4E5WA

Jak1 kinase (jh1 domain) in complex with compound 26
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
302
structure length
292
Chain Sequence
GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKNHIADLKKEIEILRNLYHENIVKYKGICTENGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK1
total genus 91
structure length 292
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e5wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e5wA01
3IG7A 4EJ7A 4QTDA 3D5UA 4UMRA 3QTQA 1W98A 4FV2A 3WF7A 4I92A 5HBJA 4HGEA 5AWMA 1PMVA 4BGGA 4O96A 2ZYBA 4ZTMA 1LEWA 5CNNA 5J87A 3CJFA 1WFCA 3BELA 3EQHA 3NNXA 4RJ5A 3SXFA 2F4JA 5JN2A 4PDSA 4BZNA 2ITZA 3MH3A 2UW0A 1WBTA 2YZLA 3BV3A 3C4WA 4XV1A 5DYJA 5CVFA 1Q8YA 3D14A 1K9AA 1HCKA 3BX5A 3QLGA 4M84A 4F63A 2YLFA 1E9HA 5KX8A 3POZA 4ANSA 5JFSA 4FSYA 1VJYA 4Y85A 3HGKA 3HLLA 1UU8A 4X3FC 3L8VA 5HZNA 3I4BA 3Q53A 3CD8A 4PQNA 2W1GA 2GFCA 3RNIA 3NUAA 3KXMA 1IRKA 1OPJA 3DKCA 2CKOA 5AR4A 2B7AA 3BPRA 4AZFA 3JR1A 2HELA 3AGLA 1SZMA 5CF4A 4R5YA 5CI6A 4DG3E 4PPAA 4LM5A 4WT6A 2J5EA 4GUBA 2XK8A 5TE0A 1OPLA 3UC3A 5AV2A 3IW5A 4IZYA 2XCHA 4OTFA 1OPKA 3DAKA 3NNUA 2XKDA 3L8PA 3EHAA 4A9SA 4ITJA 1OL5A 2NPQA 2XNBA 4RLLA 4YTHA 3K3JA 3Q2MA 3WOWA 4ANNA 4AGWA 1V0PA 2QOBA 3UPZA 2HAKA 3KRJA 3HV3A 4FT0A 5J79A 3BHYA 5M53A 4W4YA 4X6RA 4R1YA 3HAVA 3QXOA 4GCJA 3S4QA 4CTBA 3GUBA 4LMUA 4E4LA 4DEAA 4IB1A 3EN7A 4U5JA 3GQLA 3GU4A 5IMEA 4DEHA 4HNIA 1H1PA 4I22A 4FV7A 3CPCA 4KABA 5IG1A 3WF9A 2WNTA 3DS6A 3TIYA 5ITAA 2JGZA 4IFGA 3HYHA 2VWXA 4FZ7A 1T45A 3BQRA 4AG8A 2XRUA 3GEQA 3IQ7A 4MXCA 5HNBA 2UUEA 4EORA 5DRDA 4EH5A 1RQQA 2GNGA 4FKRA 3QUPA 4WA9A 4NJDA 4PP7A 2R3JA 4S34A 3ZRLA 4BF2A 2V7AA 4LRMA 3W2CA 3IW7A 3MN3A 5ETCA 2O2UA 4X2GA 3U6IA 4BYIA 2GCDA 2UZWE 5I9YA 4OTDA 1G8SA 2QURA 2GNJA 4HJOA 3AQVA 5FTOA 3M1SA 3RALA 3VBTA 4HPTE 4AGCA 1KSWA 2QHMA 4BKYA 3ZSGA 5IZFA 2WZJA 4RRVA 4NZWB 3KXXA 2OLCA 3T8OA 1AQ1A 3SV0A 4DGGA 3HA8A 3WARA 3LFAA 3WF8A 3EFLA 3R1YA 4O22A 1JAMA 4DFXE 1O9UA 2GNHA 3C4FA 3RZBA 2QCSA 2B9JA 4GEOA 4BB4A 5GZAA 3CGFA 4J8NA 4F08A 5C4LA 1SNUA 1ZMVA 3E7VA 2VGPA 3ZO4A 2XIRA 3G15A 2YZAA 3SHEA 3MJ2A 4XBRA 3N9XA 4G6NA 3RWQA 4PMPA 4FSQA 3O23A 4U9AA 3IW4A 2JIVA 3FC1X 3QZIA 3E5AA 4AA5A 4Q9ZA 1KE5A 4TNBA 2UZOA 5AM7A 3MYGA 3P7BA 3QX4A 4QP2A 5EM8A 4G6LA 4ACCA 3OTUA 4X21A 5CLPA 4D2RA 3RM7A 3GP0A 3ZLSA 5K0KA 4YO4A 5A14A 3R8ZA 4RFYA 4R6VA 2OWBA 1Q3DA 5FEQA 1PXMA 3AC1A 1LPUA 2C6TA 2ETKA 4F9BA 5JRSA 3AC4A 3DNDA 4ALUA 3NGAA 3R7YA 3ALNA 1W7HA 1BI7A 4A7CA 4FL3A 4IIRA 1RW8A 4FI1A 4UMTA 2Q0NA 2V7OA 4C4EA 2WGJA 5I9VA 3DT1A 4ZTQA 1W8CA 3FLQA 4RFZA 2J51A 2F7EE 3QKLA 4MXZA 2WMBA 2C0TA 4TTHB 4CMUA 3I5ZA 1FMOE 3HV7A 2IWIA 3OD6X 5J5TA 3DY7A 4UX9A 4ZLZA 4ZSLA 5A4LA 4AOTA 3ZZEA 1SNXA 5IA0A 1GIIA 4UV0A 4N6YA 3ZEWA 5EQYA 1G8AA 2BRNA 1URCA 1O6KA 3ZLXA 4GFMA 2FYSA 4FC0A 4I93A 1Y8YA 3D5VA 3EYGA 4GMYA 1XKKA 3S95A 4CRLA 1UNLA 4BHZA 3QZHA 3A2CA 2XK7A 3ERKA 4O7SA 1GZOA 5AUZA 3RK7A 2XIXA 3HUBA 3KU2A 3DA6A 1YWNA 1A06A 5JFVA 3K2LA 3RPRA 5DFPA 2JDSA 4MHAA 2NO3A 2W96B 3H4JA 4MXOA 4YJOA 3TI1A 2HYYA 4II5A 3WZKA 4F65A 4BICA 4MTAA 5J9LA 3D94A 4G9RA 3PXRA 4IAKA 3RP9A 5IQGA 1M7QA 4QMYA 3HDMA 2VTNA 4ZTSA 4C37A 4EOLA 4S31A 2DWBA 3HECA 3FKOA 5I5ZA 2QU6A 3D9VA 5IU2A 5HVJA 5DA3A 3PG1A 4NFMA 4RA4A 3VUIA 3QALE 2PVHA 3VUMA 1TVOA 2UW6A 2XS0A 3SG9A 4Z3VA 3GCPA 3VBYA 4R1VA 1M2PA 3F7ZA 4O38A 3D15A 3IGGA 4QP4A 4M69A 4CLJA 3DXQA 3CQUA 4IANA 1FVVA 4IWPA 5JQ5A 4QQCA 5AAGA 1OKWA 2W5AA 3LCKA 4R77A 2WIPA 2OJJA 4CKJA 1PMEA 2OK1A 3FI2A 2V0DA 3JY9A 3LVPA 3PRFA 2VD5A 3ORIA 3TDWA 3OT3A 3F3UA 4P2KA 5FLFA 4IADA 3UGCA 5CU6A 4F0FA 4FTKA 5B2MA 4FTUA 2CKQA 1FVTA 3OUKA 4BTFA 1PMNA 1UU9A 1YXXA 4RMZA 4YC6A 4ITHA 3NX8A 4BKJA 4O0XA 4IX4A 4DEDA 4CG8A 4FKSA 2JDTA 2FH9A 2W1CA 4YNOA 4TYHB 4C58A 4HVGA 1IA8A 5DN3A 3QQFA 5IDPA 5ANIA 4ZJVA 4R3RA 5IISA 5ANEA 3UVQA 2ZDUA 4CFNA 4NCTC 3R7GA 2IZRA 4N4SA 4ACHA 2QODA 2VO7A 1ZY4A 3QQJA 4KBAA 3QZFA 2G2IA 4BYJA 2CLQA 5CALA 3GU8A 2OJIA 4D1XA 4FEWA 2YHVA 2ONLA 3IOKA 5HBHA 2XMYA 2X0GA 3VULA 3VUGA 2W1FA 5AV0A 2BVAA 2YIYA 4ZAUA 3G5DA 3QWKA 4GU6A 4IAZA 1H0VA 3F6XA 5CZIA 4BFMA 2A4LA 2YM5A 4AZSA 3G2FA 1YVJA 5FD2A 2IN6A 3S0OA 2C6IA 3HUCA 4GJ3A 5AP7A 1FMKA 4FGRA 1YWVA 4B9DA 1UKIA 4O0RA 3K5UA 4J98A 4ZOGA 5BVKA 1V1KA 2P33A 1Z9XA 3OW4A 3UMWA 2R3GA 2HZ4A 3UJGA 2QO9A 4AN3A 1CDKA 5GIOE 4QYYA 3PLSA 5IA4A 2WHBA 2OFVA 3AG9A 4FG9A 4ZTHA 2JFLA 3OWLA 4LL0A 1PXKA 4K1BA 3FJQE 4ONAA 5AX9A 5GHVA 2QG5A 5LCJA 4OTPA 4QP9A 1MRYA 3TZ8A 5CAOA 1JKKA 5HLNA 4I0SA 3FV8A 3OS3A 4DEEA 3R63A 4PNKA 2WOTA 3CS9A 3NYXA 5AP2A 4CQEA 4ZEGA 4FVPA 2R5TA 5AUYA 1JPAA 3A4OX 4M8TA 4O1PA 2GQSA 1QPEA 3I5NA 3OOGA 5HESA 4WUAA 1ZYJA 3W18A 5BYZA 2XKCA 4TPTA 4TRLA 4OW8A 3AD5A 2OZAB 3BWJA 3EQPA 4AX8A 5KMJA 3ZSIA 4MQ2A 3R73A 5DRBA 3TT0A 1ZOHA 4G17A 4K11A 1XBBA 5CTPA 3BHUA 4IB0A 3CE3A 4M15A 3E7OA 4DF3A 2B53A 3R7OA 4DG2E 3BGQA 3EQRA 3P4KA 3WBLA 2PY3A 4ZP5A 4OBPA 1A9UA 2FSOX 3WYYA 1APME 3R7IA 1XH7A 4ZLOA 2W4KA 3G51A 4QP6A 4QMSA 5DR9A 2W5HA 4O0TA 5F4NA 1EH4A 3F2NA 4XEYA 2YABA 4AF3A 4WNKA 5L2QA 4HVSA 3ZXTA 2W0JA 3RHKA 4DE4A 2RG5A 5IEYA 2WEVA 1BMKA 3KCFA 5HG5A 4YJRA 4O21A 1MQBA 3V5JA 1R78A 4H1MA 4WNMA 1Q3WA 2E9OA 2OF2A 3R21A 4RVLA 4O81A 1CMKE 2PZPA 2PVJA 2XM8A 1ZOEA 4FTTA 4J71A 2OXXA 4ZTNA 3UODA 4BBMA 3MWUA 4D2WA 2UW8A 3QBNA 5GZ8A 5AAEA 1KOAA 3R7EA 3ULIA 5IUHA 3TV6A 3F5PA 4R7HA 3KK8A 5HO7A 3FC2A 1R0PA 2YWPA 3PJ3A 5JGAA 2G9XA 3PTGA 3VQHA 1YHWA 4RIWA 3LJ1A 3CSVA 4CRSA 2VWBA 3TTJA 3R9RA 5HQ0A 3GC8A 1FGKA 5H8GA 4AZVA 1OB3A 1VYZA 1OGUA 5J95A 2BPMA 4I23A 3O71A 3B8RA 3ZHPC 3PZHA 4IEBA 4B8MA 2B0QA 4HVDA 2X2MA 3OY1A 4MNFA 3O17A 4FR4A 4FV4A 3NR9A 5FM2A 5DT4A 3VF8A 4FSNA 3U55A 4FKUA 3FUPA 1UNHA 5HHWA 2XF0A 3IW6A 5LMKA 4OAVB 5AR7A 1H4LA 3HP2A 4U8ZA 3DAEA 4P5ZA 4FOBA 3T9TA 2HIWA 5EYCA 3RMFA 2JKKA 4BDHA 2UW4A 4R3CA 1WBSA 5ETIA 2OFUA 3LXNA 5TOZA 5FRIA 3N4TA 4NU1A 4EOSA 4F4PA 1YI6A 3U4UA 3DZOA 5JK3A 1XHAA 3A7GA 3V8WA 2RFNA 2RSVA 5HX8A 3WIGA 3TTIA 5AUXA 5LJJA 2X6DA 4L7SA 4V0GB 2CKPA 1PHKA 1MP8A 3OCBA 4XG9A 3TM0A 5JZNA 5AR2A 3FI8A 2IJMA 4EK3A 4A9YA 1LP4A 1OECA 1OMWA 3CCNA 1J3HA 4M0ZA 5BUEA 2R3HA 3A61A 3QXPA 4RG0A 4Z55A 3F7WA 5ANDA 3IDCA 3OBJA 4V0GA 4XP2A 3UO6A 1Q97A 4QMZA 3WZUA 3TCPA 4BL1A 1TQPA 2ZVAA 4ASXA 3FLSA 3ZO1A 4YLJA 5CF8A 3KXNA 4XV2A 4O6EA 1Q5KA 1OKZA 2YM8A 4KKEA 5I0BA 4LV8A 1Z57A 5HE0A 2XYNA 4G1WA 5EW9A 4FIHA 2OXDA 4X6QC 3ROYA 4QPMA 5HLWA 3JPVA 5JFWA 3SG8A 4C57A 3N4VA 1KV2A 3MY0A 1GJOA 2EXCX 3JYAA 5I9XA 4G34A 3FWQA 4LV5A 3DBDA 5TF9A 1NT2A 4EZ7A 5C8MA 2HWPA 1ZYDA 4RSSA 3ORXA 4QMVA 1J1CA 2XNNA 2WKMA 4KIKB 4U3ZA 2ETMA 4K18A 3EQFA 4XOYA 4MAOA 5DEYA 2XUUA 5K0XA 4LG4A 4FEXA 3ATTA 4F9WA 1J91A 2YERA 5DVRA 5TKDA 5AUVA 4BDBA 5H3QA 5EM6A 2JBPA 3DOGA 3PE2A 4QP8A 4RX8A 3C1XA 4NFNA 5TR6A 3I7CA 3L9NA 3R04A 2X7GA 4BCFA 4EUUA 4F6UA 4BIDA 4TWNA 3CKXA 4F0IA 2ZJWA 1UWJA 5ANKA 4OAUC 3AT3A 2OO8X 4BDIA 4O82A 5M08A 5FBNC 3VS5A 4JQEA 2P0CA 3TN8A 2Y6OA 2WTCA 2BIKB 3JS2A 4AW2A 1XR1A 1R1WA 4HCTA 2C1AA 3FMHA 4IJPA 1U59A 1J1BA 4WSYA 3PLAE 1OZ1A 3AMBA 4CKIA 3E64A 4GK2A 4PDYA 3FMDA 4DGNA 2JKQA 4MKCA 4I3ZA 4KKHA 1OL2A 4RIOA 4UXQA 3RPVA 3V5LA 2VU3A 4DT9A 3HRBA 4NK9A 4NCTA 4WD5A 4USEA 4WG4A 4MYGA 5CU3A 4X2KA 3AD4A 3C9WA 2OH0E 3GOKA 3CBLA 2RL5A 4LOPA 3W2OA 4I4FA 4HYHA 5EM5A 3QZGA 2ZM3A 5AA8A 4DFBA 1NA7A 3ENMA 3V5PA 5CEKA 2BIYA 1LR4A 3Q6WA 4XCUA 4GU9A 4BTJA 2YAAA 4FBXA 2GNIA 2WPAA 3PIYA 4FYOA 3FZ1A 3KEXA 3BRBA 4W8DA 3UVPA 4D5HA 4DEGA 3DDPA 3G0FA 3OBGA 3ACJA 5K5NA 4QTCA 4RWKA 4U97A 1BX6A 5BMMA 4YZBA 5AJQA 3K3IA 1MQ4A 2PMOX 4GFGA 4AGDA 4DGMA 4FK3A 4QMTA 3L8XA 2WAJA 3QQGA 4YZDA 4IDVA 2CCHA 4H58A 3THBA 4AW5A 4JX7A 1SMHA 3C5IA 5L6OA 4HW7A 3MVLA 3ULZA 2UZNA 4UMPA 1RJBA 5A4TA 3NVMB 3ORTA 2VX3A 1U4DA 4C38A 2PU8A 2P4IA 3TZ7A 4CLIA 5L6PA 3KXHA 1ERKA 2R3IA 3OCGA 5L6WL 4A4LA 4LRKA 2YDIA 2PL0A 3R0TA 3ZC5A 4JI9A 2SRCA 1PXJA 1H8FA 4G3CA 3OUNB 3PSCA 4HVIA 4QT1A 4ANQA 2QLQA 2H9VA 3P1AA 1GZNA 4JR3A 1VZOA 4RFMA 1WVYA 4X0MA 2CKEA 3KK9A 3GCVA 3EMGA 2GHGA 2OIDA 3O96A 4JS8A 3GBZA 4O0WA 4ZSEA 4IJ9A 1SVHA 2J0LA 2YLEA 4QMMA 4C3FA 2VNWA 4FOCA 2F7ZE 3PXZA 2E9UA 4JQ8A 4B7TA 3EFJA 2X6EA 2QOHA 5FEDA 4F9YA 5LMAA 4OBQA 4F7NA 4XP0A 3L9PA 2VTRA 3QUEA 3PIZA 3WF5A 2UV2A 1HOWA 1JQHA 4D9UA 3VS2A 5EW3A 4RZWA 3E92A 4I6HA 3QA8A 4ZSAA 2W1IA 2R3QA 4YTCA 1JKLA 3P0MA 4LUEA 4AP7A 2NP8A 3EH9A 4EK8A 4QMPA 3GENA 3FDNA 3MV5A 3QTIA 3I79A 3R9OA 5KZ0A 1UKHA 4H3QA 2BDJA 4U45A 4MCVA 4KSPA 3OEFX 3QAME 2QOOA 2YN8A 4YO6A 3V01A 1XO2B 4OTWA 1ZOGA 4O91A 2IW8A 2KULA 3DQXA 3FE3A 4IBMA 4LI5A 4F7JA 2J0MB 4BI1A 4W8EA 2QNJA 4XG7A 4PTGA 1F0QA 4P90A 5E1EA 1M52A 3A60A 3O50A 4GRBA 4C0TA 3FKLA 4EH8A 4RJ6A 3C0GA 5F20A 1DI8A 4E6CA 3MVJA 3QCQA 5FUTA 4AU8A 3JVSA 3MTFA 4QP3A 3SRVB 4KKGA 2C47A 4LYNA 2BILB 4HGLA 3CTQA 4YBKA 5CXHA 3U51A 4FE2A 4JAIA 3OZ6A 4PPBA 3TZ9A 3TDVA 2BRHA 4WIHA 4E73A 4HNFA 4FVQA 3DCVA 4FZ6A 3TV7A 3VUDA 4WSQA 3SRVA 1PMUA 1YDTE 2C68A 3LQ8A 3DBFA 2GDOA 5CNOA 3VBVA 5CT7A 5KMIA 5L8KA 2AC3A 2IVVA 3DK3A 3C4ZA 2NNWB 4PRJA 1JOWB 3FHIA 4IHPA 4WO5A 4CEGA 3G9LX 2O64A 4EYJA 4G3FA 1JBPE 4FTIA 5CYIA 3BEGA 3P5KA 3OXZA 4AE9A 1WCCA 5M09A 4XS2A 4ANLA 5E9EA 2ZB0A 2ZM1A 4XG8A 3BI6A 4D0XA 3V8SA 2BKKA 2C5NA 3KN5A 4N70A 1WMKA 4MBIA 4IM2A 4UYAA 1KWPA 2X39A 4H36A 4D9TA 1PXLA 3IK3A 3RWPA 3ZFMA 2ITPA 3PJ1A 2VTJA 3D2IA 2UW9A 2GS6A 2YCRA 3O8PA 3OOMA 4QMOA 4U81A 3W2QA 3RVGA 2EUFB 5EG3A 4E20A 3LMGA 1DM2A 3Q60A 5FM3A 2C6EA 5BNJA 4DFUA 4OGRA 4XNEA 5AR8A 3VRZA 3RAWA 1KUTA 2XEZA 1B39A 3QYZA 1Q24A 1I44A 3NSZA 4G3GA 2C3JA 4TXCA 1GZ8A 3SDJA 3GC0A 3HMOA 4UWBA 4Q5EA 3F69A 3MA3A 5HO6A 4O7TA 4ZMFA 4XH6A 3VN9A 4IVDA 3H0ZA 3RPOA 1WZYA 4FNXA 4YJPA 2F49A 2OJGA 4EH4A 1JSUA 2XJ0A 4FTLA 4NM5A 4KIOA 4XRLA 4IWOA 3UO4A 3UYTA 3ZONA 2J0KA 5AP6A 3KB7A 3OXIA 5KMNA 4FSWA 3E8EA 2PHKA 2JD5A 3RKBA 4DFYA 1IAJA 2Z2WA 3A7HA 2BMCA 5ICPA 2PE0A 3OWJA 4QO9A 5DE2A 2UVZA 3KN6A 2W4JA 2YIWA 3IOPA 1XQZA 3FAAA 3TACA 2V22A 5J7BA 3R30A 2JLDA 3E63A 2B55A 3ZTXA 3LFQA 3VW8A 4JBVA 2QC6A 4R3PA 3QKKA 5ANJA 2GSFA 2CJMA 4O2ZA 4XOZA 4F7SA 5F95A 4O6LA 4DLJA 3MH1A 3H9FA 4RIXA 1OL1A 3KMMA 4PPCA 4XX9A 4CSVA 5CEIA 4DA5A 4RGJA 4FKJA 1S9IA 3UZPA 2WTVA 4BZDA 3BIZA 4O27B 3ZFYA 2XKFA 1ZZ2A 4MBJA 4UBAA 4EEVA 5KKRC 3CY3A 3FLWA 4AACA 5GZ9A 1JNKA 5KCVA 4CYIA 5DLSA 3QGWA 2WMTA 2PVLA 2J4ZA 2R3KA 3QTZA 4A06A 3BLQA 3FMEA 4JIKA 4YPDA 5DT3A 4PL5A 3AT4A 5I3OA 1H07A 5AUUA 4PMMA 2PMNX 5IUIA 4KD1A 4C59A 5HD7A 4DG0E 3LXLA 3GU7A 4M13A 4FKGA 2VRXA 4GG5A 1OVEA 4QNYA 1A48A 4IB5A 2X81A 4U44A 4R7BA 2BHEA 5C8KA 5C9CA 3RJCA 3ORNA 2AYPA 2QVSE 5DPVA 4ENXA 2BZJA 1OITA 4F6WA 3MB7A 4FNZA 3DXNA 4CCUA 2Y6MA 3CXWA 5EW8A 2C6MA 5DGZA 5AP4A 4BGQA 4ALVA 3R83A 4I5MA 4Z16A 5M44A 4ANBA 5LVMA 4FNWA 2W9FB 2G2FA 3PA4A 2W1ZA 4FIIA 4FL1A 4JDKA 4PTEA 4I0TA 5DHJA 4YHJA 5AP5A 4BDAA 4QPSA 1M7NA 2UZEA 3BU3A 3ORZA 4IB3A 3U8WA 5AUTA 3U54A 5AV1A 4F99A 3TKHA 2PVNA 3PPJA 2VTPA 3KXZA 4EC9A 4EHGA 4O7VA 4X2FA 4CFMA 3TXOA 3DV3A 5KHWA 1LUFA 4K2RA 3MVHA 4AZWA 2E9VA 5M57A 4RLKA 4O1OA 4LOQA 5J1WA 5KNJA 2RIOA 3E8DA 3KXGA 1IAHA 4IZ5A 5DMZA 3CLYA 5H9BA 4CFVA 3LFCA 3LZBA 4XP3A 4BGHA 1W82A 2VWYA 2XIYA 3QD2B 1OIUA 3QQLA 3O7LB 4QP7A 4YLLA 4C4JA 2BTRA 5FTGA 3AMYA 5AP3A 4A9UA 2VO0A 3NCGA 2IW6A 3FZOA 4EI4A 3KVXA 5BVDA 4ZY6A 4QQJA 1ZYCA 3UQCA 3F9NA 5G6VA 2XA4A 2XIKA 3LXPA 5CT0A 5J9YA 2PZRA 2QONA 4GL9A 4H1JA 4IW0A 2JKMA 4BCNA 4EWQA 3QYWA 1U5QA 5D7AA 4ANOA 3HRCA 4KRDA 5HBEA 3W55A 5IQCA 4QYEA 3ENHA 5DI1A 3IGOA 4JBOA 4OTHA 3DLSA 5H2UA 5LMKC 2XNEA 2Y4PA 3ZUTA 3N4UA 2R3FA 3UYSA 3QCYA 4PV0A 3NDMA 3R8UA 3QHWA 5E8UA 4C36A 4ZTRA 3FLNC 1G3NA 4QRCA 4LQMA 1UU3A 2RKUA 3LLTA 2O3PA 4QTEA 2PTKA 4UALA 4GKIA 5CZHA 4OT6A 2ZAZA 1TQMA 2ZMDA 2P2HA 3H30A 3ORKA 3CIKA 3ORLA 4NJ3A 4QD6A 1JSVA 2JDVA 4X7QA 4Y73A 4EYMA 2PULA 2ITUA 1J7IA 5BYLA 5IEXA 3GCQA 4E6AA 3ODYX 3VNTA 4USDA 3B2WA 5EHLA 3EB0A 3BYOA 4ERWA 3R7UA 3VIDA 2W1DA 2C3KA 3GFWA 5EKOA 3VQUA 5A4QA 5AA9A 4HGSA 4IAYA 4S33A 3U87A 5LWNA 1YW2A 2B54A 3WF6A 4AFEA 5IH6A 5LVOA 5CEQA 3VS6A 3FL4A 2BROA 2YFXA 4I4EA 4GIHA 4GT4A 4G9CA 4XG6A 3SX9A 2GPHA 1KE9A 2VN9A 5AR5A 3UC4A 5CENA 4F1TA 5L2IA 3KCKA 3SOCA 3D5WA 1QPCA 3IECA 4GYGA 3FZRA 4H3PA 1YXVA 4TZRA 4GW8A 3MIAA 2VWZA 5CS6A 1PXIA 5M06A 3F66A 4GSBA 3UP2A 3R1SA 2VTLA 1U5RA 4PUZA 3PYYA 4U41A 3W32A 4EHZA 5FBOA 3QTRA 3KMUA 3PXYA 4TYEA 2UZLA 1YHSA 3BBTB 4CKRA 3V5QA 3ODZX 4DAWA 3SVVA 4FODA 5IUGA 4FTQA 4NKSA 2ZDTA 4GVJA 3F88A 4LGHA 3RI1A 3V04A 5HU9A 2OH4A 3RAKA 2GTNA 3W2SA 3JVRA 1TQIA 3UTOA 3C5UA 3EQCA 3NUUA 3PFQA 4F1OA 2GHMA 2WQMA 3QL8A 1WBOA 4PY1A 3QD3A 3V5TA 4EHVA 3FSKA 5HCXA 1QPDA 3OWPA 3ITZA 3SXSA 2BCJA 1R3CA 3PA3A 2WMWA 4NW5A 4FV8A 3Q5ZA 4DFLA 1K2PA 4XJ0A 3SA0A 4AW0A 2J2IB 4FT5A 2F2CB 2W99B 2ZV9A 3I7BA 2JIUA 4MNEB 1P2AA 2PVFA 2QR7A 2X4FA 3KA0A 4KBCA 2QU5A 2ZM4A 4D0WA 4CD0A 1P4OA 3NW5A 2OU7A 2C1BA 4RBLA 1XH4A 2I40A 5EI6A 3OXTA 5D9HA 2Q0BA 5FQDC 4QOXA 5IQBA 3E87A 3V8TA 3EQBA 3F3ZA 4FV5A 3DJ6A 4ZJJA 3TUDA 5E4HA 4A4OA 5F9EA 4E4MA 2PZIA 2RFEA 2RG6A 4I5HA 3FL5A 3KRRA 3FLZA 3IPHA 3CPBA 5EHOA 1RE8A 3FXZA 1WBVA 4M3QA 3H10A 4XLVA 4RVKA 2Y7JA 4JG8A 5FDXA 5HVKA 3PJ2A 3FZSA 4B4LA 1V0BA 1X8BA 5HLPA 3BKBA 4YR8A 2YM7A 3KF7A 2Y8OA 4AGUA 3ANQA 1UA2A 3SLSA 4IZAA 5DT0A 2G15A 3VUTA 3QRKA 3LCTA 3M42A 4GFOA 5CSPA 4EZ5A 2FGIA 4TWPA 2ITXA 3ZMMA 4BDEA 3HV6A 3PXFA 2CGWA 2YAKA 1XBCA 4FUXA 4RT7A 3TUBA 4UMQA 2BAQA 3EN4A 4BIEA 3F2AA 4AT5A 2I0EA 3OMVA 3E3BX 5FWKK 5KMKA 5AUWA 3UOKA 3PZEA 2QOLA 1Q41A 1Q99A 2JDRA 3FHRA 3ORPA 4R8QA 3PJCA 2XK6A 4GS6A 2ITWA 5AR3A 3F3WA 5HNGA 4W4VA 2JC6A 5J7HA 1ZARA 3MPMA 5K9IA 3LXKA 1JKTA 3AT2A 4NM7A 3ROCA 5CAPA 5IQIA 4QP1A 5ANGA 4EKKA 3LHJA 5C1QB 4JJRA 4ZXTA 1IASA 4W4WA 3A7IA 4I1ZA 3EWHA 3KKVA 4YTIA 4YSJA 3O51A 3U6JA 3FY2A 2Z60A 5TT7A 2C3LA 3QRIA 2VWVA 5CSVA 4C2VA 5FXSA 2OJFE 5I9WA 3TEIA 4YJNA 3S3IA 1GIHA 2EU9A 4UXLA 1G5SA 2E2BA 3QA0A 4XRJA 3R8LA 4BWXA 4USFA 5B2KA 2XYUA 5IQFA 4E6QA 4K9YA 5JRQA 1KV1A 1YOMA 4TYJA 5EHYA 3REPA 2VTSA 4MD7E 3AD6A 3ZSHA 3LCDA 4G5JA 4BY9E 4QMWA 3KVWA 2UZBA 3R02A 5JEBA 5HKMA 3ZDUA 2E9PA 4I0RA 4BI2A 3F5XA 3LIJA 4RQKA 3O2MA 3Q6UA 4FKIA 4P7EA 4MH7A 5FP6A 3PWYA 3L8SA 2I1MA 3BYUA 3RTPA 4ZZOA 2DUVA 5D1JA 3I0OA 3ETAA 4RJ7A 4TWCA 3HV5A 3W8LA 3GU6A 4CTCA 5CANA 4ASDA 2YCFA 5BMSA 4JX3A 2PMIA 3UP7A 2NRUA 2QG7A 4DEIA 4N6ZA 3BHHA 3GU5A 3MY1A 2WQEA 3Q9ZA 4ZY5A 1P14A 3TG1A 3QGYA 4KWPA 3MGYA 2BDFA 3UOLA 2R9SA 1QMZA 5IQAA 2XNGA 4HPUE 2ZB1A 1OUKA 4BDCA 4I5CA 4EOJA 3BLRA 4NTSA 3TKUA 4CQGA 4RWIA 3BE2A 3OCSA 2WD1A 3C50A 4DYMA 1O6YA 2VO3A 4J99A 5EI8A 5D41A 5HNIX 2IPXA 5A6OA 5E8TA 3EFKA 4FIJA 4IXPA 1OKYA 1STCE 4QTAA 3WIKA 4EONA 5K5XA 2YWVA 1FGIA 4MBLA 4BDFA 2C69A 3D7TB 2C0OA 5GJFA 1Q62A 1YI4A 3Q9WA 3R1QA 3TNPC 4NH1A 3UOHA 5FTQA 3SGCA 4FMQA 3VW6A 2R3LA 3LE6A 4KNBA 2J9MA 2OF4A 3KRWA 4QQ5A 3D7TA 4YU2A 3F3TA 2WMXA 3V51A 2XRWA 3MESA 3G6GA 2IG7A 4FKTA 4P4CA 3BBWA 3HZTA 4U0IA 1PF8A 3TNQB 4ACGA 1H1SA 3TL8A 3DFAA 2XKEA 3KF4A 4EH6A 3VO3A 1Y57A 4MXXA 1YDRE 3ZLYA 4YJVA 3R00A 4BVUA 5JKGA 1J7UA 3TWJA 2PMLX 2UZVA 3ZC6A 3ZM4A 3SQQA 4O0VA 4EZ3A 5J9ZA 2A27A 3PVBA 2PWLA 4JDJA 4WRSA 5KKRB 3RGFA 3DKFA 3BCEA 3GCUA 2WIHA 3CC6A 3NW7A 4QMLA 4NYEA 3PP1A 2HZIA 2CNVA 3FI3A 2VAGA 2QOCA 4FKQA 2GS7A 3O0GA 2O65A 4ZJIA 4A07A 1DAWA 4FTMA 1DS5A 1Q8WA 4JRVA 4IM3A 4ZSJA 3PSDA 4L8MA 4AOIA 5AX3A 2OIQA 5L2SA 3SW7A 4EQMA 4G3DA 4M67A 4YJSA 4QMUA 3ZU7A 4IDTA 5IA5A 1HCLA 2BZHB 5KMOA 4Q5HA 3A7FA 3I6WA 4IVCA 3R01A 4F64A 5CAQA 4L42A 1ZLTA 3WI6A 3EN9A 3QLFA 1YRPA 4KA3A 3RZFA 5CASA 2GTMA 4ZLYA 4O7LA 4CCBA 3AGMA 5A54A 1W83A 5EOBA 2DYLA 4YURA 5D12A 2CGVA 2PUNA 1TKIA 3OG7A 1W84A 2C5YA 4NM0A 2VWWA 3TJCA 4BCMA 3R1NA 3U6HA 1O6LA 3ET7A 2O63A 1U46A 4C4HA 3PA5A 2PPQA 2QLUA 2VNYA 4IX5A 4JDIA 3MY5A 2YACA 3GC7A 4CXAA 4LMNA 5HX6A 4YGAA 3I0QA 1H28A 2QI8A 4MQ1A 4F0GA 4F70A 3FMMA 3KGAA 2QKRA 4L67A 1OIYA 4W9WA 3UE4A 5BUIA 3FLYA 5CEMA 2A1AB 4QYFA 3DJ5A 4I20A 4BC6A 4RVTA 3F61A 1Q61A 2ZV2A 3E88A 3BEAA 5HO8A 3EQDA 3MH0A 3Q04A 3T3UA 4AQCA 2QO7A 3RCDA 3OHTA 3IDPA 2WXVA 4IX3A 5E8WA 3GXLA 5A6NA 2PVMA 3C51A 5ETAA 4XV3A 2XK9A 4FT3A 2E9NA 3VUKA 3Q9YA 5I9ZA 3BHTA 3VJNA 3ELJA 4CZYB 3R71A 3R8PA 3HMPA 3ZRKA 2QOQA 4DTAA 5HG7A 3NVKI 3ATSA 4WG3A 3V5WA 2R64A 4C3PA 3VVHA 3FEGA 5EQPA 3WZJA 3V6SA 4A9RA 2BAJA 3OY3A 4M14A 5EK7A 3FI4A 3RPSA 3ZH8A 5HCYA 1OIQA 2QQ7A 5C26A 4FSRA 3U4WA 3EJ1A 3FYKX 4CFXA 3P86A 5HCZA 2C30A 2X8IA 4EOMA 4LGDA 5DNRA 2XJ2A 3R2BA 3QU0A 3LFSA 5FGKA 3DNEA 3TZMA 2W5BA 4BWPA 2CDZA 2QR8A 1CSNA 2YISA 3LFEA 2WMSA 4CMTA 5HD4A 3HAMA 4JBQA 4LGGA 4AT3A 1P5EA 1H00A 4DLIA 3CJGA 2GS2A 2HY0A 4BRXA 3QF9A 4RC3A 3WZDA 2GHLA 2WB8A 3NWWA 4TYIA 2BTSA 1L3RE 2A19B 4L7FA 5ETFA 2HXQA 4GKHA 1H26A 1YDSE 5HI2A 5L4QA 2OGVA 4C8BA 4DHFA 4U3YA 5A3XA 1OIRA 4M97A 4EHEA 1UVRA 4ACDA 1IG1A 3DBCA 4TY1A 2R0UA 4DTKA 2P55A 5E8YA 3ZRMA 5LOHA 4FTAA 3HX4A 3PPZA 4E5BA 4AZEA 4O7RA 2UW5A 3GI3A 4EK6A 2WMRA 2XVDA 5HICA 2PSQA 4AA4A 3TUCA 3GC9A 1XH5A 4D4SA 3QX2A 4TL0A 4ERKA 3VS4A 5KZIA 1PKGA 3Q4ZA 5M07A 1IEPA 3EZRA 4WOVA 4KIKA 1URWA 2W06A 2BDWA 4JG6A 3KRXA 4FVRA 4W4XA 5EM7A 1PKDA 2R3PA 3D2KA 5E92A 4E26A 2IZTA 3D4QA 4DH1A 5HTCA 3I1AA 5HIDA 3FMKA 4IC8A 4WNOA 2BZIB 3QFVA 3VS7A 2OXYA 4BDKA 4YJTA 3PWDA 4V01A 1GAGA 1JVPP 4AOJA 3NUXA 4Y72A 4C35A 4RX9A 3GT8A 2PK9A 3HP5A 5DEWA 4E7WA 4Y46A 4ZTLA 1FINA 3KY2A 3MDYA 1XJDA 4D1ZA 3N51A 4H39A 4X3JA 4D4RA 4DGLC 5T68A 4UB7A 3W10A 2F2UA 3FMNA 4FZFB 3A7JA 3RNYA 2ZV7A 3UIBA 4E4NA 1NVSA 4ASZA 1F3MC 4TYGA 3FY0A 2UW7A 3MFRA 3PY1A 4IVAA 4O0SA 1DAYA 3QD0A 5EDQA 2HW7A 3E8CA 5HOAA 4XLIA 2BFYA 5JMSA 4FICA 2X9FA 4ZK5A 2HXLA 5BVFA 5LMBA 4MF0A 1SM2A 2WU6A 5M4IA 4KB8A 1VEBA 2X2KA 4ZZMA 1XBAA 3Q3BA 4BDGA 2I7QA 3QQUA 5I3RA 4CZTA 4YZ9A 3OP5A 3COIA 5CSWA 4YJUA 2WMVA 4IAIA 4YC3A 3EL7A 2ZMCA 3P9JA 4DN5A 2WTDA 1XWSA 2WQNA 3G9NA 2BHHA 2WTKB 4BWKA 3AC2A 1ND4A 4I24A 1FBNA 5AFVA 5HE2A 2XK3A 4CV8A 3WYXA 3PE1A 4CFWA 3WILA 5IH5A 4YMJA 3W2RA 3QRJA 2B9IA 4M12A 4PMTA 2GMXA 3CEKA 2WTKC 2LAVA 4FV9A 4Y5HA 2WELA 2J50A 4GH2A 3Q4TA 2YM4A 3UQGA 1OUYA 2O5KA 3PVWA 4FEQA 5AAFA 4RA5A 4BIBA 2UVXA 3NYNA 4WKQA 2YCQA 3JXWA 3OFMA 5A9UA 3QQKA 5LXMA 5AMNA 4MK0A 4EOPA 3DBEA 4O7ZA 4AN2A 4E93A 3RM6A 1ZYLA 5E8SA 1R0EA 3VS0A 5E7RA 4YSMA 3VAPA 3HMNA 4FIEA 4E1ZA 2I0YA 4D2VA 3EKNA 5CY3A 4FKVA 4MEDA 3Q9XA 3H9OA 3KFAA 3ZS5A 4GUEA 3GVUA 4BCQA 3R8MA 4CZUA 2H34A 4EH9A 4DH8A 2CHLA 1SVGA 5AP1A 2YA9A 1DI9A 2ACXA 5DOSA 4FTOA 3LMIA 4ORKA 3F82A 3LAUA 4S32A 2VWIA 3EKKA 3UG2A 5HG8A 2FA2A 4Y83A 1JLUE 2XIZA 5AEPA 3S00A 1H25A 4B6LA 5HTBA 1H1QA 4D2SA 2Z7SA 4I41A 4OTRA 4RZVA 4J96A 2XBAA 5K3YA 2V62A 3HDNA 4B0GA 3QCXA 4AWIA 1NVRA 2I0VA 3MJ1A 2VX1A 3II5A 3BGZA 5D10A 4L44A 5DWRA 4EJNA 1PXPA 3FKNA 2F9GA 5KBRA 2UZDA 2FB8A 2P2IA 5IA3A 4ALWA 3A8WA 2YCSA 4G3EA 3O8UA 4JAJA 2V5QA 4XG4A 1OL7A 3UNZA 4ACMA 2GFSA 4RX5A 4Z7HA 4UEUA 5IA2A 5KO1A 2JITA 2HZ0A 2WQBA 2J90A 4U80A 3MS9A 1ATPE 4FTRA 2W1HA 3HNGA 4GYIA 3LM5A 3NRMA 3OC1A 3OROA 4J8MA 4D55A 3ZM9A 1H08A 5IH4A 4BZOA 1ZXEA 3QRTA 3EQIA 3OW3A 1F5QA 4FUYA 3HA6A 4GVAA 4APCA 4FSMA 4PDPA 1T46A 2WTWA 2PUIA 3G90X 1FQ1B 3A99A 2YITA 2YM6A 4V04A 4L6QA 4ASEA 2YIXA 4RQVA 4EWHA 3WZEA 5CVHA 3LQ3A 4XYFA 4ID7A 1H1WA 3R9HA 3MI9A 5DBXA 4RX7A 1VYWA 1V0OA 3DKGA 2BAKA 4E4XA 2Z02A 4MF1A 4IQ6A 3GGFA 1VR2A 3NZ0A 2XM9A 4IM0A 1BLXA 2XEYA 3CTJA 4CVAA 5JGBA 4U7ZA 5K4JA 1L8TA 4YHFA 4YP8A 4IWQA 4PF4A 5DR6A 4YUQA 5BVWA 3DGKA 4FSTA 4PTCA 1Q8TA 4Y5QA 3UBDA 5A4EA 3FXWA 3TNHA 3K5VA 4NM3A 1OM1A 3FYJX 1MUOA 4K33A 5GNKA 4R5SA 5KE0A 2W7XA 1Y8GA 2YDJA 4FL2A 4PL3A 4AA0A 5HGIA 4ZIMA 3UIMA 4ZY4A 3LMHA 4NWMA 3NMUF 2Y0AA 1FVRA 3NAYA 4I6BA 4RJ3A 1GNGA 4AE6A 4J97A 3AC8A 5EH0A 4XG2A 5EYDA 2GQRA 3C4CA 4JL9A 4M0YA 1ZWSA 4V05A 4KINA 1AD5A 2B52A 4G16A 5CAUA 3MVMA 3DJ7A 3FQEA 3ZCLA 4ZS0A 5LWMA 4JT3A 3D7ZA 3BYMA 4UWCA 5BQ0A 3P79A 4FTCA 3ANRA 1WBWA 3LCOA 3MTLA 2DS1A 3DFCB 4PX6A 5JGDA 4IMYA 4XHKB 1PW2A 4K8AA 2QD9A 1PJKA 4MVFA 3U9NA 4BCJA 4EUTA 3HRFA 2RFDA 4ZZNA 1IA9A 4FV0A 3ZZWA 1UU7A 3DK7A 4UYNA 3LFNA 4DH5A 3JUHA 4FGBA 2XK4A 5EOLA 3C7QA 1CM8A 4L46A 4BHNA 1YHVA 1Q8UA 4CFUA 4M69B 4OBOA 4N57A 2GQGA 5HVYA 4AFJA 2C3IB 4FIGA 3UZRA 3C4EA 4EL9A 3DKOA 3NEWA 4F9AA 2XNMA 2WEIA 3R22A 2UZTA 4C4FA 3BLHA 3PDTA 3BYVA 5IPJA 3HEGA 3KMWA 2CSNA 2A2AA 4RIXB 2C5OA 4DTBA 4FK6A 1GIJA 1H0WA 4FKWA 4GT3A 5BVNA 5L8LA 2XB7A 4QPAA 3UIXA 4HZSA 4E5WA 5CQUA 2XZSA 3QTUA 5LVLA 3LLAA 4MWHA 2JAVA 3WE8A 4DT8A 2IVUA 2X7FA 1KOBA 4DH3A 3LJ0A 5CU2A 3R7VA 2XNOA 4TYHA 3SC1A 5CF6A 3Q2JA 4EOIA 1IR3A 4BCPA 4JG7A 4M7IA 4H05A 2HCKA 2BZKB 2FVDA 4NL0A 3NUPA 3MSSA 4HOKA 1SYKA 4JR7A 2W4OA 1BL7A 1YOJA 4IX6A 4KSQA 3VBQA 3ID6C 4OTIA 4S30A 5G1XA 3EIDA 3BQCA 5BYYA 3FZPA 2Z7RA 3F5GA 1MRVA 2HK5A 2XH5A 4XV9A 3MFTA 4YPSA 3L9MA 4FYNA 3EN5A 2REIA 5JT2A 3UZTA 4H3BA 3HKOA 4JXFA 3DBQA 4QYHA 5CQWA 5GJDA 4CV9A 3QHRA 3P7AA 3E3PA 2C4GA 3OWKA 5EDPA 3ZYAA 4PMSA 2R4BA 2EB3A 4FV3A 4AS0A 4CFFA 1PYXA 2PVRA 4UWYA 4FKOA 3KULA 1UNGA 1XH8A 2J6MA 3AMAA 3MH2A 2C6DA 3NCZA 3TNWA 2H6DA 2BR1A 2CCIA 3VJOA 4HYSA 2O0UA 4FA2A 3COMA 4D58A 2UZUE 4Q2AA 4O2PA 1ZRZA 3ZLWA 3W2PA 4OR5A 5EYKA 3KULB 2RF9A 1FOTA 5K4IA 4RJ4A 4C34A 3NUYA 3HMIA 1PY5A 2VTMA 1UWHA 2B1PA 3V3VA 4DCAA 1QCFA 1FPUA 3F5UA 3C0IA 2G1TA 4F09A 3VWAA 5IKWA 4DFNA 2O8YA 4RWLA 5CSHA 1Q4LA 2ETRA 2OG8A 2QOIA 4EC8A 3IW8A 2ONLC 2YIQA 4EK4A 4KIQA 1BKXA 1M2RA 3HV4A 2ITOA 4E6DA 4C02A 4BBFA 4YJQA 4L3LA 5CVGA 5CF5A 5HIBA 3OEZA 4NW6A 1GY3A 2ITVA 3VBXA 2XCKA 5E8VA 5TO8A 1PXNA 2GNLA 1KE6A 3HL7A 2OZAA 5M51A 4FG8A 3E62A 3BGPA 2BRBA 4IH8A 3MFUA 3P78A 5KMMA 4EOKA 1S9JA 4FSZA 2CLXA 3NW6A 4WHZA 1OI9A 2PZ5A 3FPQA 4B8LA 5AADA 1CKIA 4JDHA 4QMXA 3B8QA 4G6OA 4BKZA 2P3GX 2PVKA 3A4PA 4BDJA 3R8VA 4AT4A 3GCSA 4GG7A 5FEEA 3LCSA 4PL4A 1Y6BA 3M2WA 3F3VA 3V6RA 3QCSA 3PG3A 4I6FA 2JIIA 2YJSA 5ACKA 4C3RA 1OBGA 2HWOA 3OVVA 3UIUA 4L43A 3UVRA 4IAFA 4FKPA 3NLBA 2XNPA 2J7TA 5EQEA 3P08A 1YXUA 4J53A 2VO6A 4YZCA 5BX0A 4UZHA 2Z7LA 1PRYA 2KTYA 3CD3A 1YWRA 2B9FA 3IKAA 1ZYSA 2BFXA 2R3RA 4HYIA 1NVQA 4PP9A 2G01A 2H96A 3O7LD 1Y91A 2FSMX 4QNAA 2X1NA 4JVGA 1JSTA 2WTIA 4U6RA 2VZ6A 4RIWB 2RGPA 3GFEA 4W9XA 5CSXA 2OIBA 5ANOA 3AOXA 2FO0A 4OTQA 5JH6A 3GB2A 2R2PA 5FDPA 3QUDA 3T9IA 3NIEA 3HVCA 3A8XA 3ZXZA 4QMNA 4YZNA 3ZBFA 3G6HA 5A46A 4X2JA 4F6SA 1BYGA 2C0IA 5HIEA 4TNDA 4X2NA 2YDKA 3NPCA 4EH7A 5LQFA 4CG9A 3DXPA 2R0IA 4EH3A 2GU8A 5IA1A 3ZOSA 2ESMA 1OKVA 2YIRA 1M14A 5CI7A 3SD0A 2VUWA 3TKIA 4KS8A 3NUSA 3CP9A 2WTJA 2UVYA 3P23A 5ACBC 5EFQA 5CU4A 3LFBA 1CKJA 2C6OA 4RC2A 1P4FA 1E1XA 2X9EA 3HMMA 5H8EA 4FX3A 3K54A 4D2TA 1Y6AA 4BCHA 4K0YA 5JQ8A 4JNWA 3UPXA 5EDRA 4AXAA 5CEOA 4U43A 4OLIA 3VHEA 4L3JA 3OF0A 3PPKA 5D11A 4APPA 2AUHA 2VTOA 3FZTA 3POOA 3NS9A 4TT7A 4DC2A 4O0YA 2ITNA 5LVPA 1OBDA 4FEVA 4MNEA 3JY0A 2FSLX 3QWJA 4BCIA 2XJ1A 4E8AA 4BR3A 3C13A 5IF1A 3Q52A 4Q9SA 2EXMA 2OICA 5CWZA 3PY0A 4AW1A 5DH3A 3FMLA 3W8QA 4MD9E 3ZBXA 1JKSA 2B4SB 2Z8CA 5CEPA 2F57A 5BUJA 3UMXA 2QO2A 2QHNA 3BU6A 3DTCA 3QKMA 3H0YA 3RHXA 5C4KA 3EQGA 2PE1A 1YXSA 5AM6A 1CTPE 3BU5A 3C4XA 4PDOA 5IQEA 2RFSA 2X7OA 5CU0A 3EZVA 3IO7A 4MX9A 3UG1A 2H8HA 4DBNA 4MWIA 1WVXA 4DINA 1Q8ZA 2VTIA 2BALA 2JDOA 3ALOA 4GIIA 5FXQA 4AUAA 2G2HA 4J7BA 5I9UA 4C4GA 1WBPA 1WVWA 4NKAA 3TJDA 1YI3A 3IDBA 4JRNA 3QD4A 2YM3A 5L2WA 4ANMA 4Y8DA 4A9TA 4HVHA 2QOFA 3L9LA 1U54B 4JLCA 4OTGA 5IQDA 3PRIA 4OUCA 4YLKA 1MRUA 2OI4X 4FG7A 5HE1A 2B9HA 3EN6A 2WMUA 2CGUA 5C03A 3FPMA 4U79A 1Z5MA 4O0UA 5JSMA 4EBWA 2PZYA 3R28A 3UQFA 1U54A 4IZ7A 4AZTA 1BUHA 3G0EA 2UW3A 3W33A 3QTWA 4PNIA 2ERZE 4DCEA 4EH2A 4YZMA 2OW3A 3NNVA 4F1MA 4L68A 2EWAA 2JAMA 3MIYA 5GIPE 3SW4A 1RDQE 2R7IA 3ZUVA 2F7XE 3QC4A 2IZSA 4O83A 3FQHA 5HE3A 3PP0A 1AGWA 3M11A 5M4FA 2I6LA 3I60A 5CXZA 1H01A 5EKNA 3G33A 3VHKA 1YKRA 2EXEA 3DPKA 3EL8A 3UOJA 3KL8A 2VTQA 4EOQA 2I0HA 4IVBA 5T3QA 4JIAA 2VX0A 3RCJA 1E1VA 4UMUA 4JBPA 4L3PA 4C4IA 4QQTA 4I94A 1WBNA 2OZOA 2XP2A 2PYWA 5EYMA 4HCVA 2WFYA 2ITYA 3DK6A 4ITIA 3VBWA 2AC5A 3SXRA 2BRMA 4IC7A 4D4VA 4QMQA 4K77A 3BYSA 4NT4A 5B2LA 2EVAA 3EFWA 2VTAA 4HYUA 4RC4A 3VS3A 3UO5A 2BRGA 1NXKA 1PXOA 1REKA 2C5VA 3RAHA 1ZZLA 3AXWA 4YNEA 3MFSA 3BV2A 3PSBA 4L45A 4L53A 2R7BA 4EOOA 2WQOA 2CN8A 3NYOA 4XG3A 3R9NA 4CGAA 3OCTA 5B7VA 2WU7A 2OSCA 3L1SA 4FIFA 4LRJA 2WOUA 2CN5A 3SAYA 3VS1A 3DU8A 4KRCA 4NIFA 3WE4A 4FEUA 5L2TA 3IS5A 4G5PA 2J0JA 3QTSA 3LJ2A 1K3AA 4TN6A 3O8TA 4MXAA 4XUFA 3VC4A 3BZ3A 3KC3A 3DLZA 4KIPA 4RJ8A 2EB2A 3OTVA 4O7YA 3ZFXA 5HG9A 3T3VA 5E8ZA 4RWJA 4NIFB 1OL6A 4I5PA 3PUPA 4KS7A 5KHXA 5F1ZA 2ITQA 4UZDA 4BCGA 3UDBA 3H3CA 3ZEPA 3KQ7A 5BPYA 1CKPA 3A62A 3DTWA 2X8EA 3P7CA 4L01A 4MXYA 1QPJA 4NTTA 4O84A 2X8DA 4J1RA 4C7TA 3NYVA 2PVYA 4FT9A 4KUJA 4CT2A 4R78A 4BCKA 4UY9A 4YC8A 3TV4A 2J5FA 5GINE 4BN1A 2Y4IB 4IWDA 4LFIA 4PWNA 2Q83A 3FBVA 4NSTA 4FV1A 2PE2A 2FUMA 3KRLA 3EYHA 4HZRA 4D28A 3OT8A 5KBQA 3VF9A 3R9DA 2LGCA 3Q32A 4WG5A 4FTJA 3VRYA 4GT5A 1BI8A 4L00A 4IACA 4NUSA 1GZKA 4M68A 3I81A 5FG8A 4U42A 4L52A 2VGOA 4UN0C 3DZQA 2OKRA 1LEZA 2IO6A 4TWOA 3LFFA 2JFMA 5H8BA 4EK5A 1KE7A 4FNYA 5IDNA 4CNHA 3DDQA 4RIYA 3LKMA 4DBXA 5I4NA 4IAAA 1JWHA 3RK5A 5AIKA 5E91A 2JEDA 2VWUA 1ZMUA 3E8NA 2HOGA 2ZOQA 4IFCA 5E90A 3BHVA 2W05A 4F9CA 3DQWA 4RIYB 4Z7GA 3Q4CA 3BE9A 5DR2A 4ARKA 1PYEA 4G2FA 5LARA 2R3OA 2YEXA 3GOPA 3IONA 4IE9A 2OBJA 3MW1A 3D5XA 4GV1A 1YXTA 5BVOA 1BL6A 1UV5A 3NIZA 3PIXA 3PVUA 4AN9A 3SKCA 2R3MA 3FMJA 2JKOA 2Y4IC 5J8IA 5C01A 3NAXA 1ZMWA 4O7WA 4NEUA 4CYJA 1H27A 4P5QA 3FXXA 4E5AX 3CGOA 3S2PA 5IMXA 3FSFA 4FZAB 4C2WA 4FSUA 4M66A 4Z9LA 1M17A 5GJGA 3COKA 3U9CA 5HORA 5IEVA 4C33A 3AC3A 4GK4A 5E1SA 4R7IA 3EOCA 4O86A 1W0XC 4C61A 3QRUA 2PUUA 5EI2A 4BCOA 4JOAA 4BDDA 4BTKA 5B0XA 5M55A 3CY2A 2JBOA 4KAOA 4U40A 4YHTA 4O7NA 4LOOA 1I09A 3PXQA 3MPTA 5M56A 2C6LA 5C27A 4ZS4A 1B38A 1YQJA 2X2LA 4N0SA 2CNUA 3UNKA 4WNPA 1M2QA 3ZO2A 3MPAA 3QTXA 5AP0A 3W1FA 4A4XA 4D2PA 3ZUUA 4EKLA 4FKLA 3VUHA 4WRGA 3QC9A 5IQHA 5M4UA 3E93A 3DB8A 1H1RA 3LPBA 3NNWA 1QL6A 2FSTX 3LFDA 4FT7A 2X4ZA 3PY3A 4ENYA 5LCKA 3C0HA 3NUNA 1R39A 2ZV8A 2W9ZB 3CKWA 4FF8A 3Q96A 2V55A 2HY81 4D5KA 3CQEA 4TKSA 5BVEA 4F7LA 3DB6A 3TNIA 5AIRA 3RINA 4I21A 2DQ7X 2WO6A 3W16A 4I6QA 2WMAA 4J95A 5L8JA 2HENA 3R6XA 4LUDA 3BWFA 2WMQA 4D1SA 4FTNA 5M4CA 5J1VA 4EQUA 4Y95A 4OT5A 2Y9QA 4CMOA 1J7LA 2CNQA 2XBJA 5HU3A 3LM0A 5CX9A 3PJ8A 1XH6A 3GQIA 5DIAA 1WAKA 4AAAA 4B99A 1B6CB 2IVTA 5A4CA 5DG5A 1REJA 3LW0A 5T6KA 3S1HA 2VTHA 4BTMA 4KBKA 5CAVA 3MA6A 4FV6A 2BKZA 2HZNA 1H24A 2W1EA 3UNJA 5L3AA 3CR0A 4QYGA 4EQCA 3DAJA 1GOLA 4XMOA 4WBOA 4L9IA 5JFXA 3AC5A 2HW6A 4YTFA 3H9RA 3SOAA 3ORMA 3MB6A 2IVSA 4QTBA 4HGTA 4DGOA 3Q5IA 3B2TA 2J0IA 4WUNA 5AV3A 1SVEA 4BBEA 2CGXA 5FXRA 4TW9A 5AV4A 5KUPA 4ZSGA 4S2ZA 2C6KA 4K6ZA 3RAIA 3RBWA 1XH9A 3RK9A 3LQ5A 3COHA 4DITA 5C8NA 1YOLA 2C5XA 2CMWA 5HEZA 4DFZE 5HTIA 1NY3A 4DEBA 2CPKE 4RPVA 4GJ2A 3D83A 2IW9A 3TIZA 4HCUA 5LVNA 5F94A 4ZMEA 4YBJA 4RVMA 4LL5A 3MBLA 3RPYA 5JZJA 3GNIB 2OJ9A 4MD8E 3F2RA 2QOKA 4DH7A 2ITTA 2VTTA 3ACKA 4WBBB 5J5SA 2NRYA 2YJRA 2BUJA 2R3NA 3FQSA 3KREA 4J52A 3Q4UA 4C62A 4E3CA 4EBVA 5FP5A 4XBUA 1ZAOA 3ZO3A 4X3FB 3PVGA 4G31A 2IZUA 2Z7QA 4GK3A 4BI0A 2A0CX 3PXKA 3QQHA 4JQ7A 4CT1A 1ZY5A 3CTHA 2GNFA 3ZDIA 1NW1A 4D4YA 3R2YA 3I6UA 5KMLA 2PUPA 2ERKA 3CQWA 5D7VA 5E8XA 4FZDB 1KE8A 4X3FA 3D0EA 2QKWB 3LOKA 2W17A 2VV9A
chains in the Genus database with same CATH superfamily
3IG7A 4EJ7A 4QTDA 3D5UA 4UMRA 3QTQA 1W98A 4FV2A 3WF7A 4I92A 5HBJA 4FJVA 4HGEA 5AWMA 1PMVA 4BGGA 4O96A 2ZYBA 4ZTMA 1LEWA 5CNNA 5J87A 3CJFA 1WFCA 3BELA 3EQHA 3NNXA 4RJ5A 3SXFA 2F4JA 5JN2A 3W0MA 4PDSA 4BZNA 2ITZA 3MH3A 2UW0A 3UDZA 1WBTA 2YZLA 3BV3A 3C4WA 4XV1A 5DYJA 5CVFA 1Q8YA 3D14A 1K9AA 1HCKA 3BX5A 3QLGA 4M84A 4F63A 2YLFA 1E9HA 5KX8A 3POZA 4ANSA 5JFSA 4FSYA 1VJYA 4Y85A 3HGKA 3HLLA 1UU8A 4X3FC 3L8VA 5HZNA 3I4BA 3Q53A 3CD8A 4PQNA 2W1GA 4AXEA 2GFCA 3RNIA 3NUAA 3KXMA 1IRKA 1OPJA 3DKCA 2CKOA 5AR4A 2B7AA 3BPRA 4AZFA 3JR1A 2HELA 3AGLA 1SZMA 5CF4A 4R5YA 5CI6A 4DG3E 4PPAA 4LM5A 4WT6A 2J5EA 4GUBA 2XK8A 5TE0A 1OPLA 3UC3A 5AV2A 3IW5A 4IZYA 2XCHA 4OTFA 1OPKA 3DAKA 3NNUA 2XKDA 3L8PA 3EHAA 4A9SA 4ITJA 1OL5A 2NPQA 2XNBA 4RLLA 4YTHA 3K3JA 3Q2MA 3WOWA 4ANNA 4AGWA 1V0PA 2QOBA 3UPZA 2HAKA 3KRJA 3HV3A 4FT0A 5J79A 3BHYA 5M53A 4W4YA 4X6RA 4R1YA 3HAVA 3QXOA 4GCJA 3S4QA 4CTBA 3GUBA 4LMUA 4E4LA 4DEAA 4IB1A 3EN7A 4U5JA 3GQLA 3GU4A 5IMEA 4DEHA 4HNIA 1H1PA 4I22A 4MUQA 4FV7A 3CPCA 4KABA 5IG1A 3WF9A 2WNTA 3DS6A 3TIYA 5ITAA 2JGZA 4AXFA 4IFGA 3HYHA 2VWXA 4FZ7A 1T45A 3BQRA 4AG8A 2XRUA 3GEQA 3IQ7A 4MXCA 5HNBA 2UUEA 3AKJA 4EORA 5DRDA 4EH5A 1RQQA 2GNGA 4FKRA 3QUPA 4WA9A 4NJDA 4PP7A 2R3JA 4S34A 3ZRLA 4BF2A 2V7AA 4LRMA 3W2CA 3IW7A 3MN3A 5ETCA 2O2UA 4X2GA 3U6IA 4BYIA 2GCDA 2UZWE 5I9YA 4OTDA 1G8SA 2QURA 2GNJA 4HJOA 3AQVA 5FTOA 3M1SA 3RALA 3VBTA 4HPTE 4AGCA 1KSWA 2QHMA 4BKYA 3ZSGA 5IZFA 2WZJA 4RRVA 4NZWB 3KXXA 2OLCA 3T8OA 1AQ1A 3SV0A 4DGGA 3HA8A 3WARA 3LFAA 3WF8A 3EFLA 3R1YA 4O22A 1JAMA 4DFXE 3UDTA 1O9UA 2GNHA 3C4FA 3RZBA 2QCSA 2B9JA 4GEOA 4BB4A 5GZAA 3CGFA 4J8NA 4F08A 5C4LA 1SNUA 1ZMVA 3E7VA 2VGPA 3ZO4A 2XIRA 3G15A 2YZAA 3SHEA 3MJ2A 4XBRA 3N9XA 4G6NA 3RWQA 4PMPA 4FSQA 3O23A 4U9AA 3IW4A 2JIVA 3FC1X 3QZIA 3E5AA 4AA5A 4Q9ZA 1KE5A 4TNBA 2UZOA 5AM7A 3MYGA 3P7BA 3QX4A 4QP2A 5EM8A 4G6LA 4ACCA 3OTUA 4X21A 5CLPA 4D2RA 3RM7A 3GP0A 3ZLSA 5K0KA 4YO4A 5A14A 3R8ZA 4RFYA 4R6VA 2OWBA 1Q3DA 5FEQA 1PXMA 3AC1A 1LPUA 2C6TA 2ETKA 4F9BA 5JRSA 3AC4A 3DNDA 4ALUA 3NGAA 3R7YA 3ALNA 1W7HA 1BI7A 4A7CA 4FL3A 4IIRA 1RW8A 4FI1A 4UMTA 2Q0NA 2V7OA 4C4EA 2WGJA 5I9VA 3DT1A 4ZTQA 1W8CA 3FLQA 4RFZA 2J51A 2F7EE 3QKLA 4MXZA 2WMBA 2C0TA 4TTHB 4CMUA 3I5ZA 1FMOE 3HV7A 2IWIA 3OD6X 5J5TA 3DY7A 4UX9A 4ZLZA 4ZSLA 5A4LA 4AOTA 2XAMA 3ZZEA 1SNXA 5IA0A 1GIIA 4UV0A 4N6YA 3ZEWA 5EQYA 1G8AA 2BRNA 1URCA 1O6KA 3ZLXA 4GFMA 2FYSA 4FC0A 4I93A 1Y8YA 3D5VA 3EYGA 4GMYA 1XKKA 4O4CA 3S95A 4CRLA 1UNLA 4BHZA 3QZHA 3A2CA 2XK7A 3ERKA 4O7SA 1GZOA 5AUZA 3RK7A 2XIXA 3HUBA 3KU2A 3DA6A 1YWNA 1A06A 5JFVA 3K2LA 3RPRA 5DFPA 2JDSA 4MHAA 2NO3A 2W96B 3H4JA 4MXOA 4YJOA 3TI1A 2HYYA 4II5A 3WZKA 4F65A 4BICA 4MTAA 5J9LA 3D94A 4G9RA 3PXRA 4IAKA 3RP9A 5IQGA 1M7QA 4QMYA 3HDMA 2VTNA 4ZTSA 4C37A 4EOLA 4S31A 2DWBA 3HECA 3FKOA 5I5ZA 2QU6A 3D9VA 5IU2A 5HVJA 5DA3A 3PG1A 4NFMA 4RA4A 3VUIA 3QALE 2PVHA 3VUMA 1TVOA 2UW6A 2XS0A 3SG9A 4Z3VA 3GCPA 3VBYA 4R1VA 1M2PA 3F7ZA 4O38A 3D15A 3IGGA 4QP4A 4M69A 4CLJA 3DXQA 3CQUA 4D1SA 4IANA 1FVVA 4IWPA 5JQ5A 4QQCA 5AAGA 1OKWA 2W5AA 3LCKA 4R77A 2WIPA 2OJJA 4CKJA 1PMEA 2OK1A 3FI2A 2V0DA 3JY9A 3LVPA 3PRFA 2VD5A 3ORIA 3TDWA 3OT3A 3F3UA 4P2KA 5FLFA 4IADA 3UGCA 5CU6A 4F0FA 4FTKA 5B2MA 4FTUA 2CKQA 1FVTA 3OUKA 4BTFA 1PMNA 1UU9A 1YXXA 4RMZA 4YC6A 4ITHA 3NX8A 4BKJA 4O0XA 4IX4A 4DEDA 4CG8A 4FKSA 2JDTA 2FH9A 2W1CA 4YNOA 4TYHB 4C58A 4HVGA 1IA8A 5DN3A 3QQFA 5IDPA 5ANIA 4ZJVA 4R3RA 5IISA 5ANEA 3UVQA 2ZDUA 4CFNA 4NCTC 3R7GA 2IZRA 4N4SA 4ACHA 1G8JA 2QODA 2VO7A 1ZY4A 3QQJA 4KBAA 3QZFA 2G2IA 4BYJA 2CLQA 5CALA 3GU8A 2OJIA 4D1XA 4FEWA 2YHVA 2ONLA 3IOKA 5HBHA 2XMYA 2X0GA 3VULA 3VUGA 2W1FA 5AV0A 2BVAA 2YIYA 4ZAUA 3G5DA 3QWKA 4GU6A 4IAZA 1H0VA 3F6XA 5CZIA 4BFMA 2A4LA 2YM5A 4AZSA 3G2FA 1YVJA 5FD2A 2IN6A 3S0OA 2C6IA 3HUCA 4GJ3A 5AP7A 1FMKA 4FGRA 1YWVA 4B9DA 1UKIA 4O0RA 3K5UA 4J98A 3VONA 4ZOGA 5BVKA 1V1KA 2P33A 1Z9XA 3OW4A 3UMWA 2R3GA 2HZ4A 3UJGA 2QO9A 4AN3A 1CDKA 5GIOE 4QYYA 3PLSA 5IA4A 2WHBA 2OFVA 3AG9A 4FG9A 4ZTHA 2JFLA 3OWLA 4LL0A 1PXKA 4K1BA 3FJQE 4ONAA 5AX9A 5GHVA 2QG5A 5LCJA 4OTPA 4QP9A 1MRYA 3TZ8A 5CAOA 1JKKA 5HLNA 4I0SA 3FV8A 3OS3A 4DEEA 3R63A 4PNKA 2WOTA 3CS9A 3NYXA 5AP2A 4CQEA 4ZEGA 4FVPA 2R5TA 5AUYA 1JPAA 3A4OX 4M8TA 4O1PA 2GQSA 1QPEA 3I5NA 3OOGA 5HESA 4WUAA 1ZYJA 3W18A 5BYZA 2XKCA 4TPTA 4TRLA 4OW8A 3AD5A 2X0QA 2OZAB 3BWJA 3EQPA 4AX8A 5KMJA 3ZSIA 4MQ2A 3R73A 5DRBA 3TT0A 1ZOHA 4G17A 4K11A 1XBBA 5CTPA 3BHUA 4IB0A 3CE3A 4M15A 3E7OA 4DF3A 2B53A 3R7OA 4DG2E 3BGQA 3EQRA 3P4KA 3WBLA 2PY3A 4ZP5A 4OBPA 1A9UA 2FSOX 3WYYA 2ZFYA 1APME 3R7IA 1XH7A 4ZLOA 2W4KA 3G51A 4QP6A 4QMSA 5DR9A 2W5HA 4O0TA 5F4NA 1EH4A 3F2NA 4XEYA 2YABA 4AF3A 4WNKA 5L2QA 4HVSA 3ZXTA 2W0JA 3RHKA 4DE4A 2RG5A 5IEYA 2WEVA 1BMKA 3KCFA 5HG5A 4YJRA 4O21A 1MQBA 3V5JA 1R78A 4H1MA 4WNMA 1Q3WA 2E9OA 2OF2A 3R21A 4RVLA 4O81A 1CMKE 2PZPA 2PVJA 2XM8A 1ZOEA 4FTTA 4J71A 2OXXA 4ZTNA 3UODA 4BBMA 3MWUA 4D2WA 2UW8A 3QBNA 5GZ8A 4JMQA 5AAEA 1KOAA 1XMLA 3R7EA 3ULIA 5IUHA 3TV6A 3F5PA 4R7HA 3KK8A 5HO7A 3FC2A 1R0PA 2YWPA 3PJ3A 5JGAA 2G9XA 3PTGA 3VQHA 1YHWA 4RIWA 3LJ1A 3CSVA 4CRSA 2VWBA 3TTJA 3R9RA 5HQ0A 3GC8A 1FGKA 5H8GA 4AZVA 1OB3A 1VYZA 1OGUA 5J95A 2BPMA 4I23A 3O71A 3B8RA 3ZHPC 3PZHA 4IEBA 4B8MA 2B0QA 4HVDA 2X2MA 3OY1A 4MNFA 3O17A 4FR4A 4FV4A 3NR9A 5FM2A 5DT4A 3VF8A 4FSNA 3U55A 4FKUA 3FUPA 1UNHA 5HHWA 2XF0A 3IW6A 5LMKA 4OAVB 5AR7A 1H4LA 3HP2A 3ML1A 4U8ZA 3DAEA 4P5ZA 4FOBA 3T9TA 2HIWA 5EYCA 3RMFA 2JKKA 4BDHA 2UW4A 4LDTA 4R3CA 1WBSA 5ETIA 2OFUA 3LXNA 5TOZA 5FRIA 3N4TA 4NU1A 4EOSA 4F4PA 1YI6A 3U4UA 3DZOA 5JK3A 1XHAA 3A7GA 3V8WA 2RFNA 2RSVA 5HX8A 3WIGA 3TTIA 5AUXA 5LJJA 2X6DA 4L7SA 1TZDA 4V0GB 2CKPA 1PHKA 1MP8A 3OCBA 4XG9A 3TM0A 5JZNA 5AR2A 3FI8A 2IJMA 4EK3A 4A9YA 1LP4A 1OECA 1OMWA 3CCNA 1J3HA 4M0ZA 5BUEA 2R3HA 3A61A 3QXPA 4RG0A 4Z55A 3F7WA 5ANDA 3IDCA 3OBJA 4V0GA 4XP2A 3UO6A 1Q97A 4QMZA 3WZUA 3TCPA 4BL1A 1TQPA 2ZVAA 4ASXA 3FLSA 3ZO1A 4YLJA 5CF8A 3KXNA 4XV2A 4O6EA 1Q5KA 1OKZA 2YM8A 4KKEA 5I0BA 4LV8A 1Z57A 5HE0A 2XYNA 4G1WA 5EW9A 4FIHA 2OXDA 4X6QC 3ROYA 4QPMA 5HLWA 3JPVA 5JFWA 3SG8A 4C57A 3N4VA 1KV2A 3MY0A 1GJOA 2EXCX 3JYAA 5I9XA 4G34A 3FWQA 4LV5A 3DBDA 5TF9A 1NT2A 4EZ7A 5C8MA 2HWPA 1ZYDA 4RSSA 3ORXA 4QMVA 1J1CA 2XNNA 2WKMA 4KIKB 4U3ZA 2ETMA 4K18A 3EQFA 4XOYA 4MAOA 5DEYA 2XUUA 5K0XA 4LG4A 4FEXA 3ATTA 4F9WA 1J91A 2YERA 5DVRA 5TKDA 5AUVA 4BDBA 5H3QA 5EM6A 2JBPA 3DOGA 3PE2A 4QP8A 4RX8A 3C1XA 4NFNA 5TR6A 3I7CA 3L9NA 3R04A 2X7GA 4BCFA 4EUUA 4F6UA 4BIDA 4TWNA 3CKXA 4F0IA 2ZJWA 1UWJA 5ANKA 4OAUC 3AT3A 2OO8X 4BDIA 4O82A 5M08A 5FBNC 3VS5A 4JQEA 2P0CA 3TN8A 2Y6OA 2WTCA 2BIKB 3JS2A 4AW2A 1XR1A 1R1WA 4HCTA 2C1AA 3FMHA 4IJPA 1U59A 1J1BA 4WSYA 3PLAE 1OZ1A 3AMBA 4CKIA 3E64A 4GK2A 4PDYA 3FMDA 4DGNA 2JKQA 4MKCA 4I3ZA 4KKHA 1OL2A 4RIOA 4UXQA 3RPVA 3V5LA 2VU3A 4DT9A 3HRBA 4NK9A 4NCTA 4WD5A 4USEA 4WG4A 4MYGA 5CU3A 4X2KA 3AD4A 3C9WA 2OH0E 3GOKA 3CBLA 2RL5A 4LOPA 3W2OA 4I4FA 4HYHA 5EM5A 3QZGA 2ZM3A 5AA8A 4DFBA 1NA7A 3ENMA 3V5PA 5CEKA 2BIYA 1LR4A 3Q6WA 4XCUA 4GU9A 4BTJA 2YAAA 4FBXA 2GNIA 2WPAA 3PIYA 4FYOA 3FZ1A 3KEXA 3BRBA 4W8DA 3UVPA 4D5HA 4DEGA 3DDPA 3G0FA 3OBGA 3ACJA 5K5NA 4QTCA 4RWKA 4U97A 1BX6A 5BMMA 4YZBA 5AJQA 1OGYA 3K3IA 1MQ4A 2PMOX 4GFGA 4AGDA 4DGMA 4FK3A 4QMTA 3L8XA 2WAJA 3QQGA 4YZDA 4IDVA 2CCHA 4H58A 3THBA 4AW5A 4QDVA 4JX7A 3NFFB 1SMHA 3C5IA 5L6OA 4HW7A 3MVLA 3ULZA 2UZNA 4UMPA 1RJBA 5A4TA 3NVMB 3ORTA 2VX3A 1U4DA 4C38A 2A98A 2PU8A 2P4IA 3TZ7A 4CLIA 5L6PA 3W0PA 3KXHA 1ERKA 2R3IA 3OCGA 5L6WL 4A4LA 4LRKA 2YDIA 2PL0A 3R0TA 3ZC5A 2NYAA 4JI9A 2SRCA 1PXJA 1H8FA 4G3CA 3OUNB 3PSCA 4HVIA 4QT1A 4ANQA 2QLQA 2H9VA 3P1AA 1GZNA 4JR3A 1VZOA 4RFMA 1WVYA 4X0MA 2CKEA 3KK9A 3GCVA 3EMGA 2GHGA 2OIDA 3O96A 4JS8A 3GBZA 4O0WA 4ZSEA 4IJ9A 1SVHA 2J0LA 2YLEA 4QMMA 4C3FA 2VNWA 4FOCA 2F7ZE 3PXZA 2E9UA 4JQ8A 4B7TA 3EFJA 2X6EA 2QOHA 5FEDA 4F9YA 5LMAA 4OBQA 4F7NA 4XP0A 3L9PA 2VTRA 3QUEA 3PIZA 3WF5A 2UV2A 1HOWA 1JQHA 4D9UA 3VS2A 5EW3A 4RZWA 3E92A 4I6HA 3QA8A 4ZSAA 2W1IA 2R3QA 4YTCA 1JKLA 3P0MA 4LUEA 4AP7A 2NP8A 3EH9A 4EK8A 4QMPA 3GENA 3FDNA 3MV5A 3QTIA 3I79A 3R9OA 5KZ0A 1UKHA 4H3QA 2BDJA 4U45A 4MCVA 4KSPA 3OEFX 3QAME 2QOOA 2YN8A 4YO6A 3V01A 1XO2B 4OTWA 1ZOGA 4O91A 2IW8A 2KULA 3DQXA 3FE3A 4IBMA 4LI5A 4F7JA 2J0MB 4BI1A 4W8EA 2QNJA 4XG7A 4PTGA 1F0QA 4P90A 5E1EA 1M52A 4DHZA 3A60A 3O50A 4GRBA 4C0TA 3FKLA 4EH8A 4RJ6A 3C0GA 5F20A 1DI8A 4E6CA 3MVJA 3QCQA 5FUTA 4AU8A 3JVSA 3MTFA 4QP3A 3SRVB 4KKGA 2C47A 4LYNA 2BILB 4HGLA 3CTQA 4YBKA 5CXHA 3U51A 4FE2A 4JAIA 3OZ6A 4PPBA 3TZ9A 1W2CA 3TDVA 2BRHA 4WIHA 4E73A 4HNFA 4FVQA 3DCVA 4FZ6A 3TV7A 3VUDA 4WSQA 3SRVA 1PMUA 1YDTE 2C68A 3LQ8A 3DBFA 2GDOA 5CNOA 3VBVA 5CT7A 5KMIA 5L8KA 2AC3A 2IVVA 3DK3A 3UDSA 3C4ZA 4DDGA 2NNWB 3TYKA 4PRJA 1JOWB 3FHIA 4IHPA 4WO5A 4CEGA 3G9LX 2O64A 4EYJA 4G3FA 1W2FA 1JBPE 4FTIA 5CYIA 3P5JC 3BEGA 3P5KA 3OXZA 4AE9A 3O5AA 1WCCA 5M09A 4XS2A 4ANLA 5E9EA 2ZB0A 2ZM1A 4XG8A 3BI6A 4D0XA 3V8SA 2BKKA 2C5NA 3KN5A 4N70A 1WMKA 4MBIA 4IM2A 4UYAA 1KWPA 2X39A 4H36A 4D9TA 1PXLA 3IK3A 3RWPA 3ZFMA 2ITPA 3PJ1A 2VTJA 3D2IA 2UW9A 2GS6A 2YCRA 3O8PA 3OOMA 4QMOA 4U81A 3W2QA 3RVGA 2EUFB 5EG3A 4E20A 3LMGA 1DM2A 3Q60A 5FM3A 2C6EA 5BNJA 4DFUA 4OGRA 4XNEA 5AR8A 3VRZA 3RAWA 1KUTA 2XEZA 1B39A 3QYZA 1Q24A 1I44A 3NSZA 4G3GA 2C3JA 2IEWA 4TXCA 1GZ8A 3SDJA 3GC0A 3HMOA 4UWBA 4Q5EA 3F69A 3MA3A 5HO6A 4O7TA 4ZMFA 4XH6A 3VN9A 4IVDA 3H0ZA 3RPOA 1WZYA 4AQKA 4FNXA 4YJPA 2F49A 2OJGA 4EH4A 1JSUA 2XJ0A 4FTLA 4NM5A 4KIOA 4XRLA 4IWOA 3UO4A 3UYTA 3ZONA 2J0KA 5AP6A 3KB7A 3OXIA 5KMNA 4FSWA 3E8EA 2PHKA 2JD5A 3RKBA 4DFYA 1IAJA 2Z2WA 3A7HA 2BMCA 5ICPA 2PE0A 3OWJA 4QO9A 5DE2A 2UVZA 3KN6A 2W4JA 2YIWA 3IOPA 1XQZA 3FAAA 3TACA 2V22A 5J7BA 3R30A 2JLDA 3E63A 2B55A 3ZTXA 3LFQA 3VW8A 4JBVA 2QC6A 4R3PA 3QKKA 5ANJA 2GSFA 2CJMA 4O2ZA 4XOZA 4F7SA 5F95A 4O6LA 4DLJA 3MH1A 3H9FA 4RIXA 1OL1A 3KMMA 4PPCA 4XX9A 4CSVA 5CEIA 4DA5A 4RGJA 4FKJA 1S9IA 3UZPA 2WTVA 4BZDA 3BIZA 4O27B 3ZFYA 2XKFA 1ZZ2A 4MBJA 4UBAA 4EEVA 5KKRC 3CY3A 3FLWA 4AACA 5GZ9A 1JNKA 5KCVA 4CYIA 5DLSA 3QGWA 2WMTA 2PVLA 2J4ZA 2R3KA 3QTZA 4A06A 3BLQA 3FMEA 4JIKA 4YPDA 5DT3A 4PL5A 3AT4A 5I3OA 1H07A 5AUUA 4PMMA 2PMNX 5IUIA 4KD1A 4C59A 5HD7A 4DG0E 3LXLA 3GU7A 4M13A 4FKGA 2VRXA 4GG5A 1OVEA 4QNYA 1A48A 4DDIA 4IB5A 2X81A 4U44A 4R7BA 2BHEA 5C8KA 5C9CA 3RJCA 3ORNA 2AYPA 2QVSE 5DPVA 4ENXA 2BZJA 1OITA 4F6WA 3MB7A 4FNZA 3DXNA 4CCUA 2Y6MA 3CXWA 5EW8A 2C6MA 5DGZA 5AP4A 4BGQA 4ALVA 3R83A 4I5MA 4Z16A 5M44A 4ANBA 5LVMA 4FNWA 2W9FB 2G2FA 3PA4A 2W1ZA 4FIIA 4FL1A 4JDKA 4PTEA 4I0TA 5DHJA 4YHJA 5AP5A 4BDAA 4QPSA 1M7NA 2UZEA 3BU3A 3ORZA 4IB3A 3U8WA 5AUTA 3U54A 5AV1A 4F99A 3TKHA 2PVNA 3PPJA 2VTPA 3KXZA 4EC9A 4EHGA 4O7VA 4X2FA 4CFMA 3TXOA 3DV3A 5KHWA 1LUFA 4K2RA 3MVHA 4AZWA 2E9VA 5M57A 4RLKA 4O1OA 4LOQA 5J1WA 5KNJA 2RIOA 3E8DA 3KXGA 1IAHA 4IZ5A 5DMZA 3CLYA 5H9BA 4CFVA 3LFCA 3LZBA 4XP3A 4BGHA 1W82A 2VWYA 2XIYA 3QD2B 1OIUA 3QQLA 3O7LB 4QP7A 4YLLA 4C4JA 2BTRA 5FTGA 3AMYA 5AP3A 4A9UA 2VO0A 3NCGA 2IW6A 3FZOA 4EI4A 3KVXA 5BVDA 4ZY6A 4QQJA 1ZYCA 3UQCA 3F9NA 5G6VA 2XA4A 2XIKA 3LXPA 5CT0A 5J9YA 2PZRA 2QONA 4GL9A 4H1JA 4IW0A 2JKMA 4BCNA 4EWQA 3QYWA 1U5QA 5D7AA 4ANOA 3HRCA 4KRDA 5HBEA 3W55A 5IQCA 4QYEA 3ENHA 5DI1A 3IGOA 4JBOA 4OTHA 3DLSA 5H2UA 5LMKC 2XNEA 2Y4PA 3ZUTA 3N4UA 2R3FA 3UYSA 3QCYA 4PV0A 3NDMA 3R8UA 3QHWA 5E8UA 4C36A 4ZTRA 3FLNC 1G3NA 4QRCA 4LQMA 1UU3A 2RKUA 3LLTA 2O3PA 4QTEA 2PTKA 4UALA 1G8KA 2XARA 4GKIA 5CZHA 4OT6A 2ZAZA 1TQMA 2ZMDA 2P2HA 3H30A 3ORKA 3CIKA 3ORLA 4NJ3A 4QD6A 1JSVA 2JDVA 4X7QA 4Y73A 4EYMA 2PULA 2ITUA 1J7IA 5BYLA 5IEXA 3GCQA 4E6AA 3ODYX 3VNTA 4USDA 3B2WA 5EHLA 3EB0A 3BYOA 4ERWA 3R7UA 3VIDA 2W1DA 2C3KA 3GFWA 5EKOA 3VQUA 5A4QA 5AA9A 4HGSA 4IAYA 4S33A 3U87A 5LWNA 1YW2A 2B54A 3WF6A 4AFEA 5IH6A 5LVOA 5CEQA 3VS6A 3FL4A 2BROA 2YFXA 4I4EA 4GIHA 4GT4A 4G9CA 4XG6A 3SX9A 2GPHA 1KE9A 2VN9A 5AR5A 3UC4A 5CENA 4F1TA 5L2IA 3KCKA 3SOCA 3D5WA 1QPCA 3IECA 4GYGA 3FZRA 4H3PA 1YXVA 4TZRA 4GW8A 3MIAA 2VWZA 5CS6A 1PXIA 5M06A 3F66A 4GSBA 3UP2A 3R1SA 4O4BB 2VTLA 1U5RA 4PUZA 3PYYA 4U41A 3W32A 4EHZA 5FBOA 3QTRA 3KMUA 3PXYA 4TYEA 2UZLA 1YHSA 3BBTB 4CKRA 3V5QA 3ODZX 4DAWA 3SVVA 4FODA 5IUGA 4FTQA 4NKSA 2ZDTA 4GVJA 3F88A 4LGHA 3RI1A 3V04A 5HU9A 2OH4A 4BJJA 3RAKA 2GTNA 3W2SA 3JVRA 1TQIA 2AEGA 3UTOA 3C5UA 3EQCA 3NUUA 3PFQA 4F1OA 2GHMA 2WQMA 3QL8A 1WBOA 4PY1A 3QD3A 3V5TA 4EHVA 3FSKA 5HCXA 4BJJB 1QPDA 3OWPA 3ITZA 3SXSA 2BCJA 1R3CA 3PA3A 2WMWA 4NW5A 4FV8A 3Q5ZA 4DFLA 1K2PA 4XJ0A 3SA0A 4AW0A 2J2IB 4FT5A 2F2CB 2W99B 2ZV9A 3I7BA 2JIUA 4MNEB 1P2AA 2PVFA 2QR7A 2X4FA 3KA0A 4KBCA 2QU5A 2ZM4A 4D0WA 4CD0A 1P4OA 3NW5A 2OU7A 2C1BA 4RBLA 1XH4A 2I40A 5EI6A 3OXTA 5D9HA 2Q0BA 5FQDC 4QOXA 5IQBA 3E87A 3V8TA 3EQBA 3F3ZA 4FV5A 3DJ6A 4ZJJA 3TUDA 5E4HA 4A4OA 5F9EA 4E4MA 2PZIA 2RFEA 2RG6A 4I5HA 1ST0A 3FL5A 3KRRA 3FLZA 3IPHA 3CPBA 5EHOA 1RE8A 3FXZA 1WBVA 4M3QA 3H10A 4XLVA 4RVKA 2Y7JA 4JG8A 5FDXA 5HVKA 3PJ2A 3FZSA 4B4LA 1V0BA 1X8BA 5HLPA 3BKBA 4YR8A 2YM7A 3KF7A 2Y8OA 4AGUA 3ANQA 1UA2A 3SLSA 4IZAA 5DT0A 2G15A 3VUTA 3QRKA 3LCTA 3M42A 4GFOA 5CSPA 4EZ5A 2FGIA 4TWPA 2ITXA 3ZMMA 4BDEA 3HV6A 3PXFA 2CGWA 2YAKA 1XBCA 4FUXA 4RT7A 3TUBA 4UMQA 2BAQA 3EN4A 4BIEA 3F2AA 4AT5A 2I0EA 3OMVA 3E3BX 5FWKK 5KMKA 5AUWA 3UOKA 3PZEA 2QOLA 1Q41A 1Q99A 2JDRA 3FHRA 3ORPA 4R8QA 3PJCA 2XK6A 4GS6A 2ITWA 5AR3A 3W0OA 3F3WA 5HNGA 4W4VA 2JC6A 5J7HA 1ZARA 3MPMA 5K9IA 3LXKA 1JKTA 3AT2A 4NM7A 3ROCA 5CAPA 5IQIA 4QP1A 5ANGA 4EKKA 3LHJA 5C1QB 4JJRA 4ZXTA 1IASA 4W4WA 3A7IA 4I1ZA 3EWHA 3KKVA 4YTIA 4YSJA 3O51A 3U6JA 3FY2A 2Z60A 5TT7A 2C3LA 3QRIA 2VWVA 5CSVA 4C2VA 5FXSA 2OJFE 5I9WA 3TEIA 4YJNA 3S3IA 1GIHA 2EU9A 4UXLA 1G5SA 2E2BA 3QA0A 4XRJA 3R8LA 4BWXA 4USFA 2X0PA 5B2KA 2XYUA 5IQFA 4E6QA 4K9YA 5JRQA 3PUFC 1KV1A 1YOMA 4TYJA 5EHYA 3REPA 2VTSA 4MD7E 3AD6A 3ZSHA 3LCDA 4G5JA 4BY9E 4QMWA 3KVWA 2UZBA 3R02A 5JEBA 5HKMA 3ZDUA 2E9PA 4I0RA 4BI2A 3F5XA 3LIJA 4RQKA 4O4DA 3O2MA 3Q6UA 4FKIA