4YP8A

Irak4-inhibitor co-structure
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
296
structure length
284
Chain Sequence
RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLATTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Potent and Selective Amidopyrazole Inhibitors of IRAK4 That Are Efficacious in a Rodent Model of Inflammation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 103
structure length 284
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yp8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yp8A01
3NVKI 1OI9A 3DU8A 3F2AA 3UQCA 5JH6A 4QRCA 4FTCA 2UW4A 3PJCA 4AGDA 2G01A 3DDPA 4QMVA 3OROA 3U8WA 2I0YA 4C4HA 4JDJA 5ETAA 2PWLA 4DLJA 4C2WA 5CEIA 4PRJA 5HU9A 4CEGA 2WMTA 3IW7A 3JS2A 4QMSA 5FDPA 4I3ZA 3SKCA 2IVTA 5LCKA 5BPYA 2C6IA 4I92A 3BBTB 3A7FA 2Y7JA 3WOWA 4GKIA 2XVDA 5ACKA 3U54A 2YERA 4I6BA 4MK0A 5A6OA 3UO5A 4IZYA 5M55A 4LL5A 5KMIA 1O6YA 2C69A 3MVHA 4G9CA 4E7WA 2OH4A 3G6GA 5GZ9A 4AUAA 4EH3A 2OFVA 3A62A 1T45A 4F64A 4FV0A 5ANIA 4CCUA 4R7IA 4J52A 2QR8A 4KAOA 3FHRA 1XBCA 3I4BA 3GC8A 4QTBA 4Q9ZA 3IOKA 5LVOA 3FMHA 4DEAA 1YXTA 3MFRA 4AFJA 1DS5A 1OL1A 4O0TA 4AT4A 3LXLA 2ITQA 2O3PA 1YW2A 3E5AA 5FBOA 3AD4A 4BWKA 1X8BA 1UNHA 2VWUA 3GGFA 1WAKA 3R7IA 3WF6A 4EKLA 4L00A 5C1QB 2YIQA 4EBVA 2XNOA 2H6DA 3A4PA 3BYSA 5DA3A 3VWAA 1OIQA 5EKOA 2DWBA 5JQ8A 5ANGA 3HMIA 3RK7A 3DKCA 3GCVA 4EOQA 3E88A 4LOPA 2BDJA 4ZSEA 5I3OA 4YURA 4UMTA 3BHTA 4JT3A 4DEDA 5J5TA 2OBJA 5CVFA 3NCZA 4BBFA 5EI2A 2WU6A 5I9UA 2OO8X 2YZLA 1L3RE 3FQSA 3R8MA 4RJ6A 5BVEA 4D2SA 1W83A 1L8TA 2CNQA 2HZ4A 2PYWA 3GU8A 5ANEA 1PMVA 3L9NA 2V55A 3QRJA 2YAKA 2XMYA 3NWWA 1XBBA 4J8MA 4YZCA 5DR2A 4F1OA 3AC8A 2FO0A 3FI4A 3LFDA 4LFIA 2XNMA 5GNKA 1ERKA 2JKKA 3EH9A 4GT3A 5A4CA 4FKPA 4P4CA 3IKAA 5BVDA 3UIXA 5KMNA 4ZSAA 4DTKA 2YM8A 4L53A 4EWHA 3ZEPA 3ERKA 2AUHA 5IKWA 4Y8DA 5CAQA 4ENYA 4EZ3A 3C5IA 1PMNA 1M14A 4RX9A 4RIYA 1W8CA 3FZOA 3UC3A 4CV9A 5AP7A 2QOOA 4BWXA 1Q8UA 4CV8A 3ID6C 1GZ8A 3NMUF 1V0OA 1J3HA 1ZRZA 3VJNA 3FZTA 4BKYA 3SXSA 3ZSIA 5L2WA 5JK3A 5E8XA 4AGUA 4PDYA 3R01A 4FUYA 5CSHA 4DEBA 2C6KA 2ITNA 2OWBA 3VF9A 5J79A 2EUFB 4G6LA 4Z3VA 1LEWA 4MF1A 2XA4A 5C8MA 4CLJA 5I9ZA 2XIXA 4OTRA 4EQCA 3NUUA 4FVPA 3G90X 4GV1A 4QNYA 4CTCA 1OPKA 2XEYA 3R8UA 4O7ZA 3R2YA 1BKXA 2HENA 3V01A 5IH5A 5A4QA 3HEGA 5FD2A 3C4FA 3BI6A 3SLSA 3VQUA 2FYSA 3UNKA 2HXQA 4V01A 5AR4A 2ITUA 3H9RA 3II5A 2CGWA 3SV0A 4FA2A 2ONLA 3QYZA 3EKKA 4CZUA 1XH9A 3RP9A 2C3JA 4A07A 4BI0A 1U4DA 4RJ3A 4CGAA 4YBKA 2X2LA 3FSKA 4X2FA 4FTIA 2Q83A 4YU2A 1SNXA 3BEGA 4L43A 4JXFA 4O2ZA 3QF9A 3SX9A 4EUTA 5GZ8A 1JVPP 4ZZMA 4GU9A 5GJFA 2BVAA 2E9UA 2IW6A 4HGSA 5E91A 3R9OA 5F1ZA 2HOGA 1YOJA 5JQ5A 3NPCA 3ZDUA 2BHHA 4C4IA 1KWPA 1OPLA 3AC3A 4IAKA 1VJYA 4FKLA 4MNEA 4CMTA 1YXUA 2W4KA 3LOKA 5BYZA 2GPHA 5KMJA 3ZUTA 3EMGA 3FLSA 3MA3A 4KS8A 5M4FA 5FXRA 2XKEA 3ORPA 5L4QA 3LJ2A 5H8EA 3H9FA 4MNEB 4HPUE 4ZTRA 4EHZA 2QOHA 5A3XA 1NY3A 3FMEA 5K0KA 3WE4A 4OW8A 5L6PA 1VYZA 2RFSA 4UV0A 3R9RA 1LP4A 2IJMA 4GUEA 3EN4A 3ORXA 1Q3WA 3R7YA 4F4PA 2LAVA 2HXLA 5JT2A 3PPZA 4M15A 5E4HA 2VO0A 2XRUA 4EOSA 1IRKA 1W7HA 3MFUA 4BTKA 5CXHA 4EOPA 5B2LA 3VC4A 2VTPA 3F82A 3KCFA 3IOPA 3L9LA 2B9JA 5TF9A 3PXFA 2X7FA 3I0OA 2O2UA 4RBLA 3OBGA 4TKSA 4E4MA 2UW9A 4HVHA 3U9NA 5DT0A 4IX5A 3D5XA 2ETMA 3OMVA 3QQJA 3UJGA 1ZWSA 3C4CA 4CVAA 3EJ1A 3R00A 4ZAUA 2ZV2A 2VWWA 4ZS4A 2XCHA 2AC3A 3EN7A 4QP8A 4EH9A 4NEUA 3OEFX 4R5YA 1CKJA 3UPXA 5L2QA 4M12A 2BRHA 3COKA 3V5JA 4FTMA 4L3LA 2Y4IC 2VUWA 4NWMA 5TKDA 1NVRA 4LOQA 5GJDA 3UVRA 3VUGA 1Q4LA 1Q8ZA 5BUEA 2WMUA 5BQ0A 4APCA 2IVVA 4FGRA 3H0YA 3DQWA 2XM8A 2A19B 1R0PA 2X39A 4FV7A 3TZ9A 4IANA 3AOXA 4AZTA 4C36A 2UZTA 4L7SA 3R7GA 4PMTA 4EUUA 2OFUA 4RZVA 4ANLA 5CF8A 2OW3A 2BILB 2F7EE 3KQ7A 4L46A 3MTFA 3P7BA 3QC4A 5DG5A 4DF3A 2GNIA 1JAMA 3C13A 5GJGA 3PFQA 1M2QA 3RTPA 3CBLA 4BDFA 4QPAA 3PIZA 1XKKA 5E1SA 5HQ0A 4FKUA 4WBBB 2IW9A 4A4XA 3HZTA 2H34A 1XH8A 3QTSA 4U0IA 5H8GA 2C5YA 5IQEA 1LEZA 3MDYA 4QQJA 4O7WA 4HCVA 1UWHA 1G8SA 2CLQA 4BZNA 2EB3A 3PVUA 3UODA 4S30A 1M7NA 3ZC5A 4H1JA 2ERZE 3FEGA 3LPBA 4PL4A 5CEQA 5CEPA 4DFBA 1O9UA 5EM7A 2YABA 3TIZA 2X7OA 4Z7HA 5EHYA 4YO4A 4G3EA 4C37A 4D1XA 2IZSA 1PXPA 2W99B 1MRUA 2CKPA 3GCUA 3DTWA 3VBWA 3AC2A 4V0GA 3HUCA 2JAVA 5KKRB 2R7IA 4RIWB 3ANRA 3HVCA 4JNWA 4GVAA 5HBEA 5H3QA 2JLDA 4WIHA 5AR8A 2I40A 3TCPA 2E9PA 4EWQA 2C1BA 5LJJA 4DFLA 5CF6A 4GG7A 4HYIA 4CKJA 3I6UA 4LYNA 4X6QC 3VUHA 3ZLWA 2OG8A 1P4OA 3QD0A 4TXCA 4DFZE 4AN2A 3TJCA 2HIWA 2FSOX 3QA8A 4MCVA 4ACMA 2ZV7A 2QODA 2BAKA 4FKIA 4QYFA 4RJ8A 4DYMA 3FMMA 5HTCA 5JEBA 5L2TA 1G3NA 3KVWA 5L6WL 3VUTA 3V5TA 4HOKA 4IQ6A 2CNVA 3FKNA 4EJ7A 3TEIA 3D7TB 4D9TA 5IA0A 2QO7A 2X7GA 4IZAA 2OF4A 2WGJA 4BKJA 2R3GA 3ALNA 3UZPA 4BCMA 2GNGA 4UMRA 5JGDA 4E4XA 2EU9A 5DEWA 1YWRA 4ALVA 3BYVA 5JN2A 2BTRA 1OIRA 4C8BA 1XH4A 3QX2A 2R3QA 5A46A 1LUFA 3ODYX 4GFOA 4GYGA 3FPQA 4KIQA 4BDGA 1G8AA 4KB8A 4R3PA 2BCJA 4UYAA 4YHJA 2QO2A 2VTLA 4F7JA 3HV3A 3R8PA 2VO6A 5IQHA 3QQHA 1GZOA 3R7UA 4D58A 3S1HA 4QPMA 4L67A 3I1AA 1J7UA 1JSUA 1T46A 5I5ZA 4FTRA 2B0QA 4O7YA 2OIQA 1ZYSA 4QMUA 2BTSA 4EHVA 4FIGA 4N57A 1Q8TA 2E9NA 4BZOA 1MRYA 5EDRA 1Z5MA 5IA1A 1QL6A 1FVTA 4HGTA 5EDQA 3R28A 2ZM4A 3FLYA 2REIA 3TUCA 4PL5A 2NPQA 4WD5A 3EIDA 4FSMA 1UWJA 1M2RA 4XV9A 1IA8A 4F0FA 5L2SA 2JDOA 3MPTA 3AMYA 2ITOA 4D2TA 4Z16A 5I0BA 4I0RA 3BIZA 4F65A 5AX9A 3FMDA 3PJ1A 3E63A 4MXAA 3KULB 2F7XE 3O7LD 2X6DA 4D55A 4DEIA 2YISA 4PPBA 2A2AA 4AWIA 2WZJA 2GS6A 2XF0A 3TL8A 2BPMA 2ITXA 4XV3A 5D10A 4IX4A 4E93A 4WG5A 2YM4A 1YDSE 3MIAA 4ZLOA 2FA2A 3SDJA 4PUZA 4DGOA 3V04A 2XK3A 1HCKA 4YP8A 1W98A 3F3UA 3I81A 3LCSA 4ITJA 5HNBA 2HZNA 2VV9A 3A60A 4RX8A 5DRDA 2PUPA 3NAYA 3NRMA 3DAJA 3HKOA 3RINA 3WZDA 2GNJA 2JIUA 3LM0A 3EHAA 4RZWA 3KL8A 4IJ9A 4XX9A 4BCKA 2P3GX 5CU0A 1YWNA 5CF4A 4DC2A 2YIYA 4AACA 2YJSA 4IAYA 3QHWA 3DZOA 4D2VA 2R3OA 4O91A 5AP3A 4PNKA 5CAPA 3AD5A 5HG7A 3OWJA 4Y83A 2X8EA 3PPKA 1UU8A 3FY0A 2C3LA 4AA4A 3NUAA 2XYUA 4R6VA 5H8BA 1ZAOA 2PE0A 2JKOA 5C4KA 3LCDA 3R7VA 2IZRA 4OBQA 3FZ1A 3GC9A 3OXZA 3QFVA 3RCJA 3TZ8A 5J7BA 2JGZA 4LMNA 2P33A 4XP0A 4Y95A 3U9CA 2BRGA 2Y8OA 4X21A 4NSTA 5FTOA 1FINA 2KTYA 5DNRA 4YZNA 3SAYA 4EC9A 4O7LA 2FUMA 1REJA 4NM0A 4QQ5A 3FSFA 3GU5A 3PLSA 3RHXA 4QMNA 5EKNA 3W2RA 4RVLA 5BNJA 4DGMA 2C6LA 2R3IA 2B9FA 3Q6WA 1JQHA 4GEOA 4EOLA 5AR5A 2Z60A 2OXXA 2XJ2A 3BU3A 3GU7A 4UBAA 2B1PA 1Q8WA 2WELA 5AV2A 5A14A 3TUBA 2VD5A 3MY0A 5CI7A 3ZUVA 4F7SA 4TYHA 1YHWA 1YXVA 3HV4A 2C5XA 1H07A 1AGWA 2UZEA 3CY3A 5M4UA 4S32A 4O0WA 5LMKC 4QO9A 4AOTA 3A7JA 3DB6A 3VBQA 5EYCA 5EM8A 2Y4PA 3ZFXA 2ZAZA 3NEWA 3SRVB 4YTHA 4XBUA 2J51A 2WTCA 3NX8A 2UW3A 2XIKA 3MFTA 5E8SA 3ZM4A 2W4JA 4I94A 4WRGA 5HLPA 2WXVA 1KV1A 2ITWA 2WQNA 3G33A 3ORTA 4ZMFA 3WE8A 4C02A 3S00A 3U6IA 2OZOA 3VHKA 3EB0A 3LXNA 5EI8A 4K33A 3FYKX 3R1QA 3NCGA 4I4FA 5HIBA 5JRQA 3GFWA 1YKRA 3EL7A 3V5PA 3FZRA 2HY0A 3OTUA 3R02A 2CN8A 4B8LA 2BMCA 2RKUA 3C4WA 3QZIA 4DAWA 4U80A 3BHVA 1M2PA 3NIEA 2VTSA 3OCGA 1E1VA 3I7CA 5J87A 4JAJA 4G31A 5BYYA 5KUPA 5IEYA 1V0PA 2OJFE 2Z7SA 2W1ZA 1BYGA 4TYIA 5CWZA 3FJQE 4FSNA 5EDPA 2BZKB 5EW8A 2R3HA 5FXQA 5JZJA 2YM3A 3MH0A 5M08A 2J7TA 2F9GA 1URWA 5HO7A 3I6WA 4CRLA 2J6MA 4BL1A 3QA0A 3NLBA 3WZUA 4D4SA 3HGKA 1YWVA 4U43A 2RGPA 4DN5A 4JR3A 4M0YA 4TT7A 3IQ7A 5K5NA 3MB7A 2W17A 1MQBA 3UQFA 3DJ7A 4O0XA 3UIBA 3OWLA 3D2KA 2X2KA 5K3YA 3R7EA 3VUDA 2WTWA 5IA2A 5IDPA 3V8TA 1KE7A 1UVRA 5GHVA 3DK7A 4YSJA 5JKGA 4EL9A 4I5PA 4FK3A 5DIAA 2GMXA 4UWBA 4P90A 3COIA 4AFEA 4CG9A 3FMKA 4C4JA 5FTQA 4OTDA 3AQVA 3H9OA 2C5VA 2FB8A 2VTOA 3MY5A 4K2RA 3UVQA 5KKRC 3K3IA 4MQ2A 4L3JA 4BDDA 4RWKA 5FRIA 2XIYA 4ACGA 2Z7LA 4KRCA 1SMHA 4JOAA 4XLVA 4C3RA 1WBPA 4OT5A 3QQUA 4XUFA 4BI1A 3P86A 3D15A 4YNEA 4RVMA 2Z02A 2WQEA 4RWJA 2VRXA 5ACBC 4ANSA 3KMUA 4BZDA 4KIOA 5FXSA 3W2PA 5C4LA 2XH5A 4I23A 5IQAA 1ZMVA 2EXCX 4E6AA 1OUYA 2KULA 3PUPA 3PTGA 5JSMA 2BRNA 3PPJA 2YCFA 4OTPA 4O1OA 2WMBA 3LCTA 3QCYA 4BVUA 3CD3A 3RNIA 3RPOA 5J9ZA 2HWOA 3PSCA 3POZA 3QD4A 3DNDA 4CTBA 3R8ZA 1YOMA 3ZFMA 3UYTA 2YCQA 3TV6A 4QMQA 5F94A 5FWKK 3FMLA 4GH2A 4GW8A 4NKSA 4ANNA 1IASA 4CYIA 3ZDIA 4OBOA 1OBDA 3AC4A 3PLAE 4QP7A 2VZ6A 3WARA 2H96A 3LMGA 3NZ0A 3C4EA 3FLQA 5TT7A 5TOZA 5HG8A 4D4YA 4G16A 5C03A 3ZLSA 3MV5A 4JQ8A 5E8WA 1KSWA 1SVEA 2CCIA 4X2JA 5FEEA 4MAOA 4ZY4A 2W1GA 4HYHA 3BBWA 4ARKA 3AC5A 3B8RA 4EZ5A 2VAGA 3JVSA 3A8WA 1R39A 2PMIA 4F99A 4BR3A 4Q9SA 4EEVA 3LJ1A 2QURA 3QQFA 3LAUA 4XH6A 2VN9A 1QCFA 4BHNA 2UZUE 3MPAA 5D12A 2UZVA 3DV3A 5E8TA 3JY9A 4QMMA 4L6QA 3HV7A 4ANOA 1Q41A 1ZYLA 5KO1A 4IW0A 2V5QA 3FL4A 5KCVA 2XJ1A 3DDQA 1OL7A 2PVKA 4RFYA 3WIKA 4BCOA 4DFNA 4IM0A 1E9HA 4ZZNA 5CALA 5CX9A 3TM0A 3F2RA 3R71A 2IN6A 4ID7A 4BTFA 1DI9A 2C0TA 3A2CA 2UZLA 4YJRA 4E3CA 3LFNA 4AX8A 5T6KA 3ATSA 2BRBA 4FZAB 3MVJA 2JFMA 2I0VA 2QLUA 4HGEA 3BLRA 2HZ0A 4ZJVA 3TNQB 3D4QA 3LFBA 2C0OA 3RPVA 3V6RA 4Z9LA 4UB7A 5HIEA 5HU3A 3PYYA 4R77A 4UX9A 2C47A 3CPCA 4AE6A 4HW7A 4DA5A 4ASXA 1YI6A 1GAGA 5EOLA 3OHTA 4NT4A 4HNIA 1ND4A 5F9EA 1OBGA 4YJPA 4EHEA 4MXZA 3C0GA 2JITA 4FICA 3DLZA 3NUNA 2J5EA 4CLIA 4O1PA 2BR1A 2QU5A 3DKGA 4R1YA 3UP2A 3RGFA 3IECA 4FTNA 3OOMA 3QD3A 3ROYA 3QC9A 4LOOA 2W5BA 4IZ7A 2ITVA 2YA9A 4IB3A 4USDA 4D5HA 4TY1A 5IZFA 4H05A 4GIHA 4I4EA 5M4IA 3OUKA 1TQPA 2GFSA 4FKVA 4W4WA 4E73A 4M68A 4OTGA 2ETKA 3D0EA 1LPUA 2PVHA 3D7ZA 4IM3A 4W8EA 4K0YA 3WYYA 4FSWA 2Y0AA 3R1YA 3E8EA 4XJ0A 4GMYA 5KHXA 4A9TA 1CM8A 3R1NA 3QGWA 4NCTA 4WHZA 4MBIA 2JDRA 2R5TA 4TWPA 4AA0A 4TZRA 1H1RA 4KRDA 4XP2A 3R30A 2O0UA 3UNZA 5DGZA 1V1KA 2X81A 4GIIA 4C34A 3R8LA 4BFMA 2YCSA 3P1AA 3AXWA 3R9NA 3GQLA 4CFWA 3F9NA 4F0GA 3F88A 5CEOA 1QPJA 3T9IA 3HV6A 3PY0A 3TIYA 2DS1A 4WNOA 4S31A 5D11A 3D5WA 1BUHA 4W9WA 4DT9A 3GCSA 2YZAA 1B6CB 1YOLA 2YITA 4RVTA 4L68A 1PXLA 4KWPA 5F4NA 4LV8A 4F63A 3BZ3A 4OUCA 2B9IA 4YHFA 3ALOA 4X2KA 3L1SA 4IIRA 4YBJA 1U5QA 4YTIA 1RW8A 3DBFA 4AT3A 4C61A 4CT2A 1GZNA 2PY3A 1Y57A 3BV3A 3GUBA 4J96A 2QOIA 4XRJA 3U55A 5DR9A 3C0IA 3E87A 4CKIA 2O8YA 5ETCA 5K0XA 4ZY5A 5CXZA 3QZFA 2OJGA 3W33A 5IISA 3W2CA 5G6VA 4C4EA 4K9YA 1ZZ2A 1H27A 2HK5A 5ETIA 4DEEA 2OKRA 1Q99A 2ZJWA 4WG3A 3UZRA 2HELA 3O0GA 3WZEA 4D2PA 2R4BA 1MP8A 3LZBA 3MJ1A 4TYGA 4EKKA 2GS7A 3K54A 3U4WA 1SVHA 1BI8A 5T3QA 3RALA 2OK1A 3EFJA 4PDOA 4M14A 1NXKA 4W4XA 2B4SB 3DK6A 3NS9A 4LGGA 3SW4A 4F7LA 5B2MA 4J8NA 4IWPA 4BIEA 3Q9YA 4D1SA 1OGUA 4G17A 4X6RA 5F95A 4A4OA 1BL6A 1YDTE 1K2PA 3OVVA 4JAIA 4KUJA 3BGZA 4RVKA 3F3VA 3RWQA 4QYGA 2PMNX 5DR6A 4MF0A 4IADA 3CR0A 4Y73A 3DT1A 4B4LA 4FIJA 1CDKA 4PV0A 2OIBA 3IW5A 3W18A 4R78A 3O7LB 3HUBA 4R5SA 4LRKA 5DPVA 4EH8A 3PE1A 4IMYA 1UU3A 5LVPA 2OJIA 2BDWA 3PXRA 1JNKA 2DQ7X 2UZNA 3FI2A 3G0FA 5HNGA 4MWIA 4YPSA 2Y6MA 4YJQA 4RFZA 5KMLA 1E1XA 4O0RA 4ZTSA 3ZRKA 3S2PA 4QP4A 2PVNA 4K8AA 3O23A 3Q32A 3SVVA 4D0WA 4PTEA 2PPQA 2RFDA 3FC1X 5AM7A 3F69A 2W96B 3COHA 5DN3A 3VN9A 3C5UA 3HRCA 4RIYB 5EW3A 4CYJA 3TI1A 4FYOA 1LR4A 3CGFA 1KE9A 3GP0A 3KMMA 4I0SA 4OTWA 3ZS5A 4ANBA 5IH4A 1U46A 2J90A 2XJ0A 3RAWA 4ZLZA 4PPAA 3G6HA 3TACA 4JS8A 1ZYDA 1EH4A 1H4LA 3KFAA 4GRBA 4RMZA 1DAWA 3PA4A 4MD8E 4BBEA 4D28A 3DFAA 2R0IA 3FZSA 5I9YA 3H4JA 3TNHA 4EORA 2ZM1A 5FUTA 1CSNA 2A27A 4GK4A 4HGLA 4WG4A 2XNGA 3LCKA 4XHKB 5HD4A 3C51A 2PHKA 5KNJA 4PQNA 1ZOHA 5CS6A 3HAVA 1KE8A 4FOCA 5A9UA 4KBKA 2GFCA 3O96A 4FTAA 5CZIA 3HMMA 4G9RA 2HY81 4AAAA 4FL3A 3ELJA 4BCQA 2RIOA 1V0BA 1B39A 1OL5A 2QQ7A 3ORKA 3QZHA 5EI6A 3FYJX 4HCTA 3OZ6A 4I5CA 5CT7A 1F5QA 2JIIA 3PSDA 3D83A 1WFCA 5FP5A 4OAUC 3IDBA 3BX5A 1PRYA 1FQ1B 1KOBA 2W1FA 3F5UA 1YI4A 3OOGA 4H58A 4IAIA 4JX7A 3FAAA 4QT1A 1FGIA 4FKQA 2XZSA 4Y72A 3AMBA 4N4SA 3HDNA 3UGCA 2ZV8A 3QCXA 3KK9A 3CLYA 4FTQA 2B7AA 4FKGA 1WBSA 4P2KA 2R2PA 2V7OA 4H3PA 2WU7A 3ZMMA 3W2QA 5IUHA 3PRIA 4C3FA 5B0XA 4GJ2A 4QTCA 3MGYA 4EOMA 1HOWA 3N4UA 3P9JA 2J4ZA 4ZP5A 5AMNA 2PUIA 2A1AB 2FSLX 5B2KA 2WMRA 4F6SA 4O0UA 4QMOA 1OL2A 4NM7A 4RPVA 2YN8A 3QYWA 5HD7A 1ZOGA 4QQTA 3DNEA 4HZRA 4DCAA 3ZO3A 3IG7A 5M44A 3Q96A 2QHMA 4W4YA 2HW6A 4BN1A 2QKWB 1KE6A 3GU4A 4IWQA 5HO8A 5IG1A 5H2UA 4QMWA 5AUTA 5K9IA 2CNUA 4FTKA 4ENXA 4IE9A 2C6DA 1ZY4A 4EONA 3NW7A 4YJUA 4U40A 2F57A 4BCJA 4QNAA 3EQPA 4F70A 4J97A 3O8PA 1STCE 2VTTA 2VWIA 3C9WA 4HZSA 5EFQA 5HBHA 3QX4A 2CKQA 3Q9XA 4O0SA 4E6CA 4EOOA 2Z7QA 3VS6A 4KSPA 3SXFA 4AW1A 4F6UA 4PP9A 1DI8A 4UALA 3P08A 5I4NA 1OB3A 3E92A 4NU1A 5IQFA 5HZNA 5G1XA 3EFWA 5JFVA 3HA8A 5K4IA 5IQGA 5TR6A 2YFXA 3UDBA 1ZYJA 3K3JA 3ZRLA 4BCIA 2OLCA 2JAMA 5CVHA 3L9MA 3M1SA 2BUJA 4Y5QA 2GTMA 5A4TA 4DE4A 4O96A 4P5ZA 2R64A 3VBVA 2J5FA 2XYNA 4E1ZA 2GTNA 4Q5EA 2F7ZE 5DWRA 4C2VA 4JDHA 3QXPA 2P55A 4KNBA 3FXZA 4F9CA 5BUJA 2ZM3A 3MI9A 1Y8GA 1WVXA 1XH7A 3CE3A 3DBQA 2VX3A 3ANQA 3S3IA 3MN3A 3C1XA 2YACA 2RL5A 5AADA 1O6LA 5DE2A 2HWPA 2UZDA 3DCVA 2CKEA 3O17A 2XNPA 4FKSA 4R8QA 4XG7A 4G5PA 3SGCA 3POOA 5CZHA 4MNFA 1H1QA 3GOPA 4TPTA 5ANOA 3TZMA 2JD5A 3KMWA 4I1ZA 4G3GA 1ZARA 5HCZA 1G5SA 4YC8A 4BTJA 3NR9A 3DPKA 3PRFA 3IO7A 2PE1A 4HNFA 3CC6A 3ZFYA 2XUUA 3Q9WA 2R3RA 3QAME 1JBPE 3FZPA 5DEYA 3ZEWA 2GCDA 5CLPA 4X3JA 3KF7A 4HVSA 3F7WA 4FNYA 4Q2AA 5EM5A 5C8KA 5I3RA 2C68A 2QG5A 4YZBA 1PY5A 4FL2A 4RJ5A 5CU4A 5CQUA 2YM7A 3HP5A 3IW8A 4FEXA 2ETRA 3V5LA 2HAKA 4UYNA 4RIOA 1ZMUA 4ZY6A 4EZ7A 3VF8A 3U6JA 2R7BA 1JKLA 5CSXA 3D2IA 3QQKA 4MBJA 4RLKA 4F08A 1WBNA 4V0GB 1YXSA 1JSTA 4R7HA 3OC1A 1P5EA 4U6RA 1FPUA 3ET7A 2XM9A 4GK3A 4GT4A 4GSBA 4LV5A 3WF9A 5D7AA 3VJOA 4F0IA 3K5UA 3NYXA 3A7HA 2A0CX 4A9UA 3I0QA 3CS9A 4RC3A 3CXWA 3R9HA 3BHYA 3NAXA 5CAVA 3AT2A 3LLTA 5JFWA 4YGAA 4KKHA 4L7FA 4WNPA 5BVFA 1OVEA 1J1CA 1JWHA 4YJNA 5KHWA 3KRWA 1H08A 4FNWA 5AA8A 3UO4A 4LUEA 4ZXTA 2UVYA 4HYSA 4F7NA 3UQGA 5HESA 4QYEA 1OZ1A 4ANMA 4X2NA 4AZEA 2W1CA 1SYKA 2PZIA 4M67A 3QBNA 4J71A 2QONA 3ORNA 4EQUA 3ENMA 3LFFA 3Q2MA 4E8AA 3DJ5A 4YUQA 4DGNA 5LXMA 5E8UA 1SM2A 4E4NA 2OICA 2W7XA 4F9BA 1OKYA 3V8SA 3KXGA 3MFSA 3LXPA 4JDIA 4JBVA 4AGCA 2XKDA 3RMFA 3AGMA 5AEPA 3LFQA 3EN5A 4AQCA 3TV7A 2RG5A 4PNIA 4UEUA 3HV5A 3ZO4A 4ZS0A 3DXQA 3BU6A 4PF4A 2G15A 2PMOX 3OG7A 4CD0A 2X2MA 4M8TA 4DH5A 1JKKA 2QCSA 5F20A 2QU6A 4ZK5A 4IWOA 4Y5HA 4GYIA 2ACXA 3OT8A 3AMAA 3FPMA 2W1DA 4C57A 4PWNA 5CNOA 3QQLA 1YHSA 2C6OA 3L8PA 4F1MA 4KIKA 1VEBA 2I1MA 4A9RA 5EYMA 4A7CA 3CTJA 3L9PA 4E5BA 3LQ5A 3MBLA 1H01A 1U54A 3PG3A 3W1FA 4BCHA 2J2IB 2P2HA 3CIKA 4CT1A 4DG3E 2XEZA 4HVGA 4A9SA 4FIEA 3RM7A 2CSNA 3R1SA 2FVDA 4FUXA 3VULA 2O64A 2CGXA 4FKOA 3Q2JA 5CEMA 5JMSA 1PXMA 3MYGA 5M53A 2V0DA 4FT9A 4FV2A 4AOIA 2Z8CA 5J9LA 3PP1A 1IA9A 3U87A 4IAZA 2W9ZB 3KC3A 4OTFA 4D2RA 1CMKE 4DEGA 3R6XA 1ZOEA 3FKOA 2X4FA 5KE0A 4U79A 4WSYA 3ZZWA 2PVYA 2YWPA 2VTHA 3LMHA 1GNGA 3UNJA 3QTXA 5AAGA 3EKNA 4PX6A 1PKGA 3EN9A 3WYXA 4AZWA 3BE9A 3EOCA 1FMKA 5BVOA 3V6SA 4O86A 3ZC6A 4DFUA 1AD5A 5EOBA 2ZOQA 2UW5A 3GQIA 3L8XA 3Q4TA 4CFNA 5KZ0A 4PMMA 4MH7A 1TKIA 3FHIA 4OTIA 4QMXA 1KE5A 4FX3A 5DT4A 2ONLC 3MTLA 4DT8A 2XP2A 1PXJA 5HVYA 3CD8A 3E7VA 3VS4A 5IQIA 3ULIA 2R3LA 5J1VA 3PY3A 2C5OA 1R78A 4CSVA 4O6LA 4IH8A 5IH6A 5JRSA 3SD0A 2YHVA 3EQFA 3RAKA 2XS0A 4UMUA 2HW7A 3FE3A 3BE2A 1JKSA 4QMZA 2WO6A 4FVRA 5BVKA 5LMBA 3DBEA 4BCPA 5LCJA 3OWKA 2YLEA 4E5WA 4RJ7A 4YHTA 3PVWA 3CKWA 3UG1A 2WMAA 3K5VA 5IEVA 5HORA 1KOAA 2XNNA 2YLFA 4FT0A 4HCUA 4FODA 4EH7A 3PDTA 5CYIA 3C0HA 2P0CA 2PVMA 4YMJA 4L45A 1Y8YA 3F6XA 5J95A 4FTLA 3WZKA 3W32A 4JG8A 3A99A 4AZSA 2Z7RA 2ZMCA 4ZEGA 2EXMA 3W2SA 1AQ1A 4BF2A 3TDVA 5FP6A 4FNXA 3U51A 3Q5IA 3ORZA 3E62A 4ONAA 1OM1A 3TKHA 4C59A 1XJDA 3TTIA 2P2IA 4TYHB 4B7TA 2CGUA 4KABA 4ZMEA 3E8DA 5TE0A 3ZRMA 3UZTA 4ERWA 4B0GA 1IEPA 1J91A 3BYOA 3SQQA 3VW6A 3ZOSA 4H3BA 1OKWA 3ZTXA 4F1TA 2VNYA 3L8VA 4ZSLA 2G2FA 3EYHA 1HCLA 4H3QA 2WOTA 4USFA 2XK6A 4M66A 3GOKA 4JIKA 2EWAA 4PTCA 3W16A 5HTBA 5LWMA 4IC7A 4XG9A 3AC1A 3EQBA 4CQEA 4EYJA 3EQHA 1U5RA 1FVRA 2IVSA 3BPRA 3BV2A 3HYHA 1H1PA 3QLFA 4G1WA 5CNNA 2UZOA 3AT3A 4FTUA 4ASZA 2LGCA 4P5QA 4AXAA 3F3TA 4D0XA 5AV4A 4N6YA 4FNZA 5EK7A 4EYMA 3G9LX 4IVAA 4ZTNA 4LI5A 2DUVA 4IAFA 3SOCA 3ACJA 4FSZA 3DXNA 4TTHB 3EZVA 2VO3A 3VO3A 4BDBA 4GG5A 3V5QA 4BDEA 4C3PA 2BIKB 3HMOA 2UV2A 3PXZA 1IAJA 3KRJA 4M13A 3BKBA 3F66A 4QD6A 2WHBA 3LFAA 1ZYCA 4TWCA 3VHEA 4NKAA 2YM5A 3ATTA 3E7OA 4XOYA 2IO6A 3TZ7A 3AG9A 5BYLA 3LFEA 4JJRA 3UOHA 4MBLA 4RFMA 5DFPA 4ZSJA 3HMNA 2E2BA 1JLUE 3OT3A 4EH5A 2QOQA 3FMNA 3QQGA 3HDMA 2CN5A 2RFNA 4NIFA 3DAEA 1H25A 1PYXA 5HE3A 4BI2A 4DH1A 4EHGA 2Q0NA 3DLSA 5AV0A 1RDQE 5ICPA 3PG1A 4NW5A 1FOTA 4J1RA 4XV1A 2FGIA 2CKOA 4FZ6A 3RPRA 3QTIA 4U45A 4L8MA 1SZMA 4FSTA 4FC0A 2AYPA 3B8QA 3SA0A 3A4OX 2C0IA 3BWFA 4G3CA 5CSWA 4AF3A 4CZTA 2GQRA 2JEDA 3VS7A 4PTGA 5AR3A 1OKZA 4ZIMA 4YC3A 4QP6A 3KB7A 4CFXA 3QRTA 1GOLA 4WO5A 2VTQA 4KSQA 3HECA 2GNHA 4IDVA 4FEWA 1PF8A 4PDPA 2WMQA 3ORIA 4FV8A 3RI1A 4Q5HA 2Y6OA 2Q0BA 4OR5A 4PY1A 3UP7A 2JDSA 3QLGA 5L8JA 4BB4A 1RJBA 3KREA 2ITPA 2XK4A 3HRFA 5T68A 5DMZA 4AOJA 3LLAA 2GS2A 3Q60A 4U81A 4BTMA 2ZYBA 2BIYA 4IVBA 5ANDA 4LG4A 2W1HA 2JFLA 4S2ZA 4FG7A 1ZY5A 3PA3A 4I21A 1PMUA 3PWYA 4UMQA 3TKIA 4L3PA 3QTUA 4XYFA 2PTKA 1FMOE 1P14A 4IACA 4JQEA 4WT6A 2C1AA 5IDNA 1Q3DA 4G6OA 4ASDA 4PDSA 3E8NA 4FKJA 2X4ZA 3ULZA 3U6HA 3OW4A 4LRMA 4NZWB 2DYLA 2VTMA 5AUYA 4E26A 3BEAA 4LUDA 4BC6A 2PZYA 2CMWA 4F09A 1FBNA 3D14A 3WILA 3MJ2A 1W0XC 4KS7A 3PP0A 1RE8A 3GI3A 3GFEA 3TJDA 4KA3A 5LVNA 3C50A 3C4XA 3ROCA 4QTDA 2R9SA 3BLQA 3MH3A 4U44A 2GHGA 3JVRA 4YO6A 4FF8A 3TWJA 2EB2A 2QNJA 1Y6AA 2E9OA 2UW7A 2XK7A 3NUSA 4R3CA 5AIKA 5BVNA 5LARA 3EQRA 5AUVA 3CSVA 5IUIA 4EOIA 3QGYA 2B55A 4DITA 1NVSA 5JFSA 4ITIA 3D94A 5LVMA 1Q24A 4M0ZA 3F3WA 3QZGA 4X0MA 3SHEA 2YM6A 3PZEA 5M57A 2RSVA 3FLZA 2CDZA 3RK5A 3R21A 3K2LA 3F5PA 5HI2A 5E9EA 4HVDA 4RIXA 2GQGA 4GUBA 4MKCA 3CCNA 3I5NA 2XKFA 3NDMA 2J0IA 3Q4UA 3QCQA 4MXXA 2XNBA 3H3CA 3ZCLA 4BDAA 2UVZA 5A4LA 4LM5A 4TN6A 4CCBA 1SNUA 4YLLA 4MD7E 4RGJA 4TWOA 2WQOA 4LGHA 4ZTLA 2UUEA 4RX5A 3A8XA 4JVGA 4MQ1A 3WF5A 4XG4A 4JBPA 2H9VA 2G9XA 4TRLA 3FV8A 1UNLA 3EFLA 4FT7A 4WNMA 3KKVA 4CFFA 3COMA 2B52A 3FMJA 3RVGA 4FT3A 4QMLA 4NTSA 4EK6A 2C3IB 3VRZA 2WOUA 5AA9A 2GDOA 4FSQA 4BIBA 3BCEA 4U5JA 4IVCA 4CG8A 1OL6A 2HZIA 4BGHA 1S9JA 4TW9A 4UN0C 2AC5A 3UIMA 4MYGA 3SOAA 4F6WA 2QKRA 3GXLA 3QRKA 1QPCA 2VTAA 2PZRA 3A61A 3M42A 4O83A 2Y4IB 3DKOA 4FIIA 5IF1A 2W5AA 3PJ3A 4U42A 4O6EA 3VS1A 2R0UA 2ESMA 1UV5A 3I60A 2J0MB 4FKRA 3KU2A 4NW6A 2VU3A 1MUOA 1Y6BA 2QI8A 3FWQA 1VYWA 3TTJA 2QG7A 5EW9A 4GJ3A 5HCXA 3UOLA 4EH4A 4BGGA 5A4EA 4C38A 2UW8A 2IWIA 3PY1A 4L01A 5HG5A 4EH6A 2WMVA 4NFMA 4XG8A 5I9XA 4FVQA 3QU0A 5C26A 4NFNA 3TNWA 1UKHA 5D41A 5A6NA 4V04A 3QTWA 5M09A 3OBJA 2JKQA 4DHFA 4YJVA 1UNGA 4TWNA 4WBOA 4YNOA 2XK8A 4MD9E 3RM6A 3R9DA 4JIAA 4KKEA 4JBQA 4O0VA 5I9WA 2I0EA 4U9AA 3CPBA 5C8NA 4I24A 3TT0A 3DXPA 5KBRA 2UZBA 3QTRA 3HRBA 2XBAA 1Z9XA 2WQMA 3KXNA 2WAJA 5CASA 2PL0A 4D5KA 5IMXA 2GU8A 4FKTA 5IMEA 3G5DA 2B9HA 3GC0A 3OXIA 2I0HA 4RSSA 1REKA 4DTBA 4C7TA 3T3UA 2YJRA 3PA5A 4RA5A 4JDKA 3UOKA 1NW1A 2OH0E 2UW0A 4WUAA 2ZV9A 3JPVA 2ZB1A 4YTCA 4W9XA 4QP3A 5E90A 5L2IA 4MHAA 1CTPE 2ZDUA 2PU8A 2UZWE 4JG6A 3FL5A 4FR4A 1WBTA 3NYOA 4ZTHA 4I5MA 4IM2A 2OIDA 3OWPA 5IA3A 1Q61A 3P79A 3VW8A 2VO7A 1XO2B 2C4GA 2RFEA 3BHHA 3M2WA 4RLLA 1F0QA 3QRUA 4IDTA 1O6KA 1PXOA 5KMMA 4JQ7A 4QMTA 4YLJA 4BYJA 4RA4A 3RKBA 4BIDA 4J7BA 4XS2A 2W4OA 2BALA 5FGKA 4BWPA 3AGLA 4JL9A 4P7EA 5HCYA 4BDJA 3IONA 3OY1A 3QALE 2PUUA 5E7RA 3DGKA 3HLLA 4YLKA 1H28A 1W84A 3ZM9A 4NM3A 4L52A 3FI3A 4S34A 1WMKA 4F9AA 4XMOA 5HVJA 2PVJA 4G34A 3QKLA 3QTZA 1MQ4A 2WKMA 2YAAA 5C01A 3TKUA 3IW4A 3LIJA 2NO3A 5HIDA 2JDVA 4CMUA 1R1WA 3HP2A 5AUZA 3G0EA 4CFUA 5A54A 1R3CA 3EQDA 4E6DA 2XIZA 3KRLA 4QYHA 1PW2A 3GVUA 3S0OA 2JC6A 5FLFA 1URCA 3NW6A 1WBWA 4IX3A 3E3BX 4FSRA 3EYGA 2CPKE 1H26A 3PJ8A 4IC8A 4O2PA 4BICA 4APPA 1P4FA 4OT6A 3O2MA 3UIUA 5KBQA 1K3AA 5AIRA 4FBXA 3GNIB 5E8VA 4EK8A 4WSQA 4OAVB 2QR7A 1WVYA 3QD2B 4ZSGA 4UZHA 2WPAA 3DOGA 5CTPA 1BMKA 2XRWA 4QP1A 5AP5A 5AP4A 1VR2A 1WZYA 2R3FA 4DLIA 1H24A 1Q97A 4GCJA 4GL9A 3HNGA 1Z57A 4EH2A 1OIUA 2QOKA 4ALWA 4JLCA 3O8UA 1A06A 4PPCA 4ASEA 3NYNA 2J9MA 3O51A 2B53A 2OSCA 2V7AA 3NNWA 3OEZA 4FT5A 4C33A 3CEKA 3UO6A 4YJSA 2J0KA 2OU7A 3CQUA 4FSYA 4IJPA 1CKPA 2GNFA 3OCBA 2PVLA 1YVJA 4FZFB 1UU9A 3WI6A 5J1WA 4WA9A 3NVMB 3NUYA 2XBJA 3KA0A 3AD6A 3DZQA 4H36A 3LXKA 2BKZA 5AAEA 1IAHA 3L8SA 3ZBXA 3BGQA 3IW6A 4YR8A 1GZKA 3OUNB 3U4UA 3VS5A 3NW5A 3W55A 2I6LA 3LW0A 3KXHA 4O7VA 2JBPA 2P4IA 1ZZLA 5D7VA 3RJCA 2QC6A 3W8LA 5BMSA 2GQSA 4QMPA 2V62A 2UW6A 5IA5A 2R3PA 1QPEA 5IUGA 4M7IA 5KZIA 5CANA 2G2IA 1PYEA 4M69A 4IWDA 4K11A 4S33A 3N51A 2QOFA 1OPJA 2VWXA 2C6MA 2WEIA 4K77A 3V51A 4IB5A 4B6LA 5GINE 3SG9A 2JDTA 4PL3A 3ITZA 4FZDB 4JI9A 4O7TA 5BUIA 4I6HA 4M69B 1TQMA 4ZLYA 2X8DA 2CLXA 4K1BA 4ANQA 4PMPA 3KCKA 4NH1A 1A48A 3GC7A 3IDPA 2WMSA 2NRUA 4JX3A 5FG8A 5HE2A 1H8FA 4BGQA 5E92A 5IU2A 1XH5A 4W8DA 5AX3A 3O71A 3WIGA 4CRSA 4E6QA 4FV5A 2CJMA 3BU5A 3MY1A 4TNDA 3UG2A 1U59A 4WNKA 4O21A 4AZVA 5DHJA 2OI4X 5CAOA 3RK9A 3E8CA 3F3ZA 3MIYA 3DB8A 3R0TA 2PE2A 4YPDA 1MRVA 3KVXA 3VBYA 5D1JA 2PVRA 2VWVA 3RZFA 3ZHPC 4BCNA 4XG2A 1PKDA 3C7QA 3H10A 4L42A 4YJTA 1XR1A 2ZB0A 4CNHA 4D2WA 4AT5A 3FI8A 4I5HA 4EJNA 2IPXA 1ZMWA 2OJJA 3KN5A 5HX8A 5KX8A 1BL7A 1B38A 3I79A 1Q8YA 1OMWA 3BGPA 4FI1A 4EK4A 2JIVA 5LMKA 2C6TA 1YXXA 3EQGA 3MVLA 3REPA 4GT5A 2PZPA 3ZYAA 4FG8A 4YSMA 5HEZA 5ANJA 2F2UA 3PVBA 5FDXA 3W10A 4O7NA 4KBAA 4ACDA 3G51A 3E64A 2W1EA 4DEHA 3GENA 1BLXA 4NM5A 4AS0A 3Q53A 1M52A 2R3JA 4UZDA 5HKMA 4BDCA 4Y85A 4BKZA 2J50A 4IB0A 2OF2A 4YZMA 4DFXE 2NP8A 5FEDA 4DGLC 4U3ZA 5AUWA 4BYIA 4DBXA 4X2GA 2RG6A 4XRLA 3SG8A 3KGAA 3VQHA 2ITYA 1A9UA 4I6QA 4IAAA 5K4JA 2E9VA 3G2FA 1JSVA 5L3AA 4F9WA 1H00A 4MXOA 5LMAA 3PXKA 5CU2A 1UA2A 4QYYA 4J95A 1GY3A 3PIYA 2H8HA 2WTDA 3RNYA 4UWCA 3QKMA 4LRJA 2IG7A 2WTKB 1XHAA 2CGVA 4DH7A 5EQPA 3N9XA 3T3VA 2QOCA 3MH1A 4WRSA 3W8QA 3QTQA 4QQCA 3QWJA 4IBMA 4XBRA 5AP2A 5JZNA 3M11A 4G3FA 5AUXA 5J5SA 4UY9A 4UMPA 2YDKA 3MA6A 5CVGA 4AW2A 1QPDA 4NCTC 3PXQA 5CEKA 3HX4A 3LKMA 4JRNA 4RX7A 4JRVA 3MH2A 3JUHA 4QTEA 3KEXA 3IPHA 2BDFA 4XLIA 4K6ZA 3MPMA 3OFMA 5FM2A 4ALUA 5BX0A 4GKHA 3DBDA 3LFSA 5AFVA 2VX0A 3F61A 3R22A 4I6FA 2GNLA 3Q5ZA 3UBDA 3LHJA 4HVIA 5EM6A 3RCDA 3NNXA 3MVMA 4O84A 4DGGA 2X9FA 5HLNA 3HL7A 3SW7A 2C6EA 5DBXA 1Q5KA 4FV1A 4TYJA 4HPTE 3LE6A 2VTIA 1WVWA 2J0JA 2BZHB 1ATPE 4WKQA 4RIWA 4I22A 3TXOA 3ZLXA 3KN6A 3MS9A 3RAIA 4FYNA 4KKGA 3GT8A 3IS5A 3OW3A 2BFXA 4ZTMA 1QMZA 4F9YA 2X9EA 4NTTA 4ZJJA 4EOKA 5EH0A 3JR1A 3CQEA 4IFGA 5JFXA 2OGVA 4RJ4A 4NK9A 3RWPA 4LQMA 2J0LA 5EG3A 4XG3A 3E3PA 4U7ZA 4EC8A 5FEQA 3V3VA 4C4GA 3W2OA 3EQCA 3DA6A 4O81A 4UXQA 4D4RA 3P0MA 3HMPA 2IW8A 3VS3A 4DBNA 4U8ZA 3QWKA 2WMXA 3OS3A 4DH3A 3VS2A 4BBMA 5L8LA 3FBVA 5HG9A 3KK8A 4RC2A 5AP1A 2X6EA 4CFMA 3P7AA 2WFYA 3D7TA 3JYAA 3VVHA 3ZSGA 4A9YA 1M17A 3ENHA 5HO6A 4AGWA 1OECA 3PJ2A 5HHWA 4R3RA 1TVOA 1OIYA 3EL8A 5DRBA 3ZLYA 4Z55A 1WBVA 4DH8A 5DT3A 2XKCA 4ZTQA 5LQFA 4R1VA 5AP0A 3NGAA 3VBXA 4AE9A 3TDWA 3NUXA 4G6NA 3ZZEA 2RF9A 3KRXA 4J99A 4GFGA 3CQWA 2B54A 2YDIA 3ORLA 3QHRA 4UWYA 2FSTX 5IPJA 3MW1A 3C4ZA 4A4LA 3DS6A 1Q62A 5IQBA 3DFCB 4RQVA 2R3NA 2OXYA 4AW0A 5HE1A 3CTHA 3IK3A 3R2BA 4KD1A 4RC4A 4FMQA 4X3FA 4KIKB 4OBPA 5AR2A 4BHZA 4IVDA 1NA7A 5IEXA 2G1TA 4FSUA 3GEQA 2F49A 3Q6UA 3P5KA 3ZUUA 3D5VA 4KINA 4FEUA 1KV2A 1U54B 4X3FB 4ZJIA 1WCCA 4G2FA 5BVWA 3HAMA 4FIFA 5GZAA 4NL0A 4U41A 4AW5A 3S95A 2WEVA 5J8IA 2X1NA 2WD1A 4XP3A 5M4CA 2BZIB 4IFCA 3ZO2A 3RBWA 4O7SA 3CJGA 3DY7A 3R7OA 2OXDA 3NYVA 4USEA 3FUPA 1BI7A 2GSFA 3NSZA 3KULA 3QUPA 5JGBA 5JGAA 4AA5A 5EYKA 3BRBA 4NJ3A 5M06A 4MEDA 4GS6A 4FV6A 3UTOA 4J53A 1CKIA 4FTOA 4YZ9A 2VTNA 3BQRA 4M84A 3HA6A 3NNUA 2VX1A 3O50A 1OITA 3P23A 4O38A 5J7HA 4O22A 4BDHA 2GHLA 2XCKA 4OLIA 3VUMA 3P4KA 4BDKA 5HE0A 4YZDA 3EN6A 4N70A 2VWZA 3OCSA 4K18A 3UOJA 3BHUA 3EFKA 3I5ZA 3S4QA 5C27A 2QVSE 5ANKA 3DBCA 3VUKA 3WZJA 2VGOA 5AJQA 1FGKA 5CQWA 2QO9A 2IZTA 4FIHA 5K5XA 2NNWB 3LQ3A 4PP7A 2CHLA 3Q52A 2PSQA 4DCEA 2EVAA 3B2TA 1I09A 4O82A 4YTFA 2IZUA 4EI4A 4I41A 2OZAA 1YQJA 3IDCA 3EQIA 3FLWA 1IG1A 1XH6A 3Q04A 5GIPE 3EWHA 3SXRA 4UXLA 4BCFA 3FLNC 4E5AX 4CXAA 5DLSA 2OZAB 4FK6A 2VGPA 5HOAA 3UMWA 3ORMA 4DG2E 3V5WA 2PULA 3ZSHA 3N4VA 3BLHA 3VUIA 4NYEA 5AR7A 5CI6A 2XNEA 4KBCA 3N4TA 2W1IA 3DKFA 4LMUA 3KRRA 1GIHA 3OY3A 4IXPA 4RG0A 5EQEA 5M56A 2BFYA 1XQZA 1M7QA 4MXCA 3V8WA 2W9FB 2G2HA 4IHPA 2PK9A 2VTRA 2XB7A 4QOXA 2Y9QA 3ACKA 3LM5A 2F4JA 3OD6X 3UYSA 4J98A 3RHKA 3TNPC 1SVGA 2X8IA 5BMMA 3RZBA 4AU8A 5HICA 4C62A 1DM2A 4QTAA 4OGRA 5HTIA 1UU7A 3ETAA 3QCSA 4A06A 4CFVA 3LMIA 5DOSA 1YRPA 3KXZA 5CU6A 2Z2WA 4B8MA 4NJDA 4BRXA 3G9NA 1R0EA 1XWSA 4GK2A 1Y91A 4XEYA 3CKXA 2ITZA 4FZ7A 5HBJA 1J1BA 2R3KA 2ITTA 3GBZA 4C35A 3FQEA 3NIZA 4OTHA 5EYDA 4Z7GA 3DAKA 3SRVA 1OUKA 4FL1A 3T8OA 2YIXA 3E93A 3TN8A 3Q3BA 1KUTA 4FEQA 3GCQA 2C3KA 5FQDC 4B99A 3BELA 4L9IA 3VAPA 4C58A 4TYEA 4LL0A 5CSVA 4FE2A 2FSMX 4CQGA 3FKLA 2YEXA 4H1MA 4QPSA 3ZXZA 4CZYB 4Y46A 3QUDA 1DAYA 3LVPA 4EOJA 4ORKA 3LQ8A 4O0YA 3GCPA 3TNIA 3UC4A 2XIRA 1H1WA 4C4FA 3Q9ZA 2QOLA 3R73A 4HJOA 3QUEA 3VIDA 4XNEA 5ETFA 1P2AA 2OJ9A 2CCHA 5M07A 4MX9A 3R83A 5L8KA 2I7QA 4IZ5A 2YIWA 2ZVAA 1PXNA 4XG6A 5CT0A 2YDJA 5HVKA 3IGOA 4FV9A 2WTKC 2SRCA 1GJOA 1XBAA 3WF8A 2W0JA 4D1ZA 4O27B 3ODZX 2A4LA 2WB8A 3MWUA 3R04A 1TQIA 4AG8A 4W4VA 4O7RA 4EBWA 2FH9A 4ACHA 1YDRE 3JXWA 4I20A 5DI1A 5AV1A 3TUDA 3PZHA 5D9HA 4NIFB 2PMLX 4ITHA 3F7ZA 4LGDA 4WOVA 3ZO1A 4AZFA 2BROA 2WNTA 3FC2A 4FOBA 4KIPA 1FVVA 2YCRA 3QKKA 4XOZA 3F5XA 3FXWA 3LFCA 5DVRA 5LWNA 5IA4A 1RQQA 4BY9E 3H0ZA 2QD9A 3NUPA 4N6ZA 3KF4A 4MTAA 3RAHA 4DINA 4JG7A 1GIIA 5E8ZA 4D4VA 3CY2A 4G3DA 3P78A 3THBA 5DYJA 4DTAA 3FY2A 4RWLA 3NNVA 3BQCA 2BHEA 3Q4ZA 4IB1A 2BRMA 3ZXTA 5CF5A 1APME 1JOWB 1ZXEA 3I7BA 4WUNA 5HLWA 1H1SA 1PHKA 4FTTA 3PSBA 1PXKA 2HYYA 2QOBA 3WF7A 3IGGA 5TO8A 2WIPA 2YWVA 2V22A 2IVUA 4GFMA 2W05A 4X7QA 5CSPA 2YIRA 4YJOA 3VRYA 4BDIA 3H30A 5HX6A 5DH3A 1UKIA 2VNWA 4QP2A 2W5HA 3F2NA 3CGOA 2NRYA 3FXXA 3O8TA 3D5UA 3KXMA 1IR3A 4FV3A 4EQMA 5CU3A 2ZMDA 3Q4CA 1ZLTA 1JPAA 1F3MC 3QRIA 3DK3A 3MB6A 3R63A 3BYMA 3FQHA 3TG1A 5CENA 2X0GA 4FTJA 3WBLA 2VWBA 2QLQA 4L44A 4IX6A 2WTVA 1W82A 1NT2A 1I44A 3VNTA 4OTQA 3ZH8A 3T9TA 5GIOE 3OP5A 3GB2A 4M97A 1J7IA 5HNIX 2C30A 3PVGA 5M51A 1OKVA 2O5KA 5AWMA 3QL8A 1H0VA 5FM3A 3CTQA 5E1EA 4I93A 5B7VA 2O63A 3OCTA 4G5JA 5KMOA 4H39A 2JBOA 5EHOA 3LCOA 2O65A 4QP9A 2GHMA 4CMOA 4D9UA 5H9BA 3A7GA 3KY2A 2PUNA 3R8VA 2VWYA 4EK3A 3UMXA 1K9AA 2BAJA 3DTCA 4ACCA 3JY0A 1YHVA 5AM6A 3KXXA 3SC1A 3CP9A 4M3QA 4RWIA 5LVLA 2BKKA 4V05A 3ZU7A 4JR7A 5IQCA 2ERKA 3B2WA 4ZOGA 4E20A 5AV3A 1WBOA 3F5GA 4XV2A 1YI3A 4IEBA 4NUSA 5EQYA 1PXIA 2PZ5A 5EHLA 3ZBFA 4TL0A 4RIXB 4N0SA 2WTIA 1BX6A 4DG0E 4X3FC 4MWHA 3DQXA 5C9CA 4RRVA 2PVFA 5AAFA 4YC6A 5HGIA 3MESA 2WQBA 3OF0A 4XCUA 3QXOA 5IQDA 2JKMA 4HYUA 4AN9A 4AN3A 4ZZOA 3FDNA 3RPYA 3PXYA 5J9YA 3A7IA 3BYUA 3GU6A 3OTVA 4ERKA 4PMSA 1NVQA 3D9VA 3OXTA 4FKWA 3TV4A 2W06A 3RPSA 5KMKA 4AP7A 1H0WA 5FTGA 2BZJA 4RQKA 2F2CB 2HCKA 2WMWA 4BCGA 2XK9A 1VZOA 4FGBA 5AUUA 3UPZA 2WTJA 4FG9A 3UE4A 4MVFA 2UVXA 3P7CA 3PE2A 4U3YA 3CJFA 5LOHA 4MXYA 4EK5A 2VTJA 3BWJA 3PIXA 4II5A 3UVPA 5L6OA 4C0TA 4I0TA 5ITAA 4B9DA 4FEVA 3VS0A 1GIJA 3AT4A 4RT7A 1PMEA 2C5NA 5CAUA 4GU6A 4E4LA 1PJKA 4FV4A 4R7BA 5E8YA 2ZDTA 5I9VA 2EXEA 5CY3A 2WIHA 3EZRA 4QMYA 4TNBA 3MSSA 1S9IA 3PWDA 4JBOA 5FBNC 4CKRA 2BAQA 5AP6A 3ZONA 3LJ0A 4DFYA 2QHNA 4GVJA 3VBTA 3G15A 1J7LA 4U97A 2R3MA 1JKTA 3DJ6A
chains in the Genus database with same CATH superfamily
3NVKI 1OI9A 3DU8A 3F2AA 3UQCA 5JH6A 4QRCA 4FTCA 2UW4A 3PJCA 4AGDA 2G01A 3DDPA 4QMVA 3OROA 3U8WA 4MUQA 2I0YA 4C4HA 4JDJA 5ETAA 2PWLA 4DLJA 4C2WA 5CEIA 4PRJA 5HU9A 4CEGA 2WMTA 3IW7A 3JS2A 4QMSA 5FDPA 4I3ZA 3SKCA 2IVTA 5LCKA 5BPYA 2C6IA 4I92A 3BBTB 3A7FA 2Y7JA 3WOWA 4GKIA 2XVDA 5ACKA 3U54A 2YERA 4I6BA 4MK0A 5A6OA 3UO5A 4IZYA 5M55A 4LL5A 5KMIA 1O6YA 2C69A 3MVHA 4G9CA 4E7WA 2OH4A 3G6GA 5GZ9A 4AUAA 4EH3A 2OFVA 4AQKA 3A62A 1T45A 4F64A 4FV0A 5ANIA 4CCUA 4R7IA 4J52A 2QR8A 4KAOA 3FHRA 1XBCA 3I4BA 3GC8A 4QTBA 4Q9ZA 3IOKA 5LVOA 3FMHA 4DEAA 1YXTA 3MFRA 4AFJA 1DS5A 1OL1A 4O0TA 4AT4A 3LXLA 2ITQA 2O3PA 1YW2A 3E5AA 3W0SA 5FBOA 3AD4A 4BWKA 1X8BA 1UNHA 2VWUA 3GGFA 1WAKA 3R7IA 3WF6A 4EKLA 4L00A 5C1QB 2YIQA 4EBVA 2XNOA 2H6DA 3BYSA 3A4PA 5DA3A 3VWAA 1OIQA 5EKOA 2DWBA 5JQ8A 5ANGA 3HMIA 3RK7A 3DKCA 3GCVA 4EOQA 3E88A 4LOPA 2BDJA 4ZSEA 5I3OA 4YURA 4UMTA 3BHTA 4JT3A 4DEDA 5J5TA 2OBJA 5CVFA 3NCZA 4BBFA 4DHIB 5EI2A 2WU6A 5I9UA 2OO8X 2YZLA 1L3RE 3FQSA 3R8MA 4RJ6A 5BVEA 4D2SA 1W83A 1L8TA 2CNQA 2HZ4A 2PYWA 3GU8A 5ANEA 1PMVA 3L9NA 2V55A 3QRJA 2YAKA 2XMYA 3NWWA 1XBBA 4J8MA 4YZCA 5DR2A 4F1OA 3AC8A 2FO0A 3FI4A 3LFDA 4LFIA 2XNMA 5GNKA 1ERKA 2JKKA 3EH9A 4GT3A 5A4CA 4FKPA 4P4CA 3IKAA 5BVDA 3UIXA 5KMNA 4ZSAA 4DTKA 2YM8A 4L53A 4EWHA 3ZEPA 3ERKA 2AUHA 5IKWA 4Y8DA 5CAQA 4ENYA 4EZ3A 3C5IA 1PMNA 1M14A 4RX9A 4RIYA 1W8CA 3FZOA 3UC3A 4CV9A 5AP7A 2QOOA 4BWXA 1Q8UA 4CV8A 3ID6C 1GZ8A 3NMUF 1V0OA 1J3HA 1ZRZA 3VJNA 3FZTA 4BKYA 3SXSA 3ZSIA 5L2WA 5JK3A 5E8XA 4AGUA 4PDYA 3R01A 4FUYA 5CSHA 4DEBA 2C6KA 2ITNA 2OWBA 3VF9A 5J79A 2EUFB 4G6LA 4Z3VA 1LEWA 4MF1A 2XA4A 5C8MA 4CLJA 5I9ZA 2XIXA 4OTRA 4EQCA 3NUUA 4FVPA 3G90X 4GV1A 4QNYA 4CTCA 1OPKA 2XEYA 3R8UA 4O7ZA 3R2YA 1BKXA 2HENA 3V01A 5IH5A 5A4QA 3HEGA 5FD2A 3C4FA 3BI6A 3SLSA 3VQUA 2FYSA 3UNKA 2HXQA 4V01A 5AR4A 2ITUA 3H9RA 3II5A 2CGWA 3W0OA 3SV0A 4FA2A 2ONLA 3QYZA 3EKKA 4CZUA 1XH9A 3RP9A 2C3JA 4A07A 4BI0A 1U4DA 4RJ3A 4CGAA 4YBKA 2X2LA 3FSKA 4X2FA 4FTIA 2Q83A 4YU2A 1SNXA 3BEGA 4L43A 4JXFA 4O2ZA 3QF9A 3SX9A 4EUTA 5GZ8A 1JVPP 4ZZMA 4GU9A 5GJFA 2BVAA 2E9UA 2IW6A 4HGSA 5E91A 3R9OA 5F1ZA 2HOGA 1YOJA 5JQ5A 4QEBA 3NPCA 3ZDUA 2BHHA 4C4IA 1KWPA 1OPLA 3AC3A 4IAKA 1VJYA 4FKLA 4MNEA 4CMTA 1YXUA 2W4KA 3LOKA 5BYZA 2GPHA 5KMJA 3ZUTA 3EMGA 3FLSA 3MA3A 4KS8A 5M4FA 4QDVA 5FXRA 2XKEA 3ORPA 5L4QA 3LJ2A 5H8EA 3H9FA 4MNEB 4HPUE 4ZTRA 4EHZA 2QOHA 5A3XA 1NY3A 3FMEA 5K0KA 3WE4A 4OW8A 5L6PA 1VYZA 2RFSA 4UV0A 3R9RA 1LP4A 2IJMA 4GUEA 3EN4A 3ORXA 1Q3WA 3R7YA 4F4PA 2LAVA 2HXLA 5JT2A 3PPZA 4M15A 5E4HA 2VO0A 2XRUA 4EOSA 1IRKA 1W7HA 3MFUA 4BTKA 5CXHA 4EOPA 5B2LA 3VC4A 2VTPA 3F82A 3KCFA 3IOPA 3L9LA 2B9JA 5TF9A 3PXFA 2X7FA 3I0OA 2O2UA 4RBLA 3OBGA 4TKSA 4E4MA 2UW9A 4HVHA 3U9NA 5DT0A 4IX5A 3D5XA 2ETMA 3OMVA 3QQJA 3UJGA 1ZWSA 3C4CA 4CVAA 3EJ1A 3R00A 4ZAUA 2ZV2A 2VWWA 4ZS4A 2XCHA 2AC3A 3EN7A 4QP8A 4EH9A 4NEUA 3OEFX 4R5YA 1CKJA 3UPXA 5L2QA 4M12A 2BRHA 3COKA 3V5JA 4BJJA 4FTMA 4L3LA 2Y4IC 2VUWA 4NWMA 5TKDA 1NVRA 4LOQA 5GJDA 3UVRA 3VUGA 1Q4LA 1Q8ZA 5BUEA 2WMUA 5BQ0A 4APCA 2IVVA 4FGRA 4BJJB 3H0YA 3DQWA 2XM8A 2A19B 1R0PA 2X39A 4FV7A 3TZ9A 4IANA 3AOXA 4AZTA 4C36A 2UZTA 4L7SA 3R7GA 4PMTA 4EUUA 2OFUA 4RZVA 4ANLA 5CF8A 2OW3A 2BILB 2F7EE 3KQ7A 4L46A 3MTFA 3P7BA 3QC4A 5DG5A 4DF3A 2GNIA 1JAMA 4O4CA 3C13A 5GJGA 3PFQA 1M2QA 3RTPA 3CBLA 4BDFA 4QPAA 3PIZA 1XKKA 5E1SA 5HQ0A 4FKUA 4WBBB 2IW9A 4A4XA 3HZTA 2H34A 1XH8A 3QTSA 4FJVA 4U0IA 5H8GA 2C5YA 5IQEA 1LEZA 3MDYA 4QQJA 4O7WA 4HCVA 1UWHA 1G8SA 2CLQA 4BZNA 2EB3A 3PVUA 3UODA 4S30A 1M7NA 4O4BB 3ZC5A 4H1JA 2ERZE 3FEGA 3LPBA 4PL4A 5CEQA 5CEPA 4DFBA 1O9UA 5EM7A 2YABA 3TIZA 2X7OA 4Z7HA 5EHYA 4YO4A 4G3EA 4C37A 4D1XA 2IZSA 1PXPA 2W99B 1MRUA 2CKPA 3GCUA 3DTWA 3VBWA 3AC2A 4V0GA 3HUCA 3ML1A 2JAVA 5KKRB 2R7IA 4RIWB 3ANRA 3HVCA 4JNWA 4GVAA 5HBEA 5H3QA 2JLDA 4WIHA 5AR8A 2I40A 3TCPA 2E9PA 4EWQA 2C1BA 5LJJA 4DFLA 5CF6A 4GG7A 4HYIA 4CKJA 3I6UA 4LYNA 4X6QC 3VUHA 3ZLWA 2OG8A 1P4OA 3QD0A 4TXCA 4DFZE 4AN2A 3TJCA 2HIWA 2FSOX 3QA8A 4MCVA 4ACMA 2ZV7A 2QODA 2BAKA 4FKIA 4QYFA 4RJ8A 4DYMA 3FMMA 5HTCA 5JEBA 5L2TA 1G3NA 3KVWA 5L6WL 3VUTA 3V5TA 4HOKA 4IQ6A 2CNVA 3FKNA 4EJ7A 3TEIA 4F78A 3D7TB 4D9TA 5IA0A 2QO7A 2X7GA 4IZAA 2OF4A 2WGJA 4BKJA 2R3GA 3ALNA 3UZPA 4BCMA 2GNGA 4UMRA 5JGDA 4E4XA 2EU9A 5DEWA 1YWRA 4ALVA 3BYVA 5JN2A 2BTRA 1OIRA 4C8BA 1XH4A 3QX2A 2R3QA 5A46A 1LUFA 3ODYX 4GFOA 4GYGA 3FPQA 4KIQA 4BDGA 1G8AA 4KB8A 4R3PA 2BCJA 4UYAA 4YHJA 2QO2A 2VTLA 4F7JA 3HV3A 3R8PA 2VO6A 5IQHA 3QQHA 1GZOA 3R7UA 4D58A 3S1HA 4QPMA 4L67A 3I1AA 1J7UA 1JSUA 1T46A 5I5ZA 4FTRA 2B0QA 4O7YA 2OIQA 1ZYSA 4QMUA 3BL7A 2BTSA 4EHVA 4FIGA 4N57A 1Q8TA 2E9NA 4BZOA 1MRYA 5EDRA 1Z5MA 5IA1A 1QL6A 1FVTA 4HGTA 5EDQA 3R28A 4FRFA 2ZM4A 3FLYA 2REIA 3TUCA 4PL5A 2NPQA 4WD5A 3EIDA 1ST0A 4FSMA 1UWJA 1M2RA 4XV9A 1IA8A 4F0FA 5L2SA 2JDOA 3MPTA 3AMYA 2ITOA 4D2TA 4Z16A 5I0BA 4I0RA 3BIZA 4F65A 5AX9A 3FMDA 3PJ1A 3E63A 4MXAA 3KULB 2F7XE 3O7LD 2X6DA 4D55A 4DEIA 2YISA 4PPBA 2A2AA 4AWIA 2WZJA 2GS6A 2XF0A 3TL8A 2BPMA 2ITXA 4XV3A 5D10A 4IX4A 4E93A 4WG5A 2YM4A 1YDSE 3MIAA 4ZLOA 2FA2A 3SDJA 4PUZA 1OGYA 4DGOA 3V04A 2XK3A 1HCKA 4YP8A 1W98A 3F3UA 3I81A 3LCSA 4ITJA 5HNBA 2HZNA 2VV9A 3A60A 4RX8A 5DRDA 2PUPA 3NAYA 3NRMA 3DAJA 3HKOA 3RINA 3WZDA 2GNJA 2JIUA 3LM0A 3EHAA 4RZWA 3KL8A 4IJ9A 4XX9A 4BCKA 2P3GX 5CU0A 1YWNA 5CF4A 4DC2A 2YIYA 4AACA 2YJSA 4IAYA 3QHWA 3DZOA 4D2VA 2R3OA 4O91A 5AP3A 4PNKA 5CAPA 3AD5A 5HG7A 3OWJA 4Y83A 2X8EA 3PPKA 1W2CA 1UU8A 3FY0A 2C3LA 4AA4A 3NUAA 2XYUA 4R6VA 5H8BA 1ZAOA 2PE0A 2JKOA 5C4KA 3LCDA 3R7VA 2IZRA 4OBQA 3FZ1A 3GC9A 3OXZA 3QFVA 3RCJA 3TZ8A 5J7BA 2JGZA 4LMNA 4QDEA 2P33A 4XP0A 4Y95A 3U9CA 2BRGA 2Y8OA 4X21A 4NSTA 5FTOA 1FINA 2KTYA 5DNRA 4YZNA 3SAYA 4EC9A 4O7LA 2FUMA 1REJA 4NM0A 4QQ5A 3FSFA 3GU5A 3PLSA 3RHXA 4QMNA 5EKNA 3W2RA 4RVLA 5BNJA 4DGMA 2C6LA 2R3IA 2B9FA 3Q6WA 1JQHA 4GEOA 4EOLA 5AR5A 2Z60A 2OXXA 2XJ2A 3BU3A 3GU7A 4UBAA 2B1PA 1Q8WA 2WELA 5AV2A 5A14A 3TUBA 2VD5A 3MY0A 5CI7A 3ZUVA 4F7SA 4TYHA 1YHWA 1YXVA 3HV4A 2C5XA 1H07A 4O4FA 1AGWA 2UZEA 3CY3A 5M4UA 4S32A 4O0WA 5LMKC 4QO9A 4AOTA 2IF8A 3A7JA 3DB6A 3VBQA 5EYCA 5EM8A 2Y4PA 3ZFXA 2ZAZA 4AXCA 3NEWA 3SRVB 4YTHA 4XBUA 2J51A 2WTCA 3NX8A 2UW3A 2XIKA 3MFTA 5E8SA 3ZM4A 4DHJA 2W4JA 4I94A 4WRGA 5HLPA 2WXVA 1KV1A 2ITWA 2WQNA 3G33A 3ORTA 4ZMFA 3WE8A 4C02A 3S00A 3U6IA 2OZOA 3VHKA 3EB0A 3LXNA 5EI8A 4K33A 3FYKX 3R1QA 3NCGA 4I4FA 5HIBA 5JRQA 3BLAA 3GFWA 1YKRA 3EL7A 3V5PA 3FZRA 2HY0A 3OTUA 3R02A 2CN8A 4B8LA 2BMCA 2RKUA 3C4WA 3QZIA 4DAWA 4U80A 3BHVA 1M2PA 3NIEA 2VTSA 3OCGA 1E1VA 3I7CA 5J87A 4JAJA 4G31A 5BYYA 5KUPA 5IEYA 1V0PA 2OJFE 2Z7SA 4LV7A 2W1ZA 1BYGA 4TYIA 5CWZA 3FJQE 4FSNA 5EDPA 2BZKB 5EW8A 2R3HA 5FXQA 5JZJA 2YM3A 3MH0A 5M08A 2J7TA 2F9GA 1URWA 5HO7A 3I6WA 4CRLA 2J6MA 4BL1A 3QA0A 3NLBA 3WZUA 4D4SA 3HGKA 1YWVA 4U43A 2RGPA 4DN5A 4JR3A 4M0YA 4TT7A 3IQ7A 5K5NA 3MB7A 2W17A 1MQBA 3UQFA 3DJ7A 4O0XA 3UIBA 3OWLA 3D2KA 2X2KA 5K3YA 3R7EA 3VUDA 2WTWA 5IA2A 5IDPA 3V8TA 1KE7A 1UVRA 5GHVA 3DK7A 4YSJA 5JKGA 4EL9A 4I5PA 4FK3A 5DIAA 2GMXA 4UWBA 4P90A 3COIA 4AFEA 4CG9A 3FMKA 4C4JA 5FTQA 4OTDA 3AQVA 3H9OA 2C5VA 2FB8A 2VTOA 3MY5A 4K2RA 3UVQA 5KKRC 3K3IA 4MQ2A 4L3JA 4BDDA 4RWKA 5FRIA 2XIYA 4ACGA 2Z7LA 4KRCA 1SMHA 4JOAA 4XLVA 4C3RA 1WBPA 4OT5A 3QQUA 4XUFA 4BI1A 3P86A 3D15A 4YNEA 4RVMA 2Z02A 2WQEA 4RWJA 2VRXA 5ACBC 4ANSA 3KMUA 4BZDA 3NFGB 4KIOA 5FXSA 3W2PA 5C4LA 2XH5A 4I23A 5IQAA 1ZMVA 2EXCX 4E6AA 1OUYA 2KULA 3PUPA 3PTGA 5JSMA 2BRNA 3PPJA 2YCFA 4OTPA 4O1OA 2WMBA 3LCTA 3QCYA 4BVUA 3CD3A 3RNIA 3RPOA 5J9ZA 2HWOA 3PSCA 3POZA 3QD4A 3DNDA 4CTBA 3R8ZA 1YOMA 3ZFMA 3UYTA 2YCQA 3TV6A 4QMQA 5F94A 5FWKK 3FMLA 4GH2A 4GW8A 4NKSA 4ANNA 1IASA 4CYIA 3ZDIA 4OBOA 1OBDA 3AC4A 3PLAE 4QP7A 2VZ6A 3WARA 2H96A 3LMGA 3NZ0A 3C4EA 3FLQA 5TT7A 5TOZA 5HG8A 4D4YA 4G16A 5C03A 3ZLSA 3MV5A 4JQ8A 5E8WA 1KSWA 3TYKA 1SVEA 2CCIA 4X2JA 5FEEA 4MAOA 4ZY4A 2W1GA 4HYHA 3BBWA 4ARKA 3AC5A 3B8RA 4EZ5A 2VAGA 3JVSA 3A8WA 1R39A 2PMIA 4F99A 4BR3A 4Q9SA 4EEVA 3LJ1A 2QURA 3QQFA 3LAUA 4XH6A 2VN9A 1QCFA 4BHNA 2UZUE 3MPAA 5D12A 2UZVA 3DV3A 5E8TA 3JY9A 4QMMA 4L6QA 3HV7A 4ANOA 1Q41A 1ZYLA 5KO1A 4IW0A 2V5QA 3FL4A 5KCVA 2XJ1A 3DDQA 1OL7A 2PVKA 4RFYA 3WIKA 4BCOA 4DFNA 4IM0A 1E9HA 4ZZNA 5CALA 5CX9A 3TM0A 3F2RA 3R71A 2IN6A 4ID7A 4BTFA 1DI9A 2C0TA 3A2CA 2UZLA 4YJRA 4E3CA 3LFNA 4AX8A 5T6KA 3ATSA 2BRBA 4FZAB 3MVJA 2JFMA 2I0VA 2QLUA 4HGEA 3BLRA 2HZ0A 4ZJVA 3TNQB 3D4QA 3LFBA 2C0OA 3RPVA 3V6RA 4Z9LA 4UB7A 5HIEA 5HU3A 3PYYA 4R77A 4UX9A 2C47A 3CPCA 4AE6A 4HW7A 4DA5A 3AKLA 4ASXA 1YI6A 1GAGA 5EOLA 3OHTA 4NT4A 4HNIA 1ND4A 5F9EA 1OBGA 4YJPA 4EHEA 4MXZA 3C0GA 2JITA 4FICA 3DLZA 3NUNA 2J5EA 4CLIA 4O1PA 2BR1A 2QU5A 3DKGA 4R1YA 3UP2A 3RGFA 3IECA 4FTNA 3OOMA 3QD3A 3ROYA 3QC9A 4LOOA 2W5BA 4IZ7A 2ITVA 2YA9A 4IB3A 4USDA 4D5HA 4TY1A 5IZFA 4H05A 4GIHA 4I4EA 5M4IA 3OUKA 1TQPA 2GFSA 4FKVA 4W4WA 4E73A 4M68A 4OTGA 2ETKA 3D0EA 1LPUA 2PVHA 3D7ZA 4IM3A 4W8EA 4K0YA 3WYYA 4FSWA 2Y0AA 3R1YA 3E8EA 4XJ0A 4GMYA 5KHXA 4A9TA 1CM8A 3R1NA 3QGWA 4NCTA 4WHZA 4MBIA 2JDRA 2R5TA 4TWPA 4AA0A 4TZRA 1H1RA 4KRDA 4XP2A 3R30A 2O0UA 3UNZA 5DGZA 1V1KA 2X81A 4GIIA 4C34A 3R8LA 4BFMA 2YCSA 3P1AA 3AXWA 3R9NA 3GQLA 4CFWA 3F9NA 4F0GA 3F88A 5CEOA 1QPJA 3T9IA 3HV6A 3PY0A 3TIYA 2DS1A 4WNOA 4S31A 5D11A 3D5WA 1BUHA 4W9WA 4DT9A 3GCSA 2YZAA 1B6CB 1YOLA 2YITA 4RVTA 4L68A 1PXLA 4KWPA 5F4NA 4LV8A 4F63A 3BZ3A 4OUCA 2B9IA 4YHFA 3ALOA 4X2KA 3L1SA 4IIRA 4YBJA 1U5QA 4YTIA 1RW8A 3DBFA 4AT3A 4C61A 4CT2A 1GZNA 2PY3A 1Y57A 3BV3A 3GUBA 4J96A 2QOIA 4XRJA 3U55A 5DR9A 3C0IA 3E87A 4CKIA 2O8YA 5ETCA 5K0XA 4ZY5A 5CXZA 3QZFA 2OJGA 3W33A 5IISA 3W2CA 5G6VA 4C4EA 4K9YA 1ZZ2A 1H27A 2HK5A 5ETIA 4DEEA 2OKRA 1Q99A 2ZJWA 4WG3A 3UZRA 2HELA 3O0GA 3WZEA 4D2PA 2R4BA 1MP8A 3LZBA 3MJ1A 4TYGA 4EKKA 2GS7A 3K54A 3U4WA 1SVHA 1BI8A 5T3QA 3RALA 2OK1A 4DDIA 3EFJA 4PDOA 4M14A 1NXKA 4W4XA 2B4SB 3DK6A 3NS9A 4LGGA 3SW4A 4F7LA 5B2MA 4J8NA 4IWPA 1ST4A 4BIEA 3Q9YA 4D1SA 1OGUA 4G17A 4I6LA 4X6RA 5F95A 4A4OA 1BL6A 1YDTE 1K2PA 3OVVA 4JAIA 4KUJA 3BGZA 4RVKA 3F3VA 3RWQA 4QYGA 2PMNX 5DR6A 4MF0A 4IADA 3CR0A 4Y73A 3DT1A 4B4LA 4FIJA 1CDKA 4PV0A 2OIBA 3IW5A 3W18A 4R78A 3O7LB 3HUBA 4R5SA 4LRKA 5DPVA 4EH8A 3PE1A 4IMYA 1UU3A 5LVPA 2OJIA 2BDWA 3PXRA 1JNKA 2DQ7X 2UZNA 3FI2A 3G0FA 5HNGA 4MWIA 4YPSA 2Y6MA 4YJQA 4RFZA 5KMLA 1E1XA 4O0RA 4ZTSA 3ZRKA 3S2PA 4QP4A 2PVNA 4K8AA 3O23A 3Q32A 3SVVA 4D0WA 4PTEA 2PPQA 2RFDA 3FC1X 5AM7A 3F69A 2W96B 3COHA 5DN3A 3VN9A 3C5UA 3HRCA 4RIYB 5EW3A 4CYJA 2XAMA 3TI1A 4FYOA 1LR4A 3CGFA 1TFFA 1KE9A 3GP0A 3KMMA 4I0SA 4OTWA 3ZS5A 4ANBA 5IH4A 1U46A 2J90A 2XJ0A 3RAWA 4ZLZA 4PPAA 3G6HA 3TACA 4JS8A 1ZYDA 1EH4A 1H4LA 3KFAA 4GRBA 4RMZA 1DAWA 3PA4A 4MD8E 4BBEA 4D28A 3DFAA 2R0IA 3FZSA 5I9YA 3H4JA 3TNHA 4EORA 2ZM1A 5FUTA 1CSNA 2A27A 4GK4A 4HGLA 4WG4A 2XNGA 3LCKA 4XHKB 5HD4A 3C51A 2PHKA 5KNJA 4PQNA 1ZOHA 5CS6A 3HAVA 1KE8A 4FOCA 3TMOA 5A9UA 4KBKA 2GFCA 3O96A 4FTAA 5CZIA 3HMMA 4G9RA 2HY81 4AAAA 4FL3A 3ELJA 4BCQA 2RIOA 1V0BA 1B39A 1OL5A 2QQ7A 3ORKA 3QZHA 5EI6A 3FYJX 4HCTA 3OZ6A 4I5CA 5CT7A 1F5QA 2JIIA 3PSDA 3D83A 1WFCA 5FP5A 4OAUC 3IDBA 3BX5A 1PRYA 1FQ1B 1KOBA 2W1FA 3F5UA 1YI4A 3OOGA 4H58A 4IAIA 4JX7A 3FAAA 4QT1A 1FGIA 4FKQA 2XZSA 4Y72A 3AMBA 4N4SA 3HDNA 3UGCA 2ZV8A 3QCXA 3KK9A 3CLYA 4FTQA 2B7AA 4FKGA 1WBSA 4P2KA 2R2PA 2V7OA 4H3PA 2WU7A 3ZMMA 3W2QA 5IUHA 3PRIA 4C3FA 5B0XA 4GJ2A 4QTCA 3MGYA 4EOMA 1HOWA 3N4UA 3P9JA 2J4ZA 4ZP5A 5AMNA 2PUIA 2A1AB 2FSLX 5B2KA 2WMRA 4F6SA 4O0UA 4QMOA 1OL2A 4NM7A 4RPVA 2YN8A 3QYWA 5HD7A 1ZOGA 4QQTA 3UDSA 3DNEA 4HZRA 4DCAA 3ZO3A 3IG7A 5M44A 3Q96A 2QHMA 4W4YA 2HW6A 4BN1A 2QKWB 1KE6A 3GU4A 4IWQA 5HO8A 5IG1A 5H2UA 4QMWA 5AUTA 5K9IA 2CNUA 4FTKA 4ENXA 4IE9A 2C6DA 1ZY4A 4EONA 3NW7A 4YJUA 4U40A 2F57A 4BCJA 4QNAA 3EQPA 4F70A 4J97A 3O8PA 1STCE 2VTTA 2VWIA 3C9WA 4HZSA 5EFQA 5HBHA 3QX4A 2CKQA 3Q9XA 4O0SA 4E6CA 4EOOA 2Z7QA 3VS6A 4KSPA 3SXFA 4AW1A 4F6UA 4PP9A 1DI8A 4UALA 3P08A 5I4NA 1OB3A 3E92A 4NU1A 5IQFA 5HZNA 5G1XA 3EFWA 5JFVA 3HA8A 5K4IA 5IQGA 5TR6A 2YFXA 3UDBA 1ZYJA 3K3JA 3ZRLA 4BCIA 2OLCA 2JAMA 2X0QA 5CVHA 3L9MA 3M1SA 2BUJA 4Y5QA 2GTMA 5A4TA 4DE4A 4O96A 4P5ZA 2R64A 3VBVA 2J5FA 2XYNA 4E1ZA 2GTNA 4Q5EA 2F7ZE 5DWRA 4C2VA 4JDHA 3QXPA 2P55A 4KNBA 3FXZA 4F9CA 5BUJA 2ZM3A 3MI9A 1Y8GA 1WVXA 1XH7A 3CE3A 3DBQA 2VX3A 3ANQA 3S3IA 3MN3A 3C1XA 2YACA 2RL5A 5AADA 1O6LA 5DE2A 2HWPA 2UZDA 3DCVA 2CKEA 3O17A 2XNPA 4FKSA 4R8QA 4XG7A 4G5PA 3SGCA 3POOA 5CZHA 4MNFA 1H1QA 3GOPA 4TPTA 4LDTA 5ANOA 3TZMA 2JD5A 3KMWA 4I1ZA 4G3GA 1ZARA 5HCZA 1G5SA 4YC8A 4BTJA 3NR9A 3DPKA 3PRFA 3IO7A 2PE1A 4HNFA 3CC6A 3ZFYA 2XUUA 3Q9WA 2R3RA 3QAME 1JBPE 3FZPA 5DEYA 3ZEWA 2GCDA 5CLPA 4X3JA 3KF7A 4HVSA 3F7WA 4FNYA 4Q2AA 5EM5A 5C8KA 5I3RA 2C68A 2QG5A 4YZBA 1PY5A 4FL2A 4RJ5A 5CU4A 5CQUA 2YM7A 3HP5A 3IW8A 4FEXA 2ETRA 3V5LA 2HAKA 4UYNA 4RIOA 1ZMUA 4ZY6A 4EZ7A 3VF8A 3U6JA 2R7BA 1JKLA 5CSXA 3D2IA 3QQKA 4MBJA 4RLKA 4F08A 1WBNA 4V0GB 1YXSA 1JSTA 4R7HA 3OC1A 1P5EA 1W2DA 4U6RA 1FPUA 3ET7A 2XM9A 4GK3A 4GT4A 4GSBA 4LV5A 3WF9A 5D7AA 3VJOA 4F0IA 3K5UA 3NYXA 3A7HA 2A0CX 4A9UA 3I0QA 3CS9A 4RC3A 3CXWA 3R9HA 3BHYA 3NAXA 5CAVA 3AT2A 3LLTA 5JFWA 4YGAA 4KKHA 4L7FA 4WNPA 5BVFA 1OVEA 1J1CA 1JWHA 4YJNA 5KHWA 3KRWA 1H08A 4FNWA 5AA8A 3UO4A 3W0NA 4LUEA 4ZXTA 2UVYA 4HYSA 4F7NA 3UQGA 5HESA 4QYEA 1OZ1A 4ANMA 4X2NA 4AZEA 2W1CA 1SYKA 2XANA 2PZIA 4M67A 3QBNA 4J71A 2QONA 3ORNA 4EQUA 3ENMA 3LFFA 3Q2MA 4E8AA 3DJ5A 4YUQA 1XMMA 4DGNA 5LXMA 5E8UA 1SM2A 4E4NA 2OICA 2W7XA 4F9BA 1OKYA 3V8SA 3KXGA 3MFSA 3LXPA 4JDIA 4JBVA 4AGCA 2XKDA 3RMFA 3AGMA 5AEPA 3LFQA 3EN5A 4AQCA 3TV7A 2RG5A 4PNIA 4UEUA 3HV5A 3ZO4A 4ZS0A 3DXQA 3BU6A 4PF4A 2G15A 2PMOX 3OG7A 4CD0A 2X2MA 4M8TA 4DH5A 1JKKA 2QCSA 5F20A 2QU6A 4ZK5A 4IWOA 4Y5HA 4GYIA 2ACXA 3OT8A 3AMAA 3FPMA 4JMQA 2W1DA 4C57A 4PWNA 5CNOA 3QQLA 1YHSA 2C6OA 3L8PA 4F1MA 4KIKA 1VEBA 2I1MA 4A9RA<