4E5WA

Jak1 kinase (jh1 domain) in complex with compound 26
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
302
structure length
292
Chain Sequence
GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKNHIADLKKEIEILRNLYHENIVKYKGICTENGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK1
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 292
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e5wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e5wA01
5HTIA 3L8XA 5AUXA 2X6DA 5HE3A 1WAKA 3B8QA 4L3JA 4XG7A 3EQDA 4D4SA 4EORA 5HZNA 2UW3A 1H0VA 2E2BA 3DKOA 3LJ0A 4XBRA 3NVKI 1WZYA 5HG8A 4ERKA 4GU6A 4X2KA 3TCPA 3ZLYA 3RVGA 3QZIA 2IW9A 1IA8A 2WOUA 5CT7A 1BI8A 5F4NA 4E1ZA 3QCSA 1ZMWA 3Q4CA 3QKMA 4FTKA 4AT3A 4TXCA 3V5LA 2CLQA 3VBTA 5AAEA 4RGJA 3MA3A 4P5QA 4U5JA 2C0OA 4R78A 3TKHA 5EI8A 4L67A 4E4NA 3GQLA 4KRDA 4MBLA 1J7IA 4YC8A 3EQIA 4FZDB 3TZMA 5IZFA 4UB7A 2I0EA 4DFNA 3AMBA 3VUTA 3MESA 5HQ0A 2W9ZB 3KVWA 4K8AA 4LOQA 3CR0A 4CSVA 4JS8A 2KULA 4YSMA 2CKOA 4M0ZA 4DEAA 2JDVA 2R0IA 3OF0A 1H01A 5HIDA 3LFSA 1FVRA 1PJKA 5FP6A 2G1TA 2WTVA 4ZZMA 1UNHA 3M1SA 4KKGA 3BBWA 3DKCA 3ZSHA 2XEYA 2IW6A 4ZY4A 1BYGA 1OL6A 5DMZA 4K11A 5G1XA 1URCA 2B54A 3L8VA 5EM5A 3ORZA 2PVRA 1BUHA 2C4GA 3DBQA 4L8MA 4D4VA 5CYIA 3QTXA 3FLQA 5EDRA 4KBKA 4GH2A 5ITAA 3NPCA 3EJ1A 3VJNA 3LZBA 3UE4A 4BKJA 1GJOA 4BCQA 5E8SA 5HE1A 4O0XA 2BR1A 5HVKA 3DXPA 3PJCA 3NNWA 5C03A 4C58A 4UWCA 3VQHA 4FT5A 4FIHA 5KMKA 2OICA 2C3KA 2QR7A 3IS5A 2Q0BA 2ZV7A 5HO6A 3RWPA 2OI4X 4CYJA 2PVFA 5HCZA 3R0TA 2GQSA 5EK7A 2VRXA 2HK5A 2BCJA 2QG5A 1M2RA 4RG0A 2WMTA 1FVTA 3S3IA 4ZLYA 4AAAA 4UEUA 4D9TA 1H1RA 2A27A 5EI6A 4YZMA 5JRQA 3FXWA 1ZAOA 4WT6A 3QLFA 3HP5A 3R8VA 4Y8DA 3KMWA 2YFXA 4C2VA 1H07A 5EI2A 5C27A 4ZIMA 4NIFB 4AOJA 3GU7A 3FL5A 3PXRA 3SQQA 4CMTA 3CY2A 4ARKA 4F1TA 3ULZA 3O0GA 3IOPA 4FEQA 2XKCA 3DDQA 3GCUA 3H4JA 2C0TA 3MVLA 2OIBA 1I44A 1PY5A 2GNGA 3ZXTA 3ATSA 2IW8A 3PXZA 4J98A 4JG6A 3THBA 3AMAA 3Q4TA 3C4ZA 4GJ2A 3KGAA 4WSQA 1XWSA 4EQUA 3BV2A 5L4QA 5IA4A 3P7AA 4FIEA 3WI6A 4XH6A 5L8KA 2G2IA 2OJGA 3LHJA 3CTJA 5M4UA 3KXGA 2UZNA 5AA9A 5CEOA 2HY0A 4YR8A 1OKVA 4KS7A 4QP3A 3KXZA 4IAYA 3ZZEA 4E8AA 3DV3A 4GT4A 3OS3A 1SM2A 5AP3A 3ANRA 1DS5A 3C0HA 4RX9A 4ZSJA 2R7IA 2IVVA 4X3FC 5HCYA 4ZSGA 4ENYA 1PYXA 4C8BA 1M14A 3HUBA 4I94A 3RBWA 2VTTA 5IEYA 5TOZA 4WRGA 4O86A 3DTCA 5IQGA 2GTNA 3PLAE 1W0XC 5B2MA 4JR7A 4ALWA 3F3WA 3P08A 4RIXA 3W2PA 4AN2A 5CS6A 4BDDA 4C61A 5HG9A 2X7GA 4IX6A 4LGGA 2GCDA 2B9IA 4Y73A 3UQGA 3ZTXA 3COKA 2PUIA 2YDIA 3QTWA 4HOKA 3LLTA 1R78A 3NUPA 3QGYA 4DFBA 4D58A 3QXPA 3VRZA 4UZHA 3BWFA 4ALVA 1OIUA 3DJ5A 1JPAA 4F4PA 4GMYA 4TL0A 4WSYA 1EH4A 4OT5A 3FC1X 3DDPA 4QMUA 3E88A 3ZO4A 4MAOA 1JNKA 4C62A 4W9XA 2PU8A 3OUKA 4CV9A 5KKRC 2W5AA 4QMPA 5KE0A 2OBJA 4G5JA 4JQEA 3UNJA 3U9NA 4E93A 5EHLA 1ZWSA 2FYSA 3NUYA 2ONLA 2PVYA 2QOCA 4U42A 3MY0A 3R9RA 4M69B 1SNUA 4O0UA 2BTSA 4XOZA 3SX9A 2ZAZA 2I0VA 4MXAA 3H9RA 4J8MA 5CX9A 5AUUA 3LFEA 5LARA 2Y8OA 3SXRA 4GT3A 5JFVA 1Q8YA 4G34A 4YMJA 5TE0A 2HW7A 4UV0A 4L43A 3AXWA 1OVEA 3TV7A 4H58A 3DFAA 2BRGA 3E64A 3OBGA 2XIRA 2IZTA 3R28A 2B53A 2QOIA 4IBMA 2UZVA 4TWOA 2CKPA 4WNOA 3F7WA 2Y6MA 4G9CA 4BCGA 3A7JA 3FI2A 5AP5A 3JY0A 2F2UA 2W05A 4JL9A 1B6CB 2YABA 4O38A 5E8UA 5EM8A 2ETRA 4AZSA 5K4JA 2ITWA 4EK3A 4MWIA 4F6WA 5L3AA 4FK3A 2VWVA 2B55A 2O65A 4KIKB 4C4HA 4BWPA 4LOOA 3N51A 3PIXA 2X4FA 4DGMA 5LMKC 3VHEA 3GQIA 3KXNA 4XLVA 4X2FA 3TUBA 5CVGA 4LUEA 2OU7A 4JT3A 1V0PA 4CT1A 5LWMA 1XO2B 3R1QA 3Q6UA 4Y85A 3W55A 3QC9A 4FE2A 5J5TA 5IQIA 2HIWA 3TG1A 4D1SA 5IH6A 2UVZA 2CSNA 1Q61A 4W4YA 4M0YA 4II5A 3BHYA 5M53A 1IG1A 1VR2A 2OF2A 4NK9A 3NNVA 4RC3A 5DLSA 3U87A 5KMJA 1P4OA 2QLUA 3S1HA 4YHJA 3W1FA 3VS3A 5DN3A 3KULB 2CGXA 3QWKA 4PNIA 5E8TA 1Q97A 4D1XA 4JXFA 2B9FA 4O81A 4FTRA 4FL1A 2QHNA 2XUUA 4DFZE 1M17A 2QOQA 2ZMCA 3D7TA 3E3BX 2BALA 1YDSE 1J91A 1OKZA 2JFMA 4BVUA 3VUIA 4GIIA 3MB6A 1ZZLA 4O7NA 4FV0A 4G6OA 1QCFA 3OTUA 3SHEA 3KRRA 3ZO1A 1Y57A 3MH0A 4GVAA 4QP4A 2P2HA 1PXOA 5FWKK 4G3EA 4G16A 5LMBA 3UO6A 4X2GA 2UVYA 3RM7A 1IA9A 1HOWA 4RT7A 4B4LA 1PXPA 4LI5A 3LMIA 2H96A 1JWHA 4A07A 3LXPA 2G2HA 4ZTHA 2XNMA 2JBPA 2BVAA 3N9XA 4FKLA 3RZFA 5A54A 5IEXA 2I0YA 3N4TA 5IQFA 2WMVA 1JBPE 4XRLA 1YXUA 4JIKA 3R1NA 2DQ7X 4LM5A 4S31A 4R8QA 2ZM4A 3ID6C 2YHVA 3OEZA 4CKRA 3F9NA 2WMQA 3QGWA 4S32A 5IUGA 3BYMA 5KKRB 5CVHA 2ZVAA 3RNIA 3EZVA 4W4XA 5J8IA 3FPQA 3MB7A 4IDTA 1UNLA 4O84A 3T3VA 4BCFA 2OK1A 5TO8A 2W0JA 4ERWA 2VNWA 2I0HA 3BU3A 3QUPA 1RW8A 1YKRA 4HCVA 4PRJA 4AW5A 3RZBA 4CFVA 5DT0A 4ANLA 4I93A 4QTCA 4BF2A 4OW8A 5E8WA 5BUEA 2SRCA 3QRJA 3REPA 4BDAA 4ANOA 5CSWA 2JDSA 1MQBA 2R3IA 4QYGA 3ZO3A 4RQKA 4UX9A 4YHTA 2OZAB 4FKWA 2WMXA 2Y7JA 3MH2A 5HNIX 4R7BA 4L53A 2XNEA 3OMVA 4QD6A 3CP9A 3QA8A 3ORNA 1T46A 4GU9A 3SKCA 3W16A 3Q52A 3V6RA 4CT2A 2O63A 5AM6A 2QOFA 5FBOA 3BZ3A 4DLIA 3EN4A 4FNZA 3MFUA 5IUIA 5C9CA 4ASEA 4MBIA 3BGZA 4O1PA 3EN7A 4U45A 2RFDA 4BTJA 4NIFA 3BYOA 3MTLA 4FTTA 5LVMA 1H28A 3EYHA 4IFCA 3SG8A 5M09A 2YJRA 3EFLA 3IOKA 3QALE 4I6BA 4MQ2A 4OR5A 2CNVA 5AUWA 3QHRA 5HCXA 2PULA 2QC6A 3SAYA 4YO4A 3ODZX 5T68A 2QO9A 4PDYA 1FGKA 3C51A 3FMMA 2Z8CA 1PMUA 2JAMA 4WUAA 5EHOA 4BBFA 4DFYA 2ITVA 5L6PA 1J7LA 1U4DA 2JIIA 5CU3A 3LXNA 3QHWA 4UMRA 2ITUA 5DFPA 3CKWA 4QTEA 3ITZA 1URWA 3EFJA 1ATPE 4YLJA 4CFUA 4C37A 4PPBA 4JOAA 5DNRA 2QQ7A 4EK8A 3MH1A 3VWAA 4PMMA 2C6KA 4RVLA 3A4OX 3MFRA 1PXIA 2GDOA 5FXSA 4NWMA 3DZOA 2C0IA 5ETCA 2C5YA 4CCBA 4RIYA 3LKMA 2R3LA 3BU6A 4B0GA 2QU5A 3DY7A 3Q9YA 2PZRA 4HVIA 4GK4A 3CE3A 4QQCA 5FEEA 2W1EA 1YVJA 5A46A 1Y91A 5K4IA 4D4RA 1BX6A 3D9VA 1OL5A 2UW7A 2C5NA 2XCHA 3F82A 4USDA 3UIXA 2X6EA 4IAAA 4DHFA 5BNJA 5L2WA 5C8KA 3QYWA 4BWKA 4EUUA 1UV5A 2I7QA 3HMIA 4HYIA 3V5JA 1B39A 2BHHA 5BUIA 3RHXA 5HNGA 4A7CA 4C4JA 3BPRA 5K9IA 2Z2WA 2WQEA 2W1ZA 3VS2A 1OL7A 2P33A 3QKLA 3LFDA 2VO7A 4K9YA 4NU1A 4TWPA 4KNBA 4I92A 3DCVA 3KF4A 1OKWA 3OFMA 4O82A 1H27A 3LXLA 5FG8A 4AN3A 2ZDTA 3ZDUA 4BDJA 5B2LA 2YCRA 3H10A 4EK6A 4EKLA 3JUHA 3TN8A 4MBJA 4BCJA 3DK3A 3DGKA 3ZUVA 3P78A 3VULA 4QT1A 4EH2A 4I4FA 1ZARA 2OXDA 2R64A 4GIHA 2PUPA 5FM2A 5I5ZA 4HVSA 2B7AA 3UPXA 3BE2A 4HZRA 4M69A 3KCKA 1RJBA 1ZOEA 4ZEGA 4EKKA 2IZSA 3KREA 1IEPA 4FV7A 5FBNC 3UIUA 1OIQA 4ZTQA 3K2LA 3UYTA 4FSTA 2EVAA 2W1FA 4IADA 3ZZWA 2C6LA 3R02A 2FB8A 5JH6A 5LVLA 4QPAA 2V22A 4M97A 3FKNA 3E8NA 5KO1A 4JAJA 3TNPC 3MSSA 5AR3A 3AC1A 4PDOA 3VRYA 3KRLA 3ZFXA 5K0KA 2XM8A 4AWIA 2W1CA 3MYGA 4RBLA 4U43A 4P5ZA 4FICA 1OUYA 4QMLA 4NTSA 4R3PA 3E92A 3GC9A 3W8LA 5JZNA 4PY1A 3NW7A 3R9OA 4H05A 5CENA 4EH5A 4O0TA 5J79A 4NKAA 3LFQA 3C1XA 4DCEA 4BGGA 5HG5A 3IW4A 4RLKA 3V51A 2CNUA 3OY1A 1YI4A 3CQEA 3FMDA 4YC6A 2NPQA 4G2FA 2EB2A 2XEZA 3OC1A 1XH9A 2JEDA 3EQRA 4KIKA 4O96A 4WKQA 4O0VA 3LMHA 3KFAA 3PP0A 1CKPA 3QFVA 4A4LA 3CQWA 3NNUA 3HVCA 3GFEA 2EUFB 3FE3A 4MH7A 4F64A 2OJJA 3SOCA 4FKUA 4GFGA 3MGYA 4DH1A 5J9YA 3E3PA 3MS9A 2BIKB 3VC4A 4QMZA 2AC3A 3VQUA 2IVSA 4XS2A 3UOHA 3DXNA 4DINA 3R7OA 3VS1A 3KQ7A 3HUCA 4IB1A 4PDPA 4F9BA 1Q3WA 5IA5A 2PZ5A 2VWIA 2XRUA 3WARA 4U9AA 5GIOE 1ZZ2A 3G6HA 4NM5A 2PYWA 1WBPA 5H9BA 3QYZA 2DUVA 3RPVA 4U80A 4X3FA 3NAXA 3W2QA 4ORKA 4ZTSA 3KULA 3DS6A 4FSMA 4I0SA 3NR9A 5EYKA 3WYXA 3ZLWA 4A9TA 1GIHA 5GNKA 4AE6A 4CQEA 3IDCA 1Q62A 3TM0A 3QU0A 2VTLA 3P9JA 3I1AA 4GRBA 1P14A 2JLDA 4J53A 4FKJA 4QP2A 4FTAA 2WD1A 4KS8A 5CNOA 2B52A 3P1AA 1YHWA 4YSJA 4O91A 3W18A 4IDVA 4FOCA 1Q3DA 4O7WA 2VTNA 1Q8UA 4DLJA 5B7VA 5FP5A 4XX9A 5HBJA 1OL1A 3QRUA 4FSNA 2C68A 3TDVA 1JSTA 4FKIA 4AA5A 4JDHA 2UVXA 3JVSA 2YIQA 2W4KA 4GG5A 3ZS5A 1SVHA 3ZDIA 1H26A 2QO7A 5H8BA 2O5KA 1W84A 2A2AA 3TTIA 2VWUA 3FQHA 3ZRLA 5AV1A 2BIYA 2C6OA 5CU4A 4IW0A 4FTUA 4PF4A 2YLFA 3OY3A 4F6UA 2WIHA 4FG7A 2PMNX 1V0OA 4YJTA 3ENHA 2IWIA 4CFMA 4D28A 4K0YA 2IZRA 4FSQA 4BIBA 4RIXB 3C4EA 1TQMA 3AC8A 1H8FA 2REIA 3PFQA 5E91A 2FSLX 2VGOA 4FVQA 2A19B 3DAEA 3PPJA 2R3QA 3ALOA 3GOPA 5AEPA 4RPVA 2BZJA 1Q4LA 5F1ZA 4HCTA 4IZAA 4LL0A 4CZUA 3AGLA 2YCSA 4M3QA 3VBXA 4R77A 4D2VA 3I7CA 2C6EA 4BCNA 2WEVA 2PZIA 4GEOA 4MF0A 1FBNA 4X21A 1B38A 4WIHA 1RDQE 3QQHA 4FTQA 2PVJA 4WO5A 4BWXA 3I0OA 4YTFA 3UNKA 3BBTB 3R7EA 2J0JA 3QQFA 5JN2A 2OF4A 2Q83A 3A60A 3IW5A 4TYGA 4RMZA 5EKNA 1YW2A 5LMKA 3FZSA 2Z60A 3C5UA 4GFMA 2GQGA 1S9IA 4FKPA 4J7BA 4TZRA 3L9NA 4D4YA 5A4QA 4AZTA 4EZ5A 2DWBA 2DYLA 5CAOA 3GVUA 5AIKA 1F0QA 2JDTA 3NDMA 3ORMA 4FKTA 1K2PA 5E8XA 3A8XA 4EZ3A 4FV8A 4XCUA 2VU3A 3C9WA 3KEXA 4NSTA 4CYIA 4Z7HA 2ITZA 1O6LA 4MNEA 3VUHA 4RJ8A 1OPJA 4JQ8A 3UQCA 3MN3A 2XKEA 2H9VA 2NNWB 3SXSA 3D5WA 2FGIA 5D1JA 2XJ1A 5CTPA 2E9UA 3LFAA 4L3LA 4NJDA 4BDCA 5HLNA 5CT0A 4FG9A 4TNDA 1WBSA 5M44A 3NAYA 3JY9A 4FZAB 4TYIA 2VWZA 3PIYA 4M15A 3DK7A 3D2IA 3I81A 4QYHA 3IG7A 4EOJA 2C3IB 4IFGA 4CG8A 3LOKA 4D5KA 4USEA 5J9LA 3CD3A 4FKSA 1F5QA 5EHYA 4TYHA 3GC0A 4NW6A 1WBWA 4Y5QA 2QHMA 4U8ZA 5DEWA 5E1EA 5AA8A 5JT2A 4ZTNA 2J0LA 4TYEA 1YI6A 3A4PA 5LJJA 1MUOA 3E62A 3WYYA 3DT1A 1BMKA 2C47A 3PPZA 1U5RA 4OAVB 2YWPA 4EH8A 5HX6A 5FXRA 3PVUA 3D15A 3MA6A 4U7ZA 1GZ8A 1Z57A 1KE9A 1NA7A 3T9IA 1FMOE 4BZDA 1QMZA 2YN8A 2UZBA 5IMXA 4AZFA 2PUUA 2WQBA 3S4QA 5J5SA 4A9SA 4FT9A 5DRBA 3VBQA 2Z7LA 3G51A 4K2RA 2ITXA 1ZYCA 3G0EA 4G31A 4L44A 4F6SA 5BVEA 3SW7A 3EQCA 4F0GA 4MK0A 2G9XA 2QONA 2UW0A 4CVAA 5DEYA 3LM5A 5T6KA 4CTBA 3D7TB 3G9LX 4QNAA 4U79A 4AZEA 1NT2A 2R3OA 3CBLA 4DTAA 3GENA 3DQXA 2Z7RA 5BQ0A 2JDOA 1M2QA 1UKIA 2QI8A 3G33A 4J52A 2LGCA 4YZBA 3HMOA 4EHEA 4IZYA 3MH3A 5GIPE 3FL4A 4FOBA 5BVKA 5G6VA 4HZSA 3MPTA 5J7BA 3R21A 4RIWA 5HO7A 5I9ZA 2GNJA 4JG7A 4IWDA 4L45A 4L52A 4YO6A 3VAPA 5FXQA 1VZOA 4AW0A 2XNNA 4RC4A 4A9YA 5IDNA 1ZYJA 3R2YA 1BKXA 4IVBA 2ERKA 4A4OA 4BI1A 4RRVA 3H0YA 2B1PA 1KV1A 1Y6BA 2VD5A 5BX0A 3GNIB 1PXLA 2XVDA 4MYGA 4EJ7A 1H1WA 5EM6A 1LPUA 2YIXA 4EK5A 4ZTMA 3HV4A 3PXQA 5JKGA 2XA4A 3NWWA 3TXOA 3TKIA 4APCA 5LOHA 3ENMA 3QRKA 3FLYA 3LW0A 4EWQA 2IVUA 2C5XA 3LFFA 4UXQA 1DAYA 2X7FA 3FSFA 4OTDA 1YI3A 1GIIA 3PWYA 2XKDA 2IJMA 3EKKA 2NP8A 3IPHA 3MPAA 4FEUA 1K9AA 1ZYLA 4Y95A 2FO0A 2NRUA 2AC5A 4RX7A 1G5SA 3UDBA 3MY5A 4GUEA 5E8VA 2RKUA 1JOWB 3EHAA 4W8EA 4CMOA 2CCIA 3MI9A 4IM0A 1WFCA 1PYEA 3R7GA 4FNWA 4ZLOA 5J1VA 1Y6AA 3QL8A 5HTCA 1MRUA 4WUNA 4UN0C 1U59A 4J97A 4XG9A 3RPYA 2WMWA 4Y46A 3BEAA 1CM8A 4G6LA 2F9GA 2VX3A 4LFIA 4OUCA 3RCJA 3GFWA 4FT0A 4EONA 3ZFMA 2X8DA 4EOOA 2LAVA 1V1KA 2QVSE 3NUUA 3CTHA 4QMMA 3OXZA 3R83A 3QD2B 3WBLA 4GS6A 4GT5A 3Q9ZA 4F99A 3L9PA 3UOJA 3F5UA 4RLLA 4X6QC 1OL2A 5CI6A 4WG4A 4KSQA 2E9OA 4IB0A 4C35A 4QMSA 5IF1A 1ZRZA 2VTJA 4C36A 4FSWA 1JVPP 5CF6A 3OW4A 3G2FA 5FLFA 2R3FA 3NW5A 1ZXEA 5HE2A 4QMOA 3WF5A 3HGKA 4E4MA 4R1YA 2X7OA 5KUPA 4NYEA 3HRFA 3PRFA 4WHZA 2OGVA 4AUAA 3QTQA 2HYYA 2JIVA 2QOLA 4PTGA 4YHFA 5AUZA 2WMRA 5F94A 3QTSA 3VS5A 1KE8A 2RG5A 3PPKA 1RQQA 3EOCA 3OXTA 4YJQA 5BVDA 5C1QB 5E90A 3R30A 4CXAA 2VZ6A 4FTLA 4DGNA 4OGRA 4C3PA 4E4LA 1WBOA 4QYFA 4XNEA 5AJQA 1LUFA 1YXSA 3TJCA 3W10A 2JDRA 4G6NA 2GHGA 4RIYB 1PMEA 3BGPA 4EOMA 3DXQA 4OTIA 4Y72A 4I1ZA 1W83A 1Q8ZA 5DIAA 3UG1A 3PLSA 5DOSA 4C4IA 4AGCA 1U54B 5LCKA 4D2WA 2PVLA 4OTPA 3BQRA 4EH6A 4M7IA 4HPUE 4RJ4A 3Q32A 4I6HA 5K5XA 2XK6A 2ESMA 4JAIA 4TN6A 4ENXA 2PZYA 1REJA 4TWCA 3QRTA 3A99A 4UY9A 5L8JA 4QP8A 3HMMA 3R8PA 2BDJA 5DR2A 4R5YA 5JFSA 3RPSA 5LVPA 2I6LA 3SD0A 2F57A 5JK3A 5IQBA 3QAME 2R4BA 4QMYA 3KA0A 5EYCA 3KN6A 1MQ4A 4PMSA 2Q0NA 4FTCA 4BDHA 3GCQA 5EKOA 2W4JA 4O2PA 3FI8A 1CDKA 4H3BA 3RAHA 2H34A 3QTZA 1JKSA 2Y0AA 4O0RA 3RCDA 4DH3A 3N4UA 1A9UA 2J2IB 4DGGA 2WXVA 3R01A 2XF0A 3RWQA 3TEIA 3UIMA 4HNIA 3F5GA 4BCPA 4UMPA 1CMKE 4V01A 1UU9A 3FMHA 3NYOA 1DI8A 1ZYSA 2RFSA 4ACMA 2GNHA 4KA3A 1GZNA 3EMGA 5AADA 3ZONA 4HGLA 3CEKA 1QPJA 4D1ZA 1VYZA 3I0QA 3DTWA 4F9CA 5FRIA 2P55A 3LE6A 3D14A 4CCUA 3DBFA 3VBWA 3ZEWA 4FGBA 5FTOA 4C0TA 2WQNA 2BTRA 1X8BA 4USFA 2V7OA 3I4BA 5K0XA 3C50A 2YM3A 4FTMA 4D9UA 3AT2A 2BFXA 3E7OA 4GUBA 3NSZA 1PXNA 2RGPA 3E63A 2ERZE 3C4CA 3HLLA 4H1JA 4X2JA 5F20A 2YERA 1Q5KA 3COMA 3KCFA 5KBRA 4AN9A 3UNZA 3MTFA 1H4LA 1IR3A 3R8MA 4DFUA 2CGVA 1RE8A 4ZSAA 5LMAA 3C4XA 3MVJA 4JJRA 3W2SA 4DH8A 1IAHA 2O0UA 2EXEA 3GC7A 2BZIB 3OT3A 4FSZA 2R3GA 3UP2A 3I6UA 1KOAA 5IU2A 3R73A 3PSBA 4J95A 1G8AA 2PPQA 2VV9A 3QX2A 4RJ6A 4BDBA 4YJUA 4ZY6A 3UODA 4IXPA 4XG2A 4LMUA 2ITPA 1YHSA 3FMNA 3PXYA 4FNXA 4ZJJA 4O7YA 2HOGA 1ERKA 4FUYA 2PSQA 5TT7A 4V0GA 2Z02A 5D9HA 3PP1A 2VO0A 3MWUA 4QTDA 4BI2A 3BE9A 4S33A 1YXXA 3SLSA 4XRJA 2XM9A 3UZPA 3VBYA 3R8LA 3KL8A 4QPMA 3LLAA 3UYSA 3MY1A 3IW8A 1PF8A 3KB7A 2ZYBA 5M55A 1NY3A 4ACHA 4FIFA 2W1DA 5BMMA 4MKCA 5I0BA 1O9UA 3AG9A 4IC7A 4TTHB 3TZ9A 2OO8X 3C4WA 5ANOA 3ZFYA 1TVOA 4FVPA 4FV6A 4MXYA 5GZ8A 3VF8A 4FEXA 4X3FB 4GG7A 3WF8A 2R3KA 4BFMA 3K3JA 4C57A 4OT6A 2IPXA 2XZSA 3QZHA 4IZ7A 3F88A 3FZPA 3HL7A 4DEEA 2A4LA 5E92A 3EN9A 5CAPA 1FPUA 4J96A 3KF7A 3A7HA 4JBQA 1YWNA 1I09A 3IO7A 3LXKA 4AG8A 4FI1A 3C13A 1T45A 4QO9A 3G5DA 5EYMA 5ANGA 2FSTX 3IGOA 3HAMA 2HZNA 1PW2A 2OWBA 3MBLA 3OWJA 4CG9A 1VEBA 3EFKA 1XH6A 2YIWA 2ZM3A 3BHUA 4E6CA 3BHTA 3GU8A 4DH7A 2R7BA 1YOLA 2J51A 3BHHA 2UZOA 3UMWA 4RWJA 5AAFA 1UU7A 2WELA 5DGZA 4I5HA 4RWKA 5HORA 4H3QA 1PXJA 5IISA 3KN5A 3DKGA 4B7TA 1CTPE 4QQJA 1Y8GA 1JLUE 4LQMA 2Z7SA 2JITA 4RFMA 3ZYAA 5HVJA 1J3HA 3TT0A 3BLQA 3FDNA 4EUTA 3K54A 5HVYA 1OGUA 3GCVA 3ORPA 1XBBA 4AGDA 3U4WA 4YLKA 4DYMA 3RK9A 3C0IA 4W4WA 4BGHA 2XNOA 3LCDA 4O0WA 2FH9A 1W98A 2C6DA 4NH1A 4O2ZA 5FQDC 3KK8A 3LMGA 4HVGA 3U6IA 4L46A 2X39A 3V6SA 4AGWA 1WVYA 4AQCA 2WU6A 5L2TA 2DS1A 4KWPA 5CQWA 4QTAA 5D11A 3GU5A 4DEIA 2GFCA 4IAIA 1BL7A 4FT7A 5AR8A 5M07A 2VTRA 3DQWA 3HMPA 4KRCA 4F9YA 5DVRA 3ATTA 5M08A 5DI1A 3QF9A 3F7ZA 2UZWE 4YBJA 1K3AA 3TDWA 3FV8A 3QWJA 4X0MA 1G8SA 4EEVA 1ZY5A 4DGOA 4Z16A 4WNKA 3U55A 2ZOQA 3DJ7A 2WIPA 3BLHA 1E9HA 4LL5A 5DYJA 3B2TA 3WF6A 2XK7A 2BPMA 2HXQA 1H1SA 3BU5A 3UVRA 4EYJA 4E26A 1JSUA 1H0WA 1Y8YA 5TR6A 3AT3A 3W2RA 3SRVA 4D5HA 2R3JA 4WBBB 1ZLTA 2X9EA 3FY0A 5KHXA 4NJ3A 3NVMB 4DCAA 1JQHA 2YCQA 3EH9A 3DLZA 5LVOA 5TF9A 4U0IA 3NRMA 4YPDA 1TQPA 5KMIA 5CEQA 4AT4A 4O7RA 3KRXA 3R7YA 5CSXA 4CMUA 4B9DA 3ROYA 4O83A 2Y4PA 3PE1A 4F63A 4Z55A 2UW4A 5IQCA 4F7LA 2ZJWA 1UA2A 4MNEB 3ACJA 4I21A 5CU6A 3OOGA 2YAAA 5EYDA 1OITA 2YITA 2XYUA 4NFMA 4F09A 3JYAA 4HNFA 2C6IA 4F7JA 5CQUA 1H08A 4BTMA 3IECA 1U54A 3PA5A 2OLCA 3DJ6A 4WD5A 5FEDA 1BLXA 2OFUA 2VUWA 3GBZA 3CJGA 3IW6A 3GT8A 4IWQA 5K3YA 1H25A 3UIBA 4FR4A 3ZUTA 4YBKA 5LCJA 5HX8A 2BAKA 3NCGA 3F2AA 5A6NA 4AP7A 1PKDA 2V55A 3UTOA 5JQ8A 4FTIA 2E9NA 2YM7A 4JNWA 5HEZA 3B2WA 3FKOA 2EWAA 3ELJA 2WTIA 4FTNA 5CI7A 4Z9LA 4TYHB 4YTIA 4CKJA 2XH5A 4BYIA 3BI6A 4OBOA 5FUTA 3D0EA 4OTFA 3L8SA 3U54A 2RG6A 2IO6A 2E9VA 2HELA 2WGJA 2XIYA 1PRYA 1ZYDA 4AZVA 4YZCA 4L3PA 2IN6A 3ANQA 4BHZA 3FLZA 5HOAA 4BIEA 4BGQA 1OB3A 5I9YA 5HU3A 1P2AA 2W1HA 4RJ5A 3TNIA 4ZY5A 4DT8A 3HV7A 4AF3A 4W9WA 4ZK5A 5CU2A 3NUXA 4U40A 3OWKA 3AC5A 4LG4A 4LGHA 2C3JA 5JFWA 4DTBA 4FKOA 3PDTA 2CLXA 4FUXA 4FV3A 3EFWA 4WNPA 4WRSA 1UWHA 5AP2A 3W32A 5I9WA 4IX3A 4CD0A 2YLEA 3NUNA 4G9RA 3TNWA 1PHKA 2HENA 4FIGA 1QL6A 3MIAA 3O8UA 3EQPA 4QMQA 1IAJA 2UZDA 2VAGA 3FZRA 4G3FA 3UG2A 4IH8A 2OJ9A 3OXIA 4XP3A 4RIWB 3EQHA 4F7NA 4ANMA 3C5IA 3O8PA 3NLBA 2FA2A 3EN5A 3GGFA 2OH4A 4EQMA 3BELA 5KCVA 1JKKA 3DAKA 5AR7A 4O21A 3V01A 3CXWA 2XIXA 4FX3A 4KBAA 4U6RA 4ZS4A 4PTCA 3RJCA 4KABA 4ZZOA 3OVVA 2GU8A 4Q5HA 4F7SA 5TKDA 5A4CA 1J7UA 3DBCA 2BMCA 3PVBA 3ZLXA 4C2WA 4S30A 3EB0A 4DN5A 3UOKA 4IB5A 3ZXZA 5AR2A 4AOTA 4YNOA 3ORIA 1BI7A 5CWZA 4EOPA 2BFYA 2YZAA 3ERKA 4BKYA 1NVSA 4O7ZA 4I20A 4DEDA 2JC6A 2WEIA 3CS9A 4IVAA 3KU2A 3I7BA 4NFNA 4OLIA 2YM6A 4C4FA 4FIIA 3UO4A 3OCSA 4M13A 1YWRA 3VS4A 3FKLA 2J4ZA 4AFEA 4ZAUA 2GFSA 3DK6A 4IC8A 5DE2A 4IX5A 4NUSA 2XS0A 2QNJA 4TKSA 5DR6A 4YTHA 1L3RE 3PJ2A 3FAAA 4IHPA 2HZ4A 3R63A 1WVWA 5DBXA 4EJNA 1KV2A 4N6YA 1J1BA 2QLQA 2HWOA 3KXHA 3GCPA 2VTAA 4DG2E 4ZTRA 5HI2A 4Y5HA 3KRJA 5CZHA 4DF3A 4O7TA 3WZDA 3PG3A 3WE8A 5AP0A 2BAJA 3RK7A 4BDGA 3QXOA 3PWDA 1O6YA 5F9EA 3SA0A 2QD9A 5ETAA 3KC3A 3WF9A 1OKYA 5EH0A 2YISA 4XLIA 2WPAA 3M42A 1SMHA 4J8NA 3O23A 2CHLA 4RQVA 1LEZA 1OMWA 4FYNA 4PMTA 4QMXA 4IWOA 4W8DA 4XMOA 4HVDA 5KHWA 4AFJA 4N4SA 2GPHA 4S2ZA 5GINE 1ZMUA 2GNFA 3S2PA 1S9JA 2X2MA 2ZMDA 3TV4A 5IQEA 2VX0A 5DT3A 4F0IA 1A06A 2FVDA 2J5EA 3FMJA 4ZS0A 4YLLA 2Z7QA 5IA1A 2XK3A 5L2IA 5A14A 3CSVA 4JG8A 5IPJA 3WZKA 2XBAA 2UW6A 3A7FA 4LMNA 4NEUA 3VHKA 4YU2A 4UXLA 3LFBA 3CGFA 2GHLA 4UYAA 5EW3A 3OG7A 5IQDA 3P7CA 4G3DA 5DHJA 5JMSA 3TNHA 1Q24A 2WKMA 4L42A 4FKRA 3EWHA 3Q60A 2W96B 4GW8A 1H1PA 4I5PA 4WG5A 4M12A 5F95A 4PP9A 4RVKA 3II5A 2JFLA 3M11A 3MVHA 3UZRA 5BYYA 4FMQA 4LRKA 3WF7A 1XH7A 3PJ8A 3R9DA 4CFFA 4DFXE 2BKKA 3R04A 3W33A 3HV3A 3TTJA 4BBMA 4PL5A 5I4NA 5HLPA 2CNQA 3FHRA 3TIZA 4DG3E 4BN1A 1ZOHA 3UOLA 4IANA 4E6DA 2X1NA 4I23A 4H3PA 4R3CA 5ACBC 4BHNA 3NYXA 2WMBA 1XH8A 2WQOA 3VUDA 3FLWA 4RFZA 2A1AB 3CKXA 2G15A 4GYIA 1XH4A 1ZY4A 1SYKA 2WTJA 2C69A 3PA3A 3VO3A 5AR5A 2V7AA 2QOOA 4TNBA 1MRVA 3R8UA 2WQMA 1ZMVA 3BHVA 1WBNA 2X2LA 2YDJA 2C5OA 2JKMA 3LFCA 3PJ1A 4YNEA 2JKKA 3QZFA 4IZ5A 4EHGA 1A48A 4U97A 2H6DA 5EQYA 2ITOA 2ZB0A 2WTKC 4HGTA 5AV0A 2P2IA 3HV5A 4YC3A 3FXXA 5AP4A 3R7VA 5AV3A 3GUBA 3MW1A 3PY1A 4DC2A 1VJYA 5AUVA 4CFNA 3I5NA 3QX4A 2ETKA 3FQSA 3VBVA 5M06A 4C4GA 3I6WA 4QMWA 1OPKA 3Q4UA 4PTEA 3C7QA 3VUMA 2IVTA 1KSWA 5HD4A 2OFVA 5BMSA 4FYOA 3ORKA 4XV1A 2BUJA 2XIZA 2PVKA 3FUPA 4XEYA 2VN9A 3TUDA 2X0GA 2YM8A 3PVGA 3VS7A 4KUJA 3AD6A 4ZMEA 3LQ5A 5CXHA 5DG5A 2WTCA 2C6TA 5HLWA 4WA9A 4BCHA 1ZOGA 4OBPA 4MXZA 4QNYA 4L6QA 3QQKA 1DAWA 2W99B 4R1VA 4BDKA 2XJ0A 4E20A 4F70A 2B4SB 3GU6A 3O17A 3QTIA 4WG3A 1OPLA 3ZMMA 5HKMA 3D5VA 3UP7A 2YACA 2VTSA 4FV5A 1R0EA 4AGUA 4EOIA 4JDKA 4FIJA 2F7ZE 4CFXA 3N4VA 5CLPA 3FYKX 4MXCA 3FJQE 4V0GB 4UMUA 2R3MA 3A2CA 3PIZA 5AP1A 4BDEA 2HXLA 3QZGA 2ZDUA 3DKFA 3FZ1A 2VWXA 3L9LA 4I6QA 2BRNA 3P79A 3O51A 3QUDA 4FKGA 4A06A 4ITJA 3JR1A 1OBDA 4EL9A 2G2FA 3HEGA 4IVDA 5EDQA 4DH5A 2JGZA 2X8EA 3TKUA 4FTOA 3BV3A 4FV4A 3SOAA 5GZAA 4NCTC 3NYNA 3QD4A 4FG8A 1OIYA 4JX7A 4HGEA 4KB8A 4AW1A 1V0BA 3LCOA 3PTGA 1Z5MA 3GEQA 4CGAA 3RKBA 5JEBA 3OCTA 3ZM4A 1YQJA 3OZ6A 1FQ1B 3IK3A 3U6JA 2KTYA 1H00A 3POOA 4NM7A 4NT4A 1WMKA 2R3PA 4AX8A 4Z3VA 5A4TA 2W17A 4E73A 5M57A 2XKFA 4A9RA 4PP7A 2WTWA 4PQNA 3F3UA 5HNBA 4HYSA 3VF9A 4XG4A 2CN5A 3IONA 3QA0A 5AUYA 2NRYA 4JR3A 4IAKA 1UU3A 5CVFA 2O2UA 3CCNA 4K1BA 5I3OA 5J87A 4AACA 1KE5A 3V5WA 4G3CA 3WIKA 4KBCA 4BI0A 5AM7A 4UMTA 2OH0E 3ZCLA 2HY81 5IMEA 4FZFB 4BY9E 3P4KA 5GJFA 5HTBA 3OBJA 5LQFA 1YWVA 3RPOA 4FKVA 4TRLA 4ANBA 4EK4A 4ZJVA 4KIOA 2XP2A 3DBDA 3TJDA 4CNHA 1KOBA 3E7VA 4MNFA 4HYUA 4LV5A 2XK4A 3NS9A 4PV0A 4F65A 4FV9A 3UZTA 4RA4A 4I0RA 5D7VA 4JRVA 4BDIA 3KMMA 1DI9A 3NMUF 2Y4IC 4AS0A 4R5SA 2CMWA 3BCEA 4JI9A 2WTKB 2RL5A 4MD7E 5EDPA 4XV2A 4G1WA 4F9WA 5CEKA 4DEGA 3KMUA 3UVQA 4MEDA 3FMKA 2PWLA 4YUQA 4A4XA 4IAZA 2X81A 3R2BA 5ETFA 3WIGA 2ZV9A 4DEHA 2J0IA 3VW8A 2W1IA 3F5XA 4CEGA 5EOBA 4RSSA 1L8TA 5IH5A 4I5MA 5GJGA 2BDFA 2VO6A 2HZIA 4DGLC 4PNKA 4KKHA 1J1CA 4ANSA 4YZ9A 5M4CA 4P7EA 4DT9A 3QQLA 3MJ2A 5AFVA 1WCCA 5KNJA 4F9AA 2OJIA 4H36A 2PMOX 4GVJA 3QCQA 4FEWA 3D5UA 3F2RA 5KMMA 1AD5A 5CAQA 3MDYA 3Q3BA 3F2NA 4E5WA 2X8IA 3PRIA 4B8LA 1W7HA 3EZRA 2ITQA 3I79A 4XV9A 3RTPA 3ZEPA 3FXZA 5BPYA 4O27B 3FYJX 4MHAA 1WVXA 4PL4A 2BZKB 4RWIA 4N70A 4YJRA 3ZC6A 2CKQA 2WNTA 3ORXA 4FSUA 5GHVA 2XMYA 5CEIA 4FC0A 4TWNA 3UO5A 3SRVB 3R7IA 3V5TA 4EH3A 3GU4A 5HICA 3P86A 3T3UA 5CSHA 4ANNA 3WZUA 3LVPA 2BRHA 3H3CA 3U9CA 3MPMA 2WMUA 5JRSA 4OTWA 4EOSA 2HWPA 2PHKA 3T9TA 3MIYA 5JQ5A 4QP1A 1KE6A 5ANKA 4GV1A 4E7WA 2OW3A 4EC8A 2WZJA 4P4CA 3BIZA 4YP8A 3G9NA 2ITYA 4D0WA 5HU9A 2C3LA 3MVMA 4V04A 4D2SA 3LCTA 2J90A 3OW3A 3GP0A 3CD8A 3LQ8A 4X3JA 4J71A 3FMEA 3RAWA 3RGFA 2B9HA 4BKZA 4CRSA 4FEVA 5BUJA 5DA3A 3OUNB 1M2PA 4XJ0A 5E9EA 1WBTA 3GB2A 2OIQA 3MV5A 3RAIA 3ALNA 3KY2A 4I0TA 4I22A 3O50A 4QQTA 2WO6A 2B0QA 3ULIA 2FUMA 3DZQA 4Q9SA 5EM7A 4EC9A 3R1SA 5DRDA 3R9NA 3BRBA 4FA2A 3HECA 3BLRA 4IVCA 4CLIA 5D10A 2J0MB 4X7QA 3POZA 3F61A 4Z7GA 3BQCA 4YTCA 5E8ZA 4EOQA 4R6VA 2J6MA 2XBJA 5J1WA 2VWWA 4LV8A 3LIJA 2JKOA 5E8YA 3HYHA 4EYMA 3TNQB 2OZOA 4XG8A 5FD2A 2VTHA 2EB3A 2YIRA 5CEMA 5HD7A 3HA6A 2WMAA 2PE2A 2F4JA 2PL0A 2PMLX 2UUEA 5D12A 5M56A 3PG1A 3WILA 2AUHA 3V04A 4FK6A 5KBQA 4DA5A 3UBDA 4NW5A 2YDKA 5BVFA 5EW9A 3EQGA 4RX5A 2HZ0A 3NIZA 3ZM9A 3RNYA 4C7TA 3V8WA 2Y4IB 3CQUA 4M68A 3ZU7A 5AUTA 3QLGA 2J50A 4G17A 5CSVA 4BYJA 4BC6A 4XG6A 4I24A 4DEBA 3ORLA 1P4FA 2BDWA 4YJNA 1U46A 1XQZA 2PVMA 2WFYA 2YM4A 4HYHA 5ACKA 5FDPA 3SGCA 3VS0A 2V5QA 5CF4A 3B8RA 1QPCA 3GC8A 3L9MA 4PDSA 3V8SA 3QQUA 4E6AA 4O6LA 3P5KA 5BYLA 5JSMA 1F3MC 4W4VA 5H8EA 4X6RA 5BYZA 2PVNA 2FSOX 4PMPA 3KXXA 2CN8A 2QU6A 4Q9ZA 4EI4A 3H9FA 4BZOA 3ZSGA 2JIUA 3NZ0A 5IKWA 4K18A 4TYJA 3DBEA 2XRWA 1IRKA 3O7LD 1TQIA 2GNIA 3Q9XA 3S00A 2QOKA 5KZ0A 3H0ZA 1R0PA 2GMXA 3HA8A 4L7SA 4UMQA 4XOYA 2PTKA 3SG9A 2J7TA 5C8MA 4MX9A 4XBUA 3OROA 4FODA 1STCE 3DOGA 4IJPA 4M67A 4XV3A 3W2OA 5JFXA 3HV6A 4YZNA 4FV1A 2I1MA 2XIKA 1IASA 2C5VA 2F49A 4PX6A 3MJ1A 2QURA 3G15A 2UZUE 1GZKA 3NCZA 4XG3A 4L68A 2YA9A 1Q99A 3EL8A 3F66A 4KIPA 4NM0A 5M4FA 4MD8E 1MRYA 4IACA 2BZHB 4IEBA 3R8ZA 1CKIA 2RIOA 5LWNA 3QCYA 2EU9A 5E1SA 3Q4ZA 4Q5EA 3AOXA 3NIEA 5CASA 1SVEA 4FZ6A 4O7LA 1UWJA 1WBVA 3LAUA 4D2RA 3IQ7A 5A4EA 3W2CA 3H9OA 4FVRA 2GHMA 4EWHA 5CALA 4R3RA 4CQGA 1AQ1A 3FSKA 5I9UA 4C59A 4AU8A 4E6QA 3PVWA 1E1VA 4RX8A 1QPDA 2PZPA 4QMTA 3NUAA 3OWPA 2OJFE 4LRMA 3E8DA 3UC3A 3ODYX 1PXMA 3OT8A 3PZHA 4J1RA 3PZEA 1OIRA 1UVRA 4MXOA 4F1MA 3F3ZA 3ZO2A 4MF1A 4JVGA 4GKIA 1XBCA 1QPEA 3PSCA 3VJOA 3FZTA 3EQFA 3IGGA 3O2MA 4TT7A 5T3QA 5AAGA 5L6OA 3HDMA 5EOLA 3FLSA 5HG7A 3DB6A 4Y83A 1CSNA 5AX3A 4HW7A 5B2KA 4K77A 4RA5A 2QKRA 4D2TA 2F7EE 2VNYA 2YEXA 1Q8WA 2W5HA 2AYPA 4QOXA 5KMOA 5A9UA 3Q53A 2XYNA 2ETMA 4IMYA 4L01A 1YOMA 3KK9A 1PMVA 3BWJA 4EZ7A 2YWVA 4KAOA 4L7FA 4U41A 3QRIA 3R7UA 3OHTA 3TIYA 3OWLA 5E4HA 4PPAA 5DWRA 5FM3A 4CZTA 3LPBA 2JBOA 3G90X 3RMFA 2QKWB 3NEWA 1SNXA 4C02A 3QTUA 4Q2AA 3S95A 2EXCX 4XHKB 2W06A 3FBVA 3SW4A 1OUKA 3LJ2A 5JGAA 2UW5A 3F3TA 3VUGA 4BB4A 2BKZA 2QODA 3K5VA 4JBPA 4I41A 4AE9A 4DG0E 2B9JA 4J99A 4KKEA 4EQCA 4CLJA 4EBWA 4CKIA 3D4QA 4I6FA 3Q2JA 5I3RA 3P7BA 4GJ3A 5CZIA 5AR4A 1GAGA 5H3QA 3TZ7A 3COIA 5CY3A 2C1BA 4BL1A 4FZ7A 5BVWA 3MFTA 4UBAA 3HAVA 5AP7A 3CJFA 4AOIA 1NW1A 4ALUA 4EBVA 4FGRA 4QP7A 2R3RA 3ZLSA 3WE4A 4MCVA 3MFSA 3OD6X 3TUCA 3WOWA 1R39A 3AC3A 4H1MA 3ROCA 3KRWA 3HRBA 5IH4A 3QUEA 3RHKA 4MQ1A 1VYWA 3EL7A 2PMIA 3DNEA 4S34A 3UMXA 2CJMA 2RSVA 3AGMA 4ACCA 2QG7A 3ZC5A 4YURA 2EXMA 4FL3A 3A7GA 3R71A 4RC2A 4ZLZA 2VTIA 4GCJA 5A3XA 4GKHA 5EG3A 3BYVA 3E8EA 4U81A 4BBEA 4U3ZA 3QCXA 4TY1A 5FEQA 1PXKA 1MP8A 1XBAA 3PJ3A 3UC4A 2NO3A 1LP4A 4JDJA 4OTRA 4FTJA 3JS2A 4FBXA 5EFQA 5AP6A 5JGDA 4P90A 5C4KA 2J5FA 5L2QA 3FI3A 3R00A 2W7XA 3WZEA 4IJ9A 4QTBA 2GTMA 4JBVA 3P23A 3G6GA 3FMLA 4IX4A 3FLNC 2Y6OA 4OBQA 5CSPA 3QQJA 1LR4A 2P3GX 4BDFA 4LUDA 4MTAA 4QYYA 1YXVA 4F0FA 2X4ZA 4IIRA 3RP9A 5CAVA 3DA6A 1YDRE 2XNPA 4DITA 1CKJA 2IZUA 5HHWA 4RJ7A 2IG7A 3A61A 4NCTA 1M7NA 2R3NA 4PPCA 3L1SA 5KX8A 4K6ZA 2YCFA 5EQPA 4RWLA 4BR3A 2QOHA 4JIAA 4C3FA 5HBEA 2UV2A 1BL6A 2BRMA 4JRNA 2BILB 4RFYA 5M51A 2BAQA 4EHVA 4QPSA 2Y9QA 3FQEA 4ONAA 3SV0A 1FMKA 2R5TA 1Q8TA 3BGQA 4O7SA 4DBXA 3EYGA 4B6LA 3OEFX 4ID7A 3GOKA 4BTFA 3DLSA 1FOTA 2XK8A 4HCUA 3VW6A 2QR8A 3D7ZA 4UWBA 5ICPA 5C4LA 3OCBA 4L9IA 5I9XA 5GJDA 2W1GA 4E4XA 4KINA 5JGBA 4LOPA 3V3VA 2PE1A 5IA3A 2YIYA 4O0YA 2C30A 5L8LA 4CRLA 1XKKA 3F3VA 5HE0A 4CV8A 3PUPA 2GS6A 4ITHA 1GY3A 4AZWA 1E1XA 3KVXA 2C6MA 2UZEA 3BX5A 3FPMA 3LQ3A 5DT4A 3DPKA 4GYGA 3H30A 3TI1A 4D55A 5CANA 3VN9A 4YJSA 3PXKA 2A0CX 4O22A 4PUZA 4ZP5A 3HMNA 4KIQA 2WTDA 2WU7A 4I3ZA 1JSVA 3PXFA 4P2KA 4ZXTA 3VUKA 3CPBA 3IDBA 2PK9A 5HGIA 3Q04A 4C38A 5A4LA 1H24A 1YOJA 4E3CA 3U8WA 2VTQA 4IQ6A 5L6WL 4O0SA 3VIDA 3ZRMA 1OI9A 3Q6WA 4QRCA 4JDIA 4RZVA 1KWPA 4IM3A 4NM3A 4ZOGA 2CCHA 1XHAA 1APME 2E9PA 2HCKA 4CTCA 2F2CB 4MXXA 3UGCA 4UALA 5KMNA 2I40A 4I5CA 3ZBXA 1UKHA 2P0CA 2UZLA 3C0GA 3CY3A 2R2PA 3Q5ZA 4TPTA 4V05A 2P4IA 2UW8A 4NZWB 3ETAA 3I60A 1YHVA 4MWHA 2YZLA 2BROA 4N57A 3SC1A 4BCIA 3A62A 5CF8A 4WOVA 1HCLA 3UQFA 2JD5A 2ZM1A 2V0DA 1W82A 3QQGA 4XP0A 2YAKA 5CNNA 2CKEA 3T8OA 4E5BA 5EQEA 3ET7A 4OTGA 5KMLA 5C01A 4LRJA 2ACXA 4LGDA 3FHIA 4AT5A 2FSMX 1M52A 2VX1A 3AT4A 4FNYA 4ZJIA 4ACGA 2HW6A 2XNBA 2GNLA 3M2WA 4RJ3A 1REKA 3A7IA 4IM2A 2QO2A 4QMVA 4XP2A 4YGAA 5ETIA 4APPA 3S0OA 5CXZA 2HAKA 2O8YA 3AD4A 2GS7A 2RF9A 3K3IA 4MD9E 1GOLA 5FDXA 3ZRKA 4BICA 3LJ1A 4DBNA 3OTVA 4FL2A 2YM5A 5C8NA 3KXMA 3G0FA 4ASZA 4QQ5A 5J9ZA 3EKNA 2OKRA 4ZZNA 3BEGA 4AA0A 5FTGA 5A6OA 4BTKA 3QTRA 3CC6A 3O71A 4FSYA 3TZ8A 4ITIA 4M66A 4BCMA 1KE7A 3V5PA 3ZSIA 3DU8A 4OAUC 3PA4A 4QP9A 4PWNA 5ANJA 3D83A 3O8TA 3RK5A 4C4EA 3IKAA 2X9FA 3JXWA 4YJOA 1PKGA 5J95A 2QOBA 2BHEA 2JAVA 3KKVA 4WNMA 2X2KA 1JAMA 4C3RA 2VWYA 2H8HA 5DR9A 5EW8A 2OSCA 4YJVA 3TL8A 3RPRA 3VS6A 3FWQA 4KD1A 3U6HA 4RVTA 3D2KA 4D0XA 4BRXA 4E5AX 5IA2A 2PUNA 3P0MA 1YDTE 3RAKA 2CGWA 2ONLC 2W4OA 2W5BA 1DM2A 3DFCB 3F6XA 4JQ7A 2VTPA 3HDNA 4YJPA 5HESA 4D2PA 3C4FA 4QP6A 4R7IA 4HJOA 1SVGA 4N0SA 4U44A 1AGWA 3OP5A 5LVNA 4M14A 2XCKA 4UYNA 4EH7A 2BRBA 3BYSA 5AIRA 2ITNA 2RFNA 4FF8A 3F69A 3PE2A 4GK3A 4M8TA 1OECA 3O96A 3IDPA 2WHBA 4EOKA 2WAJA 2WB8A 5IEVA 5HIBA 3TACA 4AXAA 1Z9XA 5HO8A 3ZUUA 2V62A 4K33A 3RI1A 4F08A 3QC4A 5IDPA 5K5NA 2OIDA 2CDZA 1OBGA 3Q5IA 1YRPA 2OXYA 5ANEA 4AA4A 1FVVA 3SXFA 3FZOA 5GZ9A 2CPKE 4HGSA 3VVHA 3OOMA 2J9MA 5H8GA 4IWPA 5AV4A 3CTQA 3EN6A 5CEPA 3FY2A 5BVOA 2GS2A 2F7XE 2XJ2A 4DE4A 5IQHA 4QMNA 2PVHA 4CFWA 4IE9A 2WMSA 5DH3A 4BIDA 4ZMFA 3E87A 5ANDA 2XB7A 3R9HA 4L00A 4OTQA 2R3HA 3HZTA 1FGIA 4BCKA 4O6EA 5BVNA 1M7QA 5CAUA 3K5UA 3FEGA 3PYYA 3DNDA 3D94A 1UNGA 2GSFA 2WOTA 3E93A 2PE0A 3PSDA 4G3GA 5AX9A 3RM6A 4DFLA 5M4IA 5AV2A 3ACKA 3GCSA 4NL0A 4JBOA 4ASXA 4UWYA 3NUSA 3ZOSA 5HBHA 3BKBA 1GNGA 4ZSEA 5IG1A 4NTTA 3CGOA 3L8PA 1NVQA 1TKIA 3GI3A 3FI4A 3OCGA 4OTHA 4C33A 1U5QA 2CGUA 3Q96A 4ZTLA 1GZOA 3NNXA 4QYEA 5LXMA 2GQRA 2OG8A 4GSBA 3AD5A 3QD0A 3LFNA 2OXXA 4ANQA 5FTQA 3QBNA 1HCKA 4JLCA 3Q9WA 4FV2A 4RZWA 4GFOA 4I4EA 4B8MA 3RALA 4BZNA 1OZ1A 3UVPA 5DPVA 4EH9A 1G3NA 3VNTA 1KUTA 1P5EA 1SZMA 5IQAA 2ZB1A 3NGAA 4DAWA 4CZYB 1ND4A 3AMYA 1NVRA 3EQBA 5B0XA 5FGKA 4B99A 3UJGA 2OZAA 3E8CA 4DTKA 2XK9A 3AC2A 4KSPA 3QD3A 2VWBA 4GK2A 3SVVA 4R7HA 4JX3A 2C1AA 2J0KA 2UZTA 4X2NA 3ZHPC 5L2SA 4G5PA 1YXTA 3CIKA 4NKSA 5AMNA 3LCKA 3QKKA 4GL9A 4BCOA 3NX8A 3TV6A 4HVHA 4FT3A 3U4UA 3COHA 4RVMA 4UZDA 4YZDA 1XJDA 5H2UA 2JKQA 2O64A 4ASDA 4FKQA 5D41A 1R3CA 1JKTA 4ACDA 3O7LB 4RIOA 5AWMA 1FINA 3IW7A 3HRCA 5D7AA 4MVFA 2XNGA 4H39A 3R22A 2YJSA 2O3PA 2ITTA 1NXKA 2G01A 1XH5A 3HX4A 3PY0A 4HPTE 5KZIA 3V8TA 5CU0A 3LM0A 1GIJA 3NW6A 3HKOA 3R6XA 4LYNA 4XYFA 3ZH8A 4U3YA 5HIEA 5IA0A 2QCSA 3DAJA 3GXLA 4FSRA 4O7VA 2R9SA 3A8WA 4C34A 1JKLA 3ORTA 4EHZA 4WBOA 3TWJA 2RFEA 1W8CA 2W9FB 1XR1A 3RINA 3HP2A 3I5ZA 4IB3A 4XUFA 3CLYA 5E7RA 3DB8A 3NYVA 4ZSLA 5IUHA 3D5XA 3EIDA 5I9VA 1UU8A 5JZJA 3FC2A 4IAFA 3BYUA 2ZV8A 4O1OA 3W8QA 3WZJA 3U51A 5C26A 1R1WA 4EOLA 2VTOA 3PY3A 5ANIA 3JVRA 5J7HA 3CPCA 1PMNA 3UPZA 4YPSA 2VTMA 2PY3A 1H1QA 4AW2A 2VGPA 3ZBFA 3R1YA 3AC4A 1LEWA 4PL3A 3E5AA 3JPVA 4M84A 4N6ZA 5CF5A 3HNGA 2R0UA 3LCSA 3SDJA 2VO3A 4A9UA 2UW9A 1OM1A 1Q41A 3F5PA 4TW9A 3V5QA 3Q2MA 4F1OA 3AQVA 1O6KA 4EH4A 2ZV2A
chains in the Genus database with same CATH superfamily
5HTIA 3L8XA 5AUXA 2X6DA 5HE3A 1WAKA 3B8QA 4L3JA 4XG7A 3EQDA 4D4SA 4EORA 5HZNA 2UW3A 1H0VA 2E2BA 3DKOA 3LJ0A 4XBRA 3NVKI 1WZYA 5HG8A 4ERKA 4GU6A 4X2KA 3TCPA 3ZLYA 3RVGA 3QZIA 2IW9A 1IA8A 2WOUA 5CT7A 1BI8A 5F4NA 4E1ZA 3QCSA 1ZMWA 3Q4CA 3QKMA 4FTKA 4AT3A 4TXCA 3V5LA 2CLQA 3VBTA 5AAEA 4RGJA 3MA3A 2AQXA 4P5QA 2C0OA 4U5JA 4R78A 3TKHA 5EI8A 4L67A 4E4NA 3GQLA 4KRDA 4MBLA 1J7IA 4YC8A 3EQIA 4FZDB 3TZMA 5IZFA 4UB7A 2I0EA 4DFNA 3AMBA 3VUTA 3MESA 5HQ0A 2W9ZB 3KVWA 4K8AA 4LOQA 3CR0A 4CSVA 4JS8A 2KULA 4YSMA 2CKOA 4M0ZA 4DEAA 2JDVA 2R0IA 3OF0A 1H01A 5HIDA 3LFSA 1FVRA 1PJKA 5FP6A 2G1TA 2WTVA 4ZZMA 1UNHA 3M1SA 4KKGA 3BBWA 3DKCA 3ZSHA 2XEYA 2IW6A 4ZY4A 1BYGA 1OL6A 5DMZA 4K11A 5G1XA 1URCA 2B54A 3L8VA 5EM5A 3ORZA 2PVRA 1BUHA 2C4GA 3DBQA 4L8MA 4D4VA 5CYIA 3QTXA 3FLQA 5EDRA 4KBKA 4GH2A 5ITAA 3NPCA 3EJ1A 3VJNA 3LZBA 3UE4A 4BKJA 1GJOA 4BCQA 5E8SA 5HE1A 4O0XA 2BR1A 5HVKA 3DXPA 3PJCA 3NNWA 5C03A 4C58A 4UWCA 3VQHA 4FT5A 4FIHA 5KMKA 2OICA 2C3KA 2QR7A 3IS5A 2Q0BA 2ZV7A 5HO6A 3RWPA 2OI4X 4CYJA 2PVFA 5HCZA 3R0TA 2GQSA 5EK7A 2VRXA 2HK5A 2BCJA 2QG5A 1M2RA 4RG0A 2WMTA 1FVTA 3S3IA 4ZLYA 4AAAA 4UEUA 4D9TA 1H1RA 2A27A 5EI6A 4YZMA 5JRQA 3FXWA 1ZAOA 4WT6A 3QLFA 3HP5A 3R8VA 4Y8DA 3KMWA 2YFXA 4C2VA 1H07A 5EI2A 5C27A 4ZIMA 4NIFB 4AOJA 3GU7A 3FL5A 3PXRA 3SQQA 4CMTA 3CY2A 4ARKA 4F1TA 3ULZA 3O0GA 3IOPA 4FEQA 2XKCA 3DDQA 3GCUA 3H4JA 2C0TA 3MVLA 2OIBA 1I44A 1PY5A 2GNGA 3ZXTA 3ATSA 2IW8A 2IEWA 3PXZA 4J98A 4JG6A 3THBA 3AMAA 3Q4TA 3C4ZA 4GJ2A 3KGAA 4WSQA 1XWSA 4EQUA 3BV2A 5L4QA 5IA4A 3P7AA 4FIEA 3WI6A 4XH6A 5L8KA 2G2IA 2OJGA 3LHJA 3CTJA 5M4UA 3KXGA 2UZNA 5AA9A 5CEOA 2HY0A 4YR8A 2XAMA 1OKVA 4KS7A 4QP3A 3KXZA 4IAYA 3ZZEA 4E8AA 3DV3A 4GT4A 3OS3A 1SM2A 5AP3A 3ANRA 1DS5A 3C0HA 4RX9A 4ZSJA 2R7IA 2IVVA 4X3FC 5HCYA 4ZSGA 4ENYA 1PYXA 4C8BA 1M14A 3HUBA 4I94A 3RBWA 2VTTA 5IEYA 5TOZA 4WRGA 4O86A 3DTCA 5IQGA 2GTNA 3PLAE 1W0XC 5B2MA 4JR7A 4ALWA 3F3WA 3P08A 4RIXA 3AKLA 3W2PA 4AN2A 5CS6A 4BDDA 4C61A 5HG9A 2X7GA 4IX6A 4LGGA 2GCDA 2B9IA 4Y73A 3UQGA 3ZTXA 3COKA 2PUIA 2YDIA 3QTWA 4HOKA 3LLTA 1R78A 3NUPA 3QGYA 4DFBA 4D58A 3QXPA 3VRZA 4UZHA 3BWFA 4ALVA 1OIUA 3DJ5A 1JPAA 4F4PA 4GMYA 4TL0A 4WSYA 1EH4A 4OT5A 3FC1X 3DDPA 4QMUA 3E88A 3ZO4A 4MAOA 1JNKA 4C62A 4W9XA 2PU8A 3OUKA 4CV9A 5KKRC 2W5AA 4QMPA 5KE0A 2OBJA 4G5JA 4JQEA 3UNJA 3U9NA 4E93A 5EHLA 1ZWSA 2FYSA 3NUYA 2ONLA 2PVYA 2QOCA 4U42A 3MY0A 3R9RA 4M69B 1SNUA 4O0UA 2BTSA 4XOZA 3SX9A 2ZAZA 2I0VA 4MXAA 3H9RA 4J8MA 5CX9A 5AUUA 3O5AA 3LFEA 5LARA 2Y8OA 3SXRA 4GT3A 5JFVA 1Q8YA 4G34A 4YMJA 3W0NA 5TE0A 2HW7A 4UV0A 4L43A 3AXWA 1OVEA 3TV7A 4H58A 3DFAA 2BRGA 3E64A 3OBGA 2XIRA 2IZTA 3R28A 2B53A 2QOIA 4IBMA 2UZVA 4TWOA 2CKPA 4WNOA 3F7WA 2Y6MA 4G9CA 4BCGA 3A7JA 3FI2A 5AP5A 3JY0A 2F2UA 2W05A 4JL9A 1B6CB 2YABA 4O38A 5E8UA 5EM8A 2ETRA 4AZSA 5K4JA 2ITWA 4EK3A 4MWIA 4F6WA 5L3AA 4FK3A 2VWVA 2B55A 2O65A 4KIKB 4C4HA 4BWPA 4LOOA 3N51A 3PIXA 2X4FA 4DGMA 5LMKC 3VHEA 3GQIA 3KXNA 4XLVA 4X2FA 3TUBA 5CVGA 4LUEA 2OU7A 4JT3A 1V0PA 4CT1A 5LWMA 1XO2B 3R1QA 3Q6UA 4Y85A 3W0QA 3W55A 3QC9A 4FE2A 5J5TA 5IQIA 2HIWA 3TG1A 4D1SA 5IH6A 2UVZA 2CSNA 1Q61A 4W4YA 4M0YA 4BJJB 4II5A 3BHYA 5M53A 1IG1A 1VR2A 2OF2A 4NK9A 3NNVA 4RC3A 5DLSA 3U87A 5KMJA 1P4OA 2QLUA 3S1HA 4YHJA 3W1FA 3VS3A 5DN3A 3KULB 2CGXA 3QWKA 4PNIA 5E8TA 1Q97A 4D1XA 4JXFA 2B9FA 4O81A 4FTRA 4FL1A 2QHNA 2XUUA 4DFZE 1M17A 2QOQA 2ZMCA 3D7TA 3E3BX 2BALA 1YDSE 1J91A 1OKZA 2JFMA 4BVUA 4LV7A 3VUIA 4GIIA 3MB6A 1ZZLA 4O7NA 4FV0A 4G6OA 1QCFA 3OTUA 3SHEA 3KRRA 3ZO1A 1Y57A 3MH0A 4GVAA 4QP4A 2P2HA 1PXOA 5FWKK 4G3EA 4G16A 5LMBA 3UO6A 4X2GA 2UVYA 3RM7A 1IA9A 1HOWA 4RT7A 4B4LA 1PXPA 4LI5A 3LMIA 2H96A 1JWHA 4A07A 3LXPA 3UDZA 2G2HA 4ZTHA 2XNMA 2JBPA 2BVAA 3N9XA 4FKLA 3RZFA 5A54A 5IEXA 2I0YA 3N4TA 5IQFA 2WMVA 1JBPE 4XRLA 1YXUA 4JIKA 3R1NA 2DQ7X 4LM5A 4S31A 4R8QA 2ZM4A 3ID6C 2YHVA 3OEZA 4CKRA 3F9NA 2WMQA 3QGWA 4S32A 5IUGA 3BYMA 5KKRB 5CVHA 2ZVAA 3RNIA 3EZVA 4W4XA 5J8IA 3FPQA 1XMLA 3MB7A 4IDTA 1UNLA 4O84A 3T3VA 4BCFA 2OK1A 5TO8A 2W0JA 4ERWA 2VNWA 2I0HA 3BU3A 3QUPA 1RW8A 1YKRA 4HCVA 4PRJA 4AW5A 3RZBA 4CFVA 5DT0A 4ANLA 1W2CA 4I93A 4QTCA 4OW8A 5E8WA 4BF2A 5BUEA 2SRCA 3QRJA 3REPA 4BDAA 4ANOA 5CSWA 2JDSA 1MQBA 2R3IA 4QYGA 3ZO3A 4RQKA 4UX9A 4YHTA 2OZAB 4FKWA 2WMXA 2Y7JA 3MH2A 5HNIX 4R7BA 4L53A 2XNEA 3OMVA 4QD6A 3CP9A 3QA8A 3ORNA 1T46A 4GU9A 3SKCA 3W16A 3Q52A 3V6RA 4CT2A 2O63A 5AM6A 2QOFA 5FBOA 3BZ3A 4DLIA 3EN4A 4FNZA 3MFUA 3KIOC 5IUIA 5C9CA 4ASEA 4MBIA 3BGZA 4O1PA 3EN7A 4U45A 2RFDA 4BTJA 4NIFA 3BYOA 3MTLA 4FTTA 5LVMA 1H28A 3EYHA 4IFCA 3SG8A 5M09A 2YJRA 3EFLA 3IOKA 3QALE 4I6BA 4MQ2A 4OR5A 2CNVA 3TYKA 5AUWA 3QHRA 5HCXA 2PULA 2QC6A 3SAYA 4YO4A 3ODZX 5T68A 2QO9A 4PDYA 1FGKA 3C51A 3FMMA 2Z8CA 1PMUA 2JAMA 4WUAA 5EHOA 4BBFA 4DFYA 2ITVA 5L6PA 1J7LA 1U4DA 2JIIA 5CU3A 3LXNA 3QHWA 4UMRA 2ITUA 5DFPA 3CKWA 4QTEA 3ITZA 1URWA 3EFJA 1ATPE 4YLJA 4CFUA 4C37A 4PPBA 4JOAA 5DNRA 2QQ7A 4EK8A 3MH1A 3VWAA 4PMMA 2C6KA 4RVLA 3A4OX 3MFRA 1PXIA 2GDOA 5FXSA 4NWMA 3DZOA 2C0IA 5ETCA 2C5YA 4CCBA 4RIYA 3LKMA 2R3LA 3BU6A 4B0GA 2QU5A 3DY7A 3Q9YA 2PZRA 4HVIA 4GK4A 3CE3A 4QQCA 5FEEA 2W1EA 1YVJA 5A46A 3ML1A 1Y91A 5K4IA 4D4RA 1BX6A 3D9VA 1OL5A 2UW7A 2C5NA 2XCHA 3F82A 4USDA 3UIXA 2X6EA 4IAAA 4DHFA 5BNJA 5L2WA 5C8KA 3QYWA 4BWKA 4EUUA 1UV5A 2I7QA 3HMIA 4HYIA 3V5JA 1B39A 2BHHA 5BUIA 3RHXA 5HNGA 4A7CA 4C4JA 3BPRA 5K9IA 2Z2WA 2WQEA 2W1ZA 3VS2A 1OL7A 2P33A 3QKLA 3LFDA 2VO7A 4K9YA 4NU1A 4TWPA 4KNBA 4I92A 3DCVA 3KF4A 1OKWA 3OFMA 4O82A 1H27A 3LXLA 5FG8A 4AN3A 2ZDTA 3ZDUA 4BDJA 5B2LA 2YCRA 3H10A 4EK6A 4EKLA 3JUHA 3TN8A 4MBJA 4BCJA 3DK3A 3DGKA 3ZUVA 3PFYA 3P78A 3VULA 4QT1A 4EH2A 4I4FA 1ZARA 2OXDA 2R64A 4GIHA 2PUPA 5FM2A 5I5ZA 4HVSA 2B7AA 3UPXA 4DHZA 3BE2A 4HZRA 4M69A 3KCKA 1RJBA 1ZOEA 4ZEGA 4EKKA 2IZSA 3KREA 1IEPA 4FV7A 5FBNC 3UIUA 1OIQA 4ZTQA 3K2LA 3UYTA 4FSTA 2EVAA 2W1FA 4IADA 3ZZWA 2C6LA 3R02A 2FB8A 5JH6A 5LVLA 4QPAA 2V22A 4M97A 3FKNA 3E8NA 5KO1A 4JAJA 3TNPC 3MSSA 5AR3A 3AC1A 4PDOA 3VRYA 3KRLA 3ZFXA 5K0KA 2XM8A 4AWIA 2ZFYA 2W1CA 3MYGA 4RBLA 4U43A 4P5ZA 4FICA 1OUYA 4QMLA 4NTSA 4R3PA 3E92A 3GC9A 3W8LA 5JZNA 4PY1A 3NW7A 3R9OA 4H05A 5CENA 4EH5A 4O0TA 5J79A 4NKAA 3LFQA 3C1XA 4DCEA 4BGGA 5HG5A 3IW4A 4RLKA 3V51A 2CNUA 3OY1A 1YI4A 3CQEA 3FMDA 4YC6A 2NPQA 4G2FA 2EB2A 2XEZA 3OC1A 1XH9A 2JEDA 3EQRA 4KIKA 4O96A 4WKQA 4O0VA 3LMHA 3KFAA 3PP0A 1CKPA 3QFVA 4A4LA 3CQWA 3NNUA 3HVCA 3GFEA 2EUFB 3FE3A 4MH7A 4F64A 2OJJA 3SOCA 4FKUA 4GFGA 3MGYA 4DH1A 5J9YA 3E3PA 3MS9A 2BIKB 3VC4A 4QMZA 2AC3A 3VQUA 2IVSA 4XS2A 3UOHA 3DXNA 4DINA 3R7OA 3VS1A 3KQ7A 3HUCA 4IB1A 4PDPA 4F9BA 1Q3WA 5IA5A 2PZ5A 2VWIA 2XRUA 3WARA 4U9AA 5GIOE 1ZZ2A 3G6HA 4NM5A 2PYWA 1WBPA 5H9BA 3QYZA 2DUVA 3RPVA 4U80A 4X3FA 3NAXA 3W2QA 4ORKA 4ZTSA 3KULA 3DS6A 4FSMA 4I0SA 3NR9A 5EYKA 3WYXA 3ZLWA 4A9TA 1GIHA 5GNKA 4AE6A 4CQEA 2XALA 3IDCA 1Q62A 3TM0A 3QU0A 2VTLA 3P9JA 3I1AA 4GRBA 1P14A 2JLDA 4J53A 4FKJA 4QP2A 4FTAA 2WD1A 4KS8A 5CNOA 2B52A 3P1AA 1YHWA 4YSJA 4O91A 3W18A 4IDVA 4FOCA 1Q3DA 4O7WA 2VTNA 1Q8UA 4DLJA 5B7VA 5FP5A 4XX9A 5HBJA 1OL1A 1ST0A 3QRUA 4FSNA 2C68A 3TDVA 1JSTA 4FKIA 4AA5A 4JDHA 2UVXA 3JVSA 2YIQA 2W4KA 4GG5A 3ZS5A 1SVHA 3ZDIA 1H26A 2QO7A 5H8BA 3W0OA 2O5KA 1W84A 2A2AA 3TTIA 2VWUA 3FQHA 3ZRLA 5AV1A 2BIYA 2C6OA 5CU4A 4IW0A 4FTUA 4PF4A 2YLFA 3OY3A 4F6UA 2WIHA 4FG7A 2PMNX 1V0OA 4YJTA 3ENHA 2IWIA 4CFMA 4D28A 4K0YA 2IZRA 4FSQA 4BIBA 4RIXB 3C4EA 1TQMA 3AC8A 1H8FA 2REIA 3PFQA 5E91A 2FSLX 2VGOA 4FVQA 1W2FA 4DDIA 2A19B 3DAEA 3PPJA 2R3QA 3ALOA 3GOPA 5AEPA 2AEGA 4RPVA 2BZJA 1Q4LA 5F1ZA 4HCTA 4IZAA 4LL0A 2X0PA 4CZUA 3AGLA 2X0OA 2YCSA 4M3QA 3VBXA 4R77A 4D2VA 3I7CA 2C6EA 4BCNA 2WEVA 2PZIA 4GEOA 4MF0A 1FBNA 4X21A 1B38A 4WIHA 1RDQE 3QQHA 4FTQA 2PVJA 4WO5A 4BWXA 3I0OA 4YTFA 3UNKA 3BBTB 3R7EA 4AXDA 2J0JA 3QQFA 5JN2A 2OF4A 2Q83A 3A60A 3IW5A 4TYGA 4RMZA 5EKNA 1YW2A 5LMKA 3FZSA 2Z60A 3C5UA 4GFMA 2GQGA 1OGYA 1S9IA 4FKPA 4J7BA 4TZRA 3L9NA 4D4YA 5A4QA 4AZTA 4EZ5A 2DWBA 2DYLA 5CAOA 3GVUA 5AIKA 1F0QA 2JDTA 3NDMA 3ORMA 4FKTA 1K2PA 5E8XA 3A8XA 4EZ3A 4FV8A 4XCUA 2VU3A 3C9WA 3KEXA 4NSTA 3W0RA 4CYIA 4Z7HA 2ITZA 1O6LA 4MNEA 3VUHA 4RJ8A 1OPJA 4JQ8A 3UQCA 3MN3A 2XKEA 2H9VA 2NNWB 3SXSA 3D5WA 2FGIA 5D1JA 2XJ1A 5CTPA 2E9UA 3LFAA 4L3LA 4NJDA 4BDCA 5HLNA 5CT0A 4FG9A 4TNDA 1WBSA 5M44A 3NAYA 3JY9A 4FZAB 4TYIA 2VWZA 3PIYA 4M15A 3DK7A 3D2IA 3I81A 4QYHA 3IG7A 4EOJA 2C3IB 4IFGA 4CG8A 3LOKA 4D5KA 4USEA 5J9LA 3CD3A 4FKSA 1F5QA 5EHYA 4TYHA 3GC0A 4NW6A 1WBWA 4Y5QA 2QHMA 4U8ZA 5DEWA 5E1EA 5AA8A 5JT2A 4ZTNA 2J0LA 4TYEA 1YI6A 3A4PA 5LJJA 1MUOA 3E62A 3WYYA 3DT1A 1BMKA 2C47A 3PPZA 1U5RA 4OAVB 2YWPA 4EH8A 5HX6A 5FXRA 3PVUA 3D15A 3MA6A 4U7ZA 1GZ8A 1Z57A 1KE9A 1NA7A 3T9IA 1FMOE 4FRFA 4BZDA 1QMZA 2YN8A 2UZBA 5IMXA 4AZFA 2PUUA 2WQBA 3S4QA 5J5SA 4A9SA 4FT9A 5DRBA 3VBQA 2Z7LA 3G51A 4K2RA 2ITXA 1ZYCA 3G0EA 4G31A 4L44A 3W0MA 4F6SA 5BVEA 3SW7A 3EQCA 4F0GA 4MK0A 2G9XA 2QONA 2UW0A 4CVAA 5DEYA 3LM5A 5T6KA 4CTBA 3D7TB 3G9LX 4QNAA 4U79A 4AZEA 1NT2A 2R3OA 3CBLA 4DTAA 3GENA 3DQXA 2Z7RA 5BQ0A 2JDOA 1M2QA 1UKIA 2QI8A 3G33A 4J52A 2LGCA 4YZBA 3HMOA 4EHEA 4IZYA 3MH3A 5GIPE 3FL4A 4FOBA 5BVKA 4LDTA 2XANA 5G6VA 4HZSA 3MPTA 5J7BA 3R21A 4RIWA 5HO7A 5I9ZA 2GNJA 4JG7A 4IWDA 4L45A 4L52A 4YO6A 3VAPA 5FXQA 1VZOA 4AW0A 2XNNA 4RC4A 4A9YA 5IDNA 1ZYJA 3R2YA 1BKXA 4IVBA 2ERKA 4A4OA 4BI1A 4RRVA 3H0YA 2B1PA 1KV1A 1Y6BA 2VD5A 5BX0A 3GNIB 1PXLA 2XVDA 4MYGA 4EJ7A 1H1WA 5EM6A 1LPUA 2YIXA 4EK5A 4ZTMA 3HV4A 3PXQA 5JKGA 2XA4A 3NWWA 3TXOA 3TKIA 4APCA 5LOHA 3ENMA 3QRKA 3FLYA 3LW0A 4EWQA 2IVUA 2C5XA 3LFFA 4UXQA 1DAYA 2X7FA 3FSFA 4OTDA 1YI3A 1GIIA 3PWYA 2XKDA 2IJMA 3EKKA 2NP8A 3IPHA 3MPAA 4FEUA 1K9AA 1ZYLA 4Y95A 2FO0A 2NRUA 2AC5A 4RX7A 1G5SA 3UDBA 3MY5A 4GUEA 5E8VA 2RKUA 1JOWB 3EHAA 4W8EA 4CMOA 2CCIA 3MI9A 4IM0A 1WFCA 1PYEA 3R7GA 4FNWA 4ZLOA 5J1VA 1Y6AA 3QL8A 5HTCA 1MRUA 4WUNA 4UN0C 1U59A 4J97A 4XG9A 3RPYA 2WMWA 4Y46A 3BEAA 1CM8A 4G6LA 2F9GA 2VX3A 4LFIA 4OUCA 3RCJA 3GFWA 4FT0A 4EONA 3ZFMA 2X8DA 4EOOA 2LAVA 1V1KA 2QVSE 3NUUA 3CTHA 4QMMA 3OXZA 3R83A 3QD2B 3WBLA 4GS6A 4GT5A 3Q9ZA 4F99A 3L9PA 3UOJA 3F5UA 4RLLA 4X6QC 1OL2A 5CI6A 4WG4A 4KSQA 2E9OA 4IB0A 4C35A 4QMSA 5IF1A 3BL7A 1ZRZA 2VTJA 4C36A 4JMQA 4FSWA 1JVPP 5CF6A 3OW4A 3G2FA 5FLFA 2R3FA 3NW5A 1ZXEA 5HE2A 4QMOA 3WF5A 3HGKA 4E4MA 4R1YA 2X7OA 5KUPA 4NYEA 3HRFA 3PRFA 4WHZA 2OGVA 4AUAA 3QTQA 2HYYA 2JIVA 2QOLA 4PTGA 1TZDA 4YHFA 5AUZA 2WMRA 5F94A 3QTSA 3VS5A 1KE8A 2RG5A 3PPKA 1RQQA 3EOCA 3OXTA 4YJQA 5BVDA 5C1QB 5E90A 3R30A 4CXAA 2VZ6A 4FTLA 4DGNA 4OGRA 4C3PA 4E4LA 1WBOA 4QYFA 4XNEA 5AJQA 1LUFA 1YXSA 3TJCA 3W10A 2JDRA 3BLAA 4G6NA 2GHGA 4RIYB 1PMEA 3BGPA 4EOMA 3DXQA 4OTIA 4Y72A 4I1ZA 1W83A 1Q8ZA 5DIAA 3UG1A 3PLSA 5DOSA 4C4IA 4AGCA 1U54B 5LCKA 4D2WA 2PVLA 4OTPA 3BQRA 4EH6A 4M7IA 4HPUE 4RJ4A 3Q32A 4I6HA 5K5XA 2XK6A 2ESMA 4JAIA 4TN6A 4ENXA 2PZYA 1REJA 4TWCA 3QRTA 4O4FA 3A99A 4UY9A 5L8JA 4QP8A 3HMMA 3R8PA 2BDJA 5DR2A 4R5YA 5JFSA 3RPSA 5LVPA 2I6LA 3SD0A 2F57A 5JK3A 1ST4A 5IQBA 3QAME 2R4BA 4QMYA 3KA0A 5EYCA 3KN6A 1MQ4A 4PMSA 2Q0NA 4FTCA 4BDHA 3GCQA 5EKOA 1VLRA 2W4JA 4O2PA 3FI8A 1CDKA 4H3BA 3RAHA 2H34A 3QTZA 1JKSA 2Y0AA 4O0RA 3RCDA 4DH3A 3N4UA 1A9UA 2J2IB 4DGGA 2WXVA 3R01A 2XF0A 3RWQA 3TEIA 3UIMA 4HNIA 3F5GA 4BCPA 4UMPA 1CMKE 4V01A 1UU9A 3FMHA 3NYOA 1DI8A 1ZYSA 2RFSA 4ACMA 2GNHA 4KA3A 1GZNA 3EMGA 5AADA 3ZONA 4HGLA 3CEKA 1QPJA 4D1ZA 1VYZA 3I0QA 3DTWA 4F9CA 5FRIA 2P55A 3LE6A 3D14A 4CCUA 3DBFA 3VBWA 3ZEWA 4FGBA 5FTOA 4C0TA 2WQNA 3AKJA 2BTRA 1X8BA 4USFA 2V7OA 3I4BA 5K0XA 3C50A 2YM3A 4FTMA 4D9UA 3AT2A 2BFXA 3E7OA 4GUBA 3NSZA 1PXNA 2RGPA 3E63A 2ERZE 3C4CA 3HLLA 4H1JA 4X2JA 5F20A 2YERA 1Q5KA 3COMA 3KCFA 5KBRA 4AN9A 3UNZA 3MTFA 1H4LA 1IR3A 3R8MA 4DFUA 2CGVA 1RE8A 4ZSAA 5LMAA 3C4XA 3MVJA 4JJRA 3W2SA 4DH8A 1IAHA 2O0UA 2EXEA 3GC7A 2BZIB 3OT3A 4FSZA 2R3GA 3UP2A 3I6UA 1KOAA 5IU2A 3R73A 3PSBA 4J95A 1G8AA 2PPQA 2VV9A 3QX2A 4RJ6A 4BDBA 4YJUA 4ZY6A 3UODA 4IXPA 4XG2A 4LMUA 2ITPA 1YHSA 3FMNA 3PXYA 4FNXA 4ZJJA 4O7YA 2HOGA 1ERKA 4FUYA 2PSQA 5TT7A 4V0GA 2Z02A 5D9HA 3PP1A 2VO0A 3MWUA 4QTDA 4BI2A 3BE9A 4S33A 1YXXA 3SLSA 4XRJA 2XM9A 3UZPA 3VBYA 3R8LA 3KL8A 4QPMA 3LLAA 3UYSA 3MY1A 3IW8A 1PF8A 3KB7A 2ZYBA 5M55A 1NY3A 4ACHA 4FIFA 2W1DA 5BMMA 4MKCA 5I0BA 1O9UA 3AG9A 4IC7A 4TTHB 3TZ9A 2OO8X 3C4WA 5ANOA 3ZFYA 1TVOA 4FVPA 4FV6A 4MXYA 5GZ8A 3VF8A 4FEXA 4X3FB 4GG7A 3WF8A 4DHJA 2R3KA 4BFMA 3K3JA 4C57A 4OT6A 2IPXA 2XZSA 3QZHA 4IZ7A 3F88A 3FZPA 3HL7A 4DEEA 2A4LA 5E92A 3EN9A 4AQKA 5CAPA 1FPUA 4J96A 3KF7A 3A7HA 4JBQA 1YWNA 1I09A 3IO7A 3LXKA 4AG8A 4FI1A 3C13A 1T45A 4QO9A 3G5DA 5EYMA 5ANGA 2FSTX 3IGOA 3HAMA 2HZNA 1PW2A 2OWBA 3MBLA 3OWJA 4CG9A 1VEBA 3EFKA 1XH6A 2YIWA 2ZM3A 3BHUA 4E6CA 3BHTA 3GU8A 4DH7A 2R7BA 1YOLA 2J51A 3BHHA 2UZOA 3UMWA 4RWJA 5AAFA 1UU7A 2WELA 5DGZA 4I5HA 4RWKA 5HORA 4H3QA 1PXJA 5IISA 3KN5A 3DKGA 4B7TA 1CTPE 4QQJA 1Y8GA 1JLUE 4LQMA 2Z7SA 2JITA 4RFMA 3ZYAA 5HVJA 1J3HA 3TT0A 3BLQA 3FDNA 4EUTA 3K54A 5HVYA 1OGUA 3GCVA 3ORPA 1XBBA 4AGDA 3U4WA 4YLKA 4DYMA 3RK9A 3C0IA 4W4WA 4BGHA 2XNOA 3LCDA 4O0WA 2FH9A 1W98A 2C6DA 4NH1A 4O2ZA 5FQDC 3KK8A 3LMGA 4HVGA 3U6IA 4L46A 2X39A 3V6SA 4AGWA 1WVYA 4AQCA 2WU6A 5L2TA 2DS1A 4KWPA 5CQWA 4QTAA 5D11A 3GU5A 4DEIA 2GFCA 4IAIA 1BL7A 4FT7A 5AR8A 5M07A 2VTRA 3DQWA 3HMPA 4KRCA 4F9YA 5DVRA 3ATTA 5M08A 5DI1A 3QF9A 3F7ZA 2UZWE 4YBJA 1K3AA 3TDWA 3FV8A 3QWJA 4X0MA 1G8SA 4EEVA 1ZY5A 4DGOA 4Z16A 4WNKA 3U55A 2ZOQA 3DJ7A 2WIPA 3BLHA 1E9HA 4LL5A 2XARA 5DYJA 3B2TA 3WF6A 2XK7A 2BPMA 2HXQA 1H1SA 3BU5A 3UVRA 4EYJA 4E26A 1JSUA 1H0WA 1Y8YA 5TR6A 3AT3A 3W2RA 3SRVA 4D5HA 2R3JA 4WBBB 1ZLTA 4FJVA 2X9EA 3FY0A 5KHXA 4NJ3A 3NVMB 4DCAA 1JQHA 2YCQA 3EH9A 3DLZA 5LVOA 5TF9A 4U0IA 3NRMA 4YPDA 1TQPA 5KMIA 5CEQA 4AT4A 4O7RA 3KRXA 3R7YA 5CSXA 4CMUA 4B9DA 3ROYA 4O83A 2Y4PA 3PE1A 4F63A 4Z55A 2UW4A 5IQCA 4F7LA 2ZJWA 1UA2A 4MNEB 3ACJA 4I21A 5CU6A 3OOGA 2YAAA 5EYDA 1OITA 2YITA 2XYUA 4NFMA 4F09A 3JYAA 4HNFA 2C6IA 4F7JA