5DRBA

Crystal structure of wnk1 in complex with wnk463
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
273
structure length
273
Chain Sequence
TKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKAVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase WNK1
publication title Small-molecule WNK inhibition regulates cardiovascular and renal function.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 273
sequence length 273
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5drbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5drbA01
3U6JA 2JIUA 1CKIA 4U3ZA 2C0TA 1DI8A 1OMWA 3AD4A 4I94A 3TNWA 3GU8A 3CY2A 3TG1A 1PXIA 2DUVA 2XIKA 2W5BA 3V01A 2BMCA 4FSYA 3OWLA 4R77A 5EYDA 2XBJA 4FKQA 3A7IA 1QPEA 3F6XA 3KCFA 1YHWA 4TL0A 4JOAA 3HKOA 3QTIA 4U79A 4NSTA 1G3NA 3QCXA 4EK5A 3NIEA 3NWWA 4UMUA 2OJFE 3D94A 2BHHA 3N4TA 1XBCA 4EOIA 5CALA 1ZOHA 1I09A 1RW8A 2JAMA 3UC4A 4AZTA 4GKHA 2ZJWA 2JDSA 2QR8A 5M53A 2J50A 2JFMA 3MSSA 3QRTA 3QZIA 1APME 4L67A 4QMZA 5AP2A 5I9VA 2X9EA 5LCKA 3NUAA 4C4EA 3V6RA 4IFGA 5CAPA 3Q52A 3COIA 1Y8YA 1FBNA 4N57A 4ZZNA 3GCSA 3DK3A 4NZWB 4O84A 5AUYA 3D5XA 5EKOA 1QPDA 4EUUA 5CQWA 3EQBA 4EOPA 1P4OA 2GDOA 4EONA 4O1OA 1SVHA 4DTBA 3JY0A 3GVUA 5K4IA 4GS6A 3EKKA 4R6VA 2CPKE 1O6YA 3AD5A 4L44A 1SZMA 4NU1A 5D11A 4FK3A 3IOKA 2FO0A 2UZBA 4HYHA 4GIHA 5CTPA 4DEEA 2W1IA 4LGDA 4IC7A 1ZMWA 2CDZA 4EQCA 3VO3A 4IMYA 5BVWA 2IZRA 3E8DA 4M7IA 2YISA 4BDBA 3LFCA 3BGZA 3HRBA 3AC4A 2CCHA 3ITZA 4WOVA 4K2RA 4D2RA 4JJRA 4O7ZA 3E8CA 5CWZA 5A4TA 1O6LA 2JFLA 4D0XA 4E73A 4QPMA 4IFCA 4DFXE 4RVLA 4YHFA 2WQMA 5C01A 4D5HA 5JZNA 3W16A 2VD5A 3V5LA 5K5XA 4QYEA 3S3IA 2X39A 4FIGA 4FKUA 3FUPA 4LGGA 2BCJA 4E5BA 1VEBA 1IAJA 3DJ5A 3FQSA 2W7XA 3FMMA 2OJ9A 3A7FA 5DEYA 3ZCLA 4D1XA 4CZYB 3CE3A 2ITQA 5CSHA 5LWNA 4BCMA 2PUPA 3MV5A 4GW8A 3OD6X 4OTHA 2PY3A 3AMBA 3UP2A 4DH7A 4YJTA 4BKJA 3R8VA 3NUNA 4IH8A 1UNLA 5BYLA 3ALNA 1Q61A 2QOLA 2W1CA 4EK3A 4BCGA 1TQMA 3D14A 5D12A 4H3PA 3R6XA 2YWPA 5L6PA 5A3XA 1BUHA 3KXNA 2QOKA 2C3KA 3ACJA 3CTHA 3ENHA 3MA6A 4HPTE 2W4OA 1YHSA 3LFSA 4LFIA 3LLAA 3KREA 4CFMA 3L8VA 4G6OA 4N0SA 4PPCA 3W2QA 1OPKA 4ZZMA 3MFSA 4FG8A 5HHWA 5HGIA 4WHZA 2YJSA 2YIWA 1KOBA 4MBIA 3KGAA 2IZUA 3V5PA 1YI6A 4TNBA 3RM6A 3QU0A 3PJ1A 2OH0E 2RFDA 3FLZA 4L68A 2XH5A 4QOXA 1VR2A 3RNIA 5LJJA 3G51A 5K4JA 4RJ7A 2CKQA 1LUFA 5EM8A 5GIPE 4FTIA 3QD2B 4FKVA 3DKCA 2QC6A 4BCHA 4P5ZA 3MS9A 3O50A 4QMPA 4UY9A 4CXAA 5HTCA 3NVKI 4YHJA 4MXXA 5FEDA 2YIQA 1URWA 3DXPA 1FGIA 3HGKA 1FGKA 4FTQA 4I5CA 3VS5A 2BUJA 2X81A 1OGUA 2OSCA 3BYSA 4FEQA 2ZVAA 1LPUA 4N70A 2C5NA 4O27B 3QQLA 1Y6AA 3KA0A 3ZBFA 3KMWA 3LE6A 4B0GA 3BE9A 4LV8A 3V5WA 2GMXA 2B9JA 4LRJA 2UZLA 4YZDA 5D10A 3VS3A 4RIWB 4BC6A 3R7OA 4S32A 2WTWA 3Q9YA 3SXRA 3LXPA 4I5PA 4KSPA 2XNEA 4C2WA 4EHEA 4JBPA 4M0ZA 4O0UA 4O7NA 4CCBA 3OVVA 2ZDTA 3SKCA 5M4CA 4QMMA 2NRYA 4XNEA 5IKWA 4CD0A 5LVPA 3PP1A 4EI4A 1WVXA 3P1AA 4EK8A 3U87A 1W7HA 1ZARA 4ZJVA 3IDBA 5CVGA 5HIBA 4L01A 4TZRA 4RWKA 4OTFA 2FYSA 4HGEA 2QU5A 3ZHPC 4CFUA 3R2YA 3LQ3A 4KUJA 4UWCA 2YZLA 2RGPA 2EXMA 5CLPA 5DHJA 1ZOEA 4YLKA 4EH2A 4A07A 4XRJA 2PE2A 3RCDA 2VZ6A 1IRKA 4O7RA 2OJGA 2HELA 3COMA 3EYHA 3QTUA 4WBOA 2BROA 4LG4A 3RPYA 4BYJA 2E9NA 3UQFA 2R4BA 5C9CA 4DLIA 2XJ0A 2DYLA 3ZFXA 2A19B 4PTEA 3IPHA 5HLWA 4GT5A 1GIJA 4LMNA 4DN5A 5KX8A 5FTGA 1BI7A 4FSMA 5BUJA 4FYNA 4G6LA 2J90A 4HNIA 2W1DA 2W96B 1YXXA 2OZAB 2XKFA 5KHXA 4MK0A 4KBCA 3EN6A 3II5A 5CSVA 5IA2A 3UNKA 3HDMA 4TWCA 3SOCA 3EQGA 4CT2A 4DFLA 4BDFA 3A8XA 3F69A 1A48A 3HNGA 2VX1A 3A99A 2HW6A 3TTJA 3FZTA 1REKA 4YMJA 4LL5A 4Y85A 4ZOGA 4JT3A 5M06A 3MIAA 4U41A 3TUBA 4JXFA 5KBQA 4C3RA 5IH6A 3CQEA 3KQ7A 3PG3A 2O3PA 3PJ2A 4C4FA 5CU6A 5BQ0A 4ONAA 5IA0A 4PL4A 3Q32A 3L9LA 3SRVA 4GJ2A 3ATSA 2R0UA 1XR1A 3JUHA 5I9WA 3ANRA 4FL1A 4MF0A 3BE2A 4K77A 3R1YA 3CD3A 3IOPA 4LV5A 4HZRA 3N4VA 3QTQA 4MEDA 5ETFA 4O81A 4OT6A 5AFVA 4BKYA 3LLTA 2PVMA 3GOPA 3R7VA 4G3CA 2UZVA 2XCKA 5HI2A 3UVQA 3AQVA 3FQHA 4U42A 2XKDA 2P2IA 4KS7A 4QO9A 4DFUA 5A4CA 5E8WA 4G2FA 4YPSA 3Q4TA 1DAWA 2RG5A 4V0GB 3FY0A 3PY0A 2XJ2A 4JRNA 3DKGA 4RIXB 4X3FB 5ETAA 4FKLA 4MYGA 2BKZA 3SQQA 2C5YA 1Q4LA 3D9VA 3M42A 5HNGA 1GZOA 1SNUA 3L1SA 3H30A 2XEYA 2V7OA 2WELA 3TJCA 4C0TA 4CFVA 3BHHA 2PMOX 5AR7A 2JIVA 4AXAA 4QPSA 1ZYJA 2XIRA 5D9HA 5HX8A 4DEGA 4U45A 3L9NA 4AZSA 3BRBA 2JIIA 4Y5HA 2PU8A 3EMGA 4FR4A 4MBLA 3PSCA 2JD5A 5CSWA 3LZBA 4Y83A 5HTBA 5FG8A 2EXCX 2QG5A 4G5JA 1IA8A 1XBAA 3RJCA 5F9EA 3DTWA 3I0OA 4X6QC 1UKHA 5I4NA 4OUCA 5IU2A 4DG3E 1DS5A 3KMUA 4BDEA 3O7LD 3KVWA 5HE0A 2C0IA 4DH8A 3NAXA 4YJPA 2EB2A 2R3IA 2JGZA 3NIZA 4FV7A 4O7TA 5DOSA 3KRXA 2HXQA 3PYYA 4I92A 2Z02A 3S95A 1YQJA 2G01A 3G0FA 4U3YA 4DH5A 5LCJA 2OXXA 2J0IA 1CKPA 4FZ6A 5IQHA 3MN3A 3N51A 3KULB 4R3CA 2LGCA 3KCKA 2B52A 2NRUA 4ALVA 2BFXA 4ZEGA 2BAJA 3RZFA 3UZRA 1OECA 2WMTA 4S33A 4EH8A 1HCLA 3EQRA 4R1YA 4U43A 5IDPA 1FVTA 3FMNA 3L8XA 3BV3A 5BUIA 3TKHA 3DB6A 3DK6A 4GG5A 1RE8A 3HV4A 5A54A 3UE4A 3DKFA 3C4ZA 4HGLA 5ANJA 5CENA 2XYNA 3H4JA 2ONLC 3UBDA 1JSUA 5AV0A 2X4ZA 4OTIA 2YHVA 4O0VA 4QPAA 4Y95A 3SGCA 3Q53A 3QC4A 2B4SB 2ITOA 5ANIA 2JDRA 4TW9A 2OXDA 3KXXA 4X3FA 1VYZA 4F9YA 5HBJA 5GZ8A 4C2VA 5AR2A 4AT4A 2IW8A 4H1JA 4KRCA 4GK2A 2FH9A 4USFA 4BDJA 5LARA 1J3HA 2P0CA 4I0RA 3NUXA 5CU3A 5J79A 2HZIA 5HLNA 4ZMFA 3GCPA 4IX3A 4IM0A 2Z60A 2X4FA 3QAME 4ANNA 1SMHA 3E7OA 1OKYA 4F1TA 4D4RA 4IZYA 3ULIA 3Q9XA 2J51A 3TIZA 1P4FA 2VWZA 3UIMA 3UYSA 4IADA 2HOGA 3GCVA 3VUDA 3MVLA 1ZLTA 3IECA 4NK9A 4IX6A 3E93A 5E91A 4FICA 3FPQA 4L45A 5FLFA 5J9LA 5KKRC 3VBVA 1WBVA 2F4JA 4OTDA 2RKUA 3UNZA 3NW5A 3DTCA 3DBQA 5D1JA 4I3ZA 4BL1A 1PMEA 4HYIA 3AOXA 4IB5A 4QP9A 5AUWA 1L8TA 4IVBA 3R28A 4TPTA 4PWNA 5ACBC 4RVKA 4EKLA 4UXLA 1GZKA 1XJDA 4K1BA 1W84A 1GIIA 4RVMA 4AP7A 3S4QA 4C62A 1JVPP 3NW7A 5IQAA 4H39A 3GCQA 2VAGA 2F7XE 1R39A 2GHGA 4IM2A 4N6YA 4FTOA 3VBXA 4I1ZA 3FXWA 2WKMA 4ITJA 4A9RA 2HYYA 4D2TA 3OWPA 4M66A 1OIRA 4QYYA 1U54B 2QO9A 3DK7A 4ACGA 2GHMA 3F3VA 3FXXA 4FT9A 4IDTA 4AZFA 2VTSA 3OEZA 3O0GA 4ZJIA 4LQMA 2CSNA 4II5A 5TO8A 4ZY5A 4CKRA 1E1VA 3D0EA 1KV2A 1XO2B 2P33A 1XH7A 2VTQA 2OZOA 3I60A 2WNTA 4MTAA 4AGDA 5J9YA 3R7IA 3OG7A 3OXIA 3CJGA 4OW8A 4DHFA 4M8TA 4D1ZA 4DTAA 5J95A 4B4LA 1WBSA 3P4KA 4W4VA 2J5EA 1ZMUA 2CGXA 3IGOA 3HMNA 5HVYA 2OICA 4RX9A 2XKCA 4BBMA 4BZNA 2GNFA 3NCGA 4BGGA 5EK7A 4WNPA 4FTRA 3A4PA 1XH6A 3FEGA 4YZ9A 1PYXA 5FRIA 2HZ4A 4MX9A 3ORNA 2XK8A 4B7TA 4EOOA 4XG8A 3Q5IA 5DI1A 2R0IA 3U51A 3UIBA 5A4LA 2GS7A 4IAAA 4TT7A 4YJSA 4GYGA 1PHKA 2WTCA 3BQCA 3A8WA 4IZ7A 2WMWA 4CG9A 5AUXA 4CKIA 5IISA 2BIKB 3E92A 1GZNA 2OGVA 3QKKA 4QQJA 3JS2A 3NX8A 2BIYA 5H2UA 2RIOA 2VTJA 2BDJA 4GUBA 2X6EA 4QT1A 5T3QA 2KULA 4BWXA 2Y4PA 5M44A 3ZM4A 3FPMA 4MCVA 3LM0A 3IW5A 4YPDA 3VF8A 3VRZA 4RMZA 2YITA 3K3JA 2VWYA 3BV2A 5C4LA 4K18A 3H0YA 4YUQA 4XS2A 5C8NA 4MXOA 3VHEA 5DRBA 4X2NA 3QGWA 4FTKA 5AEPA 3VUMA 2ZB1A 4IEBA 3V8TA 5E1SA 2I7QA 2C5VA 3FJQE 3QRIA 4RG0A 2XIYA 3D7TA 3BLRA 2HWOA 3QQKA 4IQ6A 5DA3A 1U54A 1WAKA 3Q6WA 3SXFA 4JL9A 2UV2A 4JLCA 3UOJA 2NP8A 4KIKA 2R3MA 3DDPA 1DAYA 3MJ1A 4XG3A 4ZTLA 4QNYA 3HMOA 5LVLA 4CGAA 3IS5A 2UZOA 2WHBA 4FUXA 4I6BA 3FMLA 2VX3A 2OU7A 4HZSA 2QD9A 4HPUE 1YDRE 3HL7A 3EHAA 3R22A 4J71A 2R5TA 3A61A 1FMKA 5HO7A 5BVDA 4OLIA 3UG2A 2OJJA 5KMIA 3KN5A 3TCPA 2RFSA 4MNEB 1H1RA 5FGKA 1W8CA 1XBBA 4XYFA 3SAYA 4FV5A 4FYOA 3OBGA 1JQHA 4L43A 2B7AA 2EB3A 3NYVA 4OTQA 4QYFA 3TUDA 3R8MA 3TDVA 4M14A 1OKWA 5CF8A 4WSQA 3RAWA 3DFCB 2H8HA 1J1CA 3FLYA 3QUPA 5IQBA 1YXTA 3Q6UA 1Q8ZA 3QQJA 3EYGA 2QOBA 5K0KA 2P55A 4GU9A 3VS2A 3VBQA 5CEKA 5CX9A 1Q8UA 1H27A 4AAAA 3LFFA 4U7ZA 5AUVA 2W05A 5M4IA 1V0BA 5DH3A 3SW7A 4QP2A 4MWHA 4K0YA 4YZCA 5CT7A 5HICA 4FEWA 5E1EA 5IQDA 4O96A 4BCNA 2FSMX 1YXSA 5HIEA 5JT2A 1ERKA 5DFPA 3VBYA 4CFXA 5AA8A 5I3RA 5KCVA 4FZ7A 2G2IA 2ZM4A 3BWJA 4XEYA 3BKBA 4TYHA 4TRLA 3OC1A 4O0YA 4BDHA 4MF1A 2EUFB 3W8QA 5CF5A 2XP2A 2XCHA 5IA5A 5C27A 2J6MA 2CNQA 5JGBA 2XK3A 3V5TA 4C58A 2BVAA 3RM7A 3K5VA 3I6UA 4D1SA 2GU8A 3MFTA 4P4CA 3R8ZA 5AR4A 2Z2WA 4JIAA 4A7CA 4IW0A 1WVYA 1CDKA 3RWQA 3EIDA 3PDTA 4RC3A 4Y5QA 4Z55A 5M07A 5CT0A 1H0VA 3CP9A 4QP8A 3MDYA 1DM2A 5FTOA 2WMRA 3BLQA 1U4DA 3RPSA 2FB8A 3GCUA 2JEDA 3T8OA 2B54A 4U8ZA 2IWIA 3KMMA 3HAMA 3ZUUA 4BGQA 2CN8A 2AUHA 4C38A 1U5QA 2OXYA 2W1HA 4AE9A 2YACA 1Z57A 5CEIA 3GT8A 4I4FA 4RFZA 4A9UA 3PVGA 3NUUA 3C0HA 1BX6A 2UW3A 3KXMA 4DG0E 4IAKA 4GFOA 4FT5A 2B1PA 4O22A 3HECA 2XVDA 4DCEA 1PXJA 4PL3A 2UZNA 4IAYA 1QMZA 5CEOA 3UJGA 4O0TA 1H1PA 4YZBA 3KVXA 4S2ZA 4BICA 2XYUA 5B2KA 2YIYA 3PIZA 3ATTA 2Y0AA 1CM8A 3OW3A 2ESMA 5AP7A 4ERKA 2BR1A 4YP8A 3ZEPA 2WMUA 5GNKA 4G3FA 4LYNA 4XG7A 3PXQA 4R5YA 1YWRA 5EM5A 4O7WA 5CSXA 1R0PA 3R8UA 2ZM1A 4FVQA 4JI9A 4YBJA 4BI2A 2PMLX 3TL8A 4F6SA 3ID6C 3E3PA 1GOLA 3DT1A 3QCYA 3F5GA 4L46A 2C47A 4AN2A 3FAAA 3RHXA 1OL1A 5A46A 2O63A 2AYPA 2C3LA 2J0KA 3NCZA 3WZEA 4XBUA 3ZSIA 4G16A 2ETRA 4FEUA 3EQHA 2OW3A 3HEGA 4YTFA 2YM4A 3ODYX 4AWIA 3K2LA 4I5MA 3QTXA 1Y8GA 4AZEA 3PA5A 2BZKB 3QUEA 2YM5A 5HORA 3EQCA 3VBTA 2VWWA 3RBWA 2HCKA 2Y8OA 3TNPC 2WQNA 5EG3A 5A9UA 5E8ZA 5G6VA 3FI2A 2G15A 1CKJA 4ANOA 2PVRA 1GJOA 2FUMA 2PTKA 3R01A 4X21A 4R3PA 2OJIA 2JKQA 3D83A 4EZ5A 3BHTA 4MKCA 3OS3A 5BNJA 2PE1A 4TXCA 3TACA 5IMEA 3B8RA 3CQWA 3W55A 1XH4A 2ITZA 2YIRA 4RZWA 2PZRA 3UQGA 3VUGA 4RWLA 5M4UA 4JR7A 4JX3A 4DAWA 3P7CA 4GCJA 5J8IA 3HRFA 1IG1A 1W83A 2YIXA 1OPLA 3EFLA 3C4WA 4IB3A 4NTSA 3WF5A 1KUTA 3QCQA 3CY3A 3H9FA 1J7UA 3VS0A 4FX3A 3E87A 5L2SA 3KL8A 2B9IA 1K3AA 3VS6A 3I1AA 1MUOA 2PVNA 4FODA 4NW5A 5T68A 4DBNA 1RDQE 3DBCA 4DG2E 1Q8WA 1ZXEA 3NUYA 4ZTHA 5K3YA 4RIOA 3ERKA 3SHEA 4C37A 2VX0A 4ZXTA 5F1ZA 3OUKA 3POOA 4FMQA 2I1MA 5CU0A 2GQRA 2WQEA 5HNIX 1S9JA 4GEOA 4P90A 3ZC6A 2VWUA 3OXZA 3GP0A 3NPCA 5A4EA 3AD6A 4GT3A 3DLSA 2GTNA 4EWHA 2BRBA 4WG5A 4ZK5A 3RP9A 4HYUA 2YWVA 3VF9A 2EXEA 3VJNA 3QZGA 5HTIA 3IGGA 4UMTA 4DFBA 3C5IA 1OUYA 1XH5A 3MBLA 4BCOA 5IUIA 3DY7A 4O2ZA 4EH6A 5GZ9A 5H8BA 5AM7A 3AC1A 4JAIA 3UIUA 3E64A 3QXPA 4ACMA 4O91A 4AW2A 4ZLOA 1LEZA 5LOHA 5JN2A 1XHAA 4E7WA 4EH5A 1NT2A 3KKVA 3R21A 5TE0A 3ACKA 1M52A 3ZLYA 5FEEA 3CC6A 4Q5EA 3U4UA 2QODA 2YDIA 5T6KA 4RQVA 3NNVA 2BHEA 4D55A 5HCXA 4G3DA 5HX6A 4UV0A 4ZIMA 2NO3A 3I4BA 4I0SA 2GFCA 4FTCA 2PVYA 3K54A 4F0FA 3MTLA 4F0IA 4JG8A 2YM3A 1OB3A 3MI9A 5EI2A 4MXCA 3G15A 3EFJA 3NR9A 4PDPA 4E6DA 4EHVA 2OG8A 4LUDA 5B2LA 2Z8CA 3R30A 5ANOA 2UVYA 1PJKA 3F5UA 3TTIA 4HNFA 4EORA 2PUIA 2GHLA 3F3WA 5D7AA 5DPVA 4I23A 5HOAA 3RCJA 5KMOA 2XS0A 4U9AA 5EYCA 3TKUA 3DPKA 1H8FA 5CANA 1MRVA 4M13A 5I9UA 4WUNA 2HWPA 5L6WL 3BX5A 3PLSA 3VS1A 5KBRA 2YZAA 3UZTA 3OTVA 2YA9A 4X2KA 3TUCA 3PA3A 2UZDA 4R1VA 3O8UA 4KKGA 4IWDA 4PF4A 5ANKA 4X2FA 1JKKA 2E9UA 1PXNA 2UZEA 3FYKX 4BCIA 4FIIA 4D2WA 3HLLA 5BMSA 3A4OX 2YLEA 4G6NA 3Q4CA 4DEDA 4EUTA 3C7QA 3LMIA 3RGFA 5DGZA 2WIHA 2RSVA 3QRJA 4V05A 4RJ8A 3V5JA 4R7IA 4BGHA 3WZKA 4IHPA 4CFWA 3R1QA 3KB7A 4HVDA 4NWMA 3TV7A 2CGUA 2GNLA 4J8NA 4JG7A 4FKIA 2VGPA 3VUKA 3FQEA 3RMFA 4AE6A 2V22A 4EQUA 3RINA 4ARKA 4PP9A 2VTRA 3FV8A 1LP4A 2BZHB 3KK8A 3BZ3A 3LQ5A 1M17A 2YN8A 3ET7A 5AR5A 4ZLZA 5LVMA 5IA3A 1OIYA 2VRXA 3MY1A 3ZUVA 2J4ZA 4BTKA 3ZDIA 4BDCA 5J5TA 3HX4A 4FZFB 2ITUA 4NFNA 3DA6A 3VS4A 5CEPA 2VWVA 3D5WA 4J99A 4F9WA 4ZMEA 1H1WA 3SXSA 2JBOA 3R1SA 5CEQA 5L3AA 1STCE 4AOTA 3TNHA 3DBEA 4IVCA 4AT5A 4WSYA 3AGMA 3C13A 3G9NA 2FVDA 2I0HA 2F7EE 2XNOA 3EQDA 4MHAA 5CEMA 1UU7A 5FDXA 5LXMA 1J7LA 1NW1A 4OGRA 3LXNA 5A4QA 3L8SA 5I5ZA 5EHLA 5L8JA 3P23A 3R9DA 3U6HA 3UO5A 1PMVA 3OCGA 2X0GA 1JAMA 4BHZA 2O2UA 3DXNA 3GB2A 3LM5A 4QTEA 5M57A 1ZYDA 5TF9A 1YWVA 4GH2A 3IKAA 3ZO2A 1SVGA 5CQUA 3EN9A 4BTJA 5FBNC 3HMIA 3PJ8A 5CVFA 3SLSA 4EYJA 5JFWA 3UPZA 4I6FA 5M51A 1YOLA 5IH4A 4TWNA 4DEHA 4R78A 2OKRA 4HCVA 2CLXA 4KBAA 3DJ7A 4N4SA 4M0YA 4ZTSA 4M67A 5EM7A 2ZMCA 3QLFA 2ERKA 4PUZA 3NDMA 2X8IA 3IQ7A 4XV9A 4EBVA 4EKKA 3R02A 4CSVA 2C6OA 5C8KA 3QKLA 5HU9A 4JAJA 3UZPA 2O5KA 3FLWA 4NFMA 4U6RA 5AP5A 4IAIA 4DCAA 5FXQA 4PMMA 4EK6A 3F61A 3ZFMA 3JY9A 4QQCA 1CTPE 2WMAA 3C4EA 4OAVB 2GQSA 5FTQA 4FSQA 4JS8A 3RPOA 1JSTA 4FIJA 4YSMA 3RAHA 4E4XA 1H07A 1AQ1A 2SRCA 4RC4A 4CZTA 4DH3A 4EYMA 5IQIA 3ROCA 4UMRA 5F94A 3R83A 4Y73A 2J5FA 4KBKA 4QP7A 4PQNA 3EN7A 4YURA 4RIWA 2VV9A 2W4KA 3F5PA 5J7HA 3RPVA 3CGOA 3H3CA 4D9UA 2GFSA 5L2TA 1QCFA 4DE4A 3WI6A 4BDAA 3OT8A 3PE2A 4XP3A 3HUCA 3EQPA 4UEUA 3LXLA 4BCFA 5CAVA 2OIQA 5FEQA 4RBLA 3UTOA 3HV6A 2ZYBA 4QD6A 1VJYA 3CKWA 2XK6A 4ZZOA 5IA4A 4WUAA 3QYWA 3AMAA 3UMXA 4DBXA 3PY1A 3TNQB 3LCKA 4U81A 3IDPA 3Q9ZA 2H9VA 2PVJA 3H10A 5HBEA 3M2WA 1V0PA 4FZAB 3CBLA 5I9XA 4GIIA 3RAIA 4AF3A 3P08A 4WNOA 1OVEA 4F99A 4LRKA 3OHTA 4U44A 3ETAA 5C4KA 4L7SA 4C7TA 1PXLA 3E88A 3ZC5A 3IDCA 5K5NA 2I40A 4DGOA 4BR3A 3CPBA 2QLQA 2HW7A 4UALA 5DR2A 5AV2A 2DS1A 4K11A 2VWXA 4XG9A 3FL5A 4MVFA 1PMUA 4MXAA 2CMWA 4W8DA 4RJ5A 1IR3A 4QP4A 3SVVA 3W2PA 5HESA 3ZTXA 4HW7A 1H01A 2A2AA 3LCOA 3OP5A 3GGFA 4FSWA 2CLQA 5DR6A 5K0XA 1H1QA 4HJOA 4AS0A 1T46A 2OZAA 3RVGA 5KKRB 2WOUA 3I7BA 2H34A 2QU6A 4IACA 1MRUA 3BELA 4RQKA 3PXRA 3QHWA 4WBBB 2BTRA 2C4GA 1UU3A 2OO8X 4BDKA 3PRIA 4UYAA 1SYKA 3FYJX 3O8TA 4YSJA 3R1NA 4QMUA 1NVRA 4IWOA 5J5SA 3MVHA 2HZNA 4FT0A 1YKRA 3PVUA 2JKOA 3QRKA 4FSNA 4K9YA 4YLJA 4PY1A 4DFNA 3FMDA 3RTPA 1J1BA 3L8PA 3ZUTA 3DGKA 3TDWA 4FV3A 3UIXA 3VNTA 3HAVA 3OT3A 4Y46A 2QOQA 3W18A 3WOWA 4JQ8A 3ZBXA 3U54A 3W2CA 5JSMA 2I0YA 4F09A 1WBNA 2V5QA 3MGYA 4AZWA 4XP0A 3R8LA 3D4QA 1Q3DA 3Q2MA 2WD1A 4OBQA 1BYGA 4FC0A 4JRVA 3RAKA 3GQIA 3TKIA 3LCSA 2GQGA 1R78A 5HQ0A 3FHRA 3QTRA 1A9UA 4JVGA 4O0XA 2I0EA 4KINA 4J52A 1WCCA 4D28A 2C30A 2VUWA 1H28A 4JIKA 4YTHA 3ALOA 4GYIA 4UMPA 4P5QA 3WZDA 4Q9ZA 3W1FA 4QMNA 3AC2A 5IUHA 2BRHA 3H9OA 4QTBA 5KZ0A 3POZA 2VTPA 4XOYA 4OTWA 3QL8A 4WO5A 4AOIA 4HVHA 1F0QA 4W4WA 4V0GA 3CTJA 4LOOA 5CNOA 4RIXA 1I44A 4I41A 3BU6A 4HVSA 4P2KA 2OWBA 4S30A 2IVSA 3C0IA 1UNHA 5KUPA 5CZHA 5C1QB 4QYHA 3R7GA 3KRJA 3UG1A 4YJVA 2WXVA 4FT3A 4B8LA 3T3UA 3MB7A 3R9RA 3FMEA 2A27A 3LJ2A 4PV0A 5LMKA 2XK9A 4NJDA 4DGGA 4ZY6A 3NZ0A 3JR1A 2PSQA 4H3QA 3Q4UA 4AQCA 3R0TA 4M68A 4V04A 3BU3A 4PRJA 4K8AA 5AIRA 3VUIA 1LEWA 4ASEA 2XZSA 4C02A 3S00A 3GOKA 2C0OA 3ZLSA 3FDNA 2UW9A 3C5UA 4LI5A 3SX9A 3C50A 4YTIA 3ZOSA 4DGNA 3DU8A 2ZMDA 5AP6A 3AT3A 3Q96A 2JDTA 2PVKA 2VGOA 3I0QA 4X3FC 2VO0A 3LFQA 5CU2A 2BRNA 5EOBA 5AV4A 1WBTA 5LVOA 3ZM9A 3FI4A 1OKZA 2IW6A 4AUAA 4AACA 4NM5A 4DH1A 3CKXA 3C4CA 3DV3A 4ZJJA 3W10A 3KULA 3S2PA 4EH9A 1JOWB 4TKSA 4UX9A 1ZY5A 4GUEA 5LMBA 1Q3WA 1UWJA 4RX5A 4E6QA 4FVPA 4WG4A 4YNOA 4XOZA 2Y4IC 3R9OA 2QNJA 3BBWA 4FKGA 5EFQA 4ANBA 3LFEA 4CTBA 1SM2A 4DFYA 5M4FA 2BZIB 3UODA 4BDDA 3O7LB 4FVRA 4CQEA 3OTUA 1TKIA 4L52A 5HU3A 4E20A 3G90X 5JKGA 2GNHA 4B6LA 5JFVA 4BI1A 1XKKA 2QQ7A 4PNIA 4E93A 5IF1A 3LAUA 2BALA 5CAQA 3BGQA 4O6LA 3FZSA 5FP5A 4F9BA 3PZHA 1JKSA 4WG3A 2XIXA 5EDQA 1JPAA 3HYHA 3EN5A 3MA3A 3MWUA 3UVPA 3OCTA 1ZRZA 2R3RA 3ZRLA 4CCUA 3KN6A 1J7IA 5EI8A 5EW9A 1PW2A 2YM7A 2NNWB 3AXWA 2H96A 4D2SA 2JDVA 3E3BX 3OOMA 5H9BA 2XKEA 2QCSA 3F88A 5I3OA 4JBOA 3E62A 3FKNA 1YI3A 4EC8A 4QQ5A 4F7SA 4GKIA 4M69B 5IH5A 2B9HA 4ITHA 3F9NA 2XNGA 1JNKA 3KF4A 3V8WA 4RWJA 5AP3A 5AAGA 2I6LA 4RZVA 5ANDA 4ASXA 5AAEA 2R3FA 4IX5A 4IM3A 2F2UA 1WBWA 2WMSA 5G1XA 1YDTE 2R3NA 3ZO4A 1MP8A 4KD1A 4E4LA 3NEWA 3D2KA 1R0EA 2W17A 2UW5A 2GS6A 4WA9A 4RC2A 4R5SA 2AC3A 3WZUA 4E1ZA 5KMMA 5E8XA 4EZ3A 4LOPA 1GAGA 1TQIA 4AW1A 5JQ5A 4EK4A 2V62A 3ODZX 4XH6A 3EFKA 3C0GA 2QKWB 5HEZA 1W98A 4AZVA 2WO6A 5IUGA 4LGHA 3QC9A 3QQUA 1RQQA 3UDBA 2X2LA 4FA2A 3FLQA 4FOCA 1KE6A 3LMGA 5IPJA 4FF8A 2F2CB 5GINE 3LCDA 4S34A 4ZS0A 3QX2A 3LCTA 3LJ1A 2OIBA 4TNDA 4F65A 4XP2A 4C34A 3SG9A 4F0GA 3IONA 3QGYA 2WTKC 1R1WA 4OBOA 2JITA 4EEVA 5EW8A 1SNXA 3E8EA 4DINA 3DFAA 4EHGA 5B7VA 1ZZ2A 2BDFA 3QLGA 4RIYB 5KE0A 4LM5A 5J1VA 5HLPA 4UZDA 2QI8A 3ROYA 1YI4A 3I5NA 1BL6A 1XH8A 3TZ7A 4HVGA 1JBPE 2ZM3A 5E8SA 2HY81 1W0XC 2O8YA 3VQHA 3VQUA 3ZLXA 4HOKA 3MESA 3GEQA 2F57A 2QLUA 3F7WA 3IW6A 1PXOA 1OI9A 3BGPA 2W0JA 3GUBA 4ANQA 3IW8A 3KF7A 3RALA 2CNVA 4I93A 3FZOA 4CYIA 1OL7A 2FSLX 2OBJA 2WU6A 4OR5A 1E9HA 2GPHA 5AP1A 5A6OA 3OW4A 3QCSA 5DEWA 3ZEWA 5IQFA 4D5KA 2ETMA 3U55A 3OCBA 4M97A 2E2BA 4TY1A 4RA4A 3KXZA 3AG9A 4F08A 4E3CA 3BEGA 4E4MA 4YO4A 2O64A 1JKLA 1OL5A 4XV2A 2ZV2A 3PIYA 4BCQA 1OBGA 2OIDA 3F2NA 1J91A 2XNBA 3JYAA 2IN6A 3IO7A 2IVVA 2CNUA 4G5PA 4J53A 5HG7A 3PP0A 4D58A 3PJCA 5JK3A 3E5AA 3PXZA 4NCTA 4AG8A 3CR0A 5ETIA 3W2SA 1NY3A 2X2KA 3Q2JA 5DE2A 2QOIA 5TKDA 3OZ6A 4AGCA 4FUYA 4H3BA 3EL8A 1SVEA 1OZ1A 4C4JA 4ZSEA 3OEFX 4XCUA 3ZRMA 4NIFB 5I9ZA 2VO7A 1A06A 4NW6A 3TXOA 4O0RA 3CTQA 4W4XA 2X7FA 4XBRA 2VO6A 4XUFA 2J2IB 4TWOA 1XQZA 1HCKA 2C6MA 4NJ3A 3T9IA 3D15A 3G9LX 4BIEA 3PXYA 2R9SA 3OMVA 4A9YA 2RG6A 4IAFA 4MD7E 2WTVA 1JKTA 4GT4A 5ANEA 2Z7SA 4ZSGA 4BYIA 4MNEA 4E26A 4J98A 3OCSA 4BBFA 4RLLA 3EZVA 2FA2A 4NH1A 1V1KA 3W8LA 5LVNA 4FV6A 1BKXA 4KWPA 1WVWA 4U40A 4B9DA 2C6DA 2Q0BA 4KKEA 5HZNA 2CKEA 2R3QA 3TZMA 3G5DA 3NMUF 4CRSA 4RPVA 2UW4A 3S1HA 1O6KA 3F7ZA 3OWKA 2EU9A 1ZMVA 4AW0A 3AT2A 4CT1A 2Q83A 4J1RA 4AN9A 2QKRA 4V01A 4ZS4A 1H26A 3BPRA 2RFEA 4EL9A 4QP6A 1GNGA 1PY5A 3R8PA 3DS6A 2G9XA 1H0WA 1MQBA 2UW0A 2WAJA 4EOQA 4F7NA 1H25A 3N4UA 2UW7A 2WB8A 5E90A 4BHNA 3Q04A 4L53A 2VTOA 2XF0A 2IZSA 4H36A 4Z9LA 4FG7A 2ITPA 4NM7A 1QPCA 1ND4A 3GENA 3GC7A 3T9TA 3ZO1A 3HMMA 1OIUA 4GK3A 2PZIA 4L00A 4YBKA 4C35A 2JLDA 3VN9A 3BBTB 3I79A 2G1TA 3NVMB 2X7GA 3D2IA 3DZQA 4BRXA 1JSVA 3MTFA 5EH0A 3CXWA 3UO4A 2OI4X 2R7BA 4IX4A 3VULA 2OFUA 5JFSA 1IASA 3O23A 1DI9A 5HG8A 5TT7A 3UVRA 3GC9A 5FWKK 5CF4A 2V55A 4GFGA 3WF6A 3R7EA 3D7ZA 2W5HA 2ACXA 3R04A 4X2GA 4KIQA 5DBXA 2R2PA 3QA8A 2YEXA 3DQXA 4FKJA 5EQEA 2J7TA 4PDOA 1O9UA 2UZTA 2XNPA 3CCNA 4MQ1A 5JQ8A 2V0DA 5FUTA 3F3UA 3U6IA 5E92A 4AFJA 3ULZA 3VVHA 2B9FA 2C5OA 4FTNA 1ZZLA 4GFMA 5E8TA 4J97A 4DEBA 1REJA 4IWPA 3V8SA 3HV7A 5DG5A 4D2VA 4O1PA 2PUNA 4Y72A 4DFZE 3PRFA 3FKLA 2X9FA 3PPJA 3HRCA 3UP7A 4BF2A 2I0VA 2XK4A 3BCEA 4O7VA 5KO1A 3LOKA 5HE1A 5AA9A 4BTMA 2PZPA 2Z7RA 5IQEA 2WMQA 4PTGA 5L4QA 4L3PA 4XX9A 2XBAA 2QOFA 3AC8A 4JBVA 4Q2AA 1PKDA 3DKOA 1WMKA 1M7NA 4APPA 4H05A 2VNWA 3PSBA 3MH0A 4QYGA 4CEGA 4AA5A 3FSFA 4YZMA 4RJ4A 4RVTA 3JVSA 2JBPA 4C33A 2YJRA 3NNXA 4J95A 4QNAA 3AC5A 4NM0A 4YLLA 4P7EA 4CG8A 2QVSE 5JRSA 5H8EA 4CFFA 4UBAA 4AN3A 5BVFA 1ZYSA 2J0LA 3S0OA 4QQTA 4UYNA 3M1SA 4RFYA 5D41A 5EI6A 2OLCA 3FY2A 2B55A 2QOHA 4DEAA 2EVAA 3OY1A 3P79A 3PG1A 4FZDB 5ICPA 1KE5A 1Z9XA 2WOTA 4NUSA 5HD4A 3ENMA 4AOJA 1NXKA 2J0MB 4UWBA 3NSZA 3VIDA 3C4FA 5AIKA 3SW4A 1MQ4A 1Q24A 2CJMA 3UMWA 4KRDA 4BWKA 4ZLYA 1BL7A 4TYEA 4W8EA 5EYMA 4BZDA 3CSVA 4QP3A 4ENYA 4WNKA 3DOGA 3UOLA 5L2WA 3BYOA 3QYZA 2VWBA 3PUPA 4QMVA 3WE8A 3UYTA 1KE7A 2A4LA 3HDNA 4KB8A 1F3MC 1YRPA 5M56A 3O8PA 5I9YA 5IDNA 3ORZA 3MFUA 3A7GA 2F49A 3BYUA 2RF9A 4PMPA 4JQ7A 5AMNA 4FL3A 1FVVA 5DLSA 3FSKA 5IQGA 2Y6OA 3DNEA 3NAYA 5E8VA 4JBQA 3FZRA 2VTIA 4MXYA 5H3QA 5LMAA 3SOAA 1L3RE 1QPJA 5AV3A 2VO3A 2XRWA 4O0SA 4CV9A 1K2PA 1M2PA 4OBPA 4TYGA 4ANLA 3DBDA 4DGLC 2AC5A 5KMLA 5CXHA 3MH2A 4L3JA 5DRDA 3MH1A 3TJDA 4CLJA 1JWHA 2X7OA 2Y7JA 3ZXZA 1M2QA 2XNMA 4BIDA 5KNJA 4FOBA 3O51A 3PVBA 1YW2A 3A62A 3FZPA 3BLHA 4I24A 2WEVA 3GU5A 3SD0A 4A9TA 1PKGA 1VYWA 3JPVA 3MY5A 5JGDA 1M14A 4G3EA 3FLSA 4EWQA 2PWLA 3C1XA 4QMWA 3ZZEA 5CI7A 2GSFA 3L9PA 2GNGA 4FTLA 2F7ZE 5FM3A 4H1MA 3GU7A 2ZV9A 3FI3A 4FL2A 4UN0C 1GY3A 3C9WA 3TV4A 3VS7A 3F2RA 2ZB0A 3GFEA 1BI8A 4EHZA 4KA3A 2O0UA 4K6ZA 4DTKA 4CKJA 2R3PA 2R3LA 3NS9A 3QRUA 4TYIA 4I22A 5E8UA 4EOSA 2Y6MA 1YDSE 2QOCA 3MPAA 2ERZE 4BZOA 5CAOA 3TT0A 1FPUA 3HZTA 5AX3A 5L8LA 4KSQA 2R3OA 5HO6A 3LFNA 1IEPA 3K5UA 4QTCA 2YDJA 3UC3A 4NL0A 1OBDA 4GV1A 4R8QA 5DIAA 2C1AA 3MW1A 4IZAA 3CQUA 1B38A 2B53A 2YAAA 2A1AB 3L9MA 3PPKA 5BMMA 5DT4A 4EH4A 4QTDA 5HVKA 4ZAUA 3UGCA 4IZ5A 3V04A 4D9TA 3LFBA 2Z7QA 3VBWA 4YU2A 1LR4A 2PK9A 2PMIA 2XMYA 3Q5ZA 3QUDA 4QMXA 5EYKA 3FBVA 3RHKA 5HVJA 3WE4A 4FTUA 4FKOA 4CMTA 4EJNA 4FV0A 4ALWA 3CGFA 5BVEA 3O2MA 3EFWA 2YCSA 4IXPA 5EHYA 4W9WA 3NUSA 4ANMA 4ASZA 1KOAA 4C3FA 5IEXA 4AGWA 3P9JA 3CPCA 5DT3A 5GZAA 3H9RA 4DLJA 3B2TA 3H0ZA 3VC4A 1OPJA 3ORXA 2GNJA 1UWHA 1PXKA 2J0JA 1M7QA 1XWSA 4IB0A 4NM3A 4QMYA 4A4OA 4BVUA 4W4YA 4B8MA 4RA5A 2OH4A 4FEVA 4WIHA 2BAQA 3EZRA 3ZO3A 5L2QA 2YCFA 2YABA 3FI8A 2E9VA 3GNIB 3Q4ZA 4G34A 4CMOA 3SRVB 3P86A 1S9IA 4ERWA 3VRYA 1YOMA 5CAUA 2W9ZB 5JRQA 2IG7A 4FI1A 4QTAA 4YJRA 3TZ8A 4ZY4A 3LVPA 1GZ8A 4WKQA 4IVAA 1Q62A 2WGJA 3KXGA 1G5SA 1NVSA 3QD4A 2CGVA 4TWPA 3ZH8A 4B99A 2QG7A 3PIXA 5FP6A 5AJQA 2DWBA 2R7IA 3NGAA 3JXWA 4XV3A 3ZS5A 1YXUA 3HUBA 2RL5A 1R3CA 1ZY4A 5CU4A 3FC1X 2O65A 3G33A 3P5KA 4I0TA 4WNMA 3HMPA 4O0WA 3OY3A 2UZWE 3NYNA 4APCA 4DT9A 2PZ5A 4TYJA 4OTRA 3WBLA 2BTSA 3P78A 4I4EA 3K3IA 2BZJA 5J9ZA 5D7VA 2IPXA 5LQFA 3R7YA 1KE9A 4JDKA 4Z16A 4F9AA 3EH9A 3PJ3A 4DC2A 3MB6A 4AGUA 1P14A 3BYVA 4R3RA 4JX7A 4C59A 3AT4A 2UW8A 3JVRA 3BI6A 1UVRA 2JDOA 3NRMA 4F6WA 3F2AA 1OKVA 4AU8A 1FMOE 3F3TA 3F5XA 3FMKA 3GI3A 2JAVA 2PVHA 4Q5HA 1WBOA 4O6EA 3ELJA 2WMBA 2R64A 5GJGA 4A9SA 4G1WA 3DAJA 5C8MA 4O38A 5JZJA 3QHRA 3WZJA 1FOTA 5CVHA 1G8AA 3W33A 3TM0A 2JC6A 3FE3A 3CLYA 3QD3A 4H58A 4G9RA 4J8MA 3KRLA 4XLIA 5F4NA 1G8SA 4WRGA 2R3GA 2J9MA 3HV5A 4GSBA 2ITNA 4FT7A 3RI1A 1TQPA 5TOZA 4YR8A 3RZBA 1Y91A 4IAZA 2A0CX 5A6NA 3RK7A 4BY9E 3PTGA 4M12A 5L8KA 4JDJA 2CN5A 2VTTA 5F95A 4QMQA 3Q60A 3OWJA 2LAVA 3EQFA 3EKNA 2Z7LA 3VW6A 5TR6A 1YVJA 2EWAA 2W06A 2XJ1A 2YCRA 3D5UA 4BIBA 3DAEA 3VUHA 2ITVA 4USDA 1PXMA 4JG6A 3ZYAA 5BVOA 4PDYA 4L42A 1KWPA 1YXVA 3C4XA 4L6QA 4LRMA 4YJOA 4CFNA 5A14A 2PL0A 3LPBA 5DN3A 4I20A 2W1EA 3QTZA 4KIOA 2W4JA 3SDJA 4A4LA 3U9CA 4PMTA 3I81A 4EOLA 4PPAA 4C61A 4F1OA 1F5QA 4UXQA 3BHUA 3G6HA 3TN8A 4BDGA 4GMYA 3KRRA 4ORKA 4CV8A 2XIZA 3O17A 5CZIA 5GJDA 2OK1A 3OROA 5DNRA 3ZLWA 5BPYA 2VTAA 5CY3A 2ZV7A 3ORIA 3UO6A 4FSZA 4QP1A 2BRMA 4BB4A 3QWJA 3COHA 4IWQA 3HVCA 4L3LA 3FMHA 1P5EA 4A4XA 4YJNA 3MFRA 4CQGA 3QXOA 2YM6A 4UZHA 4C36A 1H24A 1PXPA 1U59A 4GK4A 4ACCA 4FV2A 3FZ1A 4FTAA 4FNXA 5KMJA 5C03A 4ZSLA 3PXKA 3U8WA 4ZTMA 1B39A 2Y4IB 4D4VA 5JH6A 3PZEA 4QMOA 4N6ZA 4YJQA 4DT8A 5HCZA 5FD2A 3DAKA 3QWKA 5E9EA 4G3GA 3IK3A 3TIYA 4E5AX 4IBMA 4EZ7A 2DQ7X 2WMXA 2X6DA 1H08A 1Y6BA 4TN6A 2B0QA 4FGRA 3MVJA 1KV1A 2HIWA 3W32A 5AV1A 2HAKA 3R00A 4M84A 4BDIA 2IVTA 2ONLA 4O7SA 4K33A 3PE1A 4YO6A 2YDKA 4EJ7A 4IB1A 2XM9A 4DGMA 4XG6A 1YOJA 2WFYA 5BYYA 1H1SA 2GCDA 2OFVA 2HXLA 3QTSA 3KK9A 2YM8A 4FE2A 3DJ6A 4YC3A 2HK5A 4XLVA 5EDPA 3TEIA 1OL6A 4BCPA 1ZYLA 3ZXTA 4C4IA 4YC8A 3AC3A 4GVJA 3WILA 3PLAE 3LHJA 4C57A 4CRLA 4CYJA 3GBZA 5EOLA 3MY0A 4F7LA 3MIYA 2PYWA 1BMKA 3E63A 5E4HA 2XB7A 5BYZA 4F63A 4MQ2A 3PWDA 3FC2A 2YAKA 4ZTNA 2UVXA 4DF3A 2WMVA 4FKSA 3COKA 4RWIA 4BTFA 3CJFA 4EOMA 2PULA 3ZZWA 3QX4A 4E6CA 3OXTA 1AGWA 3OFMA 4R7HA 2C3JA 2QHNA 3QQHA 4ANSA 4HVIA 3E7VA 3VW8A 4C4HA 3AGLA 4UB7A 4OAUC 1EH4A 4XV1A 3GFWA 5HE3A 5K9IA 3QQFA 3R2BA 3V3VA 4YZNA 2FSOX 2WEIA 5FBOA 3F66A 1IA9A 2JKMA 3OBJA 4ASDA 1ATPE 4BCJA 4FV8A 2RFNA 3VAPA 4AA0A 2OF2A 5L2IA 4BI0A 3SG8A 3UQCA 4O83A 1Q8TA 3AMYA 5KMKA 2QO2A 2ITYA 1PMNA 2XRUA 5KHWA 3N9XA 4YTCA 2YERA 2X8DA 4FK6A 1RJBA 3KXHA 4TTHB 3ZONA 2ITTA 3DDQA 2X1NA 4IC8A 4ZTQA 4FNZA 3MYGA 3ZDUA 3PSDA 4BCKA 2WU7A 3KFAA 4O2PA 4X3JA 5LMKC 5HNBA 3BWFA 4D4YA 3O96A 2BKKA 4LOQA 5AP4A 4PPBA 4G31A 4FEXA 4EC9A 2W9FB 4PDSA 3P7BA 4FSUA 4KS8A 5GIOE 1UU8A 3NYXA 1U5RA 1T45A 5JGAA 1NA7A 3B8QA 4NKAA 4RRVA 3DQWA 3NUPA 5EQPA 4D2PA 4L7FA 1CMKE 4PL5A 2HZ0A 4MD8E 1UU9A 3HV3A 5EM6A 3WIKA 3G6GA 4NEUA 4F1MA 4JR3A 1FVRA 1ZOGA 3LJ0A 3MVMA 2QO7A 2XUUA 2WTKB 5CI6A 2ZOQA 3HA6A 5EDRA 3RK9A 4MH7A 3W2OA 4D0WA 4YJUA 3RPRA 3FWQA 2W1GA 1Q99A 3PPZA 4BWPA 2R3HA 5HIDA 3WIGA 3DXQA 4O7YA 3BU5A 2ZDUA 4X2JA 5EQYA 3R73A 3LQ8A 4FTJA 4G17A 2CGWA 2WQBA 2Y9QA 4MAOA 3UPXA 4EBWA 4HCUA 4YGAA 4CVAA 2ITWA 2BRGA 3GC8A 5M55A 1Y57A 3D7TB 1NVQA 5DT0A 1BLXA 4XG4A 3C51A 2GS2A 3EOCA 4I5HA 4KIKB 3LKMA 4Z3VA 1OIQA 3KRWA 4JDIA 4I6QA 2X8EA 2JKKA 2CKOA 4GG7A 3VUTA 5FM2A 4FIEA 4FSRA 4FNYA 2PZYA 3VJOA 3CD8A 5CASA 4PNKA 4DITA 3O71A 4EH3A 2WQOA 2R3KA 3ORKA 3DNDA 5DVRA 3V6SA 4AX8A 2QOOA 4IDVA 5AUTA 5JMSA 4RX7A 4DYMA 4UMQA 4RSSA 3ZSHA 2C6EA 4W9XA 5DWRA 4ZTRA 5IA1A 2XEZA 1OL2A 4OT5A 3WF8A 3IG7A 4Z7HA 4WD5A 2H6DA 4GVAA 4LL0A 4C4GA 5FDPA 3DBFA 4ZP5A 3U4WA 5CSPA 1B6CB 3PY3A 2C6IA 5AUUA 2Q0NA 3BYMA 1UNGA 5KZIA 5BVKA 4XRLA 4USEA 3RNYA 1ZYCA 2C6TA 2CCIA 4HCTA 4U5JA 2W99B 4PX6A 2GTMA 3FXZA 2VTHA 5AADA 4GJ3A 3REPA 2G2FA 5GHVA 5J87A 4QRCA 4FG9A 4AT3A 3PA4A 4G9CA 4FKWA 3ZU7A 3QZHA 2XA4A 1PF8A 5B0XA 4MBJA 3ANQA 4U0IA 4D4SA 5HBHA 2W5AA 4OTPA 3MPTA 4QMSA 1JLUE 1URCA 3EJ1A 3TWJA 4PTCA 1WZYA 4F70A 3QFVA 2NPQA 3UOKA 5HE2A 1OM1A 4FGBA 4GU6A 5ACKA 3EN4A 4RJ3A 2VTLA 4IJPA 4FKTA 3ZFYA 3QTWA 4TYHB 5AR3A 1TVOA 4FTMA 4DEIA 2C3IB 5IEYA 4C8BA 3NW6A 3PFQA 3LXKA 2G2HA 3THBA 1H4LA 3V51A 4PMSA 4O82A 5L6OA 1QL6A 3F82A 4E8AA 3PVWA 5IZFA 4PP7A 2XNNA 4FIFA 3DB8A 4Y8DA 2IJMA 4ACDA 3KEXA 4JQEA 3FMJA 3IW4A 2BAKA 2ZAZA 3V5QA 5JEBA 5BUEA 5J7BA 1K9AA 4O7LA 5HCYA 4E4NA 3ZSGA 4EH7A 4HGSA 5AX9A 4X7QA 3LMHA 1MRYA 1KE8A 2F9GA 2ITXA 4M69A 5HO8A 2VNYA 5CYIA 3GU4A 1V0OA 5E7RA 2VN9A 5M09A 4ZSJA 3QA0A 2PMNX 3E8NA 3M11A 5EW3A 3A7HA 3SC1A 2FSTX 3HP5A 3QBNA 4E5WA 5DR9A 3F3ZA 3BEAA 3I7CA 3UNJA 1Q97A 3QALE 4NT4A 4FV9A 5J1WA 4RX8A 4BBEA 4RJ6A 5AUZA 3BIZA 1H00A 3BHYA 4IVDA 1PYEA 3QZFA 3QF9A 4QMLA 5F20A 2C6LA 5AP0A 1YHVA 3T3VA 3WYYA 3PXFA 5HKMA 3OOGA 2IO6A 4FIHA 5CF6A 4IANA 2C5XA 4MNFA 4Q9SA 1U46A 3QQGA 5EHOA 2GNIA 4HYSA 3TNIA 4O86A 2QONA 3R71A 4EQMA 2YCQA 3HP2A 3EB0A 3I5ZA 2PPQA 5B2MA 4IE9A 3P7AA 3TZ9A 2VTNA 2KTYA 5AAFA 3EWHA 5DMZA 3LW0A 2BILB 1X8BA 5EKNA 4OTGA 5CXZA 3UOHA 4O21A 2XM8A 4AFEA 1UKIA 4I6HA 2IVUA 3SA0A 3ORTA 3ORLA 3NYOA 3R63A 5IQCA 2V7AA 3KU2A 4NTTA 5DYJA 2CHLA 2ZV8A 3R9NA 2QURA 4HGTA 3Q3BA 3WYXA 4FTTA 5IMXA 1ZAOA 4WT6A 4E6AA 1Z5MA 2OF4A 5CNNA 4QMTA 2R3JA 3D5VA 5HG5A 3LIJA 2BDWA 2X2MA 4XHKB 3DLZA 4NCTC 5CS6A 3VHKA 4I21A 4RIYA 2PVFA 2WTDA 3G2FA 4XJ0A 1Q8YA 2QR7A 4ALUA 2C1BA 4MWIA 1YWNA 2P4IA 4ID7A 1GIHA 1UV5A 3A7JA 3B2WA 3ZRKA 4IIRA 4M15A 1HOWA 4F9CA 2W1FA 5M08A 2UZUE 3MPMA 2W1ZA 4FKPA 3CIKA 3SV0A 4AA4A 3KC3A 5BX0A 4ENXA 3Q9WA 3WARA 3TI1A 3RWPA 4F64A 1Q41A 5FQDC 5I0BA 4RLKA 4UWYA 5HG9A 2XK7A 3FKOA 2REIA 2BPMA 3NNWA 2QHMA 4FKRA 5LWMA 5ITAA 2E9OA 2YFXA 3KY2A 4JNWA 4C3PA 3LFDA 4Z7GA 3FHIA 3A60A 3BQRA 1W82A 4J96A 4F7JA 2PHKA 1PRYA 3P0MA 5IEVA 4KNBA 4RFMA 4NKSA 3ORMA 5E8YA 4EOJA 2P3GX 4EOKA 2PE0A 2UVZA 2WTIA 5H8GA 3GU6A 3QD0A 4FV4A 2VTMA 4R7BA 4X0MA 4FV1A 4RGJA 4BFMA 3W2RA 1Q5KA 3A2CA 5AWMA 4CLIA 1P2AA 4U97A 3CEKA 4YNEA 4XG2A 1OITA 3QKMA 4ITIA 4KKHA 4ACHA 1ZWSA 3NLBA 3WF7A 1OUKA 5IG1A 3IW7A 2WZJA 3FLNC 3PWYA 4X6RA 5GJFA 4CZUA 4F4PA 5JFXA 1M2RA 5FXRA 4JDHA 4L9IA 1E1XA 2E9PA 4NIFA 1AD5A 2PVLA 4RT7A 2PUUA 3DCVA 2IZTA 4XMOA 2IW9A 3TV6A 4ZSAA 1WBPA 4U80A 1FINA 3ZMMA 3BHVA 3MJ2A 4NYEA 2C69A 3WF9A 4YHTA 4KABA 4YC6A 3VWAA 4MD9E 5AM6A 4AW5A 4CNHA 3EQIA 3EL7A 4BN1A 3R9HA 3RKBA 3GC0A 4CMUA 2HY0A 2C6KA 4KIPA 4FBXA 4KAOA 4J7BA 2HENA 1WFCA 5HD7A 2FGIA 3MH3A 2YLFA 1XH9A 2ETKA 2WIPA 3HA8A 4FSTA 4F6UA 3FL4A 3GXLA 2UW6A 3U9NA 4IJ9A 3R7UA 1IAHA 2CKPA 2VWIA 4BKZA 4LUEA 4S31A 5ANGA 4LMUA 2C68A 3DZOA 4L8MA 5BVNA 3NNUA 3I6WA 4DA5A 5KMNA 4MXZA 5ETCA 1UA2A 5FXSA 4GL9A 4FNWA 4A06A 3OF0A 3LFAA 1KSWA 3CS9A 2BFYA 1CSNA 3G0EA 4GRBA 4CTCA 5C26A 2WPAA 5AR8A 1VZOA 2VU3A 2UUEA 3RK5A 3ORPA 1FQ1B 3OUNB 2WTJA 4WRSA 2P2HA 3GQLA 4M3QA
chains in the Genus database with same CATH superfamily
3U6JA 2JIUA 1CKIA 4U3ZA 2C0TA 1DI8A 1OMWA 3AD4A 4I94A 3TNWA 1VLRA 3GU8A 3CY2A 3TG1A 1PXIA 2DUVA 2XIKA 2W5BA 3V01A 3UDSA 2BMCA 4FSYA 3OWLA 4R77A 5EYDA 2XBJA 4FKQA 3A7IA 1QPEA 3F6XA 3KCFA 1YHWA 4TL0A 4JOAA 3HKOA 3QTIA 4U79A 4NSTA 1G3NA 3QCXA 4EK5A 3NIEA 3NWWA 4UMUA 2OJFE 3D94A 2BHHA 3N4TA 1XBCA 4EOIA 5CALA 1ZOHA 1I09A 1RW8A 2JAMA 3UC4A 4AZTA 4GKHA 2ZJWA 2JDSA 2QR8A 5M53A 2J50A 2JFMA 3MSSA 3QRTA 3QZIA 1APME 4L67A 4QMZA 5AP2A 5I9VA 2X9EA 5LCKA 3NUAA 4C4EA 3V6RA 4IFGA 5CAPA 3Q52A 3COIA 1Y8YA 1FBNA 4N57A 4ZZNA 3GCSA 3DK3A 4NZWB 4O84A 5AUYA 3D5XA 5EKOA 1QPDA 4EUUA 5CQWA 3EQBA 4EOPA 1P4OA 2GDOA 4EONA 4O1OA 1SVHA 4DTBA 3JY0A 3GVUA 5K4IA 4GS6A 3EKKA 4R6VA 2CPKE 1O6YA 3AD5A 4L44A 1SZMA 4NU1A 5D11A 4FK3A 3IOKA 2FO0A 2UZBA 4HYHA 4GIHA 5CTPA 4DEEA 2W1IA 4LGDA 4IC7A 1ZMWA 2CDZA 4EQCA 3VO3A 4IMYA 5BVWA 2IZRA 3E8DA 4M7IA 2YISA 4BDBA 3LFCA 3BGZA 3HRBA 3AC4A 2CCHA 3ITZA 4WOVA 4K2RA 4D2RA 4JJRA 4O7ZA 3E8CA 5CWZA 5A4TA 1O6LA 2JFLA 4D0XA 4E73A 4QPMA 4IFCA 4DFXE 4RVLA 4YHFA 2WQMA 5C01A 4D5HA 5JZNA 3W16A 2VD5A 3V5LA 5K5XA 4QYEA 3S3IA 2X39A 4FIGA 4FKUA 3FUPA 4LGGA 2BCJA 4E5BA 1VEBA 1IAJA 3DJ5A 3FQSA 2W7XA 3FMMA 2OJ9A 3A7FA 5DEYA 3ZCLA 4D1XA 4CZYB 3CE3A 2ITQA 5CSHA 5LWNA 4BCMA 2PUPA 3MV5A 4GW8A 3OD6X 4OTHA 2PY3A 3AMBA 3UP2A 4DH7A 4YJTA 4BKJA 3R8VA 3NUNA 4IH8A 1UNLA 5BYLA 3ALNA 1Q61A 2QOLA 2W1CA 4EK3A 4BCGA 1TQMA 3D14A 5D12A 4H3PA 3R6XA 2YWPA 5L6PA 5A3XA 1BUHA 3KXNA 2QOKA 2C3KA 3ACJA 3CTHA 3ENHA 3MA6A 4HPTE 2W4OA 1YHSA 3LFSA 4LFIA 3LLAA 3KREA 4CFMA 3L8VA 4G6OA 4N0SA 4PPCA 3W2QA 1OPKA 4ZZMA 3MFSA 1TFFA 4FG8A 5HHWA 5HGIA 4WHZA 2YJSA 2YIWA 1KOBA 4MBIA 3KGAA 2IZUA 3V5PA 1YI6A 4TNBA 3RM6A 3QU0A 3PJ1A 2OH0E 2RFDA 3FLZA 4L68A 2XH5A 4QOXA 1VR2A 3RNIA 5LJJA 3G51A 5K4JA 4RJ7A 2CKQA 1LUFA 5EM8A 3W0PA 4FTIA 3QD2B 5GIPE 4FKVA 3DKCA 2QC6A 4BCHA 4P5ZA 3MS9A 3O50A 4QMPA 4UY9A 4CXAA 5HTCA 3NVKI 4YHJA 4MXXA 5FEDA 2YIQA 1URWA 3DXPA 1FGIA 3HGKA 1FGKA 4FTQA 4I5CA 3VS5A 2BUJA 2X81A 1OGUA 2OSCA 3BYSA 4FEQA 2ZVAA 1LPUA 4N70A 2C5NA 4O27B 3QQLA 1Y6AA 3KA0A 3ZBFA 3KMWA 3LE6A 4B0GA 3BE9A 4LV8A 3V5WA 2GMXA 2B9JA 4LRJA 2UZLA 4YZDA 5D10A 3VS3A 4RIWB 4BC6A 4JMQA 3R7OA 4S32A 2WTWA 3Q9YA 3SXRA 3LXPA 4I5PA 4KSPA 2XNEA 4C2WA 4EHEA 4JBPA 4M0ZA 4O0UA 4O7NA 4CCBA 3OVVA 2ZDTA 3SKCA 5M4CA 4QMMA 2NRYA 4XNEA 5IKWA 4CD0A 5LVPA 3PP1A 4EI4A 1WVXA 3P1AA 4EK8A 3U87A 1W7HA 1ZARA 4ZJVA 3IDBA 5CVGA 5HIBA 4L01A 4TZRA 4RWKA 4OTFA 2FYSA 4HGEA 2QU5A 3ZHPC 4CFUA 3R2YA 3LQ3A 4KUJA 4UWCA 2YZLA 2RGPA 2EXMA 5CLPA 5DHJA 1ZOEA 4YLKA 4EH2A 4A07A 4XRJA 2PE2A 3RCDA 2VZ6A 1IRKA 4O7RA 2OJGA 2HELA 3COMA 3EYHA 3QTUA 4WBOA 2BROA 4LG4A 3RPYA 4BYJA 2E9NA 3UQFA 2R4BA 5C9CA 4DLIA 2XJ0A 2DYLA 3ZFXA 2A19B 4PTEA 3IPHA 5HLWA 4GT5A 1GIJA 4LMNA 4DN5A 5KX8A 5FTGA 1BI7A 4FSMA 5BUJA 4FYNA 4G6LA 2J90A 4HNIA 2W1DA 2W96B 1YXXA 2OZAB 2XKFA 5KHXA 4MK0A 4KBCA 3EN6A 3II5A 5CSVA 5IA2A 3UNKA 3HDMA 4TWCA 3W0OA 3SOCA 3EQGA 4CT2A 4DFLA 4BDFA 3A8XA 2XANA 3F69A 1A48A 3HNGA 2VX1A 3A99A 2HW6A 3TTJA 3FZTA 1REKA 4YMJA 4LL5A 4Y85A 4ZOGA 4JT3A 5M06A 3MIAA 4U41A 3TUBA 4JXFA 5KBQA 4C3RA 5IH6A 3CQEA 3KQ7A 3PG3A 2O3PA 3PJ2A 4C4FA 5CU6A 5BQ0A 4ONAA 5IA0A 4PL4A 3Q32A 3L9LA 3SRVA 4GJ2A 3ATSA 2R0UA 1XR1A 3JUHA 5I9WA 3ANRA 4FL1A 4MF0A 3BE2A 4K77A 3R1YA 3CD3A 3IOPA 4LV5A 4HZRA 3N4VA 3QTQA 4MEDA 5ETFA 4O81A 4OT6A 5AFVA 4BKYA 3LLTA 2PVMA 3GOPA 3R7VA 4G3CA 2UZVA 2XCKA 5HI2A 3UVQA 3AQVA 3FQHA 4U42A 2XKDA 2P2IA 4KS7A 4QO9A 4DFUA 5A4CA 5E8WA 4G2FA 4YPSA 3Q4TA 1DAWA 2RG5A 4V0GB 3FY0A 3PY0A 2XJ2A 4JRNA 3DKGA 4RIXB 4X3FB 5ETAA 4FKLA 4MYGA 2BKZA 3SQQA 2C5YA 1Q4LA 3D9VA 3M42A 5HNGA 1GZOA 1SNUA 3L1SA 3H30A 2XEYA 2V7OA 2WELA 3TJCA 4C0TA 4CFVA 3BHHA 2PMOX 5AR7A 2JIVA 4AXAA 4QPSA 1ZYJA 2XIRA 5D9HA 5HX8A 4DEGA 4U45A 3L9NA 4AZSA 3BRBA 2JIIA 4Y5HA 2PU8A 3EMGA 4FR4A 4MBLA 3PSCA 2JD5A 5CSWA 3LZBA 4Y83A 5HTBA 5FG8A 2EXCX 2QG5A 4G5JA 1IA8A 1XBAA 3RJCA 5F9EA 3DTWA 3I0OA 4X6QC 5BV3A 1UKHA 5I4NA 4OUCA 5IU2A 4DG3E 1DS5A 3KMUA 4BDEA 3O7LD 3KVWA 5HE0A 2C0IA 4DH8A 3NAXA 4YJPA 2EB2A 2R3IA 2JGZA 3NIZA 4FV7A 4O7TA 5DOSA 3KRXA 2HXQA 3PYYA 4I92A 2Z02A 3S95A 1YQJA 2G01A 3G0FA 4U3YA 4DH5A 5LCJA 2OXXA 2J0IA 1CKPA 4FZ6A 5IQHA 3MN3A 3N51A 3KULB 4R3CA 2LGCA 3KCKA 2B52A 2NRUA 4ALVA 2BFXA 4ZEGA 2BAJA 3RZFA 3UZRA 1OECA 2WMTA 4S33A 4EH8A 1HCLA 3EQRA 4R1YA 4U43A 5IDPA 1FVTA 3FMNA 3L8XA 3BV3A 5BUIA 3TKHA 3DB6A 3DK6A 3UDZA 4GG5A 1RE8A 3HV4A 5A54A 3UE4A 3DKFA 3C4ZA 4HGLA 5ANJA 5CENA 2XYNA 3H4JA 2ONLC 3UBDA 1JSUA 5AV0A 2X4ZA 4OTIA 2YHVA 4O0VA 4QPAA 4Y95A 3SGCA 3Q53A 3QC4A 2B4SB 2ITOA 5ANIA 2JDRA 4TW9A 2OXDA 3KXXA 4X3FA 1VYZA 4F9YA 5HBJA 5GZ8A 4C2VA 5AR2A 4AT4A 2IW8A 4H1JA 4KRCA 4GK2A 2FH9A 4USFA 4BDJA 5LARA 1J3HA 2P0CA 4I0RA 3NUXA 5CU3A 5J79A 2HZIA 5HLNA 4ZMFA 3GCPA 4IX3A 4IM0A 2Z60A 2X4FA 3QAME 4ANNA 1SMHA 3E7OA 1OKYA 4F1TA 4D4RA 4IZYA 3ULIA 3Q9XA 2J51A 3TIZA 1P4FA 2VWZA 3UIMA 3UYSA 4IADA 2HOGA 3GCVA 3VUDA 3MVLA 1ZLTA 3IECA 4NK9A 4O4BB 4IX6A 3E93A 5E91A 4FICA 3FPQA 4L45A 5FLFA 5J9LA 5KKRC 3VBVA 1WBVA 2F4JA 4OTDA 2RKUA 3UNZA 3NW5A 3DTCA 3DBQA 5D1JA 4I3ZA 4BL1A 1PMEA 4HYIA 3AOXA 4IB5A 4QP9A 5AUWA 1L8TA 4IVBA 3R28A 4TPTA 4PWNA 5ACBC 4RVKA 4EKLA 4UXLA 1GZKA 1XJDA 3NFFB 4K1BA 1W84A 1GIIA 4RVMA 4AP7A 3S4QA 4C62A 1JVPP 3NW7A 5IQAA 4H39A 3GCQA 2VAGA 2F7XE 1R39A 2GHGA 4IM2A 4N6YA 4FTOA 3VBXA 4I1ZA 3FXWA 2WKMA 4ITJA 4A9RA 2HYYA 4D2TA 3OWPA 4M66A 1OIRA 4QYYA 1U54B 2QO9A 3DK7A 4ACGA 2GHMA 3F3VA 3FXXA 4FT9A 4IDTA 4AZFA 2VTSA 3OEZA 3O0GA 4ZJIA 4LQMA 2CSNA 4II5A 5TO8A 4ZY5A 4CKRA 1E1VA 3D0EA 1KV2A 1XO2B 2P33A 1XH7A 2VTQA 2OZOA 3I60A 2WNTA 4MTAA 4AGDA 5J9YA 3R7IA 3OG7A 3OXIA 3CJGA 4OW8A 4DHFA 4M8TA 4D1ZA 4DTAA 5J95A 4B4LA 1WBSA 3P4KA 4W4VA 2J5EA 1ZMUA 2CGXA 3IGOA 3HMNA 4DHZA 5HVYA 2OICA 4RX9A 2XKCA 4BBMA 4BZNA 2GNFA 3NCGA 4BGGA 5EK7A 4WNPA 4FTRA 3A4PA 1XH6A 3FEGA 4YZ9A 1PYXA 5FRIA 2HZ4A 4AXEA 4MX9A 3ORNA 2XK8A 4B7TA 4EOOA 4XG8A 3Q5IA 5DI1A 2R0IA 3U51A 3UIBA 5A4LA 2GS7A 4IAAA 4TT7A 4YJSA 4GYGA 1PHKA 2WTCA 3BQCA 3A8WA 4IZ7A 2WMWA 4CG9A 5AUXA 4CKIA 5IISA 2BIKB 3E92A 1GZNA 2OGVA 3QKKA 4QQJA 3JS2A 3NX8A 3PFYA 2BIYA 5H2UA 2RIOA 2VTJA 2BDJA 4GUBA 2X6EA 4QT1A 5T3QA 4I6LA 2KULA 4BWXA 2Y4PA 5M44A 3ZM4A 3FPMA 4MCVA 3LM0A 3IW5A 4YPDA 3VF8A 3VRZA 4RMZA 2YITA 2X0PA 3K3JA 2VWYA 3BV2A 5C4LA 4K18A 3H0YA 4YUQA 4XS2A 5C8NA 4MXOA 3VHEA 5DRBA 4X2NA 3QGWA 4FTKA 5AEPA 3VUMA 2ZB1A 4IEBA 3V8TA 5E1SA 2I7QA 2C5VA 3FJQE 3QRIA 4RG0A 2XIYA 3D7TA 3BLRA 2HWOA 3QQKA 4IQ6A 5DA3A 1U54A 1WAKA 3Q6WA 3SXFA 4JL9A 2UV2A 4JLCA 3UOJA 2NP8A 4KIKA 2R3MA 3DDPA 1DAYA 3MJ1A 4XG3A 4ZTLA 4QNYA 3HMOA 5LVLA 4CGAA 3IS5A 2UZOA 2WHBA 4FUXA 4I6BA 3FMLA 2VX3A 2OU7A 4HZSA 2QD9A 4HPUE 1YDRE 3HL7A 3EHAA 3R22A 4J71A 2R5TA 3A61A 1FMKA 5HO7A 5BVDA 4OLIA 3UG2A 2OJJA 5KMIA 3KN5A 3TCPA 2RFSA 4MNEB 1H1RA 5FGKA 1W8CA 1XBBA 4XYFA 3SAYA 4FV5A 4FYOA 3OBGA 4O4DA 1JQHA 4L43A 2B7AA 2EB3A 3NYVA 4OTQA 4QYFA 3TUDA 3R8MA 3TDVA 4M14A 1OKWA 5CF8A 4WSQA 3RAWA 3DFCB 2H8HA 1J1CA 3FLYA 3QUPA 5IQBA 1YXTA 3Q6UA 1Q8ZA 3QQJA 3EYGA 2QOBA 5K0KA 2P55A 4GU9A 3VS2A 3VBQA 5CEKA 5CX9A 1Q8UA 1H27A 4AAAA 3LFFA 4U7ZA 5AUVA 2W05A 5M4IA 1V0BA 5DH3A 3SW7A 4QP2A 4MWHA 4K0YA 4YZCA 5CT7A 5HICA 4FEWA 5E1EA 5IQDA 4O96A 4BCNA 2FSMX 1YXSA 5HIEA 5JT2A 1ERKA 5DFPA 3VBYA 4CFXA 5AA8A 5I3RA 5KCVA 4FZ7A 2G2IA 2ZM4A 3BWJA 2X0OA 4XEYA 3BKBA 4TYHA 4TRLA 3OC1A 4O0YA 4BDHA 4MF1A 2EUFB 3W8QA 5CF5A 2XP2A 2XCHA 5IA5A 5C27A 2J6MA 2CNQA 5JGBA 2XK3A 3V5TA 4C58A 2BVAA 3RM7A 3K5VA 3I6UA 4D1SA 2GU8A 3MFTA 4P4CA 3R8ZA 5AR4A 2Z2WA 4JIAA 4A7CA 3W0NA 4IW0A 1WVYA 1CDKA 3RWQA 3EIDA 3PDTA 4RC3A 4Y5QA 4Z55A 5M07A 5CT0A 1H0VA 3CP9A 4QP8A 3MDYA 1DM2A 5FTOA 2WMRA 3BLQA 1U4DA 3RPSA 2FB8A 3GCUA 2JEDA 3T8OA 2B54A 4U8ZA 2IWIA 3KMMA 3HAMA 3ZUUA 4BGQA 2CN8A 2AUHA 4C38A 1U5QA 2OXYA 2W1HA 4AE9A 2YACA 1Z57A 5CEIA 3GT8A 4I4FA 4RFZA 4A9UA 3PVGA 3NUUA 3C0HA 1BX6A 2UW3A 3KXMA 4DG0E 4IAKA 4GFOA 4FT5A 2B1PA 4O22A 3HECA 2XVDA 4DCEA 1PXJA 4PL3A 2UZNA 4IAYA 1QMZA 5CEOA 3UJGA 4O0TA 1H1PA 1G8KA 4YZBA 3KVXA 4S2ZA 4BICA 2XYUA 5B2KA 2YIYA 3PIZA 3ATTA 2Y0AA 1CM8A 3OW3A 2ESMA 5AP7A 4ERKA 2BR1A 4YP8A 3ZEPA 2WMUA 5GNKA 4G3FA 4LYNA 4XG7A 3PXQA 4R5YA 1YWRA 5EM5A 4O7WA 5CSXA 1R0PA 3R8UA 2ZM1A 4FVQA 4JI9A 4YBJA 4BI2A 4FJVA 2PMLX 3TL8A 4F6SA 3ID6C 3E3PA 1GOLA 3DT1A 3QCYA 2AEGA 3F5GA 4L46A 2C47A 4AN2A 3FAAA 3RHXA 1OL1A 5A46A 2O63A 2AYPA 2C3LA 2J0KA 3NCZA 3WZEA 4XBUA 3ZSIA 4G16A 2ETRA 4FEUA 3EQHA 2OW3A 3HEGA 4YTFA 2YM4A 3ODYX 4AWIA 3K2LA 4I5MA 3QTXA 1Y8GA 4AZEA 3PA5A 2BZKB 3QUEA 2YM5A 5HORA 3EQCA 3VBTA 2VWWA 3RBWA 2HCKA 2Y8OA 3TNPC 2WQNA 3W0SA 5EG3A 5A9UA 5E8ZA 5G6VA 3FI2A 2G15A 1CKJA 4ANOA 2PVRA 1GJOA 2FUMA 2PTKA 3R01A 4X21A 4R3PA 2OJIA 2JKQA 3D83A 4EZ5A 3BHTA 4MKCA 3OS3A 5BNJA 2PE1A 4TXCA 3TACA 4AXFA 5IMEA 3B8RA 3CQWA 3W55A 1XH4A 2ITZA 2YIRA 4RZWA 2PZRA 3UQGA 3VUGA 4RWLA 5M4UA 4JR7A 4JX3A 4DAWA 3P7CA 4GCJA 5J8IA 3HRFA 1IG1A 1W83A 2YIXA 1OPLA 3EFLA 3C4WA 4IB3A 4NTSA 3WF5A 1KUTA 3QCQA 3CY3A 3H9FA 1J7UA 3VS0A 4FX3A 3E87A 5L2SA 3KL8A 2B9IA 1K3AA 3VS6A 3I1AA 1MUOA 2PVNA 4FODA 4NW5A 5T68A 4DBNA 2NYAA 1RDQE 3DBCA 4DG2E 1Q8WA 1ZXEA 3NUYA 4ZTHA 5K3YA 4RIOA 3ERKA 3SHEA 4C37A 2VX0A 4ZXTA 5F1ZA 3OUKA 3POOA 4FMQA 2I1MA 5CU0A 2GQRA 2WQEA 5HNIX 1S9JA 4GEOA 4P90A 3ZC6A 2VWUA 3OXZA 3GP0A 3NPCA 5A4EA 3AD6A 4GT3A 3DLSA 2GTNA 4EWHA 2BRBA 4WG5A 4ZK5A 3RP9A 4HYUA 2YWVA 3VF9A 2EXEA 3VJNA 3QZGA 5HTIA 3IGGA 4UMTA 4DFBA 3C5IA 1OUYA 1XH5A 3MBLA 4BCOA 5IUIA 3DY7A 4O2ZA 4EH6A 5GZ9A 5H8BA 5AM7A 3AC1A 4JAIA 3UIUA 3E64A 3QXPA 4ACMA 4O91A 4AW2A 4ZLOA 3BL7A 1LEZA 5LOHA 5JN2A 1XHAA 4E7WA 4EH5A 1NT2A 3KKVA 3R21A 5TE0A 3ACKA 1M52A 3ZLYA 5FEEA 3CC6A 4Q5EA 3U4UA 2QODA 2YDIA 5T6KA 2ZFYA 4RQVA 3NNVA 2BHEA 4D55A 5HCXA 4G3DA 5HX6A 4UV0A 4ZIMA 2NO3A 3I4BA 4I0SA 2GFCA 4FTCA 2PVYA 3K54A 4F0FA 1G8JA 3MTLA 4F0IA 4JG8A 2YM3A 1OB3A 3MI9A 5EI2A 4MXCA 3G15A 3EFJA 3NR9A 4PDPA 4E6DA 4EHVA 2OG8A 4LUDA 5B2LA 2Z8CA 3R30A 5ANOA 2UVYA 1PJKA 3F5UA 3TTIA 4HNFA 4EORA 3P5JC 2PUIA 2GHLA 3F3WA 5D7AA 5DPVA 4I23A 5HOAA 3RCJA 5KMOA 2XS0A 4U9AA 5EYCA 3TKUA 2XAMA 3DPKA 1H8FA 5CANA 1MRVA 4M13A 5I9UA 4WUNA 2HWPA 5L6WL 3BX5A 3PLSA 3VS1A 5KBRA 2YZAA 4AXDA 3UZTA 3OTVA 2YA9A 4X2KA 3TUCA 3PA3A 2UZDA 4R1VA 3O8UA 4KKGA 4IWDA 4PF4A 5ANKA 4X2FA 1JKKA 2E9UA 1PXNA 2UZEA 3FYKX 4BCIA 4FIIA 4D2WA 3HLLA 5BMSA 3A4OX 2YLEA 4G6NA 3Q4CA 4DEDA 4EUTA 3C7QA 3LMIA 3RGFA 5DGZA 2WIHA 2RSVA 3QRJA 4V05A 4RJ8A 3V5JA 4R7IA 4BGHA 3WZKA 4IHPA 4CFWA 3R1QA 3KB7A 4HVDA 4NWMA 3TV7A 2CGUA 2GNLA 4J8NA 4JG7A 4FKIA 2VGPA 3VUKA 3FQEA 3RMFA 4AE6A 2V22A 4EQUA 3RINA 4ARKA 4PP9A 1W2CA 2VTRA 3FV8A 1LP4A 2BZHB 3KK8A 3BZ3A 3LQ5A 1M17A 2YN8A 3ET7A 5AR5A 4QDEA 4ZLZA 4DHIB 5LVMA 5IA3A 1OIYA 2VRXA 3MY1A 3ZUVA 2J4ZA 4BTKA 3ZDIA 4BDCA 5J5TA 3HX4A 4FZFB 2ITUA 4NFNA 3DA6A 3VS4A 5CEPA 2VWVA 3D5WA 4J99A 4F9WA 3W0MA 1H1WA 3SXSA 2JBOA 4ZMEA 3R1SA 5CEQA 5L3AA 1STCE 4AOTA 3TNHA 3DBEA 4IVCA 4AT5A 4WSYA 3AGMA 3C13A 3G9NA 2FVDA 2I0HA 2F7EE 2XNOA 3EQDA 4MHAA 5CEMA 1UU7A 5FDXA 5LXMA 1J7LA 1NW1A 4OGRA 3LXNA 5A4QA 3L8SA 5I5ZA 4AQKA 5EHLA 5L8JA 3P23A 3R9DA 3U6HA 3UO5A 1PMVA 3OCGA 2X0GA 1JAMA 4BHZA 2O2UA 3DXNA 3GB2A 3LM5A 4QTEA 5M57A 1ZYDA 5TF9A 1YWVA 4GH2A 3IKAA 3ZO2A 1SVGA 5CQUA 3EN9A 4BTJA 5FBNC 3HMIA 3PJ8A 5CVFA 3SLSA 4EYJA 5JFWA 3UPZA 4I6FA 5M51A 1YOLA 5IH4A 4TWNA 4DEHA 4R78A 2OKRA 4HCVA 2CLXA 4KBAA 3DJ7A 4N4SA 4M0YA 4ZTSA 4M67A 5EM7A 2ZMCA 3QLFA 2ERKA 4PUZA 3NDMA 2X8IA 3IQ7A 4XV9A 4EBVA 3TYKA 4EKKA 3R02A 4CSVA 2C6OA 5C8KA 3QKLA 5HU9A 4JAJA 3UZPA 2O5KA 3FLWA 4NFMA 4U6RA 5AP5A 4IAIA 4DCAA 5FXQA 4PMMA 4EK6A 3F61A 3ZFMA 3JY9A 1OGYA 4QQCA 1CTPE 2WMAA 3C4EA 4OAVB 2GQSA 4O4FA 5FTQA 4FSQA 4JS8A 3RPOA 1JSTA 4FIJA 4YSMA 3RAHA 4E4XA 1H07A 1AQ1A 2SRCA 4RC4A 4CZTA 4DH3A 4EYMA 4BJJB 5IQIA 3ROCA 4UMRA 5F94A 3R83A 4Y73A 2J5FA 4KBKA 4QP7A 4PQNA 3EN7A 4YURA 4RIWA 2VV9A 2W4KA 3F5PA 5J7HA 3RPVA 3CGOA 3H3CA 4D9UA 2GFSA 5L2TA 1QCFA 4DE4A 3WI6A 4BDAA 3OT8A 3PE2A 4XP3A 3HUCA 3EQPA 4UEUA 3LXLA 4BCFA 5CAVA 2OIQA 5FEQA 4RBLA 3UTOA 3HV6A 2ZYBA 4QD6A 1VJYA 3CKWA 2XK6A 4ZZOA 5IA4A 4WUAA 3QYWA 3AMAA 3UMXA 4DBXA 3PY1A 3TNQB 4AXCA 3LCKA 4U81A 3IDPA 3Q9ZA 2H9VA 2PVJA 3H10A 5HBEA 3O5AA 3M2WA 1V0PA 3W0QA 4FZAB 3CBLA 5I9XA 4GIIA 3RAIA 4AF3A 3P08A 4WNOA 1OVEA 4F99A 4LRKA 3OHTA 4U44A 3ETAA 5C4KA 4L7SA 4C7TA 1PXLA 3E88A 3ZC5A 3IDCA 5K5NA 2I40A 4DGOA 4BR3A 3CPBA 2QLQA 2HW7A 4UALA 5DR2A 5AV2A 2DS1A 4K11A 2VWXA 4XG9A 3FL5A 4MVFA 1PMUA 4MXAA 2CMWA 4W8DA 4RJ5A 1IR3A 4QP4A 3SVVA 3W2PA 5HESA 3ZTXA 4HW7A 1H01A 2A2AA 3LCOA 3OP5A 3GGFA 4FSWA 2CLQA 5DR6A 5K0XA 1H1QA 4HJOA 4AS0A 1T46A 2OZAA 3RVGA 5KKRB 2WOUA 3I7BA 2H34A 2QU6A 4IACA 1MRUA 3BELA 4RQKA 3PXRA 3QHWA 4WBBB 2BTRA 2C4GA 1UU3A 2OO8X 4BDKA 3PRIA 4UYAA 1SYKA 3FYJX 3O8TA 4YSJA 3R1NA 4QMUA 1NVRA 4IWOA 5J5SA 3MVHA 2HZNA 4FT0A 1YKRA 3PVUA 2JKOA 3QRKA 4FSNA 4K9YA 4YLJA 4PY1A 4DFNA 3FMDA 3RTPA 1J1BA 3L8PA 3ZUTA 3DGKA 3TDWA 4FV3A 3UIXA 3VNTA 3HAVA 3OT3A 4Y46A 2QOQA 3W18A 3WOWA 4JQ8A 3ZBXA 3U54A 3W2CA 5JSMA 2I0YA 4F09A 1WBNA 2V5QA 3MGYA 4AZWA 4XP0A 3R8LA 3D4QA 1Q3DA 3Q2MA 2WD1A 4OBQA 1BYGA 4FC0A 4JRVA 3RAKA 3GQIA 3TKIA 3LCSA 2GQGA 1R78A 5HQ0A 3FHRA 3QTRA 1A9UA 1W2FA 4JVGA 4O0XA 2I0EA 4KINA 4J52A 1WCCA 4D28A 2C30A 2VUWA 1H28A 4JIKA 4YTHA 3ALOA 4GYIA 4UMPA 4P5QA 3WZDA 4Q9ZA 3W1FA 4QMNA 3AC2A 5IUHA 2BRHA 3H9OA 4QTBA 5KZ0A 3POZA 2VTPA 4XOYA 4OTWA 3QL8A 4WO5A 4AOIA 4HVHA 1F0QA 4W4WA 4V0GA 3CTJA 4LOOA 5CNOA 4RIXA 1I44A 4I41A 3BU6A 4HVSA 4P2KA 2OWBA 4S30A 2IVSA 3C0IA 1UNHA 5KUPA 5CZHA 5C1QB 4QYHA 3R7GA 3KRJA 3UG1A 4YJVA 2WXVA 4FT3A 4B8LA 3T3UA 3MB7A 3R9RA 3FMEA 2A27A 3LJ2A 4PV0A 5LMKA 2XK9A 4NJDA 4DGGA 4ZY6A 3NZ0A 3TMOA 3JR1A 2PSQA 4H3QA 2XAOA 3Q4UA 4AQCA 3R0TA 4M68A 4V04A 3BU3A 4PRJA 4K8AA 5AIRA 3VUIA 1LEWA 4ASEA 2XZSA 4C02A 3S00A 3GOKA 2C0OA 3ZLSA 3FDNA 2UW9A 3C5UA 4LI5A 3SX9A 3C50A 4YTIA 3ZOSA 4DGNA 3DU8A 2ZMDA 5AP6A