBPA 2H6DA 2R3FA 1BYGA 2RFDA 3EQGA 3NUUA 2JDOA 2Z8CA 3CY3A 2B9JA 2W5BA 4U43A 3ZH8A 2UW6A 4ALWA 1S9JA 4BKYA 3QXOA 1FOTA 2OF4A 4FSUA 2WMAA 4U41A 3ENMA 4LOQA 3G15A 4YU2A 3R8MA 2UVYA 4EI4A 3GCVA 4NCTC 4BZNA 3DBDA 2E9UA 1ZLTA 3NUSA 3MS9A 4FYOA 3OOMA 4CTCA 4M97A 4WG5A 3ULIA 4UMTA 3CC6A 5LMKC 3DKOA 3EQHA 3DA6A 3I81A 3PVBA 4GV1A 5ITAA 4BCGA 5KUPA 5L3AA 3D7ZA 5E1SA 2W06A 3MI9A 2BAJA 2W1IA 3B2TA 3D15A 4PF4A 3PE2A 2DWBA 1LP4A 4FKLA 3V01A 1RJBA 4X3FC 4YC8A 2GU8A 2J9MA 4YLJA 4ASDA 4DLJA 1U46A 2XB7A 3G51A 5BVFA 3U55A 3UP2A 2VUWA 4GEOA 3FXWA 5EOLA 2YDIA 3VS6A 2G15A 3VAPA 3V04A 4K77A 3S0OA 5AMNA 1URCA 4HGSA 4EH5A 1BI7A 3SC1A 4J52A 1Q97A 4L68A 2VTOA 5HCYA 4MCVA 3UO6A 2Y7JA 1W7HA 4O0WA 2FVDA 5HKMA 1Q8TA 4EH7A 3AD5A 3SXRA 5L2IA 2OWBA 3FPMA 2R3GA 4L9IA 3SAYA 2EXEA 2F7XE 4EC9A 4FOBA 4LM5A 4GKIA 1REJA 1X8BA 4PMMA 3CSVA 1U54A 3RVGA 3A7JA 4BDFA 4FT5A 2W99B 4BHNA 3VNTA 2ITXA 4ACHA 5IA0A 2XYUA 5DT4A 2FSTX 4OBQA 1SMHA 5CALA 3Q9YA 3N51A 1PY5A 4NJ3A 3DTWA 4AGDA 2QLQA 3F6XA 3O8PA 2ZB1A 2WFYA 4S30A 4TYGA 2XJ0A 5T68A 2F7ZE 3O7LD 5AR4A 4O84A 5C8NA 3F69A 2VTAA 4HGLA 4BDGA 2CGVA 2W4JA 4TNDA 1YI6A 5BVOA 5AAEA 4JBVA 3PPKA 5CI7A 5TE0A 3UQGA 5CEMA 4L6QA 2Z7SA 4I23A 3WF7A 4R7BA 3QBNA 1FQ1B 3CPCA 5DE2A 4M67A 4RJ4A 5H8GA 3DXPA 1YHWA 4EQMA 1H00A 1Y8YA 3WBLA 1YXVA 4EH4A 4AP7A 5HD4A 3DGKA 4YJRA 2OXXA 3ZM4A 2O65A 3FHIA 2GNFA 3GXLA 3QHWA 1NT2A 3RNIA 3KULB 3M2WA 4BYJA 3MY0A 4ANNA 2QOFA 4PX6A 1UU9A 4K8AA 5D1JA 2YITA 2IVUA 3A62A 5IH6A 4FKUA 1OL6A 1JBPE 4J95A 3SW7A 3QAME 4AFEA 1MRVA 2VTJA 3HMMA 3L8XA 3BHTA 3E8CA 2J51A 3IOKA 4IX6A 2QOQA 3FZ1A 3OCBA 4C7TA 2ITZA 1OUYA 2JKQA 3FI4A 3UZPA 1GNGA 5M51A 2BAQA 4O1PA 4B0GA 3RWPA 3FMMA 4E3CA 2QR7A 5HU9A 2B9HA 1I44A 1WBOA 2CGUA 2RF9A 2ITPA 4AX8A 5L2QA 4EBVA 2XK3A 5C8MA 2XJ2A 4EH8A 2I1MA 2OJJA 5BX0A 4M7IA 3O96A 3BRBA 3TZMA 4BIEA 4KKHA 4LGDA 3MH3A 3QZFA 3ACJA 5DHJA 4O82A 3KMWA 4YTHA 3THBA 5I9ZA 2WEVA 4C57A 4WO5A 5JMSA 2VAGA 2UW0A 3KXZA 4UMQA 4NIFB 3PXZA 3MBLA 4JQ8A 5DG5A 3NDMA 5E7RA 2UZUE 1YHVA 4LRJA 4YBJA 5CU2A 2V0DA 4FX3A 3C9WA 2R3NA 2X6EA 3DDPA 2YCQA 3VULA 4X6RA 3HRCA 4D2TA 2YZLA 2P0CA 4DITA 4EZ5A 4V01A 4YZ9A 4RRVA 5AR8A 3SDJA 3CJGA 5CS6A 3QKLA 5K5NA 3NUPA 3CR0A 4XYFA 2FSMX 3QKKA 3O8TA 3BKBA 3GU7A 2FB8A 3ZBFA 3C13A 3NIEA 1KE9A 3UP7A 4AOTA 4ZZNA 4O2PA 5I3RA 3HEGA 3S2PA 2ITYA 4B9DA 5M07A 2X7OA 2RFSA 3IQ7A 3LE6A 3R73A 4V0GA 4EOOA 5HVJA 5E8XA 4LQMA 3DZOA 2IVVA 2GNIA 5AWMA 5EQPA 3TZ9A 3GQIA 3LFQA 3ETAA 3UQCA 4RX7A 4QQTA 2YCFA 4Q5EA 3P1AA 3G9NA 1NVRA 2OFVA 3IOPA 3KA0A 5M44A 1WBNA 3EQBA 1FMKA 1STCE 3OUKA 1XR1A 1MUOA 1OKYA 2YFXA 1GZOA 4P7EA 5EH0A 3KEXA 2XNPA 4MEDA 3CP9A 2C5YA 4O86A 3RP9A 3ZRLA 3LFAA 3ZRKA 5C1QB 3C4WA 5I0BA 3LMHA 3DK7A 3DAJA 4RFZA 4Z7GA 4TRLA 3SW4A 4U6RA 3GP0A 2AC3A 4C2VA 3TNWA 2ITWA 2G01A 2IVSA 4GUBA 4H1MA 2LAVA 3WYYA 1Z57A 4R1YA 2BRGA 3QQUA 4ZAUA 2XF0A 4KB8A 5CT0A 5HTBA 3EQPA 4BI1A 4BVUA 2C6OA 2CN8A 3U9NA 4GK2A 4CRSA 2QHNA 3H30A 4BTFA 3OD6X 4FSWA 3EZVA 3VQUA 4IZAA 2ITQA 4F4PA 3MH2A 4BHZA 2OF2A 3F66A 1R1WA 4XCUA 3UIBA 3ZFMA 2EB2A 4JBQA 3TG1A 1JSVA 3R2YA 2GFSA 3DS6A 3QCSA 4OBPA 4JNWA 5DIAA 5DNRA 3OCTA 3PTGA 3IW5A 5J5TA 3GOPA 5LVPA 4QYGA 3F5XA 1Q61A 4G9CA 1OIQA 4JQEA 3RAWA 1CM8A 5EQEA 2EXCX 1PMVA 4QP1A 4IIRA 4FL1A 5LCJA 2UVXA 2W4KA 4FTJA 4MNEB 4DGOA 4FEVA 4MWHA 1YKRA 4YZCA 3W32A 2UZLA 5CF5A 5FRIA 3E7VA 2ETMA 3U4UA 3MY5A 2J0IA 3E8DA 5HI2A 4V05A 3FQEA 3E63A 5IH5A 4O7YA 4QTDA 4FT9A 4Y46A 2I0HA 2I0YA 1GIJA 1WMKA 2WMUA 4YTCA 3VF8A 5HD7A 3I1AA 4JG8A 5AUTA 3RHKA 4D9UA 2JDSA 5HIBA 1G8AA 2PVFA 3DAKA 1K9AA 5TR6A 4NJDA 4GW8A 3PUPA 5CEPA 3A7HA 4U5JA 4Q2AA 3PIXA 3F9NA 5FGKA 4D2WA 3P08A 3Q9WA 4S31A 4E4NA 2CNUA 3QUDA 1BMKA 4M0YA 3EMGA 2J6MA 3EL7A 5CSHA 4ACMA 3ORLA 4ZK5A 4TL0A 5IQEA 4FNXA 5AV0A 5M4FA 3PA4A 3D0EA 3BHUA 1JVPP 4AXAA 5EDPA 3W2PA 3M1SA 5AP6A 4KAOA 3LCKA 2GNLA 3I79A 4ASXA 3ET7A 4FTLA 3UIXA 2XNBA 4FTKA 5T3QA 3UOJA 5F1ZA 4O7RA 4TTHB 1XHAA 4XNEA 3E3PA 5CZIA 3QTWA 5HNIX 4IM2A 3ERKA 5JK3A 2R3HA 3TNIA 3C7QA 5CU4A 1BI8A 4O38A 2ZMDA 2C6DA 2AUHA 4M8TA 1ZZLA 4CQEA 3KB7A 4N57A 1M7NA 4R7HA 4L67A 1XH8A 3PJ3A 4FEXA 5EKNA 5CSPA 5L6PA 3ANQA 2VWVA 4YPSA 4EL9A 4Y85A 3SOAA 3QF9A 2UZTA 2QCSA 1HCLA 2YM6A 5JEBA 4EOKA 5IA3A 5A4CA 2I7QA 4E20A 3OT8A 4JS8A 3UIMA 4HGTA 3DBEA 3KC3A 4FT3A 5AJQA 3DPKA 1KV1A 3HP5A 2YN8A 2ESMA 4QNYA 2PUUA 4F08A 4AE6A 4BY9E 3EN7A 3W1FA 3M42A 1XBCA 4HCTA 4D4YA 3CS9A 4QP2A 2PUPA 3UOLA 3WF9A 2J7TA 3QLFA 4I22A 4QQCA 3ZS5A 4UY9A 4QNAA 2YWPA 3ZUUA 2HOGA 3AD4A 3PP1A 4OTHA 3R7OA 3QRKA 3SQQA 3TT0A 4KS7A 2NRYA 4FSRA 4XG3A 4PTEA 3FY2A 4DF3A 3KXMA 2W7XA 4HYUA 1WZYA 3AMAA 4C4HA 4EOPA 4CKRA 3V5PA 2XBAA 5AP5A 3BHVA 2PULA 4CFXA 4WRSA 4HYHA 4BICA 3DXNA 2VO0A 4WA9A 2C30A 5BQ0A 4JIKA 1BL7A 3R71A 4LL0A 3VBYA 2XIKA 1QCFA 4KIKA 5AM6A 3G9LX 1KE8A 4JX7A 3GI3A 4AZEA 2R3RA 4AW1A 5TO8A 3ZSHA 2WD1A 3GT8A 4L46A 4DH3A 4E4LA 4YO4A 4OT5A 3N9XA 5CENA 4FA2A 2XRUA 4DG3E 3T3VA 4MNFA 2XMYA 4UV0A 3R8PA 1OBGA 1B39A 1LEZA 3C4XA 2P2IA 4ITJA 5CF6A 4XLIA 3VO3A 3C4ZA 3AQVA 3UTOA 2ZV7A 1YWVA 1YOLA 3R8UA 4PUZA 3OBGA 5KHWA 3S3IA 2RG6A 2B9IA 4RVKA 2X9FA 4JOAA 4NUSA 3FE3A 3KRXA 3ITZA 3PPZA 5J9ZA 3WOWA 1ZYCA 2BRBA 3FHRA 4PPCA 4UXQA 3R7GA 4BR3A 2PU8A 3O7LB 5LVLA 1ZRZA 5I3OA 4LUEA 4CKJA 1WVXA 1FPUA 2XH5A 4H3QA 4BL1A 3EFLA 5ANIA 4ANBA 3ELJA 3QQLA 4N70A 3ZC6A 4HNFA 3F3UA 3CGOA 3MPTA 4IAFA 2ITUA 3R1YA 4QYHA 5J8IA 4DEEA 4M69A 3ZM9A 3TACA 4M13A 4PPBA 2VTIA 3ZO3A 3BU3A 4OTIA 3VJNA 2AYPA 2Q0NA 2OXDA 3Q52A 4GJ2A 2ITTA 3LHJA 1GY3A 3UYTA 1Q3DA 2BCJA 3BQCA 3FEGA 1H25A 2OJ9A 3S4QA 2XIRA 4KNBA 4KKGA 4F9WA 4OTRA 3FJQE 5DPVA 3P79A 4HNIA 2GSFA 1OMWA 4TZRA 4WSYA 4HCVA 4DCAA 2JEDA 2W1EA 3ORIA 4D4SA 4XBRA 3IW6A 3SRVA 3CQWA 4IE9A 4MD7E 5EDRA 4EOLA 3JR1A 2JDVA 4JXFA 4NW5A 4EJNA 4IAYA 4H36A 3CE3A 4NCTA 5B2LA 4AU8A 3ZCLA 3PZHA 1W8CA 4HJOA 5DR6A 3RI1A 4XHKB 3UMWA 5J7HA 4CRLA 2UW7A 4USEA 1WBPA 4NFMA 2BMCA 1V0PA 4RJ3A 4BTMA 3PSBA 4CCUA 1G8SA 2WZJA 3ZO1A 4YP8A 3IG7A 3DNDA 4GG7A 2GQSA 2QG7A 5H3QA 4FC0A 4IMYA 4ANMA 4FTTA 5GZ9A 3CQUA 4C37A 4TWPA 5KNJA 4APPA 4AGUA 4IVAA 1H0VA 1KV2A 5CXZA 3P4KA 5HBHA 4BDAA 3PVWA 4X3FA 3BGZA 3HV4A 3MTFA 4XG7A 3AMBA 3CCNA 4YSJA 1IA8A 5TKDA 2X4ZA 2XCHA 5G1XA 3RAKA 3QTRA 3U54A 3OF0A 5GZAA 5J1WA 5HBJA 4MK0A 1M2RA 3QZHA 2C5NA 4FZDB 4ZSJA 4QTAA 3F3VA 5DT3A 2XNOA 4QTCA 4P5ZA 3BYVA 2Z7RA 2JAVA 2BPMA 2QD9A 5GJDA 2R3QA 3Q9ZA 1IAJA 3RM6A 1GZKA 2JFMA 4MXXA 4Y83A 3VS5A 4CFVA 4PQNA 4PMPA 3BLHA 5TF9A 2FGIA 3V51A 4IAZA 1O6KA 2OZAA 2UZWE 1ZMWA 3LXKA 3PYYA 1Q8YA 3VN9A 2OSCA 3AXWA 1DM2A 4DG0E 2OZOA 3ORXA 4RGJA 4UZHA 3Q9XA 4D2VA 3D5WA 2JBOA 2C47A 2RKUA 3F2AA 2JKOA 3VW6A 1O6YA 3DOGA 4IX4A 1OPLA 4NH1A 3UIUA 3W55A 3A61A 3KN5A 3PWYA 2I0VA 4UWBA 2GNGA 2IW6A 4BKJA 4EOSA 5IQGA 4KRCA 1MQ4A 2C68A 1ZY4A 4FTCA 3SKCA 3DDQA 3C50A 1Q8UA 5HLPA 5AAFA 3PPJA 4AQCA 4YZBA 4GMYA 4DHFA 2B53A 3LCOA 2BILB 5F4NA 3BE2A 2ZM3A 5DN3A 4FV8A 5T6KA 2BDJA 3R8LA 1M7QA 3WZDA 3PXYA 5EK7A 5IQIA 3FLWA 2BTSA 3FBVA 5M4CA 1YI3A 4D2PA 3FUPA 1JKTA 3OTVA 2CSNA 5CEIA 2VX3A 3C4EA 4BCMA 4ZJJA 4BBMA 4EH6A 4WNOA 4YGAA 3UNKA 1YOJA 3OS3A 3LIJA 3OXIA 5CAUA 4KBAA 1OUKA 1YW2A 4ALVA 4FTOA 4IAIA 5EQYA 2J5FA 3R22A 4K33A 1NVSA 2XEYA 4FKGA 4DFLA 2UVZA 4TYJA 3PIZA 5CZHA 3DXQA 4BWPA 5JGDA 1YVJA 3FSKA 4HYIA 4X3JA 3PA3A 4D1ZA 2O2UA 1Y6AA 4W4WA 4FOCA 4L53A 1WVYA 2C6KA 4F1TA 3CTJA 2FSOX 3QTUA 3KXNA 4GIIA 1PKDA 5C9CA 4FG8A 2PMOX 2QOKA 1HCKA 1NW1A 4IB0A 3SLSA 5CAPA 2XRWA 5ANJA 3D9VA 1UNHA 5B7VA 3E93A 3HZTA 4QMNA 3MJ1A 5C27A 4DAWA 4MF0A 3LAUA 4U81A 4OTGA 5LWMA 4OTWA 4X2GA 3EOCA 1E9HA 4YC3A 4C02A 4RX5A 3HV7A 4FTAA 1NY3A 3V6RA 2J50A 2YAKA 3LJ1A 3QU0A 4L3PA 1Q99A 3QQHA 4LOOA 5D41A 4MXCA 3EWHA 4H39A 4XV3A 3RJCA 4QMTA 4H58A 2GQRA 1UVRA 2FUMA 2NP8A 4RJ8A 3QZIA 4A7CA 2X39A 1UKHA 1FGIA 4TWOA 4FV4A 3MTLA 3LFEA 4RIXB 1G5SA 4TXCA 1GIHA 2HXQA 2V7OA 4EEVA 3SGCA 3I7CA 3EZRA 4RJ5A 1DI8A 3NYOA 2C4GA 1H27A 4KBCA 5AEPA 3GNIB 4O7TA 2GNJA 2VU3A 3BELA 4IEBA 3U6IA 2W0JA 4EUUA 3DU8A 3VBVA 2FH9A 3IDBA 3LQ8A 4NT4A 4W9XA 4XG6A 3FPQA 3W18A 1IG1A 3DV3A 4MXAA 5KZIA 3WE8A 3I5ZA 3ZXTA 5KZ0A 4XOYA 4O21A 1TVOA 3O2MA 2X0GA 3LXLA 2XKFA 3PY1A 1M52A 5CNOA 4E73A 5FDPA 4A9SA 3BI6A 3DJ5A 4UBAA 4JAJA 2HK5A 3AC2A 3OXZA 2C3KA 4DGNA 4YUQA 3N4TA 5DVRA 3RZBA 1BL6A 1U5QA 4YPDA 4DFXE 3IS5A 3QC4A 4MF1A 5CT7A 3EN5A 4FZAB 4IAAA 4UALA 4KUJA 4MYGA 4WRGA 1L8TA 4FTUA 4FV5A 5DYJA 2PVMA 4FKQA 3AC3A 5C26A 2CNVA 1NA7A 1ND4A 2PE0A 2BDWA 4FV0A 3PXFA 4F0GA 1YOMA 4GSBA 4R7IA 3TV7A 4MXYA 4L43A 3LXPA 3K3IA 2QC6A 3GEQA 3ZU7A 1PXJA 3F5PA 2CKPA 1U59A 4ZTRA 3R7YA 3FLSA 1YDRE 3G5DA 4HZRA 4DGGA 2ZDUA 3LFCA 4JR3A 2BALA 3ZZEA 5AP3A 3DBQA 3AC1A 4QPSA 5L4QA 4FODA 5E92A 4O91A 4ZZOA 4DEBA 5ICPA 4AZTA 1Q8ZA 2VX0A 4EZ3A 5IDPA 2YLEA 3Q3BA 4BC6A 2ACXA 3TKHA 1DS5A 2VTTA 4I5MA 2WAJA 5E8ZA 3PDTA 2XNGA 5ETAA 4B4LA 3GB2A 2VO7A 3LCSA 1IEPA 2ZV8A 4UMRA 1ZOEA 3CD8A 4LYNA 1W0XC 5D11A 1P2AA 4CNHA 5CSXA 2HZIA 3PRFA 3UZRA 4GU6A 5AA8A 4NYEA 3QQFA 3NLBA 1Z9XA 3KRJA 3H10A 2UZBA 4GFOA 3ZONA 5EM7A 3E8EA 4AS0A 5KMMA 3AG9A 3R04A 3HV6A 3ORMA 5E9EA 4FNWA 2QOLA 5IA2A 4FIIA 2WOTA 5DR9A 5J9YA 5CLPA 2RG5A 5D7AA 2H34A 5DRBA 2R3OA 3WIKA 2CNQA 5EI8A 5FP6A 4EH2A 4KBKA 2W5AA 4LRMA 5HE3A 1T45A 3AC8A 1KE6A 2CLXA 3OWKA 4K0YA 1OB3A 4UMUA 2IJMA 1TQIA 3VUKA 3C5UA 3FKOA 4RLKA 3OXTA 5L2SA 2C6TA 3QC9A 3TIYA 3GBZA 4EH9A 5A9UA 3JXWA 2IW8A 3VBWA 2PZYA 2BVAA 2YIQA 2F9GA 1AD5A 3GCUA 4KABA 4NU1A 4QMSA 3P78A 4GCJA 3GVUA 2CCHA 4FIHA 4GK3A 5F94A 3PLAE 2F7EE 5ANEA 4PNIA 4I5PA 5IG1A 5LQFA 2JD5A 2JGZA 3G0EA 4J7BA 4AGCA 4WIHA 5E8UA 4L42A 4KD1A 2PTKA 4DEAA 3U8WA 3VUDA 3WZKA 1KE5A 4BCIA 3I6WA 2P3GX 2HZNA 3V8TA 4ENXA 4JDJA 4TWCA 4RX9A 2R0IA 5ACKA 4AT4A 4DH1A 3QL8A 3BCEA 4YNEA 4ZIMA 2YJRA 2QNJA 3F3ZA 4BBEA 4BWXA 3ZLXA 4ID7A 4BFMA 3QHRA 5AUYA 3Q53A 3REPA 3HLLA 3HVCA 5C03A 4ZSGA 3ZXZA 2VZ6A 2XZSA 4ZP5A 3A8WA 2X7FA 5EOBA 2QKWB 2X8IA 4BGGA 4R3CA 4LOPA 4QP9A 4XV2A 1J7LA 3T9TA 1CDKA 4FV7A 4BDBA 2CGXA 4FSMA 4Z9LA 4JL9A 4TKSA 3OCSA 4WNMA 1JSTA 3GC8A 4X2NA 1GAGA 5EM5A 4E6CA 2EB3A 3EFJA 3L9PA 5FBOA 2YIYA 3P5KA 1FVTA 1ZYDA 5IQDA 2FYSA 2LGCA 3RPOA 4GYIA 2PL0A 3D5XA 4E26A 2IZTA 3TTIA 2B1PA 4DEGA 4WUNA 5AA9A 5HQ0A 4ERKA 3Q04A 4E1ZA 4IM3A 4JDKA 3PXRA 4C4JA 3LKMA 1W83A 2WMQA 3UVPA 3TZ7A 5E8TA 4Y72A 2GCDA 3UNJA 4JBOA 4O96A 4G31A 5CAQA 3D83A 1XH6A 4FSNA 2YLFA 3KKVA 3R9OA 3NPCA 4MKCA 5H2UA 1VJYA 2OXYA 4X21A 4PMSA 1KE7A 2QQ7A 2OH0E 4MXOA 5BUJA 1QPCA 3F3WA 4ZLZA 3DY7A 4BCNA 4BCHA 2UZOA 4A4OA 5AP7A 2G1TA 3V3VA 2J0LA 5CEOA 1KSWA 3HDMA 4QP3A 1UU7A 5C4LA 4B6LA 4C3PA 5HCZA 3ZSGA 3K5VA 3R28A 3D5UA 2X1NA 4FTMA 3U6JA 5FTQA 4M14A 1OL5A 2G2IA 2P4IA 2VGPA 2X2MA 1Z5MA 3GU5A 3HKOA 3NUXA 3OP5A 3ZEWA 3BGQA 1IASA 2R64A 4FG9A 4BTJA 5KCVA 2UW3A 4RC4A 4CFFA 1PMNA 1WBTA 3HMIA 4IB1A 1P4OA 5HVYA 4N0SA 3TUBA 4YLLA 2KTYA 5EHLA 3QA0A 2Q0BA 3ZSIA 5IQCA 2PVYA 1YDSE 2JIUA 4DBNA 4BCOA 2V7AA 4BWKA 3PJ8A 5AV4A 3BHYA 3NIZA 3ZMMA 4DFYA 3QD3A 3MA6A 5AR2A 4TYEA 2H96A 3HA8A 4I0RA 2XIYA 4TYHA 5J1VA 3ENHA 5D7VA 3HECA 5E1EA 4BCKA 4D9TA 5KMOA 4FEUA 3W2CA 3EQDA 2QODA 1S9IA 3F5GA 2UW8A 4X6QC 4YZDA 3AD6A 3UDBA 5AP1A 3BYMA 2JAMA 5HLNA 3CBLA 3F3TA 3G6GA 3EQRA 4F9BA 3IGOA 2BKZA 4FL3A 5M08A 2BTRA 4OUCA 5F20A 2YACA 4FG7A 3R9HA 3ZZWA 4QYEA 4F9AA 5JZJA 3A60A 2FA2A 4LV8A 4F7JA 2CKOA 1U54B 4WD5A 4ZY4A 4NW6A 5HNGA 2PZPA 4H3BA 3LMGA 5K5XA 1RQQA 4N6YA 4GYGA 2W1HA 3QGYA 4FKRA 2PVLA 3PIYA 4QMMA 3ZO4A 4DGMA 4FEWA 2C0TA 1CKPA 3KXHA 5CEKA 5FTOA 2XS0A 3E8NA 3H3CA 4AFJA 4O7LA 5FXSA 1K2PA 4RZWA 4LFIA 1YDTE 4II5A 4EYJA 2F57A 4WG4A 1BKXA 4L00A 1VYZA 5J9LA 5IQFA 5BVKA 4C38A 2OH4A 2VTQA 3CY2A 3V5QA 5AP0A 2VTRA 4PWNA 3HMOA 4R5SA 2PK9A 3K2LA 3A4PA 2ZYBA 3JY0A 3UC4A 3VRYA 3BWJA 2RFNA 2UW5A 3E5AA 4GFMA 4PTGA 3U9CA 4FMQA 5LVMA 1ATPE 3MVMA 4RIYA 5AR5A 4IZ5A 4RA4A 4KA3A 4GG5A 4O0VA 3JYAA 4TW9A 5E8YA 3S1HA 3MY1A 2WTCA 4XV1A 3G2FA 3R7UA 3MPMA 4AOIA 4AZVA 4DE4A 4KIOA 4ZSLA 4EHEA 1PRYA 1W98A 2WEIA 3PA5A 2GS2A 5CVHA 1W82A 2VO6A 4BDKA 4B99A 3KK9A 2PZRA 2OIQA 3CKWA 3KRRA 3NUNA 3PY3A 4PY1A 4R3RA 5CX9A 5KE0A 2C3LA 4IW0A 4AW2A 1EH4A 5CYIA 3TNPC 3ZTXA 3WI6A 2C5VA 3EN6A 4FV6A 5CXHA 5ETCA 2YCSA 2I0EA 5GNKA 5IUGA 2DS1A 4RPVA 4QPAA 2GNHA 2WQBA 3A99A 3TL8A 3B8RA 4S34A 1PHKA 3U51A 4AE9A 5HU3A 5K4JA 2QU6A 3A4OX 5JGBA 4C34A 1Q24A 2VWBA 4JG6A 4N6ZA 3V5TA 4E5AX 4H05A 3T9IA 1H26A 2YISA 1PXIA 2GHGA 5EM6A 3FV8A 1PXOA 3IONA 4O7SA 5JFSA 2WTWA 4EHVA 5DA3A 2X6DA 4O0SA 4QMYA 4KSQA 3UODA 4ITIA 4GVJA 1BLXA 1O9UA 5A14A 2PE1A 4BRXA 4DEHA 1QPJA 5L8LA 4D1XA 3A2CA 4O0XA 2IW9A 5HE0A 2GMXA 5J7BA 3QD2B 2H8HA 3MB6A 3QALE 3WYXA 5AX9A 2GS6A 5M06A 2Z2WA 3LFDA 4RWKA 4FGRA 3FZPA 2WIPA 4U3YA 4WBOA 4CKIA 1XO2B 2HYYA 4WHZA 2F2UA 4ANQA 4D5KA 5IQHA 4FV2A 2F2CB 4AW0A 5A6NA 4D55A 3GU4A 4G2FA 4AN2A 1SM2A 3D14A 2ERZE 4CT2A 4P5QA 4D2RA 4ZSAA 5CY3A 1FINA 4AGWA 2Y6OA 4PNKA 4RG0A 1R3CA 4QD6A 2W17A 5HO6A 4BDDA 2E2BA 2ZDTA 3OZ6A 4XS2A 4EK5A 3KQ7A 4MD8E 5FEDA 2CKEA 4O7ZA 2Q83A 3QUEA 4RBLA 4ZTLA 3P86A 4JQ7A 1SNUA 4V0GB 3L9LA 5HE1A 2QO9A 2Y9QA 1R0EA 4IB5A 5F95A 2WMRA 5K3YA 5A54A 3MA3A 3B2WA 4A06A 3H9FA 3OW3A 4O81A 5HG9A 2VWZA 1UA2A 4F0IA 2XKCA 3NYVA 3LMIA 4XG8A 4MTAA 1XBBA 4LG4A 3FZOA 4PTCA 4NK9A 3IPHA 3Q6UA 3QKMA 4AAAA 4D4RA 3VBXA 3SOCA 3FMNA 3EQFA 1WFCA 5AP2A 3A7FA 3FMLA 3RTPA 2G9XA 3QWKA 4O6EA 2XM8A 4ZOGA 2GQGA 3UQFA 1XH5A 2OG8A 4EWQA 4NM5A 2GTNA 5DBXA 2ETKA 1CKIA 3ZOSA 4QMVA 2OKRA 4A4XA 1ZAOA 3DK6A 4GRBA 1YXUA 3FQHA 4HVHA 4Z7HA 5I9YA 4DTAA 4PDSA 3RWQA 3BU6A 3DLZA 2BAKA 3HMPA 5A4EA 3FYJX 2EWAA 3HRBA 3PFQA 5EW9A 2ZVAA 2CGWA 2BZHB 1WBSA 3HUCA 4JDHA 4OT6A 4XP2A 5DI1A 5I9UA 1DAYA 5CEQA 3UG2A 4F9YA 2OIBA 3OY3A 1W84A 4UN0C 3R8ZA 4C4IA 3H0YA 1J7IA 4FNZA 4BB4A 4PL3A 5AIKA 2YIXA 1JQHA 1OKZA 4W9WA 3ORKA 4MH7A 3Q32A 4ACGA 3RPRA 3T8OA 2CLQA 2HELA 4I24A 3IDPA 2PZIA 4RIWA 4UEUA 3MVJA 4RIYB 4FKJA 2UZNA 4L3JA 4EK3A 2F49A 1V0BA 1J3HA 3E62A 4CLJA 4FR4A 4NL0A 4CG8A 3EYGA 2YDKA 4OBOA 2WELA 4BCFA 4O7VA 3E88A 4PP9A 4YHJA 3F5UA 4W4VA 1KUTA 4P4CA 2ETRA 2W5HA 1OIUA 2R4BA 3TEIA 3WZEA 3V6SA 2W9FB 4BDIA 4YJSA 2QOCA 4EOIA 3ZFXA 3NMUF 5CF4A 3UMXA 4QTBA 5HBEA 4FT0A 3KREA 2W4OA 3PSDA 4WUAA 4G6NA 5DEYA 4QQ5A 4I0TA 2WQEA 4DFZE 4RX8A 2X8EA 2WTJA 2QU5A 3ANRA 3KN6A 1H01A 2WTIA 3FMKA 4FUYA 3NNUA 4NEUA 3FZTA 1ZYJA 3NW5A 4FSQA 4RJ6A 3F7ZA 3O51A 3WIGA 3F7WA 3GC0A 4C8BA 2ZM4A 2GHMA 4XP3A 1PF8A 3MPAA 5BYZA 3U6HA 3LCDA 3QTXA 5HX6A 3KK8A 4FBXA 3VUMA 1TQMA 3MIAA 4DEDA 4FTNA 3NVKI 4WSQA 3OT3A 3TV4A 4K9YA 3G0FA 5K0KA 4QMUA 4C4EA 3R6XA 1ZZ2A 4CMOA 3CQEA 4OAUC 2YM3A 1PXLA 1KOBA 2OFUA 1SVHA 1ZOGA 3OWPA 3ZDUA 1FBNA 1JAMA 1R0PA 4A9UA 3AGLA 4FKTA 4BCQA 5DR2A 3TM0A 4BN1A 2B4SB 3LJ2A 3DBFA 3OVVA 3PVUA 4IWDA 4G6LA 4DH5A 3RMFA 4D28A 4FZFB 3TZ8A 3WILA 3NUYA 3EKNA 4YTIA 3BIZA 3SD0A 3D94A 4MWIA 3Q2JA 3F2NA 1OITA 5EYMA 1RE8A 4Z16A 5EI6A 2CKQA 5FXQA 4RC3A 1H1QA 1CKJA 3VVHA 4JVGA 2ZAZA 4FIJA 4RVLA 4QP6A 4YJUA 3SVVA 4CV9A 3COKA 5GIOE 4HVGA 1PXKA 3VUGA 5HOAA 2A19B 1Q5KA 4IANA 4UWCA 3DKCA 3TKIA 1FVRA 4CCBA 5AM7A 2JDTA 2BRMA 4DTBA 3BBTB 5HVKA 4ZEGA 3LQ3A 2HXLA 2Y8OA 1NXKA 2BZKB 3OWJA 1Q3WA 3PE1A 3DT1A 2GHLA 3FKLA 2KULA 4PL4A 4K2RA 2SRCA 4R3PA 2BKKA 3QQJA 5JT2A 3L8PA 1H0WA 3RCJA 3NYNA 3AGMA 1GZ8A 3OCGA 4XV9A 1ZOHA 4FICA 5D9HA 4Y5HA 2WTKC 3VW8A 3R83A 2VTLA 4OW8A 5B2MA 5A4TA 4E6AA 4AWIA 2JFLA 4NM7A 5ANDA 5CWZA 4OTQA 1PJKA 2XBJA 3VUTA 4BKZA 4FE2A 2E9OA 1TKIA 3RKBA 4ANSA 4YJPA 3SA0A 4IACA 1SVGA 5IMXA 4BF2A 1H1SA 4TNBA 3COHA 4UYNA 4YO6A 4G3EA 4KIKB 4A4LA 4XX9A 2BFYA 4FZ7A 2Y4IB 4APCA 3R7VA 3DAEA 3U87A 3BZ3A 2R7IA 2XJ1A 2PUIA 3L8VA 3NR9A 3GOKA 3Q4ZA 5FG8A 5ANKA 3CTQA 1J7UA 4FTQA 1IAHA 4FTRA 3NWWA 4S33A 5CF8A 4GFGA 3RZFA 2P2HA 2VX1A 2WMTA 2JITA 2IG7A 4IVBA 1JSUA 5EHOA 1Y6BA 2QKRA 2PMLX 4LV5A 4IBMA 4RJ7A 3O17A 4YJTA 4IB3A 5GJFA 2G2HA 2I40A 5DFPA 2OK1A 4I6BA 2J5EA 3QXPA 5KMJA 2JDRA 2XEZA 4HVDA 4W4YA 2ITVA 3UO5A 5CU0A 1B38A 3TI1A 2HZ4A 5J79A 3NUAA 2CDZA 4UWYA 4KIQA 2QLUA 5EHYA 4J98A 2YM4A 3V8SA 4F70A 4P2KA 5CI6A 2IPXA 4JRNA 2BZIB 4IVDA 3O50A 2HY0A 3R7IA 2VTMA 2XVDA 4RFYA 4E5BA 3DFAA 4D4VA 3KRWA 2VD5A 3MYGA 2WTDA 4F09A 4G16A 4M69B 4KSPA 2VWXA 5E91A 4Z3VA 2ZM1A 4FZ6A 5BPYA 2A27A 4OTFA 2W1CA 4EJ7A 2OJIA 2W1FA 3UC3A 2VV9A 3ORTA 3HV3A 1TQPA 2ITNA 3KRLA 4RQVA 4XG2A 5I9WA 2J0MB 2YIRA 3VJOA 4FVRA 4X2KA 4CMTA 5HIDA 3R01A 1R78A 4U7ZA 3OG7A 3AC5A 4CMUA 3TDVA 4GU9A 2WU6A 4EK4A 4AZWA 3EHAA 3COIA 5CTPA 5IPJA 4C36A 3R30A 4EHGA 3N4VA 2P55A 2XM9A 2Z60A 2BRHA 4YLKA 5E90A 3SG9A 3R00A 3AT2A 3SRVB 4ALUA 3HGKA 1UU3A 1JPAA 2O8YA 4IFGA 1F0QA 5KMNA 3VF9A 3P7AA 4RWJA 5EYCA 4F7NA 4G34A 4IZYA 5ANGA 2PZ5A 5ACBC 3QTZA 1PYXA 3HDNA 4EK6A 4QMOA 5M56A 1WBWA 4GH2A 3OMVA 3NNWA 3TDWA 3TNQB 4DT8A 4DCEA 5HTIA 1AQ1A 1Q62A 3RCDA 4F64A 5JGAA 3I4BA 1H28A 5CQUA 4A9TA 4FTIA 5TOZA 3OROA 3BV2A 4GIHA 3BU5A 1ZYSA 4X3FB 5I5ZA 5K0XA 5A6OA 4K6ZA 3R9NA 2R7BA 5HTCA 4IM0A 2NPQA 1I09A 2NO3A 2OO8X 3VC4A 3RINA 3N4UA 4QOXA 3FL5A 5CASA 2E9VA 3MFTA 3EIDA 3WF5A 5FTGA 5ANOA 4ZXTA 5JQ8A 2W05A 3MVLA 3DTCA 3KULA 3BE9A 3QQGA 4EORA 3W16A 5EM8A 4IHPA 4JJRA 2WB8A 2XKEA 1VYWA 5AP4A 1UV5A 4WBBB 4B7TA 4JT3A 4IJ9A 1U4DA 4F99A 5IQAA 2XK7A 4MBIA 3NSZA 4O0TA 5LOHA 2OZAB 4R8QA 1V1KA 4CV8A 3QUPA 4FVQA 3RALA 4J97A 5KBQA 3RGFA 1JWHA 3IW4A 4L45A 5ETFA 5HNBA 5KBRA 3GU6A 2WNTA 4KRDA 4XLVA 2VWIA 3C51A 5BVNA 4E6QA 4RFMA 1OL2A 2VWWA 3AC4A 2WMVA 4Y95A 4L01A 5BUEA 1KWPA 5GIPE 4XBUA 3AT4A 4UX9A 4HPTE 3PXKA 3HAMA 2R9SA 2IVTA 4OAVB 1URWA 4HVSA 3HYHA 1P4FA 5HEZA 3GCPA 3DFCB 4U42A 3NVMB 2R3LA 2YIWA 3E3BX 4IZ7A 4O6LA 4FIGA 4IVCA 4WNPA 2BHHA 4BDHA 2WMSA 2W1DA 3FAAA 3FQSA 3E92A 4FSZA 1H4LA 2IZRA 3C0IA 4MHAA 3V5JA 1PKGA 4JRVA 1PXPA 4NIFA 3A8XA 1GZNA 3FLQA 3L8SA 1MRYA 4JLCA 2GS7A 5BVEA 3ZRMA 5KKRC 1A48A 4GVAA 4C61A 2B52A 4DEIA 1JNKA 2BDFA 2C1BA 5DT0A 5CU3A 4CXAA 1Q41A 4JI9A 4M68A 1XWSA 3GFWA 3KMMA 4S2ZA 4F63A 1LPUA 4G3CA 4GJ3A 4AOJA 3F2RA 4QO9A 4DC2A 3PXQA 2VNWA 1JKLA 2BIYA 3PY0A 1OPJA 3O0GA 4IC8A 4NKAA 4U40A 5IUIA 4BZDA 2UW9A 4K11A 4D0XA 3IGGA 5D12A 4I4EA 3QCQA 5GZ8A 2XYNA 4QPMA 4YZMA 4V04A 3ZLSA 4DA5A 5E8VA 4AUAA 4LRKA 4M15A 4OGRA 5LXMA 3FMHA 4YMJA 2WU7A 4EQCA 4TT7A 3ORPA 1DAWA 4QTEA 5JFXA 2PE2A 3B8QA 1U5RA 4ENYA 2HAKA 4DN5A 3ROYA 3WF6A 4YHFA 5FEQA 2BROA 3KU2A 3DCVA 5IA1A 4H3PA 1O6LA 4ZS4A 5AUZA 2PVNA 4O22A 1UU8A 4XMOA 2O3PA 1YI4A 3VS7A 4PP7A 1ZMUA 1PW2A 1XH7A 3HMNA 4K18A 4DINA 5DRDA 2BUJA 4HVIA 3P0MA 3DK3A 4M3QA 1PMEA 2J90A 2ZV2A 3Q6WA 4E7WA 3C0HA 1RDQE 3R7EA 1OVEA 3PJ2A 1E1VA 5JFVA 2CCIA 5IUHA 3RPVA 3HAVA 4EKLA 4AW5A 3O71A 3CIKA 5HG5A 2BZJA 3I6UA 3PLSA 4EKKA 2PVHA 4F65A 3TUCA 5JRSA 4O7WA 1FVVA 2X4FA 3DKGA 2YDJA 3IO7A 4PPAA 3EL8A 2A2AA 3QRTA 4ONAA 2QG5A 3V5LA 5I4NA 4M66A 2R3MA 4RC2A 3PVGA 3K5UA 3OC1A 5JRQA 5B0XA 3FDNA 4ACCA 3LFSA 2QO2A 1B6CB 1GIIA 2BIKB 3QTIA 3JUHA 2A0CX 3VHEA 4USFA 3ORZA 4FSTA 5M4UA 3L9MA 4DFUA 3FLZA 3DBCA 3G33A 1UNGA 4FNYA 4GT3A 3BYUA 4AG8A 4KINA 4TY1A 4IWOA 2WQNA 2X2LA 4QRCA 4ZTHA 5L8KA 4XRLA 2PUNA 1KOAA 2JC6A 3HNGA 5HE2A 1P14A 3TWJA 4O83A 4G3GA 4LMUA 5CQWA 4F6SA 5A46A 3OFMA 4I4FA 3KCFA 4LUDA 4MXZA 3W8LA 5IA5A 1JKSA 2PSQA 1GJOA 4N4SA 4RIOA 2V5QA 4B8LA 4BI2A 4CFUA 2PHKA 3FL4A 1A9UA 3GCSA 4MNEA 3UE4A 4UB7A 5AV1A 4CLIA 3QYZA 3G6HA 2C0OA 3W10A 4ZY6A 5KMKA 2C69A 4AT3A 2RIOA 3FC1X 3IK3A 2X9EA 3MIYA 1OIRA 4NM0A 4PMTA 4RQKA 4X7QA 4EZ7A 4E4MA 3TJDA 4MQ1A 1H1PA 4EOQA 4EQUA 2UZEA 4D58A 1BX6A 2O0UA 4C58A 2X8DA 2BR1A 4E4XA 5GJGA 3ALNA 2J0JA 4DGLC 3UVQA 5ETIA 4UMPA 5BMSA 4GKHA 3H4JA 4EWHA 2HZ0A 3GENA 2C1AA 4ZMEA 5C4KA 5GHVA 2GDOA 4OTPA 4ITHA 4PDYA 1H8FA 5BVDA 1AGWA 2XNNA 3SG8A 3RPYA 4J71A 2WQMA 3OTUA 5M57A 3DJ7A 2PVKA 2XCKA 4OR5A 4FKIA 4CYJA 3LW0A 2VRXA 2NNWB 4F7LA 2NRUA 2VO3A 1FGKA 3NNXA 1F5QA 3MW1A 4PDOA 2YAAA 4X2JA 4YJOA 2EXMA 3QCYA 3WARA 5L2TA 4BIBA 2UZDA 4EOJA 2ONLC 5HG7A 5CAOA 4QMLA 4C3FA 3VIDA 4YR8A 5AUVA 4IFCA 3IECA 4LGGA 3DLSA 4IWPA 4MVFA 1YXXA 5J5SA 3H0ZA 4IC7A 4FKWA 4R1VA 3RHXA 4I6HA 3DNEA 3ALOA 3MSSA 2CJMA 2UUEA 4FSYA 3TKUA 4IXPA 5CAVA 3ID6C 3R1SA 5C8KA 4O7NA 3M11A 2C5OA 1ZXEA 5D10A 3MFRA 4YBKA 3BBWA 2CN5A 4I94A 3MV5A 5JN2A 4AACA 5FM2A 2X81A 5J95A 1Y57A 5DH3A 1F3MC 3UO4A 4QP7A 2WMBA 3H9OA 2XUUA 3HX4A 4XJ0A 4FUXA 4NSTA 3VUHA 4DTKA 4EC8A 3LOKA 4O1OA 1SYKA 2QR8A 5L6OA 5FEEA 3EYHA 3GU8A 4LI5A 2PYWA 3UYSA 4JX3A 3LFFA 3Q96A 5IMEA 3Q5ZA 1QMZA 3KVWA 2FSLX 3PWDA 3BWFA 3PJ1A 3IDCA 3QFVA 3WF8A 5HZNA 3W2RA 3CXWA 4R77A 1ZY5A 4H1JA 3UOHA 4X2FA 4XRJA 2EUFB 4F1MA 4ZMFA 4ZJIA 3D7TA 1OPKA 4WT6A 5G6VA 4I92A 2R0UA 5EYDA 3FI8A 3JY9A 2QONA 5JFWA 2YM7A 4AN9A 2WXVA 3BLRA 5L8JA 4Q9ZA 5AIRA 1CSNA 3GC9A 3KF4A 5BYYA 4NKSA 3GUBA 3ZBXA 1BUHA 3RK7A 3WE4A 1J91A 2RFEA 4DFNA 5I9VA 1UKIA 3KY2A 3OBJA 4IDTA 4RT7A 2WGJA 5HICA 3ZO2A 4AN3A 4AT5A 4BDCA 3EJ1A 4L52A 2GPHA 2XK6A 2YA9A 4OTDA 4RWLA 4U79A 5M55A 1ERKA 1RW8A 3OY1A 4CGAA 4CVAA 3RAHA 5KMIA 2R3IA 3JVRA 2PMIA 3MN3A 4ANLA 4P90A 5CVGA 5A3XA 3D2KA 5FBNC 5A4LA 3FY0A 5CANA 1K3AA 5JH6A 3BHHA 5JSMA 3KGAA 5LVOA 3PG1A 3FSFA 1P5EA 5IDNA 1UWJA 1OKVA 1YWRA 3OOGA 3VUIA 4I3ZA 3FXZA 3VBQA 2GTMA 5M53A 2HWPA 5AFVA 4L44A 2YABA 2J4ZA 4BZOA 4FKPA 2VWUA 3NZ0A 4I5CA 4GK4A 4XG9A 5AUUA 4LL5A 3RNYA 3LZBA 4BI0A 4IX3A 1LR4A 4W8DA 1JOWB 4O0YA 3I0OA 3QGWA 3NX8A 4R78A 4E6DA 4BCPA 2JBPA 3BPRA 5EW3A 3R9DA 4CEGA 3ATSA 4XH6A 4DYMA 3R21A 3QTSA 5HO8A 2WQOA 4YZNA 4YC6A 3A7IA 3Q5IA 5CSVA 2B7AA 4CSVA 4I5HA 4YSMA 5CNNA 5DEWA 2UZVA 3MWUA 1G3NA 3QRIA 5BYLA 4I93A 5EYKA 4B8MA 1OKWA 4M84A 4JG7A 4MX9A 1OECA 3G90X 5E4HA 5TT7A 4CFMA 4U97A 3DZQA 4WG3A 4JIAA 4ZSEA 2RGPA 1VEBA 1OIYA 1YWNA 3Q60A 5DLSA 2OLCA 2JKKA 4FKOA 4EK8A 3D2IA 3MGYA 4F6WA 4FL2A 2ZMCA 3LM0A 4FIFA 3UG1A 4M0ZA 4FV3A 3NYXA 4CFNA 3PSCA 5IZFA 4E93A 2OW3A 3MB7A 3H9RA 5FLFA 4QYYA 5HX8A 1PXMA 3FMJA 3ZUTA 4FVPA 1CMKE 4O0RA 2YERA 3MH1A 2YEXA 4CD0A 2YWVA 2YHVA 4BBFA 4HOKA 5IKWA 4DT9A 3EKKA 3LJ0A 3QX4A 2R2PA 1REKA 4L7SA 3WZUA 5KHXA 3EFWA 3EN9A 3QZGA 3C1XA 4FKSA 4LMNA 3QWJA 4PV0A 5FWKK 5H9BA 1XKKA 5EG3A 2VNYA 3HA6A 3ATTA 5FXRA 1OI9A 5IEVA 3KFAA 1IRKA 2PWLA 1LEWA 3PP0A 4TYHB 2I6LA 3QA8A 3VRZA 4YTFA 3EQIA 3ROCA 5DOSA 2C5XA 2OIDA 1QL6A 2O5KA 3QD4A
chains in the Genus database with same CATH superfamily
4DFBA 2XK9A 5EW8A 3TCPA 5IA4A 4JAIA 3ZDIA 2XIZA 4L7FA 3FKNA 3QRJA 5CSWA 5H8BA 3CJFA 2O63A 3S00A 2O64A 2R3KA 3FWQA 5K4IA 3C5IA 2E9NA 3MFUA 4BGHA 4YNOA 2J0KA 2JIIA 3UBDA 4RVTA 4CQGA 4RVMA 3MESA 1CTPE 4D2SA 4C3RA 4GL9A 4S32A 3RPSA 4UZDA 4FYNA 3UNZA 2C6IA 2Y0AA 4HGEA 1JKKA 1XH4A 4FT7A 3HP2A 3QRUA 5FM3A 5HG8A 3TTJA 1QPDA 3SV0A 4I0SA 4L8MA 4K1BA 3P5JC 2W9ZB 3JPVA 3POOA 3FLYA 5KX8A 1XQZA 2PY3A 2Y4PA 3LM5A 2G2FA 3I7BA 4FIEA 5L6WL 2B54A 3DB8A 3D7TB 3E64A 3R63A 4W4XA 2CPKE 3VS4A 2ERKA 3PZEA 4ANOA 1MRUA 3L1SA 3ZFYA 2R3PA 3C4CA 4I6FA 3POZA 3VHKA 2HIWA 1ZWSA 4I21A 3UPXA 5AUWA 4UXLA 2QOOA 5IEXA 2HW7A 4ZS0A 2WHBA 4FK6A 1M2PA 3O8UA 3OEFX 3S95A 4GS6A 2W1ZA 4D5HA 2OU7A 1VR2A 4CTBA 3ZLWA 4EBWA 4Y5QA 4FV1A 4GUEA 4W8EA 2H9VA 1ZMVA 1M14A 3ODYX 5BMMA 3RBWA 2WIHA 4O2ZA 3AT3A 4WOVA 4L3LA 1L3RE 5KO1A 3UPZA 4CG9A 4DH8A 4U9AA 4J53A 2V62A 4G9RA 2YJSA 4FGBA 4AF3A 3OEZA 3TXOA 2HWOA 4HYSA 4I6QA 5EDQA 4PDPA 2XANA 5M4IA 2IWIA 4F0FA 1H1WA 3R2BA 2XK4A 3GGFA 2C3IB 4G3DA 3V5WA 3NS9A 1E1XA 1M2QA 4U3ZA 1OL7A 3CD3A 3KF7A 3NW7A 4ZTSA 3CTHA 3FZSA 4J8MA 2QO7A 5EI2A 3ORNA 5HIEA 3ZHPC 5FQDC 4NWMA 3Q4CA 4Q5HA 3W33A 1XJDA 5JQ5A 4XP0A 1WAKA 4IAKA 5AUXA 3RK5A 4A9RA 4BDEA 4F7SA 4E8AA 2V22A 1YXTA 3PJCA 4IH8A 4QP4A 2E9PA 2IO6A 3DQWA 4DBXA 2ZB0A 1VZOA 1ZARA 4FV9A 4EOMA 3GQLA 1Q4LA 4C62A 4AZSA 5KMLA 3BGPA 2PMNX 4ZJVA 5HESA 4QMPA 2X7GA 3BQRA 3RAIA 2WTKB 3VS0A 4LV7A 4XOZA 2DYLA 3EB0A 2OBJA 4C2WA 2AC5A 3ZLYA 4DH7A 4G3FA 4YJQA 3VS1A 4C4FA 1PYEA 2RL5A 5IQBA 2C6EA 3AOXA 3QCXA 4X0MA 4D0WA 4AA4A 3DJ6A 3P7BA 3A7GA 4ZZMA 4F1OA 1OM1A 5F9EA 4HW7A 3F61A 4AXCA 4I20A 1WVWA 3EN4A 3R02A 3LVPA 2A4LA 2YM8A 1SVEA 2EU9A 4C4GA 5AAGA 4QMWA 2Z7LA 5JKGA 3QQKA 2Z02A 4CZUA 4F9CA 1PXNA 1IA9A 3UGCA 2DQ7X 3NAXA 4FF8A 3FLNC 3LCTA 3U4WA 3RM7A 4MBJA 3TJCA 4QYFA 5IU2A 4Q9SA 4RIXA 4BGQA 3R1QA 4Y8DA 3R9RA 3SXSA 5BVWA 4KS8A 2IZUA 4EUTA 4NTSA 1GOLA 1QPEA 4JDIA 2VTSA 2DUVA 4CT1A 4G5JA 5BV3A 2W96B 5LMKA 2RSVA 5AX3A 4M12A 3GCQA 3DQXA 3P9JA 2XP2A 4QP8A 4TWNA 4QDEA 1Q8WA 1XBAA 2EVAA 4IDVA 4J99A 5C01A 5M09A 5DWRA 2VTHA 4QMQA 2B55A 4HCUA 2FO0A 4Y73A 3WZJA 2X0OA 3I5NA 3NEWA 3KXGA 4Z55A 4WKQA 2QOIA 3MVHA 4O0UA 5IF1A 2IZSA 5I9XA 5L2WA 2ITOA 3QD0A 4G5PA 2ZOQA 2A1AB 1M17A 3F88A 4FEQA 5GINE 3SXFA 3LXNA 3FMDA 4ZTMA 1SZMA 2ZJWA 2VWYA 3L9NA 2W1GA 2IN6A 2OJFE 2PVJA 2C6MA 4LGHA 4ZY5A 5IH4A 5HHWA 2JLDA 4IADA 1H24A 3LLTA 3OW4A 4ZTQA 4ACDA 4BCJA 4RLLA 3FI2A 4BIDA 4QT1A 3E87A 5EFQA 1MQBA 2VTPA 4C33A 3Q2MA 4PRJA 1H08A 3QYWA 3ODZX 4CFWA 1XH9A 5LVNA 4DLIA 4RSSA 4USDA 5EKOA 4NTTA 3OUNB 1OBDA 2XKDA 3GC7A 4DG2E 3K3JA 3O23A 3CPBA 4TPTA 3VWAA 1JLUE 5HO7A 3Q4UA 3NGAA 3TUDA 1MP8A 2OGVA 3AMYA 3Q4TA 3FMEA 2WO6A 4I1ZA 4J8NA 4RIWB 3COMA 1ZYLA 3SX9A 4HPUE 1A06A 2BFXA 2XIXA 3KVXA 1IR3A 4BDJA 3W8QA 5HORA 3IKAA 4QMXA 1DI9A 4XUFA 4OLIA 4U80A 2QURA 3KL8A 3UJGA 4CYIA 5FP5A 1YXSA 3MJ2A 4IJPA 2OJGA 2CHLA 2R5TA 3K54A 3D4QA 3NW6A 4YHTA 5E8WA 5AV2A 3UOKA 3VBTA 4C59A 3VQHA 3GFEA 2C0IA 5CVFA 3ZEPA 4BYIA 4R6VA 1V0OA 3ACKA 1APME 3FI3A 4CZTA 4KKEA 1YHSA 4QQJA 5J87A 4ARKA 3BYOA 1YQJA 2QOBA 2P33A 4NZWB 5H8EA 3NRMA 4YURA 3P23A 5LARA 1OGUA 5LMAA 5E8SA 4KIPA 1UNLA 3KMUA 3LFNA 5K9IA 2QOHA 4O4DA 3EQCA 4IX5A 2X2KA 5B2KA 3CEKA 5FDXA 5JZNA 2PVRA 4AA0A 1J1BA 4ASEA 2QVSE 3HUBA 3LPBA 3KCKA 3BEGA 3VS2A 4G6OA 2HW6A 3QX2A 4BJJB 2OICA 2Y6MA 4FI1A 4CZYB 2REIA 3C4FA 4TN6A 2YZAA 2ZFYA 3ZYAA 4KWPA 4MD9E 3TN8A 4E5WA 1T46A 2F4JA 2B0QA 3ULZA 4RZVA 4IQ6A 1FMOE 1HOWA 2BRNA 3MH0A 4WNKA 3BLQA 4EONA 4C0TA 2C6LA 4ASZA 4XG4A 3HRFA 5CU6A 3R8VA 3UVRA 1H1RA 3EFKA 4XEYA 3CLYA 2Y4IC 4C35A 1WCCA 4PL5A 2UV2A 2VGOA 3BX5A 4AA5A 2V55A 2YCRA 3CKXA 3LFBA 5DMZA 3VS3A 1PMUA 1UWHA 3BYSA 4YJNA 3W2OA 2OI4X 5AADA 3LLAA 4RA5A 3MDYA 4FKVA 4J96A 4IWQA 1H07A 3FC2A 4RWIA 4BTKA 2Z7QA 4UYAA 5LJJA 3BV3A 2PPQA 3BL9A 4U45A 1OZ1A 2ONLA 5KKRB 3UZTA 3TV6A 3SHEA 3NCZA 5BUIA 3HL7A 2QHMA 2VTNA 4TYIA 1LUFA 2B9FA 2BHEA 3FZRA 3ZUVA 4MBLA 4QMZA 3P7CA 3F82A 4ZLYA 5LMBA 4HZSA 3TNHA 4EHZA 5FUTA 3NAYA 3LQ5A 3QTQA 4RMZA 3E7OA 5HGIA 5AR3A 3ZC5A 5LCKA 2WMWA 2XA4A 2XK8A 1OL1A 3FYKX 4ORKA 1NVQA 3JS2A 4NM3A 3II5A 2JKMA 2J2IB 3PG3A 3JVSA 4G17A 2WPAA 4J1RA 2HENA 5DGZA 3TIZA 5HCXA 5IISA 1SNXA 2UW4A 3IW7A 4A07A 4O27B 2QI8A 2HCKA 3KXXA 3W2QA 5FD2A 4FK3A 4AZFA 5IEYA 1WBVA 5BNJA 3EH9A 5AV3A 1J1CA 2XNMA 4GT5A 4NFNA 3W2SA 2WMXA 2ZV9A 3FXXA 3V8WA 2R3JA 5AR7A 4GT4A 3CGFA 4U8ZA 5LWNA 3PRIA 3C0GA 3D5VA 4ZLOA 1Y8GA 2XNEA 4U44A 4F6UA 3NCGA 4G1WA 4I41A 3RK9A 2JIVA 3DKFA 1R39A 3MFSA 3NNVA 3DB6A 3IW8A 4U0IA 3I60A 2WKMA 4MQ2A 3T3UA 4EYMA 2WOUA 4R5YA 4EH3A 5A4QA 4ERWA 1Y91A 1YRPA 3HV5A 3OWLA 4JR7A 4A9YA 3BEAA 2VN9A 2GFCA 4MAOA 2C3JA 4D1SA 2CMWA 3I0QA 2HY81 3QLGA 2WTVA 3OHTA 3R0TA 4YJVA 3R1NA 4ZTNA 5HLWA 2YM5A 4JBPA 2H6DA 2R3FA 1BYGA 2RFDA 3EQGA 3NUUA 2JDOA 2Z8CA 3CY3A 2B9JA 2W5BA 4U43A 3ZH8A 2UW6A 4ALWA 1S9JA 4BKYA 3QXOA 1FOTA 2OF4A 4FSUA 2WMAA 4U41A 3ENMA 4LOQA 3G15A 4YU2A 3R8MA 2UVYA 4EI4A 3GCVA 4NCTC 4BZNA 3DBDA 2E9UA 1ZLTA 3NUSA 3MS9A 4FYOA 3OOMA 4CTCA 4M97A 4WG5A 3ULIA 4UMTA 3CC6A 5LMKC 3BL7A 3DKOA 3EQHA 3DA6A 3I81A 3PVBA 4GV1A 5ITAA 4BCGA 5KUPA 5L3AA 3D7ZA 5E1SA 2W06A 3MI9A 2BAJA 2W1IA 3B2TA 3D15A 4PF4A 3PE2A 2DWBA 1LP4A 4FKLA 3V01A 1RJBA 4X3FC 4YC8A 2GU8A 2J9MA 4YLJA 4ASDA 4DLJA 1U46A 2XB7A 3G51A 5BVFA 3U55A 3UP2A 2VUWA 4GEOA 3FXWA 5EOLA 2YDIA 3VS6A 2G15A 3VAPA 3V04A 4K77A 3S0OA 5AMNA 1URCA 4HGSA 4EH5A 1BI7A 3SC1A 4J52A 1Q97A 4L68A 2VTOA 5HCYA 4MCVA 3UO6A 2Y7JA 1W7HA 4O0WA 2FVDA 5HKMA 1Q8TA 4EH7A 3AD5A 3SXRA 5L2IA 2OWBA 3FPMA 2R3GA 4L9IA 3SAYA 2EXEA 2F7XE 4EC9A 4FOBA 4LM5A 4GKIA 1REJA 1X8BA 4PMMA 3CSVA 1U54A 3RVGA 3A7JA 4BDFA 4FT5A 2W99B 4BHNA 3VNTA 2ITXA 4ACHA 5IA0A 2XYUA 5DT4A 2FSTX 4OBQA 1SMHA 5CALA 3Q9YA 3N51A 1PY5A 4NJ3A 3DTWA 4AGDA 2QLQA 3F6XA 3O8PA 2ZB1A 2WFYA 4S30A 4TYGA 2XJ0A 5T68A 2F7ZE 3O7LD 5AR4A 4O84A 5C8NA 3F69A 2VTAA 4HGLA 4BDGA 2CGVA 2W4JA 4TNDA 1YI6A 5BVOA 5AAEA 4JBVA 3PPKA 5CI7A 5TE0A 3UQGA 5CEMA 4L6QA 2Z7SA 4I23A 3WF7A 4R7BA 3QBNA 1FQ1B 3CPCA 5DE2A 4M67A 4RJ4A 5H8GA 3DXPA 1YHWA 4EQMA 1H00A 1Y8YA 3WBLA 1YXVA 4EH4A 4AP7A 5HD4A 3DGKA 4YJRA 2OXXA 3ZM4A 2O65A 3FHIA 2GNFA 3GXLA 3QHWA 1NT2A 3RNIA 3KULB 3M2WA 4BYJA 3MY0A 4ANNA 2QOFA 4PX6A 1UU9A 4K8AA 5D1JA 2YITA 2IVUA 3A62A 5IH6A 4FKUA 1OL6A 3UDZA 1JBPE 4J95A 3SW7A 3QAME 4AFEA 1MRVA 2VTJA 3HMMA 3L8XA 3BHTA 3E8CA 2J51A 3IOKA 4IX6A 2QOQA 3FZ1A 3OCBA 4C7TA 2ITZA 1OUYA 2JKQA 3FI4A 3UZPA 1GNGA 2XALA 5M51A 2BAQA 4O1PA 4B0GA 3RWPA 3FMMA 4E3CA 2QR7A 5HU9A 2B9HA 1I44A 1WBOA 2CGUA 2RF9A 2ITPA 4AX8A 5L2QA 4EBVA 2XK3A 5C8MA 2XJ2A 4EH8A 2I1MA 2OJJA 5BX0A 4M7IA 4LDTA 3O96A 3BRBA 3TZMA 4BIEA 4KKHA 4LGDA 4AXEA 3MH3A 3QZFA 3ACJA 5DHJA 4O82A 3KMWA 4YTHA 3THBA 5I9ZA 2WEVA 4C57A 4WO5A 5JMSA 2VAGA 2UW0A 3KXZA 4UMQA 4NIFB 3W0MA 3PXZA 3MBLA 4JQ8A 5DG5A 3NDMA 5E7RA 2UZUE 1YHVA 4LRJA 4YBJA 5CU2A 2V0DA 4FX3A 3C9WA 2R3NA 4O4EA 2X6EA 3DDPA 2YCQA 3VULA 4X6RA 3HRCA 4D2TA 2YZLA 2P0CA 4DITA 4EZ5A 4V01A 4YZ9A 4RRVA 5AR8A 3SDJA 3CJGA 5CS6A 3QKLA 5K5NA 3NUPA 3CR0A 4XYFA 2FSMX 3QKKA 3O8TA 3BKBA 3GU7A 2FB8A 3ZBFA 3C13A 3NIEA 1KE9A 3UP7A 4AOTA 4ZZNA 4O2PA 5I3RA 3HEGA 3S2PA 2ITYA 4B9DA 5M07A 2X7OA 2RFSA 3IQ7A 3LE6A 3R73A 4V0GA 4EOOA 5HVJA 4AXFA 5E8XA 4LQMA 3DZOA 2IVVA 2GNIA 5AWMA 5EQPA 3TZ9A 3GQIA 3LFQA 3ETAA 3UQCA 4RX7A 4QQTA 2YCFA 4Q5EA 3P1AA 3G9NA 1NVRA 2OFVA 3IOPA 3KA0A 5M44A 1WBNA 3EQBA 1FMKA 1STCE 3OUKA 1XR1A 1MUOA 1OKYA 2YFXA 1GZOA 4P7EA 5EH0A 3KEXA 2XNPA 4MEDA 3CP9A 2C5YA 4O86A 3RP9A 3ZRLA 3LFAA 3ZRKA 5C1QB 3C4WA 5I0BA 3LMHA 3DK7A 3DAJA 4RFZA 4Z7GA 4TRLA 3SW4A 4U6RA 3GP0A 2AC3A 4C2VA 3TNWA 2ITWA 2G01A 2IVSA 4GUBA 3TMOA 4H1MA 2LAVA 3WYYA 1Z57A 4R1YA 2BRGA 3QQUA 4ZAUA 2XF0A 4KB8A 5CT0A 5HTBA 3EQPA 4BI1A 4BVUA 2C6OA 2CN8A 3U9NA 4GK2A 4CRSA 2QHNA 3H30A 4BTFA 3OD6X 4FSWA 3EZVA 3VQUA 4IZAA 2ITQA 4F4PA 3MH2A 4BHZA 2OF2A 3F66A 1R1WA 4XCUA 3UIBA 3ZFMA 2EB2A 4JBQA 3TG1A 1JSVA 3R2YA 2GFSA 3DS6A 3QCSA 4OBPA 4JNWA 5DIAA 5DNRA 3OCTA 3PTGA 3IW5A 5J5TA 3GOPA 5LVPA 4QYGA 3F5XA 1Q61A 4G9CA 1OIQA 4JQEA 3RAWA 1CM8A 5EQEA 2EXCX 1PMVA 4QP1A 4IIRA 4FL1A 5LCJA 2UVXA 2W4KA 4FTJA 4MNEB 4DGOA 4FEVA 4MWHA 1YKRA 4YZCA 3W32A 2UZLA 5CF5A 5FRIA 3E7VA 2ETMA 3U4UA 3MY5A 2J0IA 3E8DA 5HI2A 4V05A 3FQEA 3E63A 5IH5A 4O7YA 3UDTA 4QTDA 4FT9A 4Y46A 2I0HA 2I0YA 1GIJA 1WMKA 2WMUA 4YTCA 3VF8A 5HD7A 3I1AA 4JG8A 5AUTA 3RHKA 4D9UA 2JDSA 5HIBA 1G8AA 2PVFA 3DAKA 1VLRA 1K9AA 5TR6A 4NJDA 4GW8A 3PUPA 5CEPA 3A7HA 4U5JA 4Q2AA 3PIXA 3F9NA 5FGKA 4D2WA 3P08A 3Q9WA 4S31A 4E4NA 2CNUA 3QUDA 2X0PA 1BMKA 4M0YA 3EMGA 2J6MA 3EL7A 5CSHA 4ACMA 3ORLA 4ZK5A 4TL0A 5IQEA 4FNXA 5AV0A 5M4FA 3PA4A 3D0EA 3BHUA 1JVPP 2A98A 5EDPA 3W2PA 4AXAA 3M1SA 5AP6A 4KAOA 3LCKA 2GNLA 3I79A 4ASXA 3VONA 3ET7A 4FTLA 3UIXA 2XNBA 4FTKA 5T3QA 3UOJA 5F1ZA 4O7RA 4TTHB 1XHAA 4XNEA 3E3PA 5CZIA 3QTWA 5HNIX 4IM2A 3ERKA 5JK3A 2R3HA 3TNIA 3C7QA 5CU4A 1BI8A 4O38A 2ZMDA 2C6DA 2AUHA 4M8TA 1ZZLA 4CQEA 3KB7A 4N57A 1M7NA 4R7HA 4L67A 1XH8A 3PJ3A 4FEXA 5EKNA 5CSPA 5L6PA 3ANQA 2VWVA 4YPSA 4EL9A 4Y85A 3SOAA 3QF9A 2UZTA 2QCSA 1HCLA 2YM6A 5JEBA 4EOKA 5IA3A 3NFGB 5A4CA 2I7QA 4E20A 3OT8A 4JS8A 3UIMA 4HGTA 3DBEA 3KC3A 4FT3A 5AJQA 3DPKA 1KV1A 3HP5A 2YN8A 2ESMA 4QNYA 2PUUA 4F08A 4DHIB 4AE6A 4BY9E 3EN7A 3W1FA 3M42A 1XBCA 4HCTA 4D4YA 3CS9A 4QP2A 2PUPA 3UOLA 3WF9A 2J7TA 3QLFA 4I22A 4QQCA 3ZS5A 4UY9A 4QNAA 2YWPA 3ZUUA 2HOGA 3AD4A 3PP1A 4OTHA 3R7OA 3QRKA 3SQQA 3TT0A 3PFYA 4KS7A 2NRYA 4FSRA 4XG3A 4PTEA 3FY2A 4DF3A 3KXMA 2W7XA 4HYUA 1WZYA 3AMAA 4C4HA 4EOPA 4CKRA 3V5PA 2XBAA 5AP5A 3BHVA 2PULA 4CFXA 4WRSA 4HYHA 4BICA 3DXNA 2VO0A 4WA9A 2C30A 5BQ0A 4JIKA 1BL7A 3R71A 4LL0A 3VBYA 2XIKA 1QCFA 4KIKA 5AM6A 3G9LX 1KE8A 4JX7A 3GI3A 3KIOC 4AZEA 2R3RA 4AW1A 5TO8A 3ZSHA 2WD1A 3GT8A 4L46A 4DH3A 4E4LA 4YO4A 4OT5A 3N9XA 5CENA 4FA2A 2XRUA 4DG3E 3T3VA 4MNFA 2XMYA 4UV0A 3R8PA 1OBGA 1B39A 1LEZA 3C4XA 2P2IA 4ITJA 5CF6A 4XLIA 3VO3A 3C4ZA 3AQVA 3UTOA 2ZV7A 1YWVA 1YOLA 3R8UA 4PUZA 3OBGA 5KHWA 3S3IA 2RG6A 2B9IA 4RVKA 2X9FA 4JOAA 4NUSA 4JMQA 3FE3A 3KRXA 3ITZA 3PPZA 5J9ZA 3WOWA 1ZYCA 2BRBA 3FHRA 4PPCA 4UXQA 3R7GA 4BR3A 2PU8A 3O7LB 5LVLA 1ZRZA 5I3OA 4LUEA 4CKJA 1WVXA 1FPUA 2XH5A 4H3QA 4BL1A 3EFLA 5ANIA 4ANBA 3ELJA 3QQLA 4N70A 3ZC6A 4HNFA 3F3UA 3CGOA 3MPTA 4IAFA 2ITUA 3R1YA 4QYHA 5J8IA 4DEEA 4M69A 3ZM9A 3TACA 4M13A 4PPBA 2VTIA 3ZO3A 3BU3A 4O4CA 4OTIA 2AYPA 2Q0NA 3VJNA 2OXDA 3Q52A 4GJ2A 1TFFA 2ITTA 3LHJA 1GY3A 3UYTA 1Q3DA 2BCJA 3BQCA 3FEGA 1H25A 2OJ9A 3S4QA 2XIRA 4KNBA 4KKGA 4F9WA 4OTRA 3FJQE 5DPVA 3P79A 4HNIA 2GSFA 1OMWA 4TZRA 4WSYA 4HCVA 4DCAA 4DDGA 2JEDA 2W1EA 3ORIA 4D4SA 4XBRA 3IW6A 3SRVA 3CQWA 4IE9A 4MD7E 5EDRA 4EOLA 3JR1A 2JDVA 4JXFA 4NW5A 4EJNA 4IAYA 4H36A 3CE3A 4NCTA 5B2LA 4AU8A 3ZCLA 3PZHA 1W8CA 4HJOA 5DR6A 3RI1A 4XHKB 3UMWA 5J7HA 4CRLA 2UW7A 4USEA 1WBPA 4NFMA 2BMCA 1V0PA 4RJ3A 4BTMA 3PSBA 4CCUA 1G8SA 2WZJA 3ZO1A 4YP8A 3IG7A 3DNDA 4GG7A 2GQSA 2QG7A 5H3QA 4FC0A 4IMYA 4ANMA 4FTTA 5GZ9A 3CQUA 4C37A 4TWPA 5KNJA 4APPA 4AGUA 4IVAA 1H0VA 1KV2A 5CXZA 3P4KA 5HBHA 4BDAA 3PVWA 4X3FA 3BGZA 3HV4A 3MTFA 4XG7A 3AMBA 3CCNA 4YSJA 1IA8A 5TKDA 2X4ZA 2XCHA 5G1XA 3RAKA 3QTRA 3U54A 3OF0A 5GZAA 5J1WA 5HBJA 4MK0A 1M2RA 3QZHA 2C5NA 4FZDB 4ZSJA 4QTAA 3F3VA 5DT3A 2XNOA 4QTCA 4P5ZA 3BYVA 2Z7RA 2JAVA 2BPMA 2QD9A 5GJDA 4DHJA 2R3QA 3Q9ZA 1IAJA 3RM6A 1GZKA 2JFMA 4MXXA 4Y83A 3VS5A 4CFVA 4PQNA 4PMPA 3BLHA 5TF9A 2FGIA 3V51A 4IAZA 1O6KA 2OZAA 2UZWE 1ZMWA 3LXKA 3PYYA 1Q8YA 3VN9A 2OSCA 3AXWA 1DM2A 4DG0E 2OZOA 3ORXA 4RGJA 4UZHA 3Q9XA 4D2VA 3D5WA 2JBOA 2C47A 2RKUA 3F2AA 2JKOA 3VW6A 1O6YA 3DOGA 4IX4A 1OPLA 4NH1A 3UIUA 3W55A 3A61A 3KN5A 3PWYA 2I0VA 4UWBA 2GNGA 2IW6A 4BKJA 4EOSA 5IQGA 4KRCA 1MQ4A 2C68A 1ZY4A 4FTCA 3SKCA 3DDQA 3C50A 1Q8UA 5HLPA 5AAFA 3PPJA 4AQCA 2AEGA 4YZBA 4GMYA 4DHFA 2B53A 3LCOA 2BILB 5F4NA 3BE2A 2ZM3A 5DN3A 4FV8A 5T6KA 2BDJA 3R8LA 1M7QA 3WZDA 3PXYA 5EK7A 5IQIA 3FLWA 2BTSA 3FBVA 5M4CA 1YI3A 4QDVA 4D2PA 3FUPA 1JKTA 3OTVA 2CSNA 5CEIA 2VX3A 3C4EA 4BCMA 4ZJJA 4BBMA 4EH6A 4WNOA 4YGAA 3UNKA 1YOJA 3OS3A 3LIJA 3OXIA 5CAUA 4KBAA 1OUKA 1YW2A 4ALVA 4FTOA 4IAIA 5EQYA 2J5FA 3R22A 4K33A 1NVSA 2XEYA 4FKGA 4DFLA 2UVZA 4TYJA 3PIZA 5CZHA 3DXQA 3AKKA 4BWPA 5JGDA 1YVJA 3FSKA 4HYIA 4X3JA 3PA3A 4D1ZA 4AXDA 2O2UA 1Y6AA 4W4WA 4FOCA 4L53A 1WVYA 2C6KA 4F1TA 3CTJA 2FSOX 3QTUA 3KXNA 4GIIA 1PKDA 5C9CA 4FG8A 2PMOX 2QOKA 1HCKA 1NW1A 4IB0A 3SLSA 5CAPA 2XRWA 5ANJA 3D9VA 1UNHA 5B7VA 3E93A 3HZTA 4QMNA 3MJ1A 5C27A 4DAWA 4MF0A 3LAUA 4U81A 4OTGA 5LWMA 4OTWA 4X2GA 3EOCA 1E9HA 4YC3A 4C02A 4RX5A 3HV7A 4FTAA 1NY3A 3V6RA 2J50A 2YAKA 3LJ1A 3QU0A 4L3PA 1Q99A 3QQHA 4LOOA 5D41A 4MXCA 3EWHA 4H39A 4XV3A 3RJCA 4QMTA 4H58A 2GQRA 1UVRA 2FUMA 2NP8A 4RJ8A 3QZIA 4A7CA 2X39A 1UKHA 1FGIA 4TWOA 4FV4A 3MTLA 3LFEA 4RIXB 1G5SA 4TXCA 1GIHA 2HXQA 2V7OA 4EEVA 3SGCA 3I7CA 3EZRA 4RJ5A 1DI8A 3NYOA 2C4GA 1H27A 4KBCA 5AEPA 3GNIB 4O7TA 2GNJA 2VU3A 3BELA 4IEBA 3U6IA 2W0JA 4EUUA 3DU8A 3VBVA 2FH9A 3IDBA 3LQ8A 4NT4A 4W9XA 4XG6A 3FPQA 3W18A 1IG1A 2AQXA 3DV3A 4MXAA 5KZIA 3WE8A 3I5ZA 3ZXTA 5KZ0A 4XOYA 4O21A 1TVOA 3O2MA 1G8JA 2X0GA 3LXLA 2XKFA 3PY1A 1M52A 5CNOA 4E73A 5FDPA 4A9SA 3BI6A 3DJ5A 4UBAA 4JAJA 2HK5A 3AC2A 3OXZA 2C3KA 4DGNA 4YUQA 3N4TA 5DVRA 3RZBA 1BL6A 1U5QA 4YPDA 4DFXE 3IS5A 3QC4A 4MF1A 5CT7A 3EN5A 4FZAB 4IAAA 4UALA 4KUJA 4MYGA 4WRGA 1L8TA 4FTUA 4FV5A 5DYJA 2PVMA 4FKQA 3AC3A 5C26A 2CNVA 1NA7A 1ND4A 2PE0A 2BDWA 4FV0A 3PXFA 4F0GA 1YOMA 4GSBA 4R7IA 3TV7A 4MXYA 4L43A 3LXPA 3K3IA 2QC6A 3GEQA 3ZU7A 1PXJA 3F5PA 2CKPA 1U59A 4ZTRA 3R7YA 3FLSA 1YDRE 3G5DA 4HZRA 4DGGA 2ZDUA 3LFCA 4JR3A 2BALA 3ZZEA 5AP3A 3DBQA 3AC1A 4QPSA 5L4QA 4FODA 5E92A 4O91A 4ZZOA 4DEBA 5ICPA 4AZTA 1Q8ZA 2VX0A 4EZ3A 5IDPA 2YLEA 3Q3BA 4BC6A 2ACXA 4O4FA 3TKHA 1DS5A 2VTTA 4I5MA 2WAJA 5E8ZA 3PDTA 2XNGA 5ETAA 4B4LA 4F78A 3GB2A 2VO7A 3LCSA 1IEPA 2ZV8A 4UMRA 1ZOEA 3CD8A 4LYNA 1W0XC 5D11A 1P2AA 4CNHA 5CSXA 2HZIA 3PRF