5IA3A

Crystal structure of ephrin a2 (epha2) receptor protein kinase with pd173955
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
295
structure length
275
Chain Sequence
LKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 275
sequence length 295
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ia3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ia3A01
3COIA 4FTUA 4NM3A 3ZHPC 4NKSA 3O50A 3QGYA 4DCEA 4PPBA 2XYNA 4IBMA 4GJ2A 2XIRA 4MBJA 3AD5A 5IQCA 2WIHA 4KKGA 1MRVA 1ZMWA 3CQWA 4ZY6A 5BUIA 4RT7A 2XJ2A 3IW8A 2UVXA 3QD2B 4WBBB 2I0YA 4ZZMA 4D5KA 5CF6A 2GDOA 1YI3A 3OUKA 4RX5A 4IVDA 4IVAA 4AN2A 2WMSA 1UA2A 4ACGA 1XH4A 3G51A 4EH5A 5K5XA 3HL7A 4O7WA 4Z16A 3VQHA 4AW5A 2C6LA 3KQ7A 4JDJA 2VTAA 4U41A 3GNIB 3Q5IA 5A9UA 5ANEA 2Z60A 2Y4PA 4L67A 5KMNA 3FMLA 3EWHA 3GCPA 4FKJA 4A9SA 5EG3A 5I5ZA 3U6HA 3GCVA 5K5NA 3PIZA 3R28A 4RIXA 4IH8A 2BRHA 5F1ZA 5L2QA 2CNQA 2GTMA 3N51A 4RVTA 4EH3A 3MYGA 3ZFXA 2C5OA 3AC5A 1NW1A 2OKRA 5LXMA 4CGAA 2WTDA 4ZSGA 3EN4A 3LFCA 2ITXA 3HA8A 4E93A 4YSJA 3DKGA 1YOLA 5DR9A 4D4RA 2PVHA 5JEBA 3QQGA 4BYJA 3AQVA 5CQWA 3ZMMA 3DS6A 3UG2A 1OBDA 3ORNA 4FKIA 4IW0A 5BNJA 3VF9A 2YIWA 3GQIA 4FT5A 4NJ3A 3LCDA 3ORPA 3UIUA 4APPA 4C3FA 5BVFA 5IUHA 1SZMA 4BCGA 2XBAA 3ET7A 3A4PA 3NIZA 4H1MA 3ZEPA 4QMQA 3GOKA 3CLYA 3ORTA 1MQ4A 1LR4A 2QOCA 5AUTA 2VUWA 3RGFA 1VR2A 4WSYA 5LVOA 3AT2A 4IC8A 4WT6A 1FPUA 3FZRA 4WD5A 2OXYA 3TNQB 4YUQA 3MJ2A 4F7SA 2Z02A 1T46A 2JKKA 3F7ZA 3DKCA 3ORMA 3BHYA 3H10A 4ANSA 5A4TA 4PTCA 3TACA 1REKA 4F7NA 3Q5ZA 2H34A 3EN7A 4GG5A 2GU8A 4DF3A 1UU3A 3QTUA 4CCBA 1GAGA 2GSFA 2XNBA 4PNIA 1TVOA 5HGIA 4QTAA 2J5FA 5CI7A 3NUPA 3LVPA 2YEXA 4U42A 3ORZA 3DKFA 4J71A 1W8CA 5B0XA 5E1EA 5HIDA 4M0ZA 4X2GA 3KXMA 4M12A 4FKQA 3UOHA 4RVKA 5AP6A 4AGUA 5AA9A 4EH6A 2UV2A 2E2BA 3UDBA 5KUPA 3LJ1A 5AWMA 5HI2A 1GIIA 5EOLA 1PKGA 2W4OA 3IDPA 3OXTA 4MD7E 2BIYA 2HELA 2PVFA 1PMNA 2OZOA 3LJ0A 4YJTA 5AAGA 4FEUA 5IA5A 3TCPA 3QX2A 3IW4A 3GU4A 4AZWA 4ZMEA 1U54B 4LV8A 2W1ZA 4FUXA 4NT4A 5LARA 1JKKA 2CGWA 3D15A 4YJUA 3PY3A 4XG9A 2Q83A 2ZDUA 2JIUA 5IMXA 3C51A 4G3FA 1Q3WA 3PG1A 2BVAA 4X3FA 3V5PA 3F7WA 4ANOA 3IKAA 3NW5A 4I0TA 3HECA 2PHKA 3FKOA 3OCBA 4W8EA 4WRGA 4RVMA 5I3RA 2ITQA 3G2FA 4H58A 4N0SA 4EYMA 4YNOA 2IPXA 3F69A 4IB5A 2BTSA 5HVYA 4QMZA 2R3IA 1CM8A 4BFMA 3PXRA 3KF4A 1JSTA 3ZRMA 4FZ7A 5E4HA 4KWPA 1JVPP 3KULB 5EHYA 2VU3A 3S95A 4P5QA 3QQKA 4FKOA 2F9GA 4KBAA 3TZ8A 3KCKA 4B6LA 3GP0A 3BELA 2XK4A 5H3QA 3LXNA 3IQ7A 4K77A 4CLIA 4ARKA 3QRJA 4DTAA 4NK9A 3DB8A 3F3ZA 3BU3A 4UB7A 3PZHA 4RX9A 5DE2A 4L46A 3EQBA 5CX9A 1XH8A 4XP0A 4DH1A 3UMXA 4GW8A 3ZZWA 3P4KA 3LZBA 3AXWA 3DAJA 3C5IA 3UG1A 1ZOEA 3R9HA 3TWJA 4OTGA 3MESA 3D5XA 4H1JA 5JFWA 4JDHA 2QVSE 3FC2A 3SVVA 4J8MA 2FGIA 4C3RA 2VTPA 2X81A 3UQCA 4QP1A 5HE1A 4FSWA 3M1SA 2PUUA 1A06A 2IG7A 3E3BX 5FXQA 3V8WA 3BQRA 5I9XA 5HBEA 5CAPA 1GZ8A 5KMOA 5CSHA 3SRVB 2QOFA 3DCVA 3N9XA 3LCSA 3QU0A 4KBCA 5FG8A 4CQEA 5CU0A 5HU9A 1MUOA 1XWSA 4PUZA 4QMOA 5CU6A 1ZY4A 2ERZE 5HQ0A 4FV8A 2RG5A 4FKUA 2DWBA 2IVTA 4A06A 1HCLA 2BKZA 3DJ5A 4GVAA 3HUCA 2Y4IB 3LM0A 4IZAA 5E90A 1M2QA 4UMUA 4O7LA 3V6RA 2HIWA 4UY9A 4AFEA 2R0UA 3ZO3A 4FIHA 3AGLA 4EBVA 4HW7A 3BU6A 3V8SA 3F3TA 3QL8A 4IADA 4MVFA 3MS9A 4E1ZA 2J2IB 5I9UA 4U3ZA 4RRVA 3UODA 3VN9A 3SQQA 1ZRZA 3NYOA 2PZRA 3GI3A 3QQUA 3UVRA 2NPQA 3ODYX 4BIDA 2XNOA 5L6WL 4FTJA 4BZOA 5D11A 5L6PA 5AJQA 4APCA 2WMBA 2ONLA 5T3QA 3VRYA 3NUAA 4IVBA 5IA0A 2I0EA 3D2IA 2O3PA 4WBOA 4DEIA 3RZFA 4GSBA 3LLTA 3VS5A 1A9UA 1URWA 4DEDA 1PHKA 4IM3A 4L42A 5HBJA 2VTHA 2AYPA 1KE8A 4PF4A 4XYFA 4X2KA 4BCQA 3FZOA 5A4QA 4BDFA 4H36A 1OL2A 5EM8A 2PVKA 4I4FA 1F3MC 1OUYA 3KFAA 4XHKB 4HJOA 4FKLA 3U6JA 5ANGA 3LXLA 4UYAA 2QO7A 1H07A 3IOKA 3PE2A 3QX4A 4BN1A 4XEYA 4CVAA 3E8NA 3DNDA 4O0WA 3VNTA 4O38A 5EYDA 5LMAA 4I23A 1FVVA 3R2BA 4AU8A 4UMRA 5BYYA 5HX8A 1CMKE 4F6SA 3Q2MA 3QTWA 2YM6A 1H8FA 4XBUA 2WAJA 3RWQA 3OMVA 2E9OA 4IDVA 1K9AA 2BZKB 5IA3A 4ZOGA 1V0OA 2HZIA 1XQZA 3OZ6A 3E87A 3PJ8A 4IAZA 4FNWA 4JBPA 4YO6A 1BLXA 2GMXA 4O2PA 4JIAA 4BWKA 2I6LA 4FV5A 2A4LA 3MVLA 2JAVA 4BIEA 2XYUA 2CN8A 3MY1A 4AGDA 3ETAA 4HVGA 5KKRC 1Q8WA 3IS5A 3UZRA 3FZPA 2ZM1A 1IAHA 2WMQA 4LI5A 1PMUA 3GB2A 3UIBA 3PG3A 3F61A 3OWPA 4Y95A 3RVGA 3BU5A 3P08A 5CXHA 2B9FA 3ANQA 4FF8A 1XBAA 2VRXA 3S00A 2YAKA 2YABA 5A4LA 1SYKA 2EXEA 4HVDA 3U6IA 4MD8E 3ZS5A 4O84A 3VC4A 4FKRA 3TIZA 1WVYA 2UW9A 3TJCA 4FGRA 3SLSA 1H01A 3NAYA 4C62A 4UBAA 2B54A 3EQPA 5EYKA 5E8SA 5AP4A 4D4YA 3FZTA 3KXHA 5ITAA 5DLSA 4FEVA 4AACA 3LLAA 4ASDA 2IZUA 1H1PA 3FMJA 2NRUA 4S30A 3TTIA 5J5TA 3HMMA 3MJ1A 3O17A 4EQCA 4DGNA 4D9UA 4Y5HA 3W18A 4FSQA 2C5XA 5KMLA 1XKKA 4FZAB 4QMXA 4EOSA 4R1YA 2VD5A 2PUNA 4HCTA 5HIEA 4QYEA 3RPSA 4YO4A 5IEVA 3O96A 4M15A 4FL1A 4BGHA 3R22A 4BGQA 2V22A 4RQVA 4IX5A 4OTFA 4F6WA 3VS7A 5CF5A 5HESA 3DBDA 3OG7A 3UOLA 3HZTA 4UALA 4ALWA 4RIWA 2YM4A 2CGUA 3PIXA 4FI1A 2RFDA 2C6DA 3DXPA 2F57A 2HK5A 3NUNA 3EZVA 3FI2A 2BIKB 3R1QA 3CD8A 4JG7A 3HKOA 2CNVA 2X7GA 3G90X 4RJ8A 4R5SA 3D7TB 3PPJA 5A4EA 5JN2A 5M4IA 4XP3A 1H00A 3FKLA 3TI1A 2WOUA 4A9TA 4IAKA 4B99A 3DT1A 3MI9A 1DI9A 4DYMA 5HICA 3Q4TA 1IG1A 2YCRA 3VHEA 1JPAA 2BAKA 2VTMA 4RC4A 4RSSA 5ETIA 4ZSJA 2YISA 1OKWA 1YOJA 3EYHA 4BF2A 2BHEA 4KIPA 4C38A 1Q3DA 4EK4A 2VTLA 3WILA 5GIPE 2OZAB 3TT0A 2RL5A 4OTRA 5JRSA 2HW7A 3U4UA 1WBVA 2J51A 3LCOA 2PZPA 4DLIA 2JBOA 4O6LA 3KK9A 4ZTMA 1W0XC 2IZRA 3FMHA 4TZRA 5BMMA 2QI8A 2RSVA 4IANA 4FV7A 2WKMA 3EL7A 4XV1A 5AX3A 4KNBA 4B7TA 1NVRA 4WUNA 3D5VA 3QTIA 3CY2A 4B0GA 3DU8A 4DG0E 2W7XA 2WELA 4MF0A 2FSMX 4NM7A 3MY0A 3NZ0A 3NW7A 4O21A 2YITA 3BLRA 3TTJA 4O0UA 5CASA 4IHPA 3ZDIA 2C0TA 2FA2A 2ITPA 2C3KA 4Y73A 5FBNC 4DFBA 4EZ3A 2PVYA 2HENA 2PVLA 4GYIA 4RJ5A 5G6VA 2QOQA 5JGDA 3FLQA 5JZJA 5C4KA 5GIOE 2OH0E 3HV5A 1NXKA 4LMUA 3R00A 3WOWA 4W9WA 5KCVA 4RPVA 3I5NA 2IWIA 3GFEA 3EB0A 1PXLA 3NPCA 3R04A 3VBWA 1E9HA 4K8AA 4C0TA 3H30A 2B55A 3AMBA 4A9YA 2VTTA 4NTSA 4ZSAA 3QTQA 3W8LA 3F2RA 3MH3A 3VJNA 4XV9A 2XH5A 2OJGA 5IISA 3UQFA 3VUTA 4J8NA 4R7HA 4RLKA 3LXPA 3PYYA 1KV1A 3WARA 1UV5A 4O27B 4F7JA 2RFSA 3PY0A 4JLCA 4QP9A 2OH4A 2W1IA 3F5UA 3FQSA 3CQEA 4AUAA 3DB6A 4MX9A 1NA7A 2JKOA 4V04A 1B38A 4MHAA 5IU2A 1E1VA 3QZGA 1OL7A 3BYUA 4QMTA 4ANBA 3DLZA 2YM3A 4AN9A 4BBEA 4DT8A 5CZHA 3DBCA 5E8WA 3I6UA 5EYMA 2ZV7A 1RJBA 3D2KA 1KE5A 3HVCA 4IDTA 4OT5A 4RVLA 3K2LA 4JAIA 3MY5A 4QTEA 5IG1A 4F4PA 4B4LA 2B9IA 3NDMA 4YJSA 4PV0A 1REJA 2IVSA 2QG5A 3L1SA 4D2WA 4F65A 3NVKI 5K9IA 3UJGA 5DH3A 4M7IA 3QC9A 5JFSA 4W9XA 4FNZA 4FSRA 2BRGA 3SA0A 4IMYA 3MB7A 4EONA 5LVPA 3QKMA 1CDKA 3AOXA 2PMNX 2ZJWA 4Y8DA 1WVXA 2YLEA 2I1MA 4FBXA 4TN6A 2W5AA 3D9VA 4FKPA 4FIGA 3VBXA 5BVDA 2CSNA 2O8YA 2YM7A 4O7SA 3W1FA 2YDKA 5HG8A 3TKHA 4PP7A 3VUKA 2EXMA 3O8TA 4M68A 2G2HA 4IM2A 1XBBA 4LFIA 4QYFA 5DEWA 1VYWA 2UZDA 3R8MA 4NW5A 3V04A 5LOHA 5HIBA 4EYJA 4AW1A 3ZEWA 2B53A 4EORA 3QGWA 3G0FA 1RQQA 3MSSA 4WG4A 5BQ0A 4KD1A 4ITJA 1U5RA 2NO3A 1H1SA 2PVMA 3I5ZA 3CTQA 4LRKA 4L3PA 4USDA 3FBVA 4C4FA 4JQ7A 5KHXA 2CKEA 4LGHA 2B0QA 3VS0A 1ZOHA 4N6YA 3T9IA 4F9WA 4FYNA 2OJ9A 2XCHA 2OGVA 1KE9A 2BCJA 3MA3A 4ASEA 2ITZA 4L3JA 5JGAA 2VN9A 1GZOA 2G15A 1FBNA 2YZLA 3C0IA 4FTRA 3P1AA 3Q04A 2QOLA 4BYIA 5JFVA 4ASZA 4AA5A 3E88A 5K0KA 4TYJA 3FYKX 2RFEA 2VAGA 1YKRA 3I79A 1F0QA 2QOKA 4NFMA 3FZ1A 2VTSA 4EUUA 4E6DA 4HCUA 4M0YA 4WNKA 5HKMA 3RI1A 4CFXA 5M44A 3VUMA 4CV8A 3NIEA 3A7FA 3CEKA 4LOQA 4PQNA 3HAVA 4D1ZA 3AC3A 4WNPA 2UVYA 3VW8A 4BDDA 3WF6A 4AN3A 4JBVA 2WMUA 3GC9A 1BKXA 4EK3A 2B9HA 4F08A 1JKLA 1S9JA 1ZMUA 2E9PA 2Y9QA 3KVWA 4KIQA 4G17A 4JOAA 4L6QA 4QMSA 4S31A 1R78A 2PWLA 2B4SB 2W5BA 3JY0A 2JDVA 2XJ1A 3E8DA 4KAOA 4NJDA 3RZBA 3DK3A 5GHVA 2WTCA 3WZKA 4C4JA 4E7WA 3NYNA 4U40A 5C8NA 3ORLA 3ULIA 3D4QA 4D2SA 2J4ZA 4K0YA 4ACDA 4I24A 5C9CA 1YHSA 2YCFA 4I3ZA 4D5HA 4KS8A 3QYZA 1G8AA 4M69A 2YN8A 3QLFA 4DGGA 4ZSLA 1LP4A 4J1RA 3V5LA 2R3JA 3OWJA 4JNWA 1UKIA 4AQCA 3UIXA 5JH6A 4HVHA 4O7VA 3KRXA 5L8JA 4F64A 3ZSIA 5IQGA 3U4WA 3I4BA 2ITWA 4CD0A 3QAME 4AT3A 4RJ3A 3UPXA 4C35A 1HCKA 1WAKA 2PZ5A 2R3OA 3BGZA 3PXYA 4CRSA 1OL6A 2XK8A 2PSQA 2XMYA 4WKQA 4DCAA 4MNFA 4LGDA 2HWOA 3SAYA 4IZYA 4USFA 3GVUA 1SMHA 4JI9A 4IB0A 2JAMA 4RZWA 3A62A 3TZ9A 1K2PA 2PE0A 2W06A 4QMPA 1Y8YA 5CNOA 4ZTHA 2WZJA 3ZXZA 1TQPA 4BKZA 3H3CA 5K0XA 4NIFA 4O81A 1URCA 2GS6A 2IJMA 2OJFE 3LOKA 1PXOA 3E62A 4FKSA 5CVFA 5E8ZA 2VWYA 4WG3A 3I0QA 5HCYA 2ZAZA 4LL0A 2KULA 3HRCA 3PPZA 2WTVA 1RW8A 2YLFA 2UZUE 4YJRA 5DT4A 2ZM4A 3R6XA 4S2ZA 4E4LA 4BZDA 3E7VA 3ID6C 3S3IA 1Q97A 1OGUA 2QU6A 4QMNA 2YAAA 2F49A 3PP0A 3OWLA 3R7OA 2GFSA 3FL4A 2DYLA 4CT1A 4ZS4A 3BV2A 2X8DA 2O63A 4IE9A 2H8HA 1YOMA 2C0OA 2C5YA 2QHMA 3MPTA 5ACKA 4OAVB 5IDNA 2HYYA 4QTCA 4AGWA 5LVNA 1UWHA 3KY2A 5C8MA 3ZTXA 3LMGA 4BDIA 2XBJA 3P86A 4PWNA 2ITOA 2UVZA 5TO8A 3ZRKA 1L3RE 2QU5A 3HV6A 2R9SA 4HNFA 4V0GA 4EH2A 3HAMA 1FMKA 2FB8A 2HXQA 2WTJA 3SXRA 4RX7A 3PVGA 3EN5A 4MBIA 5M53A 5FTQA 4G3DA 5CALA 3W2PA 4TWCA 2J50A 2BRNA 3DV3A 4R8QA 3MWUA 5CLPA 2BDFA 5B2MA 2VTOA 1U46A 4QQTA 4ZJJA 1UU9A 4KIKA 4PY1A 3JS2A 2W1GA 4FR4A 4PL4A 3UBDA 4B9DA 2WTKC 5CXZA 5I9YA 2GTNA 1XH5A 4TYHA 3RCJA 3I7BA 5CAVA 1JLUE 4EOLA 3DK7A 4MXZA 3E93A 3V3VA 2W1CA 4JJRA 1H27A 3MFUA 3LQ5A 1V1KA 3R8PA 3QC4A 5CAUA 1IASA 2C1BA 2WXVA 2RIOA 4PDYA 3E64A 3KRLA 3BYOA 4MF1A 1XO2B 4FVPA 4M67A 5IA1A 4XRLA 1WBPA 4DEHA 4DH5A 4ZY4A 3A4OX 2C5NA 3T3UA 4FTNA 4IWOA 5M55A 3HMOA 3LE6A 4F9CA 2OICA 3QXPA 2HZNA 4Q5EA 1H08A 3WF5A 5C1QB 3JYAA 4CYIA 3HV3A 3LJ2A 3ZFMA 4TT7A 2GHGA 1J7LA 1UU7A 3NNVA 1O6KA 2OI4X 4RMZA 4WNOA 3BGQA 5AUXA 3UYTA 2QKWB 4BTJA 1Q8UA 2HY81 2P4IA 3PXKA 4FTCA 4AP7A 3GT8A 4J52A 1A48A 2OLCA 2JD5A 2VNWA 4Y72A 3N4TA 4YLJA 4E5BA 3O0GA 1LEWA 4P5ZA 4WO5A 4A7CA 3LMIA 3COMA 2R3HA 4C57A 2OU7A 1ERKA 2R3NA 5B2KA 1P4FA 3I1AA 1DI8A 2G9XA 2GQSA 3FEGA 3SD0A 3MB6A 3OC1A 4BHNA 2CKPA 3MW1A 3R21A 4W4YA 5J95A 4O7RA 3PVUA 3E8CA 3Q2JA 3SG8A 1ZAOA 3FE3A 2QQ7A 2VTIA 1WVWA 2QO2A 1SVGA 2RF9A 3KXGA 4R1VA 1KE6A 3FPQA 3TKIA 3ZLYA 4ZY5A 3GCQA 3UQGA 4O91A 4L01A 3UO6A 3UTOA 5BYLA 2YDJA 2EWAA 2WIPA 2QOBA 4O1PA 3QQFA 4LQMA 3TZ7A 4F99A 1Y91A 4D1SA 4RFYA 3KREA 3MDYA 5DEYA 5H8BA 4C2VA 4ZJIA 4FZ6A 4MEDA 2X39A 3TNIA 4BI1A 4NSTA 4D2PA 3MV5A 1OM1A 2X8EA 2OFVA 3R9OA 4FTOA 2QURA 1YDRE 3R7YA 3BIZA 4XG2A 2QOHA 3KK8A 4ZTRA 3ZUVA 4ZZNA 3ZFYA 3TNHA 3K3IA 3KXXA 3WE4A 2QONA 5J7BA 3IDBA 3QF9A 3QCXA 1IA8A 5EOBA 4CEGA 4X2NA 4JG8A 4YTFA 4NM0A 2XKDA 5JFXA 3PPKA 3TZMA 4C3PA 1H24A 4G6NA 5HX6A 1BUHA 3R8VA 4RFMA 3QZFA 5HO8A 5HVJA 4WUAA 3D83A 3QRKA 4MXYA 2AC3A 4O2ZA 5DI1A 4AFJA 3QCSA 3F9NA 3VUDA 4CG8A 5M06A 3HMPA 4L44A 1GJOA 4TL0A 4A4OA 4YJVA 5M57A 2BILB 2REIA 2BMCA 4QQ5A 3HMIA 3DKOA 4IXPA 5CEQA 3OW3A 3OROA 4YP8A 3ROYA 2B52A 3WZUA 3OBGA 2GQGA 2ITTA 3TL8A 4YTHA 2J9MA 2W1DA 4BRXA 2BTRA 3CC6A 3R1NA 3F2AA 3ERKA 1M7QA 1PXNA 2YA9A 3BE9A 4QMUA 2J0KA 4U8ZA 3C4XA 3MBLA 3F5PA 3QALE 4YTIA 4K33A 4KB8A 3D5WA 4FICA 2WGJA 1Y8GA 2WU6A 3VJOA 1WFCA 5HNBA 4C58A 4XMOA 3NAXA 2WO6A 4D9TA 4F63A 4ZEGA 5FP6A 3WF9A 4IAYA 4E5AX 4YR8A 3F3UA 3M2WA 5BUJA 2BFYA 3BYSA 3QYWA 5H8EA 2HY0A 3QD4A 4D1XA 4UMPA 4O86A 4BR3A 3R9DA 2R3QA 4HOKA 4BVUA 3BYMA 4G6LA 4KABA 4R7IA 5KBRA 3B8QA 3NGAA 4CXAA 4IZ5A 4JX3A 4K9YA 3NCGA 3QTRA 5GZAA 4CFMA 4V01A 3DZOA 3MTLA 4YMJA 2ITVA 4JAJA 3CGFA 3KGAA 5FDXA 4X3FC 4FSUA 4TPTA 4Q5HA 4HGLA 3QQJA 3VQUA 4H05A 1GY3A 2PL0A 3ITZA 2XIXA 3RALA 5HORA 5HG5A 4XP2A 3PJCA 4O0XA 3VUHA 5J9YA 1OMWA 3TM0A 3CCNA 4XNEA 5IUIA 3C1XA 3OTVA 2IW8A 2J0JA 5E1SA 2WPAA 5J8IA 3TV7A 3LQ3A 2CJMA 2DS1A 3LMHA 3AGMA 4GU9A 4LRMA 2YFXA 3VS2A 2BRBA 2XIZA 2YDIA 3F66A 5DR2A 3DGKA 1OBGA 4H3QA 4NH1A 3AMYA 3A7GA 3QZIA 3CY3A 4AOTA 3RCDA 3RAKA 2PUPA 3QZHA 3V6SA 4DFNA 1J7IA 4DE4A 3P23A 4I21A 2R4BA 2Z7RA 5A46A 3ATSA 5I0BA 5A54A 4FOBA 2I40A 3S1HA 2F7ZE 2WMVA 3K54A 3ORKA 4YC8A 3C7QA 5J5SA 5KKRB 2PE1A 4UZHA 4CTBA 4EOKA 4J96A 3COHA 3GUBA 1H26A 2JKMA 3VRZA 3O51A 1M52A 3BI6A 3FMDA 4X6QC 1YWRA 2WFYA 3ELJA 2ETKA 2JDSA 2QCSA 2LGCA 1OECA 4LG4A 1WMKA 3P0MA 4Y85A 3HP2A 5AUYA 1VYZA 2JC6A 3I0OA 3VO3A 4PMMA 3HX4A 4FSTA 2ESMA 3FUPA 4O82A 4WHZA 3MIAA 4XLIA 4BB4A 1DAYA 4FG8A 3TJDA 3FLSA 3G33A 3ZC6A 3DLSA 4BDKA 2CLXA 4FK6A 4NFNA 3KKVA 4O7NA 4AT4A 2VWXA 2ZV2A 4HNIA 4GYGA 5CT7A 3VS3A 3KA0A 2CMWA 3GCUA 2J0MB 4BI2A 3LFEA 3NMUF 2VWIA 4PTEA 3BE2A 3CE3A 2A2AA 3NYVA 4OTDA 4EH9A 5HVKA 3R83A 4IACA 5G1XA 2O5KA 5E9EA 5DT3A 4KINA 5HTIA 4OTQA 5BVEA 3RAIA 5CSVA 5FP5A 5M4CA 1YQJA 5BVKA 3W10A 2YJSA 3SOCA 2V7OA 3BPRA 4Q9SA 3VBYA 2OXXA 2C3IB 2W4KA 4J99A 3OEFX 4BCFA 3NVMB 2XM8A 3KMUA 5AR8A 1SVEA 4FIJA 4ZAUA 3EFWA 2YWVA 2ONLC 4HPTE 5BX0A 2R0IA 3CQUA 4I20A 4CFNA 4PNKA 5LVMA 3BEAA 3DA6A 2ZOQA 1BMKA 1VZOA 4I22A 2VWZA 5AP3A 3TDVA 5E8UA 1V0PA 3UP2A 5ANJA 3ZO2A 4TWNA 4RWJA 3VULA 4C36A 5IH5A 2H9VA 4WNMA 3ZUUA 5CF8A 1ZOGA 4ANMA 4QT1A 4RWIA 3G6HA 4XV2A 5EI6A 4DFYA 1CTPE 3EH9A 1FVRA 5AIKA 4F0IA 4GK3A 4RIYB 4E4NA 2XNGA 4E4MA 2F2CB 5J87A 3HGKA 4X3JA 4I0RA 3QRIA 2X2LA 3DQXA 3IECA 2OBJA 3WF7A 1S9IA 3ORXA 4FG7A 4QP3A 4JIKA 3TNWA 3UNZA 3TUCA 3NNUA 3DXQA 2VO0A 4DFLA 2R7BA 3L9LA 3OF0A 5HE3A 4CCUA 4IFCA 4CTCA 2NP8A 5CVGA 5JQ5A 1QPEA 5K4JA 3NNWA 4FTTA 4QMWA 4X0MA 5AEPA 3Q32A 4G9RA 4O7YA 3DBQA 4GUEA 2CKQA 2BROA 2CN5A 4RJ7A 4EH4A 1WBWA 4GU6A 4AA0A 2JEDA 4FSMA 3OOMA 4YHJA 3CJGA 3E8EA 3DOGA 2R3FA 3CIKA 3L9NA 1J3HA 3WYYA 1PYXA 3R2YA 2UZNA 4EHGA 1W82A 3DY7A 5IUGA 2O0UA 4DFUA 3DAKA 4HZSA 4UXQA 4RC3A 4DFXE 5IQIA 4UV0A 1DM2A 1WBTA 2XA4A 2EXCX 2OK1A 3T8OA 3V5QA 3ZSHA 4O0RA 5EI2A 3TKUA 1OKYA 5EKOA 1YHWA 3ZXTA 3NR9A 3HV7A 3W32A 4U3YA 3EKKA 1AQ1A 5CEPA 4ORKA 4EEVA 3C4FA 5CS6A 4U80A 3RK5A 2W1EA 3FSFA 5DWRA 2PK9A 1Q61A 4YLKA 2CCHA 3RM6A 1XH9A 3DTCA 4QQJA 2LAVA 3L9PA 3BHVA 3HUBA 3OXIA 5I9WA 1U4DA 3MN3A 1DAWA 2XK9A 3KCFA 4AZEA 3ENMA 2R3RA 4MXOA 4OTWA 3VBTA 4ENYA 4FIFA 3P79A 5E91A 2PVRA 2GNGA 4CMUA 2OF4A 3ALOA 2UZBA 3MVJA 3LFSA 4O0SA 4BI0A 4YPDA 3ACKA 5EHOA 2J5EA 5DFPA 3U87A 1YI6A 4MWIA 4U81A 1YXUA 5EH0A 5E8TA 1QMZA 2WQBA 3S2PA 1SNXA 3NSZA 4M13A 1NT2A 3PA3A 3G15A 3SG9A 5EW8A 1YI4A 4V05A 3BBTB 1TQIA 2GFCA 3ZH8A 5HEZA 4LGGA 4UMTA 2P55A 2HWPA 4FV4A 3COKA 4DEBA 4YJPA 5A6NA 5J79A 3H9FA 3I60A 5B7VA 5LWMA 3BWJA 1Q62A 5AUUA 3BZ3A 4YC3A 3VS1A 1HOWA 3IW6A 4E6AA 2FYSA 1H1WA 4MTAA 3AC4A 2OF2A 4XG4A 3HRFA 4XBRA 3V8TA 2O2UA 4DGLC 2HZ4A 4MNEB 5FXSA 4C59A 5F9EA 5J7HA 3KVXA 3ZM9A 3NW6A 3VIDA 4EHVA 2HW6A 3R01A 4EJNA 2R3PA 1BL6A 2FH9A 2YZAA 3E5AA 5EFQA 4O0VA 4FEWA 4BHZA 3W2RA 4I94A 1ZYCA 2E9NA 4GUBA 3ANRA 4KKEA 3SHEA 5FTGA 3PSBA 4F1OA 3F6XA 4BZNA 2X0GA 2WOTA 4G1WA 3FAAA 4YSMA 4F0GA 5M51A 4YZCA 3FMMA 3REPA 2R7IA 3FLNC 3IPHA 2PU8A 3MIYA 4YPSA 2UW3A 3GCSA 3C9WA 3AT3A 4G3CA 3ROCA 2G1TA 3EIDA 5ANOA 2OSCA 3DDPA 3PRFA 4C4GA 5I9ZA 1GZNA 4E5WA 3TXOA 4BKJA 4CQGA 3OUNB 4M97A 4CKIA 2R3MA 3AT4A 5DA3A 2XUUA 5LMKA 2EB3A 3OT8A 2GS2A 2ETMA 5C27A 4GFMA 1YXSA 3FY0A 4FSNA 3UP7A 3I6WA 5BUEA 2C3JA 3ZM4A 2OIQA 2BZJA 3BBWA 3CP9A 1Y57A 2O64A 3QWJA 3VS6A 5DVRA 4XUFA 3VBVA 3FI3A 4GFOA 5AP1A 5HU3A 3P7BA 1JQHA 3A7JA 1K3AA 3CTHA 3F5XA 3BGPA 3NUXA 2J7TA 5LMKC 2EVAA 2WTIA 3GQLA 2XEYA 2UZLA 3DNEA 3M42A 3R1YA 1OI9A 4FODA 1H1RA 4PTGA 4WOVA 3EQHA 3JVRA 1R39A 4PMSA 3CR0A 3EN6A 4D4VA 4AWIA 4IZ7A 4H3PA 1ZY5A 2X9FA 4HGEA 4NM5A 2QODA 1BYGA 2UZOA 4FV0A 1NY3A 3KN6A 4IB3A 1NVQA 5F95A 5GZ8A 4DEEA 3D0EA 5IPJA 5DYJA 3D7TA 3Q4UA 4RQKA 3PSCA 4FL3A 3FDNA 3P7AA 3QQLA 4ZTLA 4AW2A 2CLQA 4DEAA 1KUTA 4OTHA 3JVSA 4AZSA 5IQAA 2F7XE 4ZK5A 4LRJA 5D41A 3BLQA 2PVNA 5IH6A 3MVHA 4JBOA 1KV2A 2JKQA 2ZDTA 3PY1A 3OCSA 4PL5A 3F5GA 4M14A 2RG6A 2WU7A 5L4QA 2CCIA 3CPBA 4L53A 5A4CA 4S33A 2I0HA 2GPHA 4CFVA 2PZYA 2C5VA 2OZAA 3OCGA 4OUCA 4XV3A 4FG9A 3ZLXA 1JOWB 3WF8A 3VUIA 4FVQA 1CSNA 3GC7A 3IONA 2PMOX 4TNDA 5AV2A 3OOGA 3WI6A 4CT2A 3IDCA 1H0WA 2JFLA 4BDAA 4RJ4A 3FYJX 4U97A 3EQRA 4KRCA 1P14A 5AR7A 3O71A 4ONAA 3FMKA 4WA9A 2GHLA 2UW8A 4IX3A 2XNNA 4DH7A 3EYGA 5CU2A 2XIYA 4EOJA 4S34A 4A9UA 3H4JA 4DN5A 4HZRA 4O22A 3HDMA 5M56A 3A99A 1Q8ZA 2X4ZA 3OCTA 2BZHB 2AUHA 2JDTA 1P2AA 3R8UA 4C2WA 3C4CA 3SDJA 4JQ8A 3VS4A 5J1VA 2BKKA 5C8KA 4I6FA 2DQ7X 3CXWA 5K3YA 3MH0A 4FUYA 3FHIA 4KS7A 4IX6A 1MRUA 4QQCA 3R8ZA 5J1WA 2Z8CA 2R5TA 5ETFA 3BEGA 4GL9A 2WQOA 3A2CA 5TT7A 3OFMA 5GINE 2HAKA 2WEVA 2UW0A 3EJ1A 1MRYA 4FT9A 3UYSA 5IDPA 1XH6A 3KMMA 4FKWA 4FX3A 4HYSA 5EM5A 5HLPA 4UX9A 4U79A 2XKCA 2YM5A 2HCKA 3II5A 4JR3A 3OVVA 5H9BA 4JG6A 3L8SA 3UVQA 2IW6A 1OPLA 3C0HA 1NVSA 5AUVA 1UNHA 4AZTA 5HLNA 3RK9A 4O6EA 3UO4A 4EC9A 3JUHA 3QA8A 4RA4A 5D7AA 4A4LA 4FE2A 3QUDA 2Y6MA 3FZSA 4QO9A 5K4IA 1PXPA 4FIIA 4O1OA 4IC7A 4AOIA 2WMRA 5I3OA 3QTXA 2QO9A 3ZBXA 3QUPA 4AZVA 1G8SA 4GEOA 4O7TA 5TF9A 3EZRA 4TYIA 3DJ6A 4PDSA 1OIUA 4IVCA 4FA2A 2IZSA 5HCZA 1YWNA 3ZC5A 4GRBA 4BBMA 2JFMA 4UMQA 4BWXA 4N70A 3CGOA 1G3NA 3FY2A 4JDIA 4TXCA 2F4JA 4WG5A 4N57A 5L3AA 4P90A 4FT0A 4V0GB 3LFNA 4BL1A 4F9BA 5LMBA 2WTKB 3KB7A 3BX5A 2WMTA 3FXZA 3RINA 1Q24A 1JWHA 5E7RA 1FINA 4C33A 4GKIA 4ALVA 2BZIB 4GVJA 5IEXA 4AA4A 1XH7A 3D14A 4RA5A 3SW4A 3OWKA 2RKUA 2W96B 3QCYA 4RFZA 4UWBA 2XB7A 2VTJA 2VO7A 3PJ2A 2YM8A 5CWZA 2BUJA 3QLGA 3EFKA 4FKVA 4UXLA 4GIIA 4ANLA 3KN5A 3BKBA 3WYXA 4UZDA 3CPCA 5DMZA 4HGSA 3B2TA 5KMJA 1CKIA 4TTHB 5EK7A 2BDJA 4XX9A 4DC2A 2PMIA 1ZYSA 3ZU7A 4BTMA 4U5JA 4BCPA 4F0FA 1BX6A 4LMNA 5FXRA 5DRBA 5AV4A 2XVDA 4C4HA 3SOAA 4DTBA 4FYOA 2QNJA 2YJRA 3PIYA 4JS8A 4F7LA 3DBFA 2O65A 4RZVA 5HG7A 4FZFB 2A1AB 3AD4A 3GC0A 4PPCA 4IB1A 5KX8A 3LQ8A 4YBJA 5AV3A 5CQUA 5CEIA 4BCIA 1OIRA 4DTKA 2NNWB 3NUSA 5ANDA 3SXSA 4II5A 2CPKE 4BIBA 4WRSA 4EOMA 1YVJA 4CFWA 3QRTA 5BVNA 2GNJA 2VX1A 4I6HA 4QP6A 1R3CA 1B39A 4BC6A 4ZS0A 5IH4A 1KSWA 2W05A 3D94A 4P2KA 5KNJA 3MPMA 5JRQA 3WZEA 2GNLA 2HZ0A 2C30A 3OD6X 1F5QA 2OO8X 4I0SA 4NKAA 2WB8A 5AM6A 1PMEA 3OY3A 2W0JA 4RWLA 1OL5A 3UOKA 2BPMA 5BVWA 1ND4A 5IQEA 3L8XA 4RIXB 5AAEA 5CEOA 4ZTQA 2X1NA 4QD6A 3MFSA 3NRMA 4F70A 1LUFA 3OXZA 3TG1A 4PMPA 3ZLWA 1J91A 3LPBA 2C6IA 3RHXA 1G5SA 1RE8A 5AA8A 4QPAA 1JBPE 4ZMFA 4CLJA 3BHHA 4FSZA 4KIOA 3EMGA 5EM7A 3DFCB 5HLWA 2C6TA 2Y8OA 5KMKA 2ERKA 4ZZOA 3IO7A 4JRNA 3PJ3A 3RPYA 3E3PA 3BWFA 4J7BA 3W2QA 2FVDA 3AC8A 3O7LB 3ULZA 4E4XA 4R3PA 3EN9A 5DGZA 4IJ9A 3RNYA 4EQUA 4BY9E 1GIHA 4YU2A 4TWOA 4QTDA 2P2HA 2VTNA 4FIEA 5E8VA 1YDTE 3MFRA 4HYUA 5L2SA 3PRIA 4K6ZA 4OTIA 5DIAA 5C03A 3H9RA 3NUUA 3POOA 4C4IA 2XK7A 2ZVAA 1T45A 5GJGA 4FC0A 5FGKA 3RAWA 3ATTA 4EWQA 2ACXA 2YIRA 4ZLYA 2BR1A 4XLVA 2YIYA 3QBNA 3A7IA 3R73A 4JL9A 3LM5A 3HP5A 3S0OA 2P3GX 5A14A 1H0VA 1Q41A 3N4VA 4PDOA 3NWWA 2C6OA 1W98A 2VTQA 4X7QA 2XJ0A 3Q60A 4EKKA 5M08A 2Y7JA 4GK4A 4ZP5A 4QNAA 5L2TA 1H28A 1M14A 2ZB1A 4GJ3A 3R71A 3RPOA 2UZWE 4J98A 3ZBFA 2OJJA 4EH7A 3PXZA 4RLLA 4XG7A 4BCOA 4NW6A 3UO5A 4NYEA 3PA4A 4FL2A 3QTZA 5BYZA 3AD6A 4PRJA 2QOIA 3NS9A 3FLYA 4JRVA 3IOPA 3GFWA 3KC3A 4OLIA 5ETAA 3D5UA 3KRJA 3IGGA 1U5QA 3UZPA 4G3EA 2OXDA 2XCKA 4HVIA 4CKRA 5C26A 2JLDA 5CU3A 4G9CA 4XCUA 4BTKA 5FUTA 2CHLA 3ORIA 4EI4A 3N4UA 2YCSA 4EJ7A 4G5PA 4YJNA 5AP5A 2V5QA 2Y6OA 3DQWA 3CSVA 2F7EE 3A8XA 4L45A 3VHKA 3GU8A 4YBKA 5TKDA 3TV4A 2YIXA 2PMLX 2Q0BA 4PDPA 4L7FA 5KZIA 1IEPA 4YZMA 4CNHA 3A7HA 2PVJA 3GBZA 4X3FB 4EKLA 2BRMA 3K5UA 2JBPA 4G16A 5EI8A 4BDHA 4DH8A 4MAOA 5E8XA 3RMFA 5HOAA 3RJCA 3LCTA 4BTFA 2JDOA 3TEIA 1XBCA 1J7UA 2Q0NA 3KL8A 3Q52A 2HXLA 1PXIA 2JIVA 3PZEA 4O0YA 5AR2A 3R7VA 1PMVA 4QPMA 2OIBA 4FV9A 4EOOA 5FLFA 4TWPA 4A4XA 3MH1A 4H39A 4YHFA 2BHHA 3EQCA 3FXWA 2YACA 1M2PA 3F82A 3IW7A 2IW9A 1H1QA 4FOCA 1PXKA 4IIRA 5DN3A 2Y0AA 1VJYA 2JGZA 5CY3A 3B8RA 4MXXA 4DITA 4GV1A 2Z7SA 4UN0C 4EOIA 1M2RA 1PKDA 2VGPA 3K5VA 2VNYA 1ATPE 3NX8A 3DTWA 4RWKA 3UC3A 2IZTA 4K1BA 4E8AA 5CENA 2X7FA 3KXZA 3HYHA 1W83A 3OS3A 4Z7GA 2GQRA 5H8GA 3FI8A 1FQ1B 1YXXA 4QNYA 5L6OA 3FPMA 3SXFA 3V5WA 4E6CA 3C13A 3FXXA 2B1PA 4Q2AA 4RC2A 1UVRA 2W99B 2UW6A 3RPRA 4OBPA 5AV0A 2P33A 2QD9A 3C4EA 4I4EA 3WIKA 1JKSA 2ETRA 4DGOA 3TUBA 2XEZA 2WQMA 3BQCA 4YZBA 5AR4A 1JSUA 1OB3A 1ZXEA 4MK0A 4MQ2A 4P4CA 3ZUTA 4DA5A 4G34A 1IR3A 5JT2A 3WE8A 1YHVA 4QMVA 2G01A 2WMXA 4O7ZA 3BHUA 5D12A 5TE0A 3MTFA 4BCNA 4FT3A 4DT9A 4B8MA 3EHAA 4FTQA 1M7NA 3NNXA 3IG7A 3W8QA 4ERKA 1W84A 3C0GA 4EHZA 4ZLZA 5EM6A 3CD3A 3CS9A 3ZLSA 5M4FA 4R3CA 2IN6A 4TYEA 2YHVA 4JR7A 1PRYA 4YGAA 2BALA 3Q3BA 2H6DA 1FMOE 1OIQA 5CTPA 3Q6WA 4YLLA 4MD9E 3KEXA 3R7EA 4YTCA 4KSQA 3KF7A 3SC1A 4Q9ZA 3K3JA 3OP5A 5J9LA 4LL5A 5IEYA 4FNYA 1O9UA 2PE2A 4U44A 2X6EA 3BYVA 4TKSA 4WSQA 4YZDA 4D0XA 1VEBA 3FL5A 1GZKA 4O96A 3CJFA 4MBLA 3O7LD 4MYGA 3PVWA 4RBLA 4YJOA 4I1ZA 2ITNA 1QPDA 4BCJA 3PLAE 4OBQA 2VTRA 2XNPA 3FLWA 5CZIA 2YERA 4CFFA 4NTTA 4RX8A 3QXOA 4OAUC 5ICPA 4CKJA 3C4ZA 4FKTA 3ZCLA 4JBQA 5JMSA 4MQ1A 4XG6A 1TKIA 4M3QA 5FWKK 3T9TA 4M8TA 5DT0A 4EOQA 4EZ7A 1PW2A 4QRCA 4QP8A 4I5CA 4DAWA 1FVTA 3FMEA 2JIIA 3Q4ZA 3EL8A 3ZRLA 3ENHA 3JPVA 4Y83A 2BAJA 2BAQA 2J0LA 2QOOA 4EK8A 1KE7A 3O23A 4IAFA 1ZLTA 3FKNA 2UZVA 2EU9A 3QHRA 2VX3A 4N6ZA 2XKEA 4MKCA 4CSVA 1U59A 3F88A 3OBJA 4FNXA 2ZM3A 1O6LA 2Z7LA 3TN8A 3PSDA 3HNGA 4W8DA 5F94A 3E63A 4FTIA 4GFGA 1B6CB 3QWKA 5TR6A 3R7IA 5HD4A 4PX6A 4GMYA 5EKNA 5C4LA 5JSMA 1Q8YA 4LYNA 3RHKA 2V62A 2ZV9A 5LCKA 2XS0A 1U54A 4F1MA 3PP1A 5CEKA 5IQHA 2W9ZB 2XKFA 4R6VA 4DGMA 4UWCA 1ZMVA 3UE4A 3JXWA 3I7CA 3P9JA 3MPAA 5EYCA 2ZV8A 4IWDA 4DINA 3QFVA 3Q96A 3I81A 3PVBA 5FEEA 3WZJA 3GC8A 4EQMA 3AC1A 3EOCA 3F2NA 4ID7A 5DPVA 5AP7A 2UW7A 2JDRA 3IGOA 3VBQA 3VW6A 1YRPA 3DPKA 4BDJA 1PXJA 3EQFA 2PULA 4J53A 2FSLX 3G9NA 5M09A 2YWPA 3CBLA 2OW3A 5CU4A 3R02A 4DHFA 4MCVA 5LCJA 1PXMA 4USEA 4O83A 3Q53A 4BCMA 3UNJA 1Q4LA 3KULA 3WBLA 1FGIA 1GNGA 5AUZA 5JZNA 3U54A 2R3GA 2OG8A 5KBQA 5L2WA 3O2MA 4R5YA 2Z2WA 4OBOA 4RIWB 1XHAA 3IW5A 4E20A 4MXAA 4CZUA 1O6YA 2OFUA 4K2RA 4ZTNA 5AV1A 3ODZX 5A6OA 3PA5A 5HNIX 4AF3A 4EL9A 4QP2A 2QKRA 5DOSA 5HTBA 1QL6A 2AC5A 3B2WA 3DAEA 5DNRA 4EUTA 1AGWA 1IA9A 3E92A 3S4QA 4BDBA 4RIOA 3P5KA 4RG0A 3ZDUA 3UIMA 2IO6A 2I7QA 4GCJA 4TW9A 2W1HA 4BCHA 4UWYA 3E7OA 1TQMA 3NLBA 3PUPA 2XZSA 5L2IA 2SRCA 4AX8A 1QPJA 3SX9A 2VX0A 2QG7A 1BI7A 4Z3VA 3O8UA 4HPUE 2UW4A 3PLSA 4DFZE 5IA4A 4GKHA 4FTMA 5AIRA 3H9OA 2VWVA 4N4SA 5FEDA 3U8WA 1XR1A 2PZIA 5GJDA 4AE6A 5FTOA 2V55A 3DXNA 4ACMA 5HNGA 4F9AA 4R77A 4E73A 5BVOA 3SRVA 4C34A 5E8YA 4MWHA 3LKMA 4TYGA 4X2FA 2XF0A 3LFAA 3LIJA 3D7ZA 2X9EA 4OW8A 2QR8A 4CG9A 4JX7A 4L7SA 2OJIA 4FV2A 4FV1A 4BWPA 4I6QA 3DBEA 4I92A 3LFDA 3LAUA 3W33A 3QQHA 5FDPA 4L8MA 2CKOA 1IRKA 2GCDA 3SW7A 1R0PA 3GGFA 4FV6A 1WBOA 3EKNA 3KRRA 2GNHA 3VUGA 5EDPA 1WZYA 3U55A 3H0ZA 2I0VA 1R0EA 2FSOX 2GHMA 3ZOSA 3TV6A 1YXVA 5GJFA 3RP9A 3RKBA 5IQFA 2B9JA 2VWUA 3OT3A 1ZYDA 2Y4IC 4CRLA 4QPSA 2QR7A 4KA3A 3U51A 3UNKA 3PXQA 2JITA 4QMLA 4XRJA 4OGRA 4AGCA 4GG7A 2YIQA 4WIHA 5D9HA 3QHWA 4NWMA 2ZB0A 3M11A 2X7OA 5CEMA 5HE0A 4F1TA 2XM9A 5M4UA 2G2IA 4NU1A 1YW2A 3FI4A 2WMAA 2UZEA 5CSWA 5ANIA 4D4SA 4YJQA 3L8VA 1LEZA 3PWDA 4F9YA 3R63A 4JT3A 4CFUA 2VO6A 3MH2A 3NEWA 1H25A 3Q9YA 3Q9WA 3PTGA 4FSYA 1OUKA 3R7UA 3JY9A 2W5HA 3LFFA 2PPQA 4QTBA 4QOXA 4ZLOA 1EH4A 2A19B 3UGCA 2Z7QA 1SNUA 3MGYA 2NRYA 3VAPA 3ZO1A 3FJQE 4AE9A 5CF4A 3OY1A 5L8LA 3R9RA 1ZZ2A 4PMTA 4CYJA 1OIYA 4L9IA 4LUEA 5EDQA 3KU2A 4F09A 5LQFA 4DLJA 2E9VA 4DBNA 5D7VA 5T6KA 3GU7A 4ACHA 3H0YA 4RIYA 3BCEA 3NYXA 4FEQA 3RAHA 2FUMA 1MQBA 3RWPA 4ANNA 3O8PA 3R7GA 3L9MA 4C02A 4EHEA 2ITYA 4FT7A 5GNKA 1KOAA 4TNBA 5AM7A 4FTAA 4KUJA 4HGTA 3UZTA 3AC2A 5IKWA 4KRDA 5IQDA 4U6RA 1OZ1A 4CMOA 1YXTA 4XH6A 3GOPA 1Q99A 4CMTA 2FO0A 5FQDC 1Y6AA 3ZZEA 5BMSA 4QYHA 4EWHA 4W4WA 5JK3A 3ACJA 5KO1A 2ZYBA 1SM2A 4QYYA 3PFQA 1OL1A 2YCQA 4LOPA 4W4VA 2WQNA 2XIKA 4AW0A 4AXAA 5IZFA 4HVSA 4I5MA 2VO3A 5KZ0A 3C50A 3W55A 3U9CA 3HA6A 3R30A 2CDZA 4H3BA 4ZTSA 3UVPA 4AT5A 4D55A 4AAAA 1WBSA 2C0IA 5HZNA 4NL0A 3KMWA 4I41A 4QMMA 3ZONA 4C61A 4FKGA 3W2SA 5AP0A 2QLQA 1OPJA 3RM7A 3ZYAA 3EQDA 5FRIA 5EW9A 1ZARA 4OTPA 3SV0A 2X2KA 4A07A 3VF8A 1H4LA 4GIHA 1WBNA 1UKHA 4M66A 4PPAA 5HBHA 4Z55A 4S32A 4AOJA 4BDCA 3ZO4A 4GK2A 2ZMDA 3IK3A 3LXKA 3HRBA 2V0DA 3A8WA 4IWPA 4ANQA 4IEBA 3ZSGA 4UYNA 1I44A 4D58A 2R3LA 1XJDA 4F6UA 3G0EA 2WTWA 1Z9XA 1OPKA 1V0BA 2W4JA 4DG3E 3CTJA 5FM2A 5LWNA 4YZNA 2A0CX 4JDKA 2WMWA 4ZIMA 3FLZA 3FMNA 4MH7A 1MP8A 5FEQA 3Q4CA 3FWQA 1CKJA 3SKCA 2UZTA 5CSPA 1J1CA 3QD0A 3RNIA 5CNNA 1W7HA 4GH2A 5DHJA 5CAQA 3C4WA 1JSVA 2CGVA 3BLHA 5LVLA 4JXFA 4J95A 2EUFB 4EH8A 4EZ5A 5IQBA 5AFVA 4G31A 5FBOA 3FV8A 2R64A 3HDNA 4OT6A 4JVGA 4HYIA 2GS7A 3TUDA 1Z57A 5JGBA 3QD3A 5TOZA 1OKVA 4CV9A 3NUYA 3LFBA 4TRLA 4LV5A 5CSXA 4U7ZA 2VWBA 3A61A 1GIJA 1BI8A 2C69A 4C8BA 1M17A 4M69B 3GU6A 2XRWA 4YZ9A 4FVRA 5HHWA 3R9NA 3WZDA 1ZWSA 4X6RA 2BFXA 3V51A 5DR6A 5EHLA 4XOZA 1R1WA 2E9UA 2WEIA 3BRBA 4ENXA 5HTCA 1KWPA 3GENA 1JNKA 2XNEA 3LCKA 4FEXA 1E1XA 4XOYA 4D2RA 4MNEA 1IAJA 3PDTA 3DZQA 1DS5A 2KTYA 4ZJVA 3MVMA 4D2TA 3HLLA 1P5EA 4LM5A 4OR5A 4MXCA 3LW0A 4DH3A 1Q5KA 1KOBA 1YWVA 4XS2A 4E6QA 3QCQA 2P0CA 3OTUA 4RGJA 3MFTA 5FD2A 5ACBC 3V5JA 3G6GA 5J9ZA 4ACCA 4G6OA 4YC6A 1UWJA 4FK3A 3CKXA 1X8BA 3FQEA 4FTKA 2IVUA 2ZMCA 3KRWA 4CZTA 3RBWA 4P7EA 4E3CA 4ITIA 1YDSE 2P2IA 4EBWA 4FGBA 4U43A 2DUVA 2C3LA 4HYHA 4AG8A 3V5TA 1PF8A 5AR3A 3POZA 4BDGA 5LJJA 1ZYLA 5EQPA 4NIFB 5AR5A 5AUWA 4ITHA 3BHTA 5CAOA 3JR1A 1UU8A 2RFNA 1J1BA 1Z5MA 4BBFA 3RPVA 3G9LX 1PYEA 2H96A 5FM3A 5AAFA 3UC4A 3VWAA 5JKGA 4D28A 3SGCA 4R3RA 1RDQE 4G2FA 2X4FA 2UUEA 3QRUA 5ETCA 3GEQA 4G5JA 2C68A 4U45A 3L8PA 5DRDA 5KE0A 4W4XA 4PL3A 4IJPA 4XG8A 4I5HA 3OW4A 2WHBA 2V7AA 4X21A 1SVHA 4HCVA 5DBXA 4ZXTA 2RGPA 2XNMA 3DK6A 2X6DA 1OITA 3WIGA 3P7CA 5AADA 4BDEA 1PJKA 5EQYA 1Y6BA 2C6KA 3W16A 2J6MA 3R8LA 4J97A 5A3XA 2WNTA 5KMMA 2XK6A 1LPUA 2CGXA 2C1AA 3PWYA 5D1JA 3TNPC 3TDWA 2W1FA 2IVVA 3EQIA 4QYGA 2CNUA 3Q9XA 3R0TA 1PY5A 4NCTA 5HO6A 4AS0A 3UPZA 2XRUA 3THBA 1Q8TA 3V01A 4U9AA 3W2OA 4C37A 4I6BA 4TY1A 2QLUA 3EFLA 3FQHA 2QC6A 2QHNA 3FC1X 4ALUA 1L8TA 3AG9A 4FV3A 3HEGA 4QP4A 5ANKA 2PUIA 5EDRA 3Q6UA 3U9NA 3DFAA 2FSTX 4NCTC 5HCXA 4Y5QA 4ASXA 4PP9A 4KIKB 4R78A 5KHWA 4X2JA 4IWQA 3EFJA 4A9RA 5D10A 5E92A 5BPYA 3TIYA 5M07A 2WD1A 3P78A 1ZYJA 4NUSA 4TYHB 5EW3A 3KXNA 1UNLA 5GZ9A 4EK5A 1JAMA 4IAAA 2J0IA 4FTLA 4IM0A 4RJ6A 3QTSA 2ITUA 2EB2A 4E26A 4IFGA 5CT0A 3T3VA 1BL7A 2VGOA 4KBKA 3LHJA 5F20A 3RK7A 2C4GA 5CVHA 3RTPA 4XJ0A 4AZFA 4BCKA 4C7TA 1UNGA 1QPCA 4I5PA 2BDWA 3BV3A 4GT4A 5AMNA 2C6MA 3QA0A 4BGGA 4Y46A 2HOGA 2G2FA 2VZ6A 3FSKA 2W9FB 1OKZA 4EK6A 2VV9A 2PY3A 2R3KA 3NCZA 4QMYA 4K11A 4DG2E 2VWWA 5I9VA 4L52A 5B2LA 5HE2A 3QKKA 4O0TA 1I09A 4G3GA 4GT5A 2XK3A 4BKYA 4EOPA 5KMIA 4K18A 5T68A 5I4NA 2C6EA 3CKWA 2UW5A 2XP2A 1WCCA 5L8KA 2OIDA 1GOLA 3UOJA 4FZDB 3QUEA 3VVHA 1QCFA 3EQGA 5HD7A 3DDQA 4ZSEA 3C5UA 4DEGA 3OEZA 4L00A 3FHRA 3ALNA 3DJ7A 5HG9A 4KKHA 4D0WA 4R7BA 4UEUA 4KSPA 5C01A 3A60A 3W2CA 3PXFA 3R1SA 2WQEA 1OVEA 4QP7A 3UMWA 4B8LA 4CZYB 4GT3A 2B7AA 1JKTA 2PYWA 4FMQA 3OHTA 4JQEA 1FGKA 5F4NA 4M84A 3F3VA 5H2UA 2C47A 4IX4A 2GNIA 2X8IA 4L43A 5AP2A 1ZZLA 5CYIA 2J90A 5HO7A 4C4EA 4XG3A 5AX9A 4BICA 3AMAA 4L68A 4Z9LA 1STCE 5IMEA 3GU5A 1FOTA 3Q9ZA 1APME 2F2UA 2R2PA 4ERWA 5EQEA 3HV4A 4YNEA 3MA6A 3LFQA 4NEUA 1AD5A 4YURA 2A27A 2X2MA 3GXLA 3G5DA 4I93A 4U0IA 5IF1A 4D2VA 1P4OA 4GS6A 1CKPA 5CI6A 3QKLA 2OWBA 4LUDA 3PE1A 4EC8A 3HMNA 4YHTA 3PJ1A 4LOOA 4Z7HA 5IA2A 5JQ8A 4IQ6A 4NZWB 2GNFA 4IAIA 3F3WA 2PTKA 2W17A 4L3LA 4DBXA 5CANA 5DG5A
chains in the Genus database with same CATH superfamily
3COIA 4FTUA 4NM3A 3ZHPC 4NKSA 3O50A 3QGYA 4DCEA 4PPBA 2XYNA 4IBMA 4GJ2A 2XIRA 4MBJA 3AD5A 5IQCA 2WIHA 4KKGA 1MRVA 1ZMWA 3CQWA 4ZY6A 5BUIA 4RT7A 2XJ2A 3IW8A 2UVXA 3QD2B 4WBBB 2I0YA 4ZZMA 4D5KA 5CF6A 2GDOA 1YI3A 3OUKA 4RX5A 4IVDA 4IVAA 4AN2A 2WMSA 1UA2A 4ACGA 1XH4A 3G51A 4EH5A 5K5XA 3HL7A 4O7WA 4Z16A 3VQHA 4AW5A 2C6LA 3KQ7A 4JDJA 2VTAA 4U41A 3GNIB 3Q5IA 1ST0A 5A9UA 5ANEA 4O4BB 2Z60A 2Y4PA 4L67A 5KMNA 3FMLA 3EWHA 3GCPA 4FKJA 4A9SA 5EG3A 5I5ZA 3U6HA 3GCVA 5K5NA 3PIZA 3R28A 4RIXA 4IH8A 2BRHA 5F1ZA 5L2QA 2CNQA 2GTMA 3N51A 4RVTA 4EH3A 3MYGA 3ZFXA 2C5OA 3AC5A 1NW1A 2OKRA 5LXMA 4CGAA 2WTDA 4ZSGA 3EN4A 3LFCA 2ITXA 3HA8A 4E93A 4YSJA 3DKGA 1YOLA 5DR9A 4D4RA 2PVHA 5JEBA 3QQGA 4BYJA 3AQVA 5CQWA 3ZMMA 3DS6A 3UG2A 1OBDA 3ORNA 4FKIA 4IW0A 5BNJA 3VF9A 2YIWA 3GQIA 4FT5A 4NJ3A 3LCDA 3ORPA 3UIUA 4APPA 4C3FA 5BVFA 5IUHA 1SZMA 4BCGA 2XBAA 3ET7A 3A4PA 3NIZA 4H1MA 3ZEPA 4QMQA 3GOKA 3CLYA 3ORTA 1MQ4A 1LR4A 2QOCA 5AUTA 4AQKA 2VUWA 3RGFA 1VR2A 4WSYA 5LVOA 3AT2A 4IC8A 4WT6A 1FPUA 3FZRA 4WD5A 2OXYA 3TNQB 4YUQA 3MJ2A 4F7SA 2Z02A 1T46A 2JKKA 2X0OA 3DKCA 3F7ZA 3ORMA 3BHYA 3H10A 4ANSA 5A4TA 4PTCA 3TACA 1REKA 4F7NA 3Q5ZA 3P5JC 2H34A 3EN7A 4GG5A 2GU8A 4DF3A 1UU3A 3QTUA 4CCBA 1GAGA 2GSFA 2XNBA 4PNIA 1TVOA 1G8JA 5HGIA 4QTAA 2J5FA 5CI7A 3NUPA 3LVPA 2YEXA 4U42A 3ORZA 3DKFA 4J71A 1W8CA 5B0XA 5E1EA 5HIDA 4M0ZA 4X2GA 3KXMA 4M12A 4FKQA 3UOHA 4RVKA 5AP6A 4AGUA 5AA9A 4EH6A 2UV2A 2E2BA 3UDBA 5KUPA 3LJ1A 5AWMA 5HI2A 1GIIA 5EOLA 1PKGA 2W4OA 3IDPA 3OXTA 4MD7E 2BIYA 2HELA 2PVFA 1PMNA 2OZOA 3LJ0A 4YJTA 5AAGA 4FEUA 5IA5A 2AEGA 3TCPA 3QX2A 3IW4A 3GU4A 4AZWA 4ZMEA 1U54B 4LV8A 2W1ZA 4FUXA 4NT4A 5LARA 1JKKA 2CGWA 3D15A 4YJUA 3PY3A 4XG9A 2Q83A 2ZDUA 2JIUA 5IMXA 3C51A 4G3FA 1Q3WA 3PG1A 2BVAA 4X3FA 3V5PA 3F7WA 4ANOA 3IKAA 3NW5A 4I0TA 3PFYA 3HECA 2PHKA 3FKOA 3OCBA 4W8EA 4WRGA 4RVMA 5I3RA 2ITQA 3G2FA 4H58A 4N0SA 4EYMA 4YNOA 2IPXA 3F69A 4IB5A 2BTSA 5HVYA 4QMZA 2R3IA 1CM8A 4BFMA 3PXRA 3KF4A 1JSTA 3ZRMA 4FZ7A 5E4HA 4KWPA 1JVPP 3KULB 5EHYA 2VU3A 3S95A 4P5QA 3QQKA 4FKOA 2F9GA 4KBAA 3TZ8A 3KCKA 4B6LA 3GP0A 3BELA 2XK4A 5H3QA 3LXNA 3IQ7A 4K77A 4CLIA 3AKKA 4ARKA 3QRJA 4DTAA 4NK9A 3DB8A 3F3ZA 3BU3A 4UB7A 3PZHA 4RX9A 5DE2A 4L46A 3EQBA 5CX9A 1XH8A 4XP0A 4DH1A 3UMXA 4GW8A 3ZZWA 3P4KA 3LZBA 3AXWA 3DAJA 3C5IA 3UG1A 1ZOEA 3R9HA 3TWJA 4OTGA 3MESA 3D5XA 4H1JA 5JFWA 4JDHA 2QVSE 3FC2A 3SVVA 4J8MA 2FGIA 4C3RA 4DDGA 2VTPA 2X81A 3UQCA 4QP1A 5HE1A 4FSWA 3M1SA 2PUUA 1A06A 2IG7A 3E3BX 5FXQA 3V8WA 3BQRA 5I9XA 5HBEA 5CAPA 1GZ8A 5KMOA 5CSHA 3SRVB 2QOFA 3DCVA 3N9XA 3LCSA 3QU0A 4KBCA 5FG8A 4CQEA 5CU0A 5HU9A 1MUOA 1XWSA 4PUZA 4QMOA 5CU6A 1ZY4A 2ERZE 5HQ0A 4FV8A 2RG5A 4FKUA 2DWBA 2IVTA 4A06A 1HCLA 5BV3A 2BKZA 3DJ5A 4GVAA 3HUCA 2Y4IB 3LM0A 4IZAA 5E90A 1M2QA 4UMUA 4O7LA 3V6RA 2HIWA 4UY9A 4AFEA 2R0UA 3ZO3A 4FIHA 3AGLA 4EBVA 4HW7A 3BU6A 3V8SA 3F3TA 3QL8A 4IADA 4MVFA 3MS9A 4E1ZA 2J2IB 5I9UA 4U3ZA 4RRVA 3UODA 3VN9A 3SQQA 1ZRZA 3NYOA 2PZRA 3GI3A 3QQUA 3UVRA 2NPQA 3ODYX 4BIDA 2XNOA 5L6WL 4FTJA 4BZOA 5D11A 5L6PA 5AJQA 4APCA 2WMBA 2ONLA 5T3QA 3VRYA 3NUAA 4IVBA 5IA0A 2I0EA 3D2IA 2O3PA 4WBOA 4DEIA 3RZFA 4GSBA 3LLTA 3VS5A 1A9UA 1URWA 4DEDA 1PHKA 4IM3A 2AQXA 4L42A 5HBJA 2VTHA 2AYPA 1KE8A 4PF4A 4XYFA 4X2KA 4BCQA 3FZOA 5A4QA 4BDFA 4H36A 1OL2A 5EM8A 2PVKA 4I4FA 1F3MC 1OUYA 3KFAA 4XHKB 4HJOA 4FKLA 3W0SA 3U6JA 5ANGA 3LXLA 4UYAA 2QO7A 3BL7A 1H07A 3IOKA 3PE2A 3QX4A 4BN1A 4XEYA 4CVAA 3E8NA 3DNDA 4O0WA 3VNTA 4O38A 5EYDA 5LMAA 4I23A 1FVVA 3R2BA 4AU8A 4UMRA 5BYYA 5HX8A 1CMKE 4F6SA 3Q2MA 3QTWA 2YM6A 1H8FA 4XBUA 2WAJA 3RWQA 4QDVA 3OMVA 2E9OA 4IDVA 1K9AA 2BZKB 5IA3A 4ZOGA 1V0OA 2HZIA 1XQZA 3OZ6A 3E87A 3PJ8A 4IAZA 4FNWA 4JBPA 4YO6A 1BLXA 2GMXA 4O2PA 4JIAA 4BWKA 2I6LA 4FV5A 2A4LA 3MVLA 2JAVA 4BIEA 2XYUA 2CN8A 3MY1A 4AGDA 3ETAA 4HVGA 5KKRC 1Q8WA 3IS5A 3UZRA 3W0PA 3FZPA 4DDIA 2ZM1A 1IAHA 4DHJA 2WMQA 4LI5A 1PMUA 3GB2A 3UIBA 3PG3A 3F61A 3OWPA 4Y95A 3RVGA 3BU5A 3P08A 5CXHA 2B9FA 3ANQA 4FF8A 1XBAA 2VRXA 3S00A 2YAKA 2YABA 5A4LA 1SYKA 2EXEA 4HVDA 3U6IA 4MD8E 4LDTA 3ZS5A 4O84A 3VC4A 4FKRA 3TIZA 1WVYA 2UW9A 3TJCA 4FGRA 3SLSA 1H01A 3NAYA 4C62A 4UBAA 2B54A 3EQPA 5EYKA 5E8SA 5AP4A 4D4YA 3FZTA 3KXHA 5ITAA 5DLSA 4FEVA 4AACA 3LLAA 4ASDA 2IZUA 1H1PA 3FMJA 2NRUA 4S30A 3TTIA 5J5TA 3HMMA 3MJ1A 3O17A 4EQCA 3AKJA 4DGNA 4D9UA 4Y5HA 3W18A 4FSQA 2C5XA 5KMLA 1XKKA 4FZAB 4QMXA 4EOSA 4R1YA 2VD5A 2PUNA 4HCTA 5HIEA 4QYEA 3RPSA 4YO4A 5IEVA 3O96A 4M15A 4FL1A 4BGHA 3R22A 4BGQA 2V22A 4RQVA 4IX5A 4OTFA 4F6WA 3VS7A 5CF5A 5HESA 3DBDA 3OG7A 3UOLA 3HZTA 4UALA 4ALWA 4RIWA 2YM4A 2CGUA 3PIXA 4FI1A 2RFDA 2C6DA 3DXPA 2F57A 2HK5A 3NUNA 3EZVA 3FI2A 2BIKB 3R1QA 3CD8A 4JG7A 3HKOA 2CNVA 2X7GA 3G90X 2ZFYA 4RJ8A 4R5SA 3D7TB 3PPJA 5A4EA 5JN2A 5M4IA 4XP3A 1H00A 3FKLA 3TI1A 2WOUA 4A9TA 4IAKA 4B99A 3DT1A 3MI9A 1DI9A 4DYMA 5HICA 3Q4TA 1IG1A 2YCRA 3VHEA 1JPAA 2BAKA 2VTMA 4RC4A 4RSSA 5ETIA 4ZSJA 2YISA 1OKWA 1YOJA 3EYHA 4BF2A 2BHEA 4KIPA 4C38A 1Q3DA 4EK4A 2VTLA 3WILA 5GIPE 2OZAB 3TT0A 2RL5A 4OTRA 5JRSA 2HW7A 3U4UA 1WBVA 2J51A 3LCOA 2PZPA 4DLIA 2JBOA 4O6LA 3KK9A 4ZTMA 1W0XC 2IZRA 3FMHA 4TZRA 5BMMA 2QI8A 2RSVA 4IANA 4FV7A 2WKMA 3EL7A 4XV1A 5AX3A 4KNBA 4B7TA 1NVRA 4WUNA 3D5VA 3QTIA 3CY2A 4B0GA 3DU8A 4DG0E 2W7XA 2WELA 4MF0A 2FSMX 4NM7A 3MY0A 3NZ0A 3NW7A 4O21A 2YITA 3BLRA 3TTJA 4O0UA 5CASA 4IHPA 3ZDIA 2C0TA 2FA2A 2ITPA 2C3KA 4Y73A 5FBNC 4DFBA 4EZ3A 2PVYA 2HENA 2PVLA 4GYIA 4RJ5A 5G6VA 2QOQA 5JGDA 3FLQA 5JZJA 5C4KA 5GIOE 2OH0E 3HV5A 1NXKA 4LMUA 3R00A 3WOWA 4W9WA 5KCVA 4RPVA 3I5NA 2IWIA 3GFEA 3EB0A 1PXLA 3NPCA 3R04A 3VBWA 1E9HA 4K8AA 4C0TA 3H30A 2B55A 3AMBA 4A9YA 2VTTA 4NTSA 4ZSAA 3QTQA 3W8LA 3F2RA 3MH3A 3VJNA 4XV9A 2XH5A 2OJGA 5IISA 3UQFA 3VUTA 4J8NA 4R7HA 4RLKA 3LXPA 3PYYA 1KV1A 3WARA 1UV5A 4O27B 4F7JA 2RFSA 3PY0A 4JLCA 4QP9A 2OH4A 2W1IA 3F5UA 3FQSA 3CQEA 4AUAA 3DB6A 4MX9A 1NA7A 2JKOA 4V04A 1B38A 4MHAA 5IU2A 1E1VA 3QZGA 1OL7A 3BYUA 4QMTA 4ANBA 3DLZA 2YM3A 4AN9A 4BBEA 4DT8A 5CZHA 3DBCA 5E8WA 3I6UA 5EYMA 2ZV7A 1RJBA 3D2KA 1KE5A 3HVCA 4IDTA 4OT5A 4RVLA 3K2LA 4JAIA 3MY5A 4QTEA 5IG1A 4QEBA 4F4PA 4B4LA 2B9IA 3NDMA 4YJSA 4PV0A 1REJA 2IVSA 2QG5A 3L1SA 4D2WA 4F65A 3NVKI 5K9IA 3UJGA 5DH3A 4M7IA 3QC9A 5JFSA 4W9XA 4FNZA 4FSRA 2BRGA 3SA0A 4IMYA 3MB7A 4EONA 5LVPA 3QKMA 1CDKA 3AOXA 2PMNX 2ZJWA 4Y8DA 1WVXA 2YLEA 2I1MA 4FBXA 4TN6A 2W5AA 3D9VA 4FKPA 4FIGA 3VBXA 5BVDA 2CSNA 2O8YA 2YM7A 4O7SA 3W1FA 2YDKA 5HG8A 3TKHA 4PP7A 3VUKA 2EXMA 3O8TA 4M68A 2G2HA 4IM2A 1XBBA 4LFIA 4QYFA 5DEWA 1VYWA 2UZDA 3R8MA 4NW5A 3V04A 5LOHA 5HIBA 4EYJA 4AW1A 3ZEWA 2B53A 4EORA 3QGWA 3G0FA 1RQQA 3MSSA 4WG4A 5BQ0A 4KD1A 4ITJA 1U5RA 2NO3A 1H1SA 2PVMA 3I5ZA 3CTQA 4LRKA 4L3PA 4USDA 3FBVA 4C4FA 4JQ7A 5KHXA 2CKEA 4LGHA 2B0QA 3VS0A 1ZOHA 4N6YA 3T9IA 4F9WA 4FYNA 2OJ9A 2XCHA 2OGVA 1KE9A 2BCJA 3MA3A 4ASEA 2ITZA 4L3JA 5JGAA 2VN9A 1GZOA 2G15A 1FBNA 2YZLA 3C0IA 4FTRA 3P1AA 3Q04A 2QOLA 4BYIA 5JFVA 4ASZA 4AA5A 3E88A 5K0KA 4TYJA 3FYKX 2RFEA 2VAGA 1YKRA 3I79A 1F0QA 2QOKA 4NFMA 3FZ1A 2VTSA 4EUUA 4LV7A 4E6DA 4HCUA 4M0YA 4WNKA 5HKMA 3RI1A 4CFXA 5M44A 3VUMA 4CV8A 3NIEA 3A7FA 3CEKA 4LOQA 4PQNA 3HAVA 4D1ZA 3AC3A 4WNPA 2UVYA 3VW8A 4BDDA 3WF6A 4AN3A 4JBVA 2WMUA 3GC9A 1BKXA 4EK3A 3NFFB 2B9HA 4F08A 1JKLA 1S9JA 1ZMUA 2E9PA 2Y9QA 3KVWA 4KIQA 4G17A 4JOAA 4L6QA 4QMSA 4S31A 1R78A 2PWLA 2B4SB 2W5BA 3JY0A 2JDVA 2XJ1A 3E8DA 4KAOA 4NJDA 3RZBA 3DK3A 5GHVA 2WTCA 3WZKA 4C4JA 4E7WA 3NYNA 4U40A 5C8NA 3ORLA 2XAMA 3ULIA 3D4QA 4D2SA 2J4ZA 4K0YA 4ACDA 4I24A 5C9CA 1YHSA 2YCFA 4I3ZA 4D5HA 4KS8A 3QYZA 1G8AA 4M69A 2YN8A 3QLFA 4DGGA 4ZSLA 1LP4A 4J1RA 3V5LA 3ML1A 2R3JA 3OWJA 4JNWA 1UKIA 4AQCA 3UIXA 5JH6A 4HVHA 4O7VA 3KRXA 5L8JA 4F64A 3ZSIA 5IQGA 3U4WA 3I4BA 2ITWA 4CD0A 3QAME 4AT3A 4RJ3A 3UPXA 4C35A 1HCKA 1WAKA 2PZ5A 2R3OA 3BGZA 3PXYA 4CRSA 1OL6A 2XK8A 2PSQA 2XMYA 4WKQA 4DCAA 2XANA 4MNFA 4LGDA 2HWOA 3SAYA 4IZYA 4USFA 3GVUA 1SMHA 4JI9A 4IB0A 2JAMA 4RZWA 3A62A 3TZ9A 1K2PA 2PE0A 2W06A 4QMPA 1Y8YA 5CNOA 4ZTHA 2WZJA 3ZXZA 1TQPA 4BKZA 3H3CA 5K0XA 4NIFA 4O81A 1URCA 2GS6A 2IJMA 2OJFE 3LOKA 1PXOA 3E62A 4FKSA 5CVFA 5E8ZA 2VWYA 4WG3A 3I0QA 5HCYA 2ZAZA 4LL0A 2KULA 3HRCA 3PPZA 2WTVA 1RW8A 2YLFA 2UZUE 4YJRA 5DT4A 2ZM4A 3R6XA 4S2ZA 4E4LA 4BZDA 3E7VA 3ID6C 3S3IA 1Q97A 1OGUA 3BLAA 2QU6A 4QMNA 2YAAA 2F49A 3PP0A 3OWLA 3R7OA 2GFSA 3FL4A 2DYLA 4CT1A 4ZS4A 3BV2A 2X8DA 2O63A 4IE9A 2H8HA 1YOMA 2C0OA 2C5YA 2QHMA 3MPTA 5ACKA 4OAVB 5IDNA 2HYYA 4QTCA 4AGWA 5LVNA 1UWHA 3KY2A 5C8MA 3ZTXA 3LMGA 4BDIA 2XBJA 3P86A 4PWNA 2ITOA 2UVZA 5TO8A 3ZRKA 1L3RE 2QU5A 3HV6A 2R9SA 4HNFA 4V0GA 4EH2A 3HAMA 1FMKA 2FB8A 2HXQA 2WTJA 3SXRA 4RX7A 3PVGA 3EN5A 4MBIA 5M53A 5FTQA 4G3DA 5CALA 3W2PA 4TWCA 2J50A 2BRNA 3DV3A 4R8QA 3MWUA 5CLPA 2BDFA 5B2MA 2VTOA 1U46A 4QQTA 4ZJJA 1UU9A 4KIKA 4PY1A 3JS2A 2W1GA 4FR4A 4PL4A 3UBDA 4B9DA 2WTKC 5CXZA 5I9YA 2GTNA 1XH5A 4TYHA 3RCJA 3I7BA 5CAVA 1JLUE 4EOLA 3DK7A 4MXZA 3E93A 3V3VA 2W1CA 4JJRA 1H27A 3MFUA 3LQ5A 1V1KA 3R8PA 3QC4A 5CAUA 1IASA 2C1BA 2WXVA 2RIOA 4PDYA 3E64A 3KRLA 3BYOA 4MF1A 1XO2B 4FVPA 4M67A 5IA1A 4XRLA 4MUQA 1WBPA 4DEHA 4DH5A 4ZY4A 3A4OX 2C5NA 3T3UA 4FTNA 4IWOA 5M55A 3HMOA 3LE6A 4F9CA 2OICA 3QXPA 2HZNA 4FJVA 4Q5EA 1H08A 3WF5A 5C1QB 1XMMA 3JYAA 4CYIA 3HV3A 3LJ2A 3ZFMA 4TT7A 2GHGA 1J7LA 1UU7A 3NNVA 1O6KA 2OI4X 4RMZA 4WNOA 3BGQA 5AUXA 3UYTA 2QKWB 4BTJA 1Q8UA 2HY81 2P4IA 3PXKA 4FTCA 4AP7A 3GT8A 4J52A 1A48A 2OLCA 2JD5A 2VNWA 4Y72A 3N4TA 4YLJA 4E5BA 3O0GA 1LEWA 4P5ZA 4WO5A 4A7CA 3LMIA 3COMA 2R3HA 4C57A 2OU7A 1ERKA 2R3NA 5B2KA 1P4FA 3I1AA 1DI8A 2G9XA 2GQSA 3FEGA 3SD0A 3MB6A 3OC1A 4BHNA 2CKPA 2IF8A 2XALA 3MW1A 3R21A 4W4YA 5J95A 4O7RA 3PVUA 3E8CA 3Q2JA 3SG8A 4BJJA 1ZAOA 3FE3A 2QQ7A 2VTIA 1WVWA 2QO2A 1SVGA 2RF9A 3KXGA 4R1VA 1KE6A 3FPQA 3TKIA 3ZLYA 4ZY5A 3GCQA 3UQGA 4O91A 4L01A 3UO6A 3UTOA 5BYLA 2YDJA 2EWAA 2WIPA 2QOBA 4O1PA 3QQFA 4LQMA 3TZ7A 4F99A 1Y91A 4D1SA 4RFYA 3KREA 3MDYA 5DEYA 5H8BA 4C2VA 4ZJIA 4FZ6A 4MEDA 2X39A 3TNIA 4BI1A 4NSTA 4D2PA 3MV5A 1OM1A 2X8EA 2OFVA 3R9OA 4FTOA 2QURA 1YDRE 3R7YA 3BIZA 4XG2A 2QOHA 3KK8A 4ZTRA 3ZUVA 4ZZNA 3ZFYA 3TNHA 4AXDA 3K3IA 3KXXA 3WE4A 2QONA 5J7BA 3IDBA 3QF9A 3QCXA 1IA8A 5EOBA 4CEGA 4X2NA 4JG8A 4YTFA 4NM0A 2XKDA 5JFXA 3PPKA 3TZMA 4C3PA 1H24A 4G6NA 5HX6A 1BUHA 3R8VA 4RFMA 3QZFA 5HO8A 5HVJA 4WUAA 3D83A 3QRKA 4MXYA 2AC3A 4O2ZA 5DI1A 4AFJA 3QCSA 3F9NA 3VUDA 4CG8A 5M06A 3HMPA 4L44A 1GJOA 4TL0A 4A4OA 4YJVA 5M57A 2BILB 1W2FA 2REIA 2BMCA 4QQ5A 3HMIA 3DKOA 4IXPA 5CEQA 3OW3A 3W0NA 3OROA 4YP8A 3ROYA 2B52A 3WZUA 3OBGA 2GQGA 2ITTA 3TL8A 4YTHA 2J9MA 2W1DA 4BRXA 2BTRA 3CC6A 3R1NA 3F2AA 3ERKA 1M7QA 1PXNA 2YA9A 3BE9A 4QMUA 2J0KA 4U8ZA 3C4XA 3MBLA 3F5PA 3QALE 4YTIA 4K33A 4KB8A 3D5WA 4FICA 2WGJA 1Y8GA 2WU6A 3VJOA 1WFCA 5HNBA 4C58A 4XMOA 3NAXA 2WO6A 4D9TA 4F63A 4ZEGA 5FP6A 3WF9A 4IAYA 4E5AX 4YR8A 3F3UA 3M2WA 5BUJA 2BFYA 3BYSA 3QYWA 5H8EA 2HY0A 3QD4A 4D1XA 4UMPA 4O86A 4BR3A 3R9DA 2R3QA 4HOKA 4BVUA 3BYMA 4G6LA 4KABA 4R7IA 5KBRA 3B8QA 3NGAA 4CXAA 4IZ5A 4JX3A 4K9YA 3NCGA 3QTRA 5GZAA 4CFMA 4V01A 3DZOA 3MTLA 4YMJA 2ITVA 4JAJA 3CGFA 3KGAA 5FDXA 4X3FC 4FSUA 4TPTA 4F78A 4Q5HA 4HGLA 3QQJA 3VQUA 4H05A 1GY3A 2PL0A 3ITZA 2XIXA 3RALA 5HORA 5HG5A 4XP2A 3PJCA 4O0XA 3VUHA 5J9YA 1OMWA 3TM0A 3CCNA 4XNEA 5IUIA 3C1XA 3OTVA 2IW8A 2J0JA 5E1SA 2WPAA 5J8IA 3TV7A 3LQ3A 2CJMA 2DS1A 3LMHA 3AGMA 4GU9A 4LRMA 2YFXA 3VS2A 2BRBA 2XIZA 2YDIA 3F66A 5DR2A 3DGKA 1OBGA 4H3QA 4NH1A 3AMYA 3A7GA 3QZIA 3CY3A 4AOTA 3RCDA 3RAKA 2PUPA 3QZHA 3V6SA 4DFNA 1J7IA 4DE4A 3P23A 4I21A 2R4BA 2Z7RA 5A46A 3ATSA 5I0BA 5A54A 4FOBA 2I40A 3S1HA 2F7ZE 2WMVA 3K54A 3ORKA 4YC8A 4DHIB 3C7QA 5J5SA 5KKRB 2PE1A 4UZHA 4CTBA 4EOKA 4J96A 3COHA 3GUBA 1H26A 2JKMA 3VRZA 3O51A 1M52A 3BI6A 3FMDA 4X6QC 1YWRA 2WFYA 3ELJA 2ETKA 2JDSA 2QCSA 2LGCA 1OECA 4LG4A 1WMKA 3P0MA 4Y85A 3HP2A 5AUYA 1VYZA 2JC6A 3I0OA 3VO3A 4PMMA 3HX4A 4FSTA 2ESMA 3FUPA 4O82A 1W2CA 4WHZA 3MIAA 4XLIA 4BB4A 1DAYA 4FG8A 3TJDA 3FLSA 3G33A 3ZC6A 3DLSA 4BDKA 2CLXA 4FK6A 4NFNA 3KKVA 4O7NA 4AT4A 2VWXA 2ZV2A 4HNIA 4GYGA 5CT7A 3VS3A 3KA0A 2CMWA 3GCUA 2J0MB 4BI2A 3LFEA 2XAOA 3NMUF 2VWIA 4PTEA 3BE2A 3CE3A 2A2AA 3NYVA 4OTDA 4EH9A 5HVKA 3R83A 4IACA 5G1XA 2O5KA 5E9EA 5DT3A 4KINA 5HTIA 4OTQA 5BVEA 3RAIA 5CSVA 5FP5A 5M4CA 1YQJA 5BVKA 3W10A 2YJSA 3SOCA 2V7OA 3BPRA 4Q9SA 3VBYA 2OXXA 2C3IB 2W4KA 4J99A 3OEFX 4BCFA 3NVMB 2XM8A 3KMUA 5AR8A 1SVEA 4FIJA 4ZAUA 3EFWA 2YWVA 2ONLC 4HPTE 5BX0A 2R0IA 3CQUA 4I20A 4CFNA 4PNKA 5LVMA 3BEAA 3DA6A 1TFFA 2ZOQA 1BMKA 1VZOA 4I22A 2VWZA 5AP3A 3TDVA 5E8UA 1V0PA 3UP2A 5ANJA 3ZO2A 4TWNA 4RWJA 3VULA 4C36A 5IH5A 2H9VA 4WNMA 3ZUUA 5CF8A 1ZOGA 4ANMA 4QT1A 4RWIA 3G6HA 4XV2A 5EI6A 4DFYA 1CTPE 3EH9A 1FVRA 5AIKA 4F0IA 4GK3A 4RIYB 4E4NA 2XNGA 4E4MA 2F2CB 5J87A 3HGKA 4X3JA 4I0RA 3QRIA 2X2LA 3DQXA 3IECA 2OBJA 3WF7A 1S9IA 3ORXA 4FG7A 4QP3A 4JIKA 3TNWA 3UNZA 3TUCA 3NNUA 3DXQA 2VO0A 4DFLA 2R7BA 3L9LA 3OF0A 5HE3A 4CCUA 4IFCA 4CTCA 2NP8A 5CVGA 5JQ5A 1QPEA 5K4JA 3NNWA 4FTTA 4QMWA 4X0MA 5AEPA 3Q32A 4G9RA 4O7YA 3DBQA 4GUEA 2CKQA 2BROA 2CN5A 4RJ7A 4EH4A 1WBWA 4GU6A 4AA0A 2JEDA 4FSMA 3OOMA 4YHJA 3CJGA 3E8EA 3DOGA 2R3FA 3CIKA 3L9NA 1J3HA 3WYYA 1PYXA 3R2YA 2UZNA 4EHGA 1W82A 3DY7A 5IUGA 2O0UA 4DFUA 3DAKA 4HZSA 4UXQA 4RC3A 4DFXE 5IQIA 4UV0A 1DM2A 1WBTA 2XA4A 2EXCX 2OK1A 3T8OA 3V5QA 3ZSHA 4O0RA 5EI2A 3TKUA 1OKYA 5EKOA 1YHWA 3ZXTA 4AAYA 3NR9A 3HV7A 3W32A 4U3YA 3EKKA 1AQ1A 5CEPA 4ORKA 4EEVA 3C4FA 5CS6A 4U80A 3RK5A 2W1EA 4AXCA 3FSFA 5DWRA 2PK9A 1Q61A 4YLKA 2CCHA 3RM6A 1XH9A 3DTCA 4QQJA 2LAVA 3L9PA 3BHVA 3HUBA 3OXIA 5I9WA 1U4DA 3MN3A 1DAWA 2XK9A 3KCFA 4AZEA 3ENMA 2R3RA 4MXOA 4OTWA 3VBTA 4ENYA 4FIFA 3P79A 5E91A 2PVRA 2GNGA 4CMUA 2OF4A 3ALOA 2UZBA 3MVJA 3LFSA 4O0SA 4BI0A 4YPDA 3ACKA 5EHOA 2J5EA 5DFPA 3U87A 1YI6A 4MWIA 4U81A 1YXUA 5EH0A 5E8TA 1QMZA 2WQBA 3S2PA 1SNXA 3NSZA 4M13A 1NT2A 3PA3A 4DHZA 3G15A 3SG9A 5EW8A 1YI4A 4V05A 3BBTB 1TQIA 2GFCA 3ZH8A 5HEZA 4LGGA 4UMTA 2P55A 2HWPA 4FV4A 3COKA 4DEBA 4YJPA 5A6NA