4E5WA

Jak1 kinase (jh1 domain) in complex with compound 26
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
302
structure length
292
Chain Sequence
GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKNHIADLKKEIEILRNLYHENIVKYKGICTENGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK1
total genus 91
structure length 292
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e5wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e5wA01
1OGUA 1STCE 3FI2A 1GJOA 4MHAA 3TT0A 1G3NA 4GS6A 3D7TB 3ORKA 4FVQA 2J90A 1WBOA 3I81A 4BCHA 3QXOA 4BCQA 3MPMA 4MD8E 3ZFYA 4DITA 5IA1A 4C34A 4AN9A 2P3GX 4D4YA 4LMNA 4EWQA 4OBPA 3WZJA 1QPDA 3QRKA 4F99A 3MA3A 4TNDA 4IVDA 5CLPA 4ZTQA 4DH5A 2GNGA 2H34A 1LPUA 4G17A 4AS0A 3EN5A 3FKNA 3A99A 4O0SA 4WIHA 2X8IA 1JOWB 3LCSA 3QRJA 4GKHA 5FG8A 2J0LA 4HPTE 2WIPA 4D2WA 3FJQE 4EKLA 2GPHA 3NUAA 4FR4A 2W99B 3BLHA 4S31A 4YJRA 2YCQA 5CENA 4PTGA 3FYJX 1MRYA 3ROCA 4FTUA 3ZRMA 1WZYA 2FVDA 3A7HA 4IAKA 4D9TA 3KRRA 3SKCA 4ITIA 4O22A 4FUYA 3E8CA 2W7XA 4RGJA 5H2UA 5B2LA 5IA3A 4FT9A 4PL4A 1YDTE 3H30A 2W5BA 3ZC6A 2Y4PA 3TV7A 3DJ7A 3I0OA 2B9IA 2JDVA 5CANA 2E9VA 2G01A 2WAJA 2ZVAA 4DH3A 4AF3A 3TCPA 1OL1A 5IDPA 2G1TA 4EBWA 4GKIA 5FEEA 5CNOA 3B8RA 4P4CA 3HYHA 3ZTXA 3OROA 2ERKA 2GNJA 3F5PA 3PA4A 4ONAA 3TN8A 4HNFA 4AT4A 3UOKA 4O82A 1ND4A 2JLDA 2P2HA 4L68A 3IW5A 4XBRA 5EW8A 4DH8A 4BHNA 5CYIA 3FWQA 4O7NA 3QTSA 5KHWA 5EYCA 4FVPA 4MXZA 4D5KA 1HCLA 4GVJA 3QGWA 4BDFA 3E8EA 4HGEA 4HGTA 4YTIA 4W8EA 3CPBA 5I9UA 3T8OA 2CJMA 1JKLA 2OJIA 2WMQA 3EYHA 4RZWA 3ZS5A 2WHBA 3TNWA 3PY3A 3BELA 1URWA 5DIAA 3W2QA 5TKDA 3RINA 2CCHA 3GB2A 2GDOA 2WTDA 4IAAA 2C6IA 3UIUA 3FAAA 5AUYA 5J5TA 2VGOA 5CEOA 3CXWA 4TY1A 1J91A 3QXPA 4OTRA 5CQWA 4CT1A 3RM6A 4CFVA 2XIYA 4JS8A 4YLLA 3ZLSA 2R3HA 1O9UA 2OZAB 2QLUA 2V7AA 4E6CA 2W9FB 4ZY6A 2PK9A 2NP8A 4BCIA 1ZYJA 4G3CA 4U3YA 5KKRC 5DT4A 3HP5A 5JFWA 1OBGA 3KFAA 3DJ6A 5H9BA 3WZEA 3FLNC 3PPJA 4HVGA 3UG2A 1E1VA 2JAMA 3HMIA 4PTCA 2I6LA 3AD4A 5FQDC 2XK7A 4CV8A 4RX9A 3LJ2A 2EWAA 5CXZA 3DZQA 4QRCA 4I0SA 4TL0A 4UYNA 3KA0A 4YJVA 2Y4IC 5IQGA 1XKKA 4J96A 1PY5A 1UU3A 3EJ1A 1WVWA 3F3UA 3MFSA 4FIEA 3DDQA 4J52A 5AR2A 1VEBA 2GHLA 3FKOA 3PXQA 1L3RE 3Q4TA 4UMPA 3ALOA 4EZ5A 2V7OA 3DPKA 2VWZA 2JIUA 3HX4A 4QTDA 4RJ5A 4CKIA 2X7OA 3EHAA 3DTWA 4XG9A 2XS0A 4EYJA 4AZTA 5FTOA 2JKMA 4E7WA 4H39A 4MXXA 4ACCA 3PSBA 2C4GA 2A4LA 4I22A 5E8SA 3TIYA 2YLFA 3P08A 2HZNA 3FMKA 4G6NA 3EN7A 3MJ1A 4G3EA 4XG8A 3UVRA 4KRCA 3FY0A 4RX8A 2Y9QA 1Y8YA 3D4QA 3GOKA 4FG8A 2W4KA 2Y6OA 2ZYBA 2GQSA 4MWIA 4UYAA 4I5CA 3LE6A 2IZUA 4M14A 3DXPA 3KK8A 4PNKA 5EW9A 5LWMA 3UZPA 2XIKA 4FIHA 5A4LA 2W1IA 4YZDA 3PWYA 2BHHA 1LUFA 4O0TA 3W18A 5FXRA 3C4WA 4DCEA 2PVKA 3A7JA 3R00A 4ASZA 3BBWA 4WT6A 4YTFA 3I1AA 5J9LA 4U43A 4HVSA 3SOCA 5BUJA 4XEYA 2VO3A 4PMTA 4YSJA 2A0CX 5KCVA 4D58A 2UW0A 3HV7A 5AUVA 1JSUA 4C4HA 3PXFA 5FEQA 3E3BX 2R5TA 4AOJA 2OW3A 3P78A 2E9OA 3LMGA 4O81A 2RFDA 3QD4A 4IADA 1NW1A 5A4CA 1T45A 3FLYA 2YM3A 4IJPA 3WOWA 4CKRA 5HO6A 1YWVA 3RZFA 5E8UA 5CQUA 4EZ7A 1QL6A 4MF1A 3F66A 4ANNA 2HZIA 2OIBA 3ORZA 3OCGA 4JXFA 4G1WA 4ASXA 3OCTA 5FWKK 4DH1A 2PZYA 2C0TA 2VWXA 5K3YA 4Y83A 2IVVA 2XIZA 4NT4A 3O8UA 4NJDA 5CU0A 4BCFA 3L9MA 2X8DA 1R0EA 3QQUA 2X9EA 4KIPA 4RJ4A 5E92A 1XH4A 2XIXA 5HOAA 4AFJA 4DF3A 4IAFA 2IG7A 5IISA 4AZVA 4GFOA 5A46A 1PYXA 5L2SA 3MH3A 1M2QA 4QTBA 2WMVA 2C69A 2BR1A 4UV0A 4QMQA 2X1NA 4XG2A 5CAPA 3HUBA 3DXNA 4YTHA 4R3RA 4FV4A 4AACA 4AGDA 4R3CA 1F0QA 2R3OA 3UP2A 1GNGA 1H24A 4Y5QA 4H3PA 5EG3A 2YHVA 3TKUA 3QCYA 4MNEA 3MW1A 4NTSA 4MBLA 2OF4A 1PF8A 4EK4A 1A48A 3NDMA 3MDYA 2GCDA 2R9SA 4LM5A 3GT8A 4Q9SA 5HE0A 4O2PA 3AMBA 5DR6A 5A14A 3LCTA 4RPVA 4JG8A 5LVMA 2WU6A 3OS3A 4PRJA 3OEFX 3CGOA 2FH9A 4XYFA 5CF4A 4FGRA 3UGCA 3VHEA 3TM0A 1J1BA 2UW6A 3CBLA 4FNXA 3PG1A 4V0GA 2BRGA 1ZOGA 2F2UA 3RPRA 3VUMA 1Q4LA 4GFMA 2OIDA 3C0IA 2BAQA 3QU0A 4FSYA 3KRJA 3GCUA 5GJFA 3R8VA 4UXLA 4FT0A 4OBOA 2C6TA 4WRGA 3LJ1A 3N9XA 4P90A 3R73A 3K54A 4G31A 4CD0A 3SX9A 4USDA 2EUFB 4KWPA 2PVYA 5KO1A 5DEWA 4QMOA 4NM7A 1E9HA 3CKWA 4Z16A 3U55A 4XP3A 4FK6A 4RIOA 4FT5A 4WUAA 2C3LA 4C4IA 5B2KA 4FTQA 4U6RA 4GT4A 4FUXA 3BX5A 4LG4A 2FSOX 3LAUA 3EB0A 3PFQA 2X6DA 4MNEB 4CMUA 3ID6C 3TJCA 3MY1A 4ACGA 2ITUA 3B8QA 1YQJA 4G3GA 2WMAA 4M69B 4O96A 3F82A 2HENA 3UTOA 3TUCA 2H96A 3CQUA 3GCQA 3F61A 5F4NA 3DJ5A 4AA4A 3VUGA 4IZ5A 2E9UA 4L42A 4HYUA 2JD5A 2VTPA 3R02A 5J7HA 3HAVA 5EHLA 1XJDA 3S95A 1OVEA 3Q6UA 4M13A 5AIRA 3N4TA 2HY81 5BMSA 1OITA 2WQBA 2XNOA 4DE4A 4MF0A 3NWWA 3P86A 2A19B 3I79A 4ZJJA 4EH8A 4UN0C 3UO5A 1MRUA 4K8AA 4B8MA 4QYFA 4RFYA 2W05A 3COIA 3L9LA 3Q96A 5EI8A 3D5XA 3EZRA 3W2RA 2WMWA 4WNMA 3HNGA 5DH3A 1KWPA 3UVPA 4D1ZA 1J1CA 2OI4X 4XRLA 4O7LA 5D12A 4Y46A 3KC3A 2GU8A 4Y95A 3OXIA 4WG4A 5LVLA 3FSFA 4FODA 4OTHA 4AZSA 3D5WA 4EOMA 1J7IA 5K5XA 3W1FA 1H1RA 4UWCA 3PG3A 4FYNA 4EQUA 2QI8A 4DAWA 5GZ8A 1RDQE 5I9ZA 4JQ8A 4BCGA 1W84A 3COKA 3DXQA 4FT3A 3PRFA 4TWNA 3H3CA 1YHVA 4YZCA 4OTIA 5DHJA 2WEIA 3E7OA 4FV6A 3WIGA 4FTAA 5EI6A 4RQVA 5C1QB 2WTIA 5AP3A 4Q5EA 3PZEA 4AE6A 5KBRA 2ITZA 3ZSHA 2YWVA 5ANOA 4FT7A 2OJ9A 3PSCA 3QWJA 5M4UA 4NFMA 1XWSA 4KRDA 4R8QA 4PMPA 4BC6A 2WQNA 4F64A 4FEQA 5F94A 4AOIA 5JQ5A 3ZO3A 4PL3A 3HL7A 5M51A 4RSSA 3MESA 2I40A 4BCPA 2ZB0A 4JDIA 4RA4A 2VTLA 4U40A 1S9JA 4O27B 3Q60A 3R9HA 2RG5A 5CSWA 3RAHA 4AOTA 1WFCA 3FZOA 4CFWA 3DFAA 4GUEA 4ANMA 4II5A 4NEUA 2WMXA 3PY1A 4CFFA 3IONA 3NIZA 1PXLA 3DB6A 2QNJA 4FNWA 4FTTA 3V5TA 3RCDA 3ZHPC 5IA0A 3O7LB 3TZMA 2C68A 4GK3A 4AX8A 4FOCA 2BRHA 2ETMA 4DINA 4HW7A 1FVVA 5HZNA 1OIQA 3ZZEA 5HU3A 3TZ8A 3Q2JA 2SRCA 1GIJA 4FKLA 2XK8A 3NUPA 3TEIA 5KX8A 3UZTA 5C9CA 5IEVA 3O2MA 3V8TA 1TQIA 3M11A 1P14A 1LEZA 3C0GA 4FSZA 4EWHA 1J7UA 2Y4IB 3ELJA 4X7QA 4C35A 5B2MA 4HZSA 4CZYB 4PY1A 4G5JA 1UVRA 5HGIA 4DC2A 1OIYA 4X3FA 4LUEA 4I5MA 5DNRA 3QCSA 3WZUA 2WNTA 3RM7A 4HNIA 1BKXA 4U97A 4I6FA 1CKPA 4AGWA 5HICA 4ZLOA 2HIWA 2UUEA 2W5HA 3QTZA 4FV8A 1XBBA 5FD2A 3R7OA 3OW3A 4DFBA 2YCFA 3CP9A 4YLJA 3WARA 4B7TA 3T3VA 5BQ0A 5HIEA 3I0QA 3TXOA 4YNEA 4J95A 4C4FA 4F7JA 5E8VA 4JRNA 3O17A 3E8DA 2R4BA 1Q8YA 2YM5A 3IW4A 2F7XE 2Y7JA 2BUJA 4PP9A 3CD3A 2ETRA 1Q62A 1PMEA 4RIXA 5AR3A 2PE2A 1BLXA 2G15A 5EHYA 3RCJA 4ANOA 4EORA 4QP3A 4MCVA 5IQIA 1NVQA 3FL5A 3QKKA 4O1OA 4CVAA 2JKKA 3KN5A 2YM8A 5KZIA 1PXPA 1FPUA 3KXGA 2UZDA 2UVYA 4CT2A 4DYMA 5IUHA 3T9TA 5ETAA 5J87A 4KABA 3R9NA 3ZH8A 1R3CA 1GZNA 3PA3A 3QRUA 4IX5A 2WMBA 5HU9A 3VS6A 4E8AA 2X2KA 3WBLA 4K9YA 5AV0A 3D2IA 3DCVA 3RK7A 1OPKA 3ACKA 3V6SA 4DLJA 4ZIMA 5M09A 1ZYLA 2XK4A 2QCSA 2GQRA 5CSHA 5ANKA 3ITZA 5HCYA 3TACA 4ZJVA 2LGCA 4OTPA 5F9EA 3LXPA 4NZWB 4Y72A 3VS1A 3AGMA 4BIEA 4D0XA 3BGZA 3EKKA 2VU3A 1URCA 4EC9A 1U54B 4F9AA 4FV1A 2WQEA 3DBQA 5HD7A 1Z57A 4YJPA 5AX9A 3ET7A 3NUYA 4JR3A 3MA6A 4AU8A 1IA8A 3DS6A 3P7CA 4PL5A 4BTMA 5GIPE 2ZM3A 1IRKA 3ROYA 4E4XA 2IVUA 4RWIA 4AW2A 2VTJA 2J6MA 4EOLA 4CG9A 2OXXA 5AP0A 4FMQA 4GG7A 5AV2A 4EOQA 4WA9A 2C1BA 2WTKB 4ORKA 3PE1A 1AD5A 3BYUA 2XNNA 4ZOGA 4I4FA 4C61A 2EXEA 4USFA 3A7FA 1CKIA 2X4ZA 2QODA 4NJ3A 1GZKA 4EOSA 4EOJA 3G9NA 3QWKA 5HBJA 3MB7A 4IB3A 1Z5MA 4IZ7A 5J7BA 2CLXA 3QQKA 2CMWA 1PMUA 5I0BA 3ODYX 2RF9A 3KXXA 3QKMA 3IG7A 1M7NA 4O21A 3LCDA 4LOQA 5L2QA 2YDJA 5CEIA 1MQ4A 3A8XA 3K3IA 3R8ZA 2HWOA 3KULB 4QT1A 3NS9A 4BDGA 3KRXA 4ENXA 4H1JA 2BTSA 1MRVA 4J97A 5IA5A 4CTBA 3FI8A 5KBQA 4RLKA 3ACJA 4DTKA 3TIZA 5JQ8A 1H1SA 2WKMA 1CM8A 3I7CA 5CEMA 5CEPA 5K9IA 4GRBA 4YBJA 3LFNA 1XBAA 5A4TA 4ZLZA 1KSWA 3AXWA 1CTPE 4EH4A 4EZ3A 4UMTA 2YJSA 3F2NA 3BI6A 1WBPA 5DGZA 5CAOA 4KIOA 4PDYA 3DQXA 4M8TA 1ZYSA 1PRYA 3MY0A 4MKCA 4MD9E 3A4PA 3D7ZA 5M53A 3UIMA 3PYYA 1H4LA 4GSBA 4ZAUA 4IM0A 4G34A 2IVTA 4JG7A 4WD5A 5EKOA 4A9TA 2UW9A 4JRVA 3R9OA 2OJGA 3NNVA 1OUKA 1CSNA 5J5SA 5E8YA 4H36A 2UZLA 4EK8A 2UZTA 2VO7A 2X7FA 1JAMA 2XH5A 5CI7A 5EM8A 4BI2A 5LWNA 2PUIA 3VBVA 2ITYA 1W83A 3NAYA 3SV0A 5GHVA 4H3BA 3HRBA 3F3WA 3C4CA 4IAYA 4RG0A 4YO6A 4JX3A 2HAKA 3C50A 5A54A 4F1TA 4QTEA 2ZV9A 4NCTA 3PY0A 5CSPA 4M12A 3DK7A 4GL9A 1H8FA 5KE0A 4BKZA 3KXMA 4IDTA 4YGAA 2V22A 3CEKA 1YXVA 4ZMEA 3O8TA 2W1DA 1XH5A 3C4FA 3ZUVA 3ALNA 3FKLA 1QMZA 4M97A 2GFCA 2R0UA 4O0WA 3V6RA 4F6UA 1RJBA 3DDPA 4QD6A 3EWHA 2YLEA 1XQZA 4R5YA 2XEYA 4IZAA 4RWJA 3SAYA 4RJ8A 5I3OA 3NMUF 2UZOA 4I6BA 3POOA 4IEBA 4NKAA 2C6OA 3EQIA 4FIIA 4L67A 4U79A 2B53A 3Q5IA 1NVRA 4C4GA 4IQ6A 3EFWA 3DKCA 4Y5HA 2HOGA 4U3ZA 4BRXA 2VTMA 3CSVA 3BQRA 2HW7A 3KCFA 3UE4A 1NVSA 4DEBA 3R8PA 1QPJA 3OVVA 4LRKA 4LRMA 5DRBA 2BCJA 4BYJA 5KMNA 4UWYA 3UZRA 3RALA 2C1AA 3W8QA 2PL0A 1OB3A 3ORLA 2O5KA 3VQHA 3TI1A 5CS6A 3UPZA 3Q4UA 3G51A 4TWOA 4TZRA 2JDTA 3H4JA 4ACHA 5FDXA 2VX1A 3V01A 4XOZA 4EC8A 1W0XC 3LVPA 5LJJA 4I6HA 4IE9A 2OF2A 3BU3A 4AXAA 4EH6A 4E5AX 1XR1A 4GIHA 2C5XA 3ORTA 4FICA 4I24A 4X2JA 5AR4A 5LMAA 5JGDA 3R83A 5IQCA 2QC6A 2B9JA 3TUBA 5I9VA 2R3NA 4DEIA 2WTWA 4DBNA 4ZS0A 4PP7A 3ZUTA 4XV9A 4Z7GA 4KB8A 3P1AA 4D9UA 3BHYA 3FI3A 3R21A 1TQPA 4X2NA 2CNVA 4HGLA 2R3PA 4ZSGA 3ORMA 3LZBA 3MTLA 3KKVA 1LEWA 2FB8A 2OXDA 4JBVA 2R7BA 3E92A 4JAIA 4YP8A 2WU7A 5HQ0A 3LCOA 4XG7A 1DI9A 4A4XA 4C8BA 4CRSA 3BYOA 3LCKA 1KV2A 1PXIA 1ATPE 3ULIA 3DBDA 4N4SA 4DT8A 2FGIA 1PXJA 3ENHA 3QRTA 4MQ2A 1ZWSA 3CKXA 3EQGA 2YERA 3LQ5A 2C6DA 5EDPA 4F9BA 5JFSA 4V0GB 3VJOA 3OZ6A 3BE9A 2V62A 4QYYA 1R78A 3HV3A 2C3JA 3KXHA 4X3FB 5AP2A 3LLTA 4AN3A 2PZIA 4KKEA 3II5A 4EQMA 2JC6A 5BYLA 3PVUA 4GU6A 3NVKI 5L4QA 4MX9A 4X3FC 5F20A 1ZOEA 3PIZA 3VF8A 1Q8WA 4ZS4A 2QHNA 2QVSE 3OT8A 5J8IA 4DEDA 4A4LA 3QRIA 2PYWA 3BV2A 3G33A 3G6GA 3ANRA 1P4OA 3JVSA 3EIDA 1FGIA 4O7WA 4PPAA 5HG9A 3VF9A 1NA7A 2ZOQA 4F63A 3L9PA 2R3QA 4OLIA 5J1WA 3HA8A 4A07A 4I3ZA 5F1ZA 3VS2A 2JEDA 3EQHA 3DK3A 1SM2A 4U81A 2CPKE 3HDNA 5KUPA 1JKKA 4WHZA 5I3RA 3QA8A 5AV3A 4Q9ZA 4QTCA 5CX9A 2VTAA 3OBGA 2X81A 5GIOE 2XM8A 2Z60A 3FUPA 2UZUE 4J98A 4YJQA 5CU4A 2QOKA 2WO6A 2FSTX 4IIRA 2YACA 3HMOA 2IO6A 4IXPA 2CGUA 3QD0A 2WOUA 2WPAA 2YFXA 2CNUA 2CSNA 1M52A 2ITXA 3EMGA 4FIFA 3KGAA 3E93A 2LAVA 5EHOA 4IVAA 2E9PA 3QD2B 2DYLA 3OWPA 5CNNA 3SLSA 1APME 3VS7A 3H9OA 2X0GA 4KAOA 3AQVA 1MP8A 4S33A 3EQRA 2BAKA 2GNLA 4R1YA 3D0EA 4FL1A 5DPVA 2VTIA 5A6OA 5AUUA 3U8WA 3W2SA 4O0XA 2OH4A 1ZMWA 4MXYA 5C01A 4D2PA 2O8YA 2R0IA 3QQHA 2Z7LA 1PW2A 3VC4A 2XNEA 2YDKA 2ZMCA 4OTGA 3RPSA 5A4EA 4XS2A 2F9GA 2WB8A 3DAJA 3MH2A 1OBDA 4L46A 4IAZA 4MBIA 1LR4A 1YXTA 4KSQA 1QPCA 3TV6A 3VW6A 2PY3A 3VBQA 3V8SA 4RWLA 3R7UA 4N70A 1JKTA 4USEA 1H1WA 4GK2A 5LVNA 4FKJA 2X2LA 5CSXA 4DA5A 3N4VA 3PVWA 2FSLX 3UNZA 5LVOA 4I93A 4RQKA 4IB0A 4APPA 2P33A 4FA2A 5IH6A 3V5WA 5HO7A 5A3XA 4HGSA 3U9NA 4APCA 4ZZMA 1H00A 4G3DA 4R7IA 4V04A 5FP5A 2WOTA 5FTGA 3S0OA 4GT3A 4RBLA 3W55A 2ZM4A 2W4OA 3BHHA 2QU6A 4BDHA 2G2HA 3IW6A 4W4XA 5C8NA 4TRLA 2OO8X 2BMCA 4QP1A 5FBOA 2I0YA 3HV4A 2VNYA 3VVHA 5TT7A 3AT3A 2OXYA 2CGXA 2F7EE 2E9NA 3G90X 3HV5A 1V0OA 1YWRA 3AGLA 3QTXA 3K5UA 5BMMA 1V1KA 4C2WA 5I4NA 3QQGA 2J51A 2W1EA 4YJOA 4ENYA 2W4JA 4PWNA 1FOTA 3EL8A 2VWUA 2OSCA 1PXNA 3UOJA 3E62A 5HX6A 1UNHA 4I92A 4L6QA 5BX0A 2OGVA 1Y57A 4E4NA 4BBEA 4XG3A 4MK0A 5J79A 2ZDUA 1JLUE 2NPQA 2Q0BA 2YM6A 4A4OA 5AP7A 3R9DA 2HZ4A 1T46A 2WGJA 4E4MA 2ZJWA 5BVKA 4JJRA 4BDAA 2OFUA 2UZVA 2BKKA 3O0GA 2C6LA 2WTCA 3PA5A 4HVDA 4JQ7A 4U8ZA 5HE2A 3IOKA 2PPQA 5IH5A 2BRBA 4F7SA 3P23A 3WI6A 2JAVA 3CQEA 2B4SB 2X8EA 3RWQA 3CGFA 4OTQA 3DB8A 5I5ZA 5FBNC 2UZEA 3EQFA 3DV3A 3ATTA 3U4UA 1OPJA 3ZLWA 4E73A 3DLSA 4RFZA 3ZU7A 2BRMA 2IW9A 4FV0A 4O7RA 5CAQA 4JBOA 4LV8A 3TV4A 5DOSA 2CN5A 4NCTC 3R7GA 3PDTA 2HCKA 5EM5A 2IN6A 3IO7A 3QCXA 4J1RA 4B8LA 2BTRA 1ZLTA 2DS1A 3F5UA 5IQEA 5EDQA 4P5ZA 2GFSA 3P9JA 4XV3A 3NSZA 3FZSA 4ZTHA 2ITOA 2OICA 3HAMA 4F7LA 2G2FA 3Q5ZA 1JSVA 1UKIA 2P0CA 2I0HA 4IX6A 5AA8A 5EI2A 1BMKA 4RFMA 5DT3A 1XH7A 3VBWA 4O0YA 5BYZA 3R8UA 4CYJA 1TQMA 4RWKA 3FMMA 4AUAA 2QONA 3OMVA 1YWNA 2XK6A 4G3FA 4CQGA 4O7ZA 4FTKA 2FA2A 5AWMA 3SC1A 4Z9LA 3ZSIA 2GNHA 2WTVA 4RA5A 2YIQA 4ZZOA 3HMNA 3SGCA 4Y73A 4NW6A 5CZHA 2ZMDA 4FKUA 5JSMA 4Q5HA 4QP2A 5DVRA 5BNJA 4L01A 3E63A 1F3MC 3CTQA 4TTHB 1KOAA 1XHAA 4GK4A 5FEDA 2C6MA 5DMZA 4IJ9A 5CZIA 1SZMA 3COMA 2C30A 4IM3A 4B0GA 3ATSA 3I6UA 4TYHA 2JDRA 4LQMA 4BDKA 3R2YA 3EFJA 5DYJA 2J0IA 2YWPA 5AUTA 2XF0A 4H3QA 3NAXA 3AD5A 4D4VA 2JIIA 3PJCA 3LXKA 3W10A 3D15A 3Q2MA 2BAJA 5EQPA 2XYUA 4FOBA 2XK3A 3FC2A 3GNIB 4FZAB 4YLKA 4QMXA 3V51A 4GYGA 3SXFA 4QMZA 2V0DA 3BHTA 4LL5A 3UMWA 3F6XA 5AJQA 4W9WA 3FZRA 4WG3A 4D2RA 2B52A 3CD8A 4XBUA 5AR7A 4AT5A 3LFFA 3VAPA 2OK1A 2YZLA 3TNQB 3UYTA 2JBOA 2QO7A 2GSFA 4YJUA 4WO5A 1H1QA 3NUXA 3GU8A 4I0TA 4MXCA 3DNDA 1RW8A 5EM7A 2IW6A 3GCVA 1TVOA 4PDSA 3KXNA 2OJJA 4IB5A 4J8MA 2XJ0A 3NYOA 4QNYA 5A9UA 3R0TA 3S3IA 1DM2A 1QPEA 2PMLX 3F3ZA 3PJ3A 4IB1A 5LQFA 3Q9XA 1UWJA 1BI7A 3HLLA 5M56A 2PTKA 3PJ2A 3UC3A 4CFXA 4X6QC 3QTWA 3GFWA 1FMOE 4P2KA 3WZDA 4D0WA 4BYIA 5JRQA 3F7WA 4D5HA 4YMJA 4BN1A 5AP1A 2OZAA 2NRUA 3E64A 4YO4A 4AG8A 2YAKA 2EB3A 2X6EA 2J7TA 4IANA 3DBEA 4FKTA 2EXMA 1G8AA 3RHXA 4EK6A 1ZAOA 5IZFA 2NRYA 5CT7A 2Z8CA 4BZNA 3FXZA 3RK9A 2WMTA 4FI1A 3KL8A 1JVPP 4IMYA 4RIYB 4BB4A 4EH7A 5HG7A 4UMUA 2Z7RA 3LXNA 3C1XA 3RI1A 4G9CA 3AC1A 4KA3A 4OR5A 4F70A 3UOHA 5A6NA 5IH4A 1JPAA 2PMIA 2ETKA 5AUWA 3EZVA 5ANEA 4O7TA 3BBTB 3Q32A 4FSQA 1OL7A 2ZDTA 3PIYA 4Z7HA 5J9YA 3R7IA 2YDIA 3JXWA 3LOKA 5M4IA 3FEGA 2W1CA 3R22A 5BVWA 4OUCA 1YHSA 2YIRA 4QPMA 4IWQA 4QMLA 3PWDA 4YJNA 2VN9A 2YM4A 3MVMA 3LFCA 1HCKA 3FMNA 3AG9A 3NEWA 3FLWA 5ACKA 3UODA 4AW5A 5LVPA 3SXSA 3MB6A 5J95A 4W4VA 3W16A 4DGOA 4QPSA 2WMUA 3LQ8A 3MFUA 3CY3A 4AGCA 4O84A 4W9XA 3I4BA 1PHKA 4QTAA 3TL8A 4L43A 4O6EA 4DGLC 1SYKA 3FZPA 2XNBA 3ETAA 4HCTA 1OMWA 4KSPA 4NM3A 4F4PA 3Q04A 5BVNA 2OG8A 2WD1A 4YHTA 2UW3A 3DTCA 4DEHA 4U7ZA 4U5JA 2X4FA 4F08A 2A27A 4IW0A 1YKRA 2Y0AA 2R7IA 1LP4A 1ZARA 4FKRA 4ZSAA 2PULA 5B7VA 4XX9A 4IBMA 3FQEA 5TE0A 4EJNA 4X6RA 4PMMA 2DQ7X 2ONLA 3JPVA 3QTRA 4BWKA 2JDSA 5AUXA 1IEPA 4AZFA 2HELA 4FEUA 4BHZA 3PPZA 3FXWA 3ZRLA 2PSQA 3H10A 2C6KA 5FM2A 4X2GA 4XNEA 2JITA 4FSTA 3KN6A 3LFSA 3Q6WA 4YHFA 3MBLA 4EQCA 4D55A 4FL2A 2ZM1A 4BIDA 2UZWE 3C4ZA 4CLIA 4ZTLA 3OWJA 4XG6A 2C3IB 2FO0A 1WBNA 3NLBA 1Q3DA 4NFNA 4TXCA 5FGKA 3WE4A 2QURA 4ZSEA 4JBQA 4TT7A 5AA9A 3SW7A 5ETFA 3VS4A 4QP4A 1FQ1B 4E3CA 3FYKX 4BR3A 1KE6A 4L00A 4RC3A 4D1SA 3MH1A 3WILA 5IU2A 3ANQA 4F6WA 5CALA 3UC4A 2DUVA 5FM3A 5AX3A 4FKOA 3MFRA 4FTCA 3UDBA 5AADA 4UWBA 1IR3A 3DA6A 3UIXA 5AP5A 1PYEA 3TKIA 5M07A 3ZYAA 3Q9YA 4CCUA 4BDEA 4HPUE 4DG0E 1MQBA 4BY9E 2QOCA 4NIFB 3SA0A 2R3MA 2XBAA 5JEBA 5HLWA 5CVHA 5L3AA 1UNLA 4FTNA 2B9HA 1YI6A 2J5EA 4L44A 1M7QA 4Z3VA 3VUIA 3ENMA 4QYEA 5EYMA 3D14A 3QAME 4QMYA 2HY0A 5D11A 3ZO2A 4PPCA 4D28A 5E7RA 5K5NA 4JAJA 3S00A 1Q97A 3GXLA 2ITNA 4F65A 4W4WA 3R2BA 4FSNA 3O96A 4XRJA 3F5GA 5HLPA 1AQ1A 3M1SA 3VRYA 4WNOA 2ACXA 4C58A 4JL9A 1I44A 5DG5A 2OBJA 3PXZA 3BIZA 3GU7A 5AMNA 4KNBA 5G1XA 3C5UA 3AC2A 3LMIA 5EQYA 4K11A 1KUTA 3QLFA 5EDRA 5T6KA 5L6PA 4QQTA 1JKSA 4L9IA 4YURA 2XKFA 3VBXA 1H07A 3VHKA 1KE5A 4Y85A 4EOOA 3VNTA 4HVHA 3G2FA 3C9WA 3QCQA 3A61A 4YPDA 3T3UA 2PZRA 5CAVA 1OIUA 3PSDA 2QHMA 4EI4A 3ZC5A 2BZKB 4BDDA 1SVEA 4XP0A 1OIRA 2JDOA 1KOBA 4RJ3A 2XA4A 4EONA 3RPOA 4ERKA 2PVNA 5J9ZA 3S1HA 5H8BA 4IZYA 5CEQA 2PU8A 3T9IA 4ALUA 5AP6A 4BGHA 2R3FA 3CC6A 5D7VA 4F9WA 4KIKA 4IC7A 3C51A 3TJDA 3KEXA 4BIBA 5JH6A 4B9DA 2CDZA 4JIAA 4TYJA 1ZOHA 2QD9A 3CCNA 2BZJA 4ZTMA 1M2PA 2QOIA 4FSUA 4QMSA 4O83A 1QCFA 3NCGA 2BVAA 1ZYCA 4L3PA 5AM7A 5T3QA 4TW9A 3O7LD 3A62A 3NCZA 3DNEA 5HE1A 2YCSA 2VWIA 1SNUA 5CU2A 4PDPA 5HLNA 4ACMA 4MAOA 1UKHA 2BHEA 5C27A 2IW8A 4ZY5A 2VTQA 4F9CA 4KS7A 4XH6A 5DI1A 3FHIA 4MQ1A 3PXRA 4J71A 4ALWA 2GMXA 3KXZA 4NYEA 3NW5A 3UNKA 4FKSA 5HI2A 2AC5A 4X2KA 2W1HA 5EOBA 3QQFA 4WSYA 4DEGA 1W82A 3LIJA 5B0XA 4NL0A 3RGFA 4KBKA 3NYXA 4K77A 4KINA 4ID7A 4NH1A 4XJ0A 1XBCA 5AV4A 3VS5A 5IEXA 4QP6A 3F2RA 4PMSA 4I41A 5CWZA 1IG1A 2JGZA 5FP6A 3BGQA 4C36A 5HNBA 1M17A 3BLQA 3TDVA 1Q61A 4U42A 2A2AA 4E20A 2PE1A 1Q41A 4IX3A 1BYGA 4C33A 2VAGA 1R0PA 3THBA 5HVJA 4AZWA 2VO0A 3QC4A 5AAGA 4CGAA 4RVKA 5L6WL 5KMJA 1PKGA 4C3RA 3FMEA 5HHWA 3QHRA 4ASDA 2W1ZA 2BIKB 3KMWA 2HXLA 4RVMA 3C13A 3OOMA 5HIBA 3FY2A 4EYMA 3VJNA 3QD3A 3FI4A 5JFVA 3PIXA 1H26A 3K3JA 3R1NA 4HJOA 1PMNA 2BDWA 5TOZA 4FV7A 3WZKA 4DTBA 3PP1A 3ZM4A 3ODZX 3KRLA 2ZV8A 4TNBA 3HVCA 5KMLA 2GS6A 5CI6A 4AFEA 1GIIA 3FMDA 4LV5A 5HTIA 5M55A 3DGKA 3QUEA 4OAUC 1ZXEA 1H08A 2PVLA 2XIRA 3P0MA 4FZDB 4J99A 4K18A 4BL1A 2YAAA 4BZDA 5BVDA 4EHVA 2FSMX 1E1XA 4GV1A 2VWWA 4N6YA 5H8GA 5HNIX 3R8LA 3Q4ZA 2W1GA 2GNFA 4P7EA 2VWVA 3UOLA 4R77A 2O63A 4FKPA 4MNFA 3KF4A 2QOFA 2B54A 2PUUA 4FKVA 4C4EA 3P7AA 3TZ9A 5IUIA 3OTUA 3A60A 3PP0A 3SOAA 2CKEA 2ZAZA 4FTRA 3TDWA 4QMPA 4C57A 4IWPA 5CVFA 3ZXTA 3MI9A 2OFVA 2W5AA 4AGUA 1IAHA 4F9YA 4WNKA 3DKFA 5DR2A 3HUCA 4FV5A 3MH0A 4BWXA 4BCJA 3CR0A 4TYGA 3VRZA 4XG4A 2CKOA 2F4JA 3RMFA 5EM6A 3OFMA 4FTJA 4DFNA 4NTTA 4V01A 3L8XA 3MYGA 4MH7A 1OPLA 4PQNA 2PVJA 3ORNA 3SD0A 2B0QA 3C5IA 4E6QA 4BF2A 5EH0A 4S2ZA 4OTDA 5IMXA 2BZHB 5EFQA 3NZ0A 3GOPA 4CKJA 3UO6A 2R64A 2A1AB 3KULA 1YW2A 2WEVA 2ZV2A 3KVXA 4JR7A 4EOKA 3QLGA 4E5BA 2DWBA 4EL9A 4LMUA 4YTCA 3EN4A 3ZDIA 2UVXA 4YUQA 2OJFE 2RG6A 2XUUA 4GYIA 5KMIA 4FG9A 4JI9A 3MWUA 4I20A 4B99A 4AAAA 4O0RA 3ZM9A 3W2CA 2UW4A 4IWDA 4AA0A 4JX7A 3E88A 4F1OA 3IECA 2C6EA 4U80A 2EB2A 2KULA 4OT6A 3QYWA 4GU9A 3S4QA 3V5LA 5DBXA 5LXMA 3B2WA 4RIXB 4YC8A 3BYVA 1PKDA 4LI5A 5DRDA 5E8ZA 4I5PA 4CMOA 1SVGA 3VN9A 3AD6A 2PUNA 4CZUA 3JY0A 2PUPA 2BILB 3ZOSA 4CQEA 5H8EA 4U44A 3BCEA 1ERKA 2QOQA 3OCSA 4ANLA 4IC8A 2O65A 3F3TA 1OKZA 2R3GA 3V04A 2H8HA 4QP8A 4FV3A 3AC4A 3MTFA 1U5RA 4ZTNA 1RE8A 4W8DA 4B4LA 4CTCA 4CLJA 2BFYA 2G9XA 5IG1A 2RL5A 4OT5A 5M4CA 3CJFA 3CPCA 4IX4A 2GS2A 3TTJA 3D2KA 2O2UA 3CJGA 4FVRA 4TWPA 3R28A 4UXQA 5EK7A 2PMOX 2WIHA 3LFQA 4HCUA 4IVCA 3VBYA 4EHEA 5CVGA 4JBPA 4IWOA 3E87A 4E5WA 4RVLA 2W06A 5LARA 5IQDA 2RGPA 3VUDA 4P5QA 4WG5A 3K2LA 4QOXA 1ZZLA 3R7YA 4DFLA 3EL7A 2O0UA 1JWHA 3OY3A 5ACBC 5BVOA 3RTPA 4NW5A 2JBPA 2XCKA 5CF8A 4AZEA 4G2FA 4ASEA 3I7BA 3WF6A 4X21A 5CSVA 3NW7A 3E8NA 4GH2A 4DFXE 1Q3WA 3F69A 3WF7A 5KMKA 3JR1A 3QHWA 3BYMA 4FIGA 2UV2A 4YNOA 2QOLA 4DLIA 3R71A 4ITHA 1R1WA 4L45A 4IFGA 2YIXA 3LFAA 4D2TA 1H27A 4FNYA 2BKZA 3EQPA 3BWFA 4GFGA 3OY1A 5IEYA 3ZRKA 1XH8A 2H6DA 4ZTRA 3PUPA 3U54A 1H0WA 4K6ZA 1V0PA 4EJ7A 2PE0A 2WMSA 2XK9A 2RFNA 3FZTA 3MGYA 4ZY4A 4FZ6A 5IA4A 4RJ7A 1DS5A 2W0JA 4W4YA 2E2BA 3WYXA 4GT5A 3UJGA 3HZTA 4A9YA 3OTVA 4DFYA 5C8KA 4GEOA 4Q2AA 4FX3A 3ZFXA 1FMKA 3TG1A 3L8SA 2I0EA 2J0KA 1DAYA 4MBJA 3W2OA 3R9RA 3CS9A 4A06A 4K33A 2VTNA 1WCCA 3VBTA 1H01A 3ORPA 4XUFA 4BCNA 4EBVA 2CKQA 2UZNA 5J1VA 3HGKA 3LFEA 4EUTA 2JKQA 2RFEA 3EQBA 4YZ9A 3SRVB 3O8PA 2ITQA 3H9FA 1BL7A 1Q99A 1BX6A 4QMUA 4RZVA 2WQMA 3A4OX 5ETCA 4GW8A 3R04A 5I9XA 4K1BA 2C5NA 1U46A 5FTQA 4U9AA 1OECA 4UZDA 1U59A 5JN2A 3A7IA 1YOMA 2J5FA 2Z7QA 3GUBA 2CN8A 4AN2A 3RAWA 2V5QA 4L7SA 2W1FA 4LGGA 5DE2A 2H9VA 4M0ZA 5E1EA 5HD4A 1OKVA 4BDJA 4F0IA 1GIHA 3FSKA 3RHKA 4AW0A 4E4LA 4HYIA 4J53A 1WBSA 3SW4A 5L8LA 4C3FA 5CU3A 3JYAA 1WMKA 2G2IA 2XP2A 4NU1A 4FG7A 3O50A 1PXKA 1Q8UA 3LM0A 2QO2A 3BEGA 3GP0A 3OC1A 4FYOA 4K2RA 3RPYA 5ITAA 4RX5A 1FVTA 3IGGA 2O3PA 4S34A 1B6CB 4LOPA 4EHGA 1GAGA 3LFBA 4BDCA 1YOJA 3VUHA 3O51A 4MTAA 5EQEA 5IQFA 4YC6A 4KUJA 4JLCA 3EN6A 3H9RA 1BI8A 3C7QA 2ITPA 4Z55A 3TUDA 4ERWA 4WSQA 3POZA 1CDKA 1Y8GA 3WYYA 3VS0A 5AUZA 3KMMA 2R3IA 3PLSA 4FL3A 4C38A 3NYNA 1UU9A 3KREA 4XCUA 1REKA 4KBCA 2VGPA 3HKOA 4RX7A 5HX8A 2RIOA 3ZO4A 5K0KA 2VWBA 2XKCA 3WF5A 4OBQA 4ZLYA 4FV9A 4A9SA 1K2PA 2B9FA 4KKGA 1OL6A 4JOAA 1KV1A 4DN5A 3SVVA 1WBWA 5HKMA 3VO3A 2HW6A 2YABA 5EOLA 3ZLXA 4ANBA 3R30A 2YCRA 3FE3A 4AW1A 2JKOA 5C8MA 2XNMA 4QP9A 1U5QA 3HA6A 2WMRA 1YOLA 4O38A 3DZOA 4BBFA 3RJCA 4DGNA 3CTHA 2BPMA 1H28A 1W7HA 3DBCA 3R1YA 2F49A 4J7BA 5HVYA 1YI3A 3W2PA 4UX9A 3ZUUA 3D5VA 4FSRA 5HBEA 4ZZNA 2GNIA 4AQCA 5C03A 1HOWA 1YI4A 2ONLC 2XRWA 3QX2A 4GCJA 5ETIA 1FBNA 3G6HA 3GCPA 5HCXA 4UALA 2O64A 3ZBXA 3TZ7A 1UV5A 3VS3A 3IGOA 2OU7A 3A2CA 5C4LA 3LQ3A 4CG8A 1FGKA 4ZMFA 5CAUA 3MVLA 4OGRA 5IMEA 5IA2A 4UMRA 2X7GA 1A9UA 3GQIA 4HVIA 3GFEA 3MJ2A 4NK9A 4D2VA 2Z7SA 3I6WA 4N57A 5BVEA 4D4RA 2GS7A 4QMNA 4S30A 4FIJA 4G5PA 3FMHA 3IOPA 5GZAA 2VWYA 4IDVA 5EYDA 5KMMA 4MVFA 2XVDA 3GC8A 4BKJA 1W98A 3D9VA 5GZ9A 3WF9A 3IDCA 5BYYA 2VO6A 4D4SA 4AP7A 4I23A 3MPTA 2GTNA 2VV9A 3H0ZA 3RP9A 3HRCA 4BCOA 3LKMA 1R39A 4DBXA 3FHRA 4B6LA 5DR9A 4FK3A 4D1XA 3G0FA 2IZRA 5AR5A 3KF7A 2XM9A 4FTIA 3QUPA 4I0RA 4QYHA 3KQ7A 4M7IA 2XBJA 2W9ZB 1H1PA 4Y8DA 3NNWA 4TPTA 4NM0A 1OKWA 2Z2WA 2REIA 3P79A 4YC3A 3W33A 3ZXZA 3I5ZA 5LCJA 3DK6A 3QZIA 3PLAE 3QKLA 5K0XA 3R1QA 3ZFMA 3RAKA 4FSMA 3BYSA 3PE2A 5EKNA 3V3VA 4L7FA 2PZPA 3BQCA 5L2IA 1PMVA 3NNXA 3REPA 2XMYA 4L53A 1YDSE 3AT4A 4I6QA 4FKIA 4CXAA 2GHMA 3QQJA 3Q52A 2XNGA 3OG7A 5JKGA 1J7LA 3IS5A 4PTEA 3VIDA 2RFSA 4RT7A 3OBJA 3U6JA 3CQWA 5IF1A 3NUSA 2AUHA 5KKRB 4XV2A 5D7AA 4QP7A 1WBTA 1P4FA 2WTKC 3F9NA 2WFYA 4M68A 2I7QA 3MS9A 4EEVA 3LXLA 1TKIA 3NX8A 3Q3BA 4QQCA 5JGAA 5AAFA 1PJKA 3OWLA 4X2FA 2IZTA 2ITVA 3JVRA 3ZEWA 3P5KA 3RK5A 4LYNA 4MXOA 3ZONA 4DHFA 5I9YA 3F2AA 5DA3A 1WBVA 4L8MA 1Q8ZA 4JDHA 1ZY4A 5EW3A 1PXOA 2J0JA 4BCKA 4PX6A 4O7SA 2CLQA 2VZ6A 5C4KA 1MUOA 5E8WA 5AV1A 3ERKA 4XLIA 4X0MA 4CV9A 3U51A 1UWHA 3TTIA 3LLAA 2ERZE 2J0MB 3DBFA 3PXKA 4U0IA 2PWLA 5CXHA 4S32A 4KKHA 5HE3A 2HXQA 4NKSA 2P55A 5KHXA 1Q8TA 2KTYA 3FLZA 2R3RA 3VUTA 4IFCA 3E3PA 3GI3A 4IH8A 4G6LA 4OW8A 5DFPA 1G5SA 3OXZA 3DU8A 3UO4A 4E26A 5LMKC 2P2IA 4NIFA 1JNKA 5HG5A 4BWPA 2XCHA 3GU4A 3WF8A 4WBBB 1JSTA 2YM7A 3G0EA 3JUHA 4EKKA 5M57A 4IACA 3DAEA 4FZ7A 1F5QA 4DCAA 4DT9A 1H0VA 2CHLA 2VTTA 1G8SA 3NIEA 1IA9A 3PRIA 3U6HA 4DGGA 3RBWA 1JQHA 3BHVA 4FE2A 2Y8OA 4EK3A 5IQAA 4WNPA 2VUWA 5CT0A 4C62A 1O6LA 3C4XA 1UU7A 4BGQA 3FQHA 4G6OA 4QO9A 3GCSA 1GZOA 3RVGA 4UEUA 4TYHB 3UVQA 4PV0A 3IKAA 2OZOA 2C5VA 2JFLA 2QOBA 4YSMA 3A8WA 3GU5A 1J3HA 3NR9A 3V8WA 3GBZA 1OZ1A 3U4WA 3SRVA 5HORA 3QUDA 4HYSA 3D7TA 3L9NA 5HEZA 1YDRE 5JZNA 3ZSGA 5CASA 3CTJA 3QBNA 2GQGA 5E1SA 5KZ0A 1VJYA 1B39A 2J50A 4XV1A 4QQ5A 1V0BA 4BZOA 2QOOA 4JG6A 3E7VA 3NVMB 2XKEA 4BTKA 3QC9A 4MD7E 5FLFA 2W96B 3KRWA 4ACDA 2BIYA 4FBXA 4FGBA 1A06A 3GC9A 2WXVA 4R7BA 2B55A 1YRPA 3OF0A 5JRSA 4XMOA 4LRJA 3OUNB 4UB7A 3TNPC 3U9CA 2XEZA 3OXTA 1UA2A 3FMLA 4O6LA 2PMNX 5AR8A 2QKRA 4A9RA 5D41A 4QPAA 4BCMA 5IQHA 1OL5A 4FV2A 4RRVA 2UW5A 5HBHA 5JK3A 2C0OA 4M3QA 3M42A 4CRLA 2PVMA 2RKUA 5C26A 2C5YA 4F0FA 3HECA 1YXSA 2EVAA 3R6XA 4FC0A 1SMHA 3BLRA 4R3PA 3KB7A 4RIWB 3UP7A 3BZ3A 3G5DA 2FYSA 4FKQA 4RIYA 4C0TA 5JMSA 4H05A 1FINA 4NWMA 4HYHA 4LGDA 4FF8A 2V55A 4YBKA 5TF9A 2B1PA 3KMUA 4C2VA 2BDJA 3GC7A 5JT2A 5ANDA 3IQ7A 5HESA 4F6SA 5HTBA 1DAWA 3MIYA 3CY2A 4JT3A 1JBPE 4F7NA 1CKJA 2C5OA 4O1PA 3TWJA 3V5PA 3QFVA 4L52A 5GJGA 3QQLA 5AM6A 5K4JA 1AGWA 3BE2A 1XO2B 3JS2A 4R6VA 4TWCA 4CCBA 2BDFA 4NUSA 5E9EA 5IQBA 2J2IB 4KS8A 3VUKA 4BDIA 1H25A 5HO8A 3FV8A 4EUUA 1Q24A 2F7ZE 5AAEA 5KNJA 2QG5A 4ZEGA 4I1ZA 3S2PA 2PVHA 4BDBA 2OIQA 4BFMA 3OWKA 4RJ6A 3H0YA 4DEAA 1IAJA 4O0VA 4TN6A 3PVGA 4M0YA 4F0GA 4ITJA 3LFDA 3OCBA 3QF9A 4D2SA 3KU2A 3P7BA 4WBOA 4M66A 3O71A 3MY5A 3C4EA 1BL6A 4AWIA 3DOGA 4WKQA 1L8TA 3RKBA 5IDNA 3CIKA 4F1MA 3F88A 2ZV7A 4RIWA 3IDBA 3Q9ZA 3FL4A 4FEXA 5BUIA 4GVAA 3MN3A 1W8CA 2CGVA 3OUKA 3PJ1A 2B7AA 2BZIB 3BKBA 3W8LA 5CEKA 1K9AA 1KE8A 2VRXA 3NPCA 4CSVA 3IDPA 5CTPA 3DFCB 3I5NA 3FMJA 4J8NA 3Q9WA 4LFIA 4HOKA 5CF6A 1SNXA 4TYIA 3UPXA 2XB7A 5LCKA 3NW6A 5CU6A 4BTFA 2NNWB 2R3JA 5CY3A 1NT2A 2QKWB 5DLSA 4FKGA 2QOHA 4GUBA 4IAIA 3L1SA 1VYWA 3QA0A 1B38A 3ORXA 4QQJA 5AIKA 3W32A 4ZSLA 1Y91A 3NUUA 3MFTA 3ORIA 3MVJA 3KY2A 4I4EA 5FXSA 5BVFA 3G9LX 2R2PA 3DAKA 4YHJA 3EYGA 1BUHA 3COHA 4OTWA 2JFMA 3HP2A 4EH5A 4BI0A 3BPRA 4CFMA 4YR8A 2HZ0A 2BALA 4ANQA 4LGHA 3IW7A 4H58A 3DKGA 5D9HA 4CFNA 3LM5A 4GJ2A 3WE8A 4BBMA 3UG1A 5JZJA 3LPBA 2ITTA 3FQSA 4QMMA 3V5QA 5GNKA 4KIQA 1WVXA 2VX0A 2VD5A 1I09A 1Y6AA 3L8VA 5ANGA 3CLYA 2P4IA 2UVZA 5BPYA 4EH2A 2QO9A 3M2WA 1M14A 3Q53A 4FKWA 4M67A 3FXXA 3GEQA 5D1JA 3N51A 3ZZWA 1YHWA 4AE9A 1U54A 4YU2A 1VYZA 4ARKA 5D10A 4EHZA 5I9WA 1EH4A 3BU5A 3BEAA 3L8PA 4M69A 4WUNA 4ALVA 4MEDA 3FZ1A 1O6YA 3QZFA 4L3JA 4R5SA 3LW0A 1YXUA 3DT1A 3IW8A 4LL0A 4DGMA 4AT3A 3QALE 4G16A 4DG3E 3K5VA 4E6DA 4UY9A 4YJSA 3GVUA 4NM5A 2UW8A 3MV5A 5G6VA 3DY7A 4EH3A 3MVHA 4EH9A 5HIDA 1GZ8A 3Q4CA 1M2RA 2I0VA 1ZZ2A 4L3LA 4A9UA 4LUDA 5KMOA 1FVRA 2I1MA 3QL8A 4BTJA 5L6OA 2CNQA 3R7VA 2Q0NA 4PF4A 2OLCA 2XRUA 1GY3A 1KE9A 5F95A 1OKYA 3PTGA 5M08A 2YIWA 3GENA 3AC8A 1CMKE 4FTOA 4GIIA 3D5UA 4XOYA 4YJTA 4YPSA 2HYYA 3NRMA 4GJ3A 3UMXA 4O7VA 5E8TA 4OAVB 3O23A 5L8JA 3UBDA 3FDNA 2PVRA 3EFKA 4ZTSA 1SVHA 3GQLA 3QTIA 2QG7A 3HV6A 3I60A 4DEEA 4M84A 4TYEA 4MXAA 4RC2A 4RMZA 3RNIA 3SQQA 5FUTA 3EOCA 2C0IA 2ZB1A 2C3KA 4CMTA 1OM1A 3LJ0A 1UNGA 2QU5A 3HMMA 1OUYA 5E91A 4RVTA 3AT2A 5BUEA 4ZXTA 1YVJA 3TNHA 4AA5A 5ANJA 5LMKA 3OOGA 4LOOA 4O91A 2NO3A 2OH0E 4ZK5A 3UQGA 5L8KA 4PUZA 2WZJA 4O2ZA 1VR2A 1KE7A 4JDJA 3LHJA 2XNPA 4O86A 3N4UA 1ZMUA 4C37A 5A4QA 3BV3A 1Q5KA 3RAIA 3TNIA 5E90A 3VQUA 3UQCA 3OHTA 1P2AA 4CEGA 5AP4A 4EK5A 3AC3A 1DI8A 2QR7A 3FBVA 4I21A 4QMTA 2IWIA 2YITA 5CF5A 2VTOA 3ZDUA 4BVUA 4QMVA 1IASA 3D83A 1REJA 4JQEA 4JIKA 1S9IA 3UQFA 2AC3A 4FZFB 3C0HA 2XJ2A 1U4DA 2PVFA 4N0SA 3NNUA 5ANIA 3RWPA 3SXRA 4I94A 4U41A 5L2WA 2YISA 4GG5A 4MYGA 2J4ZA 3GC0A 5DN3A 2VTRA 3QZGA 4E6AA 2IZSA 3OP5A 4R7HA 5AFVA 4YZBA 1GOLA 2OKRA 3F3VA 3HDMA 5HCZA 5T68A 4C4JA 1NXKA 3BHUA 3EFLA 5DEYA 5DWRA 5HTCA 3OD6X 1O6KA 5IUGA 5FDPA 3ZBFA 3PVBA 2BFXA 1YXXA 4DTAA 2C47A 4JVGA 3BRBA 3NYVA 2F2CB 4TKSA 4K0YA 2X9FA 4U45A 2VTHA 3MSSA 1ZMVA 3SDJA 3MPAA 2OWBA 4BKYA 3KK9A 4KD1A 4RLLA 3B2TA 1RQQA 3PPKA 4DFZE 5AEPA 3R01A 5HVKA 1OL2A 4BI1A 3BWJA 3QTQA 2CGWA 4NSTA 2CKPA 2R3LA 2WELA 2QQ7A 4X3JA 3V5JA 3KCKA 4PPBA 4C7TA 3R7EA 4E93A 3SG9A 3ZEPA 4XP2A 5TR6A 5M06A 3F7ZA 4H1MA 5EYKA 2QR8A 2X2MA 3IK3A 3NGAA 4YZNA 3FLQA 1Y6BA 4YZMA 3CE3A 2VTSA 3E5AA 3SG8A 3UIBA 4QMWA 4E1ZA 2PZ5A 3PJ8A 3ZLYA 4DFUA 1ZYDA 2IPXA 2VNWA 3ULZA 4WRSA 5ICPA 3HRFA 3LMHA 3QTUA 2IVSA 3RNYA 5IPJA 3DQWA 1WAKA 4UZHA 4UBAA 5JGBA 3DLZA 5FRIA 2RSVA 3MIAA 3QX4A 3AOXA 4ANSA 3R1SA 2UW7A 3VULA 3G15A 1ZY5A 2YEXA 4R1VA 4HZRA 1PXMA 1X8BA 3GGFA 2YJRA 2BROA 2EU9A 4FSWA 4A7CA 5K4IA 2GHGA 2AYPA 4M15A 4DG2E 4ZJIA 3OT3A 3FPMA 1UU8A 2X39A 2Z02A 3UYSA 2FUMA 5GJDA 2YA9A 5E4HA 3EN9A 5FXQA 3U87A 3PZHA 2QLQA 2VX3A 3UNJA 4CNHA 4R78A 3F5XA 1Z9XA 3TKHA 3AMYA 4PDOA 1K3AA 3QGYA 1VZOA 4KIKB 5LOHA 4QNAA 5DT0A 3ZCLA 4C59A 4O7YA 2BRNA 3ZO1A 2XKDA 5TO8A 5H3QA 4BICA 4OTFA 2YN8A 2EXCX 3BGPA 4CYIA 5M44A 2CCIA 3SHEA 3ZMMA 2J9MA 3AMAA 3QYZA 4FNZA 3R63A 3PXYA 4G9RA 4HCVA 5GINE 4O0UA 4FEWA 3A7GA 3WIKA 1NY3A 5E8XA 3GU6A 4EOPA 2WQOA 4F09A 4C02A 5M4FA 4QYGA 2Y6MA 3OW4A 3BU6A 1ZRZA 2R3KA 2GTMA 4FTLA 4PNIA 4WOVA 2W17A 3EH9A 1OI9A 4UMQA 5HG8A 4DH7A 2YZAA 1XH6A 4C3PA 5JFXA 5L2TA 2ESMA 3AC5A 4I5HA 4IVBA 3FPQA 2IJMA 2XZSA 4KBAA 2F57A 4FTMA 5LMBA 2YIYA 3DKOA 3RPVA 3IPHA 4FEVA 3FC1X 4GMYA 1XH9A 3VW8A 4JDKA 2XYNA 4IM2A 4CFUA 3P4KA 3U6IA 3VWAA 2PHKA 4RC4A 2UZBA 3KVWA 3JY9A 2JIVA 4ZSJA 3FLSA 1P5EA 4MWHA 3EQCA 3RZBA 4JNWA 3HEGA 4XLVA 4EOIA 5HNGA 2Q83A 1WVYA 4CZTA 2WTJA 2HK5A 4ZP5A 3HMPA 4N6ZA 2XJ1A 3EQDA 4IHPA 2ITWA 2HWPA 4BGGA 3OEZA 3QZHA 3NUNA 4V05A 4XHKB 3D94A 3EKNA 5IKWA 3R8MA
chains in the Genus database with same CATH superfamily
1OGUA 1STCE 3FI2A 1GJOA 4MHAA 3TT0A 1G3NA 4GS6A 3D7TB 3ORKA 4FVQA 3BLAA 2J90A 1WBOA 3I81A 4BCHA 3QXOA 4BCQA 3MPMA 4MD8E 3ZFYA 4DITA 3BL9A 5IA1A 4C34A 4AN9A 2P3GX 4D4YA 4LMNA 4EWQA 4DDGA 4OBPA 3WZJA 1QPDA 3QRKA 4F99A 3MA3A 4TNDA 4IVDA 5CLPA 4ZTQA 4DH5A 2GNGA 2H34A 1LPUA 4G17A 4AS0A 3EN5A 3FKNA 3A99A 4O0SA 4WIHA 2X8IA 1JOWB 3LCSA 3QRJA 4GKHA 5FG8A 2J0LA 4HPTE 2WIPA 4D2WA 3FJQE 4EKLA 2GPHA 3NUAA 4FR4A 2W99B 3BLHA 4S31A 1OGYA 4YJRA 2YCQA 5CENA 4PTGA 3FYJX 1MRYA 3ROCA 4FTUA 3ZRMA 1WZYA 2FVDA 3A7HA 4IAKA 4D9TA 3KRRA 3SKCA 4ITIA 4O22A 4FUYA 3E8CA 2W7XA 4RGJA 5H2UA 5B2LA 5IA3A 4FT9A 4PL4A 1YDTE 3H30A 2W5BA 3ZC6A 2Y4PA 3TV7A 3DJ7A 3I0OA 2B9IA 2JDVA 5CANA 2E9VA 2G01A 2WAJA 2ZVAA 4DH3A 4AF3A 3TCPA 1OL1A 5IDPA 2G1TA 4EBWA 4GKIA 5FEEA 5CNOA 3B8RA 4P4CA 3HYHA 3ZTXA 3OROA 2ERKA 2GNJA 3F5PA 3PA4A 4ONAA 3TN8A 4HNFA 4AT4A 3UOKA 4O82A 1ND4A 2JLDA 2P2HA 4L68A 3IW5A 4XBRA 5EW8A 4DH8A 4BHNA 5CYIA 3FWQA 4O7NA 3QTSA 5KHWA 5EYCA 4FVPA 4MXZA 4D5KA 1HCLA 4GVJA 3QGWA 4BDFA 3E8EA 4HGEA 4HGTA 4YTIA 4W8EA 3CPBA 5I9UA 3T8OA 2CJMA 1JKLA 2OJIA 2WMQA 3EYHA 4RZWA 3ZS5A 2WHBA 3TNWA 3PY3A 3BELA 1URWA 5DIAA 3W2QA 5TKDA 3RINA 2CCHA 3GB2A 2GDOA 2WTDA 4IAAA 2C6IA 3UIUA 3FAAA 5AUYA 5J5TA 2VGOA 5CEOA 3CXWA 4TY1A 1J91A 3QXPA 4OTRA 5CQWA 4CT1A 3RM6A 4CFVA 2XIYA 4JS8A 4YLLA 3ZLSA 2R3HA 1O9UA 2OZAB 2QLUA 2V7AA 4E6CA 2W9FB 4ZY6A 2PK9A 2NYAA 2NP8A 4BCIA 1ZYJA 4G3CA 4U3YA 5KKRC 5DT4A 3HP5A 5JFWA 1OBGA 3KFAA 3DJ6A 5H9BA 3WZEA 3FLNC 3PPJA 4HVGA 3UG2A 1E1VA 2JAMA 3HMIA 4PTCA 2I6LA 3AD4A 5FQDC 2XK7A 4CV8A 4RX9A 3LJ2A 2EWAA 5CXZA 3DZQA 4QRCA 4I0SA 4TL0A 4UYNA 3KA0A 4YJVA 2Y4IC 5IQGA 1XKKA 4J96A 1PY5A 1UU3A 3EJ1A 1WVWA 3F3UA 3MFSA 4FIEA 3DDQA 4J52A 5AR2A 1VEBA 2GHLA 3FKOA 3PXQA 1L3RE 3Q4TA 4UMPA 3ALOA 4EZ5A 2V7OA 3DPKA 2VWZA 2JIUA 3HX4A 4QTDA 4RJ5A 4CKIA 2X7OA 3EHAA 3DTWA 4XG9A 2XS0A 4EYJA 4AZTA 5FTOA 2JKMA 4E7WA 4H39A 4MXXA 4DHIB 4ACCA 3PSBA 2C4GA 2A4LA 4I22A 5E8SA 3TIYA 2YLFA 3P08A 2HZNA 3FMKA 4G6NA 3EN7A 3MJ1A 4G3EA 4XG8A 3UVRA 3W0PA 4KRCA 3FY0A 4RX8A 2Y9QA 1Y8YA 3D4QA 3GOKA 4FG8A 2W4KA 2Y6OA 2ZYBA 2GQSA 4MWIA 4UYAA 4I5CA 3LE6A 2IZUA 4M14A 3DXPA 3KK8A 4PNKA 5EW9A 5LWMA 3UZPA 2XIKA 4FIHA 4LV7A 5A4LA 2W1IA 4YZDA 3PWYA 2BHHA 4BJJB 1LUFA 4O0TA 3W18A 5FXRA 3C4WA 4DCEA 2PVKA 3A7JA 3R00A 4ASZA 3BBWA 4WT6A 4YTFA 3I1AA 5J9LA 4U43A 4HVSA 3SOCA 5BUJA 4XEYA 2VO3A 4PMTA 4YSJA 2A0CX 5KCVA 4D58A 2AEGA 2UW0A 3HV7A 5AUVA 1JSUA 4C4HA 3PXFA 5FEQA 3E3BX 2R5TA 4AOJA 2OW3A 3P78A 2E9OA 3LMGA 4O81A 2RFDA 3QD4A 4IADA 1NW1A 5A4CA 1T45A 3FLYA 2YM3A 4IJPA 3WOWA 4CKRA 5HO6A 1YWVA 3RZFA 5E8UA 5CQUA 4EZ7A 1QL6A 4MF1A 3F66A 4ANNA 2HZIA 1VLRA 2OIBA 3ORZA 3OCGA 4JXFA 4G1WA 4ASXA 3OCTA 5FWKK 4FJVA 4DH1A 2PZYA 2C0TA 2VWXA 5K3YA 4Y83A 2IVVA 3PFYA 2XIZA 4NT4A 3O8UA 4NJDA 5CU0A 4BCFA 3L9MA 2X8DA 1R0EA 3QQUA 1TFFA 2X9EA 4KIPA 4RJ4A 5E92A 1XH4A 2XIXA 5HOAA 4AFJA 4DF3A 4IAFA 2IG7A 5IISA 4AZVA 4GFOA 5A46A 4AXEA 1PYXA 5L2SA 3MH3A 1M2QA 4QTBA 2WMVA 2C69A 2BR1A 4UV0A 4QMQA 2X1NA 4XG2A 5CAPA 3HUBA 3DXNA 4YTHA 4R3RA 4FV4A 4AACA 4AGDA 4R3CA 1F0QA 2R3OA 3UP2A 1GNGA 1H24A 4Y5QA 4H3PA 5EG3A 2YHVA 3TKUA 3QCYA 4MNEA 3MW1A 4NTSA 4MBLA 2OF4A 1PF8A 4EK4A 1A48A 3NDMA 3MDYA 2GCDA 2R9SA 4LM5A 3GT8A 4Q9SA 5HE0A 4O2PA 3AMBA 5DR6A 5A14A 3LCTA 4RPVA 4JG8A 5LVMA 2WU6A 3OS3A 4PRJA 3OEFX 3CGOA 2FH9A 4XYFA 5CF4A 4FGRA 3UGCA 3VHEA 3TM0A 1J1BA 2UW6A 3CBLA 4FNXA 3PG1A 4V0GA 2BRGA 1ZOGA 2F2UA 3RPRA 3VUMA 1Q4LA 4GFMA 2OIDA 3C0IA 2BAQA 3QU0A 4FSYA 3KRJA 3GCUA 5GJFA 3R8VA 4UXLA 4FT0A 4OBOA 2C6TA 4WRGA 3LJ1A 3N9XA 4P90A 3R73A 3K54A 4G31A 4CD0A 3SX9A 4USDA 2EUFB 4KWPA 2PVYA 5KO1A 5DEWA 4QMOA 4NM7A 1E9HA 3CKWA 4Z16A 3U55A 4XP3A 4FK6A 4RIOA 4FT5A 4WUAA 2C3LA 4C4IA 5B2KA 4FTQA 4U6RA 4GT4A 4FUXA 3BX5A 4LG4A 2FSOX 3LAUA 3EB0A 3PFQA 2X6DA 4MNEB 4CMUA 3ID6C 3TJCA 3MY1A 4ACGA 2ITUA 3B8QA 1YQJA 4G3GA 2WMAA 4M69B 4O96A 3F82A 2HENA 3UTOA 3TUCA 2H96A 3CQUA 3GCQA 3F61A 5F4NA 3DJ5A 4AA4A 3VUGA 4IZ5A 2E9UA 4L42A 4HYUA 2JD5A 2VTPA 3R02A 5J7HA 3HAVA 5EHLA 1XJDA 3S95A 1OVEA 3Q6UA 4M13A 5AIRA 3N4TA 2HY81 5BMSA 1OITA 2WQBA 2XNOA 4DE4A 4MF0A 3NWWA 3P86A 2A19B 3I79A 4ZJJA 4EH8A 4UN0C 3UO5A 1MRUA 4K8AA 4B8MA 4QYFA 4RFYA 2W05A 3COIA 3L9LA 3Q96A 5EI8A 3D5XA 4AAYA 3EZRA 3W2RA 2WMWA 4WNMA 3HNGA 5DH3A 1KWPA 3UVPA 4D1ZA 1J1CA 2OI4X 4XRLA 4O7LA 5D12A 4Y46A 3KC3A 2GU8A 4Y95A 3OXIA 4WG4A 5LVLA 3FSFA 4FODA 4OTHA 4AZSA 3D5WA 4EOMA 1J7IA 5K5XA 3W1FA 1H1RA 4UWCA 3PG3A 4FYNA 4EQUA 2QI8A 4DAWA 5GZ8A 1RDQE 5I9ZA 4JQ8A 4BCGA 1W84A 3COKA 3DXQA 4FT3A 3PRFA 4TWNA 3H3CA 1YHVA 4YZCA 4OTIA 5DHJA 2WEIA 3E7OA 4FV6A 3WIGA 4FTAA 5EI6A 4RQVA 5C1QB 2WTIA 5AP3A 4Q5EA 3PZEA 4AE6A 5KBRA 2ITZA 3ZSHA 2YWVA 5ANOA 4FT7A 2OJ9A 3PSCA 3QWJA 5M4UA 4NFMA 1XWSA 4KRDA 4R8QA 4PMPA 4BC6A 2WQNA 4F64A 4FEQA 5F94A 4AOIA 5JQ5A 3ZO3A 4PL3A 3HL7A 5M51A 4RSSA 3MESA 2I40A 4BCPA 2ZB0A 4JDIA 4RA4A 2VTLA 4U40A 1S9JA 4O27B 3Q60A 3R9HA 2RG5A 5CSWA 3RAHA 4AOTA 1WFCA 3FZOA 4CFWA 3DFAA 4GUEA 4ANMA 4II5A 4NEUA 2WMXA 3PY1A 4CFFA 3IONA 3NIZA 1PXLA 3DB6A 2QNJA 4FNWA 4FTTA 3V5TA 3RCDA 3ZHPC 5IA0A 3O7LB 3TZMA 2C68A 4GK3A 4AX8A 4FOCA 2BRHA 2ETMA 4DINA 4HW7A 1FVVA 5HZNA 1OIQA 3ZZEA 5HU3A 3TZ8A 3Q2JA 2SRCA 1GIJA 4FKLA 2XK8A 3NUPA 3TEIA 5KX8A 3UZTA 5C9CA 5IEVA 3O2MA 3V8TA 1TQIA 3M11A 1P14A 1LEZA 3C0GA 4FSZA 4EWHA 1J7UA 2Y4IB 3ELJA 4X7QA 4C35A 5B2MA 4HZSA 4CZYB 4PY1A 4G5JA 1UVRA 5HGIA 4DC2A 1OIYA 4X3FA 4LUEA 4I5MA 5DNRA 3QCSA 3WZUA 2WNTA 3RM7A 4HNIA 1BKXA 4U97A 4I6FA 1CKPA 4AGWA 5HICA 4ZLOA 2HIWA 2UUEA 2W5HA 3QTZA 4FV8A 1XBBA 5FD2A 3R7OA 3W0RA 3OW3A 4BJJA 4DFBA 2YCFA 3CP9A 4YLJA 3WARA 4B7TA 3T3VA 5BQ0A 5HIEA 3I0QA 3TXOA 4YNEA 4J95A 4C4FA 4F7JA 5E8VA 4JRNA 3O17A 3E8DA 2R4BA 1Q8YA 2YM5A 3IW4A 2F7XE 2Y7JA 2BUJA 4PP9A 3CD3A 2ETRA 1Q62A 1PMEA 4RIXA 5AR3A 2PE2A 1BLXA 2G15A 5EHYA 3RCJA 4ANOA 4EORA 4QP3A 4MCVA 5IQIA 1NVQA 3FL5A 3QKKA 4O1OA 4CVAA 2JKKA 4O4EA 3KN5A 2YM8A 5KZIA 3W0QA 1PXPA 1FPUA 3KXGA 2UZDA 2UVYA 4CT2A 4DYMA 5IUHA 3T9TA 5ETAA 5J87A 4KABA 1XMMA 3R9NA 3ZH8A 1R3CA 1GZNA 3PA3A 3QRUA 4IX5A 2WMBA 5HU9A 3AKJA 3VS6A 4E8AA 2X2KA 3WBLA 4K9YA 5AV0A 3D2IA 3DCVA 3RK7A 4O4DA 1OPKA 3ACKA 3V6SA 4DLJA 4ZIMA 5M09A 1ZYLA 2XK4A 2QCSA 2GQRA 5CSHA 5ANKA 3ITZA 5HCYA 3TACA 4ZJVA 2LGCA 4OTPA 5F9EA 3LXPA 4NZWB 4Y72A 3VS1A 3AGMA 4BIEA 4D0XA 3BGZA 3EKKA 2VU3A 1URCA 4EC9A 1U54B 4F9AA 4FV1A 2WQEA 3DBQA 5HD7A 1Z57A 4YJPA 5AX9A 3ET7A 3NUYA 4JR3A 3MA6A 4AU8A 1IA8A 3DS6A 3P7CA 4PL5A 4BTMA 5GIPE 2ZM3A 1IRKA 3ROYA 4E4XA 2IVUA 4RWIA 4AW2A 2VTJA 2J6MA 4EOLA 4CG9A 2OXXA 5AP0A 4FMQA 4GG7A 5AV2A 4EOQA 4WA9A 2C1BA 2WTKB 4ORKA 3PE1A 1AD5A 3BYUA 2XNNA 4ZOGA 4I4FA 4C61A 1W2DA 2EXEA 4USFA 3A7FA 1CKIA 2X4ZA 2QODA 4NJ3A 1GZKA 4EOSA 4EOJA 3G9NA 3QWKA 5HBJA 3MB7A 4IB3A 1Z5MA 4IZ7A 5J7BA 2CLXA 3QQKA 2CMWA 1PMUA 5I0BA 3ODYX 2RF9A 3KXXA 3QKMA 3IG7A 1M7NA 4O21A 3LCDA 4LOQA 5L2QA 2YDJA 5CEIA 1MQ4A 3A8XA 3K3IA 3R8ZA 2HWOA 3KULB 4QT1A 3NS9A 4BDGA 3KRXA 4ENXA 4H1JA 2BTSA 1MRVA 4J97A 5IA5A 4CTBA 3FI8A 4I6LA 5KBQA 4RLKA 3ACJA 4DTKA 3TIZA 5JQ8A 1H1SA 2WKMA 1CM8A 3I7CA 5CEMA 5CEPA 5K9IA 4GRBA 4YBJA 3LFNA 1XBAA 5A4TA 4ZLZA 1KSWA 3AXWA 1CTPE 4EH4A 4EZ3A 4UMTA 2YJSA 3F2NA 3BI6A 1WBPA 5DGZA 5CAOA 4KIOA 4PDYA 3DQXA 4M8TA 1ZYSA 1PRYA 3MY0A 4MKCA 4MD9E 3A4PA 3D7ZA 5M53A 3UIMA 3PYYA 1H4LA 4GSBA 4ZAUA 1ST4A 4IM0A 4G34A 2IVTA 4JG7A 4WD5A 5EKOA 4A9TA 2UW9A 4JRVA 3R9OA 2OJGA 3NNVA 1OUKA 1CSNA 5J5SA 5E8YA 4H36A 2UZLA 4EK8A 2UZTA 2VO7A 2X7FA 1JAMA 2XH5A 5CI7A 5EM8A 4BI2A 5LWNA 2PUIA 3VBVA 2ITYA 1W83A 3NAYA 3SV0A 5GHVA 4H3BA 3HRBA 3F3WA 3C4CA 4IAYA 4RG0A 4YO6A 3AKLA 4JX3A 2HAKA 3C50A 5A54A 4F1TA 4QTEA 2ZV9A 4NCTA 3PY0A 5CSPA 4M12A 3DK7A 4GL9A 1H8FA 5KE0A 4BKZA 3KXMA 4IDTA 4YGAA 2V22A 3CEKA 1YXVA 4ZMEA 3O8TA 2W1DA 1XH5A 3C4FA 3ZUVA 3ALNA 3FKLA 1QMZA 4M97A 2GFCA 2R0UA 4O0WA 3V6RA 4F6UA 1RJBA 3DDPA 4QD6A 3EWHA 2YLEA 1XQZA 4R5YA 2XEYA 4IZAA 4RWJA 3SAYA 4RJ8A 5I3OA 3NMUF 2UZOA 4I6BA 3POOA 4IEBA 4NKAA 2C6OA 3EQIA 4FIIA 4L67A 4U79A 2B53A 3Q5IA 1NVRA 4C4GA 4IQ6A 3EFWA 3DKCA 4Y5HA 2HOGA 4U3ZA 4BRXA 2VTMA 3CSVA 3BQRA 2HW7A 3KCFA 3UE4A 1NVSA 4DEBA 3R8PA 1QPJA 3OVVA 4LRKA 4LRMA 5DRBA 2BCJA 4BYJA 5KMNA 4UWYA 3UZRA 3RALA 2C1AA 3W8QA 2PL0A 1OB3A 3ORLA 2O5KA 3VQHA 3TI1A 5CS6A 3UPZA 3Q4UA 3G51A 4TWOA 4TZRA 2JDTA 3H4JA 4ACHA 5FDXA 2VX1A 3V01A 4XOZA 4EC8A 1W0XC 3LVPA 5LJJA 4I6HA 4IE9A 2OF2A 3BU3A 4AXAA 4EH6A 4E5AX 1XR1A 4GIHA 2C5XA 3ORTA 4FICA 4I24A 4X2JA 5AR4A 5LMAA 5JGDA 3R83A 5IQCA 2QC6A 2B9JA 3TUBA 5I9VA 2R3NA 4DEIA 2WTWA 4DBNA 4ZS0A 4PP7A 3ZUTA 4XV9A 4Z7GA 4KB8A 3P1AA 4D9UA 3BHYA 3FI3A 3R21A 1TQPA 4X2NA 2CNVA 4HGLA 2R3PA 4ZSGA 3ORMA 3LZBA 3MTLA 3KKVA 1LEWA 2FB8A 2OXDA 4JBVA 2R7BA 3E92A 4JAIA 4YP8A 2WU7A 5HQ0A 3LCOA 4XG7A 1DI9A 4A4XA 4C8BA 4CRSA 3BYOA 3LCKA 1KV2A 1PXIA 3P5JC 1ATPE 3ULIA 3DBDA 4N4SA 4DT8A 2FGIA 1PXJA 3ENHA 3QRTA 4MQ2A 1ZWSA 3CKXA 3EQGA 2YERA 3LQ5A 2C6DA 5EDPA 4F9BA 5JFSA 4V0GB 3VJOA 3OZ6A 3BE9A 2V62A 4QYYA 1R78A 3HV3A 2C3JA 3KXHA 4X3FB 5AP2A 3LLTA 4AN3A 2PZIA 4KKEA 3II5A 4EQMA 2JC6A 5BYLA 3PVUA 4GU6A 3NVKI 5L4QA 4MX9A 4X3FC 5F20A 1ZOEA 3PIZA 3VF8A 1Q8WA 4ZS4A 2QHNA 2QVSE 3OT8A 5J8IA 4DEDA 4A4LA 3QRIA 2PYWA 3BV2A 3G33A 3G6GA 3ANRA 1P4OA 3JVSA 3EIDA 1FGIA 4O7WA 4PPAA 5HG9A 3VF9A 1NA7A 2ZOQA 4F63A 3L9PA 2R3QA 4OLIA 4DHJA 5J1WA 3HA8A 4A07A 4I3ZA 5F1ZA 3VS2A 2JEDA 3EQHA 3DK3A 1SM2A 4U81A 2CPKE 3HDNA 5KUPA 4F78A 1JKKA 4WHZA 5I3RA 3QA8A 5AV3A 4Q9ZA 4QTCA 5CX9A 2VTAA 3OBGA 2X81A 5GIOE 2XM8A 2Z60A 3FUPA 2UZUE 4J98A 4YJQA 5CU4A 2QOKA 2WO6A 2FSTX 4IIRA 2YACA 3HMOA 2IO6A 4IXPA 2CGUA 3QD0A 2WOUA 2WPAA 2YFXA 2CNUA 2CSNA 1M52A 2ITXA 3EMGA 4FIFA 3KGAA 3E93A 2LAVA 5EHOA 4IVAA 2E9PA 3QD2B 2DYLA 3OWPA 5CNNA 3SLSA 1APME 3VS7A 3H9OA 2X0GA 4KAOA 3AQVA 1MP8A 4S33A 3EQRA 2BAKA 2GNLA 4R1YA 3W0OA 3D0EA 4FL1A 5DPVA 2VTIA 5A6OA 5AUUA 3U8WA 3W2SA 4O0XA 2OH4A 1ZMWA 4MXYA 5C01A 4D2PA 2O8YA 2R0IA 3QQHA 2Z7LA 1PW2A 3VC4A 2XNEA 2YDKA 2ZMCA 4OTGA 3RPSA 5A4EA 4DDIA 4XS2A 2F9GA 2WB8A 3DAJA 3MH2A 1OBDA 4L46A 4IAZA 4MBIA 1LR4A 1YXTA 4KSQA 1QPCA 3TV6A 3VW6A 2PY3A 3VBQA 3V8SA 4RWLA 3R7UA 4N70A 1JKTA 4USEA 1H1WA 4GK2A 5LVNA 4FKJA 2X2LA 5CSXA 4DA5A 3N4VA 3PVWA 2FSLX 3UNZA 5LVOA 4I93A 4RQKA 4IB0A 4APPA 2P33A 4FA2A 5IH6A 3V5WA 5HO7A 5A3XA 4HGSA 3U9NA 4APCA 4ZZMA 1H00A 4G3DA 4R7IA 4V04A 5FP5A 2WOTA 5FTGA 3S0OA 4GT3A 4RBLA 3W55A 2ZM4A 2W4OA 3BHHA 2QU6A 4BDHA 2G2HA 3IW6A 4W4XA 5C8NA 4TRLA 2OO8X 2BMCA 4QP1A 5FBOA 2I0YA 3HV4A 2VNYA 3VVHA 5TT7A 3AT3A 2OXYA 2CGXA 2F7EE 2E9NA 3G90X 3HV5A 1V0OA 1YWRA 3AGLA 3QTXA 3K5UA 5BMMA 1V1KA 4C2WA 5I4NA 3QQGA 2J51A 2W1EA 4YJOA 4ENYA 2W4JA 4PWNA 1FOTA 3EL8A 2VWUA 2OSCA 1PXNA 3UOJA 3E62A 5HX6A 1UNHA 4I92A 4L6QA 5BX0A 2OGVA 1Y57A 4E4NA 4BBEA 4XG3A 4MK0A 5J79A 2ZDUA 1JLUE 2NPQA 2Q0BA 2YM6A 4A4OA 5AP7A 3R9DA 2HZ4A 1T46A 2WGJA 4E4MA 2ZJWA 5BVKA 4JJRA 4BDAA 2OFUA 2UZVA 2BKKA 3O0GA 2C6LA 2WTCA 3PA5A 4HVDA 4JQ7A 4U8ZA 5HE2A 3IOKA 2PPQA 5IH5A 2BRBA 4F7SA 3P23A 3WI6A 2JAVA 3CQEA 2B4SB 2X8EA 3RWQA 3CGFA 4OTQA 3DB8A 5I5ZA 5FBNC 2UZEA 3EQFA 3DV3A 3ATTA 3U4UA 1OPJA 3ZLWA 4E73A 3DLSA 4RFZA 3ZU7A 2BRMA 2IW9A 4FV0A 4O7RA 5CAQA 4JBOA 4LV8A 3TV4A 5DOSA 2CN5A 4NCTC 3R7GA 3PDTA 2HCKA 5EM5A 2IN6A 3IO7A 3QCXA 4J1RA 4B8LA 2BTRA 1ZLTA 2DS1A 3F5UA 5IQEA 5EDQA 4P5ZA 2GFSA 3P9JA 4XV3A 3NSZA 3FZSA 4ZTHA 2ITOA 2OICA 3HAMA 4F7LA 2G2FA 3Q5ZA 1JSVA 1UKIA 2P0CA 2I0HA 4IX6A 5AA8A 5EI2A 1BMKA 4RFMA 5DT3A 1XH7A 3VBWA 4O0YA 5BYZA 3R8UA 4CYJA 1TQMA 4RWKA 3FMMA 4AUAA 2QONA 3OMVA 1YWNA 2XK6A 4G3FA 4CQGA 4O7ZA 4FTKA 2FA2A 5AWMA 3SC1A 4Z9LA 3ZSIA 2GNHA 2WTVA 4RA5A 2YIQA 4ZZOA 3HMNA 3SGCA 4Y73A 4NW6A 5CZHA 2ZMDA 4FKUA 5JSMA 4Q5HA 4QP2A 5DVRA 5BNJA 4L01A 3E63A 1F3MC 3CTQA 4TTHB 1KOAA 1XHAA 4GK4A 4O4CA 5FEDA 2C6MA 5DMZA 4IJ9A 5CZIA 1SZMA 3COMA 2C30A 4IM3A 4B0GA 3ATSA 3I6UA 4TYHA 2JDRA 4LQMA 4BDKA 3R2YA 3EFJA 5DYJA 2J0IA 2YWPA 5AUTA 2XF0A 4H3QA 3NAXA 3AD5A 4D4VA 2JIIA 3PJCA 3LXKA 3W10A 3D15A 3Q2MA 2BAJA 5EQPA 2XYUA 4FOBA 2XK3A 3FC2A 3GNIB 4FZAB 4YLKA 4QMXA 3V51A 4GYGA 3SXFA 4QMZA 2V0DA 3BHTA 4LL5A 3UMWA 3F6XA 5AJQA 4W9WA 3FZRA 4WG3A 4D2RA 2B52A 3CD8A 4XBUA 2XANA 5AR7A 4AT5A 3LFFA 3VAPA 2OK1A 2YZLA 3TNQB 3UYTA 2JBOA 2QO7A 2GSFA 4YJUA 4JMQA 4WO5A 1H1QA 3NUXA 3GU8A 4I0TA 4MXCA 3DNDA 1RW8A 5EM7A 2IW6A 3GCVA 1TVOA 4PDSA 3KXNA 2OJJA 4IB5A 4J8MA 2XJ0A 3NYOA 4QNYA 5A9UA 3R0TA 3S3IA 1DM2A 1QPEA 2PMLX 3F3ZA 3PJ3A 4IB1A 5LQFA 3Q9XA 1UWJA 1BI7A 3HLLA 5M56A 2PTKA 3PJ2A 3UC3A 4CFXA 4X6QC 3QTWA 3GFWA 1FMOE 4P2KA 3WZDA 4D0WA 4BYIA 5JRQA 3F7WA 4D5HA 4YMJA 4BN1A 5AP1A 2OZAA 2NRUA 3E64A 4YO4A 4AG8A 2YAKA 2EB3A 2X6EA 2J7TA 4IANA 3DBEA 4FKTA 2EXMA 1G8AA 3RHXA 4EK6A 1ZAOA 4QDVA 5IZFA 2NRYA 5CT7A 2Z8CA 4BZNA 3FXZA 3RK9A 2WMTA 4FI1A 3KL8A 1JVPP 4IMYA 4RIYB 4BB4A 4EH7A 5HG7A 4UMUA 3UDSA 2Z7RA 3LXNA 3C1XA 3RI1A 4G9CA 3AC1A 4KA3A 4OR5A 4F70A 3UOHA 5A6NA 5IH4A 1JPAA 2PMIA 2ETKA 5AUWA 3EZVA 5ANEA 4O7TA 3BBTB 3Q32A 4FSQA 1OL7A 3AKKA 2ZDTA 3PIYA 4Z7HA 5J9YA 3R7IA 2YDIA 3JXWA 3LOKA 5M4IA 3FEGA 2W1CA 3R22A 5BVWA 4OUCA 1YHSA 2YIRA 4QPMA 4IWQA 4QMLA 3PWDA 4YJNA 2VN9A 2YM4A 3MVMA 3LFCA 1HCKA 3FMNA 3AG9A 3NEWA 3FLWA 5ACKA 3UODA 4AW5A 5LVPA 3SXSA 3MB6A 5J95A 4W4VA 3W16A 4DGOA 4QPSA 2WMUA 3LQ8A 3MFUA 3CY3A 4AGCA 4O84A 4W9XA 3I4BA 1PHKA 4QTAA 3TL8A 4L43A 4O6EA 4DGLC 1SYKA 3FZPA 2XNBA 3ETAA 4HCTA 1OMWA 4KSPA 4NM3A 4F4PA 3Q04A 5BVNA 2OG8A 2WD1A 4YHTA 2UW3A 3BL7A 3DTCA 4DEHA 4U7ZA 4U5JA 2X4FA 4F08A 2A27A 4IW0A 1YKRA 2Y0AA 2R7IA 1LP4A 1ZARA 4FKRA 4ZSAA 2PULA 5B7VA 4XX9A 4IBMA 3FQEA 5TE0A 4EJNA 4X6RA 4PMMA 2DQ7X 2ONLA 3JPVA 3QTRA 4BWKA 2JDSA 5AUXA 1IEPA 4AZFA 2HELA 4FEUA 4BHZA 3PPZA 3FXWA 3ZRLA 2PSQA 3H10A 2C6KA 5FM2A 4X2GA 4XNEA 2JITA 4QDEA 4FSTA 3KN6A 3LFSA 3Q6WA 4YHFA 3MBLA 4EQCA 4D55A 4FL2A 2ZM1A 4BIDA 2UZWE 3C4ZA 4CLIA 4ZTLA 3OWJA 4XG6A 2C3IB 2FO0A 1WBNA 3NLBA 1Q3DA 4NFNA 4TXCA 5FGKA 3WE4A 2QURA 4ZSEA 4JBQA 4TT7A 5AA9A 3SW7A 5ETFA 3VS4A 4QP4A 1FQ1B 4E3CA 3FYKX