4YP8A

Irak4-inhibitor co-structure
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
296
structure length
284
Chain Sequence
RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLATTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Potent and Selective Amidopyrazole Inhibitors of IRAK4 That Are Efficacious in a Rodent Model of Inflammation.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 284
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yp8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yp8A01
4JDKA 5AR7A 2OIDA 4AGDA 1SVEA 4ARKA 5IH6A 2YWVA 2I0EA 4E6DA 1XBBA 3QRTA 1H28A 3OD6X 1BI7A 5LCKA 3ZFYA 1IAJA 4RVMA 2UZDA 3TACA 5JSMA 4Y72A 2X9EA 4KS7A 1OBDA 4IIRA 5IUGA 1OBGA 3BWJA 3NNXA 4Y46A 1ZY5A 2J0IA 3BU3A 3KMUA 3TJCA 4J52A 3N51A 5CS6A 4FK6A 3ZO1A 5FG8A 4XH6A 1AGWA 4BICA 4J96A 3KA0A 3A4OX 2ERKA 3D2KA 4I6HA 4P5QA 3OHTA 5FLFA 3G51A 4MCVA 4CFFA 4O7WA 5L6WL 2OIQA 4EK8A 2YEXA 4DBNA 1YRPA 1YXXA 3DOGA 3RBWA 5CSXA 3W10A 4GUBA 4DAWA 4NTTA 4Y5HA 2W1EA 3GCUA 4QMLA 5LMKA 3CSVA 5HCXA 1H1QA 3GCVA 4ANBA 4JG7A 5ETAA 3KVWA 3Q60A 2CKOA 2X81A 1JKSA 4L7SA 5IEYA 4YHJA 2ZMDA 3W8QA 4DTAA 3EL7A 4NJDA 2VO3A 5BMSA 2XNGA 4ZJIA 4QPAA 3B2TA 2VTAA 1JVPP 3QF9A 4GV1A 4O83A 3S1HA 5EDRA 2ETKA 4BKZA 3V01A 3QFVA 5IZFA 3O7LD 2JKOA 2WZJA 4FT3A 4D2WA 3SVVA 4BIDA 4BTMA 5AAGA 3UMXA 4NFMA 4A9RA 5ANIA 1YQJA 2PMLX 3QGWA 3VS2A 4ZOGA 4BGGA 1SNUA 3ZSIA 2XEYA 3MVHA 4X3FA 4C8BA 2UZVA 3FL4A 5LVOA 3H9OA 4DINA 3AMAA 2C1AA 4ZZMA 5GZ9A 4NIFA 2GQRA 3ZXTA 5GHVA 2YCFA 3CTQA 3VUIA 2R0UA 3F66A 2YERA 3GOPA 2YJRA 1JKKA 1MRVA 3OWKA 3TKHA 5IQCA 4G3DA 4CSVA 4D0XA 1V0PA 3G6HA 3ZO3A 4DG2E 5C9CA 3EH9A 4FIFA 4O1PA 4YMJA 3CQWA 4MYGA 3RPSA 3MV5A 4F63A 3PE1A 4X6QC 5I3RA 2XIKA 4DEAA 4Y8DA 4C61A 2UZNA 3DAKA 3GVUA 3CJGA 2JD5A 2B9HA 3PRFA 3TUDA 5A54A 5E1EA 4IDTA 3S2PA 3RM7A 3AC2A 4FL3A 3SHEA 2X7OA 5TE0A 3IECA 4KSQA 4E5AX 3AQVA 1GOLA 1BMKA 2JIUA 3ZYAA 4RWIA 2ONLC 5DOSA 4K9YA 2BTRA 5FDXA 3EFLA 3VC4A 1FPUA 1KE6A 4AZTA 4OBPA 3B8QA 1R0PA 2F2UA 3HECA 2OBJA 3C4WA 4JAJA 2R0IA 4K2RA 5DT4A 2WQNA 2R3JA 4B4LA 2XMYA 4OTIA 2R4BA 3OOMA 3V5TA 3QQFA 4I94A 5FQDC 2OJ9A 3UVPA 3PIXA 3PWYA 4MKCA 3OT8A 3QUPA 4C7TA 4LGDA 4WNPA 3QTIA 2YCRA 3LQ3A 3BYMA 2H9VA 3L9LA 5IA0A 2YM4A 5M4CA 3NNWA 5I9YA 2PYWA 3TCPA 2QVSE 4JVGA 2HELA 4H1MA 1KUTA 3OOGA 5J79A 3ZUVA 3DXPA 2WFYA 5EHLA 3AT3A 5IISA 4WG5A 5J9YA 5B7VA 5J9ZA 3R8PA 3R28A 3KMWA 3ZRMA 5ICPA 2C0IA 5IQAA 4YBKA 5L2QA 1DAYA 4E73A 2FSTX 1OITA 1PW2A 4IQ6A 4Y95A 4F70A 4R5YA 4YZNA 3UC4A 4QTBA 1JPAA 4X2JA 4C2WA 4DFYA 3V51A 1UA2A 4N6YA 2V5QA 5L8JA 5KMNA 1Z9XA 5CU0A 2C6DA 3WBLA 4PPCA 3II5A 5HVJA 4DGOA 3R01A 5I9ZA 5L4QA 3BYUA 3NX8A 4RX9A 1PF8A 1JBPE 2YAKA 4TY1A 4UZHA 3FAAA 3R30A 3OVVA 4DH3A 5FGKA 4DEEA 3KRLA 4PPAA 3QD0A 2VTOA 2J50A 2JLDA 1VEBA 3R6XA 3SKCA 3W8LA 2Z60A 3ZS5A 4CFXA 2C6EA 4QTEA 5L2WA 2WQOA 5M4UA 4HYUA 3TV6A 5CF4A 3L8XA 3QL8A 4V04A 4PDSA 3N9XA 4DCEA 2CGWA 2ZB0A 1UNGA 4XJ0A 1U54A 2QO9A 1KE9A 4AA0A 4R6VA 4O7TA 4O0SA 3QQJA 4OTGA 3BEAA 3RI1A 4ITJA 4F64A 2UW0A 1AQ1A 5F1ZA 4GSBA 4MWIA 3VBXA 2GHLA 5AAEA 3UIXA 4AOTA 3MGYA 1IR3A 4U8ZA 2AUHA 3DBEA 3FZSA 3BCEA 3IDCA 4HYSA 4O86A 2WMBA 3B8RA 3GI3A 3LIJA 3OXTA 2BZJA 4FX3A 5ETIA 5HG9A 1M2PA 3H0ZA 1ERKA 2WOUA 3V6RA 4B9DA 4EH9A 5HIBA 3VO3A 3PSCA 2PZ5A 3ORNA 3F69A 4BDFA 2JDSA 4D1XA 4C0TA 4TYJA 5J5TA 3O2MA 4FKSA 4TW9A 2FO0A 3QBNA 4GU6A 5D10A 1OPJA 2B53A 4O22A 4V01A 4Z7GA 2VTMA 3MFSA 4PNIA 1PXJA 5EDPA 4JJRA 1O9UA 3QXPA 1OKVA 3DNEA 2YIYA 3A2CA 3FXXA 1J7UA 3FI4A 3WF5A 5LQFA 4D5KA 4OT6A 4PX6A 1M2QA 3I79A 4F99A 3S4QA 2AC5A 2CCIA 4FZDB 3LMIA 4JQEA 2QHMA 5TT7A 2DQ7X 3FMNA 2YITA 5E8XA 1YXSA 1M2RA 3VJNA 4KABA 4IB3A 5DRDA 4H36A 3U8WA 2WQBA 3QCSA 2Y6OA 4FIJA 5EI2A 4CTCA 4ZTLA 1V0OA 4GG5A 4CZTA 4BCHA 4YTFA 1FGKA 3C4CA 3QGYA 4WRSA 3AD4A 3OZ6A 2UVYA 1H1WA 3ORZA 4UWCA 4FSUA 2Z7LA 4FV4A 4U80A 4EH6A 3QYZA 4UEUA 1VYZA 3FPQA 5IH4A 5CANA 5L2IA 4Z55A 2QG7A 1P14A 4DT8A 3D5XA 4W9XA 4WA9A 2VTLA 3PXZA 4FG8A 3F6XA 3ZM4A 5B2LA 1XR1A 2WTKB 3F7ZA 2YIRA 2WPAA 5JFVA 2XKDA 4TTHB 2IVTA 2P3GX 4IM2A 3ROCA 2ESMA 3DXQA 3M42A 5DEYA 5IQIA 3HAVA 3CR0A 1R0EA 3MN3A 3RAHA 3VS6A 3FHIA 5CI6A 4TNDA 1OIYA 1M17A 4BCIA 2JKMA 4TWNA 2UZWE 2RL5A 3L9MA 3COHA 2HW6A 4IHPA 5CWZA 3UOHA 3LCTA 1JSTA 4JI9A 4TWOA 4KBAA 5DLSA 4L00A 3WYYA 3AC5A 3RGFA 5BUEA 4ZY5A 4HVGA 2PK9A 2F9GA 3L8SA 2E9VA 3Q04A 2PUPA 1YXTA 3PVGA 4BWPA 4CFUA 5KCVA 4C59A 3Q5ZA 3LMGA 4CG9A 2R9SA 4AOJA 2VO0A 1V0BA 3EQIA 3MH3A 1WAKA 5K9IA 4ZK5A 3U55A 2X2MA 2C3KA 4C37A 4ANQA 4OBQA 1KSWA 2HY81 5C01A 3QQHA 2X4FA 3D4QA 3IG7A 4IB0A 1CM8A 2VX0A 2VUWA 3Q53A 3W32A 4DFNA 3CIKA 4CV8A 4XX9A 4OTFA 4FSQA 2PUIA 3Q9WA 4EUTA 4IANA 4ZZNA 2ZV2A 4FV8A 1P5EA 4DYMA 4IWQA 1LUFA 3E7VA 4PDPA 1S9IA 1PHKA 4KRCA 2V62A 1H0VA 4N0SA 5M07A 2PUUA 2G01A 3Q4TA 4RIYB 2VGOA 2O2UA 3DNDA 3UC3A 1ZYCA 2EVAA 2I6LA 4M3QA 4Z3VA 4WUNA 4J8MA 1WBVA 2R3IA 4E5WA 3Q96A 4MQ1A 2CNVA 4Q5EA 5IQEA 2XVDA 3BZ3A 2C4GA 1WVYA 3AMBA 1J91A 3QU0A 4IJ9A 4EK6A 3NGAA 3LCKA 2ZM4A 4O1OA 5BVEA 3MESA 3EQDA 3FLYA 4DEIA 5J9LA 5CALA 2W1CA 2GS7A 3ERKA 4RJ3A 3CGFA 2BRNA 3P79A 4JDJA 1UU3A 2UZOA 3KL8A 4AW0A 4ZTQA 4D9TA 3F2NA 4BB4A 4Z7HA 1KE7A 2IVVA 2O63A 4C57A 3EWHA 3FZOA 3G9NA 2P4IA 3CP9A 5TF9A 5AR4A 3CTHA 5AX9A 3Q2JA 1K3AA 2VWUA 4I6BA 5EHYA 4O7YA 3QUEA 2UV2A 4QTAA 4IZ7A 4XLVA 3OCTA 5HTIA 3UBDA 3BKBA 5CYIA 1REKA 2HZ0A 5IH5A 3VHEA 3WARA 3QYWA 4M0ZA 4E1ZA 1H01A 4EZ7A 2E9PA 5IKWA 3WILA 5JFWA 3QCQA 3UOJA 3KRJA 4NIFB 3VS3A 5F9EA 3BYVA 1STCE 4IX5A 5E8UA 4CXAA 4LQMA 1EH4A 4EHEA 5I9XA 5CVGA 4EHVA 3ZUTA 1XH4A 2Y6MA 3LCDA 4AA5A 3FXWA 4FSZA 4JIAA 4I5MA 3V5JA 2VTIA 4YO6A 3UJGA 2UZUE 1RDQE 5LOHA 3F3VA 4BWXA 2WXVA 2XIRA 3I7CA 4KNBA 4LRMA 4RJ5A 3DFCB 1R39A 4XS2A 1PMUA 3HMPA 3NAYA 2B9JA 3FV8A 2R3KA 4O27B 4OLIA 2X39A 3FQSA 3P86A 3R1SA 3LFFA 4G3GA 4XG8A 4IX4A 3VRYA 2IW8A 4GFGA 5HO8A 4EBWA 3BE2A 3WOWA 4NZWB 3F5GA 2YN8A 1MP8A 2YAAA 3HUBA 3QQUA 4O7VA 5KMIA 4FZ7A 4QYGA 3BI6A 2JDOA 4IBMA 4R77A 1IA9A 4FV1A 4CNHA 4N6ZA 1DM2A 1SVGA 3QA0A 2X2KA 4OUCA 2PSQA 3DJ5A 4AE6A 3U6JA 3LLAA 1YDRE 1Q8YA 3QZIA 2OH4A 5DFPA 1ZXEA 1W98A 5D11A 2IVUA 4BCJA 3BHYA 3DBFA 3E8DA 4GUEA 3WYXA 3DFAA 4G3EA 3ALOA 3C7QA 4D2TA 4ZAUA 3OCBA 5CSVA 1XO2B 4AGUA 5HICA 4QPSA 4JG8A 4RLLA 3COKA 2R3PA 3S95A 3QLGA 1IG1A 4QMVA 1IASA 3UZTA 3COMA 4LUDA 1U5QA 3RZBA 4GG7A 1P4OA 4JDIA 3TKUA 4IJPA 4H39A 5I3OA 3V3VA 3FBVA 4JQ8A 3ZLXA 3L9PA 1Y57A 4EYMA 4F7JA 2BDJA 2HOGA 2NO3A 1A06A 4CFMA 4F0GA 3RAWA 1UWJA 3KEXA 3JVRA 2C30A 4A07A 1REJA 5EYKA 5F20A 2BILB 4G3CA 5CQWA 2H34A 2F49A 4DEHA 2QR7A 3R9DA 2ZOQA 2IWIA 2XNBA 3MB7A 5JZNA 3TIZA 3SA0A 2A4LA 1NT2A 4JBOA 3UDBA 5JFSA 2ITXA 2HENA 5HOAA 2B0QA 2GNHA 2PVNA 3ZDUA 5L6PA 2RFEA 5AP5A 2XCHA 4AX8A 4AZFA 5JQ5A 4XG2A 3FC2A 4KIKB 1ZYSA 4XV3A 5HLNA 3A8WA 3C5IA 5M08A 2UZBA 4GK2A 2X0GA 4L52A 1O6YA 3EZRA 1ZY4A 5ACBC 5IDPA 3I1AA 4H1JA 3DK6A 1E1XA 4FTTA 5HX6A 4I21A 3TZ7A 3U4UA 1H1SA 2BIYA 2X1NA 4DLJA 5IA2A 3N4VA 4EOQA 2X7GA 1OIUA 4FSNA 4L43A 4RJ7A 4DGMA 1NVRA 2A0CX 3AMYA 3KXGA 3TV7A 1Q8ZA 4FOBA 4LL5A 4IVDA 1PXNA 4A9TA 2P0CA 1QL6A 2BAKA 4EHGA 4F9CA 3TL8A 5FUTA 2X2LA 2J5EA 5CAUA 3MBLA 2YHVA 2PE2A 4DG0E 4YR8A 4RG0A 3P78A 2Z02A 4FT9A 5IEVA 5AADA 4C62A 2VTPA 4PF4A 3HRCA 3R2YA 5CXZA 2Q0NA 3M1SA 4FUXA 3R7IA 3SG9A 1DS5A 3UIMA 2I40A 4ZTMA 2BPMA 2YCSA 4YU2A 4RWJA 1XBCA 3FY2A 3PXYA 4ZSEA 3ZMMA 3QTZA 1BUHA 2AYPA 5K5XA 1ZYDA 3MDYA 4QP9A 3PFQA 2I7QA 4ASZA 3E92A 4BI0A 2QOCA 3GP0A 2B54A 4MTAA 2GFCA 5KE0A 4H3BA 4W4XA 2PWLA 5BYZA 5AV2A 3D0EA 4GKHA 4O6EA 5GIOE 5IMXA 2IG7A 2HWOA 2PZIA 3VW8A 4AN2A 3NS9A 4YZ9A 3TNWA 5CEKA 5I5ZA 2C6IA 3C51A 4H3PA 3AC4A 3WIGA 3HV4A 3F5PA 3QX4A 1H25A 3LFSA 3UQFA 2ERZE 2XBJA 4Q9SA 3V8WA 4QT1A 5KZ0A 4F6UA 1J3HA 4XUFA 4YJUA 2XA4A 3F3UA 3ZBXA 3BYSA 3NWWA 3ORPA 1NVSA 5K3YA 2B52A 3V6SA 2R7BA 4JNWA 3OWJA 4KS8A 5HCYA 3QRKA 4YTHA 3BQCA 4O7RA 4F1MA 4JBQA 5DT3A 3W2OA 2G9XA 3MFTA 4FICA 4O0TA 3HVCA 4I92A 5L6OA 2BKZA 4IACA 4D2SA 3RAIA 3UVQA 2QU5A 3AC8A 2HZIA 4X21A 3KCKA 3WZKA 3CPCA 1H07A 4O0YA 3SOCA 5IUHA 4FKUA 4PTEA 4I4EA 4LV5A 3SW7A 2YIWA 3EQRA 3GENA 1PKDA 1WBOA 3H4JA 4O96A 3VNTA 5ANJA 4C4FA 3MPMA 4BIEA 3SRVB 4BDJA 3MIAA 2R5TA 4GJ3A 2UW9A 3MJ1A 3I6WA 4JRVA 1UKHA 3ZO2A 3BU6A 4WD5A 4EJNA 5BUJA 2C5OA 1OKWA 4ACMA 1Y6AA 2IW6A 5EOBA 5AFVA 3LCSA 3QC9A 4W9WA 5JRQA 3SD0A 3KRWA 3R71A 1YI4A 4M12A 4MXAA 2BRMA 2BROA 3DKCA 3D5VA 4C4IA 3F2AA 4WSYA 4O0WA 3SOAA 3MPTA 4I22A 3QQGA 4RFYA 4LUEA 2YLFA 2OJGA 3RALA 1PXOA 3GU6A 4NW5A 2EB3A 5AUVA 2X9FA 3VHKA 3WZEA 2HK5A 2H8HA 4KB8A 2Y7JA 2R3RA 4FTNA 4NKSA 4D4SA 5IDNA 4O0XA 4QTCA 5KMJA 4FKLA 4FEWA 4J97A 4U44A 2WMSA 2JFLA 3MVLA 4IDVA 4CZYB 2CKPA 4NYEA 3LFNA 5HI2A 3PSDA 2JAMA 3W1FA 1XHAA 3D7TA 4IMYA 2A19B 3ZC5A 2E9UA 3AC3A 4DHFA 3A7JA 3FKNA 4FV2A 4C4HA 1YKRA 4XG9A 4O38A 1YDSE 3FQEA 1YDTE 1XWSA 3Q6UA 3E88A 4D4RA 3R7EA 3R04A 4PL5A 4F7LA 2XJ2A 3OY3A 4F9YA 1H27A 3DLZA 3LW0A 3Q32A 3RPOA 4WNKA 4DF3A 4D28A 2F4JA 3PIZA 2H96A 5HG5A 4O81A 3O7LB 1KV1A 2A2AA 1XKKA 2WQMA 4J71A 4BFMA 2G1TA 2EXEA 3REPA 3OBGA 4YNOA 4AP7A 4AT5A 4CD0A 2VZ6A 4AW5A 4QP2A 1Q8WA 2YA9A 4GYIA 3ZSHA 4EC9A 3KN6A 3OEZA 5C4LA 5F94A 2R3LA 5KZIA 3W18A 1PMVA 4XHKB 2UZTA 1OIQA 3DBCA 5E8ZA 2Y8OA 4RX8A 5KKRC 3NUYA 5AX3A 2WHBA 4UMTA 2O5KA 3QQLA 2BFYA 4FKRA 1TQPA 4B99A 4WOVA 4AZVA 5JGAA 4ZSAA 2ZJWA 1ZOEA 5TOZA 5DRBA 3D14A 3OUNB 4RWKA 1YWVA 3GU5A 3TT0A 5M4FA 1UU8A 3E93A 3ZFMA 1TKIA 1ZMUA 1PY5A 5FXQA 2WB8A 4MXYA 4RWLA 2PTKA 3EFJA 4DEBA 4FV0A 3ORKA 5HORA 2PVHA 3RZFA 1WBPA 2WTDA 5HG7A 3RHXA 1J7IA 2YISA 4Q2AA 5KBRA 3NCZA 4TYGA 5JEBA 4CZUA 5ANDA 2C1BA 4EZ3A 1XH5A 3OT3A 5HIEA 4FTJA 3UG1A 5FM2A 4AZEA 2WMTA 2GHGA 3EN9A 5ANGA 3HKOA 4IAKA 3RNIA 2C6LA 4GK4A 3PLAE 4XV1A 4RIYA 3ZM9A 3G6GA 4H3QA 3SX9A 2VNWA 4BDGA 4F08A 3HDMA 3PDTA 2O3PA 4IFCA 5A9UA 5LMAA 1KWPA 3ALNA 5L3AA 3IDPA 3NYXA 4KKGA 4WG4A 3PY0A 3FYKX 4GEOA 5FRIA 3HV7A 5C03A 2HZ4A 3ORTA 2YIQA 2E9OA 5IU2A 5EHOA 1QPJA 4UWBA 3UNKA 1OM1A 3GCPA 4KRDA 4IX3A 4TPTA 1OGUA 4RBLA 5ETCA 4F9BA 3AG9A 2R7IA 5JK3A 5AR5A 2OFVA 2QKWB 2VO7A 2BAJA 3HP5A 4L9IA 4MVFA 4AWIA 2JKKA 5AP6A 5M55A 3R8VA 3TXOA 3H30A 5D7VA 5IQHA 4IWDA 1FMOE 4BDEA 1U5RA 2QD9A 1ZZ2A 4FBXA 4B6LA 4ITHA 3OCSA 4DGGA 4MQ2A 4C4EA 4EH4A 4UN0C 3KQ7A 4W4YA 3FKLA 2O64A 2W5AA 3LPBA 3LFDA 3WF6A 1W7HA 3HP2A 3GB2A 3MPAA 2XS0A 4QP8A 3A7HA 1RE8A 3EFWA 3DBQA 2JGZA 4HJOA 5DWRA 4JS8A 3NVMB 3ROYA 4BBFA 3T3VA 3LJ0A 3QD2B 4IH8A 5HE3A 1P4FA 2CPKE 4FV3A 3RCDA 4FEUA 4C58A 3A99A 4ZJJA 1WFCA 3I81A 4L8MA 3ZDIA 5A14A 3U6IA 4PP7A 2GTNA 4RLKA 5FTQA 2BUJA 3R7OA 4ACHA 5TR6A 1OKYA 4DFZE 4HGSA 4RVLA 4U43A 3ZFXA 2BHEA 2BZKB 4EONA 2HW7A 4XG3A 4G6NA 5CEMA 4ZSLA 3TM0A 3W55A 2W4KA 2C5XA 3VBQA 3KN5A 3QC4A 2XK6A 2BMCA 4QO9A 2W1DA 2YCQA 3KU2A 3R8MA 3F82A 3AGLA 3UIUA 1H26A 4PL4A 3QXOA 3LJ1A 1GZKA 4CVAA 4CQEA 3IW7A 4ANSA 5DR9A 1BLXA 2ITPA 4LGHA 2F57A 2XZSA 3QRIA 4EQMA 1YI6A 2C6KA 2O8YA 2HXQA 4EWQA 1Q8UA 5HU9A 1YHSA 4F6WA 4JG6A 4BDHA 3R8LA 1Y91A 4WSQA 3BV2A 3PJCA 4HCTA 4QPMA 4DH5A 2CGXA 4R3RA 5J1VA 4O82A 4PMTA 1M52A 4X2GA 3ULZA 5BQ0A 2XBAA 3PP0A 2OZOA 4HNIA 4RFZA 3ID6C 4YC3A 4ALVA 3MH1A 4CFNA 4PP9A 1ZOHA 2BVAA 4O7NA 3OTUA 3DZQA 4I41A 3R9OA 3FZPA 1IA8A 4M7IA 4HVDA 1Y6BA 2FB8A 4G16A 4C3FA 4IAZA 4G5JA 1SVHA 4PMMA 3RVGA 3ZONA 4ANMA 2QNJA 2XNPA 4E3CA 5M57A 4QMXA 4CFVA 4YJSA 4MNEB 3VBVA 3PPJA 3A7GA 3IK3A 3SV0A 3CQEA 3VUMA 1MQ4A 3LQ8A 4IZAA 5KO1A 3KXXA 4I3ZA 2C5NA 2VGPA 3EN7A 5M53A 4BCGA 5KX8A 4FSTA 3O51A 4YPDA 3S0OA 4NCTC 3ZBFA 4XBUA 5DPVA 5E8SA 3LFBA 3LXKA 3NAXA 4FIIA 3KVXA 5M51A 4RZWA 5FP6A 4XOYA 2WMVA 3I6UA 2R3GA 5AUTA 3MVMA 4IADA 3I4BA 4IWPA 3CCNA 4XG6A 4DG3E 3E3PA 3KRRA 3PA4A 2OICA 2NP8A 5DE2A 3OC1A 3IDBA 3JPVA 1K9AA 3ANQA 4KIOA 4KIKA 4A9SA 5IG1A 3QZHA 1OL5A 4BI1A 1FGIA 2O0UA 1NXKA 4IVAA 3UQCA 5E4HA 2XIZA 4BGQA 5JH6A 1NY3A 5AIRA 4E4NA 4DFBA 4C34A 4GFMA 2C5VA 3F3WA 4YBJA 3VWAA 1RW8A 4D4YA 2WNTA 5AP0A 3NLBA 4R1YA 3OROA 4F9WA 4I4FA 2PE1A 3LM0A 3TWJA 4PL3A 5HNIX 4U0IA 2RG5A 4QYEA 2QC6A 4U3ZA 5E8YA 4XRJA 1A9UA 4JL9A 4K8AA 3UO4A 3FY0A 2ZV9A 4X0MA 1GIHA 1ZMWA 4D2VA 5JQ8A 3FQHA 4IFGA 4IC7A 4XG7A 1OMWA 2R3QA 3PXRA 4DA5A 3IO7A 3ZEWA 4UALA 3HEGA 3Q4UA 4PDYA 2RGPA 3AD5A 2X8EA 2ETMA 2WELA 4EOMA 3QWJA 5FM3A 4LG4A 4QMOA 4QMWA 3V5LA 2VWVA 3P7BA 5D12A 3CC6A 2Z2WA 4FK3A 3OTVA 4QNAA 4IWOA 3UGCA 3C1XA 3HYHA 5A4CA 2JDTA 4PTCA 3WIKA 3UNZA 4BZNA 2OKRA 3KKVA 5L2TA 3TUCA 4I20A 3VUDA 2IJMA 2QONA 1Q4LA 2BRBA 4BZOA 3LFCA 4EH7A 4J95A 2CHLA 2V22A 3QRUA 4GMYA 1X8BA 3UOLA 4ANNA 3P4KA 2XIYA 4DBXA 2CCHA 3VVHA 3ULIA 5KMLA 1FBNA 4FC0A 4FSMA 2CGVA 2UZLA 3OCGA 4HNFA 4NKAA 1B39A 4O0VA 4AT3A 2JC6A 3P5KA 4M66A 3A4PA 5CTPA 4BCKA 2QODA 5AM6A 4DGNA 4EWHA 4LRJA 4YHTA 2OGVA 5CF5A 5M06A 3D83A 3R9HA 4IB5A 4O7SA 3HX4A 5EQPA 3Q4CA 4R5SA 2YZLA 1P2AA 2VTQA 4X3JA 5HVKA 2ZDUA 3ZHPC 3D7TB 3ZRKA 2VWXA 5DYJA 2OSCA 2CLXA 3P0MA 4KWPA 4GT5A 2WTJA 2VX1A 3QRJA 4M69B 1XH8A 4XLIA 3SQQA 1APME 3PXKA 3DJ6A 4KBCA 3QKLA 3RK9A 3CD3A 2R3NA 3Q3BA 5CQUA 2QHNA 5BVWA 2R3FA 3PVBA 3FLZA 2GPHA 3WF8A 4R7BA 3JY9A 4C4GA 4IAYA 4O84A 3R9RA 4F7NA 1LEWA 3SRVA 3VBWA 4AGCA 5JRSA 3R7GA 2ONLA 3QA8A 3K3JA 4R7HA 5CLPA 4GU9A 1KOBA 3TJDA 3DPKA 2EU9A 3EJ1A 3D7ZA 1Q3WA 5JT2A 2OLCA 3C0IA 3RPVA 3ZLYA 4D2RA 3DT1A 1OKZA 4X7QA 3R1YA 5EG3A 4FA2A 5LWMA 2XH5A 4FZ6A 4BDIA 3DDQA 2BDFA 2HIWA 3HDNA 5JKGA 5AP4A 4FKIA 3E62A 4IM0A 2Q83A 4O7LA 4UMQA 1UV5A 4ALUA 4BL1A 3GU8A 3R0TA 3FJQE 3QTXA 4L3PA 3OEFX 3FZ1A 3G9LX 3KXMA 3R2BA 4FIHA 5HD4A 4J8NA 5BNJA 2A27A 2XK8A 4ZZOA 2CNUA 4U7ZA 3KMMA 4QQTA 4DN5A 4TL0A 4QOXA 3VQHA 3SGCA 4NK9A 2GQGA 3SAYA 5EQEA 3C4EA 3H10A 4NU1A 3UYTA 1OECA 3ACJA 3DK3A 4WRGA 2PL0A 1ZRZA 3C0GA 3QAME 1JQHA 4I6QA 3V8TA 4F1TA 3CXWA 5DR2A 4NWMA 4IEBA 3TN8A 4YTCA 4GRBA 3ITZA 2XCKA 2W06A 4F4PA 3K5VA 1OL1A 3NCGA 3PZEA 3PG1A 4FKOA 3WE4A 3NW7A 4YZDA 4O0RA 3DB6A 3VAPA 4OAUC 2IO6A 5FXSA 1LPUA 4E4LA 1BI8A 4NJ3A 3RPRA 3GOKA 4ID7A 5HZNA 5FTGA 5A4EA 2X8DA 1FINA 5IQDA 3BEGA 3OF0A 3EYGA 3DV3A 3LJ2A 3FKOA 2XRWA 4NFNA 2XK7A 3MFRA 2C6MA 2VN9A 3C13A 4K0YA 3W2RA 4AGWA 1KOAA 3FHRA 5CEOA 3OW4A 4FV9A 1FMKA 3HV6A 3PXQA 4JRNA 3FMKA 1YWNA 4AAAA 2RFSA 4CMUA 2BRHA 3I0OA 4NM0A 3TDWA 5TO8A 4E4MA 4FL2A 5BVDA 3O17A 3FC1X 1WCCA 4WO5A 2CSNA 3JUHA 4LMNA 3MH0A 4PY1A 4FL1A 3MA6A 4BYIA 5A6NA 3TG1A 2C3LA 5CSWA 2BIKB 5FBOA 5HO7A 4GS6A 1LEZA 2VWBA 4AN3A 2XJ1A 3ZXZA 4Y83A 4S33A 4M14A 4M67A 4E4XA 2XK3A 3ZLWA 4ACDA 4YZCA 5LXMA 5HCZA 4AXAA 1JKTA 2OG8A 3BGQA 2EWAA 3KXNA 5B2KA 3QWKA 5E7RA 4AW2A 3NUNA 5KMOA 2QLQA 3SXSA 4Z16A 1JAMA 2W1ZA 2G2IA 3KCFA 4QQ5A 1R3CA 3HMMA 4DH1A 5G6VA 1CSNA 3SXRA 2R3HA 3P7CA 3NUAA 4U40A 3TDVA 5IA5A 2QOKA 3QD3A 5FDPA 3ZZEA 4ACCA 5CU2A 3H9RA 3LKMA 5DN3A 2LAVA 2W1HA 5LVMA 4O6LA 3LMHA 2GS6A 3FSFA 4J1RA 3LXNA 2HWPA 4JBPA 5CEQA 3U6HA 3DKFA 4OGRA 3Q4ZA 2P33A 4GIIA 1XJDA 3R1QA 4K6ZA 5GJGA 5H3QA 5M56A 2OJIA 2XNOA 5CAPA 5IQBA 4YTIA 3U9NA 2ITTA 5HBEA 4DTBA 4M84A 4MXCA 3CBLA 4TRLA 2XK9A 3K5UA 3UP7A 4BYJA 4BTFA 1PMEA 2RF9A 2ZAZA 5ITAA 5KMMA 4D55A 3BGZA 3ODZX 4CYJA 2BTSA 2YFXA 4IX6A 4HZRA 3MSSA 4IAFA 4RIXB 3BHTA 5AAFA 3BGPA 3FL5A 1IAHA 3NMUF 4ZSJA 4ERKA 4XCUA 3NYVA 2Y4IC 3QTQA 3RP9A 4CT1A 3BHHA 5EM5A 4ZY6A 4M97A 2UW6A 2IVSA 3RM6A 3O71A 3ACKA 5DBXA 3PJ2A 4WBBB 4EOIA 3FLSA 3GXLA 4HCVA 4L46A 3U9CA 1M14A 2ITNA 3P1AA 4WG3A 5BVKA 3UIBA 4RMZA 2X6DA 3FI2A 4U97A 3IW5A 4RC4A 3O23A 1OPKA 1OUKA 2YDKA 3KY2A 4ZXTA 5HHWA 3BU5A 3R7YA 4UYNA 3VRZA 5H8EA 3IOPA 3LXPA 1GY3A 2JAVA 5CXHA 3DTCA 3TKIA 3ZRLA 1F0QA 4Y5QA 4NTSA 3UTOA 2GFSA 3KB7A 4U5JA 1OZ1A 1NA7A 2WAJA 5EQYA 3PIYA 5KKRB 1VJYA 2Q0BA 3DGKA 4M0YA 4KKHA 4F1OA 3MW1A 4CLJA 2WEIA 4WNMA 3FZRA 4BHZA 4FTMA 4IM3A 4C2VA 2C68A 3POOA 4NH1A 4ALWA 3TZ8A 4QMUA 2HAKA 2WMUA 5HTBA 3HAMA 4M15A 3LE6A 4TYEA 3KK8A 3R00A 4P7EA 4HPUE 3GBZA 5EM7A 2C6TA 4KD1A 3G2FA 3W2SA 3GU7A 1XH7A 1W83A 1H1PA 2BALA 2GMXA 3E8CA 3PPZA 2JIVA 1QPDA 3MVJA 5AUYA 5BYYA 2OIBA 5M4IA 2QU6A 4FKJA 4AACA 2CKQA 4MNEA 4JR7A 1FVTA 4AZSA 4I6FA 4APPA 4CCUA 1G5SA 1YVJA 2RKUA 3KREA 3OG7A 3W2PA 3FSKA 1S9JA 5AMNA 4D5HA 4W8DA 2J0MB 5EW8A 1VZOA 2BAQA 3PWDA 3C4ZA 4FIEA 4OT5A 3U87A 4MNFA 5K4IA 2BFXA 4FNYA 1SZMA 5FEDA 3T3UA 4ENXA 4QMPA 5EYDA 5K0KA 2F7ZE 1ZAOA 5CVFA 4BCPA 5IQFA 2OO8X 3OW3A 4XV2A 4YHFA 3DA6A 4PNKA 4TWCA 4RC2A 1V1KA 4HGEA 3ZOSA 3OS3A 1I09A 3C9WA 3R22A 3RNYA 2XNNA 4U41A 1H00A 1JLUE 5LVNA 4FG7A 4MX9A 4O2ZA 5J8IA 3ZLSA 1W84A 4F6SA 3UP2A 4EBVA 5AA8A 4IAAA 4FTIA 3AT2A 2OFUA 4HYHA 1ZARA 4J98A 3UO5A 5C27A 2YM3A 3B2WA 1RJBA 3EQBA 5KHXA 5JGDA 1J1BA 4UZDA 5HG8A 4JX7A 4K11A 1YW2A 5LMKC 2E9NA 4D1ZA 5AUZA 4D9UA 1CDKA 3DCVA 4DITA 3R7VA 4YLLA 3WZJA 2GDOA 4E26A 1WMKA 3VS7A 1GAGA 5DMZA 4RA5A 4WBOA 3TTIA 5E8TA 5DH3A 1WBNA 4BF2A 3CD8A 1E9HA 4JAIA 3HNGA 2ZMCA 3GCSA 1Z5MA 2VRXA 4K33A 4PMSA 4AOIA 4EOOA 4D58A 2WMXA 4XG4A 3NPCA 3T8OA 3TZMA 4PQNA 4U79A 4EKLA 2FUMA 4NUSA 4CRSA 3MYGA 4L68A 4V05A 2NRYA 5M44A 2ITZA 3N4UA 4GL9A 4P5ZA 4OAVB 4FE2A 1LR4A 3KFAA 2QOFA 5BMMA 4E20A 2QO7A 2B1PA 5AWMA 3LLTA 5I9WA 3F9NA 3GEQA 4FV7A 4X3FC 3EHAA 3HV5A 5AM7A 3FYJX 3ZUUA 5G1XA 4RVTA 4CTBA 3TI1A 4DC2A 4QP4A 4EQUA 1U59A 1G8SA 4ORKA 2VTTA 3D9VA 3Q9XA 3G90X 3FLWA 4GIHA 4BDBA 4RIWB 4HZSA 3TNHA 1F5QA 1H24A 3D94A 4TNBA 5DIAA 3UPZA 3RK7A 1FVRA 1PMNA 4YJOA 1GNGA 5D9HA 3UYSA 1GIJA 1UNLA 2WO6A 3VF9A 4J99A 1NVQA 4RA4A 1YHWA 4A9UA 4CRLA 4F65A 4PRJA 2JBPA 5J95A 3LCOA 2DUVA 2CDZA 4MD8E 5HNGA 3WF7A 3FMEA 2YLEA 3ZC6A 2QOQA 3KXZA 4TXCA 3R8ZA 3ATTA 3IS5A 1BL6A 5CNNA 3HUCA 5C26A 2W1FA 4IZYA 2Y0AA 4WUAA 3RPYA 4YJQA 3HA6A 3S00A 4PWNA 4TWPA 2OJFE 5M09A 5ETFA 3NSZA 4D1SA 4FTLA 5I4NA 2UW4A 3NIZA 4APCA 2UVZA 4EOLA 4CKJA 4MBLA 2G2HA 3MWUA 4NM5A 5CEIA 4FF8A 5HKMA 5FXRA 5KUPA 4FTRA 4M69A 3QQKA 4S32A 4BTJA 2W1IA 3EMGA 3EQPA 3JXWA 3WZDA 3IONA 4L45A 5D1JA 4Z9LA 4BR3A 4IW0A 5AP1A 2J5FA 4FMQA 5A4LA 2WOTA 4FNZA 1ZWSA 4A4OA 2ZM1A 1VR2A 3LXLA 5EKNA 1M7QA 3OWLA 4G9CA 5J7BA 2WMQA 4DE4A 2WEVA 3FEGA 4U42A 3V5WA 2OXYA 2UVXA 3L1SA 4MXOA 5ANOA 4BDKA 4FZAB 5K4JA 4ZS0A 4JBVA 3SXFA 4FSYA 4CMTA 3VW6A 2CNQA 2QR8A 2RG6A 1ZZLA 2XF0A 4EKKA 4HVIA 5HGIA 3FUPA 2OU7A 2W7XA 4C35A 3UE4A 3EL8A 1PRYA 4YC6A 3R83A 4FKQA 5GZ8A 1UKIA 4E6QA 5KBQA 4LMUA 3DXNA 3D5WA 3UODA 2FSMX 1VYWA 4AG8A 1OL2A 2NNWB 4RPVA 5EDQA 3ZH8A 2XRUA 3BPRA 4FG9A 4C4JA 3G5DA 3NRMA 2HCKA 3MS9A 5DNRA 4EEVA 4F0IA 3LOKA 3I5ZA 3DAJA 5CNOA 1WVWA 3E3BX 3THBA 3ANRA 4ZTRA 4MWHA 2PUNA 4BWKA 1G3NA 4JX3A 3HZTA 2ITVA 1BKXA 3POZA 3NW6A 3P23A 3GFEA 3FMMA 3OMVA 2DWBA 2YACA 4GYGA 4ZTNA 5LMBA 2PU8A 5E9EA 2J4ZA 4DT9A 4IB1A 4JT3A 5EK7A 4NM7A 4E8AA 2OI4X 2EXCX 4PV0A 2PMIA 4I0SA 4LV8A 4E5BA 3RMFA 3QLFA 4V0GB 1HCLA 5F4NA 4X2NA 2BZHB 3SLSA 1OL7A 5L2SA 4FKTA 4QP6A 2PPQA 2W99B 3QTSA 2J7TA 4LM5A 2W05A 1Q3DA 4DEDA 4UMUA 3Q2MA 4EL9A 4KUJA 3ODYX 3BQRA 4R3CA 4FGRA 3FXZA 3KXHA 2GCDA 4F9AA 4QYFA 1HOWA 4MAOA 3IW8A 4UBAA 3PRIA 5EFQA 1Y8GA 2Z7QA 2QOIA 4ZEGA 2EUFB 2QOLA 3H3CA 3W2CA 4NT4A 3V5PA 3ENHA 2ITYA 2GNLA 5AP7A 1B38A 3VN9A 5K5NA 2OWBA 5HQ0A 1YXVA 4FT0A 4FV6A 5EW9A 4FYOA 2W0JA 4FNXA 1U4DA 4YJRA 2QI8A 1E1VA 2W5BA 3CEKA 4JQ7A 1OUYA 3NNUA 4GVAA 2I0HA 4JXFA 3TZ9A 2PZYA 4OBOA 3FWQA 3OUKA 3SDJA 4YUQA 4XP3A 1YHVA 4BGHA 3BIZA 4YSJA 2JKQA 3PA3A 2RFNA 2XK4A 3BBTB 4YLKA 5EW3A 3QHWA 4LOOA 5CU3A 3KULB 3Q9ZA 3UOKA 1QMZA 3DQXA 4OTWA 3F3TA 2VTHA 1SYKA 3GCQA 3BE9A 3BV3A 2FSLX 3CY3A 3RWQA 5LWNA 4YC8A 3DKOA 3A7IA 3RK5A 3UNJA 5DA3A 2XEZA 3R1NA 2W5HA 4FZFB 5C8KA 4A06A 4ZLYA 5B0XA 3A60A 5HTCA 2YABA 3CS9A 5HD7A 2J6MA 4HW7A 3VBYA 1UWHA 4DFXE 4F0FA 4EH5A 4NM3A 2ZYBA 4TZRA 3A7FA 2WTWA 2IZTA 4XYFA 2WU6A 4EUUA 3EIDA 3GUBA 2Z7RA 5KMKA 5J1WA 4H58A 3LM5A 4NEUA 1JNKA 2WU7A 3GU4A 5EH0A 4OTHA 2UW8A 5FBNC 5FWKK 3RCJA 4KIPA 3UZRA 4LI5A 3UVRA 4BVUA 4UV0A 2VWWA 4YJNA 1KE8A 5CF8A 5L8KA 5LVPA 2YIXA 1XH9A 4QRCA 2YDIA 1Q97A 4IE9A 3EQHA 3IOKA 1Q41A 5CU6A 4QP7A 1OPLA 4E6AA 2I0VA 2Z7SA 1UU9A 3OFMA 1ZMVA 2R64A 4C02A 4FKGA 5JZJA 5KHWA 1IEPA 4CQGA 4N57A 2C0TA 3TUBA 4LYNA 1K2PA 3D2IA 1FQ1B 2J90A 4U81A 2GS2A 4ZLOA 3LFQA 4C3PA 3BLRA 4RIXA 4MF0A 4FEXA 3ZU7A 5GINE 3WI6A 3CTJA 4EZ5A 3BX5A 4FGBA 4M68A 4RX7A 3FI8A 4CG8A 3EQGA 5HEZA 1QPEA 1ND4A 2WKMA 5FP5A 4XMOA 5H9BA 1MQBA 4NSTA 2B9IA 3R21A 3E8EA 2HZNA 3L9NA 4MH7A 5HLPA 4UYAA 5CT7A 2VAGA 3PXFA 3E63A 2WD1A 5EI6A 3RKBA 4EQCA 1OB3A 3D5UA 3EYHA 4MF1A 5GNKA 2G2FA 5HO6A 2PZPA 4L3JA 4FVRA 5CY3A 4ANLA 1ZYLA 3F3ZA 1YI3A 3BHUA 4UY9A 3VJOA 4GFOA 3MH2A 4FR4A 3R7UA 4QMSA 4GW8A 3UO6A 4BDCA 3C4FA 2PE0A 2Z8CA 5EKOA 2X8IA 4EH2A 4AUAA 3G0FA 4K77A 5BVFA 3ORIA 4OTDA 5IEXA 2QO2A 2XKEA 3G0EA 5E8WA 5I9UA 3V04A 4A4XA 4CYIA 1WBTA 3K2LA 5CZIA 4QMQA 3F7WA 1JWHA 4YO4A 4N4SA 4BCQA 4E6CA 2WTVA 4KAOA 3F2RA 5EYCA 4K1BA 2OJJA 2G15A 4KSPA 2VD5A 3HMIA 3LQ5A 4QP1A 4G5PA 2XKCA 2X4ZA 2OK1A 1CKIA 4L67A 4ZTHA 3RJCA 1M7NA 2I0YA 5BVNA 4EK3A 5JFXA 3V5QA 2DS1A 4BCOA 3DZOA 2XIXA 4TYHB 2HYYA 4RQKA 2FSOX 2PZRA 3NNVA 5H8BA 2VTRA 2C69A 4G31A 3ZCLA 3EN4A 4QD6A 2VO6A 4GK3A 3BHVA 4PDOA 3PA5A 2BZIB 3AD6A 2V7AA 3MTLA 3AOXA 3VBTA 4BDDA 5J5SA 2PMOX 5AJQA 4AN9A 1FVVA 3SC1A 2W17A 3HA8A 3QX2A 3U54A 3I7BA 4ZMFA 3K3IA 2ZM3A 3EQFA 4D2PA 3HMNA 5IF1A 5IPJA 1PXLA 4ZSGA 1LP4A 1W8CA 3NUXA 4G6OA 4HCUA 2CN5A 4F7SA 5IA3A 2BRGA 3F5XA 2GNGA 2ITUA 3OWPA 1W82A 3D15A 3MY1A 5KNJA 4FKVA 2UW7A 4RQVA 2Y4PA 5E92A 3NUSA 5FD2A 4FSRA 5HESA 1BX6A 4HVSA 5E8VA 3LFAA 3CKXA 3SG8A 2WMRA 2HXLA 5CSPA 4EYJA 1B6CB 4ZP5A 4O2PA 4U3YA 3VUKA 2JFMA 2JDRA 1XBAA 5AUXA 1A48A 3DB8A 5CSHA 4WKQA 4ITIA 4BDAA 4ZJVA 1YWRA 1HCKA 2B55A 2BHHA 4XP2A 4TT7A 3FLNC 4FTQA 5EM6A 4AF3A 4DTKA 4CGAA 4IVBA 4CMOA 1UU7A 4AW1A 4BBEA 3EKNA 4FI1A 3PP1A 2C3IB 2BDWA 4TKSA 3MFUA 4BCNA 1H0WA 1L3RE 2O65A 4J7BA 5AV3A 3OY1A 2GQSA 2Y4IB 3QKMA 4XOZA 2GSFA 4QNYA 2JEDA 1YOMA 2XKFA 4OTRA 5DG5A 4OR5A 3BLHA 2R2PA 1W0XC 5AP2A 1Q5KA 2W96B 3WE8A 1Y8YA 4P2KA 3LAUA 2PVFA 3I5NA 3NZ0A 4P4CA 4X2KA 5ANKA 3VS5A 4ERWA 4QQCA 3SW4A 3A61A 3NDMA 5LJJA 2PVLA 5EYMA 2VTNA 3EB0A 2W9FB 4DFUA 3ZTXA 1KE5A 4BY9E 3R73A 3E64A 2W1GA 1Q24A 2EXMA 2GTMA 2REIA 3OP5A 4HGTA 3W2QA 4L42A 4CCBA 1GZOA 2PVRA 3KF7A 2C47A 3E87A 1JSVA 3R02A 4CLIA 3RINA 3COIA 5LCJA 2QG5A 2CGUA 3ORXA 3VUGA 2PVYA 5F95A 4DCAA 4G6LA 2ZVAA 3F5UA 1MUOA 2F7XE 4BC6A 2ETRA 3UG2A 2F7EE 2J9MA 3P08A 4QMNA 5E1SA 4FSWA 4RJ8A 2PY3A 4LRKA 4CT2A 2PMNX 4RIWA 4RRVA 4JR3A 3LZBA 5JGBA 2OZAB 4Y73A 5K0XA 3O0GA 1SNXA 4FOCA 3TNIA 1MRYA 2LGCA 2R3MA 4FKPA 4FIGA 4W4WA 4I23A 1GZNA 3GC0A 1GIIA 2V7OA 4UWYA 3TEIA 3QTUA 2YZAA 4YLJA 1URCA 3FI3A 4O21A 1R1WA 4EC8A 5B2MA 4I0RA 2JITA 4DEGA 3ZEPA 4TYIA 4UMRA 5AIKA 5CU4A 2ZDTA 5T3QA 4BN1A 4QMYA 2YWPA 3MIYA 4IXPA 4WHZA 3M11A 5FEQA 3IGOA 5LVLA 3RHKA 3BRBA 4BRXA 3O8TA 4EOJA 4U45A 2QCSA 3BLQA 4FUYA 4NCTA 4C33A 3FPMA 4F09A 3ORMA 2IZRA 3PY3A 3LHJA 4MD9E 1OL6A 3CQUA 4EI4A 4ZY4A 3Q5IA 5D41A 5IQGA 3QD4A 2FVDA 2C6OA 5T68A 3PVWA 5A3XA 5E91A 4QYHA 2IPXA 5DVRA 4AS0A 4RJ4A 1Q8TA 3IPHA 3C5UA 3IW4A 3NUUA 2QOHA 2YDJA 4B8MA 4GCJA 1JSUA 4FYNA 4RIOA 5DHJA 1DI8A 4L3LA 2WGJA 4UXLA 3Q9YA 1UNHA 1J1CA 3VUHA 5DEWA 5AA9A 2CKEA 5J87A 1IRKA 2J0JA 4I0TA 3QCXA 5EOLA 4BKYA 2XM8A 2XYUA 3NYNA 3GC7A 3HLLA 2KTYA 4RFMA 2GU8A 3R8UA 4A9YA 4IZ5A 4X6RA 4S30A 1KV2A 2B4SB 3HV3A 5DGZA 3WF9A 5JN2A 4R7IA 2HY0A 2PHKA 3IGGA 3JS2A 4FVPA 5H8GA 5IA1A 2UW5A 2C5YA 2QLUA 3DLSA 2P55A 4GJ2A 3MB6A 4EORA 1T45A 1DI9A 4FTUA 2E2BA 5CAOA 2VWYA 4O91A 4W8EA 4G17A 3U51A 3HRFA 4YURA 3ZSGA 4YGAA 4EK4A 2JBOA 4E93A 1JKLA 2OW3A 2ZV8A 3EKKA 1DAWA 3AT4A 4BKJA 1XQZA 5FTOA 3UZPA 4X3FB 5A6OA 3PLSA 2X7FA 4G3FA 4V0GA 3BELA 4QMTA 4ZTSA 1WZYA 2OXDA 4MK0A 3OXZA 4A4LA 5AP3A 4S31A 2B9FA 2DYLA 5IUIA 5CEPA 4KKEA 3BWFA 2PVMA 4DGLC 3AXWA 3P9JA 4BTKA 2IW9A 4AE9A 3L8PA 4OTQA 2VV9A 1PXKA 3CY2A 3QZFA 2QKRA 2AC3A 4XP0A 5HVYA 1QCFA 1CKJA 2GHMA 3FDNA 4YP8A 4ZS4A 4B7TA 2XJ0A 5CT0A 4BIBA 2ITQA 3ELJA 4FODA 4RC3A 4RSSA 3QCYA 3QHRA 3EFKA 5BX0A 1Z57A 2J51A 2NRUA 3MJ2A 3E8NA 1F3MC 4HGLA 4XV9A 5ANEA 4HVHA 3PJ1A 4D4VA 2FYSA 3AC1A 3N4TA 2J0LA 5A4TA 4L7FA 5AV0A 3I0QA 4UMPA 4ZMEA 3TTJA 2W9ZB 3EZVA 2WTCA 4JIKA 3E5AA 2CN8A 3QTRA 1Q99A 2GNJA 4MBJA 3ETAA 4C38A 3PSBA 1H4LA 3KULA 1OVEA 5HNBA 4PPBA 4UB7A 4FTOA 4MXXA 2RSVA 1UVRA 5CZHA 2XNEA 3RWPA 4QQJA 4BBMA 4GT4A 5EI8A 4I1ZA 5HX8A 2EB2A 5AEPA 4YJVA 4QTDA 3Q6WA 1PKGA 3MTFA 4TN6A 5HE0A 1YXUA 4A7CA 1T46A 4LOQA 5T6KA 3GC9A 3W33A 4BI2A 4EOKA 5AV4A 4USFA 3BBWA 3PVUA 1QPCA 4PTGA 1SM2A 2V0DA 5DT0A 4AU8A 4JLCA 3FMDA 4GVJA 3UQGA 5IMEA 4BZDA 2OXXA 3JY0A 3KC3A 3PTGA 1AD5A 5C8NA 3FZTA 4AZWA 5A46A 3ENMA 5CX9A 3CGOA 4L53A 4C3RA 4EJ7A 2ZV7A 4FTKA 4GKIA 5GJDA 3TNQB 1Q62A 4G34A 1ZLTA 5AR2A 1WBSA 4ONAA 4OW8A 4XRLA 1TVOA 4RGJA 2BKKA 4K18A 3CE3A 3KF4A 4LOPA 4FT7A 1URWA 1J7LA 2R3OA 4C36A 4CKIA 5CAQA 2WMWA 4W4VA 4KINA 2FH9A 4FNWA 5BPYA 5CAVA 3QTWA 2QQ7A 3GNIB 1L8TA 4S34A 3G15A 2UW3A 1R78A 2WTKC 4I24A 5EM8A 5HE1A 3EN6A 3PZHA 2PVKA 4PMPA 2YM8A 2PVJA 5CASA 3GQLA 3O96A 3PPKA 3Q52A 3RTPA 5CVHA 2NPQA 3DY7A 2QOBA 4HOKA 2ACXA 2XNMA 3CPBA 2XM9A 4QMMA 2XUUA 4CKRA 2OF2A 1G8AA 4E7WA 1FOTA 3PJ8A 4X2FA 4ACGA 4EOSA 4Q9ZA 4CEGA 4ZLZA 1PXIA 3EN5A 4XNEA 5DR6A 4AFEA 3F61A 4GH2A 4WT6A 2FA2A 3O50A 2IZSA 4L44A 4L01A 3GFWA 4AQCA 4EH8A 1U54B 3QKKA 3C0HA 3R63A 3OXIA 4Y85A 5A4QA 5C1QB 4ZIMA 3ORLA 2J0KA 3MA3A 4RX5A 3ATSA 5I0BA 3JVSA 2A1AB 3NYOA 1GZ8A 4ANOA 4CV9A 1H1RA 3T9IA 3WZUA 3K54A 4RJ6A 3ET7A 4H05A 4FEQA 3RAKA 2VNYA 3MY5A 2RIOA 3NR9A 2YM7A 1CKPA 3O8UA 3U4WA 3PG3A 3E7OA 4EOPA 3G33A 4MEDA 3VS4A 3NIEA 4N70A 4R3PA 1PYXA 4G9RA 4PUZA 2H6DA 3DAEA 4USEA 2VX3A 2IN6A 4R1VA 3UPXA 2UUEA 1RQQA 2I1MA 2X6EA 3F88A 4M8TA 3C50A 1YOLA 2CJMA 3QZGA 4EK5A 2V55A 3TV4A 3PY1A 3DJ7A 3NW5A 4GT3A 4MXZA 4TYHA 5ACKA 4II5A 3JR1A 1Q61A 4AA4A 2ITWA 5GJFA 4KA3A 4ASXA 3NVKI 3GT8A 2ZB1A 2YJSA 1OI9A 5H2UA 2F2CB 5HBJA 3VIDA 3R9NA 4J53A 1PXMA 2J2IB 3DDPA 5HBHA 2WQEA 1YOJA 4I5HA 2WIHA 4EHZA 1O6KA 3BYOA 5BUIA 5GZAA 1TQIA 1CTPE 1MRUA 4FVQA 5HLWA 5I9VA 3VS1A 2JIIA 2XYNA 3DBDA 4QP3A 5AUUA 2P2HA 3HRBA 4BCMA 2P2IA 5C4KA 4G1WA 4I5CA 3DKGA 2BCJA 1BYGA 3I60A 5IA4A 4S2ZA 2YM6A 2VTSA 4KBKA 4NL0A 5AUWA 4IC8A 2C0OA 5AR8A 4DH8A 3FMHA 3VQUA 2KULA 4XBRA 2W4OA 3NUPA 5CENA 2GNFA 2JDVA 3QUDA 4FTCA 2BR1A 3EQCA 4JOAA 4L6QA 5HE2A 4DLIA 4OTPA 4U9AA 4MBIA 4ASEA 2VTJA 3KK9A 3S3IA 4UX9A 1U46A 1TQMA 2W4JA 3PE2A 3UMWA 3W16A 1BL7A 2OF4A 3FMLA 2FGIA 4NW6A 3T9TA 2WTIA 3GQIA 3TIYA 1ZOGA 4WIHA 3HL7A 4U6RA 5BYLA 1O6LA 4QMZA 1I44A 1H08A 5LARA 5E90A 3C4XA 3OBJA 3P7AA 4FV5A 5GIPE 3VUTA 3LFEA 3PYYA 2WIPA 4WNOA 2XP2A 4DH7A 3L8VA 4M13A 2PULA 3DU8A 1CMKE 2VWZA 3CKWA 2IZUA 4UXQA 5FEEA 3VULA 4FTAA 1NW1A 4ASDA 4HPTE 4I93A 4HYIA 4YPSA 4DFLA 5JMSA 3DS6A 3LVPA 4YZMA 4BCFA 4RT7A 3MY0A 4FT5A 3HGKA 1ATPE 1H8FA 3VS0A 4RZVA 1JOWB 1GJOA 2WMAA 3FE3A 4D0WA 3JYAA 4KIQA 2SRCA 1XH6A 4MHAA 1OIRA 3H0YA 3QALE 4Q5HA 3HMOA 4R78A 3TNPC 4G2FA 1WVXA 3DK7A 3ZO4A 4P90A 4IVCA 3VF8A 3O8PA 3IQ7A 2UZEA 4ENYA 2C3JA 3A62A 3AGMA 1WBWA 4IAIA 3KGAA 4O7ZA 3GGFA 2VWIA 3H9FA 2CMWA 4O0UA 3DTWA 2Y9QA 3FLQA 3GC8A 3PUPA 2QOOA 2XB7A 4FKWA 5DI1A 5C8MA 5L8LA 3IKAA 3ZZWA 4QYYA 4JDHA 3V8SA 2B7AA 3KRXA 4LFIA 4YSMA 1PJKA 5AR3A 3CLYA 2ITOA 2OZAA 3EOCA 4YNEA 4CFWA 3A8XA 4XEYA 4I5PA 4AT4A 3CJFA 3MI9A 5D7AA 5J7HA 3FMJA 3PJ3A 2OH0E 4EH3A 4YJTA 4LL0A 5HIDA 4B0GA 1ZYJA 4MD7E 3DQWA 1SMHA 3NEWA 4USDA 3M2WA 4LGGA 4B8LA 4YZBA 5CF6A 5TKDA 2YM5A 2QURA 1PYEA 2CLQA 2VU3A 4RVKA 4FEVA 1PXPA 3IW6A 2RFDA 4R8QA 5HU3A 4BHNA 2GNIA 4AFJA 4YJPA 5AV1A 5CI7A 5BVOA
chains in the Genus database with same CATH superfamily
4JDKA 5AR7A 2OIDA 4AGDA 1SVEA 4ARKA 5IH6A 2YWVA 2I0EA 4E6DA 1XBBA 3QRTA 1H28A 3OD6X 1BI7A 5LCKA 3ZFYA 1IAJA 4RVMA 2UZDA 3TACA 5JSMA 4Y72A 2X9EA 4KS7A 1OBDA 4IIRA 5IUGA 1OBGA 3BWJA 3NNXA 4Y46A 1ZY5A 2J0IA 3BU3A 3KMUA 3TJCA 4J52A 3N51A 5CS6A 4FK6A 3ZO1A 5FG8A 4XH6A 1AGWA 4BICA 4J96A 3KA0A 3A4OX 2ERKA 3D2KA 4I6HA 4P5QA 3OHTA 5FLFA 3G51A 4MCVA 4CFFA 4O7WA 5L6WL 2OIQA 4EK8A 2YEXA 4DBNA 1YRPA 1YXXA 3DOGA 3RBWA 5CSXA 3W10A 4GUBA 4DAWA 4NTTA 4Y5HA 2W1EA 3GCUA 4QMLA 5LMKA 3CSVA 5HCXA 1H1QA 3GCVA 4ANBA 4JG7A 5ETAA 3KVWA 3Q60A 2CKOA 2X81A 1JKSA 4L7SA 5IEYA 4YHJA 2ZMDA 3W8QA 4DTAA 3EL7A 4NJDA 2VO3A 5BMSA 2XNGA 4ZJIA 4QPAA 3B2TA 2VTAA 1JVPP 3QF9A 4GV1A 4O83A 3S1HA 5EDRA 2ETKA 4BKZA 3V01A 3QFVA 5IZFA 3O7LD 2JKOA 2WZJA 4FT3A 4D2WA 3SVVA 4BIDA 4BTMA 5AAGA 3UMXA 4NFMA 4A9RA 5ANIA 4FJVA 1YQJA 2PMLX 3QGWA 3VS2A 4ZOGA 4BGGA 1SNUA 3ZSIA 2XEYA 3MVHA 4X3FA 4C8BA 2UZVA 3FL4A 5LVOA 3H9OA 4DINA 3AMAA 2C1AA 4ZZMA 5GZ9A 4NIFA 2GQRA 3ZXTA 5GHVA 2YCFA 3CTQA 3VUIA 2R0UA 3F66A 2YERA 3GOPA 2YJRA 1JKKA 1MRVA 3OWKA 3TKHA 5IQCA 4G3DA 4CSVA 4D0XA 1V0PA 3G6HA 3ZO3A 4DG2E 5C9CA 3EH9A 4FIFA 4O1PA 4YMJA 3CQWA 4MYGA 3RPSA 3MV5A 4F63A 3PE1A 4X6QC 5I3RA 2XIKA 4DEAA 4Y8DA 4C61A 2UZNA 3DAKA 3GVUA 3CJGA 2JD5A 2B9HA 3PRFA 3TUDA 5A54A 5E1EA 4IDTA 3S2PA 3RM7A 3AC2A 4FL3A 3SHEA 2X7OA 5TE0A 3IECA 4KSQA 4E5AX 3AQVA 1GOLA 1BMKA 2JIUA 3ZYAA 4RWIA 2ONLC 5DOSA 4K9YA 2BTRA 5FDXA 3EFLA 3VC4A 1FPUA 1KE6A 4AAYA 4AZTA 4OBPA 3B8QA 1R0PA 2F2UA 3HECA 2OBJA 3C4WA 4JAJA 2R0IA 4K2RA 5DT4A 2WQNA 2R3JA 4B4LA 2XMYA 4OTIA 2R4BA 3OOMA 3V5TA 3QQFA 4I94A 5FQDC 2OJ9A 3UVPA 3PIXA 3PWYA 4MKCA 3OT8A 3QUPA 4C7TA 4LGDA 4WNPA 3QTIA 2YCRA 3LQ3A 3BYMA 2H9VA 3L9LA 5IA0A 2YM4A 5M4CA 3NNWA 5I9YA 2PYWA 3TCPA 2QVSE 4JVGA 2HELA 4H1MA 1KUTA 3OOGA 5J79A 3ZUVA 3DXPA 2WFYA 5EHLA 3AT3A 5IISA 4WG5A 5J9YA 5B7VA 5J9ZA 3R8PA 3R28A 3KMWA 3ZRMA 5ICPA 2C0IA 5IQAA 4YBKA 5L2QA 1DAYA 4E73A 2FSTX 1OITA 1PW2A 4IQ6A 4Y95A 4F70A 4R5YA 4YZNA 4AXFA 3UC4A 4QTBA 1JPAA 4X2JA 4C2WA 4DFYA 3V51A 1UA2A 4N6YA 2V5QA 5L8JA 5KMNA 1Z9XA 5CU0A 2C6DA 3WBLA 4PPCA 3II5A 5HVJA 4DGOA 3R01A 5I9ZA 5L4QA 3BYUA 3NX8A 4RX9A 1PF8A 1JBPE 2YAKA 4TY1A 4UZHA 3FAAA 3R30A 3OVVA 4DH3A 5FGKA 4DEEA 3KRLA 4PPAA 3QD0A 2VTOA 2J50A 2JLDA 1VEBA 3R6XA 3SKCA 3W8LA 2Z60A 3ZS5A 4CFXA 2C6EA 4QTEA 5L2WA 2WQOA 5M4UA 4HYUA 3TV6A 5CF4A 3L8XA 3QL8A 4V04A 4PDSA 3N9XA 4DCEA 2CGWA 2ZB0A 1UNGA 4XJ0A 1U54A 2QO9A 1KE9A 4AA0A 4R6VA 4O7TA 4O0SA 2ZFYA 3QQJA 4OTGA 3BEAA 3RI1A 4ITJA 4F64A 2UW0A 1AQ1A 5F1ZA 4GSBA 4MWIA 3VBXA 2GHLA 5AAEA 3UIXA 4AOTA 3MGYA 1IR3A 4U8ZA 2AUHA 3DBEA 3FZSA 3BCEA 3IDCA 4HYSA 4O86A 2WMBA 3B8RA 3GI3A 3LIJA 3OXTA 2BZJA 4FX3A 5ETIA 5HG9A 1M2PA 3H0ZA 1ERKA 2WOUA 3V6RA 4B9DA 4EH9A 5HIBA 3VO3A 3PSCA 2PZ5A 3ORNA 3F69A 4BDFA 2JDSA 4D1XA 4C0TA 4TYJA 5J5TA 3O2MA 4FKSA 4TW9A 2FO0A 3QBNA 4GU6A 5D10A 1OPJA 2B53A 4O22A 4V01A 4Z7GA 2VTMA 3MFSA 4PNIA 1PXJA 5EDPA 4JJRA 1O9UA 3QXPA 1OKVA 3DNEA 2YIYA 3A2CA 3FXXA 1J7UA 3FI4A 3WF5A 5LQFA 4D5KA 4OT6A 4PX6A 1M2QA 3I79A 4F99A 3S4QA 2AC5A 2CCIA 4FZDB 3LMIA 4JQEA 2QHMA 5TT7A 2DQ7X 3FMNA 2YITA 5E8XA 1YXSA 1M2RA 3VJNA 4KABA 4IB3A 5DRDA 4H36A 3U8WA 2WQBA 3QCSA 2Y6OA 4FIJA 5EI2A 4CTCA 4ZTLA 1V0OA 4GG5A 4CZTA 4BCHA 4YTFA 1FGKA 4AXEA 3C4CA 3QGYA 4WRSA 3AD4A 3OZ6A 2UVYA 1H1WA 3ORZA 4UWCA 4FSUA 2Z7LA 4FV4A 4U80A 4EH6A 3QYZA 4QDVA 4UEUA 1VYZA 3FPQA 5IH4A 5CANA 5L2IA 4Z55A 2QG7A 1P14A 4DT8A 3D5XA 4W9XA 4WA9A 2X0OA 1W2FA 2VTLA 3PXZA 4FG8A 3F6XA 3ZM4A 5B2LA 1XR1A 2WTKB 3F7ZA 2YIRA 2WPAA 5JFVA 2XKDA 4TTHB 2IVTA 2P3GX 4IM2A 3ROCA 2ESMA 3DXQA 3M42A 5DEYA 4FRFA 5IQIA 3HAVA 3CR0A 1R0EA 3MN3A 3RAHA 3VS6A 3FHIA 5CI6A 4TNDA 1OIYA 1M17A 4BCIA 2JKMA 4TWNA 2UZWE 2RL5A 3L9MA 3COHA 1XMLA 2HW6A 4IHPA 5CWZA 3UOHA 3LCTA 1JSTA 4JI9A 4TWOA 4KBAA 5DLSA 4L00A 3WYYA 3AC5A 3RGFA 5BUEA 4ZY5A 4HVGA 2PK9A 2F9GA 3L8SA 2E9VA 3Q04A 2PUPA 1YXTA 3PVGA 4BWPA 4CFUA 5KCVA 4C59A 3Q5ZA 3LMGA 4CG9A 2R9SA 4AOJA 2VO0A 1V0BA 3EQIA 3MH3A 1WAKA 5K9IA 4ZK5A 3U55A 2X2MA 2C3KA 4C37A 4ANQA 4OBQA 1KSWA 2HY81 5C01A 3QQHA 2X4FA 3D4QA 3IG7A 4IB0A 1CM8A 2VX0A 2VUWA 3Q53A 3W32A 4DFNA 3CIKA 4CV8A 4XX9A 4OTFA 4FSQA 2PUIA 3Q9WA 4EUTA 4IANA 4ZZNA 2ZV2A 4FV8A 1P5EA 4DYMA 4IWQA 1LUFA 3E7VA 4PDPA 1S9IA 1PHKA 4KRCA 2V62A 1H0VA 4N0SA 5M07A 2PUUA 2G01A 3Q4TA 4RIYB 2VGOA 2O2UA 3DNDA 3UC3A 1ZYCA 2EVAA 2I6LA 4M3QA 4Z3VA 4WUNA 4J8MA 1WBVA 4QEBA 2R3IA 4E5WA 3Q96A 4MQ1A 2CNVA 4Q5EA 5IQEA 2XVDA 3BZ3A 2C4GA 1WVYA 3AMBA 1J91A 3QU0A 4IJ9A 4EK6A 3NGAA 3LCKA 2ZM4A 4O1OA 5BVEA 3MESA 3EQDA 3FLYA 4DEIA 5J9LA 5CALA 2W1CA 2GS7A 3ERKA 4RJ3A 3CGFA 2BRNA 3P79A 4JDJA 1UU3A 4I6LA 2UZOA 3KL8A 4AW0A 4ZTQA 4D9TA 3F2NA 4BB4A 4Z7HA 1KE7A 2IVVA 2O63A 4C57A 3EWHA 3FZOA 3G9NA 2P4IA 3CP9A 5TF9A 5AR4A 3CTHA 5AX9A 3Q2JA 1K3AA 2VWUA 4I6BA 5EHYA 4O7YA 3QUEA 2UV2A 4QTAA 4IZ7A 4XLVA 3OCTA 5HTIA 3UBDA 3BKBA 5CYIA 1REKA 2HZ0A 5IH5A 3VHEA 3WARA 3QYWA 4M0ZA 4E1ZA 1H01A 4EZ7A 2E9PA 5IKWA 3WILA 5JFWA 3QCQA 3UOJA 3KRJA 4NIFB 3VS3A 5F9EA 3BYVA 1STCE 4IX5A 5E8UA 4CXAA 4LQMA 1EH4A 4EHEA 5I9XA 5CVGA 4EHVA 3ZUTA 1XH4A 2Y6MA 3LCDA 4AA5A 3FXWA 4FSZA 4JIAA 4I5MA 3V5JA 2VTIA 4YO6A 3UJGA 2UZUE 1RDQE 5LOHA 3F3VA 4BWXA 2WXVA 2XIRA 3I7CA 4KNBA 4LRMA 2IEWA 3DFCB 4RJ5A 1R39A 4XS2A 1PMUA 3HMPA 3NAYA 2B9JA 3FV8A 2R3KA 4O27B 4OLIA 2X39A 3FQSA 3P86A 3R1SA 3LFFA 4G3GA 4XG8A 4IX4A 3VRYA 2IW8A 4GFGA 5HO8A 4EBWA 3BE2A 3WOWA 4NZWB 3P5JC 3F5GA 2YN8A 1MP8A 2YAAA 3HUBA 3QQUA 4O7VA 5KMIA 4FZ7A 4QYGA 3BI6A 2JDOA 4IBMA 4R77A 1IA9A 4FV1A 4CNHA 4N6ZA 1DM2A 1SVGA 3QA0A 2X2KA 4OUCA 2PSQA 3DJ5A 4AE6A 3U6JA 3LLAA 1YDRE 1Q8YA 3QZIA 2OH4A 5DFPA 1ZXEA 1W98A 5D11A 2IVUA 4BCJA 3BHYA 3DBFA 3E8DA 4GUEA 3WYXA 3DFAA 4G3EA 3ALOA 3C7QA 4D2TA 4ZAUA 3OCBA 5CSVA 1XO2B 4AGUA 5HICA 4QPSA 4JG8A 4RLLA 3COKA 2R3PA 3S95A 3QLGA 1IG1A 4QMVA 1IASA 3UZTA 3COMA 4LUDA 1U5QA 3RZBA 4GG7A 1P4OA 4JDIA 3TKUA 4IJPA 4H39A 5I3OA 3V3VA 3FBVA 4JQ8A 3ZLXA 3L9PA 1Y57A 4EYMA 4F7JA 2BDJA 2HOGA 2NO3A 1A06A 4CFMA 4F0GA 3RAWA 1UWJA 3KEXA 3JVRA 2C30A 4A07A 1REJA 5EYKA 5F20A 2BILB 4G3CA 5CQWA 2H34A 2F49A 4DEHA 2QR7A 3R9DA 2ZOQA 2IWIA 2XNBA 3MB7A 4O4DA 1ST4A 5JZNA 3TIZA 3SA0A 2A4LA 1NT2A 4JBOA 3UDBA 5JFSA 2ITXA 2HENA 5HOAA 2B0QA 2GNHA 2PVNA 3ZDUA 5L6PA 2RFEA 5AP5A 2XCHA 4AX8A 4AZFA 5JQ5A 4XG2A 3FC2A 2XAOA 4KIKB 1ZYSA 1W2DA 4O4BB 4XV3A 5HLNA 3A8WA 3C5IA 5M08A 2UZBA 4GK2A 2X0GA 4L52A 1O6YA 3EZRA 1ZY4A 5ACBC 5IDPA 3I1AA 4H1JA 3DK6A 1E1XA 4FTTA 5HX6A 4I21A 3TZ7A 3U4UA 1H1SA 2BIYA 2X1NA 4DLJA 5IA2A 3N4VA 4EOQA 2X7GA 1OIUA 4FSNA 4L43A 4RJ7A 4DGMA 1NVRA 2A0CX 3AMYA 3KXGA 3TV7A 1Q8ZA 4FOBA 4LL5A 4IVDA 1PXNA 4A9TA 2P0CA 4AQKA 1QL6A 2BAKA 4EHGA 4F9CA 3TL8A 5FUTA 2X2LA 2J5EA 5CAUA 3MBLA 2YHVA 2PE2A 4DG0E 4YR8A 4RG0A 3P78A 2Z02A 4FT9A 5IEVA 5AADA 4C62A 2VTPA 4PF4A 3HRCA 3R2YA 5CXZA 3W0RA 4AXDA 2Q0NA 3M1SA 4FUXA 3R7IA 3SG9A 1DS5A 3UIMA 2I40A 4ZTMA 2BPMA 2YCSA 4YU2A 4RWJA 1XBCA 3FY2A 3PXYA 4ZSEA 3ZMMA 3QTZA 1BUHA 2AYPA 5K5XA 1ZYDA 3MDYA 4QP9A 3PFQA 2I7QA 4ASZA 3E92A 4BI0A 2QOCA 3GP0A 2B54A 4MTAA 2GFCA 5KE0A 4H3BA 4W4XA 2PWLA 5BYZA 5AV2A 3D0EA 4GKHA 4O6EA 5GIOE 5IMXA 2IG7A 2HWOA 2PZIA 3VW8A 4AN2A 3NS9A 4YZ9A 3TNWA 5CEKA 5I5ZA 2C6IA 3C51A 4H3PA 3AC4A 3WIGA 3HV4A 3F5PA 3QX4A 1H25A 3LFSA 3UQFA 2ERZE 2XBJA 4Q9SA 3V8WA 4QT1A 5KZ0A 4F6UA 1J3HA 4XUFA 4YJUA 2XA4A 3F3UA 3ZBXA 3BYSA 3NWWA 3ORPA 1NVSA 5K3YA 2B52A 3V6SA 2R7BA 4JNWA 4LV7A 3OWJA 4KS8A 5HCYA 3QRKA 4YTHA 3BQCA 4O7RA 4F1MA 4JBQA 5DT3A 3W2OA 2G9XA 3MFTA 4FICA 4O0TA 3HVCA 4I92A 5L6OA 2BKZA 4IACA 4D2SA 3RAIA 3UVQA 2QU5A 3AC8A 2HZIA 4X21A 3KCKA 3WZKA 3CPCA 1H07A 4O0YA 3SOCA 5IUHA 4FKUA 4PTEA 4I4EA 4LV5A 3SW7A 2YIWA 3EQRA 3GENA 1PKDA 1WBOA 3H4JA 4O96A 3VNTA 5ANJA 4C4FA 3MPMA 4BIEA 3SRVB 4BDJA 3MIAA 2R5TA 4GJ3A 2UW9A 3MJ1A 3I6WA 4JRVA 3UDSA 1UKHA 3ZO2A 3BU6A 4WD5A 4EJNA 5BUJA 2C5OA 1OKWA 4ACMA 1Y6AA 2IW6A 5EOBA 5AFVA 3LCSA 3QC9A 4W9WA 5JRQA 3SD0A 3KRWA 3R71A 1YI4A 4M12A 4MXAA 2BRMA 2BROA 3DKCA 3D5VA 4C4IA 3F2AA 4WSYA 2A98A 4O0WA 3SOAA 3MPTA 4I22A 3QQGA 4RFYA 4LUEA 2YLFA 2OJGA 3RALA 1PXOA 3GU6A 4NW5A 2EB3A 5AUVA 2X9FA 3VHKA 3WZEA 2HK5A 2H8HA 4KB8A 4DHZA 2Y7JA 2R3RA 4FTNA 4NKSA 4D4SA 5IDNA 4O0XA 4QTCA 5KMJA 4FKLA 1OGYA 4FEWA 4J97A 4U44A 2WMSA 2JFLA 3MVLA 4IDVA 4CZYB 2CKPA 4NYEA 3LFNA 5HI2A 3PSDA 2JAMA 3W1FA 1XHAA 3D7TA 4IMYA 2A19B 3ZC5A 2E9UA 3AC3A 4DHFA 3A7JA 3FKNA 4FV2A 4C4HA 1YKRA 4XG9A 4O38A 1YDSE 3FQEA 1YDTE 1XWSA 3Q6UA 3E88A 4D4RA 3R7EA 3R04A 4PL5A 4F7LA 2XJ2A 3OY3A 4F9YA 1H27A 3DLZA 3LW0A 3Q32A 3RPOA 4WNKA 4DF3A 4D28A 2F4JA 3PIZA 2H96A 5HG5A 4O81A 3O7LB 1KV1A 2A2AA 1XKKA 2WQMA 4J71A 4BFMA 2G1TA 2EXEA 3REPA 3OBGA 4YNOA 4AP7A 4AT5A 4CD0A 2VZ6A 4AW5A 4QP2A 1Q8WA 2YA9A 4GYIA 3ZSHA 4EC9A 3KN6A 3OEZA 5C4LA 5F94A 2R3LA 5KZIA 3W18A 1PMVA 4XHKB 2UZTA 1OIQA 3DBCA 5E8ZA 2Y8OA 4RX8A 5KKRC 3NUYA 5AX3A 2WHBA 4UMTA 2O5KA 3QQLA 2BFYA 4FKRA 1TQPA 4B99A 4WOVA 4AZVA 5JGAA 4ZSAA 2ZJWA 1ZOEA 5TOZA 5DRBA 3D14A 3OUNB 4RWKA 1YWVA 3GU5A 3TT0A 5M4FA 1UU8A 3E93A 3ZFMA 2X0PA 1TKIA 1ZMUA 1PY5A 5FXQA 2WB8A 4MXYA 4RWLA 2PTKA 3EFJA 4DEBA 4FV0A 3ORKA 5HORA 2PVHA 4O4EA 3RZFA 1WBPA 2WTDA 5HG7A 3RHXA 1J7IA 2YISA 4Q2AA 5KBRA 3NCZA 4TYGA 5JEBA 4CZUA 5ANDA 2C1BA 4EZ3A 1XH5A 3OT3A 5HIEA 4FTJA 3UG1A 3PUFC 5FM2A 4AZEA 2WMTA 2GHGA 3EN9A 5ANGA 3HKOA 4IAKA 3RNIA 2C6LA 4GK4A 3PLAE 4XV1A 4RIYA 3ZM9A 3G6GA 4H3QA 3SX9A 2VNWA 4BDGA 4F08A 3HDMA 3PDTA 2O3PA 4AXCA 4IFCA 5A9UA 5LMAA 1KWPA 3ALNA 5L3AA 3IDPA 3NYXA 4KKGA 4WG4A 3PY0A 3FYKX 4GEOA 5FRIA 3HV7A 5C03A 2HZ4A 3ORTA 2YIQA 2E9OA 5IU2A 5EHOA 1QPJA 4UWBA 3UNKA 1OM1A 3GCPA 4KRDA 4IX3A 4TPTA 1OGUA 4RBLA 5ETCA 4F9BA 3AG9A 2R7IA 5JK3A 5AR5A 2OFVA 2QKWB 2VO7A 2BAJA 3HP5A 4L9IA 4MVFA 4AWIA 2JKKA 5AP6A 5M55A 3R8VA 3TXOA 3H30A 5D7VA 5IQHA 4IWDA 1FMOE 4BDEA 1U5RA 2QD9A 1ZZ2A 4FBXA 4B6LA 3BLAA 4ITHA 3OCSA 4DGGA 4MQ2A 4C4EA 4EH4A 4UN0C 3KQ7A 4W4YA 3FKLA 2O64A 2W5AA 3LPBA 3LFDA 3WF6A 1W7HA 3HP2A 3GB2A 3MPAA 2XS0A 4QP8A 3A7HA 1RE8A 3EFWA 3DBQA 2JGZA 4HJOA 5DWRA 4JS8A 3NVMB 3ROYA 4BBFA 3T3VA 3LJ0A 3QD2B 4IH8A 5HE3A 1P4FA 2CPKE 4FV3A 3RCDA 4FEUA 4C58A 3A99A 4ZJJA 1WFCA 3I81A 1ST0A 4L8MA 3ZDIA 5A14A 3U6IA 4PP7A 2GTNA 4RLKA 5FTQA 2BUJA 3R7OA 4ACHA 5TR6A 1OKYA 4DFZE 4HGSA 4RVLA 4U43A 3ZFXA 2BHEA 2BZKB 4EONA 2HW7A 4XG3A 4DDGA 4G6NA 2IF8A 5CEMA 4ZSLA 3TM0A 3W55A 2W4KA 2C5XA 3VBQA 3KN5A 3QC4A 2XK6A 2BMCA 4QO9A 2W1DA 2YCQA 3KU2A 3R8MA 3F82A 3AGLA 3UIUA 1H26A 4PL4A 3QXOA 3LJ1A 1GZKA 4CVAA 4CQEA 3IW7A 4ANSA 5DR9A 1BLXA 2ITPA 4LGHA 2F57A 2XZSA 3QRIA 4EQMA 1YI6A 2C6KA 2O8YA 2HXQA 4EWQA 1Q8UA 5HU9A 1YHSA 4F6WA 4JG6A 4BDHA 3R8LA 1Y91A 4WSQA 3BV2A 3PJCA 4HCTA 4QPMA 4DH5A 2CGXA 4R3RA 4JMQA 5J1VA 4O82A 4PMTA 1M52A 4X2GA 3ULZA 5BQ0A 2XBAA 3PP0A 2OZOA 4HNIA 4RFZA 3ID6C 4YC3A 4ALVA 3MH1A 4CFNA 4PP9A 1ZOHA 2BVAA 4O7NA 3OTUA 3DZQA 4I41A 3R9OA 3FZPA 1IA8A 4M7IA 4HVDA 1Y6BA 2FB8A 4G16A 4C3FA 4IAZA 4G5JA 1SVHA 4PMMA 3RVGA 3ZONA 4ANMA 2QNJA 2XNPA 4E3CA 5M57A 4QMXA 4CFVA 4YJSA 4MNEB 3VBVA 3PPJA 3A7GA 3IK3A 3SV0A 3CQEA 3VUMA 1MQ4A 3LQ8A 4IZAA 5KO1A 3KXXA 4I3ZA 2C5NA 2VGPA 3EN7A 5M53A 4BCGA 5KX8A 4FSTA 3O51A 4YPDA 3S0OA 4NCTC 3ZBFA 4XBUA 5DPVA 5E8SA 3LFBA 3LXKA 3NAXA 4FIIA 3KVXA 5M51A 4RZWA 5FP6A 4XOYA 2WMVA 3I6UA 2R3GA 5AUTA 3MVMA 4IADA 3I4BA 4IWPA 3CCNA 4XG6A 4DG3E 3E3PA 3KRRA 3PA4A 2OICA 2NP8A 5DE2A 3OC1A 3IDBA 3JPVA 1K9AA 3ANQA 4KIOA 4KIKA 4A9SA 5IG1A 3QZHA 1OL5A 4BI1A 1FGIA 2O0UA 1NXKA 4IVAA 3UQCA 5E4HA 2XIZA 4BGQA 5JH6A 1NY3A 5AIRA 4E4NA 4DFBA 4C34A 4GFMA 2C5VA 3F3WA 4YBJA 3VWAA 1RW8A 4D4YA 2WNTA 5AP0A 3NLBA 4R1YA 3OROA 4F9WA 4I4FA 2PE1A 3LM0A 3TWJA 4PL3A 5HNIX 4U0IA 2RG5A 4QYEA 2QC6A 4U3ZA 5E8YA 4XRJA 1A9UA 4JL9A 4K8AA 3UO4A 3FY0A 2ZV9A 4X0MA 1GIHA 1ZMWA 4D2VA 5JQ8A 3FQHA 4IFGA 4IC7A 4XG7A 1OMWA 2R3QA 3PXRA 4DA5A 3IO7A 3ZEWA 4UALA 3HEGA 3Q4UA 4PDYA 2RGPA 3AD5A 2X8EA 2ETMA 2WELA 4EOMA 3QWJA 5FM3A 4LG4A 4QMOA 4QMWA 3V5LA 2VWVA 3P7BA 5D12A 3CC6A 2Z2WA 4FK3A 3OTVA 4QNAA 4IWOA 3UGCA 3C1XA 3HYHA 5A4CA 2JDTA 4PTCA 3WIKA 3UNZA 4BZNA 2OKRA 3KKVA 5L2TA 3TUCA 4I20A 3VUDA 2IJMA 2QONA 1Q4LA 2BRBA 4BZOA 3LFCA 4EH7A 3W0NA 4J95A 2CHLA 2V22A 3QRUA 4GMYA 1X8BA 2XALA 3UOLA 4ANNA 3AKKA 3P4KA 2XIYA 3W0SA 4DBXA 2CCHA 3VVHA 3ULIA 5KMLA 1FBNA 4FC0A 4FSMA 2CGVA 2UZLA 3OCGA 4HNFA 4NKAA 1B39A 4O0VA 4AT3A 2JC6A 3P5KA 4M66A 3A4PA 5CTPA 4BCKA 2QODA 5AM6A 4DGNA 4EWHA 4LRJA 4YHTA 2OGVA 5CF5A 5M06A 3D83A 3R9HA 4IB5A 4O7SA 3HX4A 5EQPA 3Q4CA 4R5SA 2YZLA 1P2AA 2VTQA 4X3JA 5HVKA 2ZDUA 3ZHPC 3D7TB 3ZRKA 2VWXA 5DYJA 2OSCA 2CLXA 3P0MA 4KWPA 4GT5A 2WTJA 2VX1A 3QRJA 4M69B 1XH8A 4XLIA 3SQQA 1APME 3PXKA 3DJ6A 4KBCA 3QKLA 3RK9A 3CD3A 2R3NA 3Q3BA 5CQUA 2QHNA 5BVWA 2R3FA 3PVBA 3FLZA 2GPHA 3WF8A 4R7BA 3JY9A 4C4GA 4IAYA 4O84A 3R9RA 4F7NA 1LEWA 3SRVA 3VBWA 4AGCA 5JRSA 3R7GA 2ONLA 3QA8A 3K3JA 4R7HA 5CLPA 4GU9A 1KOBA 3TJDA 3DPKA 2EU9A 3EJ1A 3D7ZA 1Q3WA 5JT2A 2OLCA 3C0IA 3RPVA 3ZLYA 4D2RA 3DT1A 1OKZA 4X7QA 3R1YA 5EG3A 4FA2A 5LWMA 2XH5A 4FZ6A 4BDIA 3DDQA 2BDFA 2HIWA 3HDNA 5JKGA 5AP4A 4FKIA 3E62A 4IM0A 2Q83A 4O7LA 4UMQA 1UV5A 4ALUA 4BL1A 3GU8A 3R0TA 3FJQE 3QTXA 4L3PA 3OEFX 3FZ1A 3G9LX 3KXMA 3R2BA 4FIHA 5HD4A 4J8NA 5BNJA 2A27A 2XK8A 4ZZOA 2CNUA 4U7ZA 3KMMA 4QQTA 4DN5A 4TL0A 4QOXA 3VQHA 3SGCA 4NK9A 2GQGA 3SAYA 5EQEA 3C4EA 3H10A 4NU1A 3UYTA 1OECA 3ACJA 3DK3A 4WRGA 2PL0A 1ZRZA 3C0GA 3QAME 1JQHA 4I6QA 3V8TA 3AKJA 4F1TA 3CXWA 5DR2A 4NWMA 3NFFB 4IEBA 3TN8A 4YTCA 4GRBA 3ITZA 2XCKA 2W06A 4F4PA 3K5VA 1OL1A 3NCGA 3PZEA 3PG1A 4FKOA 4O4FA 3WE4A 3NW7A 4YZDA 4O0RA 3DB6A 3VAPA 4OAUC 2IO6A 5FXSA 1LPUA 4E4LA 1BI8A 4NJ3A 3RPRA 3GOKA 4ID7A 5HZNA 5FTGA 5A4EA 2X8DA 1FINA 5IQDA 3BEGA 3OF0A 3EYGA 3DV3A 3LJ2A 3FKOA 2XRWA 4NFNA 2XK7A 3MFRA 2C6MA 2VN9A 3C13A 4K0YA 3W2RA 4AGWA 3UDZA 1KOAA 3FHRA 5CEOA 3OW4A 4FV9A 1FMKA 3HV6A 3PXQA 4JRNA 3FMKA 1YWNA 4AAAA 2RFSA 4CMUA 2BRHA 3I0OA 4NM0A <