3FHIA

Crystal structure of a complex between the catalytic and regulatory (ri{alpha}) subunits of pka
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
338
structure length
336
Chain Sequence
ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLAGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Crystal structure of a complex between the catalytic and regulatory (RIalpha) subunits of PKA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 107
structure length 336
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fhiA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fhiA02
3EMGA 4FT3A 1YI6A 4FT5A 5HLNA 3OCGA 4GT3A 4DFYA 3TZ8A 4IWOA 1PXOA 2E9PA 3C4WA 1EH4A 3C7QA 4F0IA 5EHLA 2WD1A 1M2PA 1XH7A 4IWPA 3PXKA 3IK3A 3LVPA 5AR8A 1E1VA 5LARA 2R5TA 3L8VA 3ZFXA 3T9TA 5AIRA 2WTWA 1WBWA 5CQWA 3W18A 2UZOA 4WUAA 3VS4A 3VUMA 4BCMA 4FX3A 2YDKA 4A9UA 5HNIX 4GU6A 1PMUA 3K5VA 4UN0C 1RQQA 5IMXA 5I9ZA 4DH1A 5CZHA 4EONA 4FTRA 4H58A 3CQWA 4O1PA 3WYXA 4DEHA 3G51A 2JFLA 2XRUA 3R0TA 3QQUA 4YHTA 2B53A 4FKJA 5IUHA 4C4GA 4D0WA 3E8EA 4L00A 3R9RA 3TZMA 2OF4A 3IPHA 4AZFA 2OH4A 4I23A 3C0IA 2BRBA 3WF5A 1DM2A 4I24A 1BYGA 5E8TA 3DLZA 3U8WA 4EBWA 4MF1A 3ID6C 2B55A 2HYYA 2G1TA 5J8IA 3I60A 3HL7A 4FOBA 3FKLA 4MKCA 2W0JA 3VAPA 4E7WA 4F1TA 1ZOGA 4FTUA 2Z8CA 4AE9A 4RPVA 2PZRA 3FMNA 4YC6A 4QMUA 5F1ZA 1H1QA 3SXFA 2OBJA 5ANGA 2FB8A 4A06A 5AR5A 4O7ZA 3LFEA 3FPMA 4NTSA 3VVHA 2GS2A 1KOBA 3LFDA 4DLJA 2ZVAA 4FVPA 4AT3A 4R8QA 4W8EA 2ZM3A 4FG7A 2OICA 4E4XA 1Q99A 1ZYDA 4LMUA 5H8GA 3PVWA 2JDSA 3DNEA 5L4QA 5AP1A 2X8DA 3ZDIA 4L3PA 2PVJA 3VS3A 4FKGA 2HW7A 4FICA 3UNJA 3ZM9A 3R30A 3QCXA 3WIGA 4AS0A 4KABA 2XVDA 4NM3A 4IDVA 5KKRB 3R2BA 3MS9A 2IVSA 5CX9A 3R71A 4D2RA 4EBVA 4PQNA 2UZDA 3LFCA 2BIKB 2XCKA 3RPSA 4DE4A 4U41A 3FY2A 3HMMA 4YO6A 3IDCA 3QZGA 4MTAA 4KIOA 1ZYCA 3ZLSA 5KNJA 2W9FB 4LM5A 2R3MA 2ITUA 4Z16A 2NO3A 1PJKA 2ITNA 2O63A 4EK5A 3N4UA 4O86A 4F9BA 4KS7A 4PDYA 3AD6A 1OL2A 4FV9A 3TV4A 5AMNA 3NUXA 4MBIA 3S3IA 2PHKA 2VX1A 4P90A 5T3QA 5CF4A 2GTNA 5K5XA 5DR9A 2W05A 3VQHA 5LVOA 5EM5A 4FIFA 4QP6A 3ZLYA 2E9NA 5IEVA 3OXZA 3FC1X 3BHTA 3FMEA 3W2QA 2XBJA 2R3PA 4MBJA 3C4XA 3FSFA 4FG8A 4O0UA 2WMXA 1ATPE 2FSMX 4EWQA 2UW5A 4FL3A 2ZMCA 4DH5A 5D41A 1F3MC 2VGOA 3VS1A 5A9UA 2X81A 4X3FB 2VTAA 1UKIA 4BGQA 3PWYA 4GFGA 3CR0A 4F6SA 4FSZA 4FGBA 4GJ2A 3HDNA 1H0VA 1WVXA 3AC1A 4FNXA 5A4CA 1FQ1B 1GIIA 2YWPA 5LMBA 1QPCA 2ITWA 3QRTA 3TNQB 5A4EA 4RWJA 4F1MA 4LOOA 4E8AA 3DK7A 4G9RA 2XIXA 4BCHA 3DY7A 4G2FA 4I93A 2RKUA 3S4QA 2JEDA 5FXQA 4AOIA 4LG4A 4IVCA 4KKGA 4NEUA 4DFZE 2ESMA 4EYJA 3EFKA 1W8CA 2XIZA 3E5AA 4JOAA 4NKAA 3ORIA 2LAVA 1T46A 4L3JA 5HESA 3ZUUA 4FV2A 3UQCA 2QOBA 2OW3A 1REJA 3QLGA 3BYOA 2VTTA 4V01A 3RBWA 1NVSA 1TKIA 3VUTA 5C1QB 2XA4A 2FH9A 4N6ZA 4L3LA 4DEDA 4UV0A 4BDJA 3OOGA 4IAYA 5KKRC 5GIOE 2B54A 4ERWA 2WOTA 3EKNA 1OITA 4MEDA 3SOCA 3DB8A 3BLHA 4XHKB 3HECA 2VO0A 4BYIA 3EKKA 4QO9A 4J71A 4CEGA 3NIEA 2IZUA 4D2TA 3CBLA 3ZFYA 2F2UA 5CEMA 3D15A 4M12A 3VW6A 4YZDA 2VTNA 4FTKA 4JDKA 3U4UA 4QD6A 5CYIA 1XJDA 5FP6A 3TN8A 3LFQA 1E1XA 3N51A 4BB4A 4EJNA 2UZNA 4U40A 3K5UA 2QOHA 2G2FA 5M57A 3RJCA 4YUQA 3Q3BA 4EH4A 1U54B 2OZOA 3JVRA 4ZTSA 1XO2B 5HBJA 4ITJA 1J7IA 3VF8A 3L8SA 3OWJA 4UBAA 4R7BA 1J3HA 5HCZA 3C13A 4I6HA 4U7ZA 1KE8A 5ANDA 4KSQA 4GKHA 1DAWA 1H1RA 1KOAA 3EFLA 3PA5A 4DGNA 4OTQA 1OB3A 4QMMA 4FEUA 1U59A 2WMRA 4AGWA 1QPEA 4K9YA 4L67A 4IH8A 2H8HA 3HKOA 4IVAA 2BRMA 3MVHA 3V6RA 3QD4A 2CCIA 3O23A 3CGFA 3DXPA 4FZAB 4UXLA 2UVYA 3GCUA 5GINE 1Y8YA 5KZ0A 4FV1A 2AC3A 3FWQA 2BZKB 3FV8A 4FR4A 3F5PA 3ALOA 1YDTE 4R77A 2Q0NA 4JG8A 4FE2A 2EXMA 4BF2A 3MDYA 2B9FA 4QPSA 4IZAA 3LOKA 3HP2A 5LWNA 5BYZA 5A46A 3AOXA 4FZDB 3QGWA 2GFSA 2BDWA 3PE2A 3HZTA 4G3CA 3EYGA 4Q2AA 2IZTA 3DBFA 4O96A 3UPXA 3ORMA 4V0GA 1H24A 1P4FA 2YIYA 3ZBXA 4TKSA 2PE2A 4XP0A 4BDDA 5K0KA 4CMTA 2UZEA 2XYUA 4KRCA 4IAFA 3GOKA 2C69A 4LV5A 3LQ5A 4BZDA 2PMNX 1PXNA 1PRYA 3E7OA 3AC8A 3FLYA 2J5FA 5CVHA 5C9CA 3DBDA 2AC5A 2YCFA 4CCBA 5ITAA 3HV4A 5CF6A 4BDHA 3C4EA 4KBAA 2OZAA 5DWRA 5GNKA 4MNEB 4A9TA 2W4KA 2VTIA 3MY1A 2UZLA 2GS6A 2IVTA 4FKRA 4YZMA 4EOJA 4ENXA 2PYWA 1U46A 1KE6A 2I6LA 5JEBA 1BX6A 5HE0A 3UZPA 4D9UA 4ZSJA 5E1SA 5M06A 4ORKA 4R3RA 4V0GB 3WYYA 4CMOA 3U51A 3OWKA 2B1PA 4BVUA 3IOKA 3PXQA 3RMFA 4I41A 2KULA 3MWUA 3LCKA 2WQMA 3F5GA 1DS5A 4I0RA 4E6AA 3O51A 5BUEA 3R7VA 4CSVA 4YSJA 5IKWA 3KQ7A 1R1WA 4IEBA 2I1MA 4AW2A 4C36A 1HOWA 2A0CX 4QMTA 3VNTA 5EI6A 2CNUA 2OZAB 4IAIA 4GCJA 2ITVA 2A19B 5A54A 2X39A 4LUEA 3ODZX 3RAHA 1KE7A 3P79A 3H30A 4M13A 4GMYA 3C4FA 3COMA 3P7AA 2OU7A 3ALNA 2G15A 3P78A 2V7AA 1ZLTA 1BKXA 3IW8A 3QQKA 4KNBA 4C2WA 2OO8X 1ZWSA 4Y5QA 1UU8A 3MPMA 4W4XA 4MD8E 4GK4A 3FSKA 4ACHA 4BZOA 2HZ4A 1RDQE 3DS6A 4NM0A 3EN6A 4OGRA 4AN9A 4EH5A 4FA2A 4S32A 4LUDA 2FSOX 3O8PA 4X6RA 1TQPA 4G5PA 4ACDA 4O2PA 2C3LA 2ZB1A 4EYMA 4IW0A 3BKBA 4ZEGA 5I5ZA 4XP2A 5E8VA 4P2KA 2ERZE 5HG7A 4CFVA 5IQEA 4ID7A 3PLSA 5HO6A 3FLSA 3PSBA 2P0CA 3B2TA 5CVFA 4USFA 4BKYA 4I3ZA 1NVQA 2GHLA 3GC7A 3NNXA 1V1KA 3QAME 5BVKA 3SOAA 3ZRMA 4B8LA 5ACBC 3MESA 4HPTE 4FSWA 4O7RA 4ALVA 4M15A 4C8BA 4ERKA 1YOMA 2BROA 5JFWA 4FV3A 2H96A 4WSYA 2B9IA 2A2AA 4UZDA 3ANRA 4B6LA 4CV9A 3GCVA 5L6WL 1H07A 1G8SA 2W5HA 4FVRA 3NRMA 4M97A 4O38A 4PTEA 2VD5A 4XOZA 5AUXA 5GJFA 5BYYA 4IZ7A 4WSQA 2VO3A 5JGAA 2YWVA 3DDPA 4J95A 2R3NA 3EQFA 4AOTA 4TWNA 1XBBA 2J2IB 2Z60A 2X4FA 3BU3A 4CG9A 3EN5A 2XNNA 3F82A 3E3BX 4F99A 3MFSA 2YM8A 3W2OA 3HRFA 4BICA 2Y0AA 3CKXA 3QCSA 1UNHA 5HIEA 4KINA 1H00A 5H8EA 4QMLA 3TUBA 2VNWA 4HGEA 2C6TA 3I6WA 4F09A 4CV8A 2C6LA 3LJ1A 3IONA 3VS7A 3RHXA 3PRIA 4QQ5A 5D1JA 3ZYAA 4BBMA 4ALWA 1URWA 1OVEA 3GP0A 5HG5A 3QTQA 4AZEA 4O0YA 4BZNA 5EDQA 5ANJA 1Q4LA 4Z9LA 2UW0A 2EXCX 5CAOA 3F6XA 1OPKA 4BDIA 4AX8A 4YU2A 3GU7A 3PA3A 4N57A 4NFNA 3JY9A 4BBFA 4GJ3A 4RJ4A 3KGAA 4LGHA 2B9HA 4L53A 4C57A 4D2WA 1YHSA 4EHEA 1JKKA 4B8MA 2CNVA 3SG8A 1JNKA 3UZRA 4NKSA 3BYVA 3LM5A 3IW4A 5C4KA 4G16A 2WQBA 2YDJA 4AG8A 1XKKA 4APCA 1OIQA 2GNGA 5E8WA 2Y4IB 2O2UA 1A48A 3HYHA 3VWAA 4MXCA 3Q9ZA 4O0SA 4QTCA 4ALUA 3PE1A 5KCVA 3RZFA 4A9SA 2OI4X 4BFMA 1V0OA 3ZUVA 5I9WA 4ZS0A 4YLKA 4DITA 2YM3A 3Q52A 5E91A 3RAKA 2XNMA 3D14A 2CHLA 4Y83A 3QKKA 3BHUA 4ZTNA 3POOA 4WNMA 4AOJA 4P4CA 3L9MA 3TL8A 4BL1A 4EJ7A 3ITZA 2XNGA 3A4PA 4WHZA 4OTHA 4YJTA 3KA0A 2QOLA 4F4PA 5J9ZA 4J97A 4IX5A 2VGPA 3B8RA 2C5YA 4JR7A 2YM6A 1TQMA 2J50A 1OECA 2PZYA 2WOUA 3QQGA 4IIRA 4F9YA 2OFVA 3QTZA 3FMDA 3ZSGA 4AP7A 3PY0A 4K0YA 2UW8A 3AD4A 1J1CA 4W9WA 1IR3A 3VBWA 3MFTA 3OCSA 2OJFE 5AX9A 4JL9A 3OVVA 2E2BA 4PNIA 3QZHA 4YBKA 4HCVA 4NZWB 4AW0A 1JAMA 2OGVA 2YFXA 3P5KA 3RHKA 2X8EA 5FEQA 4FSRA 4L7FA 4EZ5A 3A2CA 5KMMA 2F7XE 4GYIA 2X7OA 5AR2A 5JT2A 2J4ZA 4Y46A 3HP5A 2YM5A 4DA5A 1JKLA 1OKZA 4OBPA 3NS9A 4PPAA 3RCDA 3PTGA 4PNKA 4Z3VA 2CKQA 2C0OA 3QGYA 3UIBA 4PWNA 1V0PA 2BZHB 2QLQA 1J91A 4FIHA 1JOWB 5FEDA 1URCA 3DXNA 3DKCA 3MYGA 3SGCA 5HG8A 5IF1A 3P0MA 2IPXA 3PWDA 5DOSA 1M52A 3ROYA 3CTQA 3FUPA 3LMIA 3KCKA 3PG3A 4DN5A 4UMQA 3UVPA 1YOLA 3I81A 4K6ZA 3EQGA 4AGUA 3Q2JA 1TVOA 1J1BA 4ZTLA 3NUAA 1SMHA 3KRRA 5HCYA 4JRNA 1AD5A 5CVGA 4FGRA 4FSQA 4RZVA 1HCKA 5EW3A 3SDJA 3OW4A 2ACXA 3T8OA 2HZNA 1LPUA 1Q41A 4FIJA 2GS7A 3OBJA 3ZTXA 4MH7A 4BDEA 3TKHA 5K9IA 3W2CA 3MH2A 4OAUC 5IZFA 3ZH8A 1H01A 3PFQA 4EOLA 5AP4A 2WTVA 3DQWA 3AC5A 3UMXA 3MIYA 2QOOA 4NK9A 3W8QA 3NUPA 4FV0A 4J8MA 2W4OA 4BTFA 1YOJA 4S31A 4YTFA 4E6QA 2J0JA 4XG6A 4AQCA 1XH9A 4Y5HA 4ZP5A 2BDFA 4KSPA 5KBRA 3DCVA 4TYJA 5T6KA 4HZRA 3HGKA 3VBYA 4MXZA 3KRWA 4AACA 3VW8A 4JX7A 2IWIA 2JGZA 3PSDA 3BHHA 5I3RA 2B0QA 4LI5A 1UU3A 2WXVA 4O2ZA 2BIYA 3C51A 4FTTA 4M67A 3UQGA 4DLIA 4AW1A 1VR2A 2ZDUA 1WBVA 2GNLA 5ICPA 3D83A 3PDTA 3FZRA 4KIKB 4RT7A 4DTKA 3S1HA 1Q8WA 4ONAA 4PL4A 4RX9A 5B2LA 5M53A 2GNIA 2UZUE 1YWVA 4OTPA 3CSVA 3NVMB 4FZ7A 4JBVA 3BU5A 3PP0A 4I5PA 4MXYA 3L8XA 3MI9A 3U87A 2F7EE 4GT4A 4OAVB 1NW1A 2X4ZA 4OTGA 3CY2A 4K11A 2C6EA 2PVFA 3OCTA 3RPRA 2PUUA 2LGCA 3SVVA 4XS2A 1RW8A 5KE0A 3S2PA 3AT3A 2WNTA 4FSUA 3F3UA 4EUTA 2RGPA 4PDPA 3DJ5A 3O8UA 4I5HA 4IAKA 1APME 4QYGA 5JKGA 3BE9A 4MBLA 3G6HA 5J79A 3ACKA 4RIWA 3TV6A 3A60A 4MXOA 4EC9A 2X2KA 2VTRA 3PJCA 2R0IA 5M55A 4HVIA 2ZDTA 1H28A 4TN6A 4ZMEA 3KXMA 3FZPA 4S34A 1WMKA 5IA1A 4QP2A 4BYJA 4KIPA 2ERKA 3HRCA 4XX9A 5DVRA 3F3TA 5KMKA 3OD6X 5HIDA 5LMKC 3QHRA 2YIXA 3QTWA 2VTLA 4D58A 3SXSA 3UPZA 2QODA 5IQBA 2C5XA 3LFFA 3PXRA 3REPA 1ERKA 4FIIA 1FBNA 4D2VA 2UZWE 2V5QA 4GU9A 1YWRA 3ACJA 4FZFB 2GU8A 4PPCA 3Q5IA 3FMMA 3ZXTA 3BEGA 1MQBA 4WNPA 5FDPA 5I9YA 5M4UA 4JDJA 2W96B 3OP5A 3R7YA 3MA3A 4D55A 4DH7A 5FD2A 2BHEA 1UVRA 2WO6A 4F7SA 4RIWB 5FM3A 1PHKA 3R8MA 5BVNA 2JIIA 3NSZA 4YTIA 3TG1A 3OG7A 3NW6A 4M7IA 5HVKA 5CSPA 4OUCA 3TJCA 4FKLA 3CS9A 3A4OX 5FBOA 2W06A 3WZUA 3QYWA 1ZZ2A 1QMZA 4QYFA 4XLVA 3UE4A 4AUAA 2OG8A 3QYZA 4FTNA 5IEYA 4HVGA 4I94A 3D5VA 4QP4A 1IAJA 4EUUA 2WKMA 4ZXTA 5TT7A 4U44A 4O0VA 3HAMA 4GG7A 4WD5A 4XUFA 3SW4A 4FT7A 5L2QA 1XR1A 1PMNA 3RNIA 2HY81 2YIRA 3M11A 3Q9WA 2DYLA 5CAUA 2B52A 3D5WA 4QMQA 4EOOA 4UY9A 4F65A 4K8AA 4EL9A 4G9CA 4WT6A 3UOHA 3COKA 3CTJA 3R02A 3GQLA 4BGGA 4CFFA 4X21A 4QNYA 4YTHA 1GAGA 2O3PA 1PY5A 2YLFA 4O7NA 2QOQA 1DI9A 3KEXA 3KMMA 2BKKA 5EM8A 4TNBA 5I9VA 2GQRA 4HYIA 4NIFB 3TACA 5A4LA 1H1SA 3RPYA 4UWYA 5CI7A 5CAVA 4FEQA 5IQGA 3WF9A 4QMVA 4ENYA 3F3VA 3I5ZA 2Y9QA 3G15A 3ZUTA 5CU4A 2VV9A 5CNNA 3AG9A 4FV4A 4RA5A 3LQ8A 3R01A 5EOLA 4O22A 4O6EA 5GZ8A 1MQ4A 4X3JA 5IDPA 5GIPE 4QTDA 4O91A 5CNOA 4ZJJA 1W83A 2QVSE 3BGPA 3S95A 2JKOA 2UW7A 4XBUA 5AP6A 4EHZA 2HWPA 2AYPA 3IGOA 2IO6A 3CD8A 5DGZA 4YR8A 2AUHA 4RRVA 1R39A 4MQ1A 3JS2A 2IW9A 4MD7E 3OTUA 3HX4A 4KB8A 4Q9SA 3V5QA 2BFYA 4IACA 4DBNA 4RWLA 3AGLA 2C5OA 2YAAA 3LXKA 3SD0A 4JRVA 4EK3A 2GPHA 2PSQA 2XNPA 5KBQA 3UC3A 5BUJA 2CN8A 3JY0A 1Y8GA 1M2QA 3QRKA 3R63A 3V5PA 4QQCA 4C38A 4I0SA 3MH1A 4QT1A 1BLXA 3OMVA 4YJSA 5AAEA 2GNFA 4RGJA 3ZCLA 3A7FA 4AZVA 1ZZLA 4FC0A 5CXZA 5CF5A 3BPRA 3HEGA 3KCFA 3QBNA 4D5KA 1SM2A 2C6OA 5G6VA 3HV6A 4E20A 4DEAA 1W7HA 5AP5A 4F0FA 3C0HA 3UODA 1H8FA 3ZEWA 5BVOA 3N4TA 1OMWA 4C62A 2W1CA 3R6XA 1MUOA 4XYFA 3BGZA 4J98A 3TZ7A 3BEAA 4O7WA 3PY3A 3W33A 4YTCA 4DCAA 1KV2A 4PDOA 3ZZEA 4DGMA 3HA8A 3QCQA 1XH6A 2PL0A 2GQSA 2BAJA 4X2KA 3EL7A 5AUZA 3RINA 3PSCA 4R7IA 3A7HA 5ETCA 5LVPA 4X6QC 4O84A 2DUVA 2OFUA 5HU9A 3EN7A 4B9DA 4BN1A 4YJUA 4R1YA 3VS0A 3I0OA 2WQOA 1LUFA 4EOIA 4D5HA 2B4SB 3VS5A 3EH9A 5IUIA 4RX8A 1V0BA 1XBAA 2WMUA 2V0DA 3UBDA 4QTEA 3TV7A 4JIKA 4BTJA 4USEA 4QMXA 3NNUA 3EFWA 2GQGA 2OWBA 4ZY5A 1SNUA 1WAKA 1YKRA 4MK0A 3TDVA 3F7WA 4UZHA 5DT3A 2RG6A 2VTOA 4CD0A 5BMSA 3KFAA 1PXJA 3QA8A 1IA8A 5HVYA 3D2KA 4L8MA 5FTQA 4BCGA 5C8MA 3EZVA 3IOPA 2OLCA 3TI1A 2PUPA 4DF3A 2ZV8A 4QP8A 4IMYA 1IAHA 2YABA 1XQZA 3Q04A 4U9AA 5I9XA 1WBPA 2PUNA 2W5BA 4XBRA 3CIKA 4R6VA 2QKRA 4JQEA 2ZM4A 4TPTA 4FMQA 3GCQA 4AA4A 1LEWA 2YZLA 3NCZA 4LOPA 4RJ5A 5BVDA 4FTCA 5KO1A 2GDOA 3HV7A 4QQJA 5AP7A 3ATTA 5FTGA 3C0GA 3NIZA 1SVGA 4EQMA 3P23A 2WEVA 4FKSA 2OXXA 2W1DA 2PVHA 3KXZA 3MY0A 4R7HA 5BX0A 2XIYA 4IB5A 1KV1A 3LZBA 3VUGA 4HYSA 4I6QA 2PE1A 5CEKA 4S2ZA 2JDTA 2XRWA 3ODYX 3GU8A 5CWZA 1JPAA 1XBCA 2WU6A 3LCTA 2JKQA 4NSTA 5EW9A 2C3IB 2W1IA 3JUHA 2C68A 2PMOX 4FT0A 5TO8A 3FYKX 2WTJA 1H26A 4WKQA 5AA9A 5JN2A 2ZV7A 4H36A 1IEPA 3E62A 3E88A 3ZM4A 2XK3A 3FQHA 2XKDA 5HOAA 5F95A 4ZLOA 3UOJA 4GUEA 3ZFMA 4L01A 4MD9E 4FSYA 5FRIA 3A8XA 5C26A 2WGJA 4E4MA 2ETKA 3FMHA 4ACMA 4AXAA 4BDKA 2XNOA 3V8SA 4JX3A 3U6JA 2WMBA 3ZLWA 2QNJA 4IBMA 5DR2A 3L1SA 5CTPA 3BHVA 4S30A 4G6OA 4BKZA 3ETAA 4C4EA 1GIHA 2BMCA 4G17A 4X2NA 3U9NA 4Z55A 3CE3A 5EDPA 4D2PA 4E5WA 4CTCA 4EK4A 4ZOGA 4KS8A 4RIXA 3BQRA 1PF8A 3DA6A 4MWHA 4YPDA 2GMXA 3HV5A 5DH3A 3ZBFA 5LMKA 1W82A 3F69A 3KRJA 4BCJA 2FSLX 3TNPC 5HCXA 4TWPA 4PF4A 1MRYA 4ZMFA 3RWQA 3DK3A 4OTIA 5AV3A 3WZKA 5G1XA 3TKIA 3E63A 4O21A 3GGFA 4D9TA 3U54A 4J99A 4JVGA 4G3GA 1OPJA 5L6PA 2C47A 4FV6A 3AT4A 5HEZA 4EHGA 3ORTA 3RWPA 4RG0A 5FG8A 5KX8A 4DCEA 3QKLA 4FNYA 4IXPA 3I0QA 2JAVA 3NAYA 4PV0A 1CKJA 4OBOA 2EWAA 3SX9A 2C30A 2YIWA 3BV2A 3BELA 2R7BA 4H3PA 4IB1A 4RJ8A 5CXHA 3F2AA 4FTLA 3RP9A 1ZYJA 2VU3A 1FVVA 3GB2A 3K3IA 3NWWA 3RVGA 3UOLA 2VRXA 4NL0A 4UXQA 3D7ZA 2C6MA 5CEQA 2BZJA 1OUYA 4CGAA 4RIXB 2W17A 2QURA 3OUNB 2GNHA 4BY9E 2NPQA 3NEWA 5HQ0A 3LJ0A 3FHIA 3LE6A 3SXRA 1R0PA 4ASZA 5KMJA 4O0RA 2Y4PA 3QUDA 1P4OA 4M84A 4ZSLA 2ITZA 3FL4A 3MVMA 2ZM1A 3TTIA 4HGSA 3RK5A 2Z02A 3VUKA 3AT2A 4UWCA 5DEYA 3AC2A 4Z7HA 4WIHA 1H0WA 3Q60A 4CCUA 3O17A 2IVUA 4Q5HA 3V01A 3NAXA 1YI4A 3TEIA 4E26A 3GU4A 5M56A 3FDNA 3QWJA 5E8YA 2QOKA 3FC2A 2YISA 4LQMA 4DTAA 2OSCA 4WRGA 2BCJA 4QMSA 3KXXA 1GZNA 2C5NA 2XM8A 4UMTA 4XV9A 4ZTMA 2HAKA 4U45A 4M0ZA 3PXYA 3EQHA 2JKKA 4FZ6A 4NJDA 5HE1A 2OXDA 4J52A 4RC2A 2BVAA 3MBLA 3ORNA 5CF8A 5CU0A 4JQ7A 3VRYA 3R8ZA 3RI1A 2YERA 2G2IA 4RLKA 4NW6A 1JBPE 5KMLA 3BZ3A 2CGUA 3TNWA 3OOMA 2BTRA 2WB8A 2VO6A 4MXXA 1IG1A 4BWKA 3MVJA 2XNEA 2J0IA 3E93A 4QMWA 5JRSA 2XB7A 5EH0A 4CQGA 4F9WA 1YXSA 4IC7A 1L8TA 2VX3A 3OZ6A 4YJRA 5H9BA 2QR7A 3AMBA 5AAFA 2P2HA 4FEXA 3QQFA 4HPUE 4R3PA 4U97A 3FXWA 5AV1A 5M08A 3PZHA 5BNJA 2WAJA 4D0XA 5AP3A 3ZRKA 3VJOA 1P2AA 1H1PA 1Y6AA 3OBGA 3CQEA 4QOXA 4FTQA 4Y8DA 4N70A 4CT2A 5AA8A 3IW5A 4OTRA 5IQFA 5FDXA 4MNFA 3VO3A 3RTPA 2BUJA 3FLZA 4AU8A 3R7EA 4UMRA 1KE9A 4QYHA 3D7TA 3A7JA 3AXWA 4L46A 2J51A 4M3QA 4AWIA 2Q83A 4RIYA 3QZIA 2QONA 4QMNA 2IZRA 1NVRA 4N0SA 3POZA 4WOVA 4ZSEA 4C7TA 5HVJA 3RK9A 4HCUA 1YDRE 3MH3A 3NR9A 3WF8A 2HIWA 2BAKA 1H08A 2R3IA 4J53A 4AW5A 3LCSA 5DA3A 3KK9A 4EH7A 4J96A 1XWSA 4CZTA 1XHAA 1QL6A 3EQBA 3F66A 4TRLA 5HICA 3U55A 3EJ1A 4U80A 3WF6A 4BCNA 3FQEA 4OTWA 2X2MA 4IZYA 4U42A 3UYSA 4AGCA 1H1WA 4IANA 3P7CA 4RQVA 3FYJX 5JZNA 1ZMWA 3NYVA 4GYGA 2ITXA 5HTCA 2ZV2A 4BRXA 2W4JA 2WQEA 2YDIA 4HYHA 4EH2A 4ZZOA 4AAAA 5B2MA 3GU5A 4R1VA 2C4GA 2Q0BA 3UG2A 5J5TA 1PXPA 3T3VA 3D7TB 3PPJA 4KAOA 3HVCA 4MXAA 1PMEA 4BTMA 5L3AA 3IG7A 3UP2A 3E8DA 4RIYB 4YMJA 3PA4A 4CYIA 3SHEA 1Q24A 1YQJA 3A7GA 3MV5A 4O6LA 3R28A 4TL0A 5FEEA 4DFLA 1Q5KA 3CQUA 4BDCA 1Y57A 3QRUA 2VWXA 3CXWA 3W55A 4DGLC 2Z7QA 4PX6A 3UO6A 4F08A 1Y6BA 2JAMA 4C4IA 3ZSHA 3PXFA 3V51A 5IA0A 4BIDA 1CDKA 4ZTRA 3FXZA 1O6LA 3HMIA 5C03A 5E90A 1WVWA 2YHVA 3ULZA 3ATSA 5DN3A 4C4JA 3H9FA 5HO7A 1ZYLA 4MCVA 3KL8A 1NT2A 2C1BA 4FTMA 1CKIA 1YDSE 2WTIA 2J7TA 4B7TA 2H34A 5M07A 3OY3A 5I9UA 1UKHA 2JLDA 3BRBA 3F5XA 4J7BA 4QMZA 3CP9A 3I1AA 2HK5A 3RZBA 2ITYA 2QQ7A 3MIAA 4XMOA 4BI0A 3EWHA 4F9AA 3Q32A 3D94A 3KN5A 5E9EA 3Q4ZA 4QP3A 2XK9A 5E8UA 2YM4A 2BR1A 2XK6A 2W1EA 2ITPA 2WTDA 3R8LA 5HORA 3R00A 3QCYA 3EQIA 2E9UA 3MN3A 3TIZA 4AE6A 1OPLA 2ZOQA 1JLUE 4YZ9A 3RPOA 3TWJA 4FOCA 4TW9A 1CKPA 4PL5A 4KRDA 4XJ0A 2YCQA 4YSMA 3GU6A 4YLJA 2HWOA 2CNQA 2CGXA 4C3FA 5M44A 1KE5A 4DG3E 2FGIA 4FKUA 4CLJA 4XRJA 4DFBA 2XIRA 5EFQA 2IVVA 3I7BA 4I5CA 4M69A 2VTJA 4AZTA 5ANKA 4I6FA 2QG5A 3CPBA 4QP9A 3ORLA 3JVSA 4D2SA 4NUSA 5J1VA 1F5QA 4ASEA 1CM8A 1W84A 1LR4A 4FKWA 4OT5A 3FXXA 2VX0A 3G0FA 4G1WA 5M4FA 5AIKA 5DFPA 1GZOA 4FTAA 2WMTA 3T3UA 2XBAA 2PPQA 2ITQA 3GVUA 3Q6WA 4PP9A 4L43A 4EORA 2F57A 2XS0A 3FI4A 1GZ8A 5J7HA 1P14A 3F88A 4BCFA 3FEGA 1GZKA 3MSSA 4M8TA 3DAKA 4DEIA 3BGQA 3DJ7A 4HGLA 1IRKA 1M7NA 4P7EA 5LXMA 4GL9A 2YITA 3FE3A 2WMVA 3MTFA 5EM7A 4UX9A 4ZLYA 2WTKC 3PVUA 3QX2A 1M7QA 3UIXA 3FLNC 2VWZA 2PUIA 1J7UA 5EK7A 4ANBA 1O6YA 1Q97A 4FODA 5A6NA 3VBXA 4C3RA 2GNJA 3Q5ZA 3RAWA 3UOKA 4RVTA 4YZNA 3LLAA 2UZBA 3H0YA 4IDTA 4JG7A 4F7LA 3FHRA 2PZIA 3MVLA 3K54A 2QU6A 4RX5A 2BPMA 2YACA 3QKMA 4WG3A 1PW2A 4L44A 4WA9A 3L9PA 4R5YA 4YC8A 3FMLA 1JKTA 3ENHA 3ZSIA 4GV1A 4WO5A 4ZSAA 5IQDA 4DG2E 2IN6A 5HGIA 2VWVA 2JBPA 3NCGA 4PRJA 2W1ZA 5HLWA 5IDNA 3QXPA 4PMTA 2CLXA 4E4NA 4RC3A 4QNAA 4LMNA 1PMVA 2A4LA 2PVKA 1XH4A 3QQHA 1Z9XA 3BIZA 3BV3A 1M14A 3HUBA 3QTXA 2YAKA 3QTSA 5K4JA 4CTBA 5A4TA 2P3GX 3TJDA 2VWYA 3A7IA 4EKLA 4JT3A 4A9RA 5GZAA 5K0XA 1MRVA 3WBLA 4ZLZA 3QU0A 2Y7JA 3CCNA 1FPUA 3DLSA 3F61A 5H2UA 2WFYA 4TYHA 4XV2A 5ANIA 3VC4A 4AT4A 2I0HA 5DYJA 5J7BA 5C4LA 3C4CA 5EQPA 3AMAA 3DKGA 4I6BA 3LXLA 2JD5A 3TNHA 5L2WA 3BYUA 4I22A 3QQJA 4TY1A 4PMPA 2VN9A 2OXYA 2C0IA 4ANLA 5AV0A 4UMUA 2XZSA 4DEBA 5C01A 5D10A 1K3AA 2QC6A 3UVQA 2PVLA 2XCHA 4FL1A 2C6KA 3P7BA 4FIGA 3P1AA 4IAAA 4LRMA 3L8PA 4F7NA 2X9FA 3SA0A 4EOSA 3CGOA 5J9YA 2G01A 3HMOA 3OUKA 3EQPA 4GS6A 4ZZNA 4JS8A 2GFCA 2EB2A 3RM6A 3PJ3A 5AR4A 4D1XA 2W1FA 3SLSA 1OKVA 5LJJA 1OIYA 3VRZA 4C59A 5IQAA 4UYAA 1OL6A 3GNIB 3CC6A 4WRSA 4P5ZA 3BCEA 5CAPA 5K3YA 5L8KA 5L8LA 1R3CA 4C58A 5A3XA 4CVAA 1VJYA 3IQ7A 1CSNA 5CSVA 1H27A 5CU6A 3MGYA 4EOKA 4YJNA 3VUDA 3JPVA 4F1OA 4QPAA 3T9IA 4OBQA 3MA6A 3VS2A 5AUUA 4ZAUA 1OGUA 3DNDA 3IO7A 4K18A 4FSTA 3PY1A 4LOQA 3MB7A 4QTBA 3THBA 2BILB 5EI8A 4ZJIA 4IM0A 5CALA 1VYZA 3H9RA 4W9XA 4O0XA 3F3WA 3VHKA 2OF2A 3NGAA 3QLFA 2ETRA 2OJ9A 5HG9A 1JWHA 2Y6OA 1GJOA 4XP3A 4ZTQA 3V8WA 2WPAA 4A7CA 3KK8A 5ANEA 1PXLA 4FV7A 5TE0A 4DHFA 5AJQA 4R78A 4EOPA 2R3KA 2OIQA 2XF0A 3MH0A 3K3JA 1VYWA 3OC1A 2VTSA 4RVKA 3ZOSA 4G3DA 4Q5EA 3R7UA 2SRCA 1OL7A 2QKWB 3ZHPC 3ROCA 5AR3A 2R4BA 3QALE 3VJNA 2I0EA 4GG5A 2RG5A 2KTYA 2XIKA 1M17A 5DRBA 4CQEA 5I4NA 4O7SA 2XK7A 3V5JA 4ITHA 2O5KA 5IH5A 4CNHA 3DBCA 3PPKA 3E87A 4FTIA 2XJ0A 3O2MA 1A9UA 2UW4A 3LPBA 5EW8A 3WZJA 4AN3A 1X8BA 3WZDA 3NW5A 4G6LA 3R1NA 5DBXA 3S00A 4BCIA 2WTCA 1YXVA 3IGGA 3ORPA 1HCLA 4HNIA 3ZO4A 4WBOA 5IMEA 1FOTA 4WG4A 4LGDA 1CMKE 1I09A 2G9XA 2I40A 2J9MA 3R22A 4OT6A 1M2RA 5LVNA 1S9JA 2E9VA 2CLQA 4B4LA 4YNOA 4CKJA 2UW9A 4CMUA 2PMLX 3QX4A 4RWKA 3D4QA 4FSNA 4EQCA 2ZV9A 1T45A 2CGWA 2YN8A 4GFOA 2F7ZE 3BYMA 5DNRA 3SKCA 3ELJA 5F9EA 4DGOA 3ORZA 4EH8A 4IX6A 4MVFA 4D1ZA 3ZLXA 2PVYA 5LCJA 4C4HA 4NWMA 4RLLA 3QD0A 2BDJA 3G9LX 3O96A 4GFMA 4H1JA 2A27A 4FKOA 3U6IA 5BYLA 4ASXA 4CKRA 3QA0A 4AGDA 2FA2A 4HW7A 5EYMA 4HOKA 3GEQA 3JR1A 4EZ7A 4GIHA 4IX4A 4QTAA 5HE2A 4RA4A 4QQTA 2PULA 3KY2A 3JXWA 4JR3A 5EHOA 4L42A 4GVAA 4F64A 4FKIA 3ZEPA 4EI4A 5JZJA 3MFUA 3NMUF 4FYOA 4DEGA 3TUCA 5CEPA 1STCE 5EG3A 5EYCA 4TYEA 3OFMA 4M68A 5DR6A 3ZU7A 1Q8UA 2XYNA 2PY3A 2IW6A 3KF4A 3LLTA 4TWOA 1JVPP 3P4KA 3WE8A 3DBQA 4BDBA 4D4VA 4TXCA 4CFNA 4P5QA 3D0EA 3Q9XA 5HKMA 4CZUA 4ARKA 3FI3A 4WBBB 2W7XA 4AFJA 3KXNA 3QHWA 4CLIA 2EXEA 5A4QA 2QO2A 4PY1A 4I92A 4EWHA 1GNGA 1ZOEA 2JDRA 3QUEA 4JAJA 4YGAA 4E73A 5DT4A 5M4CA 2RFDA 2QLUA 4F7JA 4DFUA 1FVTA 5LCKA 2QO9A 5KZIA 3DB6A 4DBXA 1YXUA 4IADA 4LRKA 1U5QA 2YCRA 2V62A 4BI2A 1DI8A 5D11A 4EZ3A 3HNGA 1R0EA 3OHTA 5IH4A 4RJ7A 3UC4A 3OF0A 4D4RA 3KRXA 4FUXA 3BYSA 5GJGA 4EOMA 1MP8A 3EYHA 3NVKI 5AUYA 4ACCA 5FBNC 3BLRA 4BWPA 3W16A 1S9IA 4GKIA 4BCQA 4N6YA 3FAAA 2XP2A 5T68A 2BTSA 5JFSA 4KBCA 4C0TA 3ORXA 3C4ZA 4YJPA 4O82A 4ITIA 3Q53A 2PVRA 3HAVA 3DQXA 3KKVA 4X2GA 5LMAA 3TKUA 1FVRA 2QOCA 4BKJA 3AD5A 5IA2A 2UW3A 2WMAA 2R0UA 3KF7A 3QWKA 4G6NA 4FV5A 5B0XA 3OXIA 3IDPA 3GT8A 4OLIA 5JK3A 2V7OA 1WBTA 2QU5A 3QTIA 4Y73A 1W98A 4EH3A 4JBQA 2QO7A 3NUYA 3O50A 3PUPA 4I1ZA 4MHAA 1SVEA 4XEYA 5IA3A 4DG0E 3TDWA 3FMKA 4TTHB 3CD3A 1QPJA 3Q4CA 4G31A 3C1XA 5AM6A 1UNLA 5E92A 3V04A 4YC3A 1FGIA 2VTHA 2ZAZA 4UB7A 2R3RA 5CU2A 1Q8TA 2F2CB 2YLEA 3RGFA 4ANSA 4BGHA 3W32A 1RE8A 4K77A 3VBTA 4JAIA 1FGKA 2QOFA 5E8SA 2PK9A 1ZARA 2XJ2A 3LFAA 4FTJA 3O8TA 5D9HA 5DT0A 4ZIMA 1SYKA 4IAZA 2XUUA 4D4YA 2JFMA 5C8NA 2BRHA 2JKMA 3FMJA 4O7LA 4DFNA 4K33A 1GOLA 3VBVA 5JFVA 3G6GA 1Z5MA 1AQ1A 1OL5A 3R1SA 1REKA 2JITA 3BWJA 3DFCB 3WZEA 5JSMA 5LVLA 2CKEA 3N4VA 2P55A 1UWJA 5FLFA 5HE3A 3DKFA 4D4SA 5A14A 4FEWA 3FZSA 2VWBA 5ETIA 5J95A 4MF0A 3L9LA 4BBEA 4HVHA 4CT1A 4NCTA 3Q4UA 4PTGA 5TOZA 4IWQA 2PWLA 2O64A 1PKDA 4I4FA 2OJGA 2UV2A 4PL3A 4UYNA 5I3OA 3ERKA 5AV4A 5M4IA 4ANMA 3COHA 4F63A 1SVHA 3A99A 2YJSA 2FO0A 2WMSA 5JGDA 3C5IA 4HVDA 5KMIA 2VUWA 3KU2A 4JBOA 4XOYA 4Z7GA 4EK6A 4FNWA 1LEZA 3G2FA 4JQ8A 5FXSA 4FYNA 3CPCA 5HI2A 2Z7RA 2GCDA 5E8XA 3KXHA 1G5SA 5GJDA 2PZPA 3UYTA 3DOGA 4BI1A 2IG7A 1W0XC 1KSWA 1ZMVA 2ZJWA 3RCJA 3EQRA 3H3CA 4KKEA 3RK7A 3V5TA 4O81A 4FKVA 4QMYA 4F70A 5J87A 3NZ0A 4YNEA 1O9UA 2H6DA 4V05A 2PTKA 2DQ7X 2PMIA 3GBZA 3PZEA 5F20A 4E5AX 3FLQA 1UU7A 2BKZA 4GK3A 4TNDA 3DGKA 5FWKK 4EKKA 4U0IA 3F5UA 4YP8A 3VULA 2X7FA 3ULIA 3MFRA 3VS6A 2BHHA 3EB0A 4RZWA 4RFYA 4LL0A 1UNGA 2VNYA 2J6MA 3BHYA 4DT9A 4PTCA 1YRPA 4FBXA 2DS1A 5EI2A 3KMWA 2F4JA 1OBGA 4G3EA 3ZS5A 2CMWA 1U5RA 4MYGA 5ANOA 3PJ8A 3QC9A 4BCKA 2W5AA 4G34A 2J0KA 2VWWA 3OWLA 1TQIA 2QR8A 1NA7A 3IDBA 3ZC6A 5K5NA 5L2IA 4AA0A 2YIQA 3VQUA 4CRLA 2IZSA 3FZ1A 5F4NA 1OZ1A 2ZYBA 1WCCA 4FKQA 3QFVA 4KD1A 4BIEA 4F9CA 4B99A 5JQ5A 4Y85A 3VBQA 3Q96A 4IJPA 4X3FA 5CANA 1YI3A 5CU3A 4U3ZA 4U81A 4BC6A 2YJRA 3LCDA 3H9OA 1LP4A 1Q8ZA 1UA2A 4XCUA 3TTJA 3LMHA 3DXQA 3BLQA 4LYNA 3ZONA 2H9VA 4BTKA 2RL5A 3I6UA 4IVBA 2V55A 4LL5A 2FSTX 2VTMA 3TM0A 1R78A 3II5A 4ASDA 3LFNA 4FF8A 4I5MA 2IW8A 3SAYA 1WFCA 5AEPA 3RM7A 3DU8A 3OY1A 4YJQA 4RFZA 4A9YA 3RAIA 5J5SA 3ENMA 2O0UA 3LIJA 3N9XA 4JBPA 5F94A 5BVEA 5BQ0A 5L8JA 4D28A 2JIVA 5BVWA 4ZSGA 2OKRA 2YCSA 1Q8YA 1OIUA 3DJ6A 4EH9A 3NW7A 4O27B 2WIHA 3FJQE 5BVFA 2CGVA 5A6OA 2Y8OA 3CEKA 4CKIA 5DI1A 5CAQA 2VTQA 4G5JA 3KVXA 3VIDA 3ZO1A 1VZOA 2XEYA 3BQCA 4IX3A 3FQSA 4NCTC 3IS5A 3OEZA 3P9JA 4TZRA 5TKDA 4C35A 5I0BA 2UVZA 4E6DA 5LOHA 3EZRA 5AWMA 5AUWA 5DPVA 3WE4A 3OXTA 4MX9A 3KMUA 3LW0A 4O83A 4NM5A 3PIZA 5FTOA 3PJ1A 4JIAA 5GZ9A 2BAQA 3DBEA 3GUBA 3NYNA 2RFEA 3M2WA 4JDIA 4NTTA 3D5XA 2UZTA 3ORKA 5IA4A 3W8LA 2QG7A 4TWCA 4BWXA 4YURA 3GC9A 3DAJA 4EK8A 4K2RA 3R04A 3UP7A 4CFMA 2EB3A 2Z2WA 4PDSA 3QZFA 1U54A 4G3FA 1FMKA 3SQQA 2GTMA 3R83A 3W10A 4BCPA 3G0EA 4QPMA 4UALA 5B2KA 2WMWA 4PPBA 4K1BA 5AP0A 4F6UA 2HZIA 3KN6A 3IECA 3QXOA 2YA9A 2CDZA 4HGTA 4OW8A 4QYEA 4HCTA 3CLYA 1G3NA 2X8IA 2P33A 4XV1A 5IPJA 4BHNA 3AMYA 5EKNA 2PU8A 1DAYA 3O71A 4RMZA 3ZDUA 4ANNA 4BCOA 4IM3A 4XLIA 3WI6A 2F9GA 2XK4A 1J7LA 4DFXE 3R9DA 1Z57A 5D7VA 5HIBA 5EKOA 5GHVA 4KA3A 5HX8A 5FM2A 4H3BA 1KWPA 2HZ0A 1ZRZA 2Z7LA 3HV3A 4C34A 4I0TA 5C27A 5IA5A 3DZQA 2X7GA 2C6DA 5FXRA 3HLLA 5BPYA 5ETAA 4C33A 5CY3A 4XG2A 4FI1A 2R3HA 3QRJA 4JI9A 5HD4A 2WEIA 4RBLA 1JSVA 4ZY6A 4Q9ZA 3SC1A 1PYXA 3Q9YA 3PPZA 5CT7A 3R8PA 4RSSA 3DAEA 3LXPA 3SRVA 3UG1A 3B8QA 4O1OA 3UO4A 3TUDA 3E3PA 1K9AA 4QRCA 2RIOA 3LXNA 2BZIB 4X3FC 5CI6A 1FINA 3PLAE 3DTCA 1UU9A 3WILA 2W1GA 1MRUA 3IW6A 4JDHA 1CTPE 3U9CA 3M42A 4KIQA 4PMMA 4NFMA 4FKTA 4QMPA 3KC3A 3ZO2A 1Q3DA 4X7QA 2J0MB 5IH6A 3C50A 4YJVA 2DWBA 3KVWA 5KMNA 1QPDA 3MTLA 4FL2A 3R9HA 1OI9A 1ZMUA 3F7ZA 3CJGA 4FG9A 4MNEA 3R9NA 1RJBA 3NUNA 1IASA 3ZZWA 4ANQA 2C3KA 3EN4A 4PP7A 1WBSA 3RNYA 2X9EA 4YO4A 4U5JA 4E3CA 1OKYA 2WHBA 3SRVB 4WNKA 4DTBA 2J90A 3D2IA 3FLWA 4L52A 3HMPA 2B9JA 1Y91A 4A4XA 4UEUA 3Q6UA 5CLPA 5M09A 4LFIA 4YPSA 3UJGA 5L2TA 3DK6A 2I0YA 2PZ5A 3ZXZA 4NJ3A 2XMYA 5AUVA 5KHXA 4RC4A 4GT5A 3P08A 3FKOA 2VTPA 4CYJA 3NNWA 5EYKA 4BDFA 3W2SA 4GRBA 2CN5A 2JBOA 3DDQA 3LQ3A 4U6RA 4L45A 4YHJA 4FEVA 2HY0A 3R9OA 3I7CA 5CASA 1ZXEA 2E9OA 4I20A 1GY3A 4IJ9A 4ZS4A 4L68A 2XM9A 4CFUA 1IA9A 1WBNA 4C37A 1ZY5A 4AZWA 3HMNA 1PYEA 2J0LA 4RQKA 2HENA 4H39A 1ZAOA 1ZOHA 5CSXA 2HXLA 4CZYB 5JH6A 3O7LD 4TYIA 4NYEA 2WZJA 3EFJA 4AF3A 4ZJVA 3GXLA 4OR5A 3IKAA 1PXMA 3W2RA 4ACGA 4YJOA 5KMOA 3JYAA 5HTIA 4RWIA 4O7TA 4ANOA 1VEBA 5IISA 1YXTA 4C4FA 1Q3WA 3GFEA 4A4LA 2ONLA 4ZTHA 5HTBA 3KULA 4UWBA 4X2JA 2QI8A 3UZTA 5AFVA 5KHWA 3GQIA 3NUSA 2WTKB 4JXFA 4RJ6A 1QCFA 4C3PA 1B6CB 3OS3A 3FL5A 2X0GA 2GHGA 3R1YA 5HD7A 1XH5A 3GC8A 4WNOA 4TYGA 4H3QA 2R3QA 5IEXA 3OCBA 3V6SA 4MAOA 5HX6A 4C2VA 2BRNA 2IJMA 4V04A 3G33A 2QCSA 5CSHA 2Z7SA 3NUUA 1E9HA 2ZB0A 3NYXA 2W9ZB 3PXZA 2WQNA 2XKEA 5HO8A 2G2HA 3GOPA 4IFGA 1OUKA 2C0TA 3MY5A 4O7YA 5CZIA 4BHZA 3CTHA 4E93A 3PP1A 5IQHA 1H25A 3E7VA 3KULB 4GIIA 1WZYA 4HJOA 2CJMA 2OIBA 3KREA 3AC3A 4PUZA 5AP2A 1BL7A 2JIUA 4HZSA 4N4SA 2R3JA 3UQFA 3LM0A 2EVAA 4PMSA 5DHJA 1PKGA 5IUGA 4EC8A 3GFWA 3EQDA 2REIA 4FNZA 4J1RA 3RKBA 4C02A 2CKPA 4FK6A 4GUBA 5HNBA 3E92A 1SZMA 3MPAA 4IE9A 4LRJA 5K4IA 4E6CA 5HNGA 2JDOA 2OK1A 2R2PA 2UUEA 3W1FA 3AC4A 4LGGA 4CFWA 4IB0A 5JMSA 3QD3A 3E8CA 4FT9A 4M14A 3FZOA 5E7RA 1I44A 3R21A 2CKOA 1BI8A 4JG6A 3A62A 4RIOA 3BBTB 5BMMA 3C5UA 3EQCA 2VZ6A 4U79A 3OWPA 4B0GA 1BI7A 5EDRA 1OKWA 4X0MA 4CFXA 1BUHA 4X2FA 3ZO3A 5H8BA 3PIXA 3DT1A 3NDMA 3H10A 2GSFA 2C6IA 3LKMA 3P86A 4FVQA 2B7AA 4OTFA 2R3OA 1K2PA 3AQVA 5D12A 3UO5A 4LV8A 4M69B 2C3JA 3MW1A 3DKOA 2BRGA 3QTRA 3LFSA 4IVDA 3G90X 2P4IA 1UWHA 5CSWA 4GVJA 4YHFA 3NNVA 5JGBA 4MWIA 1G8AA 2ETMA 5E8ZA 3M1SA 2X6DA 4AT5A 3FBVA 2F49A 1YHVA 1YVJA 2EUFB 4CG8A 2OJIA 3H0ZA 2PVMA 4IZ5A 2HW6A 3BU6A 2W99B 1PXKA 2OIDA 3DFAA 5C8KA 3D5UA 5AR7A 3RALA 1GIJA 2ONLC 3I79A 5D7AA 5HBEA 2R9SA 3PG1A 1A06A 4DGGA 5CEIA 1FMOE 3OT3A 3GCSA 4MQ2A 2ITTA 1KUTA 5EYDA 3LHJA 2VWUA 2YEXA 4RJ3A 3VUIA 4FKPA 5DG5A 1JQHA 3BX5A 2PE0A 4DC2A 3U6HA 4F0GA 3TCPA 2R7IA 2VAGA 4I21A 4XG7A 5AAGA 4RX7A 3V5LA 5M51A 5DEWA 3DPKA 1Q61A 3O7LB 4WG5A 5DIAA 4C61A 3GI3A 2HXQA 3KB7A 3PRFA 3R7GA 5CQUA 5E4HA 4RVMA 3GCPA 3MPTA 4EH6A 5L6OA 4IQ6A 4U8ZA 5ACKA 2HCKA 3OTVA 2XKFA 1BL6A 3ZRLA 2P2IA 4O0TA 4Y72A 5LWMA 4BDGA 5J1WA 5EHYA 4IC8A 3FKNA 2XJ1A 4RFMA 5AV2A 4A07A 3NYOA 1ZY4A 1JSUA 3CJFA 5JFXA 2RSVA 3EHAA 4USDA 2XH5A 3QTUA 1NXKA 1BMKA 3HUCA 3BWFA 3R7IA 4FSMA 4DAWA 4NW5A 3CY3A 4TYHB 3D9VA 3MJ1A 3FY0A 2NNWB 2ZMDA 3NLBA 4YBJA 5H3QA 4XG3A 4HNFA 1H4LA 1ZYSA 4FK3A 4ZK5A 4EQUA 4D1SA 4R3CA 3S0OA 3HRBA 3E64A 3UMWA 1UV5A 4A4OA 1JKSA 4GEOA 4FIEA 3WIKA 1B39A 5FUTA 5AM7A 4EHVA 1WVYA 4L9IA 5AADA 3E8NA 3GC0A 4KIKA 1YW2A 2Y4IC 3LAUA 4XRLA 5HBHA 3TXOA 4U43A 3TZ9A 3U4WA 5KUPA 5EQYA 2VO7A 2BALA 2V22A 2WELA 4RVLA 4YLLA 3CKWA 3HDMA 3R2YA 4L7SA 4W4WA 4QP1A 2WIPA 3LMGA 1WBOA 4O0WA 4KBKA 4II5A 5EM6A 2NRUA 5IQCA 4XNEA 3EN9A 3W2PA 2PVNA 4XG8A 3EOCA 3QQLA 4DH3A 3MJ2A 2HOGA 3DTWA 2Y6MA 1XH8A 4IHPA 4YZBA 3TIYA 3F3ZA 2FYSA 4AA5A 5AUTA 3G9NA 4NM7A 2JC6A 4H1MA 2XK8A 5L2SA 3EIDA 2X6EA 2UZVA 4XH6A 3DV3A 3NX8A 5ETFA 4QYYA 1OBDA 5J9LA 5CT0A 2WU7A 3NPCA 2HELA 5FP5A 3QD2B 3R1QA 3A8WA 1AGWA 2VWIA 2CPKE 3I4BA 4NT4A 4U3YA 3QF9A 3UNZA 5IU2A 4EOQA 4I4EA 5DRDA 5EOBA 3Q2MA 3OROA 5AX3A 2R3GA 4IWDA 3HA6A 1U4DA 3PVBA 4WUNA 3WF7A 2OJJA 3IW7A 3UIUA 5EQEA 2XKCA 2GHMA 2ITOA 4IB3A 3C9WA 3ANQA 3H4JA 3VF9A 1JSTA 2R64A 2R3LA 3SW7A 3V5WA 3COIA 2NRYA 1L3RE 4DEEA 4CXAA 5B7VA 5LVMA 4H05A 3PYYA 3TT0A 4S33A 5DLSA 5TF9A 3UVRA 4BIBA 4GW8A 3TNIA 3BBWA 5DMZA 2WMQA 1ND4A 5HHWA 2QOIA 2UVXA 2RFNA 2NP8A 2BFXA 5HLPA 2A1AB 3G5DA 5CENA 3FPQA 5HU3A 3SG9A 3L9NA 4W4VA 2QHMA 3Q4TA 4M0YA 4APPA 5IQIA 2C1AA 4J8NA 4JLCA 4W8DA 2R3FA 4EEVA 5DE2A 3A61A 5FQDC 4FUYA 4AN2A 1F0QA 2I0VA 3PVGA 4AZSA 3UNKA 3OT8A 2FVDA 2XEZA 2UW6A 4ZZMA 4CRSA 1B38A 5JRQA 3QUPA 4JNWA 4E1ZA 2QD9A 3R8VA 1OL1A 4HYUA 4QMOA 5LQFA 3O0GA 5CS6A 4BDAA 4O7VA 1YXXA 3KXGA 2W1HA 3V3VA 4DYMA 1OIRA 1YHWA 5TR6A 3VHEA 4GK2A 3FZTA 3WOWA 3OEFX 2I7QA 5E1EA 4GSBA 4E4LA 2C5VA 4DT8A 4Y95A 3MB6A 1Q62A 3RPVA 3BI6A 3I5NA 1O6KA 2YZAA 3OW3A 4JJRA 4NIFA 5BUIA 2EU9A 2QHNA 4M66A 1OM1A 4YZCA 3B2WA 2X2LA 3DZOA 3K2LA 3AGMA 3LFBA 3QRIA 3PJ2A 5HZNA 5IG1A 3SV0A 3UIMA 4XG9A 1YWNA 3UDBA 4DINA 3PIYA 4FTOA 4NH1A 3R8UA 3FI2A 4GH2A 4W4YA 3F9NA 4DH8A 5CEOA 5JQ8A 3QL8A 3FI8A 2O65A 4F6WA 3EL8A 4TT7A 4KKHA 4IM2A 4KWPA 2O8YA 3VN9A 3R73A 4OTDA 3QC4A 3LCOA 3ZMMA 4AFEA 2FUMA 2RF9A 2YM7A 1NY3A 4QP7A 1P5EA 5FGKA 3F2RA 2X1NA 3LJ2A 4XG4A 4L6QA 3V8TA 3KRLA 4IFCA 3BE2A 3ET7A 3GENA 2OH0E 1SNXA 4XV3A 3F2NA 3WARA 4E5BA 4UMPA 2JDVA 4HVSA 4BR3A 3UTOA 4FV8A 3R7OA 4ZY4A 1PXIA 2J5EA 3ZC5A 2CCHA 4NU1A 2CSNA 4R5SA 3VUHA 2RFSA 2XNBA 3UGCA 4KUJA
chains in the Genus database with same CATH superfamily
3EMGA 4FT3A 1YI6A 4FT5A 5HLNA 3OCGA 4GT3A 4DFYA 3TZ8A 4IWOA 1PXOA 2E9PA 3C4WA 1EH4A 3NFFB 3C7QA 4F0IA 5EHLA 2WD1A 1M2PA 1XH7A 4IWPA 3PXKA 3IK3A 3LVPA 5AR8A 1E1VA 5LARA 2R5TA 3L8VA 3ZFXA 3T9TA 5AIRA 2WTWA 1WBWA 5CQWA 3W18A 2UZOA 4WUAA 3VS4A 3VUMA 4BCMA 4FX3A 2YDKA 2X0OA 4A9UA 5HNIX 4GU6A 1PMUA 3K5VA 4UN0C 1RQQA 5IMXA 5I9ZA 4DH1A 5CZHA 4EONA 4FTRA 4H58A 3CQWA 4O1PA 3WYXA 4DEHA 3G51A 2JFLA 2XRUA 3R0TA 3QQUA 4YHTA 2B53A 4FKJA 5IUHA 4C4GA 4D0WA 3E8EA 4L00A 3R9RA 3TZMA 2OF4A 3IPHA 4AZFA 2OH4A 4I23A 3C0IA 2BRBA 3WF5A 1DM2A 4I24A 1BYGA 5E8TA 3DLZA 3U8WA 4EBWA 4MF1A 3ID6C 2B55A 2HYYA 2G1TA 5J8IA 3I60A 3HL7A 4FOBA 3FKLA 4MKCA 2W0JA 3VAPA 4E7WA 4F1TA 1ZOGA 4FTUA 2Z8CA 4AE9A 4RPVA 2PZRA 3FMNA 4YC6A 4QMUA 5F1ZA 1H1QA 3SXFA 2OBJA 5ANGA 2FB8A 4A06A 5AR5A 4O7ZA 3LFEA 3FPMA 4NTSA 3VVHA 2GS2A 1KOBA 3LFDA 4DLJA 2ZVAA 4FVPA 4AT3A 4R8QA 4W8EA 2ZM3A 4FG7A 2OICA 4E4XA 1Q99A 1ZYDA 4LMUA 5H8GA 3PVWA 2JDSA 3DNEA 5L4QA 5AP1A 2X8DA 3ZDIA 4L3PA 2PVJA 4AXFA 3VS3A 4FKGA 2HW7A 4FICA 3UNJA 3ZM9A 3R30A 3QCXA 3WIGA 4AS0A 4KABA 2XVDA 4NM3A 4IDVA 5KKRB 3R2BA 3MS9A 2IVSA 5CX9A 3R71A 4D2RA 4EBVA 4PQNA 2UZDA 3LFCA 2BIKB 2XCKA 3RPSA 4DE4A 4U41A 3FY2A 3HMMA 4YO6A 3IDCA 3QZGA 4MTAA 4KIOA 1ZYCA 3ZLSA 5KNJA 2W9FB 4LM5A 2R3MA 2ITUA 4Z16A 2NO3A 1PJKA 2ITNA 2O63A 4EK5A 3N4UA 4O86A 4F9BA 4KS7A 4PDYA 3AD6A 1OL2A 4FV9A 3TV4A 5AMNA 3NUXA 4MBIA 3S3IA 2PHKA 2VX1A 4P90A 5T3QA 5CF4A 2GTNA 5K5XA 5DR9A 2W05A 3VQHA 5LVOA 5EM5A 4FIFA 4QP6A 3ZLYA 2E9NA 5IEVA 3OXZA 3FC1X 3BHTA 3FMEA 3W2QA 2XBJA 2R3PA 4MBJA 3C4XA 3FSFA 4FG8A 4O0UA 2WMXA 1ATPE 2FSMX 4EWQA 2UW5A 4FL3A 2ZMCA 4DH5A 5D41A 1F3MC 2VGOA 3VS1A 5A9UA 2X81A 4X3FB 2VTAA 1UKIA 4BGQA 3PWYA 4GFGA 3CR0A 4F6SA 4FSZA 4FGBA 4GJ2A 3HDNA 1H0VA 1WVXA 3AC1A 4FNXA 5A4CA 1FQ1B 1GIIA 2YWPA 5LMBA 1QPCA 2ITWA 3QRTA 3TNQB 5A4EA 4RWJA 4F1MA 4LOOA 4E8AA 3DK7A 4G9RA 2XIXA 4BCHA 3DY7A 4G2FA 4I93A 2RKUA 3S4QA 2JEDA 5FXQA 4AOIA 4LG4A 4IVCA 4KKGA 4NEUA 4DFZE 2ESMA 4EYJA 3EFKA 1W8CA 2XIZA 3E5AA 4JOAA 4NKAA 3ORIA 2LAVA 1T46A 4L3JA 5HESA 3ZUUA 4FV2A 3UQCA 2QOBA 2OW3A 1REJA 3QLGA 3BYOA 2VTTA 4V01A 3RBWA 1NVSA 1TKIA 3VUTA 5C1QB 2XA4A 2FH9A 4N6ZA 4L3LA 4DEDA 4UV0A 4BDJA 3OOGA 4IAYA 5KKRC 5GIOE 2B54A 4ERWA 2WOTA 3EKNA 1OITA 4MEDA 3SOCA 3DB8A 3BLHA 4XHKB 3HECA 2VO0A 4BYIA 3EKKA 4QO9A 4J71A 4CEGA 3NIEA 2IZUA 4D2TA 3CBLA 3ZFYA 2F2UA 5CEMA 3D15A 4M12A 3VW6A 4YZDA 2VTNA 4FTKA 4JDKA 3U4UA 4QD6A 5CYIA 1XJDA 5FP6A 3TN8A 3LFQA 1E1XA 3N51A 4BB4A 4EJNA 2UZNA 4U40A 3K5UA 2QOHA 2G2FA 5M57A 3RJCA 4YUQA 3Q3BA 4EH4A 3UDZA 1U54B 2OZOA 3JVRA 4ZTSA 1XO2B 5HBJA 4ITJA 1J7IA 3VF8A 3L8SA 3OWJA 4UBAA 4R7BA 1J3HA 5HCZA 3C13A 4I6HA 4U7ZA 1KE8A 5ANDA 4KSQA 4GKHA 1DAWA 1H1RA 1KOAA 3EFLA 3PA5A 4DGNA 4OTQA 1OB3A 4QMMA 4FEUA 1U59A 2WMRA 4AGWA 1QPEA 4K9YA 4L67A 4IH8A 2H8HA 3HKOA 4DHJA 4IVAA 2BRMA 3MVHA 3V6RA 3QD4A 2CCIA 3O23A 3CGFA 3DXPA 4FZAB 4UXLA 2UVYA 3GCUA 5GINE 1Y8YA 5KZ0A 4FV1A 2AC3A 3FWQA 2BZKB 3FV8A 1XMLA 4FR4A 3F5PA 3ALOA 1YDTE 4R77A 2Q0NA 4JG8A 4FE2A 2EXMA 4BF2A 3MDYA 2B9FA 4QPSA 4IZAA 3LOKA 3HP2A 5LWNA 5BYZA 5A46A 3AOXA 4FZDB 3QGWA 2GFSA 2BDWA 3PE2A 3HZTA 4G3CA 3EYGA 4Q2AA 2IZTA 3DBFA 4O96A 3UPXA 4QEBA 3ORMA 4V0GA 1H24A 1P4FA 2YIYA 3ZBXA 4TKSA 2PE2A 4XP0A 4BDDA 5K0KA 4CMTA 2UZEA 2XYUA 4KRCA 4IAFA 3GOKA 2C69A 4LV5A 3LQ5A 4BZDA 2PMNX 1PXNA 1PRYA 3E7OA 3AC8A 3FLYA 2J5FA 5CVHA 5C9CA 3DBDA 4O4CA 2AC5A 2YCFA 4CCBA 5ITAA 3HV4A 5CF6A 4BDHA 3C4EA 4KBAA 2OZAA 5DWRA 5GNKA 4MNEB 4A9TA 2W4KA 4F78A 2VTIA 3MY1A 2UZLA 2GS6A 2IVTA 4FKRA 4YZMA 4EOJA 4ENXA 2PYWA 1U46A 1KE6A 2I6LA 5JEBA 1BX6A 5HE0A 3UZPA 4D9UA 4ZSJA 5E1SA 5M06A 4ORKA 4R3RA 4V0GB 3WYYA 4CMOA 3U51A 3OWKA 2B1PA 4BVUA 3IOKA 3PXQA 3RMFA 4I41A 2KULA 3MWUA 3LCKA 2WQMA 3F5GA 1DS5A 4I0RA 4E6AA 3O51A 5BUEA 3R7VA 4CSVA 4YSJA 5IKWA 3KQ7A 1R1WA 4IEBA 2I1MA 4AW2A 4C36A 1HOWA 2A0CX 4QMTA 3VNTA 5EI6A 4AXEA 2CNUA 2OZAB 4IAIA 4GCJA 2ITVA 2A19B 5A54A 2X39A 4LUEA 3ODZX 3RAHA 1KE7A 3P79A 3H30A 4M13A 4GMYA 3C4FA 3COMA 3P7AA 2OU7A 3ALNA 2G15A 3P78A 2V7AA 1ZLTA 1BKXA 3IW8A 3QQKA 4KNBA 4C2WA 2OO8X 1ZWSA 4Y5QA 1UU8A 3MPMA 4W4XA 4MD8E 4GK4A 3FSKA 4ACHA 4BZOA 2HZ4A 1RDQE 3DS6A 4NM0A 3EN6A 4OGRA 4AN9A 4EH5A 4FA2A 3NFGB 4S32A 4LUDA 2FSOX 3O8PA 4X6RA 1TQPA 4G5PA 4ACDA 4O2PA 2C3LA 2ZB1A 4EYMA 4IW0A 3BKBA 4ZEGA 5I5ZA 4XP2A 5E8VA 4P2KA 2ERZE 5HG7A 4CFVA 5IQEA 4ID7A 3PLSA 5HO6A 3FLSA 3PSBA 2P0CA 3B2TA 5CVFA 4USFA 4BKYA 4I3ZA 1NVQA 2GHLA 3GC7A 3NNXA 1V1KA 3QAME 5BVKA 3SOAA 3ZRMA 4B8LA 5ACBC 3MESA 4HPTE 4FSWA 4O7RA 4ALVA 4M15A 4C8BA 4ERKA 1YOMA 2BROA 5JFWA 4FV3A 2H96A 4WSYA 2B9IA 2A2AA 4UZDA 3ANRA 4B6LA 4CV9A 3GCVA 5L6WL 1H07A 1G8SA 2W5HA 4FVRA 2X0PA 3NRMA 4M97A 4O38A 2VD5A 4PTEA 4XOZA 5AUXA 5GJFA 4IZ7A 4WSQA 2VO3A 5BYYA 2YWVA 1ST4A 3DDPA 4J95A 2R3NA 3EQFA 4AOTA 4TWNA 1XBBA 2J2IB 2Z60A 2X4FA 3BU3A 4CG9A 3EN5A 2XNNA 3F82A 3E3BX 4F99A 3MFSA 2YM8A 3W2OA 3HRFA 4BICA 2Y0AA 3CKXA 3QCSA 1UNHA 5HIEA 4KINA 1H00A 5H8EA 4QMLA 3TUBA 2VNWA 4HGEA 2C6TA 3I6WA 4F09A 4CV8A 2XANA 2C6LA 3LJ1A 3IONA 4O4BB 3VS7A 3RHXA 3PRIA 4QQ5A 5D1JA 3ZYAA 4BBMA 4ALWA 1URWA 1OVEA 3GP0A 5HG5A 3QTQA 4AZEA 4O0YA 4BZNA 5EDQA 5ANJA 1Q4LA 4Z9LA 2UW0A 2EXCX 5CAOA 3F6XA 1OPKA 4BDIA 4AX8A 4YU2A 3GU7A 3PA3A 4N57A 4NFNA 3JY9A 4BBFA 4GJ3A 4RJ4A 3KGAA 4LGHA 2B9HA 4L53A 4C57A 4D2WA 1YHSA 4EHEA 1JKKA 2AQXA 4B8MA 2CNVA 1JNKA 3SG8A 4NKSA 3BYVA 3LM5A 3IW4A 5C4KA 4G16A 2WQBA 2YDJA 4AG8A 1XKKA 4APCA 1OIQA 2GNGA 5E8WA 2Y4IB 2O2UA 1A48A 3HYHA 3VWAA 4MXCA 3Q9ZA 4O0SA 4QTCA 4ALUA 3PE1A 5KCVA 3RZFA 4A9SA 2OI4X 4BFMA 1V0OA 3ZUVA 4DHIB 5I9WA 4ZS0A 4YLKA 4DITA 2YM3A 3Q52A 2IF8A 5E91A 3RAKA 2XNMA 3D14A 2CHLA 4Y83A 3QKKA 3BHUA 4ZTNA 3POOA 4WNMA 4AOJA 4P4CA 3L9MA 3TL8A 4BL1A 4EJ7A 3ITZA 2XNGA 3A4PA 4WHZA 4OTHA 4YJTA 3KA0A 2QOLA 4F4PA 5J9ZA 4J97A 4IX5A 2VGPA 3B8RA 2C5YA 4JR7A 2YM6A 1TQMA 2J50A 1OECA 2PZYA 2WOUA 3QQGA 4IIRA 4F9YA 2OFVA 3QTZA 3FMDA 3ZSGA 4AP7A 3PY0A 4K0YA 2UW8A 3AD4A 1J1CA 4W9WA 3ML1A 1IR3A 3VBWA 3MFTA 3OCSA 2OJFE 5AX9A 4JL9A 3OVVA 2E2BA 4PNIA 3QZHA 4YBKA 4HCVA 4NZWB 4AW0A 1JAMA 2OGVA 2YFXA 3P5KA 3RHKA 2X8EA 5FEQA 4FSRA 4L7FA 4EZ5A 4AQKA 3A2CA 5KMMA 2F7XE 4GYIA 2X7OA 5AR2A 5JT2A 2J4ZA 4Y46A 3HP5A 2YM5A 4DA5A 1JKLA 1OKZA 4OBPA 3NS9A 4PPAA 3RCDA 3PTGA 4PNKA 4Z3VA 2CKQA 2C0OA 3QGYA 3UIBA 4PWNA 1V0PA 2BZHB 2QLQA 1J91A 4FIHA 1JOWB 5FEDA 1URCA 3DXNA 3DKCA 3MYGA 3SGCA 5HG8A 5IF1A 3P0MA 2IPXA 4AAYA 3PWDA 5DOSA 1M52A 3ROYA 3CTQA 3FUPA 3LMIA 3KCKA 3PG3A 4DN5A 4UMQA 3UVPA 1YOLA 3I81A 4K6ZA 3EQGA 4AGUA 3BL7A 3Q2JA 1TVOA 1J1BA 4ZTLA 3NUAA 1SMHA 3KRRA 5HCYA 4JRNA 1AD5A 5CVGA 3AKKA 4FGRA 4FSQA 4RZVA 1HCKA 5EW3A 3SDJA 3OW4A 2ACXA 3T8OA 2HZNA 1LPUA 1Q41A 4FIJA 2GS7A 3OBJA 3ZTXA 4MH7A 4BDEA 3TKHA 5K9IA 3W2CA 3MH2A 4OAUC 5IZFA 3ZH8A 1H01A 3PFQA 4EOLA 5AP4A 2WTVA 3DQWA 3AC5A 3UMXA 3MIYA 2QOOA 4NK9A 3W8QA 3NUPA 4FV0A 4J8MA 2W4OA 1VLRA 3AKJA 4BTFA 1YOJA 4S31A 4YTFA 4E6QA 2J0JA 4XG6A 4AQCA 1XH9A 4Y5HA 4ZP5A 2BDFA 4KSPA 5KBRA 4AXDA 3DCVA 4TYJA 5T6KA 4HZRA 3HGKA 3VBYA 4MXZA 3KRWA 4AACA 3VW8A 4JX7A 2IWIA 2JGZA 3PSDA 3BHHA 5I3RA 2B0QA 4LI5A 1UU3A 2WXVA 4O2ZA 2BIYA 3C51A 4FTTA 4M67A 3UQGA 4DLIA 4AW1A 1VR2A 2ZDUA 1WBVA 2GNLA 5ICPA 3D83A 3PDTA 3FZRA 4KIKB 4RT7A 4DTKA 3S1HA 1Q8WA 4ONAA 4PL4A 4RX9A 5B2LA 5M53A 2GNIA 2UZUE 3UDSA 1YWVA 4OTPA 3CSVA 3NVMB 4FZ7A 4JBVA 3BU5A 3PP0A 4I5PA 4MXYA 3L8XA 3MI9A 3U87A 2F7EE 4GT4A 4OAVB 1NW1A 2X4ZA 4OTGA 3CY2A 4K11A 2C6EA 2PVFA 3OCTA 3RPRA 2PUUA 2LGCA 3SVVA 4XS2A 3BL9A 1RW8A 5KE0A 3S2PA 3AT3A 2WNTA 4FSUA 3F3UA 4EUTA 2RGPA 4PDPA 3DJ5A 3O8UA 4I5HA 4IAKA 1APME 4QYGA 5JKGA 3BE9A 4MBLA 3G6HA 5J79A 3ACKA 4RIWA 3TV6A 3A60A 4MXOA 4EC9A 2X2KA 2VTRA 3PJCA 2R0IA 5M55A 4HVIA 2ZDTA 1H28A 4TN6A 4ZMEA 3KXMA 3FZPA 4S34A 1WMKA 5IA1A 4QP2A 4BYJA 4KIPA 2ERKA 3HRCA 4XX9A 5DVRA 3F3TA 5KMKA 3OD6X 5HIDA 4QDEA 5LMKC 3QHRA 2YIXA 3QTWA 2VTLA 4D58A 3SXSA 3UPZA 2QODA 5IQBA 2C5XA 3LFFA 3PXRA 3REPA 1ERKA 4FIIA 1FBNA 4D2VA 2UZWE 2V5QA 4GU9A 1YWRA 3ACJA 4FZFB 2GU8A 4PPCA 3Q5IA 3FMMA 3ZXTA 3BEGA 1MQBA 4WNPA 5FDPA 5I9YA 5M4UA 4JDJA 2W96B 3OP5A 3R7YA 3MA3A 4D55A 4DH7A 5FD2A 1TFFA 2BHEA 1UVRA 2WO6A 4F7SA 4RIWB 5FM3A 1PHKA 3R8MA 5BVNA 2JIIA 3NSZA 4YTIA 3TG1A 3OG7A 3NW6A 4M7IA 5HVKA 5CSPA 4OUCA 3TJCA 4FKLA 3CS9A 3A4OX 5FBOA 2W06A 3WZUA 3QYWA 1ZZ2A 1QMZA 4QYFA 4XLVA 3UE4A 4AUAA 2OG8A 3QYZA 4FTNA 5IEYA 4HVGA 4I94A 3D5VA 4QP4A 1IAJA 4EUUA 2WKMA 4ZXTA 5TT7A 4U44A 4O0VA 3HAMA 4GG7A 4WD5A 4XUFA 3SW4A 4FT7A 5L2QA 1XR1A 1PMNA 3RNIA 2HY81 2YIRA 3M11A 3Q9WA 2DYLA 5CAUA 2B52A 3D5WA 4QMQA 4EOOA 4UY9A 4F65A 4K8AA 4EL9A 4G9CA 4WT6A 3UOHA 3COKA 3CTJA 3R02A 3GQLA 4BGGA 4CFFA 4X21A 4QNYA 4YTHA 1GAGA 2O3PA 1PY5A 2YLFA 4O7NA 2QOQA 1DI9A 3KEXA 3KMMA 2BKKA 2XALA 5EM8A 4TNBA 5I9VA 2GQRA 4HYIA 4NIFB 3TACA 5A4LA 1H1SA 3RPYA 4UWYA 5CI7A 5CAVA 4FEQA 5IQGA 3WF9A 4QMVA 4ENYA 3F3VA 3I5ZA 2Y9QA 3G15A 3ZUTA 5CU4A 2VV9A 5CNNA 3AG9A 4FV4A 4RA5A 3LQ8A 3R01A 5EOLA 4O22A 4O6EA 5GZ8A 1MQ4A 4X3JA 5IDPA 5GIPE 4QTDA 4O91A 5CNOA 4ZJJA 1W83A 2QVSE 3BGPA 3S95A 2JKOA 2UW7A 4XBUA 5AP6A 4EHZA 2HWPA 2AYPA 3IGOA 2IO6A 3CD8A 5DGZA 4YR8A 2AUHA 4RRVA 1R39A 4MQ1A 3JS2A 2IW9A 4MD7E 3OTUA 3HX4A 4KB8A 4Q9SA 3V5QA 2BFYA 4IACA 4DBNA 4RWLA 3AGLA 2C5OA 2YAAA 3LXKA 3SD0A 4JRVA 4EK3A 2GPHA 2PSQA 2XNPA 5KBQA 3UC3A 5BUJA 2CN8A 3JY0A 1Y8GA 1M2QA 3QRKA 3R63A 3V5PA 4QQCA 4C38A 4I0SA 3MH1A 4QT1A 1BLXA 3OMVA 4YJSA 5AAEA 2GNFA 4RGJA 3ZCLA 3A7FA 4AZVA 1ZZLA 4FC0A 5CXZA 5CF5A 3BPRA 3HEGA 3KCFA 3QBNA 4D5KA 1SM2A 2C6OA 5G6VA 3HV6A 4E20A 1W2CA 4DEAA 1W7HA 5AP5A 4F0FA 3C0HA 3UODA 1H8FA 3ZEWA 5BVOA 3N4TA 1OMWA 4C62A 2W1CA 3R6XA 1MUOA 4XYFA 3BGZA 4J98A 3TZ7A 3BEAA 4O7WA 3PY3A 3W33A 4YTCA 4DCAA 1KV2A 4PDOA 3ZZEA 4DGMA 3HA8A 3QCQA 1XH6A 2PL0A 2GQSA 2BAJA 4X2KA 3EL7A 5AUZA 3RINA 3PSCA 4R7IA 3A7HA 5ETCA 2NYAA 3VONA 5LVPA 4X6QC 4O84A 2DUVA 2OFUA 5HU9A 3EN7A 4B9DA 4BN1A 4YJUA 4R1YA 3VS0A 3I0OA 2WQOA 1LUFA 4EOIA 4D5HA 2B4SB 3VS5A 3EH9A 5IUIA 4RX8A 1V0BA 1XBAA 2WMUA 2V0DA 3UBDA 4QTEA 3TV7A 4JIKA 4BTJA 4USEA 4QMXA 3NNUA 3EFWA 2GQGA 2OWBA 4ZY5A 1SNUA 1WAKA 1YKRA 4MK0A 3TDVA 3F7WA 4UZHA 5DT3A 2RG6A 2VTOA 4CD0A 5BMSA 3KFAA 1PXJA 3QA8A 1IA8A 5HVYA 3D2KA 4L8MA 5FTQA 4BCGA 5C8MA 3EZVA 3IOPA 2OLCA 3TI1A 2PUPA 4DF3A 2ZV8A 4QP8A 4IMYA 1IAHA 2YABA 1XQZA 3Q04A 4U9AA 5I9XA 1WBPA 4O4EA 2PUNA 2W5BA 4XBRA 3CIKA 4R6VA 2QKRA 4JQEA 4JMQA 4DDIA 2ZM4A 4TPTA 4FMQA 3GCQA 4AA4A 1LEWA 2YZLA 3NCZA 4LOPA 4RJ5A 5BVDA 4FTCA 5KO1A 2GDOA 3HV7A 4QQJA 5AP7A 3ATTA 5FTGA 3C0GA 3NIZA 1SVGA 4EQMA 3P23A 2WEVA 4FKSA 2OXXA 1OGYA 2W1DA 2PVHA 3KXZA 3MY0A 4R7HA 5BX0A 2XIYA 4IB5A 1KV1A 3LZBA 3VUGA 4HYSA 4I6QA 2PE1A 5CEKA 4S2ZA 2JDTA 2XRWA 3ODYX 3GU8A 5CWZA 1JPAA 1XBCA 2WU6A 3LCTA 2JKQA 4NSTA 5EW9A 2C3IB 2W1IA 3JUHA 2C68A 2PMOX 4FT0A 5TO8A 3FYKX 2WTJA 1H26A 4WKQA 5AA9A 5JN2A 2ZV7A 4H36A 1IEPA 3E62A 3E88A 3ZM4A 2XK3A 3FQHA 2XKDA 5HOAA 5F95A 4ZLOA 3UOJA 4GUEA 3ZFMA 4L01A 4MD9E 4FSYA 5FRIA 3A8XA 5C26A 2WGJA 4E4MA 2ETKA 3FMHA 4ACMA 4AXAA 4BDKA 2XNOA 3V8SA 4JX3A 3U6JA 2WMBA 3ZLWA 2QNJA 4IBMA 5DR2A 3L1SA 5CTPA 3BHVA 4S30A 4G6OA 4BKZA 3ETAA 4C4EA 1GIHA 2BMCA 4G17A 4X2NA 3U9NA 4Z55A 3CE3A 5EDPA 4D2PA 4E5WA 4CTCA 4EK4A 4ZOGA 4KS8A 4RIXA 3BQRA 1PF8A 3DA6A 4MWHA 4YPDA 2GMXA 3HV5A 5DH3A 3ZBFA 5LMKA 1W82A 3F69A 3KRJA 4BCJA 4MUQA 2FSLX 3TNPC 5HCXA 4AXCA 4TWPA 4PF4A 1MRYA 4ZMFA 3RWQA 3DK3A 4OTIA 5AV3A 3WZKA 5G1XA 3TKIA 3E63A 4O21A 3GGFA 4D9TA 3U54A 4J99A 4JVGA 4G3GA 1OPJA 5L6PA 2C47A 4FV6A 3AT4A 5HEZA 4EHGA 3ORTA 3RWPA 4RG0A 5FG8A 5KX8A 4DCEA 3QKLA 4FNYA 4IXPA 3I0QA 2JAVA 3NAYA 4PV0A 1CKJA 4OBOA 2EWAA 3SX9A 2C30A 2YIWA 3BV2A 3BELA 2R7BA 4H3PA 4IB1A 4RJ8A 5CXHA 3F2AA 4FTLA 3RP9A 1ZYJA 2VU3A 1FVVA 3GB2A 3K3IA 3NWWA 3RVGA 3UOLA 2VRXA 3O5AA 4NL0A 4UXQA 3D7ZA 2C6MA 5CEQA 2BZJA 1OUYA 4CGAA 4RIXB 2W17A 2QURA 3OUNB 2GNHA 4BY9E 2NPQA 3NEWA 5HQ0A 3LJ0A 3FHIA 3LE6A 3SXRA 1R0PA 4ASZA 5KMJA 4O0RA 2Y4PA 3QUDA 1P4OA 4M84A 4ZSLA 2ITZA 3FL4A 3MVMA 2ZM1A 3TTIA 4HGSA 3RK5A 2Z02A 3VUKA 3AT2A 4UWCA 5DEYA 3AC2A 4Z7HA 4WIHA 1H0WA 3Q60A 4CCUA 3O17A 2IVUA 4Q5HA 3W0RA 3V01A 3NAXA 1YI4A 3TEIA 4E26A 3GU4A 5M56A 3FDNA 3QWJA 5E8YA 2QOKA 3FC2A 2YISA 4LQMA 4DTAA 2OSCA 4WRGA 2BCJA 4QMSA 3KXXA 1GZNA 2C5NA 2XM8A 4UMTA 4XV9A 4ZTMA 2HAKA 4U45A 4M0ZA 3PXYA 3EQHA 2JKKA 4FZ6A 4NJDA 5HE1A 2OXDA 4J52A 4RC2A 2BVAA 3MBLA 3ORNA 5CF8A 5CU0A 4JQ7A 3VRYA 3R8ZA 3RI1A 2YERA 2G2IA 4RLKA 4NW6A 1JBPE 5KMLA 3BZ3A 2CGUA 3TNWA 3OOMA 2BTRA 2WB8A 2VO6A 4MXXA 1IG1A 4BWKA 3MVJA 2XNEA 2J0IA 3E93A 4QMWA 5JRSA 2XB7A 5EH0A 4CQGA 4F9WA 1YXSA 4IC7A 1L8TA 2VX3A 3OZ6A 4YJRA 5H9BA 2QR7A 3AMBA 5AAFA 2P2HA 4FEXA 3QQFA 4HPUE 4R3PA 4U97A 3FXWA 5AV1A 5M08A 3PZHA 5BNJA 2WAJA 4D0XA 5AP3A 3ZRKA 3VJOA 1P2AA 1H1PA 1Y6AA 3OBGA 3CQEA 4QOXA 4FTQA 4Y8DA 4N70A 4CT2A 5AA8A 2AEGA 3IW5A 4OTRA 5IQFA 5FDXA 4MNFA 3VO3A 3RTPA 2BUJA 3FLZA 4AU8A 3R7EA 4UMRA 1KE9A 4QYHA 3W0NA 3D7TA 3A7JA 3AXWA 4L46A 2J51A 4M3QA 4AWIA 2Q83A 4BJJA 4RIYA 3QZIA 2QONA 4QMNA 2IZRA 1NVRA 4N0SA 3POZA 4WOVA 4ZSEA 4C7TA 5HVJA 3RK9A 4HCUA 1YDRE 3MH3A 3NR9A 3WF8A 2HIWA 2BAKA 1H08A 2R3IA 4J53A 4AW5A 3LCSA 5DA3A 3KK9A 4EH7A 4J96A 1XWSA 4CZTA 1XHAA 1QL6A 3EQBA 3F66A 4TRLA 5HICA 3U55A 3EJ1A 4U80A 3WF6A 4BCNA 3FQEA 4FJVA 4OTWA 2X2MA 4IZYA 4U42A 3UYSA 4AGCA 1H1WA 4IANA 3P7CA 4RQVA 3FYJX 5JZNA 1ZMWA 3NYVA 4GYGA 2ITXA 5HTCA 2ZV2A 4BRXA 2W4JA 2WQEA 2YDIA 4HYHA 4EH2A 4ZZOA 4AAAA 5B2MA 3GU5A 4R1VA 2C4GA 2Q0BA 3UG2A 5J5TA 1PXPA 3T3VA 3D7TB 3PPJA 4KAOA 3HVCA 4MXAA 1PMEA 4BTMA 5L3AA 3IG7A 3UP2A 4BJJB 3E8DA 4RIYB 4YMJA 4LDTA 3PA4A 4CYIA 3SHEA 1Q24A 1YQJA 3A7GA 3MV5A 4O6LA 3R28A 4TL0A 2XAOA 5FEEA 4DFLA 1Q5KA 3CQUA 4BDCA 1Y57A 3QRUA 2VWXA 3CXWA 3W55A 4DGLC 2Z7QA 4PX6A 3UO6A 4F08A 1Y6BA 2JAMA 4C4IA 3ZSHA 3PXFA 3V51A 5IA0A 4BIDA 1CDKA 4ZTRA 3FXZA 1O6LA 3HMIA 5C03A 5E90A 1WVWA 2YHVA 3ULZA 3ATSA 5DN3A 4C4JA 3H9FA 5HO7A