4E5WA

Jak1 kinase (jh1 domain) in complex with compound 26
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
302
structure length
292
Chain Sequence
GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKNHIADLKKEIEILRNLYHENIVKYKGICTENGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK1
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 292
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e5wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e5wA01
4NCTC 5HBEA 4C37A 2B0QA 5JRQA 3LJ2A 1P4OA 3WI6A 1B38A 3F3VA 2C3LA 4L01A 4RIXB 4PL5A 3AG9A 2A0CX 4DTAA 5GJGA 4FKLA 3BBWA 4AE6A 4EK5A 2YM3A 4DEEA 1DI9A 3HMOA 4ZY5A 4LG4A 4UBAA 5LJJA 4RJ7A 5ITAA 2VO7A 3N51A 5TE0A 4JG8A 4K11A 4EYJA 4CFWA 5BPYA 4DITA 4F7LA 3FZPA 2JDTA 1OM1A 3CS9A 4IB5A 3T9IA 4ZK5A 2JAMA 2ITQA 2O0UA 4LGDA 2W1ZA 4W9WA 1MRYA 3SG9A 3H0YA 4YJTA 3FLNC 2PUNA 4OTQA 4YZBA 2XKDA 3JVRA 2XKCA 1YI4A 2XIKA 3C50A 4GU6A 3HKOA 1NXKA 5DFPA 5HCYA 3OWKA 4JG7A 2QHMA 5IUHA 3UNKA 3CGOA 4C3PA 1H1QA 5CEIA 1WBVA 4RWIA 4YC3A 4D2WA 4JX7A 1P5EA 2YJSA 2W1DA 3UP2A 4BDCA 4ANQA 1SMHA 4ITIA 2XEZA 5CZHA 1NW1A 1QCFA 4YZDA 4R1VA 2PMLX 3VHEA 4DBXA 4QP2A 3QHWA 4PL4A 4JAIA 1W8CA 5FBNC 1VEBA 4GG5A 3IW5A 4BB4A 1WBPA 4YPDA 2CLQA 5CALA 5K0XA 4L44A 5E8UA 5CAUA 3F3ZA 3HL7A 1CDKA 3FMLA 2ONLA 4EOKA 1LEZA 1U4DA 5IF1A 5IPJA 2IO6A 2WIHA 4N70A 5CSVA 5HIDA 5IEVA 3VJNA 4BDIA 3SG8A 4GFGA 1VJYA 4XG8A 2F49A 2YITA 1VR2A 3TTJA 3G0FA 5HCZA 2WKMA 3TXOA 3FZ1A 4N0SA 4ZAUA 4WSYA 3A61A 4GMYA 4WUNA 4E8AA 4R3RA 4ERWA 4QTDA 4BYJA 3ZM4A 3GUBA 3LMHA 3R83A 3GQLA 5BVOA 4O84A 3CKXA 2RFDA 5CF5A 2HY0A 2VX3A 4G3CA 3MA3A 1OIYA 4O91A 4QYHA 1V0OA 3MH0A 4M12A 3OT3A 4OW8A 4MH7A 4MXXA 3ET7A 2WZJA 4BDAA 3QQHA 5CVFA 5E8XA 4IB0A 2FSTX 4O0XA 4XLIA 2XUUA 4RIYB 5LMBA 3NX8A 5BYZA 3HYHA 4GL9A 3FSFA 3ZHPC 3UQGA 3KXXA 2FSOX 3ODZX 3PIZA 2H6DA 4CRSA 3ACKA 5HI2A 3RALA 4AW5A 2WMBA 2R0UA 3D5WA 3G2FA 2IWIA 1OGUA 2VTJA 2BAJA 2C3KA 3KVWA 4PP9A 4UZHA 4F1MA 5CEPA 2HW6A 2ZB1A 3BI6A 1ZRZA 3K3IA 5EFQA 2C0TA 4B8LA 3W2PA 3GNIB 1F0QA 4I4FA 2WMRA 1AGWA 4LUDA 4DFUA 3EQRA 4FTTA 2UW0A 2ZM1A 2GNFA 4IANA 3KREA 4F9CA 4HVDA 1OUYA 2XNNA 3DTCA 3W18A 2J5EA 3ALNA 3ZUVA 3OXIA 3ZEWA 2GMXA 1XBCA 2OIBA 2RSVA 3LCTA 4K8AA 3FYJX 3P08A 4YU2A 5K5XA 3F2RA 3F88A 5T3QA 3Q96A 4BCIA 1YI3A 4F70A 5D12A 5FG8A 5LCKA 5A9UA 5C8MA 2YIYA 3DDPA 3I5NA 3TZ8A 4EOIA 1ZMVA 4EOLA 3EQFA 2Z7RA 4TWOA 4PPBA 4GJ2A 5HG9A 3TZ7A 5K0KA 5IISA 2WXVA 3OEFX 4YZNA 1NVSA 5F4NA 2HZNA 3LFBA 1Q3WA 4IVDA 3ZSHA 3LJ0A 4DFZE 4EBWA 4PWNA 1W84A 1OIQA 4F08A 4HW7A 3F66A 2BAKA 3HUCA 4PMMA 1ZWSA 3ZFXA 5EI2A 4J95A 3EFJA 4LMUA 3HMPA 3E5AA 3PSCA 2PUUA 4IXPA 4FKJA 3RAWA 2XJ1A 1OI9A 3CBLA 4LMNA 4RMZA 3OUKA 5CSWA 3VS0A 4U41A 3FZTA 3I60A 4MD9E 3R7VA 4C8BA 5JGBA 3QCQA 3K2LA 2OU7A 4U5JA 3G5DA 1TQPA 5I3RA 4BI2A 3O23A 4JR7A 2CGWA 3UIMA 3ZO4A 4NJDA 3HAMA 1JKKA 4I6BA 3Q9WA 4QPMA 3ERKA 3D2IA 4FNZA 4KIKA 4O7WA 4EBVA 4C2WA 3SVVA 2EXCX 2QOCA 3ALOA 4H58A 3R22A 4AOJA 4F7JA 4ZSAA 5FTGA 1YOJA 3FLWA 4FV3A 4OAVB 3AD6A 3UQCA 4CMUA 2JDOA 3LFFA 3LQ5A 2GS2A 3BGQA 4IWOA 3RM7A 4XH6A 4CT1A 3LFCA 4K33A 3H10A 4E7WA 5J7HA 2NP8A 3PE1A 3RZBA 2QOHA 4A9RA 5AR2A 3R02A 4DGLC 3FKLA 5JFWA 5ETCA 3UYSA 3LM5A 3GOKA 4JRNA 4L7SA 2XK3A 4M97A 2OGVA 2UW8A 1UWHA 4L67A 4FGRA 3ZONA 3C4EA 1HOWA 2P3GX 3MIYA 5I9UA 3HV6A 4F1TA 5KCVA 3NPCA 4YGAA 4IACA 2VRXA 1ZYSA 3DFAA 2XNBA 4NIFB 2YZLA 1FMOE 3Q52A 2KULA 3ENHA 1OIUA 4QO9A 5IH5A 3QL8A 2XIYA 4AP7A 4V0GB 3SHEA 4HGLA 3UZTA 2J90A 4FG8A 4I6QA 2XNPA 2HOGA 2VTAA 5CANA 2OXDA 3DQWA 4EOJA 3NSZA 1ZY4A 4GT5A 4I5MA 3LMGA 1LEWA 3LXNA 4EONA 3KVXA 2BRGA 3HMNA 2BMCA 3ORIA 3Q3BA 3R71A 4FT7A 4AOTA 2W5AA 5DVRA 2EB2A 2XP2A 3PIXA 4BKJA 2UW6A 1H07A 2QR7A 1YVJA 4JIKA 4PPCA 3NYOA 3EHAA 4W4XA 1YOLA 2OZOA 2UZEA 4D0XA 3E8DA 4DEDA 1BL6A 4H05A 2W06A 5HNGA 2GQGA 3MY5A 4DF3A 5EHLA 5GZAA 2GU8A 4PMPA 5FQDC 2QOKA 2XEYA 4BHNA 4LV8A 4DH7A 3VS1A 3VBTA 4EYMA 5IU2A 1OPKA 3E62A 4I5HA 4CT2A 1H8FA 5IEXA 2Z60A 4OTGA 1Z5MA 2C6OA 3DJ6A 4YJNA 2PVMA 2Y7JA 2QURA 2OW3A 3EB0A 3Q4TA 3TZ9A 4NL0A 2ZMCA 5JN2A 1FMKA 1KOBA 3NR9A 4ZMEA 3C5IA 4JL9A 2W05A 4GYIA 2X7FA 2YM8A 4S2ZA 1BI7A 2YA9A 3UO4A 2W0JA 5JH6A 3COHA 3P7CA 1TQIA 3A7IA 1K9AA 3QC4A 4ZJIA 1DS5A 1NT2A 3V5LA 1JKTA 3UMWA 4EKKA 2VNWA 5FM3A 4K2RA 2BKKA 3R63A 2XRWA 4Y5QA 4AXAA 4RFYA 5KHXA 4IAAA 4JBPA 4QD6A 5E1SA 1YHWA 5CVGA 4F9BA 4LOQA 3MPMA 4D1XA 3PPZA 1FBNA 4EOSA 3N9XA 2YIRA 1MP8A 4FZ6A 4X3FA 3BE2A 4L6QA 4WNMA 5LVMA 2CNUA 2VO3A 2C5XA 4FE2A 3OCTA 4FYNA 2PHKA 4UYAA 1PJKA 2IZSA 3AQVA 1OPJA 2QOOA 2XCHA 3DT1A 4L9IA 4Z55A 4NEUA 4FEUA 3UG1A 5CU4A 3I81A 1L3RE 1W7HA 1XH8A 2OWBA 2O64A 1OKYA 2XJ2A 2W1IA 4G5PA 2PULA 2Z02A 4QP1A 4IZ7A 3VC4A 4E5BA 1Z57A 2HW7A 4ZJJA 1OBGA 3P23A 1V1KA 1R0PA 3R8VA 1UVRA 4XG7A 2BR1A 2BHEA 4DYMA 5BUEA 3O2MA 4XV9A 3S0OA 2Z7SA 3PLSA 3PVUA 4NK9A 2YAKA 3DCVA 4TW9A 1TVOA 4BDHA 2CNVA 3R8PA 3ZBFA 2GNLA 3SGCA 5IDPA 1R1WA 3EZRA 4PTEA 3KK8A 4F64A 3A7HA 5FBOA 2A4LA 5FXQA 3PDTA 3WZKA 5HVJA 3NIZA 4DEBA 4O86A 2XM8A 4IVBA 3NUYA 5BYYA 3UOHA 3R28A 2PVJA 1UNGA 3KB7A 3LXPA 4N6YA 4D2RA 1YHVA 3NNWA 4CFVA 5E8VA 2W99B 3GC9A 4EH7A 3EN5A 4S33A 2X0GA 3LAUA 3HV5A 4TY1A 5CF6A 1LR4A 3GT8A 3QU0A 4L8MA 2P0CA 3UG2A 3VS6A 3W32A 2C5YA 2WTKC 4BZDA 3FZOA 3HLLA 5HICA 5HEZA 2R5TA 3BRBA 3GCVA 5HO6A 3PY3A 3CP9A 4GUBA 5ANJA 4X3FC 4RBLA 3OT8A 4GW8A 4P4CA 4BKYA 3TUDA 4R3PA 4I41A 1JAMA 4LUEA 3EFWA 3ORMA 2QQ7A 2JAVA 3HAVA 3DK6A 5M09A 1O6YA 4FIFA 2JKQA 3HV7A 5AP2A 3AMYA 3KXZA 1OL2A 1NA7A 2C0OA 4S32A 3P1AA 5HBJA 4ZEGA 2BFYA 3E3BX 4BZNA 4TWPA 2QU6A 3C4ZA 2F7XE 3E88A 3TZMA 2I40A 3OFMA 3EMGA 4RLLA 4EI4A 4X2FA 1J1BA 3C9WA 5E92A 4IX4A 4EL9A 2ZJWA 5BUIA 5EW8A 3EWHA 5HE3A 5A4LA 2R3QA 2BRBA 4U40A 1KE9A 3TKHA 4G3FA 4C2VA 3F5GA 1PMUA 3OBGA 4JQ7A 5H8BA 2JBOA 3DXQA 3H9OA 3G6GA 2HZ4A 2UZUE 2PE0A 4FKSA 4M15A 4WRSA 3R1QA 1QPCA 4RQVA 5DOSA 4G6LA 3H30A 3II5A 4M69B 2GS7A 2P4IA 5KMMA 4DAWA 3NAXA 5DT0A 3BHUA 2PE2A 5AV0A 4I3ZA 4DGOA 5CY3A 3QC9A 4IAKA 2XJ0A 2FSLX 5CU2A 2XIXA 3R30A 2BIYA 2AYPA 5AM7A 3G9NA 3KL8A 5K3YA 3W8QA 4FT0A 3GU5A 4DT8A 4EH5A 5AUXA 2EVAA 3G33A 3U51A 3KA0A 2QG5A 3ORXA 5HLNA 3RAIA 3BHYA 1GOLA 5AX9A 1PF8A 3FEGA 2BZJA 3MFUA 3HRCA 4YC6A 5F95A 4BY9E 3TKIA 3C4XA 4PP7A 2YIXA 3EJ1A 4O0WA 1H0WA 2ITYA 2WELA 3MSSA 4TYIA 5KKRB 1H1SA 3EFLA 1F5QA 4MNEB 2XM9A 2VTPA 4YJVA 3NW6A 3LFEA 5DR2A 3CJGA 4C4EA 3DQXA 4MXAA 5J7BA 5IQBA 2OBJA 3DK3A 5AUYA 2G2FA 4G31A 1VYWA 1MQBA 2FB8A 3VHKA 4XYFA 3SRVB 4CRLA 3LFDA 4CSVA 2HAKA 1JPAA 3MPTA 4GG7A 3MV5A 5HCXA 4EOOA 5EQEA 3TNPC 4ZS0A 3RPVA 4E6AA 5J79A 4G2FA 5GIOE 2ZM3A 4AA5A 3KRRA 5CU0A 3PXZA 1SVHA 4D5KA 4C02A 4EC8A 4FSNA 5H3QA 1G5SA 2ERKA 4FV5A 4BTKA 5L2TA 4ACMA 4IWPA 1JSVA 2RKUA 3GU6A 1PMNA 3DBFA 4A07A 1Q8TA 3QKKA 4UMUA 2ZM4A 3EH9A 4FNWA 2O2UA 3QALE 1KE5A 1SNXA 3BPRA 3R00A 3BU3A 4GT3A 5L2QA 4O7YA 1XKKA 5E90A 2Q0NA 2IW8A 1OIRA 4F1OA 2V55A 3TNHA 1W98A 4C57A 2A19B 5HQ0A 2QVSE 3DBCA 4GT4A 2I0VA 1UNHA 3V6SA 3WZUA 3O96A 3RPRA 4QMQA 4MF1A 4IX3A 4R77A 5DGZA 5LVPA 3CQWA 2V0DA 4GUEA 1JKLA 4PDOA 3TIYA 4O1OA 5C8KA 5HE2A 4GH2A 3GQIA 5AX3A 5FM2A 4BDDA 2UW9A 5A6NA 3AC5A 3AC2A 4E4XA 4OAUC 5AMNA 1BLXA 2Y4IC 5DH3A 4TYEA 4YC8A 3ZLSA 3O50A 2Y6OA 3HGKA 5FP5A 4E73A 3EN4A 3NNUA 2OXXA 2YCQA 2XBJA 1WVWA 4XUFA 4DGGA 3GOPA 3WYYA 3CEKA 4CGAA 1ZZ2A 3DAJA 4JR3A 5CAOA 2XK9A 3PXYA 4DA5A 4R78A 4H1JA 4XV1A 1JNKA 2XS0A 4UEUA 5B0XA 4CKJA 3U6HA 5TKDA 4GKIA 3MB6A 5IUGA 1QPEA 5DPVA 3TNWA 2C1BA 2JKOA 3EKKA 4G9RA 4U45A 3G15A 5C4LA 3NUSA 4DBNA 4JBQA 5FDPA 4HYSA 3VUMA 3D5UA 2YN8A 4YJPA 3BU5A 4I20A 2Z7QA 2VGOA 4MEDA 2XKEA 3VIDA 4B4LA 3LFQA 5F94A 2YCFA 3QXOA 2E9OA 3C0IA 4PNIA 1YDSE 4FMQA 4EZ3A 2J4ZA 2HZ0A 5KZ0A 5AAFA 4RVLA 3MW1A 5K4IA 2F2CB 4LM5A 2XNOA 4U44A 5A4EA 3AC1A 1IRKA 3ZLXA 3BKBA 4WNPA 4M67A 3WE8A 1K2PA 4I24A 1KWPA 2RFEA 3UC3A 4AGCA 3VRZA 3FMMA 3TN8A 1FINA 3I0QA 4PTGA 4IIRA 4MD8E 1NVRA 3W55A 3N4TA 3IOKA 4ANNA 2YAAA 4PUZA 5DBXA 5D7AA 3UO6A 4HOKA 2WD1A 4IFGA 5HU3A 5LWMA 4BR3A 5C03A 4ASEA 1IA8A 4QPSA 3DU8A 1UKHA 4TWCA 4OTDA 4W9XA 4Y73A 1Q24A 3D9VA 1OKZA 2PWLA 4ARKA 3OWPA 1XBAA 3V5QA 5CSPA 3C5UA 4LRKA 5CAVA 4EK4A 4WRGA 3RWPA 3FMDA 5CT0A 2REIA 1IEPA 3C51A 4FSMA 4AFJA 4E5AX 5CU3A 4HVIA 3K5UA 3OTUA 3P9JA 4BCPA 4DFYA 5JZNA 3P0MA 1APME 4BDEA 5LMAA 2C6KA 5IA0A 2GQRA 3LLAA 4TNDA 5IQCA 4G9CA 3QTWA 4LGGA 1UNLA 3D7TA 3TACA 5BNJA 4FSUA 4C36A 3KF7A 4ZLZA 4ANMA 2WOTA 1WMKA 3L9MA 2QONA 2WMQA 3CC6A 4XEYA 3R7YA 3FC1X 4U97A 5ANDA 3O71A 1SVGA 1ZYLA 2GFCA 4JQ8A 3HNGA 3ZDIA 5M4FA 2AUHA 3FSKA 4GVAA 2OJJA 2WMWA 5CNOA 4CV9A 4JX3A 2C5NA 2ZMDA 3PJCA 4D28A 2QOBA 4K1BA 4KKEA 1QMZA 3GC0A 5DNRA 4C4HA 1S9JA 3S95A 3F7ZA 4ZTMA 4R5YA 5HVYA 3R9HA 1YDRE 4MWIA 2CN8A 1TQMA 2F4JA 3FKOA 4FIEA 2FVDA 3BU6A 3QRKA 3S3IA 3KULA 2FO0A 4KA3A 1ZLTA 4I4EA 4QQTA 2IVVA 4RWJA 2QR8A 3GCPA 4DINA 2VD5A 4D2SA 3RWQA 4F0FA 1WBSA 2WO6A 1PXKA 3PA3A 4KBCA 2PK9A 2PMOX 3R1NA 4IBMA 4QQJA 4WHZA 3ZRKA 2XNMA 5TOZA 3WE4A 2VWWA 1UU7A 1RQQA 4YBKA 4FR4A 3FY2A 3FZRA 4QP4A 4UWYA 4QMVA 2QOIA 5EYDA 3CTHA 3R9OA 2VTLA 2FYSA 1IR3A 1J91A 3NCGA 4W4VA 4BCKA 4KABA 2J0KA 4ITJA 4CCBA 2ITVA 5EHOA 2IJMA 3PPJA 3BQCA 3CPBA 3ZRLA 4FIIA 3R01A 5CNNA 4FTNA 3VUKA 3UTOA 4ALUA 1Y8YA 2YCRA 4EHGA 4Q5EA 2PVLA 3MTLA 3TWJA 4C4FA 5AA8A 3RPOA 1B39A 4NKSA 2DUVA 4QMUA 3AC4A 4IM0A 3S1HA 4RJ4A 4QYFA 4UMRA 2OJFE 5JFVA 3DV3A 2R9SA 2GTNA 2WQBA 3OUNB 3R6XA 1ZMUA 3VS7A 3OBJA 5AV3A 5AP1A 3MBLA 4E6DA 4EH2A 5AP4A 2G01A 2C68A 3DB6A 3MGYA 2BDFA 4YSMA 4J52A 4F9WA 3F3TA 3UVRA 2X8IA 5JFXA 4R1YA 3KY2A 5ETAA 3OWJA 4B8MA 4XG9A 3SKCA 3MFSA 5ETIA 3VBQA 4JXFA 3SOCA 3QGWA 4NTTA 4ALWA 3QRTA 2X1NA 1SVEA 3LQ8A 3D5VA 2J51A 3FY0A 3R2BA 3GC7A 5ACKA 2R3FA 5B2LA 1BUHA 2CLXA 2HWPA 4QNAA 3PZHA 4GYGA 1OECA 3FI2A 4FX3A 4ANSA 4MHAA 4RJ5A 5DE2A 4FKOA 3I7CA 1RE8A 3E7OA 3QD4A 5FEQA 4RIXA 1I44A 1H08A 3BGZA 4DFXE 5AV2A 4TYHA 3QFVA 2BCJA 2UW5A 5AIRA 3ZXZA 4AAAA 4EZ5A 1PXOA 3MH1A 1ATPE 3F5UA 1OPLA 4ZSEA 5C1QB 4XV3A 4AW1A 4CG9A 3KQ7A 4IW0A 5EM6A 1YXSA 5JGDA 4EORA 2QI8A 3KRJA 3VAPA 4BCNA 1Q97A 1XH7A 5IQHA 1H1PA 4TXCA 4QQCA 3N4VA 1GZ8A 3G9LX 4PPAA 3NWWA 5H2UA 3F5PA 4I23A 3UODA 4UMTA 4ZZOA 3KGAA 3ROYA 3OWLA 2WPAA 5JMSA 4KSQA 1Y6AA 1T46A 4J8NA 4IAZA 5J1WA 3SAYA 3I6UA 3QKMA 2J50A 5KNJA 2C1AA 2C69A 2YM7A 4RJ8A 5EQPA 4XCUA 3FMKA 5KMIA 3A4OX 3HRBA 3OEZA 3PVWA 2R3NA 1E1VA 5GINE 3GXLA 4HZSA 2B9HA 4BIBA 1UKIA 2ZAZA 1STCE 1OITA 4RJ3A 5E8YA 5AR4A 4E6QA 5K5NA 4I0TA 5KMLA 4W8DA 3PE2A 2JFMA 4RC3A 4FKGA 4W8EA 3ID6C 2C0IA 3PRFA 4X21A 1F3MC 1YRPA 3ENMA 4G3EA 4BI0A 5EOBA 4IVAA 2WEIA 3QTZA 5IQAA 3LE6A 3JUHA 3A8XA 4FEQA 3R8UA 1O6KA 4FIJA 4E4LA 4WA9A 3F5XA 2XK6A 3OG7A 4GIHA 4KIQA 1GIIA 3S4QA 4C61A 2WTDA 4DEAA 4R6VA 1LUFA 3H9FA 3MIAA 4CMOA 4BIEA 2O8YA 5CSHA 1XR1A 2E2BA 4E4NA 4IAFA 5DWRA 1H1WA 4APCA 3NYVA 3DJ5A 4OBQA 4DCAA 3EN9A 3PZEA 2F2UA 2YISA 3HV4A 3LLTA 3OC1A 3OD6X 5EDRA 4LQMA 5CLPA 4HYHA 2Z2WA 3LM0A 2XYNA 4JDIA 2SRCA 4HJOA 4MTAA 3OZ6A 5CXHA 5FD2A 3VN9A 3F2NA 5KBQA 3FLZA 2WAJA 4TKSA 4RIYA 3QQJA 5DI1A 3WZJA 4PDYA 3P79A 4EOMA 3AT4A 4UMPA 4RGJA 3TV6A 4AT3A 2RFNA 5EKNA 2ONLC 2UZDA 5KE0A 2XH5A 3R8MA 3FBVA 5EYMA 5BVEA 5HX8A 2G1TA 3OVVA 3GENA 4QRCA 3KCFA 5K9IA 4TNBA 3V01A 2UZWE 4BHZA 2QLUA 4ZTHA 3TIZA 3MJ1A 2XIRA 3CTJA 2BRMA 2Y0AA 2ITTA 3IPHA 3ORKA 2WNTA 3IGGA 4OBOA 5TR6A 4RG0A 2I0HA 3FDNA 3MFRA 2FSMX 3BCEA 3DA6A 3VUHA 4JDHA 3WILA 4HVHA 3B8QA 4FV1A 4QYYA 4QTCA 5KMJA 4HCUA 4WOVA 1XJDA 3AGMA 3NYXA 3DAKA 3OY3A 4HYIA 4DH5A 5AUTA 4B7TA 3QA8A 4QTAA 2X9EA 3RVGA 4GRBA 4O96A 4I93A 1M7NA 1MUOA 5HORA 4O0VA 4H1MA 5F20A 3TDVA 3GBZA 1H0VA 3OROA 2JGZA 4G34A 4D9UA 4YUQA 2W1CA 3HRFA 5ANKA 5DN3A 4XNEA 3U54A 3WF8A 1YXUA 2YHVA 4EH6A 4U42A 4AZVA 1OZ1A 3CR0A 4C35A 4E93A 5CAPA 5JZJA 4I94A 3QQGA 5EK7A 5C4KA 4RFZA 3IO7A 1Y8GA 4BRXA 3R0TA 4IB3A 2O5KA 5FTQA 3UDBA 3TG1A 5IA1A 4RZVA 4TYGA 3B2WA 3OW3A 4C34A 3Q2MA 4CKRA 3LCSA 3LW0A 4PY1A 5J8IA 2BAQA 3A99A 5JQ8A 4EJ7A 1S9IA 2PVNA 4JOAA 2WQOA 2OK1A 5I9XA 3NW5A 5A4CA 1UA2A 3PG1A 4Q2AA 5I0BA 4DCEA 3OOMA 3DLZA 4MAOA 5CEQA 4AZTA 3ANRA 5M4CA 1L8TA 3L8PA 4D2TA 5I9WA 3BYVA 3MA6A 4Y46A 3TJDA 4ZLOA 2YDKA 4JVGA 3U9CA 1PYEA 5AUWA 2J0MB 2CMWA 3PP0A 4NT4A 2GNHA 5G1XA 5BVDA 2G2HA 3EN7A 5EM5A 2HXLA 2ITPA 4O82A 1YDTE 4NM5A 5IG1A 4DG0E 2W4KA 4RC2A 4FT5A 4JDJA 3O8TA 3FL4A 4DTKA 3ZOSA 5IDNA 2XIZA 3EFKA 4X3JA 3LHJA 2PZIA 5CEKA 1YI6A 1M52A 2R3IA 5ANOA 4YTHA 5L6OA 5EDPA 5EH0A 4FV6A 5DEYA 5FWKK 3WIKA 4CZYB 4WBOA 3TL8A 4BGHA 4TL0A 4Z3VA 2X2LA 1VZOA 4RX7A 3HZTA 5J95A 2IW9A 2XRUA 4DE4A 5CXZA 4XV2A 5CI7A 1GJOA 1HCLA 1B6CB 2LAVA 3HVCA 1H01A 5HLWA 3ZRMA 3BHTA 3ZU7A 3VS4A 3ZBXA 3AOXA 5BQ0A 5J9YA 2VWIA 1M14A 4KUJA 4MYGA 4FKIA 3NCZA 4DLIA 5KMKA 2B1PA 4ORKA 4J8MA 3EQHA 3RPYA 3Q6UA 3Q60A 4O6LA 4UALA 3BWFA 4I1ZA 1P14A 3PSDA 4G6NA 3SW4A 2ITUA 4ACCA 4DH1A 3COIA 4CD0A 4NSTA 4LOPA 3O51A 2XK4A 1OUKA 2HENA 3DNEA 4NIFA 4QMWA 4QNYA 3W2RA 4ACDA 3DBQA 4UX9A 4DEHA 3RK7A 1PHKA 4JNWA 4TN6A 3NS9A 2Q83A 3COKA 4Y95A 3QUDA 3W1FA 1BX6A 2C6MA 4KKHA 5E8ZA 2PVHA 1FGIA 2RFSA 5EW9A 5M53A 5DG5A 2BROA 1PW2A 2VU3A 5H8GA 3R04A 1XHAA 2BTRA 4UMQA 3ZMMA 2QD9A 4QP6A 2WMAA 1OMWA 3RP9A 3PJ8A 4FV8A 3VULA 2VTMA 4RZWA 2B7AA 4P2KA 4B9DA 4FVPA 3QTQA 4BC6A 3PWYA 4Z7HA 5IA3A 5LVOA 4OTRA 4ZJVA 5CEOA 2H8HA 2O65A 3F61A 5LMKA 5E9EA 3D4QA 5I9YA 5JKGA 3AGLA 4D55A 1CKIA 1ZARA 3ZEPA 3PFQA 4PV0A 3TCPA 4DN5A 3OOGA 2J7TA 2WTKB 2YWVA 1ZMWA 3ZTXA 5IA4A 4AGUA 2A2AA 4FKVA 1UV5A 2JBPA 3UGCA 4Q9SA 2W1HA 3OW4A 3QD2B 3QUPA 3BE9A 4TWNA 4X3FB 3DKFA 2W1GA 1P2AA 3KRWA 3V51A 4BCMA 4KS7A 4BYIA 2V22A 4USFA 2V5QA 4F09A 3NUAA 4R5SA 3POOA 3NUXA 4F6UA 2GHGA 2P55A 2B53A 2OH4A 4RT7A 1IA9A 4YZMA 2CKOA 1Y91A 3FV8A 3VUGA 4RA4A 4ZSLA 5BVFA 2OLCA 3DK7A 4FV9A 1JQHA 5CSXA 5AUUA 2WTVA 2H34A 4C4JA 4FSTA 4AF3A 3QCXA 4O7LA 3L8VA 5DRDA 4Q9ZA 2HIWA 3EQDA 2H96A 4P90A 4GFMA 4UXQA 1URWA 3TT0A 4CYJA 5AM6A 5HESA 5L6PA 2A27A 3DBEA 4FKRA 4FSWA 5B2KA 4YMJA 3QRIA 4L45A 3EN6A 3T9TA 4AACA 4AGDA 4AZFA 4BDJA 2BTSA 4C4IA 3UJGA 4BWKA 4JAJA 3ZC5A 4K6ZA 4R7HA 4MXOA 1A06A 2EU9A 3KCKA 5AP5A 5L2SA 2I0EA 3LCDA 2VN9A 1HCKA 2PE1A 2R3LA 2JEDA 3C4WA 4K77A 5ETFA 3MVJA 2YIQA 4M84A 5HG5A 3ZO2A 5J9ZA 3JR1A 4IFCA 3UZPA 4AG8A 1MRVA 3U87A 3NNXA 2R64A 3TUCA 2R3GA 4BCGA 4I5CA 2WMSA 3TKUA 3K3JA 1ZOGA 2UZNA 3MFTA 3O8UA 4CTBA 2CHLA 2OZAA 3R73A 4BWXA 2C3JA 5CF4A 2YWPA 3MH2A 5HNBA 5K4JA 4I92A 4ZTLA 3JY9A 4J97A 4G5JA 3U9NA 5DYJA 3P7BA 2X8EA 2V62A 3H9RA 2WB8A 3HUBA 3CQEA 2XA4A 1PXLA 4FV0A 5E1EA 4DHFA 4F63A 5AAGA 3R9NA 4CXAA 2BDWA 3VVHA 3HEGA 4ZY6A 4AWIA 3UOKA 2BILB 2R3RA 3ACJA 1A9UA 4FVRA 2JLDA 4AA4A 4ALVA 4QTEA 4O7NA 3A62A 5HO8A 2BUJA 1UU9A 4CFMA 4CLIA 3IQ7A 2ZDUA 2VO6A 3PA4A 2BIKB 3PG3A 3RMFA 5HU9A 3RZFA 3FL5A 4X6QC 4EEVA 5HIEA 4FZ7A 4IJ9A 4MCVA 5LOHA 5M06A 3I0OA 3MJ2A 4S30A 2OFVA 2YJRA 5L2IA 4GSBA 3WF9A 1KE6A 3R2YA 1YHSA 2GFSA 1KV2A 2EUFB 2B9FA 3KN5A 2WQMA 3Q4ZA 2XCKA 4RRVA 4ACHA 3ZCLA 4GK4A 4IC8A 3V04A 4BBFA 2CJMA 2E9VA 4XS2A 5IQEA 3KFAA 2W1FA 5HLPA 5JFSA 3ITZA 4DLJA 2O3PA 3BYUA 3WBLA 4X2KA 4D4SA 4O7VA 4CKIA 2OI4X 3RCDA 2VNYA 5M51A 5T6KA 3D83A 3E93A 4L3JA 5EM7A 4U9AA 5FLFA 1JSUA 3RTPA 3WF7A 4IH8A 3KXGA 4QYEA 4IWQA 3LKMA 2IVTA 4O7SA 1Q62A 2VO0A 1AD5A 1UU3A 5AV4A 4KWPA 2DQ7X 2PMIA 3ORLA 4N6ZA 4AFEA 3V5PA 3MESA 1CTPE 1V0PA 1WBOA 2CGUA 3VNTA 3HX4A 3RCJA 3OCBA 5JEBA 4OR5A 3THBA 5HBHA 1WBWA 2EWAA 4U80A 4QMMA 4BBEA 1M2QA 3PYYA 1SZMA 3DZQA 3QTXA 3RHXA 1O6LA 4FK6A 3VQHA 3QLFA 3A7FA 2QC6A 2X2KA 3BBTB 5M44A 3QKLA 4L3LA 3QRJA 4FT9A 4ASDA 2Y4IB 4BCJA 4YJQA 3IW7A 4L68A 1ZAOA 3IS5A 3OS3A 1M7QA 1YWVA 1YKRA 2E9NA 3GU7A 4JDKA 2YM6A 4KRCA 4EH9A 2G2IA 4EHVA 5D9HA 4EC9A 3UQFA 5FUTA 3Q4UA 4BIDA 3KRLA 4J53A 3QRUA 2IZTA 5EHYA 3E7VA 3AC3A 3RNIA 4CCUA 1SYKA 4O21A 4IAIA 4S31A 1G8SA 4ZOGA 3NRMA 4O7ZA 3WOWA 4XOYA 5LCJA 2W4JA 3PXQA 1BYGA 4I22A 3T3VA 4O22A 3BYSA 1SNUA 1U54B 4MF0A 5FRIA 3VS5A 1OKWA 4YJSA 2JKMA 2ACXA 2WFYA 5C01A 1U5RA 5BVKA 3MWUA 4ZMFA 2WTJA 2IZUA 3OP5A 3DXNA 3EYGA 5CASA 3JYAA 3OHTA 4MD7E 3NNVA 3ZLYA 2PVKA 4D2PA 4FTLA 4C59A 3MY0A 3Q9YA 3SRVA 4L7FA 3WIGA 2BZHB 3HDMA 4ACGA 3P5KA 4XP3A 2X7OA 3A7JA 2VV9A 4I6HA 5IKWA 3KMMA 3P4KA 4U6RA 2E9UA 1BL7A 2W7XA 4D1SA 5HTCA 3LJ1A 4YZCA 3BYMA 2GDOA 4ZSGA 4MNFA 5BVNA 5ANGA 4HGTA 4HYUA 2RL5A 4ZXTA 3QTUA 5HGIA 4CMTA 2BVAA 4NW6A 5CVHA 3MDYA 4Z16A 2WEVA 2PMNX 3QYWA 3S2PA 3NDMA 1JSTA 1NVQA 1WCCA 3ZLWA 3FQSA 1H27A 5EW3A 4RVTA 3PRIA 4H3QA 4CFUA 3VW6A 3BELA 2PPQA 3FQHA 4LFIA 2OF2A 3MB7A 3BLHA 4FSQA 4BGGA 3KK9A 2GQSA 5A4QA 3M1SA 1J7IA 4FTJA 5L8KA 4PMTA 4BI1A 4IE9A 4QP8A 3UOJA 2XB7A 3O0GA 3NVMB 2JIIA 5AR8A 4C3FA 2IW6A 5FXSA 3A4PA 3DNDA 3RNYA 5LARA 2QCSA 2OJGA 3KN6A 5IH6A 4N4SA 5IQGA 2HY81 4FOCA 2NO3A 3BGPA 4FVQA 4V04A 1H26A 2VTTA 1Q8YA 2EB3A 3CCNA 4NKAA 5CU6A 1XO2B 3R9RA 3KMUA 2QU5A 3RM6A 2VZ6A 2ZDTA 2VWZA 5AV1A 5EOLA 2X9FA 5CENA 1URCA 1J3HA 3GCQA 2PU8A 4WSQA 4IQ6A 4GFOA 3FC2A 3IDBA 1RDQE 4FC0A 5T68A 1YXVA 2PZYA 3CLYA 4IDTA 3QTIA 3MYGA 4FKPA 4C58A 1W0XC 4KBAA 2HCKA 2FGIA 1ZZLA 4FV7A 4AW0A 4II5A 2P33A 4O81A 1OBDA 1REJA 1E1XA 3DAEA 4LYNA 3ZXTA 3FE3A 3PJ1A 1PRYA 4LL5A 3PA5A 3Q9XA 4GJ3A 4WBBB 3L9LA 3QLGA 4NWMA 4ZZNA 3I5ZA 4C3RA 1ZOHA 4FTCA 3FI4A 4ZSJA 5HNIX 5E7RA 4ENYA 1XH6A 2OH0E 1LP4A 1H28A 3CKWA 4E1ZA 1IASA 1YWNA 4NZWB 2PL0A 2HXQA 2QHNA 3U55A 3U4UA 4L52A 4DFNA 2Z7LA 3O7LB 3E8NA 3M42A 2J0LA 1P4FA 4Z9LA 2XK7A 4U0IA 3AD4A 1GZKA 2YDJA 4FA2A 4EH4A 4H39A 3GFEA 3ZDUA 3FJQE 5BYLA 3MVLA 1WBTA 5TT7A 3VBXA 5M4UA 3D7TB 5BMMA 4AX8A 3V8SA 3UYTA 3ZM9A 4MVFA 3NMUF 3M11A 4BGQA 5JT2A 2XVDA 3FKNA 1Q5KA 2QODA 4B6LA 3GCUA 2AC5A 2C6IA 3EKNA 3PWDA 4AUAA 5BMSA 2UVYA 3ETAA 4FIHA 4BKZA 3Q53A 4KIOA 4OGRA 3CY3A 4CFXA 4DEIA 3LQ3A 1YWRA 3DS6A 5KBRA 2PZRA 1M17A 5DR9A 3KEXA 1ERKA 3FMEA 1WZYA 3NUNA 4KBKA 4OLIA 2YERA 2HZIA 3W8LA 1FQ1B 1ZYCA 3OTVA 4QYGA 3RINA 2P2HA 1XBBA 3AMBA 1JOWB 3QQKA 5IA2A 5E4HA 4BN1A 2R3KA 3AC8A 2OSCA 3UP7A 5KMOA 2XNGA 3UNZA 2PSQA 4YHFA 2YCSA 5EYKA 3KULB 4E6CA 4BFMA 5A6OA 5J5SA 2CPKE 3DB8A 1VYZA 3SOAA 4RQKA 4ZS4A 4IADA 2I6LA 3E8EA 4QMNA 1PXMA 3L8SA 2YDIA 3DLSA 4NCTA 2QNJA 2JC6A 2W9FB 3D5XA 3EQPA 4AGWA 4RIWB 4CV8A 4E26A 2QLQA 5D1JA 1OL1A 3NZ0A 4XG4A 5AP6A 3PIYA 5ANEA 5IH4A 5E8SA 3FHIA 3KKVA 5CWZA 3U6IA 4QMPA 3PY0A 5FGKA 1X8BA 4V05A 4AZWA 4U81A 4D2VA 3TM0A 4MK0A 3RJCA 4G3GA 3P86A 4TPTA 4YJRA 2W5HA 4USEA 4H36A 5M08A 2QOFA 3RPSA 5KX8A 4G1WA 2YLEA 4D4YA 4ZTSA 3QHRA 2B9JA 4LV5A 2JFLA 3BWJA 3HV3A 4G17A 2OJIA 4KD1A 3RAKA 4D9TA 4JG6A 2CCHA 3QAME 2ETKA 4F99A 3EQGA 4M68A 4IZAA 1IAJA 2UZBA 3CGFA 1WVXA 3KXMA 3FMJA 4JBOA 3DGKA 4FBXA 3VWAA 4OT5A 3WARA 1U5QA 3C13A 3EQBA 1SM2A 5CYIA 4AS0A 3PXRA 1KE8A 1WVYA 2JDVA 5J87A 2R2PA 4R7BA 5GIPE 4W4YA 3DZOA 4MBLA 4XG6A 4EHEA 3SA0A 4U3ZA 2VWXA 2G15A 3E87A 3NGAA 4UN0C 4YR8A 2Q0BA 1BKXA 5M56A 3U4WA 4ERKA 4A7CA 1KOAA 1FVRA 4G6OA 2RG5A 2XMYA 4C62A 1Q61A 3P7AA 4IZYA 2GTMA 5DLSA 1MRUA 1PY5A 2CDZA 3ELJA 3PY1A 2PZ5A 3A7GA 3BHVA 3BYOA 2WMTA 4IC7A 3COMA 2J0JA 2YM4A 3EIDA 1FVVA 4M8TA 4L43A 4TYHB 4CNHA 3NIEA 4CFFA 2XBAA 2YZAA 4RC4A 3EZVA 5C27A 3TV7A 2P2IA 2CCIA 3GGFA 5CTPA 2WQEA 3PP1A 4BWPA 5EDQA 3PJ3A 4FIGA 5HTBA 3K54A 3FWQA 2BALA 4RSSA 4CTCA 4I0SA 4L42A 4KKGA 2GHMA 1XH4A 4BCQA 2NPQA 4FV2A 5AR5A 2VAGA 4DFBA 2CKQA 5B2MA 3ORPA 2JIVA 2BRNA 4QPAA 5IA5A 4MKCA 4GU9A 4S34A 3DBDA 2C5VA 4MXCA 2CKEA 1V0BA 4YNEA 3EL8A 4EUTA 2BZIB 3CQUA 5CT7A 3ZZWA 4BDKA 2Y6MA 3R21A 3QWKA 4XRLA 3QGYA 4QTBA 4ZTRA 1ND4A 4EK8A 2UW3A 3E3PA 5C26A 4RIOA 3IG7A 3EQIA 5CQWA 5LVLA 4B99A 3NUUA 4IAYA 2X8DA 4L3PA 4BCHA 4AW2A 4DG3E 1OL7A 4RLKA 5GJFA 5HE0A 5FP6A 5DEWA 4E5WA 2UZVA 3QD3A 4CFNA 3IOPA 3OF0A 1GZOA 4O2ZA 4F6SA 4CYIA 4AT4A 2WMUA 4WT6A 5M55A 3MI9A 2ZV7A 4X0MA 4DH8A 2UUEA 3ORNA 4FTAA 2IVSA 4LI5A 4E20A 2X4ZA 3R9DA 4MX9A 3D15A 4UV0A 4K18A 5FDXA 1H24A 3HDNA 3IW6A 3LFAA 3R7UA 3LFSA 1IAHA 2ESMA 4RWKA 2C5OA 2OG8A 4U3YA 4XRJA 4Y72A 2NNWB 4AE9A 4O0SA 5L3AA 4EK3A 3FXWA 1ZY5A 1PXNA 3GVUA 5EM8A 2B52A 5AR3A 3CIKA 4EQCA 1G3NA 4KINA 3W2SA 2GNJA 3QZIA 4O1PA 2VTOA 3FPQA 1GZNA 4HCTA 4NM7A 2R3OA 1WFCA 4UZDA 4M0YA 1E9HA 2ITZA 3C1XA 3NYNA 5HKMA 3SQQA 3QZHA 2OXYA 3ORZA 3KF4A 4RA5A 5H9BA 5I3OA 2BKZA 3WF6A 3JS2A 3QTRA 4IWDA 1YOMA 3VBWA 3MVHA 4YNOA 2CGXA 3V3VA 2O63A 2JDSA 4H3PA 4FEWA 3PXFA 2WTWA 2X6EA 2UW4A 4RX5A 1UWJA 4O0UA 2VTHA 3UNJA 4EHZA 1Q41A 5J5TA 4Y8DA 1DM2A 2BRHA 4FUYA 5L2WA 4ZZMA 4P7EA 2X6DA 5CS6A 4QMSA 4A9UA 1WAKA 4QMXA 3SXSA 2HWOA 3I79A 3TEIA 5BUJA 1ZYDA 5D11A 4QMLA 4D58A 3SXFA 4I21A 3UVQA 3DOGA 3LPBA 2WOUA 4NW5A 5M07A 4ID7A 2PUPA 4HVSA 3BV3A 3Q5ZA 4OTHA 4BVUA 4JQEA 4LRJA 5HIBA 3G6HA 5I9ZA 2VWUA 5CX9A 3PVGA 4ZLYA 1Q3DA 4U8ZA 2FA2A 3SLSA 3FLYA 2OJ9A 2R3MA 4ZP5A 3JY0A 3SV0A 4YO4A 4OBPA 4BTMA 2ITWA 2I1MA 3L9NA 3BEGA 4C33A 1T45A 3RBWA 2YM5A 4YHTA 1H1RA 4EK6A 5IQDA 3LMIA 5AFVA 4KIKB 2GNIA 4XHKB 2VGPA 2R7IA 4BICA 3RAHA 4YLKA 3F82A 1PXIA 2YEXA 3MN3A 4DT9A 4RVMA 4DC2A 4RFMA 3H3CA 3KC3A 4NM3A 3OY1A 4WNOA 5LXMA 1I09A 3JXWA 4FL2A 4PL3A 5F1ZA 3WZEA 4OTWA 4D0WA 4KIPA 4EJNA 3PPKA 3VS3A 3MS9A 4CG8A 4IMYA 4XOZA 2R0IA 3NW7A 3OXZA 4FYOA 3VRYA 5CF8A 2BHHA 4YHJA 4TRLA 2ITXA 2PTKA 3ZUTA 3VS2A 4KNBA 4WUAA 4YTCA 2QKWB 3O7LD 1Q4LA 2YACA 3CTQA 3NEWA 2C6EA 3CJFA 3IECA 5AWMA 3SD0A 2C3IB 4U79A 3HA8A 2BZKB 5IZFA 4QP9A 3ODYX 2WIPA 4DTBA 4XBUA 3AMAA 4F0GA 2G9XA 1YXXA 4MXYA 3H0ZA 4QMOA 4OUCA 4NJ3A 2R3PA 4O7RA 3ZO3A 4JBVA 5AJQA 1H00A 2FUMA 4FUXA 5HE1A 3V5WA 4B0GA 4R3CA 3NUPA 1OKVA 3BLRA 3CD3A 3IW8A 4FV4A 2W9ZB 4FF8A 3T8OA 4EOQA 1KE7A 4Y5HA 2J2IB 3FHRA 5JGAA 3D14A 3W33A 3ATSA 1J1CA 4QP7A 3Q5IA 4DH3A 2PUIA 2YABA 4ZIMA 4BBMA 5LVNA 5CZIA 3FAAA 3U6JA 5DHJA 2DYLA 2ZB0A 1XH5A 1GAGA 5HVKA 3QZFA 3SW7A 4D4RA 2X81A 4FTRA 4JLCA 4HNFA 3G51A 4JJRA 4V0GA 4C4GA 4IM3A 4F0IA 3FQEA 1BI8A 4FG7A 4GK2A 4N57A 4HGEA 5FXRA 2C47A 3MH3A 2OFUA 3I1AA 5J1VA 5M57A 4O0RA 3KMWA 2B4SB 3R8LA 3V5JA 4FK3A 3BIZA 4CLJA 4YZ9A 4JIAA 4DG2E 1UU8A 4RX9A 2WU6A 3SDJA 3F69A 3FMNA 2WQNA 4BZOA 4OTPA 4FKQA 2RG6A 2RIOA 3GB2A 3QZGA 4FTMA 4O0YA 5FTOA 4IHPA 2V7AA 4KAOA 4AQCA 5EYCA 1PXPA 3EYHA 3BEAA 3A2CA 3Q2JA 4UB7A 2VUWA 2OKRA 2RGPA 3SX9A 4J1RA 4IX6A 1FGKA 5L6WL 2Z8CA 5GZ8A 4C0TA 1GIJA 2JITA 2VTIA 4LL0A 4USDA 2XNEA 3VO3A 4ANOA 1MQ4A 4XLVA 5AA9A 3PSBA 4PDPA 4YURA 1R39A 3RK5A 2R3HA 1QL6A 4QP3A 2ZV9A 4FTUA 3FLSA 4XX9A 3HECA 1J7UA 3KXNA 4F9YA 5D41A 4DFLA 4E3CA 4PNKA 3FMHA 1GY3A 4HPTE 3Q04A 4J71A 3KRXA 4O27B 2Y4PA 3GC8A 4O6EA 4O83A 4M3QA 2WGJA 1DAYA 3PTGA 4M7IA 3VF9A 3PXKA 3ZYAA 5L4QA 3C4CA 3QQFA 5HD7A 1RW8A 3F3UA 4CZTA 5I9VA 2WMXA 1R78A 4FNYA 3V5TA 3H4JA 4MQ1A 5ICPA 5L8JA 4WNKA 3NLBA 4GV1A 3UBDA 4CEGA 3C0HA 3UC4A 3FI3A 4FTKA 1W83A 3R1SA 4D5HA 4ANLA 5BX0A 3N4UA 3ZUUA 4DGNA 4FNXA 4A9TA 4NTSA 4WG4A 3AD5A 1GNGA 3IGOA 5HG8A 3A60A 5JRSA 2XF0A 4EKLA 3UPZA 4FEVA 2OF4A 2A1AB 4QT1A 4NUSA 3I6WA 4XG2A 2WTCA 4IB1A 2GCDA 2R3JA 3B8RA 5ANIA 4J7BA 4ONAA 3ZZEA 5LMKC 4BCOA 4FKWA 1K3AA 4FICA 1G8AA 3VW8A 3KU2A 1H4LA 2QOQA 2DWBA 2OZAB 1FVTA 4YPSA 2PVYA 3QF9A 2PZPA 5ACBC 4HPUE 4HCVA 4UWBA 1ZOEA 2WMVA 4IVCA 2E9PA 3L1SA 3E92A 2J0IA 3R1YA 5KZIA 4IZ5A 3F3WA 2QO9A 4O38A 5IUIA 3V6RA 5TO8A 5IQFA 5HZNA 5AUVA 3GEQA 1QPDA 4IEBA 4X2GA 1CKJA 3FLQA 1QPJA 2YFXA 2ZVAA 1CMKE 3I4BA 3REPA 2XYUA 2ITNA 1A48A 3C7QA 1XQZA 2J6MA 2XK8A 4M66A 5GZ9A 4AN9A 4EZ7A 4MBJA 3PVBA 2CNQA 3HA6A 1Y57A 4CQGA 2CKPA 4A4LA 4Q5HA 4YBJA 3IDPA 4GK3A 4JT3A 4JI9A 3RKBA 4FOBA 2R7BA 4F6WA 2C4GA 3V8WA 4HNIA 4NH1A 3CD8A 4MBIA 3QX4A 2HYYA 3BX5A 3F2AA 4FSZA 3LVPA 4XP0A 5JQ5A 2FH9A 4BL1A 5LWNA 4J96A 3DKGA 4QMTA 3W2QA 4BCFA 3WYXA 4GKHA 4DGMA 3TNQB 3E8CA 4M14A 2OO8X 2OICA 3E63A 5JK3A 3GU8A 1WBNA 1YQJA 2XZSA 3QWJA 4U7ZA 3VF8A 4FKTA 1YW2A 2B54A 3EL7A 2I0YA 4XBRA 3QUEA 4UY9A 2VX1A 4EWHA 4M0ZA 5JSMA 2ITOA 4PMSA 4X2JA 5DT3A 3NVKI 2Y9QA 3DDQA 5F9EA 1KV1A 5EI8A 3GP0A 2IN6A 4ANBA 3VJOA 4H3BA 3FXXA 1JKSA 1DI8A 1LPUA 4O7TA 4PDSA 2J9MA 3R7OA 3D7ZA 5GJDA 2W1EA 4Y83A 2UZTA 3KXHA 5E8WA 2B9IA 5D7VA 3NAYA 1OL5A 3Q4CA 2BDJA 3I7BA 3ZH8A 4M69A 3Q6WA 2ERZE 4TYJA 5AEPA 3Q32A 5GHVA 4FZFB 2VWYA 4NFNA 5C8NA 1R0EA 3ANQA 2DS1A 2GPHA 2VTNA 1Z9XA 4YLJA 4GIIA 4X2NA 4Y85A 4I0RA 3CE3A 3S00A 3T3UA 3QD0A 5A14A 3C4FA 4O2PA 3TUBA 3QCSA 2IVUA 4BTJA 5E8TA 3TI1A 2WHBA 5DRBA 4K9YA 4EWQA 4ZY4A 2VWBA 3VUTA 2IG7A 3DJ7A 4NYEA 5IMXA 3OCGA 2UVXA 3W2OA 3SC1A 1OL6A 4WG5A 5A3XA 4YO6A 5DMZA 1AQ1A 3IW4A 4OT6A 4MNEA 3ORTA 4YTFA 4HZRA 4G3DA 4P5ZA 3DY7A 3MVMA 3OXTA 4J99A 4UXLA 4FEXA 3ULZA 5IEYA 3QX2A 3DXPA 2OIQA 2PVRA 3A8WA 4X7QA 3G0EA 2F7EE 3ZFMA 4AT5A 2B55A 2IZRA 4YJOA 5CQUA 3UIUA 3IDCA 5AIKA 5DT4A 5HX6A 4LOOA 2X39A 3PUPA 3MPAA 3R7EA 4TZRA 4ASZA 3FZSA 4PX6A 4BTFA 5CEMA 3RK9A 2UW7A 2JKKA 3D2KA 4KSPA 4AU8A 1U54A 2UV2A 5M4IA 4MWHA 3B2TA 3ROCA 4RVKA 1TKIA 4XMOA 4TTHB 1CKPA 2QOLA 2QG7A 3WF5A 3E64A 5AR7A 1YXTA 2JIUA 2ZV2A 2C6TA 1JVPP 4AZEA 2X4FA 2GSFA 2GS6A 2QO2A 4C7TA 5KO1A 2YLFA 4R7IA 2XKFA 5C9CA 4QMYA 5GNKA 3W2CA 3ZFYA 3BV2A 1R3CA 1U46A 5HG7A 4XP2A 4F4PA 2AC3A 4EOPA 3O17A 3AXWA 2C6DA 3LXLA 5IQIA 4JS8A 1REKA 4RPVA 2UVZA 3CSVA 2W4OA 4L46A 4GEOA 2F9GA 3LCKA 4UWCA 2BPMA 5AP0A 4EQUA 1KSWA 5B7VA 3RHKA 2EXEA 2Y8OA 1PMEA 2ETRA 4G16A 2PVFA 1EH4A 3EOCA 3WZDA 1JBPE 3QQLA 1FOTA 4FG9A 4WIHA 5D10A 3GFWA 2W96B 1O9UA 3HP2A 4EQMA 5KKRC 4DEGA 4A4OA 4IM2A 4L00A 1M2PA 2W5BA 3HP5A 1H25A 3FUPA 3IONA 2JD5A 3HMIA 4FSRA 5G6VA 4BDFA 5L8LA 4QOXA 3FXZA 2VTRA 3PJ2A 4J98A 4FGBA 3DFCB 3JPVA 5EKOA 1CSNA 4O0TA 3RI1A 3UPXA 4OTIA 3IK3A 3POZA 3DPKA 3CXWA 4FKUA 3QA0A 5E91A 5FEDA 3U8WA 3VBYA 4ASXA 4P5QA 3C0GA 4KS8A 4X6RA 4ENXA 3CPCA 5A4TA 2C30A 3LFNA 3ZSGA 2VTSA 5CAQA 3LOKA 5H8EA 2PYWA 4IJPA 2R4BA 3V8TA 3BZ3A 4FZDB 5AUZA 4BDBA 4A4XA 2V7OA 4LRMA 3VUIA 1ZYJA 2W17A 4RWLA 3Q9ZA 4WO5A 2CSNA 2WU7A 4A9SA 2QO7A 1U59A 1KUTA 5CI6A 3ATTA 4GS6A 4F65A 5IMEA 5KMNA 5AP7A 4EH3A 1RJBA 4LGHA 4QQ5A 3AT2A 3D0EA 3K5VA 4ZTNA 4HGSA 2C6LA 4QMZA 4ZTQA 3UMXA 2X7GA 2UZLA 4XG3A 3UIXA 4FL3A 4APPA 4W4WA 4F9AA 5DA3A 3QYZA 2JDRA 3W16A 4NM0A 2BFXA 2ZV8A 3SXRA 3F7WA 4TT7A 4GCJA 4UYNA 3LIJA 5LQFA 4C38A 4YSJA 1Y6BA 3ZO1A 3GU4A 3GI3A 2QKRA 1PMVA 2NRUA 3UVPA 4EH8A 4YP8A 2ZYBA 3LCOA 3JVSA 3GCSA 4F7NA 1GIHA 3QCYA 4PTCA 4CVAA 4FTQA 3DKOA 5EG3A 5BVWA 2VWVA 3O8PA 1Q8UA 4KB8A 3FYKX 1PKDA 4NU1A 4I5PA 2X2MA 4PQNA 4F7SA 2WTIA 3L8XA 2LGCA 1OB3A 4YJUA 4YLLA 3UOLA 5I4NA 3OMVA 3MTFA 3W10A 5FEEA 1XWSA 2HK5A 3DTWA 3UZRA 3TJCA 2PY3A 1Q99A 4FL1A 4FTIA 3ULIA 4MXZA 2EXMA 5HHWA 1M2RA 1J7LA 3IKAA 2HELA 5EI6A 1XH9A 3R7GA 2F57A 2ETMA 4YTIA 1BMKA 4CZUA 3OCSA 4WD5A 3HMMA 2CGVA 3F6XA 4GVJA 3QBNA 4V01A 3TNIA 4ITHA 2VX0A 1CM8A 4AZSA 3BLQA 5I5ZA 1PYXA 2CN5A 4K0YA 4OTFA 4WG3A 5KHWA 4BDGA 5EQYA 5A46A 4AN2A 3VUDA 4AA0A 2KTYA 3ZSIA 4FODA 1JWHA 3R7IA 3TTIA 2I7QA 2F7ZE 2NRYA 1DAWA 4IDVA 3P78A 4KRDA 4D1ZA 4FI1A 3FI8A 1JLUE 3TV4A 4A06A 3BHHA 1NY3A 3VQUA 3EQCA 3UE4A 3QTSA 4D4VA 5AP3A 2OIDA 1OVEA 1Q8ZA 4IX5A 5AADA 4PRJA 4XJ0A 4RX8A 3F9NA 4U43A 4BF2A 5A54A 5KUPA 3L9PA 4FTOA 4L53A 4R8QA 5TF9A 1FPUA 3M2WA 4RIWA 2GNGA 2ZOQA 4MQ2A 3VBVA 4AOIA 4NFMA 3TDWA 3UO5A 3ZS5A 3CY2A 4E4MA 4HVGA 4FSYA 3LXKA 5AAEA 3QQUA 4M13A 3FPMA 4AN3A 2GHLA 3MY1A 3DKCA 5HTIA 3AT3A 2UZOA 3LZBA 2H9VA 3UIBA 2IPXA 5HOAA 4CQEA 1ZXEA 3QXPA 4FT3A 1Q8WA 4JRVA 3BQRA 5HD4A 1PKGA 3D94A 3G90X 4I6FA 5DR6A 2J5FA 5HO7A 2VTQA 4PF4A 4RJ6A 4Z7GA 3ZC6A 1W82A 4FZAB 3RGFA 1IG1A 4EUUA 3PLAE 3R8ZA 1PXJA 2RF9A 2YIWA 5DIAA 4A9YA 5J9LA 4WKQA
chains in the Genus database with same CATH superfamily
4NCTC 5HBEA 4C37A 2B0QA 5JRQA 2XAOA 3LJ2A 1P4OA 3WI6A 1B38A 3F3VA 2C3LA 4L01A 3TMOA 4RIXB 4PL5A 3AG9A 2A0CX 4DTAA 5GJGA 4FKLA 3BBWA 4AE6A 4EK5A 2YM3A 4DEEA 1DI9A 3HMOA 4ZY5A 4LG4A 4UBAA 5LJJA 4RJ7A 5ITAA 2VO7A 3N51A 5TE0A 4JG8A 4K11A 4EYJA 4CFWA 5BPYA 4DITA 4F7LA 3FZPA 2JDTA 1OM1A 3CS9A 4IB5A 3T9IA 4ZK5A 2JAMA 2ITQA 2O0UA 4LGDA 2W1ZA 4W9WA 1MRYA 3SG9A 3H0YA 4YJTA 3FLNC 2PUNA 4OTQA 4YZBA 2XKDA 3JVRA 2XKCA 1YI4A 2XIKA 3C50A 4GU6A 3HKOA 1NXKA 5DFPA 5HCYA 1G8JA 3OWKA 4JG7A 2QHMA 5IUHA 3UNKA 3CGOA 2AQXA 4C3PA 1H1QA 5CEIA 1WBVA 4RWIA 4YC3A 4D2WA 4JX7A 1P5EA 2YJSA 2W1DA 3UP2A 4BDCA 4ANQA 1SMHA 4ITIA 2XEZA 5CZHA 1NW1A 1QCFA 4YZDA 4R1VA 2PMLX 3VHEA 4DBXA 4QP2A 3QHWA 4PL4A 4JAIA 1W8CA 5FBNC 1VEBA 4GG5A 3IW5A 4BB4A 1WBPA 4YPDA 2CLQA 5CALA 5K0XA 4L44A 5E8UA 5CAUA 3F3ZA 3HL7A 1CDKA 3FMLA 2ONLA 4EOKA 1LEZA 1U4DA 5IF1A 5IPJA 2IO6A 2WIHA 4N70A 5CSVA 5HIDA 5IEVA 3VJNA 4BDIA 3SG8A 4GFGA 1VJYA 4XG8A 2F49A 2YITA 1VR2A 3TTJA 3G0FA 5HCZA 2WKMA 3TXOA 3FZ1A 4N0SA 4ZAUA 4WSYA 3A61A 4GMYA 4WUNA 4E8AA 4R3RA 4ERWA 4QTDA 4BYJA 3ZM4A 3GUBA 3LMHA 3R83A 3GQLA 5BVOA 4O84A 3CKXA 2RFDA 5CF5A 2HY0A 2VX3A 4G3CA 3MA3A 1OIYA 4O91A 4QYHA 1V0OA 3MH0A 4M12A 3OT3A 4OW8A 4MH7A 4MXXA 3ET7A 2WZJA 4BDAA 3QQHA 5CVFA 5E8XA 4IB0A 2FSTX 4O0XA 4XLIA 2XUUA 4RIYB 5LMBA 3NX8A 5BYZA 3HYHA 4GL9A 3FSFA 3ZHPC 3UQGA 3KXXA 2FSOX 3ODZX 3PIZA 2H6DA 4CRSA 3ACKA 5HI2A 3RALA 4AW5A 2WMBA 2R0UA 3D5WA 3G2FA 2IWIA 1OGUA 2VTJA 2BAJA 2C3KA 3KVWA 4O4EA 4PP9A 4UZHA 4F1MA 2HW6A 2ZB1A 3BI6A 5CEPA 1ZRZA 3K3IA 5EFQA 2C0TA 4B8LA 3W2PA 3GNIB 1F0QA 4I4FA 2WMRA 1AGWA 4LUDA 4DFUA 3EQRA 4FTTA 2UW0A 2ZM1A 2GNFA 4IANA 3KREA 4F9CA 4HVDA 1OUYA 2XNNA 3DTCA 3W18A 2J5EA 3ALNA 3ZUVA 3OXIA 3ZEWA 2GMXA 1XBCA 2OIBA 2RSVA 3LCTA 4K8AA 3FYJX 3P08A 4YU2A 5K5XA 3F2RA 3F88A 5T3QA 3Q96A 4BCIA 1YI3A 2IF8A 4F70A 3PUFC 5D12A 5FG8A 5LCKA 5A9UA 5C8MA 2YIYA 3DDPA 3I5NA 3TZ8A 4EOIA 1ZMVA 4EOLA 3EQFA 2Z7RA 4TWOA 4PPBA 3W0SA 4GJ2A 5HG9A 3TZ7A 5K0KA 5IISA 2WXVA 3OEFX 4YZNA 3BLAA 1NVSA 5F4NA 2HZNA 3LFBA 1Q3WA 4IVDA 3ZSHA 3LJ0A 4DFZE 4EBWA 4PWNA 1W84A 1OIQA 4F08A 4HW7A 3F66A 2BAKA 3HUCA 4PMMA 1ZWSA 3ZFXA 2X0OA 5EI2A 4DHJA 4J95A 3EFJA 4LMUA 3HMPA 3E5AA 3PSCA 2PUUA 4IXPA 4FKJA 3RAWA 2XJ1A 1OI9A 3CBLA 4LMNA 4RMZA 3OUKA 5CSWA 3VS0A 4U41A 3FZTA 3I60A 4MD9E 3R7VA 4C8BA 5JGBA 3QCQA 3K2LA 2OU7A 4U5JA 3G5DA 1TQPA 5I3RA 4BI2A 3O23A 4JR7A 2CGWA 3UIMA 3ZO4A 4NJDA 3HAMA 1JKKA 4I6BA 3Q9WA 4QPMA 3ERKA 3D2IA 4FNZA 4KIKA 4O7WA 4EBVA 4C2WA 4O4FA 3SVVA 2EXCX 4AXDA 2QOCA 3ALOA 4H58A 3R22A 4AOJA 4F7JA 4ZSAA 5FTGA 1YOJA 3FLWA 4FV3A 4OAVB 3AD6A 3UQCA 4CMUA 2JDOA 3LFFA 3LQ5A 2GS2A 3BGQA 4IWOA 3RM7A 4XH6A 4CT1A 3LFCA 4K33A 3H10A 4E7WA 5J7HA 2NP8A 3PE1A 3RZBA 2QOHA 4A9RA 5AR2A 3R02A 4DGLC 3FKLA 5JFWA 5ETCA 3UYSA 3LM5A 3GOKA 4JRNA 4L7SA 2XK3A 4M97A 2OGVA 2UW8A 1UWHA 4L67A 4FGRA 3ZONA 3C4EA 1HOWA 2P3GX 3MIYA 5I9UA 3HV6A 4F1TA 5KCVA 3NPCA 4YGAA 4IACA 2VRXA 1ZYSA 3DFAA 2XNBA 4NIFB 2YZLA 1FMOE 3Q52A 2KULA 3ENHA 1OIUA 4QO9A 5IH5A 3QL8A 2XIYA 4AP7A 4V0GB 3SHEA 4HGLA 3UZTA 2J90A 4FG8A 4I6QA 2XNPA 2HOGA 2VTAA 5CANA 2OXDA 3DQWA 4EOJA 3NSZA 1ZY4A 4GT5A 4I5MA 3LMGA 1LEWA 3LXNA 4EONA 3KVXA 2BRGA 3HMNA 2BMCA 3ORIA 3Q3BA 3R71A 4FT7A 4AOTA 2W5AA 5DVRA 2EB2A 2XP2A 3PIXA 4BKJA 2UW6A 1H07A 2QR7A 1YVJA 4JIKA 4PPCA 3NYOA 3EHAA 4W4XA 1YOLA 2OZOA 2UZEA 4D0XA 3E8DA 4DEDA 1BL6A 4H05A 2W06A 5HNGA 2GQGA 3MY5A 4DF3A 5EHLA 5GZAA 2GU8A 4PMPA 5FQDC 2QOKA 2XEYA 4BHNA 4LV8A 4DH7A 3VS1A 3VBTA 4EYMA 5IU2A 1OPKA 3E62A 4I5HA 4CT2A 1H8FA 5IEXA 2Z60A 4OTGA 4JMQA 1Z5MA 2C6OA 3DJ6A 4YJNA 2PVMA 2Y7JA 2QURA 2OW3A 3EB0A 3Q4TA 3TZ9A 4NL0A 2ZMCA 5JN2A 1FMKA 1KOBA 3NR9A 4ZMEA 3C5IA 4JL9A 2W05A 4GYIA 2X7FA 2YM8A 4S2ZA 1BI7A 2YA9A 3UO4A 2W0JA 5JH6A 3COHA 3P7CA 1TQIA 3A7IA 4BJJB 1K9AA 3QC4A 4ZJIA 1DS5A 1NT2A 3V5LA 1JKTA 3UMWA 4EKKA 2VNWA 5FM3A 4K2RA 2BKKA 3R63A 2XRWA 4Y5QA 4AXAA 1OGYA 4RFYA 5KHXA 4IAAA 4JBPA 4QD6A 5E1SA 1YHWA 5CVGA 4F9BA 4LOQA 3MPMA 4D1XA 3PPZA 1FBNA 4EOSA 3N9XA 2YIRA 1MP8A 4FZ6A 4X3FA 3BE2A 4L6QA 4WNMA 5LVMA 2CNUA 2VO3A 2C5XA 3P5JC 3OCTA 4FYNA 2PHKA 4UYAA 4FE2A 1PJKA 2IZSA 3AQVA 1OPJA 2QOOA 2XCHA 3DT1A 4L9IA 4Z55A 4NEUA 4FEUA 3UG1A 5CU4A 3I81A 1L3RE 1W7HA 1XH8A 2OWBA 2O64A 1OKYA 2XJ2A 2W1IA 4G5PA 2PULA 2Z02A 4QP1A 4IZ7A 3VC4A 4E5BA 1Z57A 2HW7A 4ZJJA 1OBGA 3P23A 1V1KA 1R0PA 3R8VA 1UVRA 4XG7A 2BR1A 2BHEA 4DYMA 5BUEA 3O2MA 4XV9A 3S0OA 2Z7SA 3PLSA 3PVUA 4NK9A 2YAKA 3DCVA 4TW9A 1TVOA 4BDHA 2CNVA 3R8PA 3ZBFA 2GNLA 3SGCA 5IDPA 1R1WA 3EZRA 4PTEA 3KK8A 4F64A 3A7HA 5FBOA 2A4LA 5FXQA 3PDTA 3WZKA 5HVJA 3NIZA 4DEBA 4O86A 2XM8A 4IVBA 3NUYA 5BYYA 3UOHA 3R28A 2PVJA 1UNGA 3KB7A 3LXPA 4N6YA 4D2RA 1YHVA 3NNWA 4CFVA 5E8VA 2W99B 3GC9A 4EH7A 3EN5A 4S33A 2X0GA 3LAUA 3HV5A 4TY1A 5CF6A 1LR4A 3GT8A 3QU0A 4L8MA 2P0CA 3UG2A 3VS6A 3W32A 2C5YA 2WTKC 4BZDA 3FZOA 3HLLA 5HICA 5HEZA 2R5TA 3BRBA 3GCVA 5HO6A 3PY3A 3CP9A 4GUBA 5ANJA 4X3FC 4RBLA 3OT8A 4GW8A 4P4CA 4BKYA 3TUDA 4R3PA 4I41A 1JAMA 4LUEA 3EFWA 3ORMA 2QQ7A 2JAVA 3HAVA 3DK6A 5M09A 1O6YA 4FIFA 2JKQA 3HV7A 5AP2A 3AMYA 3KXZA 1OL2A 1NA7A 2C0OA 4S32A 3P1AA 5HBJA 4ZEGA 2BFYA 3E3BX 4BZNA 4TWPA 2QU6A 3C4ZA 2F7XE 3E88A 3TZMA 2I40A 3OFMA 3EMGA 4RLLA 4EI4A 4X2FA 1J1BA 3C9WA 5E92A 4IX4A 4EL9A 2ZJWA 5BUIA 5EW8A 3EWHA 5HE3A 5A4LA 2R3QA 2XALA 2BRBA 4U40A 2ZFYA 1KE9A 3TKHA 4G3FA 4C2VA 1XMLA 3F5GA 1PMUA 3OBGA 4JQ7A 5H8BA 2JBOA 3DXQA 3H9OA 3G6GA 2HZ4A 2UZUE 2PE0A 4FKSA 4M15A 4WRSA 3R1QA 1QPCA 4RQVA 5DOSA 4G6LA 3H30A 1XMMA 3II5A 4M69B 2GS7A 2P4IA 5KMMA 4DAWA 3NAXA 5DT0A 3BHUA 2PE2A 5AV0A 4I3ZA 4DGOA 5CY3A 3QC9A 4IAKA 2XJ0A 2FSLX 5CU2A 2XIXA 3R30A 2BIYA 2AYPA 5AM7A 3G9NA 3KL8A 5K3YA 3W8QA 4FT0A 3GU5A 4DT8A 4EH5A 5AUXA 2EVAA 3G33A 3U51A 3KA0A 4F78A 2QG5A 3W0QA 3ORXA 5HLNA 3RAIA 3BHYA 1GOLA 5AX9A 1PF8A 3FEGA 2BZJA 3MFUA 3HRCA 4YC6A 5F95A 4BY9E 3TKIA 3C4XA 4PP7A 2YIXA 3EJ1A 4O0WA 1H0WA 2ITYA 2WELA 3MSSA 4TYIA 5KKRB 4DDGA 1H1SA 3EFLA 1F5QA 4MNEB 2XM9A 2VTPA 4YJVA 3NW6A 3LFEA 5DR2A 3CJGA 4C4EA 3DQXA 4MXAA 5J7BA 5IQBA 2OBJA 3DK3A 5AUYA 2G2FA 4G31A 1VYWA 1MQBA 2FB8A 3VHKA 4XYFA 3SRVB 4CRLA 3LFDA 4CSVA 2HAKA 1JPAA 3MPTA 4GG7A 3MV5A 5HCXA 4EOOA 5EQEA 3TNPC 4ZS0A 3RPVA 4E6AA 5J79A 4G2FA 5GIOE 2ZM3A 4AA5A 3KRRA 5CU0A 3PXZA 1SVHA 4D5KA 4C02A 4EC8A 4FSNA 5H3QA 1G5SA 2ERKA 4FV5A 4BTKA 5L2TA 4ACMA 4IWPA 1JSVA 2RKUA 3GU6A 1PMNA 3DBFA 4A07A 1Q8TA 3QKKA 4UMUA 2ZM4A 3EH9A 4FNWA 2O2UA 3QALE 1KE5A 1SNXA 3BPRA 3R00A 3BU3A 4GT3A 5L2QA 4O7YA 1XKKA 5E90A 2Q0NA 2IW8A 1OIRA 4F1OA 2V55A 3TNHA 1W98A 4C57A 2A19B 5HQ0A 2QVSE 3DBCA 4GT4A 2I0VA 1UNHA 3V6SA 3WZUA 3O96A 3RPRA 4QMQA 4MF1A 4IX3A 4R77A 5DGZA 5LVPA 3CQWA 2V0DA 4GUEA 1JKLA 4PDOA 3TIYA 4O1OA 5C8KA 5HE2A 4GH2A 3GQIA 5AX3A 5FM2A 4BDDA 2UW9A 5A6NA 3AC5A 3AC2A 4E4XA 4OAUC 5AMNA 1BLXA 2Y4IC 5DH3A 4TYEA 4YC8A 3ZLSA 3O50A 2Y6OA 3HGKA 5FP5A 4E73A 3EN4A 3NNUA 2OXXA 2YCQA 2XBJA 1WVWA 4XUFA 4DGGA 3GOPA 3WYYA 3CEKA 4CGAA 1ZZ2A 3DAJA 4JR3A 5CAOA 2XK9A 3PXYA 4DA5A 4R78A 4H1JA 4XV1A 1JNKA 2XS0A 4UEUA 5B0XA 4CKJA 3U6HA 3VONA 5TKDA 4GKIA 3MB6A 5IUGA 1QPEA 5DPVA 3TNWA 2C1BA 2JKOA 3EKKA 4G9RA 4U45A 3G15A 5C4LA 3NUSA 4DBNA 4JBQA 5FDPA 4HYSA 3VUMA 3D5UA 2YN8A 4YJPA 3BU5A 4I20A 2Z7QA 2VGOA 4MEDA 2XKEA 3VIDA 4B4LA 3LFQA 5F94A 2YCFA 3QXOA 2E9OA 3C0IA 4PNIA 1YDSE 4FMQA 4EZ3A 2J4ZA 3KIOC 2HZ0A 5KZ0A 5AAFA 4RVLA 3MW1A 5K4IA 2F2CB 4LM5A 2XNOA 4U44A 5A4EA 3AC1A 1IRKA 3ZLXA 3BKBA 4WNPA 4M67A 3WE8A 1K2PA 4I24A 1KWPA 2RFEA 3UC3A 4AGCA 3VRZA 3FMMA 3TN8A 1FINA 3I0QA 4PTGA 4IIRA 4MD8E 1NVRA 3W55A 3N4TA 3IOKA 4ANNA 2YAAA 4PUZA 5DBXA 5D7AA 3UO6A 4HOKA 2WD1A 4IFGA 5HU3A 5LWMA 4BR3A 5C03A 4ASEA 1IA8A 4QPSA 3DU8A 1UKHA 4TWCA 4OTDA 4W9XA 4Y73A 1Q24A 3D9VA 1OKZA 2PWLA 4ARKA 3OWPA 1XBAA 3V5QA 5CSPA 3C5UA 4LRKA 5CAVA 4EK4A 4WRGA 3RWPA 3FMDA 5CT0A 2REIA 1IEPA 3C51A 4FSMA 4AFJA 4E5AX 5CU3A 1TZDA 3K5UA 4HVIA 3OTUA 3P9JA 4BCPA 4DFYA 5JZNA 3P0MA 1APME 4BDEA 5LMAA 2C6KA 5IA0A 2GQRA 3LLAA 4TNDA 4AXEA 4G9CA 3QTWA 4LGGA 1UNLA 3D7TA 3TACA 5BNJA 4FSUA 4C36A 3KF7A 4ZLZA 4ANMA 2WOTA 1WMKA 3L9MA 2QONA 2WMQA 3CC6A 4XEYA 3R7YA 3FC1X 4U97A 5ANDA 3O71A 1SVGA 1ZYLA 2GFCA 4JQ8A 3HNGA 3ZDIA 5M4FA 2AUHA 3FSKA 4GVAA 2OJJA 2WMWA 5CNOA 4CV9A 4JX3A 2C5NA 2ZMDA 3PJCA 4D28A 2QOBA 4K1BA 4KKEA 1QMZA 3GC0A 5DNRA 4C4HA 1S9JA 3S95A 3F7ZA 4ZTMA 4R5YA 5HVYA 3R9HA 1YDRE 4MWIA 2CN8A 1TQMA 2F4JA 3FKOA 4FIEA 2FVDA 3BU6A 3QRKA 3S3IA 3KULA 2FO0A 4KA3A 1ZLTA 4I4EA 4QQTA 2IVVA 4O4BB 4RWJA 2QR8A 3GCPA 4DINA 2VD5A 4D2SA 3RWQA 4F0FA 1WBSA 2WO6A 1PXKA 3PA3A 4KBCA 2PK9A 2PMOX 3R1NA 4IBMA 4QQJA 4WHZA 3ZRKA 2XNMA 5TOZA 3WE4A 2VWWA 1UU7A 1RQQA 4YBKA 4FR4A 3FY2A 3FZRA 4QP4A 4UWYA 4QMVA 2QOIA 5EYDA 3CTHA 3R9OA 2VTLA 2FYSA 1IR3A 1J91A 3NCGA 4W4VA 4BCKA 4KABA 2J0KA 4ITJA 4CCBA 2ITVA 5EHOA 2IJMA 3PPJA 3BQCA 3CPBA 3ZRLA 4FIIA 3R01A 5CNNA 4FTNA 3VUKA 3UTOA 4ALUA 1Y8YA 2YCRA 4EHGA 4Q5EA 2PVLA 3MTLA 3TWJA 4C4FA 5AA8A 3RPOA 1B39A 4NKSA 2DUVA 4QMUA 3AC4A 4IM0A 3S1HA 4RJ4A 4QYFA 4UMRA 2OJFE 5JFVA 3DV3A 2R9SA 2GTNA 2WQBA 3OUNB 3R6XA 1ZMUA 3VS7A 3OBJA 5AV3A 5AP1A 3MBLA 4E6DA 4EH2A 5AP4A 4LV7A 2G01A 2C68A 3DB6A 3MGYA 2BDFA 4YSMA 4J52A 4F9WA 3F3TA 3UVRA 2X8IA 5JFXA 4R1YA 3KY2A 5ETAA 3OWJA 4B8MA 4XG9A 3SKCA 3MFSA 5ETIA 3VBQA 4JXFA 3SOCA 3QGWA 4NTTA 3UDTA 4ALWA 3QRTA 2X1NA 1SVEA 3LQ8A 3D5VA 2J51A 3FY0A 2XAMA 3R2BA 3GC7A 5ACKA 2R3FA 5B2LA 1BUHA 2CLXA 2HWPA 4QNAA 3PZHA 4GYGA 1OECA 3FI2A 4FX3A 4ANSA 4MHAA 4RJ5A 5DE2A 4FKOA 3I7CA 1RE8A 3E7OA 3QD4A 5FEQA 4RIXA 1I44A 1H08A 3BGZA 4DFXE 5AV2A 4TYHA 3QFVA 2BCJA 2UW5A 5AIRA 3ZXZA 4AAAA 4EZ5A 1PXOA 3MH1A 1ATPE 3F5UA 1OPLA 4ZSEA 5C1QB 3ML1A 4XV3A 4AW1A 4CG9A 3KQ7A 4IW0A 5EM6A 1W2DA 1YXSA 5JGDA 4EORA 2QI8A 3KRJA 3W0OA 3VAPA 4BCNA 1Q97A 1XH7A 5IQHA 1H1PA 4TXCA 4QQCA 3N4VA 1GZ8A 3G9LX 4PPAA 3NWWA 5H2UA 3F5PA 4I23A 3UODA 4UMTA 4ZZOA 3KGAA 3ROYA 3OWLA 2WPAA 5JMSA 4KSQA 1Y6AA 1T46A 4J8NA 4IAZA 5J1WA 3SAYA 3I6UA 3QKMA 2J50A 5KNJA 2C1AA 2C69A 2YM7A 4RJ8A 5EQPA 4XCUA 3FMKA 5KMIA 3A4OX 3HRBA 3OEZA 3PVWA 2R3NA 1E1VA 5GINE 3GXLA 4HZSA 2B9HA 4O4DA 4BIBA 1UKIA 2ZAZA 1STCE 1OITA 4RJ3A 5E8YA 5AR4A 4E6QA 5K5NA 4I0TA 5KMLA 4W8DA 3PE2A 2JFMA 4RC3A 4FKGA 4W8EA 3ID6C 2C0IA 3PRFA 4X21A 1F3MC 1YRPA 3ENMA 4G3EA 4BI0A 4O4CA 4IVAA 5EOBA 2WEIA 3QTZA 5IQAA 3LE6A 3JUHA 3A8XA 4FEQA 3R8UA 1O6KA 4FIJA 4E4LA 4WA9A 3F5XA 2XK6A 3OG7A 4GIHA 4KIQA 1GIIA 3S4QA 4C61A 2WTDA 4DEAA 4R6VA 1LUFA 3H9FA 3MIAA 4CMOA 4BIEA 2O8YA 5CSHA 1XR1A 2E2BA 4E4NA 4IAFA 5DWRA 1H1WA 1W2FA 3NYVA 3DJ5A 4OBQA 4APCA 3EN9A 4DCAA 3PZEA 2F2UA 2YISA 3HV4A 3LLTA 3OC1A 3OD6X 5EDRA 4LQMA 5CLPA 4HYHA 2Z2WA 3LM0A 2XYNA 4JDIA 2SRCA 4HJOA 4MTAA 3OZ6A 5CXHA 5FD2A 3VN9A 3F2NA 5KBQA 3FLZA 2WAJA 4TKSA 4RIYA 3QQJA 5DI1A 3WZJA 4PDYA 3P79A 4EOMA 3AT4A 4UMPA 4RGJA 3TV6A 4AT3A 2RFNA 5EKNA 2ONLC 2UZDA 5KE0A 2XH5A 3R8MA 3FBVA 5EYMA 5BVEA 5HX8A 3AKKA 2G1TA 3OVVA 3GENA 4QRCA 4QDVA 3KCFA 5K9IA 4TNBA 3V01A 2UZWE 4BHZA 2QLUA 4ZTHA 3TIZA 3MJ1A 2XIRA 1G8KA 3CTJA 2BRMA 2Y0AA 2ITTA 3IPHA 3ORKA 2WNTA 3IGGA 4OBOA 5TR6A 4RG0A 2I0HA 3FDNA 3MFRA 2FSMX 3BCEA 3DA6A 3VUHA 4JDHA 3WILA 4HVHA 3B8QA 4FV1A 4QYYA 4QTCA 5KMJA 4HCUA 4WOVA 1XJDA 3AGMA 3NYXA 3DAKA 3OY3A 4HYIA 4DH5A 5AUTA 4B7TA 3QA8A 4QTAA 2X9EA 3RVGA 4GRBA 4O96A 4I93A 1M7NA 1MUOA 2IEWA 5HORA 4O0VA 4H1MA 5F20A 3TDVA 3GBZA 1H0VA 3NFFB 3OROA 2JGZA 4G34A 4D9UA 4YUQA 4DHIB 2W1CA 3HRFA 5ANKA 1TFFA 5DN3A 4XNEA 3U54A 3WF8A 1YXUA 2YHVA 4EH6A 4U42A 4AZVA 1OZ1A 3CR0A 4C35A 4E93A 5CAPA 5JZJA 4I94A 3PFYA 3QQGA 5EK7A 5C4KA 4RFZA 3IO7A 1Y8GA 4BRXA 3R0TA 4IB3A 2O5KA 5FTQA 3UDBA 3TG1A 5IA1A 4RZVA 4TYGA 3B2WA 3OW3A 4C34A 3Q2MA 4CKRA 3LCSA 3LW0A 4PY1A 5J8IA 2BAQA 3A99A 5JQ8A 4EJ7A 1S9IA 2PVNA 4JOAA 2WQOA 2OK1A 5I9XA 3NW5A 5A4CA 1UA2A 3PG1A 4Q2AA 5I0BA 4DCEA 3OOMA 3DLZA 4MAOA 5CEQA 4AZTA 3ANRA 5M4CA 1L8TA 3L8PA 4D2TA 5I9WA 3BYVA 4QDEA 3MA6A 4Y46A 3TJDA 4ZLOA 2YDKA 4JVGA 3U9CA 1PYEA 5AUWA 2J0MB 2CMWA 3PP0A 4NT4A 2GNHA 5G1XA 5BVDA 2G2HA 3EN7A 5EM5A 2HXLA 2ITPA 4O82A 1YDTE 4NM5A 5IG1A 4DG0E 2W4KA 4RC2A 4FT5A 4JDJA 3O8TA 3FL4A 4DTKA 3ZOSA 5IDNA 2XIZA 3EFKA 4X3JA 3LHJA 2PZIA 5CEKA 1YI6A 1M52A 2R3IA 5ANOA 4YTHA 5L6OA 5EDPA 5EH0A 4FV6A 5DEYA 5FWKK 3WIKA 4CZYB 4WBOA 3TL8A 4BGHA 4TL0A 4Z3VA 2X2LA 1VZOA 4RX7A 3HZTA 5J95A 2IW9A 2XRUA 4DE4A 5CXZA 4XV2A 5CI7A 1GJOA 1HCLA 1B6CB 2LAVA 3HVCA 1H01A 5HLWA 3ZRMA 3BHTA 3ZU7A 3VS4A 3ZBXA 3AOXA 5BQ0A 5J9YA 2VWIA 1M14A 4KUJA 4MYGA 4FKIA 3NCZA 4DLIA 5KMKA 2B1PA 4ORKA 4J8MA 3EQHA 3RPYA 3Q6UA 3Q60A 4O6LA 4UALA 3BWFA 4I1ZA 1P14A 3PSDA 4G6NA 3SW4A 2ITUA 4ACCA 4DH1A 3COIA 4CD0A 4NSTA 4LOPA 3O51A 2XK4A 1OUKA 2HENA 3DNEA 4NIFA 4QMWA 4QNYA 3W2RA 4ACDA 3DBQA 4UX9A 4DEHA 3RK7A 1PHKA 4JNWA 4TN6A 3NS9A 2Q83A 3COKA 4Y95A 3QUDA 3W1FA 1BX6A 2C6MA 4KKHA 5E8ZA 2PVHA 1FGIA 2RFSA 5EW9A 5M53A 5DG5A 2BROA 1PW2A 2VU3A 5H8GA 3R04A 1XHAA 2BTRA 4UMQA 3ZMMA 2QD9A 4QP6A 2WMAA 1OMWA 3RP9A 3PJ8A 4FV8A 3VULA 2VTMA 4RZWA 2B7AA 4P2KA 4B9DA 4FVPA 3QTQA 4BC6A 3PWYA 4Z7HA 5IA3A 5LVOA 4OTRA 4ZJVA 5CEOA 2H8HA 2O65A 3F61A 5LMKA 5E9EA 3D4QA 5I9YA 5JKGA 3AGLA 4D55A 1CKIA 1ZARA 3ZEPA 3PFQA 4PV0A 3TCPA 4DN5A 3OOGA 2J7TA 2WTKB 2YWVA 1ZMWA 3ZTXA 5IA4A 4AGUA 2A2AA 4FKVA 1UV5A 2JBPA 3UGCA 4Q9SA 2W1HA 3OW4A 3QD2B 3QUPA 3BE9A 4TWNA 4X3FB 3DKFA 2W1GA 1P2AA 2XANA 3KRWA 3V51A 4BCMA 4KS7A 4BYIA 2V22A 4USFA 2V5QA 4F09A 3NUAA 4R5SA 3POOA 3NUXA 4F6UA 2GHGA 2P55A 2B53A 2OH4A 4RT7A 1IA9A 4YZMA 2CKOA 1Y91A 3FV8A 3VUGA 4RA4A 4ZSLA 5BVFA 2OLCA 3DK7A 4FV9A 1JQHA 5CSXA 5AUUA 2WTVA 2H34A 4C4JA 4FSTA 4AF3A 3QCXA 4O7LA 3L8VA 5DRDA 4Q9ZA 2HIWA 3EQDA 2H96A 4P90A 4GFMA 4UXQA 1URWA 3TT0A 4FRFA 4CYJA 5AM6A 5HESA 5L6PA 2A27A 3DBEA 4FKRA 4FSWA 5B2KA 4YMJA 3QRIA 4L45A 3EN6A 3T9TA 4AACA 4AGDA 4AZFA 4BDJA 2BTSA 4C4IA 3UJGA 4BWKA 4JAJA 3ZC5A 4K6ZA 4R7HA 4MXOA 1A06A 2EU9A 3KCKA 5AP5A 5L2SA 2I0EA 3LCDA 2VN9A 1HCKA 2PE1A 2R3LA 2JEDA 3C4WA 4K77A 5ETFA 3MVJA 2YIQA 4M84A 5HG5A 3ZO2A 5J9ZA 3JR1A 4IFCA