4E5WA

Jak1 kinase (jh1 domain) in complex with compound 26
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
302
structure length
292
Chain Sequence
b'GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKNHIADLKKEIEILRNLYHENIVKYKGICTENGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK1
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 292
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e5wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e5wA01
2C0OA 4WO5A 3VUKA 4YMJA 4FSMA 1PW2A 3ULIA 3PP0A 4IB3A 3DK7A 1IAJA 1MQBA 2CLXA 4AWIA 5CF5A 3MJ1A 1JWHA 1LPUA 5DN3A 5IZFA 4L3LA 3MVLA 3H30A 1IAHA 4CMOA 1KOBA 2YEXA 4QOXA 2QG7A 5EDRA 3SOCA 1XKKA 1ZMVA 3QUDA 4CFVA 4F9AA 4GK3A 3NZ0A 1MQ4A 3G9LX 2Z2WA 3GP0A 3NW7A 3OW3A 4AN3A 2JDOA 1IG1A 3BYMA 4M13A 1UV5A 1VZOA 2VTSA 4YZDA 4ITIA 3RGFA 1OBDA 4ASXA 2R3QA 2A19B 3GCSA 4L44A 1QPCA 3H10A 5C03A 2PZPA 1GOLA 4Z3VA 3RALA 3HAVA 4ZSEA 2O64A 3ZRMA 2V7OA 4BWPA 2F7EE 2ZM1A 2BDWA 3IO7A 4YJSA 4G3DA 4BICA 4PF4A 2XKDA 4JS8A 3WF8A 3C0HA 4FTJA 4RC2A 4EJNA 3GBZA 2B4SB 3ENHA 3M42A 4C34A 3ET7A 4UV0A 2A4LA 4EQCA 4U81A 4FV6A 4KWPA 2KULA 2YM7A 3HV7A 4W9XA 4WUAA 5HI2A 4D9UA 3SXRA 1UA2A 4IAFA 4OTQA 4O1PA 3Q9ZA 5IH6A 3O7LD 5CSPA 3BV3A 3RZFA 1PHKA 2BIYA 4GJ2A 4J96A 4AUAA 4AZWA 4NU1A 1H1PA 1AD5A 2GS6A 3PIZA 4K11A 3VF8A 4K8AA 5JT2A 3TXOA 3PA5A 4BDCA 1NY3A 3ZZEA 2XP2A 4AW1A 3CIKA 3U6IA 3QD0A 3ATSA 1U54A 3OZ6A 4LMUA 4DCEA 5B7VA 3Q4CA 4M84A 3BHTA 1WBTA 2R3MA 3O2MA 2QOQA 5CSHA 3UPXA 3LOKA 3TV7A 3VO3A 5AAEA 5KBRA 2QG5A 5M4CA 3QX4A 5HLWA 4P5QA 4M12A 4IW0A 4HOKA 2P3GX 3KXMA 5EW9A 3PJCA 5CTPA 2CNVA 4MNEB 3C0GA 3HAMA 4R3CA 5CAPA 3NEWA 4QMNA 3W2OA 5H3QA 4BGQA 4L68A 3KEXA 2WMQA 4NUSA 4FV2A 3R28A 2F7XE 3LCKA 5LCKA 4J8NA 4W4WA 4ZSJA 5J7HA 1XBBA 4C7TA 4IAKA 3FDNA 4MYGA 4WOVA 4Y73A 1M7NA 4W4XA 4G6NA 4E1ZA 4W9WA 5BX0A 4FV9A 5CAQA 3NUNA 3OTUA 5I9XA 3MN3A 3PRFA 3R9HA 3MDYA 4D2RA 4F6UA 2JEDA 3DKOA 2UW6A 4C4IA 2XK8A 3NW5A 4G9CA 4KSQA 4ALWA 4EOOA 4OBOA 4OTIA 4XOYA 1NT2A 5AWMA 2G01A 4N6ZA 4YJUA 4BI1A 2W1IA 3WOWA 3ZRKA 4EWHA 5IG1A 4RGJA 3QTSA 3GGFA 4RG0A 5CWZA 1OKZA 3PIYA 2YM3A 4KB8A 1YOMA 3TCPA 2GNJA 3ZO1A 3P86A 4PX6A 5AP6A 2GNIA 3D7TA 1OUYA 5HQ0A 1PMVA 5EYMA 3R01A 2ZM4A 1U5QA 5HCZA 2Z60A 1YKRA 3KB7A 1R1WA 3P1AA 2YDIA 4YZ9A 3G6HA 3RKBA 3DKCA 3FV8A 4DAWA 4FG8A 4JIAA 4ALVA 3CPBA 3MY5A 5AEPA 3HGKA 4O7NA 2ERKA 4BZNA 4JOAA 1H8FA 4QYHA 4W4VA 2XEYA 4F63A 4L9IA 5HTBA 2RG5A 4F1OA 3TUCA 3BE9A 3QKLA 3FAAA 2J50A 4O6LA 3MH1A 3T3VA 3GFWA 4WKQA 3H4JA 2WMXA 3HP2A 4OAUC 2ETMA 2BRMA 3GOKA 4Z55A 3LCSA 2ZOQA 4ENYA 2G15A 4WNOA 2OI4X 5DE2A 1B39A 5HZNA 4JR3A 5DRDA 3GQIA 3MIAA 3CQWA 3PZHA 3NGAA 3DXQA 5HG7A 1H24A 2GNLA 3WYYA 5LVNA 3S1HA 4JI9A 4FODA 2IZTA 3COMA 4FTAA 4W4YA 2JKMA 4RVMA 2BKKA 1JKKA 2WZJA 3LFFA 4TYIA 3Q52A 4GUEA 4XG7A 1O6YA 4IXPA 3FXZA 5JGAA 2QR8A 3UOHA 4PTCA 5IH4A 5LXMA 2XM8A 5I3RA 4YP8A 3DGKA 2Y4IC 2X7FA 4FTUA 4RVKA 3DAEA 3V8SA 5JGDA 3KRWA 4J8MA 5E8YA 5DIAA 2O0UA 1XH8A 4MWIA 2VTHA 3TDWA 3CY3A 1QCFA 2W06A 2GQRA 3ROYA 1JVPP 4X3FA 2XVDA 3V5WA 3FZPA 2W1EA 3FMLA 2HWOA 3C5UA 3KMMA 4QNYA 5AV0A 3RP9A 5IQBA 2GQGA 3PWDA 4U97A 5CSXA 2QO7A 2XKFA 4FIEA 3Q9XA 5A14A 3I5NA 4BDDA 1EH4A 3RJCA 1ZMWA 4RRVA 4S32A 3PYYA 1QL6A 3FYJX 5FQDC 4Q5EA 1Q61A 4I92A 2CKPA 5KZIA 3R9OA 4X3JA 5KMJA 2XM9A 3BYSA 5KUPA 3O71A 3LXKA 1M52A 3BYVA 4K33A 4NM5A 3IG7A 3LJ1A 2PMNX 3C5IA 4J7BA 2QOHA 2WGJA 4O0YA 5AP4A 2XJ2A 3REPA 4H3PA 4HNIA 4YLKA 1PY5A 4XRJA 4YJOA 3A99A 3R00A 4CFMA 3IGGA 3SLSA 3EKKA 5GIOE 2Z7RA 4CFNA 2UZVA 5DGZA 2UVXA 4EOJA 2YHVA 3NNWA 4AT4A 3BIZA 3DAJA 3ACJA 1BKXA 2BRNA 3M2WA 4FNYA 5HG9A 4BDJA 5I9VA 2PE1A 4MXZA 3QRUA 1HCLA 3SRVA 3ZLWA 2PU8A 2XJ1A 2C3IB 1UU7A 2VWVA 4GU9A 4JG7A 4JXFA 3KXZA 3PG3A 3I79A 4RFMA 4UX9A 3LQ3A 4QMQA 4PTEA 4QMSA 2ETKA 5IDNA 4FICA 4HPTE 3VBVA 4C36A 4CCUA 2QU6A 3JY9A 5AR7A 3DPKA 4EOQA 4ARKA 3NUAA 4M67A 3TKUA 3COHA 3DBDA 4DG2E 4QP2A 3WF9A 1M2RA 2RF9A 3LJ0A 5LMKC 3BBTB 4XBRA 3OVVA 5CEMA 2ZB0A 4RX5A 4EZ5A 4NM3A 2XYNA 3COKA 3LAUA 3QCXA 3W18A 3UQGA 2PZRA 4H3BA 4F4PA 3B8RA 2XNOA 3PUPA 2UVZA 4GL9A 2BMCA 4F09A 3IECA 4G6LA 5FM2A 3ZBXA 4E4XA 5HCXA 4EH7A 5CEPA 2QHNA 3OY1A 5IUHA 1U46A 2UW0A 4FTRA 3UVQA 1OPLA 5LARA 1G8SA 1PF8A 2WXVA 4IJ9A 4DH5A 2V7AA 3OOMA 4ZTHA 5CU0A 2VX0A 2PE0A 3EWHA 1OL2A 4KAOA 3ETAA 4J52A 3LMIA 5DEWA 4AFJA 4ENXA 5DYJA 3VW8A 4KA3A 4MD8E 1YXTA 3CBLA 3W2CA 5JFSA 5LCJA 2FO0A 3DNDA 3R7YA 2EB2A 2PL0A 4N4SA 5IKWA 5HIEA 3QCYA 4OUCA 4I6QA 3TNHA 3DXNA 2CPKE 1GIJA 5CY3A 4EK6A 4G17A 3IDBA 4D9TA 4CQEA 3DY7A 3VS0A 2W5AA 3C4WA 3LKMA 2GHLA 4WUNA 3VBTA 2A1AB 3PVWA 3HEGA 4AE9A 4JBOA 4ACGA 3ZTXA 2R4BA 3QF9A 4FSTA 5DH3A 5DRBA 1MUOA 1IA8A 2XCHA 3QCSA 4IB1A 2B0QA 5EYCA 2VU3A 3ZS5A 5KBQA 1TQIA 2I0YA 3IW5A 4O6EA 4RJ7A 5I5ZA 1Q41A 4D2VA 4YLJA 5D7VA 3MFUA 2JFMA 3E88A 3OXIA 4HCVA 3Q5ZA 4M68A 3VULA 2ESMA 3W2RA 3UIMA 3KREA 3R21A 2XS0A 4O2ZA 3VBYA 3ZC5A 4AS0A 3HV5A 4AW0A 2X4ZA 3A7IA 3MH2A 2QCSA 3FHIA 2VWWA 3P08A 4KD1A 4QYEA 3OF0A 4RSSA 2B9FA 3NPCA 3PE2A 4USDA 3TTJA 3MV5A 4FV4A 2VO0A 4FOBA 4TYGA 3Q3BA 2Y9QA 4AZTA 4G16A 1ZYLA 2ZV7A 3F7ZA 4I4FA 4U41A 5IUGA 3BZ3A 3ALNA 3ZLSA 5CF6A 3VQUA 2XKEA 2I0VA 3F3UA 4YBKA 1V0PA 2R3GA 4BI2A 2HWPA 1E9HA 3KL8A 4FE2A 4E4MA 3GCPA 3VC4A 1HCKA 3HNGA 3MWUA 1ATPE 4PPAA 5BYYA 3DJ6A 2VGPA 3QBNA 4KSPA 5AV4A 1Q3WA 2B55A 3EYHA 4FL3A 3SQQA 4QT1A 3PXFA 4ZZOA 3ZU7A 1WVWA 2F57A 3VNTA 4CLJA 2G9XA 1W0XC 5CENA 4CT2A 5DI1A 5EOBA 4DH3A 2IW9A 5M53A 3L9NA 4WG5A 4DGOA 4FTLA 5ACBC 4ZP5A 4ANOA 1ZMUA 3MSSA 2BTRA 1FGIA 2C6OA 1P2AA 4PMSA 4RWIA 5E90A 4IZ7A 2QU5A 2WAJA 4FTKA 4N0SA 3MFTA 1URCA 3ZSHA 2VO6A 4QP3A 1V0BA 3FE3A 3P7AA 5AP2A 4FT9A 4BBEA 2RIOA 2OJFE 3R02A 2J9MA 4MNEA 3DAKA 4MXCA 4QPMA 3PXZA 5CAUA 4FSQA 3GCQA 1XJDA 3ZONA 4AZSA 2BCJA 1FMKA 3ORZA 4YLLA 2WMBA 1T45A 5E1EA 4A9UA 3P79A 4APPA 1KV2A 2W1ZA 3OCTA 2X9FA 3F5PA 3DFCB 3QX2A 4IC8A 3QZHA 4ZSGA 5HE1A 5KZ0A 3SXFA 4EUUA 4O96A 3Q6UA 5TF9A 4PL4A 1YOJA 2WMUA 4AQCA 5A46A 2X7OA 3TWJA 4XG3A 3G90X 5DHJA 4LUDA 2OG8A 4R6VA 5HO8A 3R6XA 3EN6A 4FMQA 5IA2A 5TKDA 3F7WA 1H0VA 3I7CA 3PTGA 3UOKA 2JC6A 5K5NA 4NL0A 4DH7A 3Q6WA 3QQLA 4HYHA 4RZWA 4APCA 4B9DA 2WMSA 5CAVA 3WE4A 5IQAA 3I0QA 3D4QA 4FUXA 3EB0A 3OS3A 2VTLA 3C1XA 2UUEA 1BI8A 1Q5KA 3LQ8A 4GCJA 4M3QA 2QO2A 3KY2A 4LG4A 3LMGA 4MK0A 5EH0A 3R7IA 5JFXA 2BZIB 4FIGA 4Y95A 5CF8A 3OP5A 4BCPA 4B6LA 1Q97A 4AOIA 2UZNA 2ONLA 3FL4A 4G34A 4IC7A 2CCHA 4EOPA 2YCQA 4GW8A 2B9HA 3UG2A 3QD4A 2UZLA 2XA4A 3QTIA 2ITTA 2XK9A 2PMOX 2X1NA 4XCUA 4XG4A 3S0OA 4O7LA 2BDFA 3RVGA 3LCDA 4O86A 3CD3A 4HYUA 5EQPA 3W2QA 3RK9A 3CXWA 4S2ZA 4FKLA 2J0MB 1U4DA 1P4OA 4CKIA 5KNJA 2PVMA 2C68A 4KBCA 4CV8A 2BRHA 3A7GA 5GJGA 3GFEA 3MYGA 4ZSLA 5M56A 2B52A 4I5CA 3RWPA 3TNWA 1G8AA 4O0VA 4RWJA 3ACKA 3IW6A 3FLWA 4J95A 2R3OA 3MW1A 3NVKI 5FXSA 2UW4A 3FPMA 4C59A 4I0SA 2WPAA 3F6XA 4JBQA 2X9EA 4IX3A 2JFLA 2IZRA 3GU4A 4HGEA 3FUPA 1KSWA 1W84A 1FGKA 3OEFX 4ID7A 4XV3A 3CQUA 2P2IA 4GU6A 5I3OA 5J7BA 4CLIA 2PUUA 2H8HA 4U8ZA 3WIGA 3L8VA 3NNXA 3PJ2A 1XHAA 4F65A 2ZVAA 3DTCA 1R0PA 4I93A 4A9RA 1S9IA 5A4CA 5AUTA 3UOJA 2YIRA 3CKWA 2IN6A 3Q53A 4Q2AA 5BVOA 2VWYA 4CT1A 4R78A 5CANA 3LJ2A 3PXRA 3F2AA 4F64A 1CKJA 3LFAA 4ITHA 4KNBA 2FSMX 2UZTA 2QOOA 4C35A 4PDSA 3C7QA 3DB6A 3O96A 1YHWA 2IVSA 3FMJA 3QQFA 3R7UA 4YU2A 4O91A 4XLVA 5HO7A 4YPSA 4JAIA 4G3CA 4ZS0A 4EZ7A 5L2IA 5EHYA 4DBXA 5AAFA 3UMXA 3R1NA 2J0IA 5AR4A 4OBQA 5GHVA 3TZMA 3IQ7A 3KN6A 2XRWA 2YIQA 3DNEA 2HYYA 3FSFA 3FKOA 4H1MA 4A4LA 4HGSA 4BBMA 4B8MA 1M7QA 1W83A 5AX9A 4OLIA 3UQCA 3BI6A 4E7WA 3O8PA 4E20A 4QP7A 2ZM3A 2YFXA 5H2UA 1GNGA 3QA8A 4C4HA 3G9NA 4XV9A 4DFZE 5C8NA 4BDIA 3HV3A 3OWLA 5IQCA 4X3FC 4RT7A 4YHTA 3NYOA 1FBNA 1WAKA 4I6BA 2QOCA 5DLSA 3G33A 5EDPA 3OCBA 4BWKA 4IZ5A 4BC6A 4CZYB 4UMRA 5EM7A 5ITAA 3JR1A 3KVXA 5ANDA 3OY3A 3QZGA 2C5VA 1YI6A 2R3HA 2GCDA 2R3IA 3MA3A 5CSWA 2QR7A 3HRFA 4X6RA 4HW7A 5B2LA 4E3CA 4XHKB 2OIDA 3RAWA 2XJ0A 4UN0C 4ANLA 3Q9YA 3O8TA 3Q4TA 3AC5A 2Z8CA 1L8TA 3GXLA 2W96B 1W7HA 4M97A 4ZTQA 4JLCA 3RHKA 4NEUA 3DDQA 4BB4A 5AADA 2WOUA 4TYHB 5M57A 3IOPA 4QMWA 4D4YA 1ZOGA 2YISA 4KS8A 1KUTA 4JNWA 4D0XA 2YERA 3BHHA 5LWNA 1JOWB 4HYIA 2ITYA 3FI2A 4KIPA 4Z7HA 4DLJA 3L8XA 1H0WA 3Q32A 5JK3A 5E8UA 3IONA 1W98A 4UALA 4FKIA 4BWXA 3ANQA 2NRUA 4MNFA 3DK3A 4M69B 1MRUA 4G3EA 3VS7A 3CR0A 3ZLYA 4WNKA 4DLIA 3SKCA 4ACDA 4BTJA 1UVRA 1FINA 1WZYA 1XR1A 2J5FA 5AR5A 4FTNA 5L8LA 1Q99A 3HDMA 4FNWA 4CD0A 4F9YA 4FEWA 4EI4A 2NP8A 3CCNA 3PXKA 4DH1A 4C62A 4CKJA 5JRQA 3WF6A 4EHZA 5K5XA 5AUWA 2ITXA 4LMNA 4V01A 3DV3A 2OXYA 4JQ7A 5EDQA 3UDBA 2WEIA 2PUIA 2IO6A 4P2KA 4DFLA 3ORNA 4U45A 2W17A 4YSJA 1YXVA 4CG9A 1PYEA 3KGAA 5ANOA 1PXJA 5AX3A 5B0XA 4IHPA 5E8TA 5D41A 3ZO4A 4BGGA 5E4HA 1ZARA 3D5UA 4F9BA 3GI3A 3QL8A 3K5VA 4KIQA 5GNKA 3V5QA 1H1RA 1Z5MA 5CT7A 3WZJA 2VD5A 3GU6A 3MPMA 3QWKA 3FZTA 5FP6A 4CYJA 4QTAA 2W5BA 4HVHA 2VX1A 5L4QA 1BI7A 3PY3A 3V5TA 2V62A 5E1SA 5J9ZA 2OBJA 3BHUA 4O7RA 4FV0A 1WFCA 2XBJA 2IZUA 5E8ZA 4PMPA 4AA5A 3U87A 3R7OA 2H6DA 4ZJIA 4MF1A 3U9NA 1S9JA 5HIBA 2XF0A 5IA5A 2DUVA 4F1MA 4UB7A 2OU7A 3QLFA 3LZBA 3CPCA 4J1RA 2HZ4A 4LV8A 3TL8A 3BU3A 4V0GB 4JJRA 3HRBA 2OZOA 2XCKA 4O27B 5AUVA 5TR6A 4D2SA 4C57A 1XH4A 2RFEA 3OTVA 4QTCA 3LFBA 3QTRA 4BKZA 3H9OA 5ANIA 3RAHA 3EQPA 3Q60A 4W8DA 3SW7A 3N4UA 3E5AA 4PTGA 4RJ5A 1BLXA 2JKOA 4FC0A 2O63A 4D4SA 5KMIA 2ITWA 1QPJA 4UEUA 1DAYA 4BVUA 4MQ2A 4ZZNA 2WELA 1UU3A 4I21A 5T6KA 1WBVA 3WZUA 1H1WA 3OG7A 2PVYA 4O7TA 4HVSA 3AMBA 5A4EA 4QMYA 4O7YA 5HEZA 4X21A 2RKUA 5H8GA 4FTIA 4PUZA 4NKAA 4UMUA 2VUWA 2R9SA 4J97A 3G6GA 1BL7A 1M14A 5CVFA 3OCGA 5T68A 3AD4A 2EVAA 3NYVA 2YIWA 2W0JA 3EIDA 4U5JA 5EYDA 4FKTA 2YA9A 2W4JA 3W55A 5DT4A 5FEQA 5IQDA 3P9JA 3GB2A 3KRLA 2BRBA 4GUBA 3HDNA 4O2PA 5JFVA 4CKRA 1H4LA 5G6VA 1E1VA 5ETCA 3UPZA 1I09A 4F7LA 4MWHA 1OPKA 1SNUA 1B38A 4DGMA 3LCOA 1YQJA 3DBFA 3B2TA 5JQ8A 4IAZA 1YXSA 1FVVA 1Y8GA 3L8SA 3H9FA 3LIJA 3CC6A 3MPAA 4NSTA 5A3XA 4FKRA 5HOAA 2EWAA 2OF2A 4S33A 3NUXA 3R1SA 5CVHA 3EQBA 3EZRA 4GH2A 4EOLA 4CXAA 4FK3A 3PVBA 4YZCA 4FT7A 5JGBA 4L53A 3PRIA 4IWDA 2PSQA 3GU5A 4RFYA 5FTGA 2PWLA 3ATTA 4QQ5A 5ACKA 4XUFA 4OW8A 4TY1A 5E8VA 2BAJA 3WF5A 3HL7A 5DOSA 3AQVA 3DZOA 4I41A 1XBCA 3ORMA 4UMTA 5HD7A 3UO5A 4OAVB 3ODYX 3EQCA 5HTCA 4TN6A 3GENA 3U4UA 4QYFA 3PVGA 2QO9A 5C8MA 2JGZA 5J95A 1MRVA 2PTKA 3EZVA 2W1CA 4FBXA 3F3VA 4RQVA 3ENMA 2FB8A 4C3RA 1KOAA 3IOKA 1VEBA 4FV8A 5CI6A 2CKQA 4R7IA 4H36A 2UVYA 2R3RA 3AOXA 2UW7A 2BZHB 2ITQA 2PY3A 2QC6A 4O82A 3TJCA 3VJOA 3BLQA 2WMWA 2YJSA 5F95A 4F99A 2JKKA 2ZV2A 3FKLA 4I5HA 4GRBA 4EJ7A 3VS4A 3SA0A 1PKGA 2OJJA 3F5UA 5GZAA 3R8UA 3CE3A 3U51A 1NA7A 4XNEA 5HBHA 3EQIA 2ETRA 3AMAA 2DS1A 3WYXA 2JIUA 4IFGA 2R3JA 2PVKA 3FY2A 4CEGA 5I4NA 2BRGA 5EK7A 4IANA 3VN9A 1UKHA 4DEGA 2WTKB 3POZA 5HCYA 4ZK5A 1KE9A 1YWVA 2BFYA 2ONLC 4DFXE 5J5SA 2JITA 1OKVA 4EH9A 2YM8A 2F4JA 4O1OA 2CN8A 4FSWA 3AGLA 4FZ7A 3RZBA 5LOHA 4ORKA 3AT4A 4F7NA 5AV2A 3DJ7A 2XRUA 4K6ZA 4EH3A 1XH7A 4AE6A 5IH5A 3R9RA 4UYNA 3B8QA 2WQNA 3PA3A 3LXLA 1H07A 4YURA 3IK3A 3OBGA 3QGWA 4WG4A 3OXTA 4K9YA 2XK6A 4CTCA 4EK4A 2R0UA 3DB8A 3UP7A 1XBAA 2XZSA 3CTHA 2C5NA 2WIHA 3IDPA 1B6CB 3IS5A 5E8XA 5D9HA 1RJBA 1FVRA 1VYZA 3UVPA 5DA3A 4NTSA 3THBA 3UNJA 3OBJA 4L7SA 4XYFA 3MVHA 4JQ8A 4EH5A 3DBQA 3BELA 3L9LA 4FTQA 5ANJA 3N51A 2GQSA 3F2RA 4OT5A 2OO8X 3N4VA 5BUIA 2YAAA 5IMEA 2C3KA 5GIPE 4B4LA 2PVRA 4X6QC 2I40A 2QLQA 3OT3A 1H08A 3QC9A 4ACHA 4AX8A 4E5AX 3CQEA 1KWPA 1Y91A 3E62A 5ANEA 1J91A 3C9WA 4CNHA 3RM7A 3W16A 4BN1A 4EHVA 1SZMA 1UNGA 1G5SA 5K3YA 3FSKA 3BQRA 5C1QB 3AG9A 3V8TA 3BGPA 3F5XA 1J7LA 3PJ3A 4C37A 4DCAA 3LXPA 4U7ZA 4YSMA 4Q9SA 1PYXA 4P90A 4HCTA 4G3GA 5CYIA 3QXOA 3E7OA 4G1WA 2EB3A 4PV0A 3DJ5A 3QTZA 5KHWA 4LOPA 2G2FA 4BCNA 1Z9XA 5M51A 4OR5A 1J3HA 3R9NA 4PQNA 4RC4A 5EM5A 5FBNC 3ORXA 4F0GA 1RE8A 3DQWA 3EQFA 4GK4A 4C0TA 3HKOA 3O17A 1JSVA 3K3JA 3ZFXA 2OKRA 4PNIA 3ERKA 4IQ6A 3Q9WA 2PUPA 4FI1A 4UWCA 2YZLA 3RAKA 4EQMA 3CEKA 4M0YA 5HO6A 5E7RA 3B2WA 3O7LB 5IA3A 3BV2A 3LFEA 3EQDA 2OW3A 2QURA 3BU6A 2WTIA 2X2LA 3A60A 5BVWA 3ZUTA 4DF3A 3E64A 3SW4A 4AGUA 4RA4A 4TYHA 3LXNA 1ZXEA 4O7SA 3QHRA 4F08A 2ITOA 4BYJA 2W05A 3ORLA 1PXOA 4FKUA 3BGZA 3T9IA 1XO2B 1Y57A 4BBFA 3ORPA 2VZ6A 3P7CA 3QWJA 2QKRA 3U4WA 3BU5A 4FGBA 4MTAA 3ZMMA 1TVOA 3VUMA 4C2VA 2O2UA 1CTPE 2YWPA 4HPUE 4NCTC 4WHZA 3TUBA 3HX4A 4LL0A 3Q04A 4FKQA 1GIHA 4M69A 3Q2MA 5JZJA 3HYHA 1NVSA 4WIHA 4XG8A 3NSZA 1QPEA 4RVTA 5CU4A 2ACXA 4O22A 3ALOA 4U79A 2F2CB 5L6WL 3V6SA 4USEA 3PSDA 2R7IA 1IA9A 1VJYA 4FZFB 1J1CA 4IWOA 3NMUF 3IW8A 1L3RE 3GOPA 3POOA 1JSTA 4EH2A 4O7ZA 3BEGA 1YXXA 4U44A 5FG8A 1UNHA 5H8BA 2R3PA 5CEQA 2PUNA 4RLKA 5AUUA 2IWIA 5A54A 4GFMA 4EQUA 2VWXA 4QMZA 3W1FA 4NKSA 3H3CA 2W99B 5DWRA 5GZ9A 4C4FA 4F7JA 2BAQA 4UWBA 3IDCA 4TWCA 5KCVA 4BY9E 3ZBFA 4AGDA 5DR9A 4NIFB 4BRXA 5CT0A 1O9UA 2CCIA 4NM7A 4CRLA 3NUUA 2A27A 1OL5A 3PY1A 2V22A 2IVUA 3KULB 4W8EA 2NPQA 5FBOA 3GUBA 1FOTA 4BYIA 3V51A 2B54A 1P5EA 4GIHA 5J9LA 2VTNA 5AAGA 2WTJA 2QONA 5L3AA 3TKHA 3DBEA 4V0GA 2XEZA 4XS2A 3KXHA 4NT4A 1HOWA 1OIYA 4O38A 4H3QA 2X2MA 4AFEA 5HLPA 3OFMA 3AD6A 4FSZA 3WZKA 5HKMA 2VWZA 2OH4A 4MBLA 4D4RA 1ZY5A 2SRCA 3BRBA 3KRXA 4FEQA 4GVJA 4EH8A 4FVPA 4IX4A 4C3FA 5E9EA 4OTWA 3A62A 4O84A 5AM7A 1OGUA 5IMXA 3MS9A 4MXOA 2IVTA 3ZH8A 4TNBA 4I6HA 2HK5A 5EI2A 4ZXTA 4H1JA 4S31A 4RFZA 4ZY6A 2OWBA 3CTQA 2FUMA 2UW3A 5M4UA 2X39A 4FV1A 5F9EA 2XK3A 5AM6A 5ANKA 1F3MC 4C3PA 3VS6A 3UMWA 1AGWA 3S4QA 3TKIA 4RWLA 4NFNA 4BKYA 3ODZX 2C6DA 1JBPE 1GY3A 2W1GA 3SV0A 3QGYA 5FXQA 3VF9A 4GYGA 3C13A 3U6HA 3R71A 3R1YA 4JDKA 4QP4A 3GVUA 4XP3A 3ZDUA 2JBPA 3DK6A 4ZJJA 1YWRA 2BVAA 3GCVA 4I23A 4KRDA 3F3ZA 4EWQA 2J0JA 4CQGA 4DGLC 4V04A 3IKAA 1X8BA 4X7QA 1YI3A 1DAWA 4DT9A 2CGUA 4FX3A 4DE4A 3K54A 1Q8ZA 4FL1A 4I94A 3P78A 2E9PA 3D0EA 4I6FA 2YACA 5TOZA 4XV2A 3D94A 2ITPA 3NUSA 2XIRA 3ZM4A 3TACA 4BTMA 3CS9A 3LFDA 2JAMA 2O65A 2PVNA 2VTOA 3ZEPA 4F9WA 2FVDA 4UXQA 2E2BA 4BDHA 5L2TA 3FL5A 2W9FB 2OJGA 4R77A 2X8IA 2XIZA 3FMDA 3RPRA 4M14A 5DR6A 3W10A 3KXNA 4MHAA 3EN9A 2I0HA 4FGRA 4FVQA 3GC9A 2P2HA 3QQHA 4IWQA 3BWFA 4HVDA 3HMIA 4QTDA 4RJ8A 4X2FA 4E5WA 1J7UA 1JNKA 2C6MA 2B9JA 4IACA 1PJKA 2A0CX 2XNGA 3AC8A 4L67A 4ZJVA 3VS5A 5GJDA 4IM2A 2W1HA 4L01A 5IEYA 3VWAA 5AP0A 1ZAOA 3R2BA 4XLIA 1Z57A 2YM5A 4U40A 4FV5A 4IIRA 2EU9A 1OKYA 2VX3A 4EL9A 3VS3A 4B0GA 4O0RA 3LM0A 4HNFA 3C4XA 3A4OX 4FV3A 3PY0A 3FI4A 2BZKB 2HAKA 5JSMA 1ZOEA 2AUHA 4GKHA 5K0XA 4DG0E 2W7XA 3TNIA 5EYKA 4XV1A 2ZYBA 3EOCA 5KO1A 4AW2A 5HX8A 4USFA 2YABA 3MY0A 5J1VA 5IUIA 3PLSA 3VUIA 4Y46A 2UZUE 5LJJA 5FDPA 3PDTA 1SVHA 2IZSA 1M2PA 4QMXA 2UZEA 2VGOA 4WNPA 5E8WA 4H39A 4WBOA 2HW6A 4RIYB 2R7BA 5CEKA 5D10A 4RZVA 1J7IA 1TQMA 3AD5A 3RK5A 4CCBA 2RG6A 3G0EA 4RIWB 4RJ4A 4MAOA 5H8EA 3MI9A 4DH8A 3HZTA 5CQUA 4DT8A 4QMOA 2BR1A 5CNOA 3FLZA 3O0GA 2XNMA 4ANMA 3QQKA 3TIYA 5L6OA 4H58A 1SMHA 4IAAA 2XIYA 3FI3A 4BCQA 5HD4A 2WEVA 5FTOA 4TWOA 4ACMA 2HELA 5HICA 3RPSA 1GZNA 2XK4A 3FZOA 3NS9A 4AT5A 4FEXA 1ZY4A 3PPKA 2CKOA 3OWJA 3ZUVA 4BL1A 3A4PA 2CLQA 4BDAA 3QYZA 2QOKA 3EL7A 1WMKA 4N70A 4IBMA 2XNNA 1YVJA 3UZTA 4NJDA 3QRTA 5B2MA 3A7JA 5IU2A 5A6NA 5HORA 4ALUA 2IVVA 1REJA 4DEIA 2Y0AA 5EW8A 3QQUA 1YXUA 4E73A 4DA5A 4FKJA 1LUFA 2UZWE 3TV4A 4AT3A 4FIIA 2PE2A 3SG9A 3MY1A 4EH4A 4DFNA 5CZIA 3RBWA 4JRNA 4CRSA 2OFUA 2XUUA 2Y4PA 4GK2A 4PMMA 2V55A 2J0KA 3BLRA 4BF2A 2QQ7A 4RIXB 5C9CA 2JKQA 3FLNC 4IE9A 4K2RA 3W33A 5KKRC 3UNZA 3MBLA 1P14A 5LMBA 3D2IA 3L9MA 3R63A 4F6SA 3PLAE 2YN8A 2XIXA 4JBVA 3NX8A 5EI8A 3NRMA 5FM3A 5HIDA 4WA9A 5EM6A 4KBKA 2OK1A 2EXEA 4CFWA 3WZEA 3ZFYA 3RPOA 3KXXA 4YJTA 2RFSA 3MH0A 2XMYA 4OTDA 5M4FA 5AFVA 3UYSA 5IF1A 2X8DA 5C01A 4FSNA 4YZMA 4ANSA 1H01A 2JIIA 3GC8A 2R5TA 4PNKA 5A9UA 2WQOA 4C4EA 1R39A 2QVSE 3QALE 3II5A 4ZSAA 4GKIA 1BUHA 5KHXA 3TM0A 4U9AA 3O8UA 2ZB1A 3TG1A 3NYNA 4R3RA 4DG3E 2P33A 3FBVA 3QXPA 1OL1A 1JQHA 3CTJA 4G2FA 4NM0A 3FLSA 5AV1A 5FLFA 3UZPA 5JKGA 4RJ3A 3D14A 4QMUA 4L42A 4E6QA 4KIOA 4ZTNA 3FKNA 4JDIA 5IISA 4L7FA 3I60A 3A2CA 1P4FA 2AYPA 2HZIA 2PVFA 2RSVA 4X2GA 4CFXA 3COIA 5F1ZA 4AA0A 4ZLOA 4DN5A 5BVNA 2EUFB 5GINE 3QFVA 2G1TA 3JYAA 4ZZMA 4D2PA 4UYAA 2J5EA 5M44A 3WILA 4FV7A 3E3PA 1F0QA 3E8CA 1H26A 3D7ZA 4CMTA 1IR3A 5KE0A 2J7TA 5FTQA 3SHEA 1DM2A 1OVEA 5EG3A 1NXKA 3MIYA 4XG9A 1CSNA 2E9OA 1IEPA 4DEAA 4YTIA 4BZDA 3Q5IA 3AT2A 2IJMA 4A9TA 4ASEA 5K0KA 4ZMEA 2WNTA 4AGCA 5BYLA 1YHVA 1V0OA 1ZYSA 5AA8A 3GC7A 5DEYA 4YC6A 4CG8A 2OIBA 3E3BX 4FT5A 4NWMA 5LVPA 1APME 3MA6A 3EHAA 5HBEA 1T46A 4TKSA 4L3PA 3U55A 4JG6A 3TNQB 4OTPA 4QQCA 4KINA 1JKLA 3W2PA 4HZSA 4OTRA 1OM1A 2J6MA 2WOTA 4ZOGA 2FSTX 5EHLA 5FD2A 4C2WA 2PYWA 3VUTA 2R3FA 2O3PA 4BR3A 5A4QA 5BQ0A 4BCJA 4NW5A 3TZ9A 2YCSA 2NNWB 4J99A 4X0MA 3CGOA 2GTNA 3HECA 4Y8DA 1ZYCA 3U9CA 4GFOA 3V5PA 2DWBA 4AOJA 5EOLA 2Y6OA 3PWYA 2AC5A 2C4GA 4FEUA 3ZM9A 2C6KA 2QD9A 1OL7A 3FWQA 3R83A 5I9ZA 4BDGA 4C4JA 2ITVA 2VTTA 2UV2A 4ZIMA 1M2QA 2BZJA 1J1BA 3ORIA 4R1VA 3QUEA 5IA0A 1ND4A 3LFNA 4NIFA 5JH6A 2VTJA 3AC4A 2QKWB 3QD3A 2EXCX 3BQCA 3GQLA 4I5PA 4AP7A 3I0OA 1LEZA 5HE2A 2J51A 3KULA 2C0IA 3ZLXA 2VTPA 3QA0A 5BUEA 3LVPA 3NW6A 4E5BA 4IM0A 2HOGA 3CSVA 4DITA 4YO4A 4AW5A 2WIPA 3UO6A 2R0IA 3V5JA 3W8LA 2WO6A 3KMUA 2ZAZA 4JR7A 3JY0A 3OUNB 4TXCA 3R7VA 4WNMA 4MD7E 3GU7A 5M06A 2Z02A 2WTDA 1URWA 2OIQA 3F5GA 3D15A 4FOCA 2AC3A 5CVGA 5IA1A 2HXQA 4YR8A 3PP1A 4IFCA 5IPJA 3OHTA 1WBNA 2PMLX 2CDZA 2XYUA 2HCKA 2OICA 3L1SA 2CHLA 5D7AA 3LE6A 1JPAA 5IA4A 4U0IA 4EKKA 3I5ZA 2B7AA 3KK9A 4YNEA 4EOKA 1ZZLA 5AMNA 5AP3A 4XP0A 4NYEA 4FF8A 5I9UA 4F70A 2OJIA 3NAYA 3GU8A 3OUKA 3QHWA 2WFYA 4LRKA 3HV4A 4O0TA 4QMPA 4XP2A 5FWKK 3OC1A 4HVGA 1OL6A 4LM5A 2Q0BA 1GIIA 2Q0NA 4TT7A 5E92A 4FKOA 1KV1A 4KRCA 2PZIA 5LMKA 2Z7LA 4EZ3A 4L52A 4TYEA 1YI4A 5IDPA 2VN9A 2CJMA 2IG7A 4QP6A 3D83A 2WTWA 1YDRE 2Y6MA 3MFRA 5HBJA 2F9GA 2C30A 1Q8WA 5C8KA 3AT3A 3MTLA 4BIDA 5K4IA 1SVEA 5AUZA 3UIUA 4TNDA 4QMLA 4YNOA 4AN2A 4BIBA 5LVOA 2F2UA 1YW2A 2WQBA 4QP9A 4QRCA 4D28A 5EKNA 4NJ3A 2VRXA 4ANNA 3R73A 3R9DA 4ANBA 3LQ5A 3EL8A 4C02A 3QZFA 4RPVA 2JBOA 3P4KA 3UNKA 4K1BA 2UW9A 3BX5A 4LL5A 5AV3A 3WIKA 4Y5HA 3MB7A 2VWUA 4M15A 5DBXA 4OBPA 2BHHA 3HV6A 3QLGA 3C4ZA 4AZFA 4FKSA 3DKFA 3ULZA 4EK5A 2X4FA 2X7GA 4IJPA 4KIKB 4AG8A 4GIIA 1JAMA 4BDEA 2FSOX 5M4IA 3VBWA 3DFAA 4IX5A 1AQ1A 1JKSA 3E7VA 3UIBA 3A8XA 2YM4A 3SVVA 2XH5A 2I6LA 3QRIA 4AGWA 2ITZA 3KCKA 3F2NA 2PVJA 3NWWA 4HZRA 4BCOA 3RAIA 2W4KA 3A7FA 4DFUA 3OXZA 2UZDA 4JG8A 1W8CA 3NNUA 3UTOA 4FT0A 2FA2A 2W5HA 3R8ZA 2CNQA 4D5KA 3BGQA 4I5MA 4ERWA 1Y6AA 1E1XA 2R3NA 1YOLA 5DG5A 1FVTA 3FMMA 4IX6A 4S34A 3UIXA 5EW3A 3ZO3A 4QP1A 1FPUA 5D12A 2I7QA 3VRZA 5DMZA 3U6JA 4M8TA 2W1FA 5JZNA 4DYMA 4DHFA 3FYKX 4MXAA 3R22A 3HP5A 4GEOA 4TTHB 1CDKA 4RIYA 3EH9A 4FKWA 4I4EA 3KU2A 3RTPA 3MTFA 4JL9A 4RIWA 5CLPA 3R8LA 2P55A 3MH3A 3G2FA 2WTVA 2X81A 5CQWA 2C3JA 4RJ6A 4PP9A 5LVLA 1OZ1A 3AC1A 4F1TA 1OPJA 5DT3A 5H9BA 4YJQA 3FMHA 4NTTA 2IW8A 1PXKA 4GYIA 1Q8UA 3FXXA 5CEOA 4EK3A 3R0TA 2X0GA 2WTKC 3KCFA 4R5SA 1K9AA 5DR2A 2C6EA 4YC3A 5AP1A 3UC3A 1GAGA 4U3YA 1VYWA 4IVBA 3QD2B 5F4NA 4LV5A 1QMZA 3DQXA 3TV6A 3C4CA 3FJQE 4QO9A 2XBAA 3BYOA 3L8PA 4UMPA 2VV9A 2JDSA 4IDTA 1RW8A 4A07A 4V05A 3RPVA 4FTCA 2J4ZA 4RIOA 4X2JA 4AN9A 3SGCA 5L8KA 3R04A 3LLTA 4MXYA 4Z7GA 4FG7A 3V6RA 4O83A 5HESA 3H9RA 4FNXA 3U8WA 5TT7A 4ASZA 4G5PA 4L3JA 3OCSA 3PJ8A 4IVAA 4DTKA 2GHMA 4GJ3A 4TWNA 1STCE 4ZTLA 3TTIA 3LFQA 4IB0A 4FEVA 5T3QA 4RIXA 3VAPA 1PRYA 1OITA 4G31A 3P23A 2HZNA 1K2PA 5ETAA 1XH5A 3W8QA 1G3NA 4FSUA 3V3VA 3VUGA 5HLNA 3LMHA 3PSCA 4FNZA 5BVDA 3ZCLA 3EN4A 4R1YA 1K3AA 2HENA 4YC8A 5BVFA 3FMEA 4R7HA 2RFNA 5KX8A 2VAGA 4LUEA 5TO8A 3AC2A 4DFBA 3C51A 1NVQA 4ACCA 1OBGA 2E9UA 3F9NA 3OMVA 4UWYA 3S00A 5FGKA 4I22A 5D11A 1VR2A 4DINA 1JKTA 3F3WA 4RX7A 4JX7A 3WARA 2JIVA 3KK8A 4ZS4A 1XWSA 2YDJA 3FHRA 4ZEGA 3PA4A 4XX9A 3ZZWA 3RPYA 2XNEA 3AMYA 3QKMA 3EQGA 2H96A 4JDHA 5CX9A 5ETIA 3NVMB 3RMFA 5AJQA 5GJFA 4JT3A 2I0EA 2OXXA 5HNBA 2BFXA 5I0BA 4FZAB 3F82A 1FQ1B 5M07A 2YLEA 3ZXZA 4ITJA 1YDSE 3BHVA 3NAXA 4FG9A 4D55A 5G1XA 4YJPA 3ZSGA 2JD5A 1UWJA 2CSNA 2OJ9A 2WMRA 3FY0A 3ZHPC 4LI5A 5CU3A 3F3TA 2VNYA 4Q5HA 3I81A 4RQKA 4WT6A 1OECA 4LOOA 1Q62A 4FTMA 3JVSA 5C27A 3QRKA 4I24A 3SAYA 2NRYA 4P7EA 5HVJA 5FUTA 5HG8A 3WZDA 3ZXTA 4J53A 3R8VA 3TNPC 3V01A 2YITA 1BMKA 2DQ7X 3KRRA 4DEBA 3ID6C 1SM2A 4BCHA 4PRJA 1H27A 3FC2A 4FIJA 5CEIA 3KKVA 3O23A 2O5KA 1H1QA 2ZV9A 4A4XA 3TN8A 3DKGA 3OEZA 4IVDA 2HW7A 1PMNA 5IQFA 2CGWA 4CFFA 2C0TA 3EFWA 2A2AA 3VJNA 2GMXA 2VNWA 3QTWA 3MB6A 4UMQA 1KE7A 2OH0E 1YRPA 1M17A 2OSCA 2C69A 4IB5A 4QPAA 3R8PA 2ZDTA 3ZYAA 5J79A 2Q83A 4IH8A 2GS2A 1CM8A 2HXLA 3VHKA 1Q3DA 2GNHA 5J87A 1XH9A 4RLLA 5LVMA 4E26A 4BDBA 4O21A 4IDVA 4M7IA 2B9IA 3WBLA 2BPMA 1WBPA 4QYGA 2EXMA 4RC3A 2Z7QA 3G0FA 1Q8TA 2JDTA 4K77A 2ZMDA 3OWPA 2ITUA 3T3UA 3UJGA 2VTQA 3M1SA 4AF3A 1DI8A 4WSYA 4LGHA 3DS6A 1RQQA 4FIFA 5AR2A 3JS2A 4C33A 4U42A 3MJ2A 5CASA 1F5QA 1FMOE 3IW4A 4FT3A 2YAKA 3K3IA 2LAVA 3RINA 1WBOA 3NCZA 4CZUA 2C47A 4M0ZA 5AP7A 4BZOA 5J9YA 5IQEA 2WKMA 3E8DA 4GMYA 2YWVA 3T9TA 3JVRA 3KN5A 2PPQA 3QAME 3N9XA 4GG5A 5HVYA 4D2WA 4KBAA 4PDYA 4FKGA 4GS6A 2WU7A 4YZNA 4MD9E 4EHEA 4QNAA 2VO3A 2PULA 4AAAA 4DTBA 4DGNA 3PFQA 4IEBA 2PHKA 4TL0A 4GFGA 2J0LA 4FK6A 3CKXA 1H25A 2QOLA 4EKLA 4YJNA 5CS6A 4G9RA 2B53A 2VTIA 4E4NA 4EC9A 3R30A 4YPDA 3SD0A 3KF4A 4DGGA 2UZOA 3QU0A 2B1PA 4KS7A 3NDMA 5CALA 1DS5A 2UW5A 4NH1A 5DNRA 4E6CA 3BCEA 3K2LA 2C3LA 2WMAA 2Y4IB 3LCTA 2CNUA 3O50A 2GFSA 4O0XA 4N57A 3QZIA 4GSBA 3RM6A 4YJVA 3HUBA 3NIEA 4LRJA 5EHOA 1BX6A 3PVUA 4E4LA 4D1XA 3EFLA 4MXXA 1ERKA 4R5YA 1PXMA 2NO3A 3CP9A 2G2IA 4YHJA 3VQHA 1OIUA 5BNJA 2KTYA 2GHGA 4O0WA 4MCVA 2OZAB 3SXSA 1Q4LA 1H1SA 4QTBA 1ZYDA 4I1ZA 3KQ7A 4IZYA 3ZO2A 4LGGA 5HGIA 3EFKA 3V5LA 4Y85A 4FIHA 3OWKA 4O0SA 2Y7JA 3F88A 4FVRA 4BCGA 4PMTA 4E6AA 3QQJA 3HUCA 3KXGA 2UZBA 2QLUA 4GT5A 3EQHA 2C6LA 3T8OA 4BDKA 3TUDA 3DU8A 3HMNA 3NYXA 1YHSA 3BEAA 2I1MA 1KE6A 2JAVA 3AC3A 5KMNA 4KKEA 3GEQA 3O51A 3QUPA 4QMMA 1WBWA 4A7CA 4L45A 4CTBA 5FXRA 3ZRLA 1O6KA 1SVGA 2YCRA 5L8JA 4EOMA 3BPRA 4ZLZA 4R3PA 2BDJA 1JSUA 3ZSIA 5L6PA 3DTWA 2XK7A 2UW8A 3EJ1A 3MVJA 4EHGA 1WVYA 3DA6A 3MGYA 5AR3A 1A9UA 5AP5A 3KA0A 3QTQA 4ZAUA 4B7TA 4L00A 4IM3A 4BCKA 5HG5A 4HJOA 4BTKA 4KIKA 5F20A 4YTHA 3ZUUA 4AXAA 3EKNA 4CMUA 2BILB 4YTCA 4BHZA 1OI9A 2YZAA 3FXWA 1PKDA 2OF4A 3MVMA 4QP8A 4RMZA 4EEVA 2BKZA 3E93A 2OFVA 1R0EA 2R2PA 3PXYA 3TI1A 1H00A 4HVIA 4P5ZA 2FSLX 1LP4A 4YJRA 4DFYA 4Z16A 2C1BA 4FZ6A 4R8QA 1OKWA 2PVLA 2JDVA 3OW4A 2FYSA 2WMTA 2O8YA 4BIEA 3UQFA 5EQYA 3EYGA 1RDQE 2XKCA 4R7BA 1PMUA 4IMYA 1CKPA 4IVCA 2Z7SA 2GNGA 1UNLA 4NK9A 3C4EA 4JDJA 2WD1A 3KMWA 3UGCA 1LR4A 1Y6BA 4L6QA 3QQGA 4QQTA 2W1DA 2DYLA 3IPHA 5FEEA 5FRIA 3UBDA 4OT6A 3MESA 3VBXA 2ITNA 5KMMA 4IWPA 5HX6A 4JRVA 4MQ1A 2RGPA 2YIYA 3G51A 4XEYA 3HVCA 3LFCA 3FZRA 4PY1A 3UOLA 5BUJA 5C26A 5HU3A 3UO4A 4LOQA 4EOIA 3P5KA 3I4BA 5HE3A 4A06A 5ANGA 4KKGA 4FSYA 4P4CA 5EKOA 4QPSA 4WRSA 5JRSA 1TQPA 2JLDA 5CI7A 4GT3A 2RL5A 4EONA 2GFCA 3ROCA 2BIKB 2VTRA 4BKJA 4FTOA 3CY2A 1ZWSA 3VBQA 3SOAA 2OXDA 3OT8A 3IW7A 2R64A 3VIDA 4RA5A 4Y5QA 4BDFA 4TPTA 4ERKA 4RVLA 4FA2A 4H05A 2OGVA 3PSBA 4RX9A 5FP5A 3PE1A 4PL5A 5HNIX 2YLFA 4JQEA 4G6OA 5M09A 1GJOA 5LMAA 4LGDA 3FLQA 4YZBA 3TT0A 2BUJA 4JX3A 2C5XA 5DFPA 1BL6A 3E92A 5E8SA 3TZ8A 1PXIA 1I44A 4WSQA 2XNPA 4XBUA 3D9VA 2PMIA 2BHEA 4XOZA 4JIKA 1NVRA 2VTMA 3VUDA 1KE8A 2XIKA 4LQMA 3LLAA 1W82A 4NFMA 4F9CA 1BYGA 3QRJA 3DDPA 3KRJA 4TWPA 4TZRA 3BYUA 3L9PA 4D0WA 5CU2A 3JUHA 4Z9LA 3UYTA 3M11A 5TE0A 1GZKA 1PMEA 4HYSA 3VUHA 3D5VA 2HIWA 3DLSA 3SC1A 4A9SA 4L8MA 4CFUA 3EN5A 4CV9A 3AXWA 4ZLYA 4PPCA 2GNFA 3FZSA 1UKIA 4EOSA 4BCFA 5JN2A 3BLHA 5C4KA 3H0YA 3OROA 4EYMA 3MFSA 1PXLA 2Y8OA 3NLBA 1YDTE 3CLYA 4FUYA 3QCQA 4AU8A 5HNGA 3F61A 4FTTA 2RFDA 3HMOA 1CMKE 3GCUA 4RBLA 2W9ZB 4XH6A 2ERZE 3R7GA 1KE5A 3NR9A 3NUYA 4QMTA 5JEBA 1ZOHA 4ZTRA 3NCGA 5CU6A 4YHFA 2W4OA 5IQHA 2P4IA 2XNBA 3IGOA 2GS7A 4MBIA 4KKHA 4S30A 2X6DA 3V8WA 4AZVA 5HVKA 4OTHA 3FEGA 4C8BA 3JXWA 3FLYA 4J98A 4E6DA 5A4LA 4A9YA 4FKPA 4GT4A 4D4VA 3BKBA 2LGCA 3NNVA 1LEWA 1QPDA 1ZZ2A 5CF4A 5JMSA 5K9IA 5KMLA 4UBAA 1TKIA 4L43A 3NUPA 4PP7A 4MX9A 3VVHA 5HTIA 4D5HA 1U54B 3H0ZA 4QYYA 4ZY4A 3W32A 3SX9A 2WQEA 4I0RA 2FH9A 4LFIA 4FSRA 4BTFA 1Q8YA 2E9NA 2X2KA 2CN5A 3DT1A 2PZYA 4FZDB 3TJDA 4ZY5A 3SDJA 5IEXA 4MKCA 5DT0A 3A61A 1R3CA 2P0CA 2ZDUA 4U80A 3S95A 5J1WA 2IPXA 2WMVA 4O7WA 5A6OA 5BMSA 4EBVA 5K4JA 4BCMA 2GDOA 3WI6A 3CGFA 4CVAA 3ZFMA 5CAOA 5LWMA 4BFMA 4BI0A 2X8EA 3RCJA 4BGHA 4JAJA 2G2HA 5EFQA 4ZTMA 2QI8A 2REIA 3R1QA 5HE0A 4EK8A 3A7HA 3MPTA 4PL3A 4DTAA 4D1SA 1OB3A 3SG8A 2F49A 3N4TA 3F69A 4ZMFA 2QODA 3FMKA 3RHXA 3R7EA 3P7BA 5D1JA 3KFAA 5IQGA 1UU8A 3UC4A 2VWIA 5L2SA 2FGIA 4N6YA 2VWBA 3JPVA 4YUQA 3RCDA 4PDOA 4JBPA 1OUKA 2QOBA 3C4FA 4UXLA 5CXHA 2JDRA 4IAYA 5BPYA 1R78A 4XG2A 4RX8A 5AUYA 4CGAA 3G15A 3EFJA 3PPJA 4M66A 3FMNA 4HGLA 1U5RA 2YCFA 5L2QA 4IAIA 2V0DA 5BMMA 3UZRA 3PJ1A 4ASDA 3ANRA 4PPBA 3D7TB 4MF0A 5JFWA 3UG1A 5KKRB 1GZ8A 3FC1X 3QTUA 4K0YA 3I6UA 5EM8A 5KMOA 1XH6A 2WTCA 4TW9A 3UODA 3ZEWA 5M55A 1OIRA 4MEDA 5AUXA 2HY0A 4Y83A 1ZLTA 5AR8A 2WQMA 2VO7A 3HLLA 5CZHA 2CGVA 2H34A 2YIXA 4LRMA 1SYKA 1PXNA 3PIXA 5DPVA 3C0IA 4C61A 3R2YA 4I20A 2QOIA 4MBJA 5IEVA 4ANQA 4G5JA 3FI8A 3KVWA 4QQJA 4II5A 3RK7A 4GG7A 3PZEA 4DEEA 1ZYJA 2WU6A 3K5UA 3OD6X 3QC4A 5E91A 5BVEA 1UU9A 4YTFA 5JQ5A 2YJRA 4U43A 3DLZA 4WBBB 3VHEA 3HA6A 3S3IA 3HA8A 3VS1A 3RWQA 4G3FA 4LYNA 2C6TA 3VRYA 5DVRA 2YM6A 3ZC6A 2QHMA 5IQIA 5F94A 3D2KA 4D2TA 1H28A 4O0UA 4UY9A 5AA9A 5CNNA 2C5OA 4Y72A 5HU9A 3UVRA 4F7SA 2HZ0A 4L46A 3GC0A 2C1AA 3I1AA 1WCCA 2C5YA 1MRYA 3AGMA 1Y8YA 4OGRA 3TIZA 4XRLA 3HMMA 4BCIA 1NW1A 3Q4UA 1UWHA 3D5XA 4KABA 4C58A 1OMWA 1Q24A 4I3ZA 4OTGA 1WBSA 4F6WA 4CYIA 1CKIA 2BTSA 4WRGA 4EORA 1A48A 3CJGA 4EUTA 4X2NA 3S2PA 4UZHA 2OZAA 4I0TA 4U3ZA 3Q4ZA 5BYZA 3W2SA 3TDVA 1DI9A 3I6WA 2J2IB 4FL2A 4NCTA 3FQSA 3OOGA 4J71A 4YGAA 4DC2A 3ZDIA 3DXPA 2PK9A 5M08A 2PZ5A 3C50A 4HGTA 2ZJWA 1IASA 2R3KA 4FYNA 4E93A 2IW6A 4X3FB 3R8MA 1JLUE 3D5WA 4DBNA 4HCUA 3BHYA 4FYOA 5CSVA 4A4OA 5A4TA 3ORKA 1ZRZA 5KMKA 4DEDA 4B99A 2GU8A 3NIZA 2YDKA 3TZ7A 4IZAA 3FPQA 3A8WA 4U6RA 2HY81 4QD6A 4RWKA 4AOTA 2CGXA 3GNIB 2OLCA 1SNXA 2ZMCA 1MP8A 2VTAA 3DCVA 3EQRA 2H9VA 4WG3A 2C6IA 5CXZA 3G5DA 1A06A 2CKEA 2BAKA 2E9VA 2PVHA 4PWNA 3BWJA 1YWNA 2BALA 3EMGA 3GT8A 4EH6A 2F7ZE 3PPZA 3PXQA 3U54A 4GVAA 4NZWB 1V1KA 4E8AA 4GV1A 5GZ8A 3DBCA 3TEIA 3E8NA 1U59A 2J90A 4IADA 5HHWA 1OIQA 4EYJA 3E87A 1PXPA 2GTMA 5J5TA 4JVGA 3PG1A 3HRCA 4C4GA 3EN7A 3Q96A 3VS2A 3F66A 3P0MA 4TYJA 4ZTSA 4PDPA 4YBJA 4D58A 3LW0A 3RI1A 3SRVB 3LM5A 4ONAA 4WD5A 5AIRA 4OTFA 2QNJA 3RNYA 2GSFA 3HMPA 2V5QA 1IRKA 5FEDA 4FR4A 3WE8A 4C38A 3DZQA 3LPBA 3RNIA 3QKKA 1XQZA 3ELJA 4DEHA 5B2KA 4AACA 5L2WA 5ETFA 4F0IA 5I9YA 5FDXA 3ITZA 4XJ0A 2QOFA 2WHBA 4D1ZA 5BVKA 3CJFA 4TRLA 4QMVA 5EI6A 4Q9ZA 3QYWA 3VW6A 4FKVA 3KF7A 3UP2A 3WF7A 3I7BA 1REKA 4B8LA 5LQFA 3FQHA 3QTXA 4XMOA 4MH7A 3BE2A 5AIKA 5EQEA 2CMWA 1WVXA 3CD8A 2X6EA 4UZDA 5J8IA 4CSVA 4O81A 2R3LA 2WB8A 4K18A 4X2KA 2GPHA 3LFSA 4AA4A 4F0FA 3ORTA 4NW6A 3Q2JA 3V04A 4O7VA 3LHJA 4XG6A 2XB7A 3FZ1A 2BROA 4BHNA 3FQEA 3ZOSA 4AZEA 4CZTA 4EBWA 4KUJA 2ZV8A 4MVFA 3UE4A 3E8EA 5C4LA 5I9WA 5ICPA 4YO6A 1GZOA 3DOGA 3KC3A 4EC8A 1O6LA 3BBWA 3E63A 4QTEA
chains in the Genus database with same CATH superfamily
2C0OA 4WO5A 3VUKA 4LDTA 4YMJA 4FSMA 1PW2A 3ULIA 3PP0A 4IB3A 3DK7A 1IAJA 1MQBA 2CLXA 4AWIA 5CF5A 3MJ1A 1JWHA 1LPUA 5DN3A 5IZFA 4L3LA 3MVLA 3H30A 1IAHA 4CMOA 1KOBA 2YEXA 4LV7A 4QOXA 2QG7A 5EDRA 3SOCA 1XKKA 1ZMVA 3QUDA 4CFVA 4F9AA 4GK3A 3NZ0A 1MQ4A 3G9LX 2Z2WA 3GP0A 3NW7A 3OW3A 4AN3A 2JDOA 1IG1A 3BYMA 4M13A 1UV5A 1VZOA 2VTSA 4YZDA 4ITIA 3RGFA 1OBDA 4ASXA 2R3QA 2A19B 3GCSA 4L44A 1QPCA 3H10A 5C03A 2PZPA 1GOLA 4Z3VA 3RALA 3HAVA 4ZSEA 2O64A 3ZRMA 2V7OA 4BWPA 2F7EE 2ZM1A 2BDWA 3IO7A 4YJSA 4G3DA 4BICA 4PF4A 2XKDA 4JS8A 3WF8A 3C0HA 4FTJA 4RC2A 4EJNA 3GBZA 2B4SB 3ENHA 3M42A 4C34A 3ET7A 4UV0A 2A4LA 4EQCA 4U81A 4FV6A 4KWPA 2KULA 2YM7A 3HV7A 4W9XA 4WUAA 5HI2A 4D9UA 3SXRA 1UA2A 4IAFA 4OTQA 4O1PA 3Q9ZA 5IH6A 3O7LD 5CSPA 3BV3A 3RZFA 1PHKA 2BIYA 4GJ2A 4J96A 4AUAA 4AZWA 4NU1A 1H1PA 1AD5A 2GS6A 3PIZA 4K11A 3VF8A 4K8AA 5JT2A 3TXOA 3PA5A 4BDCA 1NY3A 3ZZEA 2XP2A 4AW1A 3CIKA 3U6IA 3QD0A 3ATSA 1U54A 3OZ6A 4LMUA 4DCEA 5B7VA 3Q4CA 4M84A 3BHTA 1WBTA 2R3MA 3O2MA 3TMOA 2QOQA 5CSHA 3UPXA 3LOKA 3TV7A 3VO3A 5AAEA 5KBRA 2QG5A 5M4CA 3QX4A 5HLWA 4P5QA 4M12A 4IW0A 4HOKA 2P3GX 3KXMA 5EW9A 3PJCA 5CTPA 2CNVA 4MNEB 3C0GA 3HAMA 3NFFB 4R3CA 5CAPA 3NEWA 4QMNA 3W2OA 5H3QA 4BGQA 4L68A 3KEXA 2WMQA 4O4FA 4NUSA 4FV2A 3R28A 2F7XE 3LCKA 5LCKA 4J8NA 4W4WA 4ZSJA 5J7HA 1XBBA 4C7TA 4IAKA 3FDNA 4MYGA 4WOVA 4Y73A 1M7NA 4W4XA 4G6NA 4E1ZA 4W9WA 5BX0A 4FV9A 5CAQA 3NUNA 3OTUA 5I9XA 3MN3A 3PRFA 3R9HA 3MDYA 4D2RA 4F6UA 2JEDA 3DKOA 2UW6A 4C4IA 2XK8A 3NW5A 4G9CA 4KSQA 4ALWA 4EOOA 4OBOA 4OTIA 4XOYA 1NT2A 5AWMA 2G01A 4N6ZA 4YJUA 4BI1A 2W1IA 3WOWA 3ZRKA 4EWHA 5IG1A 4RGJA 3QTSA 3GGFA 4RG0A 5CWZA 1OKZA 3PIYA 2YM3A 4KB8A 1YOMA 3TCPA 2GNJA 3ZO1A 3P86A 4PX6A 5AP6A 3W0SA 2GNIA 3D7TA 1OUYA 5HQ0A 1PMVA 5EYMA 3R01A 2ZM4A 1U5QA 5HCZA 2Z60A 1YKRA 3KB7A 1R1WA 3P1AA 2YDIA 4YZ9A 3G6HA 3RKBA 1W2DA 3DKCA 3FV8A 4DAWA 4FG8A 4JIAA 4ALVA 3CPBA 3MY5A 5AEPA 3HGKA 4O7NA 2ERKA 4BZNA 4JOAA 1H8FA 4QYHA 4W4VA 2XEYA 4F63A 4L9IA 5HTBA 2RG5A 4F1OA 3TUCA 3BE9A 3QKLA 3FAAA 2J50A 4O6LA 3MH1A 3T3VA 3GFWA 4WKQA 3H4JA 2WMXA 3HP2A 4OAUC 2ETMA 2BRMA 2AEGA 3GOKA 4Z55A 3LCSA 2ZOQA 2NYAA 4ENYA 2G15A 4WNOA 2OI4X 5DE2A 1B39A 5HZNA 4JR3A 5DRDA 3GQIA 3MIAA 3CQWA 3PZHA 3NGAA 3DXQA 5HG7A 1H24A 2GNLA 3WYYA 5LVNA 3S1HA 4JI9A 4FODA 2IZTA 3COMA 4FTAA 4W4YA 2JKMA 4RVMA 2BKKA 1JKKA 2WZJA 3LFFA 4TYIA 3Q52A 4GUEA 4XG7A 1O6YA 4IXPA 3FXZA 5JGAA 2QR8A 3UOHA 4PTCA 5IH4A 5LXMA 2XM8A 5I3RA 4YP8A 3DGKA 2Y4IC 2X7FA 4FTUA 4RVKA 3DAEA 3V8SA 5JGDA 3KRWA 4J8MA 5E8YA 5DIAA 2O0UA 1XH8A 4MWIA 2VTHA 3TDWA 3CY3A 1QCFA 2W06A 2GQRA 3ROYA 1JVPP 4X3FA 2XVDA 3V5WA 3FZPA 2W1EA 3FMLA 2HWOA 3C5UA 3KMMA 4QNYA 5AV0A 3RP9A 5IQBA 2GQGA 3PWDA 4U97A 5CSXA 2QO7A 2XKFA 4FIEA 3Q9XA 5A14A 3I5NA 4BDDA 1EH4A 3RJCA 1ZMWA 4RRVA 4S32A 3PYYA 1QL6A 3FYJX 5FQDC 4Q5EA 1Q61A 4I92A 2CKPA 5KZIA 3R9OA 4X3JA 5KMJA 2XM9A 3BYSA 5KUPA 3O71A 3LXKA 1M52A 3BYVA 4K33A 4NM5A 3IG7A 3LJ1A 2PMNX 3C5IA 4J7BA 2QOHA 2WGJA 4O0YA 5AP4A 2XJ2A 3REPA 4H3PA 4HNIA 4YLKA 1PY5A 4XRJA 4YJOA 3A99A 3R00A 4CFMA 5BVDA 3IGGA 3SLSA 3EKKA 5GIOE 2Z7RA 4CFNA 2UZVA 5DGZA 2UVXA 4EOJA 2YHVA 3W0NA 3NNWA 4AT4A 3BIZA 3DAJA 3ACJA 1BKXA 2BRNA 3M2WA 4FNYA 5HG9A 4BDJA 5I9VA 2PE1A 4MXZA 3QRUA 1HCLA 3SRVA 3ZLWA 2PU8A 2XJ1A 4MUQA 2C3IB 1UU7A 2VWVA 4GU9A 4JG7A 4JXFA 3KXZA 3PG3A 3I79A 4RFMA 4UX9A 3LQ3A 4QMQA 4PTEA 4QMSA 2ETKA 5IDNA 4FICA 4HPTE 3VBVA 4C36A 4CCUA 2QU6A 3JY9A 5AR7A 3DPKA 4EOQA 4ARKA 3NUAA 4M67A 3TKUA 3COHA 3DBDA 4DG2E 4QP2A 3WF9A 1M2RA 2RF9A 3LJ0A 5LMKC 3BBTB 4XBRA 3OVVA 5CEMA 2ZB0A 4RX5A 4EZ5A 4NM3A 2XYNA 3COKA 3LAUA 3QCXA 3W18A 3UQGA 2PZRA 4H3BA 4F4PA 3B8RA 2XNOA 3PUPA 2UVZA 4GL9A 2BMCA 4F09A 3IECA 4G6LA 5FM2A 3ZBXA 4E4XA 5HCXA 4EH7A 5CEPA 2QHNA 3OY1A 5IUHA 1U46A 2UW0A 4FTRA 3UVQA 1OPLA 5LARA 1G8SA 1PF8A 2WXVA 4IJ9A 4DH5A 2V7AA 3OOMA 4ZTHA 5CU0A 2VX0A 2PE0A 3EWHA 1OL2A 4KAOA 3ETAA 4J52A 3LMIA 4FJVA 5DEWA 4AFJA 4ENXA 5DYJA 2AQXA 3VW8A 4KA3A 4MD8E 1YXTA 3CBLA 3W2CA 5JFSA 5LCJA 2FO0A 3DNDA 3R7YA 2EB2A 2PL0A 4N4SA 5IKWA 5HIEA 3QCYA 4OUCA 4I6QA 3TNHA 3DXNA 2CPKE 1GIJA 5CY3A 4EK6A 4G17A 3IDBA 4D9TA 4CQEA 3DY7A 3VS0A 2W5AA 3C4WA 3LKMA 2GHLA 4WUNA 3VBTA 2A1AB 3PVWA 3HEGA 4AE9A 4JBOA 4ACGA 3ZTXA 2R4BA 3QF9A 4FSTA 5DH3A 5DRBA 1MUOA 1IA8A 2XCHA 3QCSA 4IB1A 2B0QA 5EYCA 2VU3A 3ZS5A 5KBQA 1TQIA 2I0YA 3IW5A 4O6EA 4RJ7A 5I5ZA 1Q41A 4D2VA 4YLJA 5D7VA 3MFUA 2JFMA 3E88A 3OXIA 4HCVA 3Q5ZA 4M68A 3VULA 2ESMA 3W2RA 3UIMA 3KREA 3R21A 2XS0A 4O2ZA 3VBYA 3ZC5A 4AS0A 3HV5A 4AW0A 2X4ZA 3A7IA 3MH2A 2QCSA 3FHIA 2VWWA 3P08A 4KD1A 4QYEA 3OF0A 4RSSA 2B9FA 3NPCA 3PE2A 4USDA 3TTJA 3MV5A 4FV4A 2VO0A 4FOBA 4TYGA 3Q3BA 2Y9QA 4AZTA 4G16A 1ZYLA 2ZV7A 3F7ZA 4I4FA 4U41A 5IUGA 3BZ3A 3ALNA 3ZLSA 5CF6A 3VQUA 2XKEA 2I0VA 3F3UA 4YBKA 1V0PA 2R3GA 4BI2A 2HWPA 1E9HA 3KL8A 4FE2A 4E4MA 3GCPA 3VC4A 1HCKA 3HNGA 3MWUA 1ATPE 4PPAA 5BYYA 3DJ6A 2VGPA 3QBNA 4KSPA 5AV4A 1Q3WA 2B55A 3EYHA 4FL3A 3SQQA 4QT1A 3PXFA 4ZZOA 3ZU7A 1WVWA 2F57A 3VNTA 4CLJA 2G9XA 1W0XC 5CENA 4CT2A 5DI1A 5EOBA 4DH3A 2IW9A 5M53A 3L9NA 4WG5A 4DGOA 4FTLA 5ACBC 4ZP5A 4ANOA 1ZMUA 3MSSA 2BTRA 1FGIA 2C6OA 1P2AA 4PMSA 4RWIA 5E90A 4IZ7A 2QU5A 2WAJA 4FTKA 4N0SA 3MFTA 1URCA 3ZSHA 2VO6A 4QP3A 1V0BA 3FE3A 3P7AA 5AP2A 4FT9A 4BBEA 2RIOA 2OJFE 3R02A 2J9MA 4MNEA 3DAKA 4MXCA 4QPMA 3PXZA 5CAUA 4FSQA 3GCQA 1XJDA 3ZONA 4AZSA 2BCJA 1FMKA 3ORZA 4YLLA 2WMBA 1T45A 5E1EA 4A9UA 3P79A 4APPA 1KV2A 2W1ZA 3OCTA 2X9FA 3F5PA 3DFCB 3QX2A 4IC8A 3QZHA 4ZSGA 5HE1A 5KZ0A 3SXFA 4EUUA 4O96A 3Q6UA 5TF9A 4PL4A 1YOJA 2WMUA 4AQCA 5A46A 2X7OA 3TWJA 4XG3A 3G90X 5DHJA 4LUDA 2OG8A 4R6VA 5HO8A 3R6XA 3EN6A 4FMQA 5IA2A 5TKDA 3F7WA 1H0VA 3I7CA 3PTGA 3UOKA 2JC6A 5K5NA 4NL0A 4DH7A 3Q6WA 3QQLA 4HYHA 4RZWA 4APCA 4B9DA 2WMSA 5CAVA 3WE4A 5IQAA 3I0QA 3D4QA 4FUXA 3EB0A 3OS3A 2VTLA 3C1XA 2UUEA 1BI8A 1Q5KA 3LQ8A 4GCJA 4M3QA 2QO2A 3KY2A 4LG4A 3LMGA 4MK0A 5EH0A 3R7IA 5JFXA 2BZIB 4FIGA 4Y95A 5CF8A 3OP5A 4BCPA 4B6LA 1Q97A 4AOIA 2UZNA 2ONLA 3FL4A 4G34A 4IC7A 2CCHA 4EOPA 2YCQA 4GW8A 2B9HA 3UG2A 3QD4A 2UZLA 2XA4A 3QTIA 2ITTA 2XK9A 2PMOX 2X1NA 4XCUA 4XG4A 3S0OA 4O7LA 2BDFA 3RVGA 3LCDA 4O86A 3CD3A 4HYUA 5EQPA 1ST4A 3W2QA 3RK9A 3CXWA 4S2ZA 4FKLA 2J0MB 1U4DA 1P4OA 4CKIA 5KNJA 2PVMA 2C68A 4KBCA 4CV8A 2BRHA 3A7GA 5GJGA 3GFEA 3MYGA 4ZSLA 5M56A 2B52A 4I5CA 3RWPA 3TNWA 1G8AA 4O0VA 4RWJA 3ACKA 3IW6A 3FLWA 4J95A 2R3OA 3MW1A 3NVKI 5FXSA 2UW4A 3FPMA 4C59A 4I0SA 2WPAA 3F6XA 4JBQA 2X9EA 3AKLA 4IX3A 2JFLA 2IZRA 3GU4A 4HGEA 3FUPA 1KSWA 1W84A 1FGKA 3OEFX 4ID7A 4XV3A 4AXDA 3CQUA 2P2IA 4GU6A 5I3OA 5J7BA 4CLIA 2PUUA 2H8HA 4U8ZA 3WIGA 3L8VA 3NNXA 3PJ2A 1XHAA 4F65A 2ZVAA 3DTCA 1R0PA 4I93A 4A9RA 1S9IA 5A4CA 5AUTA 3UOJA 2YIRA 3CKWA 2IN6A 3Q53A 4Q2AA 5BVOA 2VWYA 4CT1A 4R78A 5CANA 3LJ2A 3PXRA 3F2AA 4F64A 1CKJA 3LFAA 4ITHA 4KNBA 2FSMX 2UZTA 2QOOA 4C35A 4PDSA 3C7QA 3DB6A 3O96A 1YHWA 2IVSA 3FMJA 3QQFA 3R7UA 4YU2A 4O91A 4XLVA 5HO7A 2X0QA 4JAIA 4YPSA 4G3CA 4ZS0A 4EZ7A 5L2IA 5EHYA 4DBXA 5AAFA 3UMXA 2XAOA 3R1NA 2J0IA 5AR4A 4OBQA 5GHVA 3UDSA 3TZMA 3IQ7A 3KN6A 2XRWA 2YIQA 3DNEA 2HYYA 3FSFA 3FKOA 4H1MA 4A4LA 4HGSA 4BBMA 4B8MA 1M7QA 1W83A 5AX9A 4OLIA 3UQCA 3BI6A 4E7WA 3O8PA 4E20A 4QP7A 2ZM3A 2YFXA 5H2UA 1GNGA 3QA8A 4C4HA 3G9NA 4XV9A 4DFZE 5C8NA 4BDIA 3HV3A 3OWLA 5IQCA 4X3FC 4RT7A 4YHTA 3NYOA 1FBNA 1WAKA 4I6BA 2QOCA 5DLSA 3G33A 5EDPA 3OCBA 4BWKA 4IZ5A 4BC6A 4CZYB 4UMRA 5EM7A 5ITAA 3JR1A 3KVXA 5ANDA 3OY3A 3QZGA 2C5VA 1YI6A 2R3HA 2GCDA 2R3IA 3MA3A 5CSWA 2QR7A 3HRFA 4X6RA 4HW7A 5B2LA 1G8JA 1VLRA 4E3CA 4XHKB 2OIDA 3RAWA 2XJ0A 4UN0C 4ANLA 3Q9YA 3O8TA 3Q4TA 3AC5A 2Z8CA 1L8TA 3GXLA 2W96B 1W7HA 4M97A 1G8KA 4ZTQA 4JLCA 3RHKA 4NEUA 3DDQA 4BB4A 5AADA 2WOUA 4TYHB 5M57A 3IOPA 4QMWA 4D4YA 1ZOGA 2YISA 4KS8A 1KUTA 4JNWA 4D0XA 2YERA 3BHHA 5LWNA 1JOWB 4HYIA 2ITYA 3FI2A 4KIPA 4Z7HA 4DLJA 3L8XA 1H0WA 3Q32A 5JK3A 5E8UA 3IONA 1W98A 4UALA 4FKIA 4BWXA 3ANQA 2NRUA 4MNFA 3DK3A 4M69B 1MRUA 4G3EA 3VS7A 3CR0A 3ZLYA 4WNKA 4DLIA 3SKCA 4ACDA 4BTJA 1UVRA 1FINA 1WZYA 1XR1A 2J5FA 5AR5A 4FTNA 5L8LA 1Q99A 3HDMA 4FNWA 4CD0A 4F9YA 4FEWA 4EI4A 2NP8A 3CCNA 3PXKA 4DH1A 4C62A 4CKJA 5JRQA 3WF6A 4EHZA 5K5XA 5AUWA 2ITXA 4LMNA 4V01A 3DV3A 2OXYA 4JQ7A 5EDQA 3UDBA 2WEIA 2PUIA 2IO6A 4P2KA 4DFLA 3ORNA 4U45A 2W17A 4YSJA 1YXVA 4CG9A 1PYEA 3KGAA 5ANOA 1PXJA 5AX3A 5B0XA 4IHPA 5E8TA 5D41A 3ZO4A 4BGGA 5E4HA 1ZARA 3D5UA 4F9BA 3GI3A 3QL8A 3K5VA 4KIQA 5GNKA 3V5QA 1H1RA 1Z5MA 5CT7A 3WZJA 2VD5A 3GU6A 3MPMA 3QWKA 3FZTA 5FP6A 4CYJA 4QTAA 2W5BA 4HVHA 2VX1A 5L4QA 3NFGB 1BI7A 3PY3A 3V5TA 2V62A 5E1SA 5J9ZA 2OBJA 3BHUA 4O7RA 4FV0A 1WFCA 2XBJA 2IZUA 5E8ZA 4PMPA 4AA5A 3U87A 3R7OA 2H6DA 4ZJIA 4MF1A 1W2FA 3U9NA 1S9JA 5HIBA 2XF0A 5IA5A 2DUVA 4F1MA 4UB7A 2OU7A 3QLFA 3LZBA 3CPCA 4J1RA 2HZ4A 4LV8A 3TL8A 3BU3A 1ST0A 4V0GB 4JJRA 3HRBA 2OZOA 2XCKA 4O27B 5AUVA 5TR6A 4D2SA 4C57A 1XH4A 2RFEA 3OTVA 4QTCA 3LFBA 3QTRA 4BKZA 3H9OA 5ANIA 3RAHA 3EQPA 3Q60A 4W8DA 3SW7A 3N4UA 3E5AA 4PTGA 4RJ5A 1BLXA 2JKOA 4FC0A 2O63A 4D4SA 5KMIA 2ITWA 1QPJA 4UEUA 1DAYA 4BVUA 4MQ2A 4ZZNA 2WELA 1UU3A 4I21A 5T6KA 1WBVA 3WZUA 1H1WA 3OG7A 2PVYA 4O7TA 4HVSA 3AMBA 5A4EA 4QMYA 4O7YA 5HEZA 4X21A 2RKUA 5H8GA 4FTIA 4PUZA 4NKAA 4UMUA 2VUWA 2R9SA 4J97A 3G6GA 1BL7A 1M14A 5CVFA 3OCGA 5T68A 3AD4A 2EVAA 3NYVA 2YIWA 2W0JA 3EIDA 4U5JA 5EYDA 4FKTA 2YA9A 2W4JA 3W55A 5DT4A 5FEQA 5IQDA 3P9JA 3GB2A 3KRLA 2BRBA 4GUBA 3HDNA 4O2PA 5JFVA 4CKRA 1H4LA 5G6VA 1E1VA 5ETCA 3UPZA 1I09A 4F7LA 4MWHA 1OPKA 1SNUA 1B38A 4DGMA 3LCOA 1YQJA 3DBFA 3B2TA 5JQ8A 4IAZA 1YXSA 1FVVA 1Y8GA 3L8SA 3H9FA 3LIJA 3CC6A 3MPAA 4NSTA 5A3XA 4FKRA 5HOAA 2EWAA 2OF2A 4S33A 3NUXA 3R1SA 5CVHA 3EQBA 3EZRA 4GH2A 4EOLA 4CXAA 3W0PA 4FK3A 3PVBA 4YZCA 4FT7A 5JGBA 4L53A 3BL9A 3PRIA 4IWDA 2PSQA 3GU5A 4RFYA 5FTGA 2PWLA 3ATTA 4QQ5A 5ACKA 4XUFA 4OW8A 4TY1A 5E8VA 2BAJA 3WF5A 3BLAA 3HL7A 5DOSA 3AQVA 3DZOA 4I41A 1XBCA 3ORMA 4UMTA 5HD7A 3UO5A 4OAVB 3ODYX 3EQCA 5HTCA 4TN6A 3GENA 3U4UA 4QYFA 3PVGA 2QO9A 5C8MA 2JGZA 5J95A 1MRVA 2PTKA 3EZVA 2W1CA 4FBXA 3F3VA 4RQVA 3ENMA 2FB8A 4C3RA 1KOAA 3IOKA 1VEBA 4FV8A 5CI6A 2CKQA 4R7IA 4H36A 2UVYA 2R3RA 3AOXA 2UW7A 2BZHB 2ITQA 2PY3A 2QC6A 4O82A 3TJCA 3VJOA 3BLQA 2WMWA 2YJSA 5F95A 4F99A 2JKKA 2ZV2A 3FKLA 4I5HA 4GRBA 4EJ7A 3VS4A 3SA0A 3W0MA 1PKGA 2OJJA 3F5UA 5GZAA 3R8UA 3CE3A 3U51A 1NA7A 4XNEA 5HBHA 3EQIA 2ETRA 3AMAA 2DS1A 3WYXA 2JIUA 4IFGA 2R3JA 2PVKA 3FY2A 4CEGA 5I4NA 2BRGA 5EK7A 4IANA 3VN9A 1UKHA 4DEGA 2WTKB 3POZA 5HCYA 4ZK5A 1KE9A 1YWVA 2BFYA 2ONLC 4DFXE 5J5SA 2JITA 1OKVA 4EH9A 2YM8A 2F4JA 4O1OA 2CN8A 4FSWA 3AGLA 4FZ7A 3RZBA 5LOHA 4ORKA 3AT4A 4F7NA 5AV2A 3DJ7A 2XRUA 4K6ZA 4EH3A 1XH7A 4AE6A 5IH5A 3R9RA 4UYNA 3B8QA 2WQNA 3PA3A 3LXLA 1H07A 4YURA 3IK3A 3OBGA 3QGWA 4WG4A 3OXTA 4K9YA 2XK6A 4CTCA 4EK4A 2R0UA 3DB8A 3UP7A 1XBAA 2XZSA 3CTHA 2C5NA 2WIHA 3IDPA 1B6CB 3IS5A 5E8XA 5D9HA 1RJBA 1FVRA 1VYZA 3UVPA 5DA3A 4NTSA 3THBA 3UNJA 3OBJA 4L7SA 4XYFA 3MVHA 4JQ8A 4EH5A 3DBQA 3BELA 3L9LA 4FTQA 5ANJA 3N51A 2GQSA 3F2RA 4OT5A 2OO8X 3N4VA 5BUIA 2YAAA 5IMEA 2C3KA 5GIPE 4B4LA 4DHZA 2PVRA 4X6QC 2I40A 2QLQA 3OT3A 1H08A 3QC9A 4ACHA 4AX8A 4E5AX 3CQEA 1KWPA 1Y91A 3E62A 5ANEA 1J91A 3C9WA 4CNHA 3RM7A 3W16A 4BN1A 4EHVA 1SZMA 1UNGA 1G5SA 5K3YA 3FSKA 3BQRA 5C1QB 3AG9A 3V8TA 3BGPA 3F5XA 1J7LA 3PJ3A 4C37A 4DCAA 3LXPA 4U7ZA 4YSMA 4Q9SA 1PYXA 4P90A 4HCTA 4G3GA 5CYIA 3QXOA 3E7OA 4G1WA 2EB3A 4PV0A 3DJ5A 3QTZA 5KHWA 4LOPA 2G2FA 4BCNA 1Z9XA 5M51A 4OR5A 1J3HA 1XMLA 3R9NA 4PQNA 4RC4A 5EM5A 5FBNC 3ORXA 4F0GA 1RE8A 3DQWA 3EQFA 4GK4A 4C0TA 3HKOA 3O17A 1JSVA 3K3JA 3ZFXA 2OKRA 4PNIA 3ERKA 4IQ6A 3Q9WA 2PUPA 4FI1A 4UWCA 2YZLA 3RAKA 4EQMA 3CEKA 4M0YA 5HO6A 5E7RA 3B2WA 3O7LB 5IA3A 3BV2A 3LFEA 3EQDA 2OW3A 2QURA 3BU6A 2WTIA 2X2LA 3A60A 5BVWA 3ZUTA 4DF3A 3E64A 3SW4A 4AGUA 4RA4A 4TYHA 3LXNA 1ZXEA 4O7SA 3QHRA 4F08A 2ITOA 4BYJA 2W05A 3ORLA 1PXOA 4FKUA 3BGZA 3T9IA 1XO2B 1Y57A 4BBFA 3ORPA 2VZ6A 3P7CA 3QWJA 2QKRA 3U4WA 3BU5A 4FGBA 4MTAA 3ZMMA 1TVOA 3VUMA 4C2VA 2O2UA 1CTPE 2YWPA 4HPUE 4NCTC 4WHZA 3TUBA 3HX4A 4LL0A 3Q04A 4FKQA 1GIHA 4M69A 3Q2MA 5JZJA 3HYHA 1NVSA 4WIHA 4XG8A 3NSZA 1QPEA 4O4DA 4RVTA 2ACXA 5CU4A 4O22A 3ALOA 4U79A 2F2CB 5L6WL 3V6SA 4USEA 3PSDA 2R7IA 1IA9A 1VJYA 4FZFB 1J1CA 4IWOA 3NMUF 3IW8A 1L3RE 3GOPA 3POOA 1JSTA 4EH2A 4O7ZA 3BEGA 1YXXA 4U44A 5FG8A 1UNHA 5H8BA 2R3PA 5CEQA 2PUNA 4RLKA 5AUUA 2IWIA 5A54A 4GFMA 4EQUA 2VWXA 4QMZA 3W1FA 4NKSA 3H3CA 2W99B 5DWRA 5GZ9A 4C4FA 4F7JA 2BAQA 4UWBA 3IDCA 4TWCA 5KCVA 4BY9E 3ZBFA 4AGDA 3TYKA 5DR9A 4NIFB 4BRXA 5CT0A 1O9UA 2CCIA 4NM7A 4CRLA 3NUUA 2A27A 1OL5A 3PY1A 2V22A 2IVUA 3KULB 4W8EA 2NPQA 5FBOA 3GUBA 1FOTA 4BYIA 3V51A 2B54A 1P5EA 4GIHA 5J9LA 2VTNA 5AAGA 2WTJA 2QONA 5L3AA 3TKHA 3DBEA 4V0GA 2XEZA 4XS2A 3KXHA 4NT4A 1HOWA 1OIYA 4O38A 4H3QA 2X2MA 4AFEA 5HLPA 3OFMA 3AD6A 4FSZA 3WZKA 5HKMA 2VWZA 2OH4A 4MBLA 4D4RA 1ZY5A 2SRCA 3BRBA 3KRXA 4FEQA 4GVJA 4EH8A 4FVPA 4IX4A 4C3FA 5E9EA 4OTWA 3A62A 4O84A 5AM7A 1OGUA 5IMXA 3MS9A 4MXOA 2IVTA 3ZH8A 4TNBA 4I6HA 2HK5A 5EI2A 4ZXTA 4H1JA 4S31A 4O4BB 4RFZA 4ZY6A 2OWBA 3CTQA 2FUMA 2UW3A 5M4UA 2X39A 4FV1A 5F9EA 2XK3A 5AM6A 5ANKA 1F3MC 4DDGA 4C3PA 3VS6A 3UMWA 1AGWA 3S4QA 3TKIA 4RWLA 4NFNA 4BKYA 3ODZX 2C6DA 1JBPE 1GY3A 2W1GA 3SV0A 3QGYA 5FXQA 3VF9A 4GYGA 3C13A 3U6HA 3R71A 1W2CA 3R1YA 4JDKA 4QP4A 3GVUA 4XP3A 3ZDUA 2JBPA 3DK6A 4ZJJA 1YWRA 2BVAA 3GCVA 4I23A 4KRDA 3F3ZA 4EWQA 2J0JA 4CQGA 4DGLC 3O5AA 4V04A 3IKAA 1X8BA 4X7QA 1YI3A 1DAWA 4DT9A 2CGUA 4FX3A 4DE4A 3K54A 1Q8ZA 4FL1A 4I94A 3P78A 2E9PA 3D0EA 4I6FA 2YACA 5TOZA 4XV2A 3D94A 2ITPA 3NUSA 2XIRA 3ZM4A 3TACA 4BTMA 3CS9A 3LFDA 2JAMA 2O65A 2PVNA 2VTOA 3ZEPA 4F9WA 2FVDA 4UXQA 2E2BA 4BDHA 5L2TA 3FL5A 2W9FB 2OJGA 4R77A 2X8IA 2XIZA 3FMDA 3RPRA 4M14A 5DR6A 3W10A 3KXNA 4MHAA 3EN9A 2I0HA 4FGRA 4FVQA 3GC9A 2P2HA 3QQHA 4IWQA 3BWFA 4HVDA 3HMIA 4QTDA 4RJ8A 4X2FA 4E5WA 1J7UA 1JNKA 2C6MA 2B9JA 4IACA 1PJKA 2A0CX 2XNGA 3AC8A 4L67A 4ZJVA 3VS5A 5GJDA 4IM2A 2W1HA 4L01A 5IEYA