5DRBA

Crystal structure of wnk1 in complex with wnk463
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
273
structure length
273
Chain Sequence
TKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKAVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase WNK1
publication title Small-molecule WNK inhibition regulates cardiovascular and renal function.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 84
structure length 273
sequence length 273
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5drbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5drbA01
5IQEA 1H08A 4Y5QA 2QODA 3EL8A 4IWPA 2CSNA 4DYMA 3DNDA 2VD5A 2E9NA 3AT4A 1H28A 5HIDA 4QP9A 3OXIA 4E6AA 4BIDA 2B54A 4FKLA 3SQQA 4G6LA 3WIGA 4F65A 5A6NA 3SG8A 3F5PA 2CKOA 3ZLWA 4NK9A 2FGIA 2H96A 3EQBA 4O38A 4HVSA 5IMXA 5FBOA 2YDIA 4FBXA 3QTIA 3BIZA 1OM1A 2BDJA 3RPOA 4O7ZA 4LMUA 2XIYA 3KULB 1TQIA 3TEIA 3TIZA 3QQLA 5A54A 3EL7A 3F61A 3C4XA 3SOAA 3R7EA 3QQFA 2WMTA 4XG6A 3HX4A 4O7YA 5IDPA 4HYIA 1PXLA 3HYHA 3MPTA 4FKOA 4IC8A 4MXXA 4TRLA 4XV9A 4J8NA 1GY3A 2YFXA 4I92A 4Y8DA 4AOIA 1NA7A 1UNLA 4L01A 2ZOQA 5ITAA 2VTOA 4NW5A 5IQIA 4RQKA 5DRBA 4L67A 3SW4A 1G8AA 3OWKA 4AFJA 3VQUA 3TNPC 4X3FC 5CQUA 1OL2A 3MIYA 4QQ5A 4CLJA 1YXUA 4QYGA 4RA4A 5EI8A 5K3YA 4BCMA 2YAKA 4BWKA 4EWQA 5KKRB 3ID6C 4IZ7A 5I0BA 3WZJA 4MNFA 1JNKA 5HE3A 2YITA 3DCVA 1Y8GA 3PVBA 4N0SA 3LFAA 3NW5A 3NVMB 5I4NA 2VTLA 5EG3A 4XLVA 1YI4A 4OBOA 3C4ZA 1LPUA 3JR1A 4R78A 4NEUA 4JDJA 1UU8A 3B2WA 2YDJA 3THBA 3BBTB 4C02A 2Z7RA 3OCGA 4YURA 4N70A 3FUPA 2NRUA 4YJVA 3OT8A 5AWMA 4MQ1A 3CY3A 4MK0A 2JAMA 4RIWA 4DITA 2PUNA 3RKBA 3U55A 4C0TA 3MA6A 2WU7A 4L3PA 3GC0A 1ZOGA 3V5JA 4XG2A 4F64A 4AGDA 3RZFA 4B8LA 2G2IA 3PPKA 3ODYX 4IWDA 2C5VA 4UN0C 3NEWA 4JBOA 2C0TA 2R3QA 2WTVA 3DJ5A 4U81A 5CEQA 1U59A 3BE9A 2IVUA 3ORKA 2BFYA 2Y7JA 2CGWA 3R9OA 3QD4A 5GJDA 1O9UA 2OIQA 4K18A 3W16A 3CBLA 1MRUA 2R0UA 5DR6A 4E93A 1JQHA 2YISA 2GNIA 2BROA 3SHEA 4QTDA 2W1GA 5HU3A 4F6UA 2X81A 3OD6X 3R01A 5EDRA 5ETIA 4QYFA 2HZ4A 3NS9A 3ZBXA 2GTNA 4BTMA 4LGGA 4BCOA 2ITVA 4XV1A 4G5PA 3VBTA 3FWQA 2XS0A 5EH0A 4X21A 1H1WA 3EB0A 2UVYA 3D94A 3MVLA 3UVQA 4TYJA 5AIKA 3HP5A 4MF0A 2RG5A 3H4JA 3CQUA 4FOBA 4RZWA 2WAJA 4CT2A 3SG9A 2EVAA 4I5CA 4AZSA 4MHAA 5EI2A 3GC7A 3S4QA 4IXPA 1RJBA 1NXKA 2PSQA 1J7UA 2Y9QA 3JYAA 4RJ7A 2G2FA 2X2LA 5J9LA 4ASDA 1WBWA 5CXZA 3TTIA 3VO3A 4U41A 4KIKA 3GI3A 3QTRA 4AOTA 4FSUA 4FIIA 3AQVA 3HV3A 3VC4A 3GOKA 4HPTE 3TNQB 4BDAA 4F7SA 4JAIA 3L8VA 4O83A 1YXTA 3CQEA 4GU9A 1P4FA 4JI9A 5L2QA 3QL8A 3DOGA 3W32A 2PZYA 4AT5A 3PLAE 2C6EA 3MFRA 4YJUA 3AG9A 4KIKB 2PZ5A 3UTOA 4RWKA 5D11A 4QMWA 3OEZA 2QG5A 3C50A 3PUPA 3UQCA 5TKDA 3VUMA 3L1SA 2PVHA 4CT1A 3FMDA 4ANLA 2B9FA 2BR1A 2WIPA 3CJFA 4C57A 3PIXA 4I1ZA 5CF5A 2J0JA 2X2MA 3NRMA 3FV8A 4IJ9A 3R73A 4I94A 4D9UA 3TJCA 3O50A 3PSCA 3FQSA 4NT4A 4AN9A 3O51A 1HOWA 2W1CA 4QP1A 4BGHA 3KU2A 1SM2A 1Z9XA 2OIDA 3JS2A 4IX5A 3SW7A 1ZOHA 1G8SA 5M06A 5GZ9A 1E1XA 4ONAA 4BCGA 2J0IA 1WBNA 4N6YA 3RMFA 5IQBA 2PL0A 3CD3A 4WD5A 3LM0A 2VTMA 3H0YA 3VRYA 3NCGA 4D0WA 5IISA 4CD0A 2OWBA 3KGAA 4MD9E 2BAJA 3W18A 3LJ0A 2W9ZB 4TNBA 3MTLA 1H27A 3D15A 2ITPA 5BVKA 4BY9E 2PVRA 4NTSA 5ETFA 5HX6A 3AMAA 3E7VA 5CQWA 3TXOA 4X2FA 2H6DA 3E64A 1DI8A 2XZSA 4KNBA 2YERA 3D83A 2C4GA 3EQGA 5AP2A 4GL9A 2YIRA 4XHKB 5J8IA 5BYYA 2I6LA 2PVFA 2HENA 3QF9A 2XVDA 4FTIA 1HCLA 3RNIA 3MY5A 2OU7A 2WIHA 4O0UA 5EI6A 1XH7A 2GHGA 2BZKB 4IBMA 4JBQA 4FT5A 4AUAA 3DKCA 4BDCA 3ODZX 4DGLC 3WF7A 3S00A 5C01A 2JIVA 2XK6A 1OL1A 5A4LA 5BMMA 3QA8A 4U5JA 5IKWA 3DV3A 3MB6A 2JBPA 5C03A 4LOQA 3U4UA 3P08A 4RJ8A 5HE0A 5IG1A 3UIMA 3KXMA 5CAUA 4L68A 3V04A 2BVAA 1Q97A 5LWNA 1OI9A 4GFOA 4HJOA 3EZVA 3PJ1A 2C5XA 3UO4A 5JFSA 4A9RA 2PUIA 3FMMA 5EQPA 2P2HA 4AGUA 4FV4A 4RIXB 2WMUA 1UKHA 2VTAA 2BUJA 4UALA 3U6HA 2YCQA 3H30A 4F7LA 1Q41A 4MBIA 4PP9A 3A4PA 1Y6BA 4FNYA 2BCJA 2G9XA 1FPUA 5CU3A 3RPVA 4EOSA 3ZCLA 4PNIA 4JX7A 1FINA 3BEGA 3O8UA 2JDVA 4KBKA 3RAHA 5JKGA 2NRYA 2PWLA 3FKOA 4ERWA 4L46A 5GZAA 4YJSA 1XH6A 5BVFA 2UUEA 2P0CA 4YLKA 1JPAA 5EKNA 2GHMA 3BLHA 3PYYA 4IAKA 5DH3A 1WBVA 4FEQA 3CPBA 2BRHA 4WSQA 1IASA 2HW7A 4YZNA 4IVDA 3NVKI 3PLSA 4I0RA 4JIKA 4L3JA 4RLLA 5DBXA 2Y6MA 3SKCA 4EHZA 3N4VA 5M55A 4F0FA 3GB2A 3CQWA 2WMBA 4TT7A 4ZSLA 4JRNA 3FPQA 2YN8A 1OPKA 5G1XA 4M69A 4EK5A 1HCKA 2VNWA 3ZH8A 5HLNA 5DEWA 1IAHA 4QTAA 3HMPA 2JEDA 3KA0A 4APCA 3A8XA 4KS7A 4IAFA 1OITA 1LEWA 4U45A 4OAUC 4FUXA 4OBQA 2XIRA 4BF2A 4CTBA 2R3GA 4U0IA 1V0OA 1IR3A 4CV8A 4BDGA 2QR8A 4N57A 3ZU7A 4S30A 1ZZ2A 5CT0A 2Z02A 2X7GA 1JSVA 2BIKB 3F7ZA 3QZFA 4D2PA 2IVTA 1ZYDA 4O7NA 4AACA 5FUTA 3CTHA 2GNLA 3HAMA 3VS1A 5FRIA 4DINA 4CQGA 1P4OA 4HGSA 3RM7A 5HG8A 4GMYA 1W84A 1SMHA 3SX9A 2XUUA 2XKEA 4PRJA 3ZFXA 3LMIA 5L2WA 2QCSA 3D2KA 5HG7A 5EW3A 3G9LX 1Y6AA 2W7XA 1KE9A 5DLSA 5LVMA 2PVYA 1R1WA 3K3IA 1MP8A 2QOFA 2Z7LA 3KB7A 3HRBA 2WQOA 3DXPA 2XEZA 4CFUA 3RWQA 5HD4A 2UZOA 5J79A 3ZO1A 3ORIA 3UZTA 4Q2AA 3G9NA 3AMYA 3QQGA 4EOOA 3V3VA 4KRCA 2X0GA 3AMBA 4NFNA 3T3UA 4YLLA 4MNEB 2FSMX 4C37A 4NYEA 1J7IA 3KXHA 4B6LA 4EKLA 2F7ZE 5AM6A 3WYYA 4UY9A 5CU2A 2UW8A 4ZZOA 4EEVA 5HVJA 1OBDA 3EN7A 5TT7A 4DH3A 4GW8A 2AYPA 1DS5A 4P2KA 1JWHA 4EK4A 1P5EA 5HE1A 4ANOA 4QD6A 2VGPA 3QYZA 4O0YA 3DT1A 3R9DA 5BYZA 2UZTA 1RW8A 4C4GA 4BDKA 2PK9A 3KN5A 1JVPP 1A06A 3OZ6A 2HWPA 4CZTA 4V01A 5EDPA 4EK6A 4W4VA 4ZXTA 1OL5A 3KMMA 3OUNB 3MH3A 3RALA 4E5BA 3I0OA 3MVMA 2GQSA 1GNGA 4EH6A 4YZBA 3FJQE 4OGRA 4C61A 2RL5A 4U79A 4PMPA 2I0VA 4FIHA 4I4EA 4L52A 3DBDA 3KMWA 2YAAA 1SZMA 4Y83A 3F66A 3GOPA 4G5JA 4YJOA 1ERKA 5HHWA 4X3JA 3SD0A 4I3ZA 4BCPA 1U5RA 1Q8YA 4EHVA 2X1NA 4XOZA 5DN3A 4R7HA 5CU0A 5C8KA 4LV5A 5CWZA 4YTCA 3HUCA 3TKIA 3C0GA 3MI9A 3W2SA 5AP6A 3EFKA 3JY0A 5L6OA 4IZAA 5IH5A 4NTTA 2HIWA 5HESA 5FTGA 2J50A 4NH1A 3FMLA 5I9VA 3HAVA 3UC4A 3VJNA 1PJKA 4H39A 5HE2A 4ID7A 3TZ8A 3EN9A 3CKXA 3TNWA 3ZC5A 2RGPA 4LV8A 4W9XA 3AC2A 3ULIA 2BAQA 4MBJA 4FK6A 1WBTA 5C8NA 4IM2A 3M42A 5F9EA 3QCYA 3EH9A 4YMJA 4DEDA 4IAZA 4BYIA 1UWJA 3ORPA 1XBBA 3L8XA 4TYHA 4IAAA 4ACCA 4RFZA 4OTQA 3M1SA 5BPYA 4PDPA 3LVPA 3LFBA 4QMXA 4QO9A 3UBDA 3ORXA 2QC6A 4ASZA 3WI6A 4IB5A 5LQFA 5HNBA 3OW4A 2C6OA 3DKFA 2IW9A 2PTKA 4JJRA 5EHOA 3KK8A 2R3HA 4D2TA 2BAKA 3FDNA 4KKGA 4FTOA 4QMVA 5JSMA 3VHEA 2J5FA 5C4LA 2ZV9A 1QPJA 5I9WA 4FODA 4LMNA 3EQPA 4S2ZA 2B9HA 2RSVA 3VHKA 2X7FA 2W4OA 5KMOA 4L45A 4YJRA 3FYJX 3ZLYA 3AT3A 4XG8A 2JDRA 2PZIA 3A99A 3BHYA 3WZEA 3SRVA 3P7AA 3PA4A 2XNNA 2OZAA 3LCSA 3R2BA 5HIBA 1BL6A 1UV5A 3JVSA 3OBGA 4ALWA 4L43A 2W99B 3KCFA 4FL1A 5DMZA 1YOMA 4RFMA 3I7BA 1XJDA 4R3CA 5HD7A 2OGVA 2VRXA 4UB7A 3LCOA 3N4UA 1JBPE 2HZNA 2J51A 4EWHA 3WZKA 5AV4A 5LVNA 4P5ZA 3BCEA 5DOSA 3JXWA 3TV7A 5B2LA 3LFCA 4GK3A 5IA1A 4FTUA 5FG8A 5D10A 3ZEWA 4C58A 2FH9A 2XNGA 4AFEA 2BHHA 5CALA 4M13A 4EK3A 4M3QA 3HECA 3PG1A 4YHTA 2X6EA 2WTWA 4B9DA 1WBSA 4K6ZA 4O86A 5HBJA 5D41A 4C4HA 4RJ4A 3HV4A 5DVRA 4EJNA 5KMNA 2UZLA 3QTQA 1Q62A 3I5NA 3TT0A 5CAPA 4GS6A 4FZAB 4IADA 4W4XA 2VV9A 3ET7A 3FC2A 3IONA 4TY1A 2QOKA 2PVMA 4LG4A 4XRJA 4FIGA 2C5YA 1L8TA 3NUUA 3FI3A 4U40A 1W83A 4H05A 2OLCA 2R7BA 4CG8A 2WGJA 2R3MA 3WIKA 4JDHA 4AW0A 3P7CA 4KWPA 2G1TA 4O27B 4RT7A 5DR9A 3PPZA 5DT3A 4DT9A 3KK9A 4W4YA 4DH7A 2P33A 5T3QA 3OWJA 4LRKA 4B7TA 5IEVA 4JLCA 5HG5A 3UOKA 3E88A 2RFDA 2HYYA 5F4NA 3IDBA 2VTJA 3AXWA 4TNDA 4C33A 3C0HA 2C30A 4EK8A 4PMTA 4WSYA 2NPQA 5L2SA 2P2IA 3V8WA 1M14A 3TUCA 3LAUA 2XK7A 3LFNA 4TKSA 3Q2JA 4XCUA 3PP1A 2QD9A 2QOLA 3WF6A 2WTKB 3QC4A 4CZYB 4CSVA 5AAEA 5HVYA 4FSNA 4L9IA 4RPVA 4MXYA 2ITZA 3ZSHA 3BHTA 2HY81 4MXAA 5JN2A 3HDNA 4G2FA 3I4BA 3OC1A 4PDSA 3LCTA 4JT3A 2CKQA 3SA0A 2I7QA 3V8TA 4RX8A 3HMOA 3RAIA 1KE8A 2VAGA 1H1QA 4D5HA 2WMRA 4CFWA 4ANMA 4O7LA 2G2HA 5JT2A 3AT2A 2GQRA 4L8MA 4U42A 3EIDA 5DGZA 4IHPA 1GIHA 3RAKA 2VWXA 3SGCA 1PXIA 1REKA 4H3QA 5CVFA 4KBAA 4CKIA 4FA2A 4AS0A 5K4IA 4L3LA 5GHVA 3V5LA 2FO0A 2JAVA 4A4LA 4S33A 5IUHA 3UVRA 5CTPA 2PZPA 3ZXTA 3F3ZA 3EKNA 3MJ2A 3IQ7A 3UMWA 4DC2A 3OMVA 4ZK5A 4U8ZA 1YHVA 5E8WA 1IAJA 3E5AA 2WKMA 4O1PA 3REPA 3F2RA 1R0PA 4GCJA 5LXMA 1QPCA 4FTJA 4ZJJA 1H1PA 3E92A 3PSBA 4C59A 4QMMA 4PDYA 3ORZA 1ZY4A 3R1SA 3ROCA 5HORA 4FG9A 4G9CA 3EQDA 2Y8OA 3F6XA 3VUTA 1LEZA 4S34A 4Z3VA 4DH8A 3R0TA 4DEGA 3TACA 3VUIA 3L9LA 3F3VA 2Z7QA 4QP2A 2BMCA 4XH6A 4KABA 3ZS5A 2PPQA 1BYGA 3V5QA 3SVVA 5B7VA 5ANIA 1VJYA 3BLRA 1P14A 3CCNA 2ETRA 4FV8A 4RQVA 3GCVA 4QPMA 3DKOA 5HO8A 1XH9A 3ZRKA 2YACA 2EB3A 2ONLC 2XRWA 4BZOA 4BWXA 1LP4A 2X6DA 4I0SA 5CZIA 1VEBA 3KL8A 5FLFA 3V51A 3ZBFA 4TL0A 4RWJA 5J9ZA 2VTPA 3ZMMA 4EORA 5FTOA 3B8RA 4B8MA 3CTQA 4YNOA 3QTSA 3MWUA 3PY3A 3MB7A 5G6VA 3CY2A 3WE4A 4AX8A 2XM8A 3V5WA 3ZUVA 2ZM1A 3NYOA 2EXEA 4DEBA 5CLPA 4I21A 1ZY5A 2GS6A 1YHWA 2DS1A 5CU6A 4EC9A 1OUKA 3L9NA 4A9UA 2PVNA 3FKLA 3ZSIA 2R3KA 4PNKA 1PXNA 4UYNA 3OCBA 5FD2A 4BDFA 4FSTA 4IEBA 4OTGA 3PA3A 4BCNA 5FXRA 1AD5A 3K54A 5CF8A 4D5KA 2O0UA 5JQ5A 1VYWA 2QNJA 2C6LA 4K77A 3ZRMA 3NLBA 2VWWA 5ACKA 3GU7A 2Z2WA 1WAKA 3LCDA 4GFMA 4K2RA 1T46A 3PDTA 3ZO3A 3UVPA 2F2CB 1OPJA 4BBEA 1V0BA 3UNZA 1IEPA 1M2QA 3VW8A 1YDRE 2F2UA 3BU6A 2E9OA 2YEXA 4WNPA 2VNYA 4XG9A 5AR3A 2CNVA 1XH4A 2C69A 3BYSA 3GC9A 4BZDA 3R1YA 2BHEA 4O22A 4OTRA 1REJA 4JBVA 5K5NA 4O81A 4LL5A 3UG1A 1FMKA 3D5WA 4V0GB 3OOGA 2ZM3A 3VS0A 3MPMA 4BICA 2RFNA 4A07A 3W2PA 2XP2A 5M4CA 4X7QA 3ZFYA 2HZ0A 1H26A 4AG8A 4XBRA 4MAOA 2NO3A 4P4CA 3RM6A 3BHVA 4ARKA 5ANDA 2R7IA 3R6XA 4CV9A 4FEWA 5M4FA 1CKPA 3O2MA 3EFWA 4FTAA 4UMPA 3PZHA 3K5VA 4KSPA 3OFMA 3I6WA 4FG8A 5CSHA 3ZM4A 3QTZA 5AP4A 3MIAA 4D9TA 4D4RA 4I5HA 3HMIA 4ZZMA 5AR7A 3RHKA 3UQFA 3DA6A 2JFMA 4F6SA 4QNAA 4XOYA 3FZTA 3L8SA 3BV3A 1QPDA 2OJJA 3O8PA 3ZYAA 4CQEA 4J99A 1BKXA 4BL1A 4DF3A 5BVDA 4YUQA 3FI2A 1K3AA 5AP3A 4F7JA 3GFWA 4ZS0A 5HX8A 5CI7A 3VBVA 5JRQA 4R3PA 4FV6A 3FLNC 4FG7A 1WCCA 4L7SA 4B4LA 1UU9A 1PMVA 3RINA 5T6KA 1ZZLA 3QXOA 2BRNA 1Q3DA 4C4EA 2EUFB 2ITTA 2WQBA 3LW0A 5H8BA 2OF2A 4YHJA 1E1VA 4FUYA 4DGOA 5C26A 4UEUA 5KE0A 4FV3A 3GCQA 2X4FA 4FF8A 4IIRA 1YWRA 3O96A 2GHLA 4NSTA 4IVBA 4RJ5A 4RJ3A 3EQFA 4K33A 4D2VA 3N51A 3PRFA 4X6QC 3DFAA 3W8QA 4FT3A 4MX9A 1QPEA 5ANEA 3QLGA 3UQGA 3UZPA 1OKVA 4NIFA 5BUEA 3LPBA 2BALA 4NJDA 5FEEA 4BN1A 1APME 4JR3A 4BGGA 1A9UA 4YSJA 5H9BA 4M84A 5M4UA 3DDPA 4PTGA 5AR8A 4XV2A 3JUHA 4ZTQA 4C4FA 3TV4A 1IA9A 4KIPA 2PE1A 3R8PA 3CSVA 1FOTA 4UMTA 2W0JA 4EOJA 2B9JA 1IA8A 3QQHA 4O0VA 2QR7A 4ALVA 4NIFB 2C6IA 3UO5A 3QHRA 5AFVA 3ELJA 3Q6WA 4IACA 4ZEGA 1URWA 4RIYA 3NIZA 3V6SA 4ACGA 4CFVA 2XRUA 5ANKA 4D4YA 5TF9A 3MY0A 2GCDA 5FGKA 5B2MA 3P0MA 3FZRA 4F63A 2E9VA 4Z9LA 4UMQA 3B8QA 2YIQA 5EOBA 1UVRA 3PWDA 4GFGA 5KBQA 4OUCA 2WQEA 2UZEA 3AGLA 3KKVA 5CVHA 4AGCA 5I3OA 4RIWB 5KZIA 4FYNA 4R7IA 4FSQA 4WOVA 3P7BA 5J5SA 2XNBA 3A60A 3PA5A 3OUKA 3QC9A 4FKJA 4KD1A 4XEYA 3QTWA 3HMNA 2LAVA 2QLQA 2WOTA 4E6CA 3H9OA 2PMIA 3MFSA 3BWJA 3OEFX 3GXLA 4MQ2A 1KE5A 4RVTA 2O5KA 4XG7A 5FXSA 3NNVA 3O71A 4NCTA 1UNHA 4FI1A 4HGEA 4R8QA 4QTCA 4ZSJA 4YU2A 4LGHA 3UODA 1ZMUA 1PXPA 3KXZA 4GVJA 2UW9A 3EQCA 4IVCA 4D28A 3SXFA 4D58A 4DTAA 3WF5A 4NJ3A 3QA0A 4D2RA 5K0KA 1M7NA 4Z16A 3ZZWA 4I41A 3U8WA 1DI9A 2YM8A 2VTIA 4OTFA 3O7LD 4F70A 3G6GA 4AW2A 2Y6OA 4FIEA 2R3NA 3RK7A 3SOCA 1SVHA 3ZFMA 2C1BA 4EZ7A 1WVWA 4MXCA 3DGKA 1J1CA 4I5PA 4QMPA 2I40A 3NUSA 2HK5A 2QHMA 4IDVA 1AQ1A 4KIQA 5D1JA 1O6LA 4K0YA 5FTQA 4ZIMA 3V5TA 2OJIA 3LE6A 1BI7A 4FIJA 2CLQA 2O63A 3D9VA 4TWPA 2IN6A 3IECA 5TO8A 3WZDA 4JR7A 1ND4A 3HGKA 2WTKC 2PVJA 5CAOA 2XA4A 3OP5A 3Q60A 4DG2E 3U6IA 2QVSE 2VTSA 1Q5KA 2W06A 4BDHA 3KVWA 1XO2B 3NNXA 4UXQA 3G33A 4GIHA 4RGJA 2WZJA 4XS2A 3VW6A 4AE9A 5DNRA 5A14A 3KQ7A 4C4JA 2C0OA 4HCTA 4FSMA 4YBKA 4I24A 3GCPA 4ASEA 4TYIA 3HV7A 3RZBA 4NW6A 5K9IA 2VO0A 3FMJA 3LFSA 3PSDA 3QGWA 5LARA 3PXKA 2JKOA 3LLAA 2YDKA 4QMTA 3VUHA 5HCXA 3WOWA 2ZAZA 5LJJA 5CAQA 1AGWA 3L9MA 4RWLA 3QTXA 4GUEA 5JZJA 2VGOA 5CX9A 3Q04A 3GU5A 5D7AA 3C5IA 3AC3A 3R9NA 3T9TA 1H0VA 4UXLA 4QP4A 4O0SA 1JSUA 2QOOA 4J96A 3P9JA 2FSLX 1W7HA 1YVJA 3TL8A 2HXLA 1YKRA 4XP3A 4IFGA 4DLIA 3PFQA 4O2ZA 3CPCA 2XKFA 5KMIA 2Y4IB 1PXJA 1WFCA 1KWPA 2BTSA 2EXMA 5C9CA 3BYVA 4CFXA 4JOAA 3NWWA 3RPSA 3FSKA 1QMZA 3NZ0A 5ICPA 2BZJA 3WF8A 4BKJA 4CRLA 4KSQA 2FA2A 5F20A 5A4QA 2V5QA 2XJ2A 3MA3A 3HEGA 3D7ZA 3O0GA 2WEIA 4IJPA 5EFQA 2R4BA 3NMUF 4EOIA 4NM0A 1PXMA 5BUJA 1ZYJA 5HLWA 2YABA 5D12A 4ANBA 2O8YA 1BL7A 4G3FA 3W1FA 5E8XA 4NZWB 5I9XA 3ROYA 2BKZA 4PY1A 3KRLA 5EDQA 4BR3A 4A4OA 1JKSA 1U5QA 5F94A 4F08A 4H1MA 2O3PA 4UV0A 3S1HA 2PUPA 2CN5A 2WTJA 3KN6A 2Z60A 3ENMA 5E8TA 3I5ZA 4M66A 4J97A 5E8SA 3UP2A 1JOWB 1L3RE 1PW2A 2BKKA 3A7FA 3P5KA 3SV0A 4DCEA 4EYMA 2J90A 4NU1A 5HTCA 3DLSA 4AW5A 2P3GX 4CFMA 3Q5ZA 3PRIA 4PF4A 5IMEA 4HYSA 5I5ZA 5IZFA 2DUVA 2VWVA 2UW5A 3P23A 1M2RA 3FBVA 5BX0A 5HIEA 4WBOA 3BWFA 4FKPA 2OFVA 2AC3A 2WMXA 2ZV2A 1CDKA 3D5XA 4TWCA 2IW8A 2C5OA 3ZHPC 4IM3A 4YPSA 3O17A 3V6RA 5L8LA 3QLFA 2E2BA 1OKWA 4M0ZA 3IGGA 1H8FA 1NVQA 2BTRA 3UG2A 3EQRA 5AP5A 2A4LA 5AP1A 5AUUA 3NYVA 2B53A 2UW3A 5H3QA 5M56A 3FC1X 1VR2A 4RWIA 3VVHA 3ZONA 3GC8A 4FTRA 5A3XA 1OMWA 4C35A 2EWAA 4BKYA 1MRVA 3ZM9A 4BCIA 3KRXA 5FDPA 4FTCA 4OT5A 4QP6A 5BMSA 3DK3A 3R7IA 3SXRA 2B1PA 4ANQA 2Y0AA 1RE8A 5JFWA 4FK3A 1Q8ZA 4X0MA 4RVMA 4DA5A 5GIOE 5M44A 3MJ1A 3QQJA 3JVRA 4O0TA 3FQEA 3Q52A 4ZLOA 3BGQA 4FKGA 5AIRA 2PE0A 3IW7A 3W2CA 1Y57A 1OGUA 4WKQA 4AZTA 5GJFA 2VTRA 3VIDA 4ERKA 4J7BA 4XMOA 3TV6A 1JLUE 4BKZA 1ZRZA 3VS4A 4RLKA 4U7ZA 3R30A 2UV2A 3GNIB 4H3BA 4BCFA 3EQHA 4ENYA 4GK4A 4U43A 4AGWA 3EHAA 3DJ6A 1W82A 1YRPA 1YWVA 2GTMA 2F9GA 2W1FA 4GYGA 3TZ7A 4DAWA 4QPAA 5IU2A 3KFAA 4RMZA 5L2IA 3GQLA 3QUEA 4F9BA 4G3DA 4IH8A 4M69B 3SAYA 3VF9A 4C2VA 3KXGA 3NDMA 4I22A 2OG8A 4JXFA 1CKJA 5HGIA 4NKAA 4OTPA 1F5QA 1PKGA 2OI4X 5DEYA 4C8BA 5AEPA 3E8DA 4D1XA 5CEKA 4K1BA 5EM5A 3OWPA 3ZRLA 3L9PA 2HELA 4IM0A 3II5A 4NM7A 3CXWA 4TW9A 4G3CA 4IVAA 5E1EA 1CSNA 2XCHA 4F9YA 3C1XA 2CGVA 3E8NA 3LFDA 3H0ZA 1GOLA 5JGAA 4YTHA 2CJMA 3PVGA 4BZNA 4U9AA 1YDTE 3VS7A 1NVSA 4F1MA 5J5TA 3A7JA 2IJMA 5DRDA 5IA4A 4TPTA 3D0EA 3LFFA 5AP0A 2OJGA 1DAYA 1OB3A 3LFEA 3PJ3A 4YNEA 4E4XA 2CCIA 1YOJA 3Q9XA 3U54A 3QTUA 4YTFA 3E7OA 1QCFA 2P55A 2YHVA 1FBNA 1SYKA 3DS6A 4LM5A 5HCZA 4QYHA 4WUNA 3ZC6A 5FM2A 3ULZA 4FZFB 4OT6A 5IQHA 5EM8A 3ZO4A 1PKDA 5L4QA 4DGNA 2QU6A 3ZLXA 1GZOA 3IW6A 4OBPA 2WFYA 4DE4A 2JC6A 3BYUA 4D1SA 5HTIA 5L2TA 3FZOA 3EN6A 5C8MA 3PXZA 4TWNA 5D9HA 4BC6A 2PMOX 2RF9A 3FMEA 3F7WA 1GZKA 4EOMA 2ZDTA 5CSWA 5EK7A 3P1AA 4I23A 2XKDA 3WF9A 3IPHA 3ORNA 2XNEA 2OXXA 2IW6A 3TUBA 2GS2A 3GP0A 3PXYA 4NUSA 2J7TA 3I60A 3IK3A 3QRKA 5EOLA 4EOLA 3KVXA 3ENHA 4FTLA 5DG5A 2I0YA 3MVHA 4FV9A 2AC5A 3OHTA 1UU3A 1ZWSA 3P78A 2EU9A 3E8EA 3QFVA 3QUPA 4XUFA 3RGFA 5E1SA 4C7TA 4F4PA 4BYJA 4FEVA 1K9AA 4QP7A 5AM7A 5J1VA 4CMUA 5LCKA 4QQTA 2W17A 4W8DA 3SDJA 1MUOA 4JDIA 4QP3A 1VYZA 2JFLA 2VZ6A 4EQCA 4QMYA 1I44A 4APPA 4FIFA 4JG8A 5HBEA 4YZMA 4IW0A 4YPDA 3VQHA 5FEDA 3BU5A 4QMLA 3NAYA 4RX5A 4KKEA 2C68A 3AC8A 5EYMA 3RCDA 4BTFA 3QRIA 3U6JA 4ZSGA 3PE2A 2CGUA 3FLZA 3C7QA 5IA5A 3BELA 3F5XA 3CS9A 2A1AB 3S95A 4YC3A 3R22A 5BQ0A 5JMSA 4QMZA 2LGCA 3U4WA 4YO4A 4QQCA 5L6PA 2HCKA 3EN5A 3DU8A 3FAAA 4BVUA 1Q3WA 1YI3A 2I1MA 2R3IA 4EH4A 5CF4A 4L6QA 3CC6A 3DK6A 4PUZA 5CXHA 3TIYA 5EYKA 5GZ8A 2B52A 2ETMA 3PWYA 5BNJA 4QRCA 3AD6A 4GIIA 5EHLA 3RAWA 4GSBA 2IZUA 3GT8A 3BHUA 3QXPA 3O8TA 4O0RA 5TR6A 2Z8CA 3MYGA 4D4SA 4Y46A 4Y95A 4ZJVA 4MKCA 3FLWA 2J0MB 3MGYA 4J52A 4EC8A 4O7VA 1OUYA 2QOQA 4QMNA 2GNJA 3F3TA 4TYHB 5JQ8A 2R3PA 5CNNA 3ZTXA 5IA3A 4RVKA 4TYEA 5HNIX 2WQMA 4ZTHA 3ZOSA 1GZNA 2Z7SA 2R5TA 2VX1A 3WE8A 4JAJA 5AA8A 4FV5A 4BBMA 3OROA 1XR1A 3F5GA 3OCSA 4IB1A 4BDEA 3NNUA 1PRYA 3MVJA 1X8BA 3BZ3A 3KXXA 2XH5A 2W4JA 2PZRA 3CR0A 3Q3BA 4JG6A 5K0XA 4R7BA 4JQ8A 4CFNA 2UW6A 4X3FA 2CPKE 3KRRA 4UBAA 1J91A 2B0QA 3IW4A 3MDYA 4C3FA 4YTIA 4O1OA 4BTJA 2IO6A 4TWOA 3ZUUA 1OL6A 1FGKA 3SRVB 3T3VA 2OZAB 4ZZNA 2XIKA 1XKKA 3UOHA 4PP7A 3OG7A 4C34A 2CGXA 3NNWA 4M12A 3IOKA 5IQAA 4F9AA 3F3UA 4XG4A 3UYTA 4RRVA 4BIEA 4IFCA 3TG1A 2JLDA 3E3BX 2Y4IC 4FVQA 2W1EA 4J98A 5DPVA 3NSZA 1R39A 2JGZA 5E8ZA 3R02A 4FTQA 4FGRA 4EOQA 3MSSA 4R1VA 4OR5A 4BCKA 3FL4A 2YLFA 2ZV7A 4FV7A 2KULA 2VWBA 1OBGA 4ASXA 3TZ9A 3VS5A 3DTCA 1H1SA 3E62A 3G6HA 4P7EA 5IEXA 3DZQA 5A6OA 4YO6A 3FMHA 1PXOA 1YHSA 4PPAA 2EB2A 4RVLA 4CKRA 3IW8A 4CXAA 5KMKA 2HY0A 3UZRA 4BI1A 3GFEA 3NCZA 1TVOA 3KF4A 4YBJA 2WQNA 4RSSA 5IA0A 5CASA 3TDVA 4O82A 3QGYA 5CEIA 4MWHA 2C6TA 3FMKA 5FXQA 3ZEPA 4HCVA 2OBJA 3FSFA 3IDPA 4E4MA 3PIZA 2J2IB 4BI0A 2RKUA 5B2KA 3QUDA 3HVCA 3UOLA 4EUUA 2C3IB 5E8YA 3ANRA 3PE1A 4E6DA 5CT7A 3NYXA 4WHZA 4AT3A 5LMAA 3VUDA 2QKWB 2R3JA 4O21A 1SVGA 4IMYA 2VWIA 4DH5A 3IW5A 1BI8A 3FZPA 4BCJA 3VULA 2C6DA 1ZOEA 2O65A 4NM5A 3DDQA 5LOHA 3OW3A 3UOJA 2XK8A 2HZIA 4PL5A 4DFUA 2QO2A 2R9SA 4M15A 4EOPA 4RIOA 5AV2A 4YP8A 3RTPA 3F9NA 3SC1A 2IWIA 1UA2A 4CLIA 4DEHA 2FSOX 3KREA 4DFYA 4G6NA 2BZHB 4IAIA 3CTJA 3EYGA 4LFIA 5KBRA 3E63A 4IQ6A 2W96B 2VTTA 3VAPA 2WMVA 4R5SA 4HOKA 5JGDA 5J7BA 3R8MA 3U9NA 3BPRA 2E9UA 2YWPA 4ANSA 4O6EA 4F0GA 3PIYA 3WZUA 3WBLA 3FZ1A 4YJTA 5KMLA 1CTPE 3KC3A 3NAXA 3NYNA 5I9UA 3PP0A 4GKHA 4FV1A 3VJOA 2JKQA 5HI2A 4HVDA 3BV2A 2C5NA 4FSZA 4YLJA 4YJNA 3JY9A 1U54A 3PY1A 5JK3A 4JVGA 4YJQA 2QONA 4OW8A 5D7VA 4E7WA 3N4TA 5I3RA 2VO6A 3A61A 4BRXA 1PYXA 2DWBA 1UNGA 4BCQA 2UVZA 1WBOA 2W1IA 1TQMA 3C13A 4ACDA 3K3JA 1KUTA 3MFTA 4M97A 3RK5A 2WU6A 4XG3A 4ZTRA 2PE2A 4WNMA 3Q32A 2Q83A 5J95A 4QMSA 1BMKA 3AD4A 4XRLA 3OTVA 4PDOA 4Q9SA 2ERKA 3QALE 1K2PA 4X2KA 4AAAA 4FYOA 2EXCX 4OTWA 3FI4A 3I81A 4HW7A 4CEGA 1H25A 4YZCA 2YZAA 3PTGA 3PZEA 2H8HA 4FKQA 3FLYA 1M7QA 3HL7A 3R8VA 4IX6A 4R5YA 4X2JA 4BTKA 4CCBA 2J0LA 3VS3A 3FL5A 2OJFE 4EH8A 3M2WA 1Q24A 2QO7A 4ZTMA 4M68A 5AAFA 4XYFA 2C6MA 3HRCA 1YOLA 3LFQA 1M17A 1B38A 3GGFA 5IH6A 3D7TA 4W9WA 4E5WA 3BE2A 3C4WA 3KXNA 1TQPA 1W8CA 4M7IA 4LI5A 3OOMA 3RI1A 2UZDA 5C1QB 1OKZA 3P4KA 5IQCA 1KOBA 3PPJA 4U6RA 3I0QA 4FKIA 3FKNA 5F1ZA 4N6ZA 5HOAA 5LMKA 1NW1A 5EW9A 4HCUA 3FI8A 3PY0A 2CDZA 3HRFA 4AA0A 3POOA 3DXNA 2HOGA 3GUBA 3LIJA 1XBAA 1YDSE 4GEOA 3L8PA 4IWOA 2WMWA 3NGAA 4QQJA 2YM4A 3CE3A 1Q99A 4PL4A 4YC6A 5HO6A 4BDJA 4E4LA 1NVRA 2XIZA 3BRBA 3Q4CA 3GQIA 3P79A 4EUTA 2X8DA 3OY1A 1F0QA 4L7FA 5DFPA 2ZJWA 2X9FA 4CCUA 5AMNA 4R1YA 3TUDA 2I0HA 2QURA 2QOCA 1RQQA 3LXNA 3QRJA 4PTCA 3F2NA 4RA5A 5EM7A 4AOJA 4CZUA 3HV6A 5CNOA 3VUKA 3GVUA 3QZHA 3QHWA 4U3YA 2PU8A 1WBPA 2REIA 4FTTA 2OSCA 3D14A 2I0EA 2XJ1A 4LOOA 3S2PA 3DBEA 2QI8A 1YXVA 4HNFA 3ACJA 4ITHA 4KRDA 2YJSA 4U80A 5AUTA 5E4HA 2ITYA 3VBXA 4DFBA 1H00A 2SRCA 4KA3A 5H8EA 1H01A 4DEEA 3DZOA 5DE2A 1T45A 1Q8TA 5ACBC 3VS6A 5M53A 3F88A 4F9CA 3NX8A 4FE2A 2X7OA 3QKMA 1ZYCA 1PMEA 2OKRA 2WXVA 3BYOA 2YA9A 1B6CB 2JDTA 3HA6A 4J95A 3RWPA 4BIBA 4CNHA 1WMKA 2WO6A 3LKMA 2W5AA 4BI2A 4O7WA 5A4EA 2C47A 2YIXA 4AE6A 3CLYA 4TTHB 3E93A 4OTHA 4QTEA 5EQEA 4EQUA 1KV2A 3FMNA 3HMMA 4NKSA 3GCSA 4ZS4A 2GDOA 3Q6UA 4E8AA 1W0XC 4CMOA 3ORTA 3BGPA 3ZDIA 4DBXA 4FTNA 2CKEA 1H4LA 5CVGA 1JKTA 2JIIA 3R7OA 1Q8WA 3KULA 5CY3A 2YM3A 3R63A 4EJ7A 4E1ZA 3IG7A 4XV3A 4GG5A 4EONA 1QL6A 2XEYA 4FKRA 4ITIA 4O0WA 4GT5A 4O0XA 4PPBA 3HV5A 4ORKA 2QO9A 3COKA 4UWBA 3A8WA 4D55A 5EHYA 1CM8A 4FMQA 3RHXA 2CMWA 2R64A 2X39A 4CYIA 5HVKA 3F82A 3RBWA 2VWZA 3TNHA 4USFA 3MW1A 1XHAA 1GAGA 4BFMA 5J87A 4IB0A 4DBNA 5LMKC 4DEIA 2ITQA 2QKRA 3ZSGA 1LR4A 2JDOA 3GU6A 4IDTA 3FXZA 3R7YA 4E20A 5AR2A 3KMUA 3FHIA 5E9EA 3DPKA 4GJ3A 1PF8A 5AUZA 2C3KA 2RFSA 4YZ9A 4V05A 2XB7A 3D2IA 3QU0A 2BRBA 1H1RA 3G0EA 4I0TA 5ANGA 3T9IA 3FHRA 2CN8A 4FT0A 4MF1A 4A7CA 2VO7A 4G3GA 3UDBA 1KSWA 1UWHA 5DHJA 4DTKA 4FNWA 3ORLA 4WUAA 4EH7A 2BRMA 3DBFA 3DJ7A 5BYLA 3NPCA 2C0IA 5KNJA 2BRGA 3MH0A 4I4FA 3GU8A 4EQMA 2QLUA 4MH7A 1P2AA 3AD5A 3OXZA 3UIUA 4F9WA 3W2OA 3TTJA 1YXSA 2B55A 4RIYB 3U87A 4CYJA 1YXXA 5LVOA 4ZTNA 1U4DA 4D1ZA 3LHJA 2R0IA 2HXQA 2PY3A 5AADA 5K5XA 1PY5A 2RG6A 4U44A 1H07A 3ZXZA 2GQGA 3QZIA 5GIPE 2UW7A 3G5DA 1NY3A 2VX3A 3QX4A 2VTHA 3FQHA 2G01A 2YM6A 2W05A 4Y5HA 5HCYA 3ZDUA 4LGDA 1E9HA 2XBJA 3D4QA 3GEQA 3NUPA 4IC7A 1OIRA 3KEXA 4FX3A 4RBLA 2WB8A 2OH0E 2PVLA 3DK7A 4EH2A 2XYUA 4JQ7A 3RCJA 4KAOA 2JDSA 2X8EA 2J0KA 4FV2A 4AXAA 1FVRA 2ITUA 1Q8UA 2BILB 4D4VA 2R3OA 4MBLA 3D5VA 3VF8A 2ITNA 1KV1A 5M51A 4ZOGA 4FICA 1ATPE 2ZM4A 3BGZA 5FQDC 5JGBA 2AUHA 2V7OA 2XJ0A 3FLQA 3A4OX 3A7IA 3MH2A 4AU8A 4Z7HA 3G15A 2JD5A 4OTIA 4Y85A 3ZO2A 3H10A 1XQZA 4FEUA 4FSWA 3G90X 3ERKA 4S31A 2C3JA 2UVXA 3GU4A 3S3IA 3R04A 5M09A 3ALOA 4IZ5A 3LCKA 4PL3A 5KHXA 3VRZA 3LJ1A 1M52A 2OXYA 3ZLSA 1S9IA 1MRYA 4F7NA 3IDCA 2BDWA 4CKJA 3IKAA 5DYJA 2VUWA 2ZMCA 4O96A 3ZZEA 1PXKA 4CG9A 5DWRA 3UJGA 4A4XA 1JKLA 5AX3A 5BVWA 1OVEA 1YI6A 4FT9A 4X2GA 2B7AA 4IZYA 3AOXA 5GNKA 1DAWA 5IF1A 4JNWA 5ANJA 1OL7A 3DFCB 1ZARA 1YWNA 2ACXA 3ALNA 3GENA 4K8AA 5DT4A 5AV0A 2P4IA 3QCSA 4KUJA 4OAVB 5EKOA 3G51A 2PHKA 4XLIA 2W1DA 2ITXA 5JH6A 1EH4A 1BX6A 3NIEA 4BHNA 3EQIA 1OIQA 5AUVA 2JKMA 5E90A 4IANA 4UZDA 3DBCA 4QMQA 4IE9A 5DI1A 4E4NA 4FNZA 5ANOA 4BDDA 4RZVA 1ZAOA 1URCA 3Q53A 5DA3A 4W4WA 4KINA 4JQEA 3QRTA 4BBFA 2IVVA 5JZNA 4H36A 5EW8A 4YJPA 4FTKA 4GJ2A 4MXZA 4CVAA 4I5MA 3VUGA 2QOIA 4R6VA 3BI6A 4PX6A 3Q9WA 1PYEA 1XWSA 2XIXA 5KX8A 4F09A 1XH8A 3O23A 1DM2A 3RPYA 1LUFA 1TKIA 3QBNA 4TN6A 2F4JA 5LVPA 2RFEA 3OBJA 4V04A 1ZYLA 2JBOA 2W9FB 5E8UA 5I9YA 1G3NA 3R28A 4PWNA 2HAKA 3H9FA 4RG0A 3LM5A 4R3RA 4GUBA 4DG3E 2CLXA 4QTBA 2X9EA 3QAME 4I20A 4AWIA 5BVOA 5CSPA 4GT4A 5L3AA 2X8IA 4BDIA 4MD8E 4GK2A 3FE3A 5E92A 1V0PA 2FB8A 4G17A 2IZRA 2YWVA 5JFVA 3DAEA 3HZTA 5FM3A 4ANNA 3I7CA 4LUEA 2W5HA 4FKUA 2YCFA 3RNYA 4ZMEA 1KE7A 3QD2B 4USDA 5IQDA 1XBCA 3QQUA 4IB3A 4RIXA 4E73A 5M08A 3T8OA 2W1HA 2J4ZA 1SNUA 3FY0A 4PMSA 4EZ5A 4G34A 5FWKK 4TZRA 3HA8A 3R7VA 3LXPA 4FT7A 2A0CX 3OTUA 3Q4ZA 4U97A 1OPLA 4OTDA 5CENA 2UW0A 2Q0NA 5F95A 4BDBA 3OF0A 2YM7A 5A4TA 4FSRA 3OS3A 5KHWA 5LCJA 4QYYA 5HU9A 5CF6A 5IEYA 3EYHA 4QMUA 3TJDA 3D5UA 1GJOA 3RPRA 3DAJA 2H9VA 3EZRA 3NR9A 4IX3A 5FP5A 4EH5A 2XNPA 4ZJIA 2VWYA 5AUYA 4C2WA 2WELA 2R2PA 3KCKA 3Q5IA 4MWIA 5EYDA 2WOUA 4MD7E 4JL9A 3CEKA 3V5PA 5HTBA 4GG7A 4X6RA 4DFXE 3POZA 2GFSA 5HLPA 3NUYA 4M14A 4DEAA 4EZ3A 4Q5EA 4A9YA 4AP7A 2O64A 2WD1A 3TKHA 3VN9A 4F0IA 5AX9A 3W2RA 2CKPA 3FPMA 4XJ0A 4OLIA 4ZSAA 2VTQA 3IOPA 5A4CA 5FEQA 3Q2MA 4LOPA 4FEXA 3K5UA 2YIYA 4ACMA 3EMGA 4BCHA 3R9HA 3I1AA 4FC0A 4O91A 4FGBA 1Z5MA 3C9WA 2GSFA 3BLQA 2R3RA 4HVIA 3SLSA 4FNXA 4AA4A 5FBNC 4FVPA 1YW2A 2O2UA 5I9ZA 2RIOA 4HGTA 2PMLX 3SXSA 3A2CA 4BWPA 1Y8YA 3EFLA 4NM3A 4K9YA 4QPSA 4FV0A 3OCTA 4XNEA 3VWAA 3CD8A 2WHBA 4FTMA 4NL0A 4LRMA 3R8ZA 3AC1A 2IVSA 3HDMA 3C4FA 4RC4A 3H9RA 3Q96A 3QKLA 3W8LA 5HQ0A 4QMOA 2OZOA 4I6QA 5CEMA 4MTAA 4H1JA 2FYSA 2ONLA 2W5BA 4JG7A 2OFUA 2QOBA 2PVKA 1MQ4A 4AA5A 4F1TA 5C4KA 4MEDA 3C4CA 4P90A 4YHFA 2IPXA 2GNHA 1O6YA 3BKBA 4RX9A 5AV1A 1J3HA 5CEPA 2XK4A 4FKWA 3COHA 3Q9ZA 4RX7A 5HNGA 3LMGA 1UKIA 3CJGA 5CI6A 4WNOA 4MNEA 4LQMA 4WT6A 5KCVA 5L8KA 4QT1A 4X2NA 4L44A 3RVGA 4EH3A 1B39A 4DH1A 4O7TA 2B4SB 4W8EA 5HG9A 4PTEA 4D0XA 2XYNA 3KRJA 2QG7A 4HYUA 3A62A 3IO7A 3V01A 4EYJA 4F6WA 1BLXA 2VWUA 4I6HA 5KO1A 5E8VA 5JEBA 1STCE 3AGMA 4HPUE 4DLJA 4KIOA 3G2FA 3HLLA 3MTFA 2OICA 3C4EA 3GCUA 3P86A 5BVEA 3ANQA 2ITWA 3R1QA 4L42A 3I79A 3PVUA 3ITZA 4EI4A 5EYCA 2PUUA 5KKRC 2WTDA 2YCSA 3QD0A 5IUIA 5E91A 3Q9YA 4P5QA 5H2UA 4A9TA 5AR5A 2C1AA 3WARA 2ITOA 4WG4A 3BBWA 3NW6A 3UP7A 3U51A 4KBCA 1MQBA 2X2KA 2Y4PA 4FVRA 2CHLA 4Q5HA 3TZMA 5KMMA 4C4IA 4IX4A 4L53A 5KZ0A 1CKIA 5GINE 3R7UA 4LRJA 4HNIA 1SVEA 4JIAA 3M11A 3PXQA 5ETCA 3R2YA 2UZVA 4QNYA 3JPVA 3R8UA 3TI1A 5L8JA 1V1KA 3TM0A 1CMKE 4ZY6A 3N9XA 4KKHA 3QRUA 4B99A 5CU4A 2ESMA 3UYSA 2JIUA 3EN4A 3OWLA 1IRKA 1FMOE 3LJ2A 3WYXA 4AZWA 5CAVA 4G1WA 4BB4A 4DG0E 2GS7A 5JRSA 4NCTC 1OIYA 3C5UA 2F7EE 4R77A 2GNGA 4Y73A 2UW4A 2YM5A 3MFUA 3E87A 3KRWA 4G6OA 2UZUE 5JFXA 4C62A 3DB8A 3DY7A 4AW1A 4A9SA 4YGAA 1PMNA 1WVYA 3HP2A 4K11A 3MN3A 4YR8A 4E5AX 2CNQA 5EQYA 1PMUA 4PQNA 3FYKX 3KY2A 4ZTLA 5AP7A 2R3LA 4GVAA 4MCVA 3LQ3A 3IS5A 3QCQA 3TN8A 2VO3A 2WNTA 4WBBB 3LZBA 5C27A 4A06A 3BQRA 2WMSA 2H34A 2XKCA 1SNXA 2W4KA 4KS8A 5AUXA 2CNUA 1WVXA 3B2TA 4MYGA 4CGAA 3DXQA 3MY1A 2A2AA 4WG5A 3NUAA 3NW7A 2J9MA 4CMTA 3FEGA 4YC8A 3A7GA 5LVLA 5KUPA 3BQCA 4HZSA 4H3PA 5TE0A 2YLEA 3EWHA 3Q4TA 3UO6A 2XK9A 3C0IA 4J53A 1ZMVA 2ZVAA 4UX9A 3UNKA 4CRSA 2NP8A 3WILA 3LQ5A 5M57A 4X3FB 4EKKA 2GNFA 4O7SA 3ATSA 2OO8X 4DFNA 2WTCA 3PJCA 3MS9A 3VS2A 3AC4A 4CTCA 2XNOA 3CGFA 4HVGA 1H0WA 4O7RA 2CCHA 4FL2A 3NUNA 2ZYBA 2GFCA 3DQXA 4RC3A 3R71A 3DLZA 2WMAA 1Y91A 4GU6A 4WRSA 4LL0A 2XNMA 1JSTA 4MVFA 3LLTA 4GYIA 2ZV8A 4UMUA 4S32A 5M07A 2WTIA 2XK3A 4J71A 2BFXA 5CS6A 3PXFA 4NFMA 5B0XA 3UIXA 2PYWA 5AJQA 3W2QA 4AN2A 4CFFA 3EJ1A 3PJ8A 3PXRA 5AUWA 3R9RA 4C3RA 4D2WA 4FOCA 4M67A 3K2LA 2V62A 4AZVA 4ZAUA 2ZMDA 5J1WA 4N4SA 3QKKA 2ZB0A 4XP2A 2F49A 3LXLA 4ZY4A 3RK9A 3TDWA 2WPAA 3C51A 3FY2A 1J1BA 4IAYA 2OH4A 4AT4A 3CIKA 5EM6A 4C38A 4Q9ZA 4C3PA 5HBHA 5LWMA 3ACKA 4UWYA 2XBAA 5IQGA 2OJ9A 4DGMA 2FUMA 3NUXA 3UNJA 4AN3A 4EHEA 5LMBA 3QWJA 5IPJA 1PHKA 3QCXA 4JBPA 1Q61A 1R0EA 1R3CA 3DBQA 4DHFA 2IZTA 2DYLA 4DN5A 4ZLYA 3LOKA 2OW3A 3BU3A 4MXOA 5DIAA 1G5SA 3FXXA 5BVNA 3ATTA 1H24A 4WNKA 4EOKA 2FVDA 3QWKA 3R00A 4QOXA 3MV5A 4ALUA 3E8CA 1VZOA 4AZEA 1O6KA 3DNEA 2V22A 4PMMA 3O7LB 3QD3A 2HWOA 2BIYA 3HUBA 3W33A 2V7AA 2A19B 2VX0A 3R7GA 1FGIA 2VU3A 1Q4LA 1ZLTA 3R8LA 3EFJA 3VBYA 1GIIA 3E3PA 4UWCA 2OK1A 5BUIA 5GJGA 4ZMFA 2XMYA 3TCPA 3BHHA 4Z7GA 4I6FA 1KOAA 4GT3A 4HZRA 4EL9A 2W1ZA 3COIA 3R1NA 3TNIA 3UE4A 4UMRA 1OZ1A 4II5A 4ZP5A 5IQFA 2X4ZA 4JDKA 3TKUA 5CANA 1OKYA 3DTWA 4ZSEA 3UGCA 4PPCA 5DT0A 1YQJA 4ENXA 3S0OA 5CYIA 4UZHA 4DCAA 1S9JA 1A48A 2BDFA 2JITA 2DQ7X 1U54B 2ZDUA 3UPXA 4FKSA 2PULA 4DGGA 4KB8A 3F5UA 5AR4A 4HYHA 3ZUTA 4ACHA 5KMJA 4FKVA 3PG3A 2J6MA 5HZNA 4TYGA 3UC3A 4FR4A 4GH2A 4QP8A 5J9YA 4G31A 3QX2A 3VBWA 1ZMWA 4WA9A 2F57A 1JKKA 3LQ8A 3CGOA 4LYNA 3KF7A 5HO7A 3BYMA 4PV0A 2GPHA 5A9UA 1OECA 3R83A 4DFZE 1WZYA 2Q0BA 3A7HA 4EBWA 4GRBA 3F3WA 3OXTA 2KTYA 1U46A 4ZTSA 4AF3A 5CEOA 5CSXA 4G16A 3G0FA 3DB6A 4JS8A 4AZFA 4FL3A 5J7HA 3FXWA 3BX5A 4WRGA 4F1OA 5ETAA 3LXKA 5HEZA 2ERZE 2F7XE 4E26A 5H8GA 1UU7A 3CKWA 3W55A 3MESA 3V8SA 5A46A 1FQ1B 4E3CA 3DAKA 4UYAA 1OIUA 4D2SA 4ZLZA 4YSMA 3QYWA 5M4IA 1KE6A 5CZHA 2WMQA 4EH9A 4ZY5A 4GKIA 4NWMA 4XX9A 5FP6A 3MPAA 1R78A 3IGOA 1XH5A 4GV1A 3QQKA 4ITJA 3HNGA 3D7TB 2UZNA 4RFYA 3EOCA 3MH1A 2YZLA 1ZYSA 2YCRA 2J5EA 2OIBA 1Z57A 2ETKA 3GBZA 3BEAA 4JX3A 2UZWE 3RP9A 3PJ2A 4O84A 5TOZA 4DT8A 3QZGA 5AV3A 2FSTX 4IWQA 4C36A 5IH4A 4XBUA 1RDQE 4DFLA 3OT3A 3UMXA 3DQWA 5IUGA 1GIJA 1F3MC 2VN9A 2C6KA 3MBLA 4I6BA 4QYEA 5AAGA 2E9PA 1I09A 2GMXA 3OVVA 4G9RA 4EBVA 4M0YA 3I6UA 2WEVA 2VTNA 4RJ6A 2NNWB 4FZ6A 2A27A 4L00A 1M2PA 4O6LA 2V0DA 3OY3A 2UZBA 4USEA 4I93A 2BZIB 4HGLA 5HICA 3H3CA 4H58A 4EHGA 4F99A 2QOHA 3F2AA 3ORMA 1IG1A 5L6WL 1FVVA 4J8MA 4WO5A 2GU8A 4FKTA 2ZB1A 4JRVA 5IDNA 3UPZA 5T68A 5HKMA 4M8TA 4TXCA 3CP9A 2QQ7A 2G15A 3AC5A 2C3LA 3DKGA 3R21A 4YZDA 5DR2A 3F69A 3RJCA 3W10A 1NT2A 2IZSA 3FZSA 2B9IA 3U9CA 3LMHA 1ZXEA 2JKKA 3HKOA 3COMA 4J1RA 4FSYA 3VBQA 2OF4A 4O2PA 2YIWA 5CSVA 2IG7A 3EKKA 1J7LA 4HVHA 1BUHA 5FDXA 2HW6A 4V0GA 3VNTA 5K4JA 1GZ8A 5E7RA 1W98A 3Q4UA 4G3EA 2QU5A 5AA9A 4RC2A 4AQCA 2XCKA 3ETAA 4B0GA 2BPMA 4FZ7A 4U3ZA 4FZDB 3UIBA 4BHZA 4LUDA 4BGQA 2PMNX 4E6QA 4Z55A 3FLSA 4DTBA 1JAMA 2XM9A 2YJRA 3PVWA 5IA2A 2XF0A 2R3FA 4WG3A 2QHNA 4Y72A 2OXDA 4WIHA 3TWJA 2V55A 1FVTA 4XP0A
chains in the Genus database with same CATH superfamily
5IQEA 1H08A 4Y5QA 2QODA 3EL8A 4IWPA 2CSNA 4DYMA 3DNDA 2VD5A 2E9NA 3AT4A 1H28A 5HIDA 4QP9A 3OXIA 4E6AA 4BIDA 2B54A 4FKLA 3SQQA 4G6LA 3WIGA 4F65A 5A6NA 3SG8A 3F5PA 2CKOA 3ZLWA 4NK9A 2FGIA 2H96A 3EQBA 4O38A 4HVSA 5IMXA 5FBOA 2YDIA 4FBXA 3QTIA 3BIZA 1OM1A 2BDJA 3RPOA 4O7ZA 4LMUA 2XIYA 3KULB 1TQIA 3TEIA 3TIZA 3QQLA 5A54A 3EL7A 3F61A 3C4XA 3SOAA 3R7EA 3UDTA 3QQFA 2WMTA 4XG6A 3HX4A 4O7YA 5IDPA 4HYIA 1PXLA 3HYHA 3MPTA 4FKOA 4IC8A 4MXXA 4TRLA 4XV9A 4J8NA 1GY3A 3W0MA 2YFXA 4I92A 4Y8DA 4AOIA 1NA7A 1UNLA 4L01A 2ZOQA 5ITAA 2VTOA 4NW5A 5IQIA 4RQKA 5DRBA 4L67A 3SW4A 1G8AA 3OWKA 3W0RA 4AFJA 3VQUA 3TNPC 4X3FC 5CQUA 1OL2A 3MIYA 4QQ5A 4CLJA 1YXUA 4QYGA 4RA4A 5EI8A 5K3YA 4BCMA 2YAKA 4BWKA 4EWQA 5KKRB 3ID6C 4IZ7A 5I0BA 3WZJA 4MNFA 1JNKA 5HE3A 2YITA 3DCVA 1Y8GA 3PVBA 4N0SA 3LFAA 3NW5A 3NVMB 5I4NA 2VTLA 5EG3A 4XLVA 1YI4A 4OBOA 3C4ZA 1LPUA 3JR1A 4R78A 4NEUA 4JDJA 1UU8A 3B2WA 2YDJA 3THBA 3BBTB 4C02A 2Z7RA 3OCGA 4YURA 4N70A 3FUPA 2NRUA 4YJVA 3OT8A 5AWMA 4MQ1A 3CY3A 4MK0A 2JAMA 4RIWA 4DITA 2PUNA 3RKBA 3U55A 4C0TA 3MA6A 2WU7A 4L3PA 3GC0A 1ZOGA 3V5JA 4XG2A 4F64A 4AGDA 3RZFA 4B8LA 2G2IA 3PPKA 3ODYX 4IWDA 2C5VA 4UN0C 3NEWA 4JBOA 2C0TA 2R3QA 2WTVA 3DJ5A 4U81A 5CEQA 1U59A 3BE9A 2IVUA 3ORKA 2BFYA 2Y7JA 2CGWA 3R9OA 3QD4A 5GJDA 1O9UA 2OIQA 4K18A 3W16A 3CBLA 1MRUA 2R0UA 5DR6A 4E93A 1JQHA 2YISA 2GNIA 2BROA 3SHEA 4QTDA 2W1GA 5HU3A 4F6UA 2X81A 3OD6X 3R01A 5EDRA 5ETIA 4QYFA 2HZ4A 3NS9A 3ZBXA 2GTNA 4BTMA 4LGGA 4BCOA 2ITVA 4XV1A 4G5PA 3VBTA 3FWQA 2XS0A 5EH0A 4X21A 1H1WA 3EB0A 2UVYA 3D94A 3MVLA 3UVQA 4TYJA 5AIKA 3HP5A 4MF0A 2RG5A 3H4JA 3CQUA 4FOBA 4RZWA 2WAJA 4CT2A 3SG9A 2EVAA 4I5CA 4AZSA 1ST0A 4MHAA 5EI2A 3GC7A 3S4QA 4IXPA 1RJBA 1NXKA 2PSQA 1J7UA 2Y9QA 3JYAA 4RJ7A 2G2FA 2X2LA 5J9LA 4ASDA 1WBWA 5CXZA 3TTIA 3VO3A 4U41A 4KIKA 3GI3A 3QTRA 4AOTA 4FSUA 4FIIA 3AQVA 3HV3A 3VC4A 3GOKA 4HPTE 1W2DA 3TNQB 4BDAA 4F7SA 4JAIA 3L8VA 4O83A 1YXTA 3CQEA 4GU9A 1P4FA 4JI9A 5L2QA 3QL8A 3DOGA 3W32A 2PZYA 4AT5A 4FJVA 3PLAE 2C6EA 3MFRA 4YJUA 3AG9A 4KIKB 2PZ5A 3UTOA 4RWKA 5D11A 4QMWA 3OEZA 2QG5A 3C50A 3PUPA 3UQCA 5TKDA 3VUMA 3L1SA 2PVHA 4CT1A 3FMDA 4ANLA 2B9FA 2BR1A 2WIPA 3CJFA 4C57A 3PIXA 4I1ZA 5CF5A 2J0JA 2X2MA 3NRMA 3FV8A 4IJ9A 3R73A 4I94A 4D9UA 3TJCA 3O50A 3PSCA 3FQSA 4NT4A 4AN9A 3O51A 1HOWA 2W1CA 4QP1A 4BGHA 3KU2A 1SM2A 1Z9XA 2OIDA 3JS2A 4IX5A 3SW7A 1ZOHA 1G8SA 5M06A 5GZ9A 1E1XA 4ONAA 4BCGA 2J0IA 1WBNA 4N6YA 3RMFA 5IQBA 2PL0A 3CD3A 4WD5A 3LM0A 2VTMA 3H0YA 3VRYA 3NCGA 4D0WA 5IISA 4CD0A 2OWBA 3KGAA 4MD9E 2BAJA 3W18A 3LJ0A 2W9ZB 4TNBA 3MTLA 1H27A 3D15A 2ITPA 5BVKA 4BY9E 2PVRA 2IEWA 4NTSA 5ETFA 5HX6A 3AMAA 3E7VA 5CQWA 3TXOA 4X2FA 2H6DA 3E64A 1DI8A 2XZSA 4KNBA 2YERA 3D83A 2C4GA 3EQGA 5AP2A 4GL9A 2YIRA 3W0QA 4XHKB 5J8IA 5BYYA 2I6LA 2PVFA 2HENA 3QF9A 2XVDA 4FTIA 1HCLA 3RNIA 3MY5A 2OU7A 2WIHA 4O0UA 5EI6A 1XH7A 2GHGA 2BZKB 4IBMA 4JBQA 4FT5A 4AUAA 3DKCA 4BDCA 3ODZX 4DGLC 3WF7A 3S00A 5C01A 2JIVA 4DDIA 2XK6A 1OL1A 5A4LA 5BMMA 3QA8A 4U5JA 5IKWA 3DV3A 3MB6A 2JBPA 5C03A 4LOQA 3U4UA 3P08A 4RJ8A 5HE0A 5IG1A 3UIMA 3KXMA 5CAUA 4L68A 3V04A 2BVAA 1Q97A 5LWNA 1OI9A 4GFOA 4HJOA 3EZVA 3PJ1A 2C5XA 3UO4A 5JFSA 4A9RA 2PUIA 3FMMA 5EQPA 2P2HA 4AGUA 4FV4A 4RIXB 2WMUA 1UKHA 2VTAA 2BUJA 4UALA 3U6HA 2YCQA 3H30A 4F7LA 3VONA 1Q41A 4MBIA 4PP9A 3A4PA 1Y6BA 4FNYA 2BCJA 2G9XA 1FPUA 5CU3A 3RPVA 4EOSA 3ZCLA 4PNIA 4JX7A 1FINA 3BEGA 3O8UA 2JDVA 4KBKA 3RAHA 5JKGA 2NRYA 2PWLA 3FKOA 4ERWA 4L46A 5GZAA 4YJSA 1XH6A 5BVFA 2UUEA 2P0CA 4YLKA 1JPAA 5EKNA 2GHMA 3BLHA 3PYYA 4IAKA 5DH3A 1WBVA 4FEQA 3CPBA 2BRHA 4WSQA 1IASA 2HW7A 4YZNA 4IVDA 4O4EA 3NVKI 3PLSA 4I0RA 4JIKA 4L3JA 4RLLA 5DBXA 2Y6MA 3SKCA 4EHZA 3N4VA 5M55A 4F0FA 3GB2A 3CQWA 2WMBA 4TT7A 4ZSLA 4JRNA 3FPQA 2YN8A 1OPKA 5G1XA 4M69A 4EK5A 1HCKA 2VNWA 3ZH8A 5HLNA 5DEWA 1IAHA 4QTAA 3HMPA 2JEDA 3KA0A 4APCA 3A8XA 4KS7A 4IAFA 1OITA 1LEWA 4U45A 4OAUC 4FUXA 4OBQA 2XIRA 4BF2A 4CTBA 2R3GA 4U0IA 1V0OA 1IR3A 4CV8A 4BDGA 2QR8A 4N57A 3ZU7A 4S30A 1ZZ2A 5CT0A 2Z02A 2X7GA 3AKLA 1JSVA 2BIKB 3F7ZA 3QZFA 4D2PA 2IVTA 1ZYDA 4O7NA 4AACA 5FUTA 3CTHA 2GNLA 3HAMA 3VS1A 5FRIA 4DINA 4CQGA 1P4OA 4HGSA 3RM7A 5HG8A 4GMYA 1W84A 1SMHA 3SX9A 2XUUA 2XKEA 4PRJA 3ZFXA 3LMIA 5L2WA 2QCSA 3D2KA 5HG7A 5EW3A 3G9LX 1Y6AA 2W7XA 1KE9A 5DLSA 5LVMA 2PVYA 1R1WA 3K3IA 1MP8A 2QOFA 2Z7LA 3KB7A 3HRBA 2WQOA 3DXPA 2XEZA 4CFUA 3RWQA 5HD4A 2UZOA 5J79A 3ZO1A 5A4QA 3ORIA 3UZTA 4Q2AA 3G9NA 3AMYA 3QQGA 4EOOA 3V3VA 4KRCA 2X0GA 3AMBA 4NFNA 3T3UA 4YLLA 4MNEB 2FSMX 4C37A 4NYEA 1J7IA 3KXHA 4B6LA 4EKLA 2F7ZE 5AM6A 3WYYA 4UY9A 5CU2A 2UW8A 4ZZOA 4EEVA 5HVJA 1OBDA 3EN7A 5TT7A 4DH3A 4GW8A 2AYPA 1DS5A 4P2KA 1JWHA 4EK4A 1P5EA 5HE1A 4ANOA 4QD6A 2VGPA 3QYZA 4AQKA 4O0YA 3DT1A 3R9DA 5BYZA 2UZTA 1RW8A 4C4GA 4BDKA 2PK9A 3KN5A 1JVPP 1A06A 3OZ6A 2HWPA 4CZTA 4V01A 5EDPA 4EK6A 4W4VA 4ZXTA 1OL5A 3KMMA 3OUNB 3MH3A 3RALA 4E5BA 3I0OA 3MVMA 2GQSA 1GNGA 4EH6A 4YZBA 3FJQE 4OGRA 4C61A 2RL5A 4U79A 4PMPA 2I0VA 4FIHA 4I4EA 4L52A 3DBDA 3KMWA 2YAAA 1SZMA 4Y83A 3F66A 3GOPA 4G5JA 4YJOA 1ERKA 5HHWA 4X3JA 3SD0A 4I3ZA 4BCPA 1U5RA 1Q8YA 4EHVA 2X1NA 4XOZA 5DN3A 4R7HA 5CU0A 5C8KA 4LV5A 5CWZA 4YTCA 3HUCA 3TKIA 3C0GA 3MI9A 3W2SA 5AP6A 3EFKA 3JY0A 1ST4A 5L6OA 4IZAA 3NFGB 5IH5A 4NTTA 2HIWA 5HESA 5FTGA 2J50A 4NH1A 3FMLA 5I9VA 3HAVA 3UC4A 3VJNA 1PJKA 4H39A 5HE2A 4ID7A 3TZ8A 3EN9A 3CKXA 3TNWA 3ZC5A 1XMLA 2RGPA 4LV8A 4W9XA 3AC2A 3ULIA 2BAQA 4MBJA 4FK6A 1WBTA 5C8NA 4IM2A 3M42A 5F9EA 3QCYA 3EH9A 4YMJA 4DEDA 3PFYA 4IAZA 4BYIA 1UWJA 3ORPA 1XBBA 3L8XA 4TYHA 4IAAA 4ACCA 4RFZA 4OTQA 3M1SA 5BPYA 4PDPA 3LVPA 3LFBA 4QMXA 4QO9A 3UBDA 3ORXA 2QC6A 4ASZA 3WI6A 4IB5A 4DDGA 5LQFA 5HNBA 3OW4A 2C6OA 3DKFA 2IW9A 2PTKA 4JJRA 5EHOA 3KK8A 2R3HA 4D2TA 2BAKA 3FDNA 4KKGA 4FTOA 4QMVA 5JSMA 3VHEA 2J5FA 5C4LA 2ZV9A 3AKKA 1QPJA 5I9WA 4FODA 4LMNA 3EQPA 4S2ZA 2B9HA 2RSVA 3VHKA 2X7FA 2W4OA 5KMOA 4L45A 4YJRA 3FYJX 3ZLYA 3AT3A 4XG8A 2JDRA 2PZIA 3A99A 3BHYA 3WZEA 3SRVA 3P7AA 3PA4A 2XNNA 2OZAA 3LCSA 3R2BA 5HIBA 1BL6A 1UV5A 3JVSA 3OBGA 4ALWA 4L43A 2W99B 3KCFA 4FL1A 5DMZA 1YOMA 4RFMA 3I7BA 1XJDA 4R3CA 5HD7A 2OGVA 2VRXA 4UB7A 3LCOA 3N4UA 1JBPE 2HZNA 2J51A 4EWHA 3WZKA 5AV4A 5LVNA 4P5ZA 3BCEA 5DOSA 3JXWA 3TV7A 5B2LA 3LFCA 4GK3A 5IA1A 4FTUA 5FG8A 5D10A 3ZEWA 4C58A 2FH9A 2XNGA 4AFEA 2BHHA 5CALA 4M13A 4EK3A 4M3QA 3HECA 3PG1A 4YHTA 2X6EA 2WTWA 4B9DA 1WBSA 4K6ZA 4O86A 5HBJA 5D41A 4C4HA 4RJ4A 3HV4A 5DVRA 4EJNA 5KMNA 2UZLA 3QTQA 1Q62A 3I5NA 3TT0A 5CAPA 4GS6A 4FZAB 4IADA 4W4XA 2VV9A 3ET7A 3FC2A 3IONA 4TY1A 2QOKA 2PVMA 4LG4A 4XRJA 4FIGA 2C5YA 1L8TA 3NUUA 3FI3A 4U40A 1W83A 4H05A 2OLCA 2R7BA 4CG8A 2WGJA 2R3MA 4QDVA 3WIKA 4JDHA 4AW0A 3P7CA 4KWPA 2G1TA 4O27B 4RT7A 5DR9A 3PPZA 5DT3A 4DT9A 3KK9A 4W4YA 4DH7A 2P33A 5T3QA 3OWJA 4LRKA 4B7TA 5IEVA 4JLCA 5HG5A 3UOKA 3E88A 2RFDA 2HYYA 5F4NA 3IDBA 2VTJA 3AXWA 4TNDA 4C33A 3C0HA 2C30A 4EK8A 4PMTA 4WSYA 2NPQA 5L2SA 2P2IA 3V8WA 1M14A 3TUCA 3LAUA 2XK7A 3LFNA 4TKSA 3Q2JA 2XANA 4XCUA 3PP1A 2QD9A 2QOLA 3WF6A 2WTKB 3QC4A 4CZYB 4CSVA 5AAEA 5HVYA 4FSNA 4L9IA 4RPVA 4MXYA 2ITZA 3ZSHA 3BHTA 2HY81 4MXAA 5JN2A 3HDNA 4G2FA 3I4BA 3OC1A 4PDSA 3LCTA 4JT3A 2CKQA 3SA0A 2I7QA 3V8TA 4RX8A 3HMOA 3RAIA 1KE8A 2VAGA 1H1QA 4D5HA 2WMRA 4CFWA 4ANMA 4O7LA 2G2HA 5JT2A 3AT2A 2GQRA 4L8MA 4U42A 4DHIB 3EIDA 5DGZA 4IHPA 1GIHA 3RAKA 2VWXA 3SGCA 1PXIA 1REKA 4H3QA 5CVFA 4KBAA 4CKIA 4FA2A 4AS0A 5K4IA 4L3LA 5GHVA 3V5LA 2FO0A 2JAVA 4A4LA 4S33A 5IUHA 3UVRA 5CTPA 2PZPA 3ZXTA 3F3ZA 3EKNA 3MJ2A 3IQ7A 3UMWA 4DC2A 3OMVA 4ZK5A 4U8ZA 1YHVA 5E8WA 1IAJA 3E5AA 2WKMA 4O1PA 3REPA 3F2RA 1R0PA 4GCJA 5LXMA 1QPCA 4FTJA 4ZJJA 1H1PA 3E92A 3PSBA 4C59A 4QMMA 4PDYA 3ORZA 1ZY4A 3R1SA 3ROCA 5HORA 4FG9A 4G9CA 3EQDA 2Y8OA 3F6XA 3VUTA 1LEZA 4S34A 4Z3VA 4DH8A 3R0TA 4DEGA 3TACA 3VUIA 3L9LA 3F3VA 2Z7QA 3TYKA 4QP2A 2BMCA 4XH6A 4KABA 3ZS5A 2PPQA 1BYGA 3V5QA 3SVVA 5B7VA 5ANIA 1VJYA 3BLRA 1P14A 3CCNA 2ETRA 4FV8A 4RQVA 3GCVA 4QPMA 3DKOA 5HO8A 1XH9A 3ZRKA 2YACA 2EB3A 2ONLC 2XRWA 4BZOA 4BWXA 1LP4A 2X6DA 4I0SA 5CZIA 1VEBA 3KL8A 5FLFA 3V51A 3ZBFA 4TL0A 4RWJA 5J9ZA 2VTPA 3ZMMA 4EORA 5FTOA 3B8RA 4B8MA 3CTQA 4YNOA 3QTSA 3MWUA 3PY3A 3MB7A 5G6VA 1G8JA 3CY2A 3WE4A 4AX8A 2XM8A 3V5WA 3ZUVA 2ZM1A 3NYOA 2EXEA 4DEBA 5CLPA 4I21A 1ZY5A 2GS6A 2XAMA 1YHWA 2DS1A 5CU6A 4EC9A 1OUKA 3L9NA 4A9UA 2PVNA 3FKLA 3ZSIA 2R3KA 4PNKA 1PXNA 4UYNA 3OCBA 5FD2A 4BDFA 4FSTA 4IEBA 4OTGA 3PA3A 4BCNA 5FXRA 1AD5A 3K54A 5CF8A 4D5KA 2O0UA 5JQ5A 1VYWA 2QNJA 2C6LA 4K77A 3ZRMA 3NLBA 2VWWA 5ACKA 3GU7A 4F78A 2Z2WA 1WAKA 3LCDA 4GFMA 4K2RA 1T46A 3PDTA 3ZO3A 3UVPA 2F2CB 1OPJA 4BBEA 1V0BA 3UNZA 1IEPA 1M2QA 3VW8A 1YDRE 2F2UA 3BU6A 2E9OA 2YEXA 4WNPA 2VNYA 4XG9A 5AR3A 2CNVA 1XH4A 2C69A 3BYSA 3GC9A 4BZDA 3R1YA 2BHEA 4O22A 4OTRA 1REJA 4JBVA 5K5NA 4O81A 4LL5A 3UG1A 1FMKA 3D5WA 4V0GB 3OOGA 2ZM3A 3VS0A 3MPMA 4BICA 2RFNA 2X0OA 4A07A 3W2PA 2XP2A 5M4CA 4X7QA 3ZFYA 2HZ0A 1H26A 4AG8A 4XBRA 4MAOA 2NO3A 4P4CA 3RM6A 3BHVA 4ARKA 5ANDA 2R7IA 3R6XA 4CV9A 4FEWA 5M4FA 1CKPA 3O2MA 3EFWA 4FTAA 4UMPA 3PZHA 3K5VA 4KSPA 3OFMA 3I6WA 4FG8A 5CSHA 3ZM4A 3QTZA 5AP4A 3MIAA 4D9TA 4D4RA 4I5HA 3HMIA 4ZZMA 5AR7A 3RHKA 3UQFA 3DA6A 2JFMA 4F6SA 4QNAA 4XOYA 3FZTA 3L8SA 3BV3A 1QPDA 2OJJA 3O8PA 3ZYAA 4CQEA 4J99A 1BKXA 4BL1A 4DF3A 5BVDA 4YUQA 3FI2A 1K3AA 5AP3A 4F7JA 3GFWA 4ZS0A 5HX8A 5CI7A 3VBVA 5JRQA 4R3PA 4FV6A 3FLNC 4FG7A 1WCCA 4L7SA 4B4LA 1UU9A 1PMVA 3RINA 2X0QA 1ZZLA 5T6KA 3QXOA 2BRNA 1Q3DA 4C4EA 2EUFB 2ITTA 2WQBA 3LW0A 5H8BA 2OF2A 4YHJA 1E1VA 4FUYA 4DGOA 5C26A 4UEUA 5KE0A 4FV3A 3GCQA 2X4FA 4FF8A 4IIRA 1YWRA 3O96A 2GHLA 4NSTA 4IVBA 4RJ5A 4RJ3A 3EQFA 4K33A 4D2VA 3N51A 3PRFA 4X6QC 3DFAA 3W8QA 4FT3A 4MX9A 1QPEA 5ANEA 3QLGA 3UQGA 3UZPA 1OKVA 4NIFA 5BUEA 3LPBA 3UDZA 2BALA 4NJDA 5FEEA 4BN1A 1APME 4JR3A 4BGGA 1A9UA 4YSJA 5H9BA 4M84A 5M4UA 3DDPA 4PTGA 5AR8A 4XV2A 3JUHA 4ZTQA 4C4FA 3TV4A 1IA9A 4KIPA 2PE1A 3R8PA 3CSVA 1FOTA 4UMTA 2W0JA 4EOJA 2B9JA 1IA8A 3QQHA 4O0VA 2QR7A 4ALVA 4NIFB 2C6IA 3UO5A 3QHRA 5AFVA 3ELJA 3Q6WA 4IACA 4ZEGA 1URWA 4RIYA 3NIZA 3V6SA 4ACGA 4CFVA 2XRUA 5ANKA 4D4YA 5TF9A 3MY0A 2GCDA 5FGKA 5B2MA 3P0MA 3FZRA 4F63A 2E9VA 4Z9LA 4UMQA 3B8QA 2YIQA 5EOBA 1UVRA 3PWDA 4GFGA 5KBQA 4OUCA 2WQEA 2UZEA 3AGLA 3KKVA 5CVHA 4AGCA 5I3OA 4RIWB 5KZIA 4FYNA 4R7IA 4FSQA 4WOVA 3P7BA 5J5SA 2XNBA 3A60A 3PA5A 3OUKA 3QC9A 4FKJA 4KD1A 4XEYA 3QTWA 3HMNA 2LAVA 2QLQA 2WOTA 4E6CA 3H9OA 2PMIA 3MFSA 3BWJA 3OEFX 3GXLA 4MQ2A 1KE5A 4RVTA 2O5KA 4XG7A 5FXSA 3NNVA 3O71A 4NCTA 1UNHA 4FI1A 4HGEA 4R8QA 4QTCA 4ZSJA 4YU2A 4LGHA 3UODA 1ZMUA 1PXPA 3KXZA 4GVJA 2UW9A 3EQCA 4IVCA 4D28A 3SXFA 4D58A 4DTAA 3WF5A 4NJ3A 3QA0A 4D2RA 5K0KA 1M7NA 4Z16A 3ZZWA 4I41A 3U8WA 1DI9A 2YM8A 2VTIA 4OTFA 3O7LD 4F70A 3G6GA 4AW2A 2Y6OA 4FIEA 2R3NA 3RK7A 3SOCA 1SVHA 3ZFMA 2C1BA 4EZ7A 1WVWA 4MXCA 3DGKA 1J1CA 4I5PA 4QMPA 2I40A 3NUSA 2HK5A 2QHMA 4IDVA 1AQ1A 4KIQA 5D1JA 1O6LA 4K0YA 5FTQA 4ZIMA 3V5TA 2OJIA 3LE6A 1BI7A 4FIJA 2CLQA 2O63A 3D9VA 4TWPA 2IN6A 3IECA 5TO8A 3WZDA 4JR7A 1ND4A 3HGKA 2WTKC 2PVJA 5CAOA 2XA4A 3OP5A 3Q60A 4DG2E 3U6IA 3W0OA 2QVSE 2VTSA 1Q5KA 2W06A 4BDHA 3KVWA 1XO2B 3NNXA 4UXQA 3G33A 4GIHA 4RGJA 2WZJA 4XS2A 3VW6A 4AE9A 5DNRA 5A14A 3KQ7A 4C4JA 2C0OA 4HCTA 4FSMA 4YBKA 4I24A 3GCPA 4ASEA 4TYIA 3HV7A 3RZBA 4NW6A 5K9IA 2VO0A 3FMJA 3LFSA 3PSDA 3QGWA 5LARA 3PXKA 2JKOA 3LLAA 2YDKA 4QMTA 3VUHA 5HCXA 3WOWA 2ZAZA 5LJJA 5CAQA 1AGWA 3L9MA 4RWLA 3QTXA 4GUEA 5JZJA 2VGOA 5CX9A 3Q04A 3GU5A 5D7AA 3C5IA 3AC3A 3R9NA 3T9TA 1H0VA 4UXLA 4QP4A 4O0SA 3PUFC 1JSUA 2QOOA 4J96A 3P9JA 2FSLX 1W7HA 1YVJA 3TL8A 2HXLA 1YKRA 4XP3A 4IFGA 4DLIA 3PFQA 4O2ZA 3CPCA 2XKFA 5KMIA 2Y4IB 1PXJA 1WFCA 1KWPA 2BTSA 2EXMA 5C9CA 3BYVA 4CFXA 4JOAA 3NWWA 3RPSA 3FSKA 1QMZA 3NZ0A 5ICPA 2BZJA 3WF8A 4BKJA 4CRLA 4KSQA 2FA2A 2AQXA 5F20A 2V5QA 2XJ2A 3MA3A 3HEGA 3D7ZA 3O0GA 2WEIA 4IJPA 5EFQA 2R4BA 3NMUF 4EOIA 4NM0A 1PXMA 5BUJA 1ZYJA 5HLWA 4DHJA 2YABA 5D12A 4ANBA 2O8YA 1BL7A 4G3FA 3W1FA 5E8XA 4NZWB 5I9XA 3ROYA 2BKZA 4PY1A 3KRLA 5EDQA 4BR3A 4A4OA 1JKSA 1U5QA 5F94A 4F08A 4H1MA 2O3PA 4UV0A 3S1HA 2PUPA 2CN5A 2WTJA 3KN6A 2Z60A 3ENMA 5E8TA 3I5ZA 4M66A 4J97A 5E8SA 3UP2A 1JOWB 1L3RE 1PW2A 2BKKA 3A7FA 3P5KA 3SV0A 4DCEA 4EYMA 2J90A 4NU1A 5HTCA 3DLSA 4AW5A 2P3GX 4CFMA 3Q5ZA 3PRIA 4PF4A 5IMEA 4HYSA 5I5ZA 5IZFA 2DUVA 2VWVA 2UW5A 3P23A 1M2RA 3FBVA 5BX0A 5HIEA 4WBOA 3BWFA 4FKPA 2OFVA 2AC3A 2WMXA 2ZV2A 1CDKA 3D5XA 4TWCA 2IW8A 2C5OA 3ZHPC 4IM3A 4YPSA 3O17A 3V6RA 5L8LA 3QLFA 2E2BA 1OKWA 4M0ZA 3IGGA 1H8FA 1NVQA 2BTRA 3UG2A 3EQRA 5AP5A 2A4LA 5AP1A 5AUUA 3NYVA 2B53A 2UW3A 5H3QA 5M56A 3FC1X 1VR2A 4RWIA 3VVHA 3ZONA 3GC8A 4FTRA 5A3XA 1OMWA 4C35A 2EWAA 4BKYA 1MRVA 3ZM9A 4BCIA 3KRXA 5FDPA 4FTCA 4OT5A 4QP6A 5BMSA 3DK3A 3R7IA 3SXRA 2B1PA 4ANQA 2Y0AA 1RE8A 5JFWA 4FK3A 1Q8ZA 4X0MA 4RVMA 4DA5A 5GIOE 5M44A 3MJ1A 3QQJA 3JVRA 4O0TA 3FQEA 3Q52A 4ZLOA 3BGQA 4FKGA 5AIRA 2PE0A 3IW7A 3W2CA 1Y57A 1OGUA 4WKQA 4AZTA 5GJFA 2VTRA 3VIDA 4ERKA 4J7BA 4XMOA 3TV6A 1JLUE 4BKZA 1ZRZA 3VS4A 4RLKA 4U7ZA 3R30A 2UV2A 3GNIB 4H3BA 4BCFA 3EQHA 4ENYA 4GK4A 4U43A 4AGWA 3EHAA 3DJ6A 1W82A 1YRPA 1YWVA 2GTMA 2F9GA 2W1FA 4GYGA 3TZ7A 4DAWA 4QPAA 5IU2A 3KFAA 4RMZA 5L2IA 3GQLA 3QUEA 4F9BA 4G3DA 4IH8A 4M69B 3SAYA 3VF9A 4C2VA 3KXGA 3NDMA 4I22A 2OG8A 4JXFA 1CKJA 5HGIA 4NKAA 4OTPA 4AXFA 1F5QA 1PKGA 2OI4X 5DEYA 4C8BA 5AEPA 3E8DA 4D1XA 5CEKA 4K1BA 5EM5A 3OWPA 3ZRLA 3L9PA 2HELA 4IM0A 3II5A 4NM7A 3CXWA 4TW9A 4G3CA 4IVAA 5E1EA 1CSNA 2XCHA 4F9YA 3C1XA 2CGVA 3E8NA 3LFDA 3H0ZA 1GOLA 5JGAA 4YTHA 2CJMA 3PVGA 4BZNA 4U9AA 1YDTE 3VS7A 1NVSA 4F1MA 5J5TA 3A7JA 2IJMA 5DRDA 5IA4A 4TPTA 3D0EA 3LFFA 5AP0A 2OJGA 1DAYA 1OB3A 3LFEA 3PJ3A 4YNEA 4E4XA 2CCIA 1YOJA 3Q9XA 3U54A 3QTUA 4YTFA 3E7OA 1QCFA 2P55A 2YHVA 1FBNA 1SYKA 3DS6A 4LM5A 5HCZA 4QYHA 4WUNA 3ZC6A 5FM2A 3ULZA 4FZFB 4OT6A 5IQHA 5EM8A 3ZO4A 1PKDA 5L4QA 4DGNA 2QU6A 3ZLXA 1GZOA 3IW6A 4OBPA 2WFYA 4DE4A 2JC6A 3BYUA <