3FHIA

Crystal structure of a complex between the catalytic and regulatory (ri{alpha}) subunits of pka
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
338
structure length
336
Chain Sequence
ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLAGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Crystal structure of a complex between the catalytic and regulatory (RIalpha) subunits of PKA.
pubmed doi rcsb
source organism Mus musculus
total genus 107
structure length 336
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fhiA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fhiA02
3DLZA 4W4YA 2YCQA 3CEKA 4Y85A 4OBOA 3UVPA 3QD2B 1NVSA 3RNIA 2PSQA 4FI1A 3RPYA 3LQ5A 4YTCA 3OT8A 2R2PA 5DN3A 4FICA 4RJ7A 4XOZA 2W96B 3DY7A 4M84A 4ZOGA 2KULA 1U54B 2R3HA 4GFOA 4JQ8A 4ACDA 4BTKA 4F09A 4S34A 1OL1A 3C4XA 3LLAA 4AXAA 4JG6A 3VHEA 4AN9A 1ZOGA 4EOMA 2ITOA 4ZZOA 5DMZA 4FSMA 3D94A 1Q61A 4PPBA 5A6OA 5E9EA 3U87A 4AP7A 2XIRA 3OEFX 3IGOA 5FXQA 3BGQA 2C0IA 2XP2A 3PY3A 4NIFB 4K9YA 3PWYA 2C1AA 3EH9A 1L3RE 4MYGA 4J1RA 3QQKA 4KKEA 4QO9A 4S31A 4NH1A 4TPTA 4ZY5A 3FPMA 4D4RA 4M8TA 5CWZA 1GZOA 2PUPA 2QOIA 4QT1A 4JDIA 3BYMA 5B0XA 5J95A 5CAPA 1A9UA 4FEXA 4UY9A 1F5QA 2C47A 3DNEA 2W99B 2WQMA 2WAJA 3NAYA 4JDKA 2V5QA 4X2FA 3ZO3A 2ZVAA 4BC6A 4E20A 3P7BA 2P0CA 1PF8A 2A4LA 3FXWA 4JR7A 4MKCA 4DBNA 1OECA 3TT0A 4ZTHA 2X7GA 3ZYAA 1FOTA 5JGBA 1YWNA 3U6JA 5AV0A 1PXIA 3MFRA 3LAUA 4L43A 4W9WA 3RZBA 3F61A 1H28A 3ZBXA 4FODA 1SVGA 4F9WA 3QZIA 4FSZA 3E7VA 4J97A 4EUUA 2ITZA 2PULA 3KXHA 5FTGA 3R63A 3KCFA 1ZMVA 3NUNA 4RIXA 1FINA 1BMKA 2F7EE 3IW7A 5F94A 1OIQA 4B8LA 4DFUA 3P0MA 5DE2A 2PMNX 1JAMA 1Q3DA 2JFLA 2UVYA 2FYSA 2OH4A 2Z8CA 4YJPA 1SNXA 2ETRA 3MB7A 4KSPA 2HW7A 4FUXA 2JDVA 5CEOA 3QX4A 1UNHA 5KCVA 3VN9A 5L2QA 1CDKA 4RIOA 4JT3A 5AJQA 4KKGA 4DGMA 2QU6A 3BRBA 2VTLA 4L3LA 2XK7A 4Z55A 2WOUA 4YTHA 2WPAA 4BCNA 3F2RA 2J90A 4FC0A 2WMXA 3QTZA 4JG8A 4ZSEA 4FZ7A 4HYUA 4RG0A 5K4JA 2AC3A 2XKDA 2PZRA 2BHEA 3R7VA 2PVYA 4TYJA 5AAGA 3WIKA 4B6LA 2HWOA 2P2IA 3AD6A 3HDNA 3PXRA 2XK4A 4IADA 1VR2A 4FIFA 1SNUA 4XV2A 5CQUA 3NW6A 3ZMMA 4F4PA 4JOAA 5AP1A 2C6TA 5KKRB 1WBNA 3U51A 2W17A 4OTGA 3PA4A 4BDIA 2WIHA 3DJ6A 2OZAB 1PXPA 2VWBA 4GJ2A 4AX8A 5AV3A 2YWPA 2I7QA 3F2AA 3N4UA 2CGUA 4Q5EA 3AQVA 4FKUA 5CAQA 3IDCA 2AUHA 3CLYA 5HO7A 2W9ZB 3O96A 4A07A 3DKOA 5IH5A 4NM7A 4M14A 4F70A 3OZ6A 2X7FA 5HTCA 2XKCA 2UW8A 2WMSA 3EYHA 2QU5A 4N70A 4YSJA 3O8PA 5K4IA 2G2IA 2C68A 3EZRA 4RX7A 4BIEA 2A0CX 4CKJA 3QHRA 4FTNA 3P79A 5KMOA 2CPKE 2HZIA 4O1OA 2W7XA 4JJRA 4CKRA 3ULIA 4GK3A 1Y8YA 4D2TA 4DTAA 4R5YA 3GFWA 4Y83A 2PMIA 2P4IA 3KMMA 5AUXA 1LEZA 4I0SA 5ETCA 4Z16A 5HNIX 4AZSA 3PJ3A 1M2QA 4DH1A 4H36A 4EZ3A 3CC6A 4I24A 2Y6OA 2R3OA 4GU9A 5BYYA 3QCXA 5HE3A 2HW6A 4YMJA 3ZRLA 1BX6A 4BBFA 4MWIA 2P3GX 3C5UA 5T3QA 3TZMA 3E8CA 3ZO2A 5JGAA 2WTDA 3V5LA 2XBAA 4O83A 3JY9A 1Q5KA 3VC4A 5ANDA 3MYGA 2PE0A 2R3JA 3BQRA 3VQUA 3G2FA 2PY3A 4XEYA 3PLAE 1DM2A 2FSOX 3RPSA 4NWMA 5C03A 3LXPA 4ASXA 3GEQA 2PZPA 3BEGA 4FEWA 2GNFA 4FKPA 4UB7A 4FZ6A 4EH7A 2V7OA 3S4QA 2ZMCA 2FSMX 2X8IA 1BKXA 1HCKA 1NVQA 2QC6A 3GP0A 3GU8A 3ZUVA 4YR8A 3EN5A 2RG6A 4AS0A 5BVOA 4DEHA 4ACMA 4XV3A 2GS7A 2IZUA 2ITQA 4IJ9A 2X6EA 4GH2A 5IA5A 3A7IA 3CGFA 2WD1A 4FVPA 2QNJA 4GEOA 3EWHA 4L00A 3COKA 3E8EA 5BVKA 3G90X 3L9LA 3E63A 4HNIA 5ANEA 4WBOA 2YAKA 4N4SA 3A62A 3F2NA 1U54A 3VWAA 3ZEWA 4EQCA 3AMAA 4YNEA 2OH0E 4Y72A 4D1ZA 3MVLA 4RC2A 4BCIA 2Y8OA 4XCUA 4AAAA 4DG2E 2BKZA 3Q3BA 5HCZA 5LWNA 3ITZA 1STCE 3O8TA 3BKBA 4K1BA 3A7JA 1PMUA 1M7QA 3QBNA 4MVFA 4NIFA 3EQHA 4HVHA 1XH4A 4GUBA 5I9YA 3MVHA 3UIMA 4MXZA 3LKMA 5KBRA 3HZTA 4PV0A 1YDSE 2PVRA 4LUDA 4KKHA 5EYDA 4EH6A 5JQ5A 3NSZA 2ZMDA 2WQBA 3FZRA 3P86A 2W5HA 2DYLA 3LVPA 1H01A 5F1ZA 4XP0A 3VS4A 4UWYA 2KTYA 4FOBA 3ORMA 3BPRA 4C35A 1BLXA 2VZ6A 4NKSA 3GOPA 2IZSA 1IASA 2DS1A 2EWAA 4BGHA 4MNEB 4D1XA 3HAVA 2XNNA 1JSTA 4F9YA 4JBVA 3V6RA 1O6LA 3MFUA 3E87A 5KO1A 4ANMA 4YZ9A 5DR9A 3Q96A 3FI3A 1PY5A 2C6LA 2W05A 2I0YA 2OGVA 2BRMA 3CPCA 1QMZA 3DK7A 3OC1A 3VAPA 5HU9A 5IQCA 4DN5A 3GXLA 4IM2A 3G33A 4NM5A 3C1XA 4YPSA 3VUTA 3VJOA 4UMQA 3ROCA 2XK6A 4EK6A 2RFNA 3DBDA 2GS2A 3Q32A 3H0ZA 4C8BA 3E3BX 4IQ6A 2YIXA 4KSQA 4GK4A 5AR3A 4FKOA 3UG1A 3V51A 5J9LA 3C4CA 1DAYA 3TV4A 3KXZA 3DFAA 3ERKA 3KVWA 4I6QA 4YJTA 5LVMA 2XBJA 1TQMA 2YIQA 1RE8A 2Y0AA 4GV1A 3TNPC 4NJDA 2J5FA 3D5WA 3TJCA 4BRXA 2OIBA 4WKQA 2EUFB 2Z60A 2BRBA 3EQIA 4IWQA 5J7HA 3QTQA 2A19B 2OSCA 3KFAA 2R3QA 4MBIA 4BCFA 4DA5A 5GZAA 3TIYA 1PXMA 4MQ1A 4EBWA 4AZTA 4I6FA 5EM6A 2BALA 2QD9A 2W1ZA 1G8AA 3TZ8A 3KRRA 2CKQA 2VWWA 4EYMA 5CASA 3BYUA 3JY0A 1LUFA 5H8GA 5DNRA 5J87A 5IA2A 1H08A 4ZSAA 2OZAA 3OCSA 3ZSGA 3G6HA 4Y8DA 2R0UA 4C02A 2RG5A 3PYYA 2VO0A 3W2RA 4S2ZA 1P14A 1JVPP 2A1AB 2WU6A 4KD1A 4XOYA 2VWUA 4W4VA 5IPJA 3NW5A 5D41A 3H4JA 3LJ0A 5KNJA 3R9HA 2QOLA 4QYGA 2BTSA 2R7BA 5D9HA 5EYKA 4YURA 4OTWA 1H1WA 4RVLA 3F3ZA 5ICPA 4TT7A 3LQ3A 4AT5A 2JDSA 3RKBA 1RDQE 3DGKA 2XIYA 3HP2A 3MA3A 3ET7A 3Q5IA 4Y46A 3TZ7A 1OMWA 3W2OA 2PHKA 4BIBA 2OXXA 5AP0A 4QTAA 3NVKI 4CQGA 1F0QA 4D9TA 3WZKA 5IZFA 3PY0A 3PA3A 4O0WA 4MXAA 4ZLZA 5DT0A 2VGPA 5AP3A 3VUMA 1MRUA 4OTPA 1GNGA 3MPTA 4AE6A 5L6PA 2GNJA 2O5KA 3LJ2A 5IEXA 3C7QA 4II5A 3K2LA 5TR6A 2W5AA 2J2IB 4LUEA 5E8XA 3VS7A 4AN2A 4FSUA 4XV9A 3QCYA 1XH7A 5M4CA 4RC4A 3OTVA 2P2HA 3LE6A 5M57A 3BV2A 4KIQA 4CKIA 2BR1A 1BL6A 3GC8A 3BGPA 3R1NA 1V0BA 3V3VA 4AOIA 4BWXA 2C69A 3PXYA 3ZZWA 4EH5A 5BYLA 3I81A 5I3RA 2G2FA 4RPVA 4A06A 4CT1A 4DG3E 4F7LA 4KBCA 4RWLA 1O9UA 3RAIA 2XUUA 2WEVA 3WYYA 4CFWA 2WTJA 4ASDA 2ERZE 3HV3A 1AGWA 1YI6A 4RSSA 3VS2A 1J1BA 4AGCA 1YDRE 2J51A 3OG7A 2WTKC 4OT6A 5ANKA 1GIHA 3P1AA 4YLLA 2WZJA 4FGRA 4JQ7A 2O63A 2W4JA 3FMNA 4FA2A 3SQQA 5HBEA 4LL0A 2OI4X 3ZXTA 4ANNA 1NA7A 4L7SA 3FI2A 1ZMUA 2VTQA 4YJVA 3FL5A 3BHTA 3RVGA 4ZLYA 3R9RA 1KWPA 4BZNA 4RJ5A 2QR8A 5DT3A 3ZUUA 2J0LA 3BEAA 3BYOA 3QRUA 2CGWA 4XH6A 2GNLA 3UIBA 1Q99A 4PDSA 4QPMA 4UXLA 5I9ZA 2JC6A 5AR2A 3FC1X 2OJGA 2QOKA 3KU2A 4QMSA 4ALUA 3NZ0A 4KRCA 4ZSGA 4WT6A 3DU8A 5J1WA 2F2CB 3NAXA 1OM1A 5I4NA 3LPBA 4FF8A 2WNTA 4I5CA 4U5JA 3C0IA 5IH4A 3M42A 3P4KA 3R2YA 2IO6A 4XG2A 3TACA 4WRSA 3IONA 2NRYA 5L8KA 4E5BA 4XG9A 4YJSA 4B7TA 1G8SA 1OUKA 1R0PA 3KY2A 2OJ9A 3NR9A 4J52A 1ZY5A 2HZNA 1ZLTA 2ITTA 4CRSA 3PXQA 3VS5A 4CT2A 3TEIA 1YXTA 3MN3A 3ZEPA 4MF1A 4E4LA 4UEUA 2F4JA 2XNPA 2VTNA 3RAHA 4DHFA 1EH4A 3COHA 1J1CA 1YXVA 4MNEA 3DKGA 4C61A 4EJ7A 1E9HA 4FIJA 1GY3A 3D5XA 3MTLA 3LHJA 3HV7A 3LCDA 5FXRA 4MEDA 4ZSLA 3IW8A 3V5QA 3R22A 4YHFA 4FUYA 3CKXA 3GCUA 2HYYA 5B7VA 4U40A 4AUAA 4IZ5A 3PP1A 5JMSA 4ENXA 2OG8A 5IG1A 2OFUA 3ZHPC 2G2HA 2WMAA 3GNIB 4RJ3A 3FL4A 3L8PA 4QMNA 4CG8A 1ZYJA 4QP1A 4O38A 4Y5HA 4BHNA 4FSTA 2DWBA 3EL8A 4RVTA 4EUTA 3IPHA 5H2UA 4G3EA 5G6VA 4B4LA 3JVSA 3EZVA 3RZFA 4O7ZA 2HWPA 3L8XA 4FTRA 2GHMA 4EH8A 2ITVA 5HG8A 4E8AA 3QU0A 4BR3A 4F1MA 3FKNA 4YZMA 3OY3A 3UOLA 1DS5A 2I0HA 2IVTA 4IX3A 2ZDTA 3NNXA 5EHLA 4CGAA 4V0GB 2XYUA 3G0EA 3UPZA 4ANLA 5EHOA 3O0GA 3BV3A 3FPQA 2WQOA 2X1NA 5BVDA 3QQFA 2Z02A 2X9EA 3FEGA 4UXQA 4F65A 3PSDA 2UVZA 4ITHA 2X39A 3HLLA 4IAFA 2XJ1A 2VWXA 4OUCA 1MQBA 3SVVA 1G3NA 3A7HA 3HA8A 3QZFA 4QQCA 4DEDA 2NO3A 1JKLA 4QYYA 5E8UA 3KXMA 5FP5A 5H8EA 2QOCA 3HX4A 3R7GA 3OVVA 3MY5A 3R8VA 3W18A 3IK3A 4YSMA 4M3QA 3F5GA 1OL7A 3NRMA 4MXCA 5EOLA 2UW9A 1ZYDA 4P5ZA 5FEEA 5AWMA 4C34A 5AP5A 3AC8A 4A9SA 5J79A 2OFVA 3MFSA 2JDTA 2VTIA 4FG8A 5CSXA 4L7FA 3TL8A 1GIIA 2CDZA 1Q8ZA 3VBQA 3U4WA 1U46A 4O7WA 4RRVA 4BHZA 3VS1A 3G9NA 3HECA 4LM5A 4RIYB 4YC8A 3MWUA 3R7EA 4EH4A 1WVXA 3QQHA 3HYHA 4BDAA 1H4LA 3UC4A 4X7QA 4FSNA 4QMLA 5CAOA 3KB7A 4W9XA 5LJJA 2W5BA 3FDNA 5A4QA 5IU2A 2VTRA 2XK8A 3PVUA 5H3QA 2QHMA 3UTOA 1R1WA 4Z7HA 5FWKK 4WNKA 4C7TA 3IW5A 5KMJA 4FEVA 1FQ1B 2W4KA 4F6UA 3JYAA 2YM4A 3RMFA 5HU3A 4MNFA 2YISA 4R5SA 4RJ8A 3NYNA 4KIOA 4M67A 3RP9A 2ITWA 2CKOA 4O1PA 4DEBA 4HYHA 2X2LA 3HV4A 4ZS0A 3V5JA 2R0IA 4O7VA 4B0GA 2X8DA 2PTKA 1W98A 2CNUA 2OIQA 3P78A 2C3LA 3K5UA 2VO3A 2YA9A 2GCDA 3LFSA 5A4EA 4O0TA 1Y8GA 1H24A 4RA4A 4D4YA 4FT3A 1BUHA 4GKHA 2PMOX 2WTVA 4U3YA 4D2SA 3FQEA 1M2RA 5EDQA 5L3AA 4BTFA 2J9MA 3CQUA 3IO7A 4BWKA 4PP7A 2HY0A 5CEQA 5GIPE 2GQSA 3VW6A 2ZV2A 4ZSJA 2BKKA 2W9FB 5FRIA 5K9IA 1YXSA 3PXZA 4FV0A 3HKOA 3GCSA 1ZOHA 3FMKA 3NYVA 4JQEA 4DH3A 4E4XA 3U6HA 1Z9XA 5CALA 4F9BA 1YXUA 3POOA 4GCJA 3HEGA 4I23A 5CSVA 4U97A 5FDXA 5I5ZA 5DHJA 1E1VA 3L8SA 4E1ZA 4IJPA 2EB3A 4DTBA 4IAIA 5CU6A 2O0UA 2YFXA 2C5OA 5IA4A 4BI2A 1WBPA 2CGVA 2WMUA 3BLRA 4K6ZA 2FSTX 4E4MA 4XP3A 2QG7A 1Q8WA 2J7TA 2VTSA 3CBLA 3NCGA 4MD7E 5CX9A 3VBXA 2UW4A 4AG8A 4ZAUA 4RX5A 2B52A 5CZIA 3CE3A 3QQJA 4IB1A 4CMOA 1XBCA 5HNGA 3UJGA 4GJ3A 1TVOA 1OKZA 4S32A 1P2AA 3MH1A 4BCOA 4ZMEA 1H07A 4DE4A 4ZZMA 2JFMA 4FBXA 5J5TA 4ALVA 4BL1A 2YM5A 5J1VA 5IUIA 4ACCA 4IW0A 4FGBA 3NWWA 1Q24A 4APPA 2RSVA 2VN9A 2Y7JA 3VO3A 5HIDA 3QRIA 3QTIA 5GNKA 2CKPA 3I0QA 2YAAA 3ETAA 3W2QA 4FTIA 4Z7GA 5BMSA 3AGLA 5H9BA 4LI5A 4FV2A 3BHVA 4CMUA 1Q8YA 4RIWB 2B4SB 3D14A 5CF6A 2JITA 4UALA 3H30A 2XKFA 3W32A 4HPUE 2JDRA 1KOAA 3QQUA 4RWJA 3UNJA 4PF4A 4ERWA 3EQCA 4QMZA 2ITUA 3DXQA 3FUPA 4V05A 4DEAA 4XUFA 4I6BA 4H3PA 2VX1A 2X8EA 3DAJA 5EW3A 3ORPA 3S0OA 5EYCA 4IX5A 5KKRC 1H1QA 3QWJA 4O6EA 4IX6A 3NS9A 5EHYA 5GJGA 2GNGA 4KS7A 4HOKA 5AMNA 3R8MA 5HBJA 5D11A 1FGIA 5JFVA 2BCJA 3D9VA 4CCBA 4AT3A 1R39A 4ACHA 2WOTA 4FTKA 2QVSE 2E2BA 4J71A 4ZY4A 3PFQA 3N51A 1HOWA 1W8CA 2BDWA 3GQLA 3F5PA 2GTNA 2YZAA 3OT3A 3QTUA 3ORTA 4G16A 3PY1A 3F6XA 4U81A 5E91A 2R3GA 4QMTA 3SXRA 1O6KA 4AA0A 3FZ1A 4E6CA 5E8ZA 4OAVB 3IS5A 4AGDA 4D0WA 3G0FA 5CEPA 1H00A 1U5QA 1Y57A 2BDFA 3CY2A 3Q9WA 4FT7A 4V0GA 5AIKA 5CYIA 5AP7A 5LMKC 2WMQA 3LQ8A 3RPRA 4LRKA 5CT0A 4B9DA 4EK3A 5JH6A 1MP8A 1ATPE 1X8BA 2HK5A 4LMNA 1B39A 2B9HA 3EKNA 4I94A 3GENA 4GMYA 4O2ZA 4EBVA 4XV1A 3R8PA 4QMYA 3ATSA 3CD3A 5AR5A 5E4HA 2R3IA 1UKIA 3OW4A 3EOCA 5KMKA 4K11A 4UMTA 3UQCA 2VO6A 4YJQA 3OFMA 4G17A 5AUWA 5AFVA 3GFEA 2LGCA 4LYNA 3I4BA 1CTPE 4BCPA 3DBFA 2E9UA 5IQIA 4C33A 5CVFA 4WO5A 1QPEA 4XG3A 3TM0A 2X7OA 4C37A 1CKJA 4UZHA 4JBQA 3KXXA 4I5PA 3BHHA 2GTMA 4NYEA 5G1XA 3QX2A 5I9UA 3I0OA 4I41A 5F20A 1KE9A 3OROA 3Q2JA 3BU5A 4G6OA 4Q5HA 3OXIA 4RIYA 3BZ3A 2WMRA 4LOPA 5FXSA 4C0TA 5M55A 5KMMA 4XLVA 5AEPA 4BDEA 1T46A 4AA4A 1CKPA 4UX9A 3PA5A 4DLJA 3PTGA 5HX8A 3A4OX 4N0SA 3DT1A 4EZ5A 3B8QA 3OD6X 4NUSA 5L2TA 3F3VA 4MXYA 3KRWA 3MIYA 2IW6A 4PPAA 4EHZA 4FKVA 2YDKA 1VJYA 2ETMA 3CJGA 3FMHA 4KA3A 5BUIA 3ALNA 3DOGA 4CQEA 4F9AA 3PG1A 2HXQA 3TXOA 5L2WA 2W4OA 1YOMA 5FP6A 2YCRA 4O82A 4O6LA 1PXNA 2PL0A 4GIHA 4E26A 3I1AA 4NCTC 1W84A 2JBPA 5HE2A 5DG5A 4TL0A 4GK2A 1ND4A 3PZHA 2XCKA 3VBVA 2WFYA 5I9XA 1MRVA 2Y4IB 4OTDA 4BCQA 3FQSA 3RJCA 2Z7QA 3TNWA 3HNGA 4MCVA 4RLKA 3FMMA 3RWQA 4QMXA 5BQ0A 5K5XA 4LV8A 3PE1A 1I09A 1OI9A 4U8ZA 2BMCA 4G3CA 5DRBA 3R8ZA 3NUSA 5JFXA 3UQFA 3FC2A 4CG9A 4DEEA 3R30A 4HVGA 2OW3A 5DT4A 2YCFA 4JXFA 4EOJA 5IH6A 2X4ZA 5CXHA 3W8LA 2VNYA 2BHHA 4IZYA 2BVAA 4EQMA 5M51A 3A8WA 1M2PA 3AT4A 5M4UA 3QKLA 3PRIA 5T6KA 4PNKA 3UZTA 2ETKA 3A99A 2X2KA 3IGGA 3L9MA 3POZA 4ZTQA 3V8WA 4IH8A 5E7RA 4EOLA 3V5TA 1XH9A 3R00A 4KBAA 2E9VA 1JKTA 4OLIA 3FHRA 4FKSA 4PDOA 5CY3A 5CNOA 4AOJA 4G6NA 4DEGA 3R02A 5FQDC 4PL4A 3UP7A 2X6DA 2BUJA 2WELA 4X6RA 4AU8A 2BFXA 5DFPA 2UW0A 5C8NA 3QTXA 5L6OA 5CVGA 1UU7A 4CFUA 2XVDA 5DR6A 2W0JA 3VBYA 3FY0A 2PZIA 3OWLA 4I3ZA 1PW2A 3DZQA 3LW0A 4HVIA 4AACA 3MDYA 3NVMB 3GI3A 3F3WA 4KBKA 4QPSA 3DBQA 3I5NA 5HO6A 3QCSA 4I0RA 3LCTA 3HRBA 2JKQA 3QAME 3NIZA 3BBWA 2E9OA 4BFMA 1Q97A 5HD7A 4QOXA 4CLJA 3SG8A 5J8IA 3QZGA 4D2PA 4X2KA 4F9CA 3QHWA 5C4LA 4FSYA 1WAKA 3HMPA 4FTOA 4ZMFA 2LAVA 1MRYA 3SOCA 3QLGA 5DPVA 3KQ7A 3TJDA 3VRYA 4RIWA 4E3CA 3GOKA 1FVTA 1JNKA 4I92A 2JDOA 4IMYA 4U3ZA 1KE7A 4Y73A 4FVRA 1OPKA 2Z7SA 3EN7A 2QOFA 2PYWA 4DYMA 3L9PA 4FYOA 4PNIA 1Y91A 2XMYA 3QUDA 4FNWA 4IBMA 3RWPA 4KS8A 4OAUC 3ZFXA 2H96A 2JD5A 2R5TA 3CY3A 3VUGA 1H0VA 1ZAOA 4FTTA 5D1JA 1SZMA 4EOPA 4YC3A 2EU9A 2VWIA 3DBCA 4FV5A 3O2MA 1O6YA 4R7IA 2UZEA 2WMWA 4P4CA 4USEA 5AUVA 4FV1A 3R7OA 4TW9A 4C58A 4FTCA 1S9JA 3COIA 3RI1A 4XMOA 5A4LA 3Q2MA 4DT9A 3KF4A 3HA6A 3CP9A 4C59A 3CQWA 3MW1A 2PUUA 4DFBA 3GBZA 4ZTSA 4YHJA 3TUCA 1GJOA 2QI8A 2Z2WA 4A9RA 4U9AA 4EZ7A 5JK3A 2BIYA 3QRTA 5HCXA 3C9WA 4O91A 2VTOA 5IISA 4FZFB 4IC7A 3FY2A 4H1JA 2G15A 3QQGA 5KHWA 5GZ8A 5BVWA 3LXKA 5CENA 4ANBA 2YM3A 4M69B 3HAMA 3JXWA 1XKKA 3F7ZA 5JT2A 2EXEA 3DCVA 4QMVA 2W1CA 3BWJA 3PXFA 4HGEA 3UNZA 5CU0A 2QOOA 5FGKA 3FMLA 1CSNA 1LR4A 4J53A 3S2PA 4CVAA 2O3PA 5I9VA 2OJJA 1Q41A 2QKWB 5C1QB 3SXSA 2X2MA 3PP0A 5ANJA 4YUQA 2QKRA 4WSQA 4BF2A 4QMQA 2J5EA 5AP4A 3R28A 4F63A 4E73A 5AUZA 3RAWA 5EQPA 5GHVA 4A7CA 4I5MA 1T45A 3DZOA 4IAZA 1JOWB 2UZLA 2Z7RA 3MPMA 3ZFYA 5F95A 2WXVA 5KBQA 1XBBA 2B54A 4MHAA 4HGTA 4ONAA 3R9NA 2WHBA 3ZTXA 2R9SA 4FZAB 1OVEA 4OTFA 4Z9LA 4J8NA 3FMDA 4D2RA 3REPA 1XR1A 3L9NA 3DV3A 3DDPA 4K77A 3IQ7A 4TWPA 2NP8A 2I1MA 2VX3A 4F0IA 3EIDA 3MH0A 4FIEA 5JEBA 4HZRA 4KWPA 3U54A 2YM6A 3I5ZA 4FL3A 5CF5A 5D10A 4GYGA 4MX9A 1K9AA 5CSWA 5CVHA 5EH0A 4ZLOA 4FSRA 5KMLA 2W1FA 3WZEA 3V6SA 4DGNA 3DK6A 4N6ZA 4KIPA 3QXOA 3UMWA 2UW5A 3R9OA 4ORKA 4NFMA 3QCQA 2HOGA 4F0FA 5KE0A 5CXZA 3DAEA 5E92A 4KINA 4L9IA 2PVLA 4DTKA 3DK3A 4GFMA 3FI8A 4CFXA 5FBOA 3BWFA 4D0XA 1XHAA 5L2SA 3RK5A 4BDFA 5CEMA 1KUTA 3A61A 1PKDA 4L53A 4Y5QA 5FTQA 4BDCA 4QMOA 2PZ5A 4MQ2A 3U9NA 5AUUA 1IAHA 3Q4UA 4O0SA 3DLSA 4FOCA 3SXFA 3R7IA 3O51A 5AAFA 2F49A 2H6DA 3OWJA 5HZNA 3F69A 3SKCA 3ZLWA 4OTQA 3OBGA 3IKAA 5FDPA 1Z57A 3A60A 3SG9A 5A4TA 5CU2A 1JQHA 5EW9A 2Y9QA 4JAIA 5TOZA 3LM0A 1E1XA 1YHSA 4DFNA 1PJKA 5ANIA 5CS6A 3ZOSA 4RQVA 4RWIA 4FNZA 2PVNA 4FZDB 3C4FA 5A46A 3N4VA 2QURA 1XQZA 3BCEA 3KULB 3HGKA 2NRUA 4NT4A 3FZSA 4AE9A 4EORA 3AC3A 3UDBA 4YBJA 1OUYA 4R7HA 3KC3A 4GIIA 4QQJA 5IA1A 2ONLA 3BE9A 2R64A 3D7ZA 4D55A 3TDWA 2XJ0A 3UPXA 5EM7A 3WZUA 3KKVA 1SMHA 1SVEA 4X3FB 5J7BA 4AZVA 4L68A 5ETFA 3ALOA 1XH8A 3PUPA 5EI2A 3CTJA 5IDPA 4OT5A 3QUPA 5LVNA 3PSBA 3W10A 1OIUA 3NPCA 4DH5A 3F82A 5HLWA 5AUTA 3H10A 4OBPA 3PJCA 1PYXA 4TWOA 4YPDA 2BILB 3QL8A 4FT0A 4QMUA 3VNTA 4BKJA 4TYGA 2R3MA 3NMUF 3VRZA 1DAWA 2ZV9A 4FKTA 4G31A 3DTCA 5C8MA 5CNNA 3UE4A 1J7UA 3O17A 3TWJA 4FMQA 4G2FA 3HV5A 4BGQA 2EXCX 4JBPA 4LRMA 4ZJIA 4UN0C 2Q0NA 4JG7A 5IA3A 3GCPA 4O0UA 2XF0A 2IJMA 2VO7A 3ANQA 3I60A 5LVPA 3JR1A 2WTWA 3AOXA 4HYIA 3P08A 5DOSA 4CD0A 1K2PA 4UMUA 2XJ2A 2O8YA 1Q8TA 4NFNA 1PXJA 3ANRA 1IA8A 4Q2AA 4DAWA 5BPYA 2C5YA 2GDOA 4PRJA 2Q0BA 4DITA 3O7LD 4E5WA 3QALE 2F2UA 3I6UA 5LARA 2XIXA 2QODA 4XG7A 3RHXA 4YHTA 4EONA 4UZDA 3IG7A 3VULA 2E9NA 2ZB0A 4TKSA 1WBWA 4PY1A 4R6VA 5EM8A 3LFNA 3ZO4A 3G6GA 4NW5A 5KUPA 1KE6A 5M56A 1KE8A 5E90A 3FI4A 2XIKA 5C01A 2Y6MA 5DBXA 3EQBA 4QTEA 3KL8A 5M4FA 1CKIA 5E8TA 2YN8A 2O65A 4M12A 1YDTE 4ZTNA 3HV6A 2JGZA 3MFTA 4C38A 4DBXA 2OZOA 5IQGA 1Q62A 3LXLA 4R3CA 5KMIA 4CSVA 2GNHA 1YRPA 3MPAA 4I5HA 4ID7A 3RPVA 4KAOA 4K18A 5B2LA 1FMKA 4KRDA 3GU5A 2XEZA 4BDHA 3KMUA 3KRLA 4M69A 3NNUA 1BI7A 4G5PA 5C27A 1ZMWA 2VX0A 1ZYLA 3W1FA 3ZSHA 4JLCA 1P5EA 4HVSA 2J6MA 4AGUA 2HCKA 2XM9A 3PJ8A 4EHVA 4JX3A 4CFFA 3AC5A 3L8VA 2CCHA 4L52A 4FKQA 4NJ3A 1REKA 4K33A 4M13A 3EN9A 3BX5A 4UWBA 2FO0A 4WRGA 2WMBA 4FKIA 3LIJA 2JLDA 1FPUA 3VQHA 3S00A 2C5NA 3OHTA 2QOBA 3OCGA 3QGWA 2UZUE 4BDJA 5M4IA 4YNOA 3G9LX 4GG5A 3FWQA 3R7UA 4EWQA 4DG0E 4YJRA 5HI2A 3C4EA 1ZWSA 4LQMA 2ITYA 2HELA 3D2KA 4K0YA 4LOQA 3QQLA 2YWVA 3QA8A 4WG4A 3R8LA 4B99A 4JAJA 4LL5A 1Q3WA 2C30A 4F7NA 3R0TA 2BZHB 2GQGA 2XA4A 4P2KA 3ZS5A 2BDJA 1FBNA 5GIOE 3R01A 2FUMA 4JIAA 4ALWA 1Y6BA 4PMTA 3NUAA 3NYOA 3PJ2A 4FSQA 4FK6A 1I44A 4TNDA 2F7ZE 4CCUA 4DFZE 1KOBA 4XBRA 3HMOA 5CF8A 3D5UA 3TN8A 3UNKA 5AV4A 5HOAA 3V5PA 4X0MA 5HNBA 4GFGA 5E8SA 4IVCA 4X2GA 4XRLA 2NNWB 4HGLA 5H8BA 2J0IA 1UVRA 4IANA 4CFVA 4DF3A 2CN8A 3OOMA 1VYWA 4M7IA 3BQCA 2UZDA 4FEQA 3ZXZA 4KIKB 2UZVA 5AX9A 2PVMA 3LFEA 3GC9A 5AM7A 4R7BA 3VVHA 4DGGA 5IKWA 3LCKA 4BICA 2JKOA 1V0OA 5HEZA 3GVUA 2CMWA 3DFCB 4NEUA 4WOVA 5TKDA 5CAVA 1YI3A 5M06A 2XRWA 4NZWB 3UC3A 1OIRA 3E62A 5KX8A 4BB4A 5CSPA 4GT4A 4YZBA 3VIDA 4G9CA 3RNYA 4O81A 1ZZ2A 4ZTMA 3EJ1A 1H1PA 4LRJA 2OIDA 4AFEA 3A7FA 3CS9A 2ZDUA 5CI7A 3NUXA 4EH3A 5K3YA 4J95A 3TKUA 3FKLA 4FTJA 4BYIA 4W4WA 4EHEA 4JDJA 3T9TA 4FG9A 3E5AA 3KULA 4BBEA 4QQTA 3GQIA 3K54A 4USFA 5HG5A 3LLTA 2G01A 4ZK5A 2H9VA 5HE1A 3T3UA 4QTBA 4ANOA 1PXOA 3TUDA 1J7IA 2YZLA 3QD3A 1GIJA 4DGOA 4QMMA 4X3FA 1UKHA 4J99A 5JQ8A 4C4EA 3PPZA 5TT7A 1H25A 5IQHA 3ZCLA 3MGYA 4A9YA 4FR4A 3WIGA 3QRKA 3MVJA 5LCKA 1PRYA 3ACJA 1G5SA 5IQBA 4FT5A 5ETIA 3QTWA 2XNEA 3AD5A 3BYSA 4FV7A 2CHLA 5I9WA 3OWPA 5F9EA 3G51A 3JPVA 2YIYA 3FSFA 4GS6A 3COMA 3A8XA 4EC8A 4NK9A 4L45A 2WQNA 1UU9A 2WGJA 3K3JA 2VD5A 1YKRA 4NKAA 2IVSA 3TCPA 2XS0A 4FX3A 2XB7A 3P7AA 3RGFA 4AGWA 2VU3A 4ZJVA 4R77A 3LJ1A 2UZTA 4JI9A 5LVLA 3Q60A 1IRKA 4HJOA 2YM7A 3UO6A 5CU3A 3B2TA 3LOKA 3DA6A 3QZHA 5EQEA 5EM5A 4G1WA 2RL5A 3QLFA 1OBGA 4D9UA 2UUEA 4D2WA 2C6DA 3NEWA 4QQ5A 5JSMA 3DXPA 4FYNA 4KNBA 4DINA 1YVJA 2CSNA 2XH5A 1IA9A 5AR7A 4O27B 2PVJA 3F3TA 2JIUA 1JSVA 3KK8A 5DEYA 4BCHA 4IVAA 1NT2A 4U43A 3AC4A 4IHPA 5DGZA 4Z3VA 4CTCA 3NYXA 4C4GA 4IVDA 1YW2A 5B2MA 3VW8A 4EH2A 5HIBA 3Q4TA 3OCBA 3PVWA 3HP5A 3UVQA 4OW8A 4YJNA 4WNOA 2B9IA 2ESMA 3FKOA 3EQDA 5CI6A 3F7WA 4TN6A 2P55A 4GUEA 3THBA 2HZ4A 4LMUA 5E8VA 3TNQB 1OGUA 2C5VA 3DDQA 2HXLA 3MY0A 4EK8A 4ZTLA 3CSVA 5DYJA 4MH7A 4ANSA 4IAKA 3WOWA 4XG8A 4JRNA 3MI9A 3CD8A 1IEPA 4CFNA 2PVHA 2PZYA 2QOQA 4O2PA 2GQRA 4Q9SA 3R1SA 4RFZA 2XEYA 2BZKB 5DLSA 4A9UA 2XIZA 2IW8A 4I4EA 4PX6A 3R1QA 1NXKA 2EXMA 3FQHA 1UA2A 2B53A 3ELJA 2BAJA 4MWHA 3BLQA 2Y4IC 3D5VA 2C3KA 4WUNA 3OS3A 4WA9A 3D2IA 1B6CB 3PE2A 4MK0A 5HORA 4LV5A 4PPCA 1L8TA 3M11A 1GZKA 2ITNA 2PVKA 4JNWA 3B2WA 3IW4A 4HYSA 1URCA 4BVUA 2WMVA 1M14A 2PVFA 5L6WL 5IQEA 2A27A 1H1SA 1YHWA 1OIYA 3FHIA 4FK3A 2R3RA 2C6KA 5CZHA 4K8AA 2XZSA 2W1IA 3MSSA 5ACBC 3SW4A 3DNDA 5ACKA 1VYZA 2B55A 3KRXA 4R3RA 3BHUA 4CYIA 2QHNA 2C3IB 2UW7A 4KIKA 5ETAA 3QD0A 5JGDA 4N57A 3GCQA 4QP9A 5B2KA 3Q6UA 5BX0A 4RC3A 4RZWA 2ONLC 4LG4A 3LFDA 4RT7A 4XG6A 2O2UA 3PPKA 3FLZA 3BELA 4H3QA 3WF5A 4FL2A 4IWDA 2BTRA 4RWKA 3EL7A 3CXWA 3FLWA 1YI4A 2ZV7A 3PJ1A 3AMBA 4BZOA 2JKKA 1H1RA 1KV2A 2XNBA 3HMIA 2UVXA 4JDHA 1OITA 3QTRA 4NU1A 5EK7A 4EOSA 4YJUA 5EW8A 4BBMA 4BI1A 4XJ0A 3AT3A 4X6QC 4J8MA 4ERKA 1SM2A 1WZYA 3EFJA 4QP2A 4JS8A 4XRJA 4EHGA 4YTIA 3FXZA 3ORZA 2RFEA 3CTQA 3H9FA 4QNYA 4BDDA 3GB2A 4WSYA 5ANGA 5BVEA 3JVRA 4PTCA 2UW3A 4EC9A 3KCKA 1QPJA 3FBVA 2YJRA 2RFSA 4EKLA 2W1DA 3TZ9A 3ZDUA 2YCSA 3V01A 2VRXA 1U5RA 5A54A 5TO8A 2UZOA 2GMXA 1IG1A 3ORIA 3EHAA 3MH2A 4RX9A 3SHEA 2UW6A 2PE2A 3R2BA 2YLEA 1J3HA 4CZTA 1BYGA 4ZJJA 2X0GA 4D28A 4EK5A 2ITXA 4YLJA 2OF4A 1VEBA 3GC0A 4MXXA 4YP8A 4G3GA 3RALA 4AFJA 1Q8UA 3QKKA 4GSBA 3SGCA 5GJDA 2QO7A 5AP2A 3O8UA 5FEQA 1J7LA 3SD0A 3NLBA 2ZM4A 3O50A 1NW1A 4L6QA 3R83A 3MB6A 2JIIA 3NX8A 3TG1A 5EQYA 2J4ZA 1CM8A 1PXKA 3PZEA 4JVGA 3ZLSA 2B9JA 2WTIA 4EJNA 3OOGA 3PPJA 2YIWA 1TQIA 4ZIMA 4RMZA 3R9DA 3QYWA 5TF9A 4BTJA 2F7XE 2JIVA 3HUCA 1URWA 3VUDA 3NUUA 4WNMA 3ORXA 4U7ZA 4FV4A 1K3AA 5EOBA 3W8QA 1BI8A 2VTTA 3GGFA 3P5KA 4AZFA 1ZYSA 2H34A 3V8TA 2RGPA 4W8DA 4O86A 5M08A 3PDTA 3C4WA 3OXZA 2V22A 3QYZA 5K0KA 4B8MA 2OICA 1V1KA 2ZM1A 5HG7A 4BKZA 4DFLA 3WF7A 3VBTA 2R4BA 2IWIA 2X9FA 5A6NA 3UG2A 2WEIA 2GU8A 4IWPA 2WB8A 4L8MA 3R8UA 2CNVA 4CZYB 4HVDA 3W2PA 4ITIA 3ZM9A 4ARKA 3RM7A 3II5A 4I20A 3VS3A 5JN2A 2GFCA 4QTCA 3U9CA 4JL9A 4O7TA 3E8DA 4GT3A 5LCJA 2WIPA 3C50A 4FKWA 4PMSA 1H26A 1GZNA 2OK1A 4AZEA 3KREA 3DXNA 2X81A 1MQ4A 4GVAA 3A2CA 3R7YA 4I0TA 3WF6A 3N4TA 4L42A 4YZCA 4FV9A 2R3PA 3ID6C 4UBAA 4RX8A 2VTMA 3WARA 3VUHA 3BGZA 3I79A 5TE0A 3Q4ZA 1GZ8A 4QP3A 1JWHA 1WMKA 1ERKA 2BRNA 2JAVA 3DQXA 4IZAA 4M97A 3EN4A 4L3JA 3SAYA 1JKSA 4QP8A 3IW6A 3PLSA 4IC8A 1RW8A 2QG5A 4PDPA 3CGOA 4A9TA 4TTHB 3S1HA 4LOOA 4W4XA 3W55A 2UZBA 1ZOEA 2B7AA 5EDRA 3KXGA 2J50A 3NCZA 2VTAA 4H58A 3WE4A 4G3FA 3SRVB 3FV8A 2UV2A 4U42A 3PIYA 3VS6A 3D4QA 4OBQA 4YU2A 3AD4A 3EB0A 3SW7A 4AW5A 3LMIA 5EI6A 1M17A 2VAGA 3WZJA 1IR3A 4BY9E 2YM8A 3FXXA 4M66A 1NVRA 5CLPA 5DR2A 3QC4A 3LFAA 4QPAA 4EK4A 1S9IA 1VZOA 3DBEA 3G5DA 3UIXA 4BCMA 4RVMA 4QMPA 2CNQA 5EKNA 4BI0A 3OUKA 4C36A 4FTLA 1XO2B 2BFYA 4CYJA 4HNFA 3UYSA 4BWPA 2BRGA 2WU7A 5HLPA 1PKGA 5M44A 2C6EA 3V04A 5DVRA 2XM8A 3MA6A 4R1VA 2HIWA 3UZPA 4AW2A 4RA5A 3ZM4A 1ZARA 4C4JA 5KMNA 3Q5ZA 5AADA 3ZO1A 1LPUA 1B38A 2BPMA 1KSWA 4R1YA 4FV3A 2CCIA 3WI6A 4MXOA 4S33A 5EKOA 3MJ2A 5JZJA 3OUNB 5E1SA 2IPXA 3O23A 2GHLA 5DI1A 3D7TB 4AQCA 3TNHA 3CCNA 3EQRA 4PWNA 4JRVA 4TYEA 4YLKA 5CANA 1WVWA 4BDKA 4I1ZA 3UMXA 5DWRA 4CLIA 5EG3A 3TV7A 3WZDA 4WBBB 2A2AA 3E7OA 2ZYBA 4U45A 4AOTA 4TYHB 2WTCA 3WF9A 1JPAA 5M09A 2VTHA 3ZDIA 1OPJA 4KUJA 1A06A 3V5WA 2VWZA 4LGGA 2EVAA 2DQ7X 5FM2A 2O64A 3Q53A 3FLNC 3ZC6A 3Q6WA 4YZNA 1UV5A 5HKMA 4AW1A 4AZWA 2YHVA 4O22A 1XH6A 4X3FC 3U6IA 2FH9A 5BUJA 5E8YA 1FMOE 4JR3A 3KN6A 4HPTE 1YOJA 4JIKA 1PMVA 1F3MC 2C4GA 3LFQA 3EQGA 4U79A 5HICA 2OKRA 2PUIA 5BYZA 1JLUE 1H8FA 2JKMA 3FSKA 4G5JA 2R3FA 4YZDA 5AP6A 4CXAA 5JKGA 4F1OA 4MD9E 3MESA 5KZ0A 2IW9A 3QTSA 5LMBA 1HCLA 3AXWA 3QWKA 3DJ5A 3NUPA 5DRDA 1U4DA 1XBAA 5HX6A 3QRJA 5JFWA 3DKCA 4DGLC 2ERKA 2VV9A 3LMGA 4PMMA 1OBDA 5EFQA 1UNGA 1Y6AA 3PWDA 5E1EA 2F57A 4FEUA 4IAYA 5CAUA 4D4SA 4N6YA 2ITPA 5HESA 3EQFA 4OTIA 3OCTA 4H05A 4J7BA 1M52A 3ROYA 2ZB1A 3O71A 3MV5A 2PK9A 3AC1A 3C4ZA 3PVBA 3ZBFA 2RFDA 4OTHA 1WBVA 3TIZA 4X2JA 4C4HA 4AW0A 4J96A 1Q4LA 3AGMA 3GU6A 3JS2A 4FV6A 4CZUA 3RK7A 4GRBA 4TWNA 4BDGA 5L8LA 4NTSA 3IOKA 1CMKE 3R21A 4YO6A 3IDPA 4G6LA 3QUEA 2F9GA 2YLFA 4IWOA 4GW8A 4E5AX 2AYPA 2CLQA 3MJ1A 4ZY6A 4CRLA 3S3IA 1H27A 3PVGA 1ZY4A 3QFVA 4HZSA 4RQKA 4GKIA 1WFCA 3TNIA 3ODZX 2HAKA 2C6OA 1REJA 4I6HA 2OXDA 4NW6A 4XX9A 5IMXA 1P4OA 5IQDA 1JKKA 3RTPA 4F64A 5HIEA 2QR7A 5CEKA 2W1GA 1DI8A 2YDJA 5DH3A 3RBWA 5JRQA 3FLSA 3I6WA 4O7YA 4FNYA 2BROA 5K5NA 2HZ0A 2W1HA 4EQUA 2YITA 3AMYA 5CEIA 5GJFA 5LWMA 2CGXA 5KZIA 2B0QA 4FIHA 3F5XA 3EFWA 5D7AA 3F66A 3VBWA 3Q4CA 1FGKA 4GL9A 2YIRA 4XP2A 2OJFE 3OF0A 4GU6A 4BTMA 1OZ1A 4HCUA 5FD2A 4O0YA 2VGOA 4XLIA 5AA8A 1W0XC 4YGAA 1QCFA 3KMWA 4GT5A 4PL5A 4P7EA 1W83A 3FMJA 5HE0A 4F0GA 4TRLA 3VF9A 4IM0A 2YJSA 3F5UA 2JEDA 4Q9ZA 2IVUA 2BRHA 4IIRA 3SLSA 4QP6A 3C0HA 3OY1A 5EYMA 3EN6A 4YO4A 2NPQA 4GYIA 4BCGA 5HD4A 1YOLA 4G3DA 4A4LA 5JZNA 4XYFA 4BDBA 4C2WA 2PMLX 3W2CA 2RIOA 2XCHA 3HRFA 4L01A 4RVKA 3MTFA 4W8EA 3W2SA 3FAAA 4BIDA 2X4FA 2XK9A 2C1BA 3CJFA 4EWHA 2PUNA 3HMNA 1ZXEA 3LMHA 4DLIA 2GS6A 5AX3A 3CKWA 4IAAA 1YHVA 3BYVA 3EMGA 4TNBA 4MAOA 3SRVA 4O0VA 5BVFA 3RINA 4F1TA 5LOHA 3UO4A 3GUBA 3UOJA 2IZTA 3ORLA 4E6AA 3OMVA 5IEYA 3TUBA 1YWVA 4BYJA 5BMMA 5LXMA 4IE9A 3BBTB 5DEWA 1QL6A 4QP4A 1SVHA 1W7HA 3PG3A 4LGHA 2RKUA 3H9OA 3SOAA 2XK3A 3RPOA 3ZZEA 3KEXA 4WG3A 3CR0A 5C8KA 4QP7A 3DQWA 3LFBA 3UYTA 3DJ7A 3NIEA 1PMEA 3OP5A 2OJIA 4O21A 2BZJA 5CU4A 2V55A 3ORNA 3OTUA 3LFCA 3GCVA 3MH3A 1LP4A 3LCSA 4FKLA 3UQGA 4QRCA 4DT8A 3G15A 4O7RA 2JAMA 3F9NA 3M1SA 5FBNC 2PPQA 1OL5A 4RJ6A 4TWCA 2GNIA 4PTGA 3ZLXA 4HGSA 1OB3A 4YBKA 3Q9XA 5A3XA 3JUHA 5LMKA 3ZUTA 5D7VA 5J9ZA 5M07A 4D4VA 1XJDA 3LFFA 4FV8A 1YXXA 3D7TA 4FL1A 3U8WA 4O0XA 3E64A 5ITAA 2YABA 4IM3A 4FVQA 4CFMA 1WBTA 3TDVA 2ZM3A 3EYGA 4YJOA 4YTFA 5FUTA 1DI9A 3T8OA 1KE5A 4FTQA 2GPHA 5AA9A 1OL2A 1JSUA 3SV0A 2H8HA 4TYHA 2C6MA 4F7SA 3ZRKA 2OO8X 4FG7A 4O0RA 3VUIA 4ANQA 4V01A 5IDNA 3EQPA 4M0ZA 4ZEGA 3ZFMA 4ZTRA 5EDPA 1AQ1A 3H9RA 4G34A 2YDIA 3DB8A 2RF9A 4UWCA 4I4FA 5IF1A 3I7BA 1NY3A 4AT4A 1GOLA 4O7SA 3QKMA 4DC2A 3V8SA 2J0KA 3TTJA 3SDJA 4HCTA 5IQFA 2ZV8A 3O7LB 3DPKA 3KGAA 1M7NA 2VTJA 3FZPA 4I22A 4IFCA 5CF4A 3KK9A 4CV8A 1JBPE 5CSHA 4XHKB 3R1YA 5EI8A 3U4UA 4AN3A 1FVRA 3FLQA 4I21A 3E92A 3LCOA 4WIHA 4XS2A 3HUBA 3N9XA 4FTAA 5F4NA 3I7CA 3CQEA 2XYNA 3QF9A 5DIAA 3TI1A 3UOKA 4UMPA 5IUGA 3P9JA 4V04A 1TKIA 4EOKA 5C9CA 2V7AA 3BI6A 5GINE 2XNMA 2ZOQA 4ASEA 4L46A 5HLNA 1SYKA 2R7IA 3FYJX 4E93A 4PP9A 4OTRA 4RFMA 4U44A 5CT7A 4CMTA 3A7GA 1R3CA 3BU6A 4GG7A 5HTBA 4JX7A 3UO5A 4H3BA 4IDTA 4PL3A 3ULZA 3NDMA 3C13A 1XWSA 4WHZA 5AV2A 4O7NA 5HBHA 4APCA 4O84A 4D2VA 1W82A 4XG4A 3HMMA 4L3PA 4O96A 4C3PA 4NCTA 4G9RA 5AV1A 2HENA 4PMPA 3KF7A 2OLCA 3EFLA 4C4IA 5AM6A 2Y4PA 2C5XA 2XNOA 3E3PA 5FG8A 3WILA 4Y95A 4CTBA 2VWVA 4EKKA 3WYXA 5ANOA 4IB3A 1UU8A 1LEWA 5CTPA 1YWRA 5D12A 3BE2A 3VF8A 4TYIA 3UZRA 2PWLA 3LZBA 3DKFA 3C5IA 3W16A 3UOHA 4F08A 2R3KA 3ZH8A 1OL6A 3W33A 2C0TA 2QCSA 2OWBA 2W1EA 4E4NA 1R78A 2C6IA 5KHXA 2P33A 4DFXE 2IN6A 5HVJA 4XBUA 3NNVA 4PUZA 5LQFA 3Q9YA 5J5SA 4C57A 2OXYA 2VTPA 3IDBA 4H39A 3E93A 3RCJA 2Q83A 3OBJA 2B9FA 3RAKA 3H0YA 5DA3A 4AWIA 2BAQA 3WE8A 3ZLYA 4M0YA 3Q04A 1YQJA 4ITJA 3GU7A 4X3JA 3TTIA 4FKJA 3WBLA 2YACA 1UU3A 4EI4A 2IVVA 2HY81 3EFKA 3ATTA 2UZWE 4FTMA 2CN5A 1XH5A 2BZIB 1U59A 4IZ7A 5E8WA 4WNPA 2AC5A 4RZVA 5BUEA 3RK9A 4IEBA 5C26A 5A4CA 3E8NA 4P5QA 1Z5MA 5JRSA 2J0MB 3ZU7A 4U6RA 4FIGA 3D0EA 5BNJA 4FNXA 2I0EA 2IZRA 3ENHA 3FE3A 3VUKA 3B8RA 4MD8E 1PHKA 3AT2A 2GSFA 2SRCA 2V0DA 3HDMA 5HCYA 5LMAA 3T9IA 4F99A 4J98A 3UP2A 3OWKA 3TKIA 5C4KA 1GAGA 4BKYA 3HL7A 4DH8A 3R6XA 4BN1A 3TV6A 2ACXA 4ZS4A 3PIXA 5JFSA 4C2VA 5L8JA 3TKHA 4EH9A 2YERA 4USDA 3FYKX 4IXPA 4D5KA 5A14A 4IX4A 5AAEA 4FE2A 3LM5A 1UNLA 4IVBA 4FKGA 3UBDA 4U41A 3SC1A 2CLXA 1H0WA 3ACKA 1WBSA 2WTKB 2CKEA 3ENMA 1PYEA 2C0OA 2V62A 5GZ9A 4IDVA 1RJBA 4DCEA 4UYAA 3NNWA 2VWYA 3QXPA 2QLUA 3GU4A 5I3OA 2QO9A 5FLFA 3ZC5A 4CV9A 3OXTA 4EL9A 3VJNA 5K0XA 5CQWA 4OR5A 3FLYA 4CEGA 1WCCA 3L1SA 4EOQA 3E88A 4EYJA 2JBOA 4QTDA 4FTUA 3UIUA 4MF0A 2QQ7A 3CTHA 2DUVA 3P23A 4FKRA 3K3IA 4RFYA 2R3LA 4JBOA 5IMEA 2QOHA 5BVNA 4O7LA 2G1TA 4R78A 5HTIA 3AG9A 4R3PA 4AA5A 1AD5A 4CNHA 4BGGA 3NW7A 4UYNA 1UWJA 3PIZA 4QYEA 2WO6A 3F88A 4U0IA 2REIA 3ZONA 5IEVA 5IA0A 3ZRMA 2YEXA 4IACA 2I0VA 3BLHA 4NM0A 2ZAZA 4E6QA 5HVYA 1OKWA 3FZTA 1PMNA 1UWHA 3LXNA 4I93A 1QPCA 1OKVA 4D58A 1IAJA 3BHYA 4ASZA 3GT8A 3UVRA 4RIXB 4MBJA 4MTAA 4R8QA 4ZXTA 3HRCA 4BCJA 1A48A 2FGIA 2QO2A 2GHGA 5FEDA 2IG7A 4U80A 3RCDA 3H3CA 3S95A 4RBLA 1V0PA 4DH7A 4DCAA 5FM3A 1WBOA 2XRUA 4X2NA 3CPBA 3R73A 4YC6A 4IFGA 5M53A 4F6SA 2OF2A 5HG9A 4QYHA 4A4OA 1ZYCA 4C3RA 3IOPA 4UMRA 2R3NA 3FJQE 3PXKA 3ZSIA 2Z7LA 3R04A 1OKYA 2EB2A 4RGJA 4C4FA 4ENYA 2G9XA 3KVXA 3RM6A 4LFIA 4K2RA 2C3JA 3P7CA 3R71A 2VUWA 4QYFA 2BIKB 4ACGA 4GVJA 3WF8A 3D83A 4S30A 3UODA 2BAKA 4E6DA 2I40A 4KB8A 3ORKA 5HHWA 4HCVA 4QMWA 4DFYA 3KA0A 3U55A 4E7WA 3PRFA 4KABA 4FT9A 3QC9A 4F7JA 4NM3A 4X21A 3EKKA 4TY1A 2FA2A 5AR4A 1RQQA 3IECA 2W06A 2PE1A 2XNGA 4M15A 1TQPA 5A9UA 1J91A 1ZRZA 3KXNA 3QD4A 4OGRA 3BIZA 3OW3A 5L4QA 4TXCA 4XNEA 5J9YA 4WD5A 4QD6A 3Q9ZA 4MBLA 3KRJA 4P90A 3RHKA 4DEIA 5AR8A 2I6LA 4D5HA 3KN5A 3BU3A 1PXLA 4L67A 1KV1A 3DAKA 4QNAA 5HGIA 4NL0A 4FSWA 4NSTA 2E9PA 5IQAA 3CIKA 4BCKA 3K5VA 3HVCA 3SA0A 3A4PA 3D15A 4ZP5A 3UGCA 3VS0A 4RJ4A 3MBLA 3NUYA 2WQEA 4TZRA 3VHKA 3AC2A 2WKMA 3SX9A 4IB5A 4BZDA 3DS6A 3T3VA 3C0GA 4AF3A 1FVVA 3ODYX 4EOOA 5HQ0A 3NGAA 4IB0A 4NTTA 3GC7A 3QA0A 4WG5A 4A4XA 2GFSA 2ZJWA 3MVMA 5AUYA 5I0BA 4FIIA 2J0JA 4PDYA 3MY1A 3F3UA 4UV0A 2OBJA 3Q52A 1OPLA 5FTOA 2FVDA 2PU8A 4PQNA 4L44A 4EOIA 1BL7A 2FSLX 3PSCA 3M2WA 1ZZLA 3FMEA 4F6WA 4ZZNA 3DB6A 1QPDA 1MUOA 2UZNA 3QGYA 4LGDA 4HW7A 3OEZA 2QLQA 1APME 4C3FA 2QONA 2VNWA 4RLLA 2OU7A 5LVOA 5L2IA 2CJMA 3MS9A 1P4FA 5T68A 1R0EA 2XKEA 3C51A 3DTWA 5AIRA 2B1PA 5HO8A 4PTEA 4WUAA 2WMTA 4M68A 5IUHA 4EEVA 4H1MA 1WVYA 5HVKA 4D1SA 2FB8A 3FZOA 4C62A 3MIAA
chains in the Genus database with same CATH superfamily
3DLZA 4W4YA 2YCQA 3CEKA 4Y85A 4OBOA 3UVPA 3QD2B 1NVSA 3RNIA 2PSQA 4FI1A 3RPYA 3LQ5A 4YTCA 3OT8A 2R2PA 5DN3A 4FICA 4RJ7A 4XOZA 2W96B 3DY7A 4M84A 4ZOGA 2KULA 1U54B 2R3HA 4GFOA 4JQ8A 4ACDA 4BTKA 4F09A 4S34A 1OL1A 3C4XA 3LLAA 4AXAA 4JG6A 3VHEA 4AN9A 1ZOGA 4EOMA 2ITOA 4ZZOA 5DMZA 4FSMA 3D94A 1Q61A 4PPBA 5A6OA 5E9EA 3U87A 4AP7A 2XIRA 3OEFX 3IGOA 5FXQA 3BGQA 2C0IA 2XP2A 3PY3A 4NIFB 4K9YA 3PWYA 2C1AA 3EH9A 1L3RE 4MYGA 4J1RA 3QQKA 3BL7A 4KKEA 4QO9A 4S31A 4NH1A 4TPTA 4ZY5A 3FPMA 4D4RA 4M8TA 5CWZA 1GZOA 2PUPA 2QOIA 4QT1A 4JDIA 3BYMA 5B0XA 5J95A 5CAPA 1A9UA 4FEXA 4UY9A 1F5QA 2C47A 3DNEA 2W99B 2WQMA 2WAJA 3NAYA 4JDKA 2V5QA 4X2FA 3ZO3A 2ZVAA 4BC6A 4E20A 3P7BA 2P0CA 1PF8A 2A4LA 3FXWA 4JR7A 4MKCA 4DBNA 1OECA 3TT0A 4ZTHA 2X7GA 3ZYAA 1FOTA 5JGBA 1YWNA 3U6JA 5AV0A 1PXIA 3MFRA 3LAUA 4L43A 4W9WA 3RZBA 3F61A 1H28A 3ZBXA 4FODA 1SVGA 4F9WA 3QZIA 4FSZA 3E7VA 4J97A 4EUUA 2ITZA 2PULA 3KXHA 5FTGA 3R63A 3KCFA 1ZMVA 3NUNA 4RIXA 1FINA 1BMKA 2F7EE 3IW7A 5F94A 1OIQA 4B8LA 4DFUA 3P0MA 5DE2A 2PMNX 1JAMA 1Q3DA 2JFLA 2UVYA 2FYSA 2OH4A 2Z8CA 4YJPA 1SNXA 2ETRA 3MB7A 4KSPA 2HW7A 4FUXA 2JDVA 5CEOA 3QX4A 1UNHA 5KCVA 3VN9A 5L2QA 1CDKA 4RIOA 4JT3A 5AJQA 4KKGA 4DGMA 2QU6A 3BRBA 2VTLA 4L3LA 2XK7A 4Z55A 2WOUA 4YTHA 2WPAA 4BCNA 3F2RA 2J90A 4FC0A 2WMXA 3QTZA 4JG8A 4ZSEA 4FZ7A 4HYUA 4RG0A 5K4JA 2AC3A 2XKDA 2PZRA 2BHEA 3R7VA 2PVYA 4TYJA 5AAGA 3WIKA 4B6LA 2HWOA 2P2IA 3AD6A 3HDNA 3PXRA 2XK4A 4IADA 1VR2A 4FIFA 1SNUA 4XV2A 5CQUA 3NW6A 3ZMMA 4F4PA 4JOAA 5AP1A 2C6TA 5KKRB 1WBNA 3U51A 2W17A 4OTGA 3PA4A 4BDIA 2WIHA 3DJ6A 2OZAB 1PXPA 2VWBA 4GJ2A 4AX8A 5AV3A 2YWPA 2I7QA 3F2AA 3N4UA 2CGUA 4Q5EA 3AQVA 4FKUA 5CAQA 3IDCA 2AUHA 3CLYA 5HO7A 2W9ZB 3O96A 4A07A 3DKOA 5IH5A 3PFYA 4NM7A 4M14A 4F70A 3OZ6A 2X7FA 5HTCA 2XKCA 2UW8A 2WMSA 3EYHA 2QU5A 4N70A 4YSJA 3O8PA 5K4IA 2G2IA 2C68A 3EZRA 4RX7A 4BIEA 2A0CX 4CKJA 3QHRA 4FTNA 3P79A 5KMOA 2CPKE 2HZIA 4O1OA 2W7XA 4JJRA 4CKRA 3ULIA 4GK3A 1Y8YA 4D2TA 4DTAA 4R5YA 3GFWA 4Y83A 2PMIA 2P4IA 3KMMA 5AUXA 1LEZA 4I0SA 5ETCA 4Z16A 5HNIX 4AZSA 3PJ3A 4QDVA 1M2QA 4DH1A 4H36A 4EZ3A 3CC6A 4I24A 2Y6OA 2R3OA 4GU9A 5BYYA 3QCXA 5HE3A 2HW6A 4YMJA 3ZRLA 1BX6A 4BBFA 4MWIA 2P3GX 3C5UA 5T3QA 3TZMA 3E8CA 3ZO2A 5JGAA 2WTDA 3V5LA 2XBAA 4O83A 3JY9A 1Q5KA 3VC4A 5ANDA 3MYGA 2PE0A 2R3JA 3BQRA 3VQUA 3G2FA 2PY3A 4XEYA 3PLAE 1DM2A 2FSOX 3RPSA 4NWMA 5C03A 3LXPA 4ASXA 3GEQA 5BV3A 2PZPA 3BEGA 4FEWA 2GNFA 4FKPA 4UB7A 4FZ6A 4EH7A 2V7OA 3S4QA 2ZMCA 2FSMX 2X8IA 1BKXA 1HCKA 1NVQA 2QC6A 3GP0A 3GU8A 3ZUVA 4YR8A 3EN5A 2RG6A 4AS0A 5BVOA 4DEHA 3NFGB 4ACMA 4XV3A 4AXFA 2GS7A 2IZUA 4JMQA 2ITQA 4IJ9A 2X6EA 4GH2A 5IA5A 3A7IA 3CGFA 2WD1A 4FVPA 2QNJA 4GEOA 3EWHA 4L00A 3COKA 3E8EA 5BVKA 3G90X 3L9LA 3E63A 4HNIA 5ANEA 4WBOA 2YAKA 4N4SA 3A62A 3F2NA 1U54A 3VWAA 3ZEWA 4EQCA 3AMAA 4YNEA 2OH0E 4Y72A 4D1ZA 3MVLA 4RC2A 4BCIA 2Y8OA 4XCUA 4AAAA 4DG2E 2BKZA 3Q3BA 5HCZA 5LWNA 3ITZA 1STCE 3O8TA 3BKBA 4K1BA 3A7JA 1PMUA 1M7QA 3QBNA 4MVFA 4NIFA 3EQHA 4HVHA 1XH4A 4GUBA 5I9YA 3MVHA 3UIMA 4MXZA 3LKMA 5KBRA 3HZTA 4PV0A 1YDSE 2PVRA 4LUDA 4KKHA 5EYDA 4EH6A 5JQ5A 3NSZA 2ZMDA 2WQBA 3FZRA 3P86A 2W5HA 2DYLA 3LVPA 1H01A 5F1ZA 4XP0A 3VS4A 4UWYA 2KTYA 4FOBA 3ORMA 3BPRA 4C35A 3TMOA 1BLXA 2VZ6A 4NKSA 3GOPA 2IZSA 1IASA 2DS1A 2EWAA 4BGHA 4MNEB 4D1XA 3HAVA 2XNNA 1JSTA 4F9YA 4JBVA 3V6RA 1O6LA 3MFUA 3E87A 5KO1A 4ANMA 4YZ9A 5DR9A 3Q96A 3FI3A 1PY5A 2C6LA 2W05A 2I0YA 2OGVA 2BRMA 3CPCA 1QMZA 3DK7A 3OC1A 3VAPA 5HU9A 5IQCA 4DN5A 3GXLA 2X0QA 4IM2A 3G33A 4O4FA 4NM5A 3C1XA 4YPSA 3VUTA 3W0PA 3VJOA 4UMQA 3ROCA 2XK6A 4EK6A 2RFNA 3DBDA 2GS2A 3Q32A 3H0ZA 4C8BA 3E3BX 4IQ6A 2YIXA 4KSQA 4GK4A 5AR3A 4FKOA 4O4BB 3UG1A 3V51A 5J9LA 3C4CA 1DAYA 3TV4A 3KXZA 3DFAA 3ERKA 3KVWA 4I6QA 4YJTA 5LVMA 2XBJA 1TQMA 2YIQA 1RE8A 2Y0AA 4GV1A 3TNPC 4NJDA 2J5FA 3D5WA 3TJCA 4BRXA 2OIBA 4WKQA 2EUFB 2Z60A 2BRBA 3EQIA 4IWQA 5J7HA 3QTQA 2A19B 2OSCA 3KFAA 2R3QA 4MBIA 4BCFA 4DA5A 5GZAA 3TIYA 1PXMA 4MQ1A 4EBWA 4AZTA 4I6FA 5EM6A 2BALA 2QD9A 2W1ZA 1G8AA 3TZ8A 3KRRA 2CKQA 2VWWA 4EYMA 5CASA 3BYUA 3JY0A 1LUFA 5H8GA 5DNRA 5J87A 5IA2A 1H08A 4ZSAA 2OZAA 3OCSA 3ZSGA 3G6HA 4Y8DA 2R0UA 4C02A 2RG5A 3PYYA 2VO0A 3W2RA 4S2ZA 1P14A 1JVPP 2A1AB 2WU6A 4KD1A 4XOYA 2VWUA 4W4VA 5IPJA 3NW5A 5D41A 3H4JA 3LJ0A 5KNJA 3R9HA 2QOLA 4QYGA 2BTSA 2R7BA 5D9HA 5EYKA 4YURA 4OTWA 1H1WA 4RVLA 3F3ZA 5ICPA 4TT7A 3LQ3A 4AT5A 2JDSA 3RKBA 1RDQE 3DGKA 2XIYA 3HP2A 3MA3A 3ET7A 3Q5IA 4Y46A 3TZ7A 1OMWA 3W2OA 2PHKA 4BIBA 2OXXA 5AP0A 4QTAA 3NVKI 4CQGA 1F0QA 4D9TA 3WZKA 5IZFA 3PY0A 3PA3A 4O0WA 4MXAA 4ZLZA 5DT0A 2VGPA 5AP3A 3VUMA 1MRUA 4OTPA 1GNGA 3MPTA 4AE6A 5L6PA 2GNJA 2O5KA 3LJ2A 5IEXA 3C7QA 4II5A 3K2LA 5TR6A 2W5AA 2J2IB 4LUEA 5E8XA 3VS7A 4AN2A 4FSUA 4XV9A 3QCYA 1XH7A 5M4CA 4RC4A 1XMLA 3OTVA 2P2HA 3LE6A 5M57A 3BV2A 4KIQA 4CKIA 2BR1A 1BL6A 3GC8A 3BGPA 3R1NA 1V0BA 3V3VA 4AOIA 4BWXA 2C69A 3PXYA 3ZZWA 4EH5A 5BYLA 3I81A 5I3RA 2G2FA 4RPVA 4A06A 4CT1A 4DG3E 4F7LA 4KBCA 4RWLA 1O9UA 3RAIA 2XUUA 2WEVA 3WYYA 4CFWA 2WTJA 4ASDA 2ERZE 3HV3A 1AGWA 1YI6A 4RSSA 3VS2A 1J1BA 4AGCA 1YDRE 2J51A 3OG7A 2WTKC 4OT6A 5ANKA 1GIHA 3P1AA 4YLLA 2WZJA 4FGRA 4JQ7A 2O63A 2W4JA 3FMNA 4FA2A 3SQQA 5HBEA 4LL0A 2OI4X 3ZXTA 4ANNA 1NA7A 4L7SA 3FI2A 1ZMUA 2VTQA 4YJVA 3FL5A 3BHTA 3RVGA 4ZLYA 3R9RA 1KWPA 4BZNA 4RJ5A 2QR8A 5DT3A 3ZUUA 2J0LA 3BEAA 3BYOA 3QRUA 2CGWA 4XH6A 2GNLA 3UIBA 1Q99A 4PDSA 4QPMA 4UXLA 5I9ZA 3VONA 2JC6A 5AR2A 3FC1X 2OJGA 2QOKA 3KU2A 4QMSA 4ALUA 3NZ0A 4KRCA 4ZSGA 4WT6A 3DU8A 5J1WA 2F2CB 3NAXA 1OM1A 5I4NA 3LPBA 4FF8A 2WNTA 4I5CA 4U5JA 3C0IA 5IH4A 3M42A 3P4KA 3R2YA 2IO6A 4XG2A 3TACA 4WRSA 3IONA 2NRYA 5L8KA 4E5BA 4XG9A 4YJSA 4B7TA 1G8SA 1OUKA 1R0PA 3KY2A 2OJ9A 3W0OA 3NR9A 4J52A 1ZY5A 2HZNA 1ZLTA 2ITTA 4CRSA 3PXQA 3VS5A 4CT2A 3TEIA 1YXTA 3MN3A 3ZEPA 4MF1A 4E4LA 4UEUA 2F4JA 2XNPA 2VTNA 3RAHA 4DHFA 1EH4A 3COHA 1J1CA 1YXVA 4MNEA 3DKGA 4C61A 4EJ7A 1E9HA 4FIJA 1GY3A 3D5XA 3MTLA 3LHJA 3HV7A 3LCDA 5FXRA 4MEDA 4ZSLA 3IW8A 3V5QA 3R22A 4YHFA 4FUYA 3CKXA 3GCUA 2HYYA 5B7VA 4U40A 4AUAA 4IZ5A 3PP1A 5JMSA 4ENXA 2OG8A 5IG1A 2OFUA 3ZHPC 2G2HA 2WMAA 3GNIB 4RJ3A 3FL4A 3L8PA 4QMNA 4CG8A 1ZYJA 4QP1A 4O38A 4Y5HA 4BHNA 4FSTA 2DWBA 3EL8A 4RVTA 4EUTA 3IPHA 5H2UA 4G3EA 5G6VA 4B4LA 3JVSA 3EZVA 3RZFA 4O7ZA 2HWPA 3L8XA 4FTRA 2GHMA 4EH8A 2ITVA 5HG8A 4E8AA 3QU0A 4BR3A 4F1MA 3FKNA 4YZMA 3OY3A 3UOLA 1DS5A 2I0HA 2IVTA 4IX3A 2ZDTA 3NNXA 5EHLA 4CGAA 4V0GB 2XYUA 3G0EA 3UPZA 4ANLA 5EHOA 3O0GA 3BV3A 3FPQA 2WQOA 2X1NA 5BVDA 3QQFA 2Z02A 2X9EA 3FEGA 4UXQA 4F65A 3PSDA 3AKLA 2UVZA 4ITHA 2X0OA 2X39A 3HLLA 4IAFA 2XJ1A 2VWXA 4OUCA 1MQBA 3SVVA 1G3NA 3A7HA 3HA8A 3QZFA 4QQCA 4DEDA 2NO3A 2AEGA 1JKLA 4QYYA 5E8UA 3KXMA 5FP5A 5H8EA 3W0RA 2QOCA 3HX4A 3R7GA 3OVVA 3MY5A 3R8VA 3W18A 3IK3A 4YSMA 4M3QA 3F5GA 1OL7A 3NRMA 4MXCA 5EOLA 2UW9A 1ZYDA 4P5ZA 5FEEA 5AWMA 4C34A 5AP5A 3AC8A 4A9SA 5J79A 2OFVA 3MFSA 2JDTA 2VTIA 4FG8A 5CSXA 4L7FA 3TL8A 1GIIA 2CDZA 1Q8ZA 3VBQA 3U4WA 1U46A 4O7WA 4RRVA 4BHZA 3VS1A 3G9NA 3HECA 4LM5A 4RIYB 4YC8A 3MWUA 3R7EA 4EH4A 1WVXA 3QQHA 3HYHA 4BDAA 1H4LA 3UC4A 4X7QA 4FSNA 4QMLA 4FJVA 5CAOA 3KB7A 4W9XA 5LJJA 2W5BA 1ST0A 3FDNA 5A4QA 5IU2A 2VTRA 2XK8A 3PVUA 5H3QA 2QHMA 3UTOA 1R1WA 4Z7HA 5FWKK 4WNKA 4C7TA 3IW5A 5KMJA 4FEVA 1FQ1B 2W4KA 4F6UA 3JYAA 2YM4A 3RMFA 5HU3A 4MNFA 2YISA 4R5SA 4RJ8A 3NYNA 4KIOA 4M67A 3RP9A 2ITWA 2CKOA 4O1PA 4DEBA 4HYHA 2X2LA 3HV4A 4ZS0A 3V5JA 2R0IA 4O7VA 4B0GA 2X8DA 2PTKA 1W98A 2CNUA 2OIQA 3P78A 2C3LA 3K5UA 2VO3A 2YA9A 2GCDA 3LFSA 5A4EA 4O0TA 1Y8GA 1H24A 4RA4A 4D4YA 4FT3A 1BUHA 4GKHA 2PMOX 2WTVA 4U3YA 4D2SA 3W0QA 3FQEA 1M2RA 5EDQA 5L3AA 4BTFA 2J9MA 3CQUA 3IO7A 4BWKA 4PP7A 2HY0A 5CEQA 5GIPE 2GQSA 3VW6A 2ZV2A 4ZSJA 2BKKA 2W9FB 5FRIA 5K9IA 1YXSA 3PXZA 4FV0A 3HKOA 4AXCA 3GCSA 1ZOHA 3FMKA 3NYVA 4JQEA 4DH3A 4E4XA 3U6HA 1Z9XA 3TYKA 5CALA 4F9BA 1YXUA 3POOA 4GCJA 3HEGA 4I23A 5CSVA 4U97A 5FDXA 5I5ZA 5DHJA 2NYAA 1E1VA 3L8SA 4E1ZA 4IJPA 2EB3A 4DTBA 4IAIA 5CU6A 2O0UA 2YFXA 2C5OA 5IA4A 4BI2A 1WBPA 2CGVA 2WMUA 3BLRA 4K6ZA 2FSTX 4E4MA 4XP3A 2QG7A 1Q8WA 2J7TA 2VTSA 3CBLA 3NCGA 4MD7E 5CX9A 3VBXA 2UW4A 4AG8A 4ZAUA 4RX5A 2B52A 5CZIA 3CE3A 3QQJA 4IB1A 4CMOA 1XBCA 5HNGA 3UJGA 4GJ3A 1TVOA 1OKZA 4S32A 1P2AA 3MH1A 4BCOA 4ZMEA 1H07A 4DE4A 4ZZMA 2JFMA 4FBXA 5J5TA 4ALVA 4BL1A 2YM5A 5J1VA 5IUIA 4ACCA 4IW0A 4FGBA 3NWWA 1Q24A 4APPA 2RSVA 2VN9A 2Y7JA 3VO3A 5HIDA 3QRIA 3QTIA 5GNKA 2CKPA 3I0QA 2YAAA 3ETAA 3W2QA 3BLAA 4FTIA 4Z7GA 5BMSA 3AGLA 5H9BA 4LI5A 4FV2A 3BHVA 4CMUA 1Q8YA 4RIWB 2B4SB 3D14A 5CF6A 2X0PA 2JITA 4UALA 3H30A 2XKFA 3W32A 4HPUE 4QEBA 2JDRA 1KOAA 3QQUA 4RWJA 3UNJA 4PF4A 4ERWA 3EQCA 4QMZA 2ITUA 3DXQA 3FUPA 4V05A 4DEAA 4XUFA 4I6BA 4H3PA 2VX1A 2X8EA 3DAJA 5EW3A 3ORPA 3S0OA 5EYCA 4IX5A 5KKRC 1H1QA 3QWJA 4O6EA 3PUFC 4IX6A 3NS9A 5EHYA 5GJGA 2GNGA 4KS7A 4HOKA 5AMNA 3R8MA 5HBJA 5D11A 1FGIA 5JFVA 2BCJA 3D9VA 4CCBA 4AT3A 1R39A 4ACHA 2WOTA 4FTKA 2QVSE 2E2BA 4J71A 4ZY4A 3PFQA 3N51A 1HOWA 1W8CA 2BDWA 3GQLA 3F5PA 2GTNA 2YZAA 3OT3A 3QTUA 3ORTA 4G16A 3PY1A 3F6XA 4U81A 5E91A 2R3GA 4QMTA 3SXRA 1O6KA 4AA0A 3FZ1A 4E6CA 5E8ZA 4OAVB 3IS5A 4AGDA 3UDSA 4D0WA 3G0FA 5CEPA 1H00A 1U5QA 1Y57A 2BDFA 3CY2A 3Q9WA 4FT7A 4V0GA 5AIKA 5CYIA 5AP7A 5LMKC 2WMQA 3LQ8A 3RPRA 4LRKA 5CT0A 4B9DA 4EK3A 5JH6A 1MP8A 1ATPE 1X8BA 2HK5A 4LMNA 1B39A 2B9HA 3EKNA 4I94A 3P5JC 3GENA 4GMYA 4O2ZA 4EBVA 4XV1A 3R8PA 4QMYA 3ATSA 3CD3A 5AR5A 5E4HA 2R3IA 1UKIA 3OW4A 3EOCA 5KMKA 4K11A 4UMTA 3UQCA 2VO6A 4YJQA 3OFMA 4G17A 5AUWA 5AFVA 3GFEA 2LGCA 4LYNA 3I4BA 1CTPE 4BCPA 3DBFA 2E9UA 5IQIA 4C33A 5CVFA 4WO5A 1QPEA 4XG3A 3TM0A 2X7OA 4C37A 1CKJA 4UZHA 4JBQA 3KXXA 4I5PA 3BHHA 2GTMA 4NYEA 5G1XA 3QX2A 5I9UA 3I0OA 4I41A 5F20A 1KE9A 3OROA 3Q2JA 3BU5A 4G6OA 4Q5HA 3OXIA 4RIYA 3BZ3A 2WMRA 4LOPA 5FXSA 4C0TA 5M55A 5KMMA 4XLVA 5AEPA 4BDEA 1T46A 4AA4A 1CKPA 4UX9A 3PA5A 4DLJA 3PTGA 5HX8A 3A4OX 4N0SA 3DT1A 4EZ5A 3B8QA 1ST4A 3OD6X 4NUSA 5L2TA 3F3VA 4MXYA 3KRWA 3MIYA 2IW6A 4PPAA 4EHZA 4FKVA 2YDKA 1VJYA 2ETMA 3CJGA 3FMHA 4KA3A 5BUIA 3ALNA 3DOGA 4CQEA 4F9AA 3PG1A 2HXQA 3TXOA 5L2WA 2W4OA 2XAMA 1YOMA 5FP6A 2YCRA 4O82A 4O6LA 1PXNA 2PL0A 4GIHA 4E26A 3I1AA 4NCTC 1W84A 2JBPA 5HE2A 5DG5A 4TL0A 4GK2A 1ND4A 3PZHA 2XCKA 3VBVA 2WFYA 5I9XA 1MRVA 4AXDA 2Y4IB 4OTDA 4BCQA 3FQSA 3RJCA 2Z7QA 3TNWA 3HNGA 4MCVA 4RLKA 3FMMA 3RWQA 4QMXA 5BQ0A 2A98A 4LV8A 5K5XA 3PE1A 1I09A 1OI9A 4U8ZA 2BMCA 4G3CA 5DRBA 3R8ZA 3NUSA 5JFXA 3UQFA 3FC2A 4CG9A 4DEEA 3R30A 4HVGA 2OW3A 5DT4A 2YCFA 4JXFA 4EOJA 5IH6A 2X4ZA 5CXHA 3W8LA 2VNYA 2BHHA 4IZYA 2BVAA 4EQMA 5M51A 3A8WA 1M2PA 3AT4A 5M4UA 3QKLA 3PRIA 5T6KA 4PNKA 3UZTA 2ETKA 3A99A 2X2KA 3IGGA 3L9MA 3POZA 4ZTQA 3V8WA 4IH8A 5E7RA 4EOLA 3V5TA 1XH9A 3R00A 4KBAA 2E9VA 1JKTA 4OLIA 3FHRA 4FKSA 4PDOA 5CY3A 5CNOA 4AOJA 4G6NA 4DEGA 3R02A 5FQDC 4PL4A 3UP7A 2X6DA 2BUJA 2WELA 4X6RA 4AU8A 2BFXA 5DFPA 2UW0A 5C8NA 3QTXA 5L6OA 5CVGA 1UU7A 4CFUA 2XVDA 5DR6A 2W0JA 3VBYA 3FY0A 2PZIA 3OWLA 4I3ZA 1PW2A 3DZQA 3LW0A 4HVIA 4AACA 3MDYA 3NVMB 3GI3A 3F3WA 4KBKA 4QPSA 1W2CA 3DBQA 3I5NA 5HO6A 3QCSA 4I0RA 3LCTA 3HRBA 2JKQA 3QAME 3NIZA 3BBWA 2E9OA 4BFMA 1Q97A 5HD7A 4QOXA 4CLJA 3SG8A 5J8IA 3QZGA 4D2PA 4X2KA 4F9CA 3QHWA 5C4LA 4FSYA 1WAKA 3HMPA 4FTOA 2IF8A 4ZMFA 2LAVA 1MRYA 3SOCA 3QLGA 5DPVA 3KQ7A 3TJDA 3VRYA 4RIWA 4E3CA 3GOKA 1FVTA 2ZFYA 1JNKA 4I92A 2JDOA 4IMYA 4U3ZA 1KE7A 4Y73A 4FVRA 1OPKA 2Z7SA 3EN7A 2QOFA 2PYWA 4F78A 4DYMA 3L9PA 4FYOA 4PNIA 1Y91A 2XMYA 3QUDA 4FNWA 4IBMA 3RWPA 4KS8A 4OAUC 3ZFXA 2H96A 2JD5A 2R5TA 3CY3A 3VUGA 1H0VA 1ZAOA 4FTTA 5D1JA 1SZMA 4EOPA 4YC3A 2EU9A 2VWIA 3DBCA 4FV5A 3O2MA 1O6YA 4R7IA 2UZEA 2WMWA 4P4CA 4USEA 5AUVA 4FV1A 3R7OA 4TW9A 4C58A 4FTCA 1S9JA 3COIA 3RI1A 4XMOA 5A4LA 3Q2MA 4DT9A 3KF4A 3HA6A 3CP9A 4C59A 3CQWA 3MW1A 2PUUA 4DFBA 3GBZA 4ZTSA 4YHJA 1VLRA 3TUCA 1GJOA 2QI8A 2Z2WA 4A9RA 4U9AA 4EZ7A 5JK3A 2BIYA 3QRTA 5HCXA 3C9WA 4O91A 2VTOA 5IISA 4FZFB 4IC7A 3FY2A 4H1JA 2G15A 3QQGA 5KHWA 5GZ8A 5BVWA 3LXKA 5CENA 4ANBA 2YM3A 4M69B 3HAMA 3JXWA 1XKKA 3F7ZA 5JT2A 2EXEA 3DCVA 4QMVA 2W1CA 3BWJA 3PXFA 4HGEA 3UNZA 5CU0A 2QOOA 5FGKA 3FMLA 1CSNA 1LR4A 4J53A 3S2PA 4CVAA 2O3PA 5I9VA 2OJJA 1Q41A 2QKWB 5C1QB 3SXSA 2X2MA 3PP0A 5ANJA 4YUQA 2QKRA 4WSQA 4BF2A 4QMQA 2J5EA 5AP4A 3R28A 4F63A 4DDGA 4E73A 5AUZA 3RAWA 3AKKA 5EQPA 5GHVA 4A7CA 4I5MA 1T45A 3DZOA 4IAZA 1JOWB 2UZLA 2Z7RA 3MPMA 3ZFYA 5F95A 2WXVA 5KBQA 1XBBA 2B54A 4MHAA 4HGTA 4ONAA 3R9NA 2WHBA 3ZTXA 2R9SA 4FZAB 1OVEA 4OTFA 4Z9LA 4J8NA 3FMDA 4D2RA 3REPA 1XR1A 3L9NA 3DV3A 3DDPA 4K77A 3IQ7A 4TWPA 2NP8A 2I1MA 2VX3A 4F0IA 3EIDA 3MH0A 4FIEA 5JEBA 4HZRA 4KWPA 1G8JA 3U54A 2YM6A 3I5ZA 4FL3A 5CF5A 5D10A 4GYGA 4MX9A 1K9AA 5CSWA 5CVHA 5EH0A 4ZLOA 4FSRA 5KMLA 2W1FA 3WZEA 3V6SA 4DGNA 3DK6A 4N6ZA 4KIPA 3QXOA 3UMWA 2UW5A 3R9OA 4ORKA 4NFMA 3QCQA 2HOGA 4F0FA 5KE0A 5CXZA 3DAEA 5E92A 4KINA 4L9IA 2PVLA 4DTKA 3DK3A 4GFMA 3FI8A 4AZFA 4CFXA 5FBOA 3BWFA 4D0XA 1XHAA 5L2SA 3RK5A 4BDFA 5CEMA 1KUTA 3A61A 1PKDA 4L53A 4Y5QA 5FTQA 4BDCA 4QMOA 2PZ5A 4MQ2A 3U9NA 5AUUA 1IAHA 3Q4UA 4O0SA 3DLSA 4FOCA 3SXFA 3R7IA 3O51A 5AAFA 2F49A 2H6DA 3OWJA 5HZNA 3F69A 3SKCA 3ZLWA 4OTQA 3OBGA 3IKAA 5FDPA 1Z57A 3A60A 3SG9A 5A4TA 5CU2A 1JQHA 5EW9A 2Y9QA 4JAIA 5TOZA 3LM0A 1E1XA 1YHSA 4DFNA 1PJKA 5ANIA 5CS6A 3ZOSA 4RQVA 4RWIA 4FNZA 2PVNA 4FZDB 3C4FA 5A46A 3N4VA 2QURA 1XQZA 3BCEA 3KULB 3HGKA 2NRUA 4NT4A 3FZSA 4AE9A 4EORA 3AC3A 3UDBA 4YBJA 1OUYA 4R7HA 3KC3A 4GIIA 4QQJA 5IA1A 2ONLA 3BE9A 2R64A 3D7ZA 4D55A 3TDWA 2XJ0A 4O4EA 3UPXA 5EM7A 3WZUA 3KKVA 1SMHA 1SVEA 4X3FB 5J7BA 4AZVA 4L68A 5ETFA 3ALOA 1XH8A 3PUPA 5EI2A 3CTJA 5IDPA 4OT5A 3QUPA 5LVNA 3PSBA 3W10A 1OIUA 3NPCA 4DH5A 3F82A 5HLWA 1W2FA 5AUTA 3H10A 4OBPA 3PJCA 1PYXA 4TWOA 4YPDA 2BILB 3QL8A 4FT0A 4QMUA 3VNTA 4BKJA 4TYGA 2R3MA 3NMUF 3VRZA 1DAWA 2ZV9A 4FKTA 4G31A 3DTCA 5C8MA 5CNNA 3UE4A 1J7UA 4DHIB 3O17A 3TWJA 4FMQA 4G2FA 3HV5A 4BGQA 2EXCX 4JBPA 4LRMA 4ZJIA