5IA3A

Crystal structure of ephrin a2 (epha2) receptor protein kinase with pd173955
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
295
structure length
275
Chain Sequence
LKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 275
sequence length 295
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ia3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ia3A01
4FTAA 2P2HA 5FGKA 3VUMA 4TNBA 5L8LA 2ZB0A 5F95A 3A2CA 3NUYA 2WIPA 3FI3A 3Q4CA 4I24A 2JDTA 2VTSA 3I7BA 2XNMA 2C3JA 3BHHA 2XKFA 4WO5A 5ANDA 4AT5A 3PVUA 4X3FC 5C8KA 1ZYJA 5I9UA 5K4JA 2QI8A 2YCRA 4I94A 4JT3A 4L52A 4EZ3A 3FZ1A 1RDQE 3TTJA 1PMUA 4A9UA 3F69A 1GIJA 4QQ5A 1KE5A 4XG3A 2C30A 2QURA 3SVVA 4WSQA 4DCEA 2GNLA 1IG1A 3PP0A 4L43A 4R5YA 2WMXA 3JXWA 5CSXA 3OOMA 3VO3A 4E93A 1E1VA 2BFYA 4U3ZA 3TI1A 4AN3A 4B8MA 1SVHA 3F6XA 1GOLA 4KS7A 4F9CA 2PY3A 3MPMA 4JLCA 4AOTA 5J8IA 3CY2A 5JEBA 3ZM9A 2Y7JA 4XP3A 2QO2A 2X81A 3LCTA 2PUPA 4S31A 2ETKA 5HTCA 2GNIA 3MVHA 4IX4A 2VGPA 3EQHA 4KIKA 1CDKA 2OJ9A 2JIIA 2FB8A 3JY9A 4L3LA 4QP3A 5AJQA 4C4JA 2QD9A 1Q41A 4C3PA 3NAYA 1MQBA 4USFA 1RJBA 4KS8A 4BTJA 3W2PA 3CLYA 4J95A 4AT3A 1PXKA 4NCTA 3WI6A 2XIRA 4F9AA 4YJUA 3MPTA 3CEKA 4GT5A 5EQYA 5CAPA 2HY0A 1JKLA 4EOKA 4WT6A 4XV3A 4PDPA 4W4XA 5AP3A 3K2LA 4J96A 2IZRA 5CALA 2ITNA 2R3GA 2X7OA 3VVHA 4CKRA 5K5NA 3WOWA 5M08A 2H6DA 4M67A 3LVPA 3UE4A 4CT2A 1O9UA 3O2MA 4Q9ZA 4CG8A 1J91A 2BRGA 5DEWA 3ITZA 4NFNA 5AUYA 3UVQA 4E4XA 1OMWA 4I5PA 4OTPA 4IH8A 4OW8A 5FBNC 3S3IA 4FEUA 2W1ZA 2WFYA 4XG2A 4FZAB 5B0XA 1G8SA 1R1WA 2WTWA 4CZTA 1YDSE 3DBQA 4WNMA 3HECA 4U80A 5A4LA 2OXXA 2J0MB 3JUHA 3FZRA 3QZFA 4HZRA 3VBXA 3AMYA 3I79A 2IWIA 2BR1A 3VUHA 2YM8A 4NKSA 4DH8A 4DG3E 1KOAA 3FMEA 5E8UA 5IQFA 4GSBA 2JGZA 5FM3A 4D2RA 2Y4PA 4ANQA 3NNXA 3KRWA 4EWQA 5J7HA 3SG8A 4LUEA 4RIYB 4AXAA 2C69A 2FVDA 3PY1A 4FG8A 5DT4A 3GCVA 1GNGA 2XZSA 3ZLXA 3RALA 4ZLZA 2H9VA 2V0DA 3FMLA 1OB3A 4F08A 5CEKA 2YABA 3QD0A 4DEBA 3SW4A 4M3QA 3W8QA 4MF1A 3P7BA 3QTRA 2OH0E 3OCBA 3UOHA 3C4EA 3HUCA 5IUIA 4X3FA 3SXRA 3QTUA 4ZMEA 3PPJA 2QR8A 2DWBA 3FBVA 1NVQA 2F7ZE 3Q2JA 4QTCA 2G2IA 2A0CX 3RPYA 4BTKA 4DEEA 1XHAA 4BDCA 3FYKX 5EHLA 4JI9A 3KU2A 4IQ6A 4CLIA 4II5A 3NGAA 4QO9A 3OCTA 2NNWB 3OWJA 2WHBA 4UXLA 3BHTA 1Q4LA 3QRIA 3I81A 4YGAA 3CBLA 1IASA 2OJGA 4RQVA 4UWYA 4EC9A 4O84A 2RKUA 4GYGA 4O7RA 4O81A 2F2CB 2LGCA 3F3TA 4FTKA 4I1ZA 3W2SA 2GQRA 2PL0A 4EH7A 3Q9XA 2JD5A 4FV6A 5IA5A 4ZIMA 2XKDA 3ZOSA 3QZIA 4YZMA 2ZV9A 4GFOA 2ZDUA 3TTIA 3AGLA 5E8SA 3RI1A 2GHMA 5CF6A 4WSYA 4XMOA 4N4SA 2BUJA 4GKIA 1LP4A 3GU4A 4LGGA 5AR5A 2QLUA 2GNGA 3SG9A 4PTGA 3DKFA 3IW6A 3MY5A 1W8CA 1PKDA 2VO6A 3Q5IA 3UO6A 4LGHA 4X0MA 4AX8A 4HPTE 3GU5A 4GH2A 4IVAA 4EBVA 4UN0C 4M66A 2FSOX 3IDCA 5M4FA 3ATSA 4MQ2A 4UX9A 5IQEA 2HCKA 3LMGA 4CSVA 5DR2A 5KHWA 5LMAA 1PMNA 4C7TA 5KMKA 4I20A 2QHNA 5F4NA 1XH6A 4GUBA 4BCGA 3V6RA 2OG8A 2IW9A 3V5LA 5HU3A 5KHXA 4QMMA 1DS5A 2BDJA 2WMUA 1VYWA 4FTLA 5FTQA 4WBBB 3ZXTA 1Q3DA 2UW9A 2O5KA 3D15A 2RF9A 4ONAA 4BL1A 3GCUA 3OW4A 4AZFA 4LOPA 3ORLA 3TJDA 2VNWA 2WMVA 3A62A 4M15A 5E1SA 3RTPA 5HQ0A 4FSZA 4FZ6A 3ORXA 2HWPA 2C47A 3COIA 4V05A 5CVHA 3ZO4A 4E6DA 3VS7A 1F0QA 1M14A 3I7CA 3TIZA 3UMXA 4QP1A 4HOKA 5IH5A 2YEXA 1Z5MA 2YA9A 3UO4A 2B7AA 5FXQA 3GCSA 4DC2A 4ENYA 3L9MA 3LFDA 1JVPP 4FSMA 3VW8A 2PULA 2PZIA 2JEDA 4DGNA 4FV9A 5IA1A 2PMLX 3R00A 4CFMA 1HCKA 2Y6OA 1PJKA 1XKKA 5CZIA 2UW3A 4JBOA 4IIRA 5DWRA 3KXNA 4CG9A 3DQXA 3JS2A 4IDTA 4TL0A 2PE1A 3LCOA 3P78A 4M14A 3R71A 4AS0A 4BRXA 2ONLA 5B2LA 4OTFA 4RMZA 4UBAA 4F64A 4U41A 4QQTA 3OROA 2R3LA 3GENA 3ZONA 3KRXA 1MRYA 3BELA 4FIGA 4IVCA 2QO7A 5AP5A 3WZKA 5AP1A 3FZSA 3P79A 4NW5A 2J0LA 3KULA 4N6ZA 1CM8A 1LR4A 4LFIA 4HYUA 4RJ4A 5DBXA 1U46A 4WHZA 2JKOA 3FQHA 2PVFA 5EW3A 4G9RA 4EZ7A 5KMNA 4OAVB 5ANGA 3BU6A 4FIFA 3OF0A 2R7BA 4AT4A 4O7SA 1CMKE 4KA3A 4IX5A 2V55A 5FG8A 3DTCA 3COKA 1K9AA 5EK7A 3UMWA 5LVNA 3ORZA 3QTSA 4BWPA 4APCA 3U6IA 1GY3A 5HKMA 3VULA 3R7EA 3C13A 3JVSA 4A4OA 4F6WA 4HCTA 4E3CA 2W9ZB 4E4MA 1Y6BA 2J90A 3GC0A 1P4FA 3O0GA 4O1PA 5IPJA 1A06A 2ZV7A 3NUUA 5E8ZA 4UMPA 5LVMA 2W1HA 4FG9A 1Y91A 5CU3A 2I1MA 4CKIA 2ZJWA 5C8NA 2IVSA 3Q6UA 2CGUA 3BIZA 2PE2A 1MRVA 3DXQA 4IWOA 3HV7A 3HV6A 3RJCA 3PXQA 4D4SA 4WKQA 4Y73A 3D4QA 5BVWA 4F09A 4FE2A 4LRJA 5KNJA 3BHUA 2C6KA 2XCHA 5B2MA 3DAEA 4DT8A 4QMVA 2XM9A 2PSQA 4FKGA 3LW0A 2W7XA 4YR8A 4GT3A 4TWPA 3WF5A 4G31A 5ITAA 4HGLA 4RC2A 4BZDA 3OY3A 3RAWA 3DAJA 4IBMA 2QO9A 4RVMA 3UBDA 2IG7A 4J7BA 3NMUF 5L2QA 4QMTA 2GHLA 4PL5A 5BMMA 3F82A 4U0IA 5AP6A 5AV2A 3UTOA 2YLFA 2P3GX 4OBPA 4OT5A 1XH4A 3AC2A 3EN7A 4KKHA 3W32A 1B39A 1PF8A 4BF2A 4EKLA 4ZY4A 3K3IA 4U5JA 4CLJA 4P5ZA 5JFVA 3QD3A 5J7BA 1AQ1A 3MFSA 5IUGA 4C0TA 3BKBA 4H39A 5HCZA 2VTQA 4FIEA 3ANRA 5M4UA 3ZFYA 3EQCA 3O51A 2WQOA 4L9IA 2R9SA 3G51A 5CYIA 2JC6A 4U6RA 3TNPC 4NH1A 4LOQA 4DA5A 2UUEA 3PG1A 5B7VA 4HVGA 5JKGA 4IFCA 4O82A 4G34A 5CZHA 4DTKA 3TV7A 3II5A 4FVRA 2GS2A 2PZRA 5FLFA 4QMQA 3RPRA 2W5BA 3C5UA 4C36A 5J95A 4R5SA 2C6MA 3R9DA 5DRDA 3VIDA 4G3FA 1YKRA 4MAOA 1ZYDA 4B8LA 2PVMA 3FMKA 3QRUA 1HOWA 5CY3A 4AFEA 3K5VA 4RIWA 1H1SA 4CQEA 1FMOE 4PPBA 5H8BA 4LM5A 2I0VA 1H0WA 1SMHA 4BGHA 1M2RA 4F7NA 2YIYA 2Z8CA 3UP2A 5CU6A 4J98A 2YM6A 3GOKA 1FGIA 2R64A 2QVSE 4L7SA 5HE3A 4BHZA 4S34A 4MK0A 4XV9A 3KK9A 5KMLA 1OVEA 2A27A 5HE2A 1Q97A 4EK5A 4U44A 2IW8A 3WZDA 3A7HA 2QR7A 1YVJA 1V1KA 1ZZLA 2F49A 4WIHA 2BKZA 4GG5A 5F94A 3V6SA 3TG1A 5ETAA 4EWHA 5HEZA 2UZVA 2Z2WA 4JQ7A 4W8DA 3ZUVA 2VWYA 3R1YA 4DTBA 2HELA 2XK6A 4XH6A 1SYKA 2J4ZA 5C4KA 2C4GA 1H1WA 1Y6AA 3R7IA 1YI3A 4BWXA 4PX6A 4IM0A 3GQIA 4I92A 1OKYA 2UZBA 2QU6A 3OUNB 3IGGA 4AFJA 4BICA 3T9TA 2GQSA 3QKLA 3D2KA 2HXQA 1J7LA 2J51A 4JOAA 3ZO2A 3LCDA 4X6RA 4HVSA 3OWKA 4PDOA 2WTIA 4EH4A 1PRYA 5BUJA 2BCJA 3RAKA 4WOVA 3W16A 3FHRA 4ZTHA 5BVEA 4FK6A 3NUXA 4MF0A 3RNIA 5K9IA 3DLSA 4C4EA 3W1FA 3Q32A 3POOA 2ITZA 4S33A 3IG7A 3RGFA 2UW5A 4O0SA 3OTVA 4GMYA 1XQZA 3OCSA 5JRSA 3SRVA 5LJJA 4EKKA 4A4LA 3FXXA 2JIVA 3V5TA 3EQDA 4MD9E 2YJSA 4F65A 3VJNA 3L8PA 2PVRA 5JGAA 4FR4A 2GSFA 1Y8GA 3KXZA 5TKDA 1H08A 3QGWA 5FQDC 2PMOX 2UW8A 3UODA 4L01A 4L3JA 4NUSA 3PLAE 4X7QA 5K5XA 4RIXB 2W96B 3DA6A 2BRBA 3HDNA 4G5PA 5BYZA 4JL9A 4B0GA 1G8AA 2FUMA 4O1OA 4XCUA 4AZSA 3SV0A 4CYIA 4CYJA 4ZP5A 3RAHA 4XX9A 4BYIA 4M0YA 5DRBA 4G5JA 1OGUA 5EOBA 5GZ8A 4MTAA 4PP9A 1NXKA 3E88A 3P23A 2C6IA 3DS6A 3GU8A 4LV5A 1ZMVA 1LEZA 3EB0A 4GU9A 3VUDA 3DPKA 2XEZA 3NUSA 4IX3A 3HVCA 3ZUUA 4U97A 4KBKA 3AMAA 3NCGA 2QG5A 4QP4A 3CP9A 4RLKA 2VO3A 4K11A 4C2WA 2GS7A 1WBSA 2OW3A 3NDMA 1ZMUA 3ENHA 3I5NA 4R1VA 3TKUA 3G6GA 4IXPA 3OZ6A 5AV3A 4A06A 2R3KA 3BE9A 2KULA 4XS2A 3C4CA 4I22A 4O0TA 3BYVA 3Q2MA 4I6FA 4A9YA 2YIQA 4DT9A 3QX2A 3AG9A 3ZS5A 2W5AA 4BCFA 3S95A 3I0OA 4GK3A 4TZRA 1UWHA 2OBJA 1YOJA 4QMWA 2VD5A 4U43A 3M11A 4YLJA 2YERA 2CKOA 1QPCA 3OW3A 4O86A 4TWOA 3MH2A 2OGVA 2XJ1A 3F5PA 3LPBA 5LWMA 3QA8A 4YLKA 4ACGA 4YSMA 2ITPA 1V0BA 3ALOA 3QRKA 4ZS0A 3PYYA 4C3RA 4UMRA 2ITTA 3WYXA 2WMAA 4GS6A 2W1CA 4F9YA 2Z7SA 5IQBA 4RWKA 2BIKB 3EIDA 2X4ZA 3FQSA 2VX0A 3F5UA 4IWPA 4YURA 4NT4A 3H9OA 2X39A 4L46A 5J87A 4CMTA 2XJ2A 5KKRC 4UMTA 3FEGA 1WBTA 4FF8A 4KKEA 3ZEPA 3DLZA 4N0SA 4NM7A 5IA0A 4B9DA 3FMNA 4K9YA 5GJGA 5JSMA 3NUAA 4LI5A 4Z7GA 1IAHA 2XNNA 3VS6A 4FKTA 2R0UA 5EI8A 1OBDA 5LCKA 1PYEA 5DI1A 2CJMA 5M57A 1IAJA 4NZWB 5A3XA 2F7EE 2R4BA 1S9IA 3GCQA 1ZARA 3A8XA 3HMNA 2KTYA 5AP4A 5CANA 1IA9A 4JAIA 2CPKE 4CXAA 4NM5A 3COMA 3SOAA 3DK7A 4WRSA 5HOAA 5EYCA 4BIBA 5EH0A 3NYXA 3QXOA 4ERKA 5K0XA 4F0GA 1M2QA 3RPSA 4Y46A 3UP7A 3D2IA 1R78A 3UYTA 2I0YA 3L8XA 2VTRA 3F3ZA 4ITIA 5IG1A 3QKMA 3ZM4A 4MWHA 4F7SA 4C57A 3CSVA 2CNVA 3KGAA 1WBVA 3QQGA 4ANOA 3GC9A 1PXOA 2YDIA 3K5UA 5IA3A 4I3ZA 5FTGA 4KNBA 3ET7A 4ZTSA 3ZRKA 4A07A 1ZOGA 4IWDA 2FYSA 3DZQA 4XP0A 5M53A 2UVZA 5FUTA 3BYUA 4AWIA 2W17A 1WZYA 3CY3A 5GZAA 3OUKA 2XYNA 5ANJA 3UC3A 4KIKB 4WD5A 1H01A 2OSCA 4QMNA 2PYWA 1DI9A 4YTCA 3QC9A 3DB6A 4ANLA 3DBFA 4AZVA 2C5OA 3C4FA 4FC0A 3A60A 3BPRA 3CXWA 3DTWA 3GFWA 1H1RA 3HMMA 2VU3A 2ITWA 5AP7A 4YNEA 2V22A 5B2KA 1WBOA 2B55A 3LOKA 3RZFA 3MGYA 4D9UA 3NS9A 5HLWA 2UZEA 4FT7A 4Z16A 4YC3A 2V62A 3FUPA 5CSVA 4IB5A 3FSFA 3AD6A 3MVLA 4JG6A 4XG9A 4BDHA 1UVRA 4GG7A 4IAAA 1A48A 2X4FA 3CCNA 1J1BA 5DE2A 3ALNA 3GP0A 3R04A 5HG9A 2C0TA 4L45A 3OXZA 3EL8A 2H8HA 3EQRA 2G1TA 3SKCA 3TNHA 2GFSA 2X8IA 1BI7A 3MDYA 2VWZA 2F9GA 3ETAA 1H0VA 2EWAA 2ITYA 3MSSA 4WUNA 4D9TA 2QKWB 3RZBA 3HLLA 4AACA 5DPVA 5DLSA 1U4DA 2VV9A 3IDPA 4U7ZA 4WBOA 5AA9A 2UW0A 2GS6A 3Q9ZA 4DLJA 4UV0A 4JQEA 4YJSA 3R28A 3EN4A 5JN2A 4F7JA 4UYNA 1E9HA 2E9NA 2A1AB 2W4JA 2YDKA 4FSNA 5AR7A 4ALVA 4TN6A 3MJ2A 5CNNA 4JDKA 5DVRA 4EK3A 3Q9YA 4QYEA 1JOWB 1OIUA 3KFAA 1SVEA 5EHOA 5G1XA 2R3RA 3FY2A 3UGCA 2I40A 2QHMA 4FOCA 4WG3A 4CMUA 4BCIA 3E8NA 4L6QA 3TNWA 5IDPA 3FKLA 3OHTA 3TKIA 4ACMA 3HAVA 3IONA 2OXYA 5HX8A 4M97A 1OM1A 4KWPA 5E92A 4FKOA 4K1BA 3ZHPC 4DFYA 3KY2A 2VWXA 2R3OA 4G1WA 4BKJA 3LKMA 3DK6A 2PVJA 1WBPA 4IM3A 4X3FB 3CC6A 4XG4A 1REKA 4YZBA 3U9NA 4F70A 3MS9A 4PY1A 5IEXA 3TUCA 1I44A 2BFXA 5JFWA 5L6OA 3LE6A 2X1NA 3MH1A 4IAYA 2B4SB 3KXXA 3CJGA 2UW4A 3OVVA 3NUNA 4RT7A 2HZIA 2BHHA 5CEQA 3Q04A 4YTHA 2WQNA 4D1XA 4J99A 4JBVA 3VBYA 2YISA 4YC8A 2ZM1A 3RK7A 3HV3A 1TQPA 3ODZX 3VQHA 2XA4A 3PA4A 2X7GA 1Q8UA 3FMDA 4FA2A 4MNEA 3RCJA 4FVPA 2WTDA 3R1SA 1YRPA 5BVKA 2BHEA 5IISA 3QD4A 4WRGA 1PXMA 4B99A 4NM3A 1OUKA 4AAAA 3GQLA 2CKPA 3TIYA 3ORTA 4XV2A 4D1ZA 3MWUA 3W33A 4W4WA 3G0EA 4O2ZA 3VBVA 4AU8A 5HO8A 3QCSA 4H58A 3ELJA 2C0OA 4QP9A 5KZIA 3A99A 1K3AA 1XWSA 3OOGA 4XG8A 1QPDA 5HNIX 4USDA 5GHVA 1Y8YA 1OL1A 3F3VA 4FNZA 2JDVA 4IAIA 4RFYA 2PVHA 4EH6A 4GKHA 3ZRMA 4BDKA 4FEWA 3UQCA 5F20A 1SVGA 2XJ0A 3W55A 3C4WA 4TT7A 5BYYA 5HI2A 5DR9A 4BCKA 3TEIA 4N57A 2ITQA 4BFMA 4JDHA 3UQGA 3C4ZA 5HVJA 3NW5A 3MPAA 4DH3A 1CKJA 1V0PA 2JBOA 2NP8A 4QQJA 3EFJA 4IZ7A 4QRCA 3WARA 4BY9E 5TF9A 2E9OA 4XV1A 3RNYA 1XH7A 4XBRA 5CNOA 5JFSA 4CQGA 4ALWA 4PL4A 4AZTA 1NVRA 1OUYA 3PRFA 4GJ2A 3QF9A 3NR9A 4QD6A 5IA4A 4FTCA 4BDIA 5EM8A 5IF1A 2FGIA 1DAWA 2HAKA 2NRYA 3IPHA 3QGYA 2RSVA 4IMYA 5K0KA 4E20A 4RWLA 4F99A 5LVOA 3QQFA 5CT7A 4ZJJA 4U8ZA 3SAYA 3S2PA 3P4KA 1JSTA 4OAUC 2XCKA 3UIBA 1P2AA 3E87A 4OTGA 4BTMA 3U6HA 3PJ2A 4K18A 1PXLA 1ZAOA 2I0EA 5DHJA 4FZFB 3NRMA 4DG0E 2EU9A 1Q8TA 3CR0A 2P2IA 4QTEA 2WPAA 5ANKA 1LEWA 5CSPA 3DDQA 4EH5A 3ZYAA 3NWWA 3QQKA 1OL5A 4AGWA 2F4JA 4MXCA 2ERZE 3FLQA 4YJTA 2QG7A 3M1SA 2ZB1A 5HBHA 4QMSA 2PPQA 3VUTA 4CD0A 3KULB 1J1CA 3KXHA 5JGDA 1OPKA 3CTJA 4YJOA 4IC7A 2ONLC 3MY0A 3G9LX 4CV8A 1OPLA 3OG7A 4TWNA 2UZNA 3MIAA 5C4LA 4MXAA 4JJRA 4I5CA 2G9XA 2VTHA 2WTVA 3V5JA 3HL7A 4QYYA 5CX9A 2WQBA 4ERWA 1JSVA 2BAQA 4IADA 2FSLX 3RPVA 1OIQA 2O0UA 3AGMA 1M7QA 4DE4A 5EYMA 1YXUA 5K4IA 3UO5A 4RQKA 2HZ4A 3FE3A 5KX8A 5JMSA 4S2ZA 4EH9A 2QOKA 3LJ0A 2XNBA 1PY5A 1BUHA 1PXNA 3MBLA 2UW6A 4DBNA 3GCPA 2OIDA 1SM2A 5JT2A 1BLXA 4XG7A 5EM6A 3QLGA 1H4LA 4IB0A 4O6EA 2CN5A 5HNBA 2XK7A 3SC1A 1FVVA 4BVUA 2EUFB 3MA3A 5J9YA 1FGKA 2R3JA 3DJ7A 1WBNA 2ITXA 3QRJA 1WVYA 3HP2A 2X8EA 4M69A 5CQUA 4RSSA 3R2BA 4ASDA 3EKKA 5HICA 4ZXTA 4G3CA 2OZOA 4GFMA 4XRJA 4G6LA 4RBLA 2PTKA 2NPQA 3IW8A 2GPHA 2XM8A 4IJPA 4ENXA 5JQ8A 3A7FA 3QHRA 4PDSA 4O27B 4R3RA 4DGGA 4K77A 5L8KA 3PRIA 4IAFA 4WNPA 5JZNA 2ZYBA 4ZTLA 4MBIA 3OEZA 1YI6A 1WCCA 4UWCA 1ZOHA 3VBWA 4BBEA 2RG6A 3DNEA 4FV3A 4RG0A 4EOSA 1QPEA 2XVDA 2E9PA 3GNIB 5CAVA 2PU8A 3DQWA 4O7NA 5KMIA 2HK5A 5DGZA 5IEVA 5AA8A 3F61A 1YXSA 4HNIA 2X7FA 4BYJA 4DITA 5HX6A 3BEGA 4RC3A 4F1MA 2Y6MA 5HO7A 1OI9A 5AAGA 4L53A 2XKEA 4FSYA 2X2KA 3PFQA 2IJMA 4LL0A 5AIKA 4LV8A 5JGBA 5JZJA 3VN9A 3QLFA 4KUJA 1JKTA 2XH5A 4D55A 5EHYA 3IDBA 4ID7A 4C35A 2AUHA 4YO4A 3VS0A 4O22A 5AUZA 3ZSHA 3EOCA 3F3WA 3FZPA 3VS5A 3UOJA 4FSTA 2GU8A 3QHWA 3DK3A 4WA9A 3R8PA 2WMTA 4RVLA 2JAVA 2GTNA 2GQGA 4W4YA 4QOXA 3CQEA 3CS9A 5FBOA 2Z60A 2BZJA 3T8OA 3UNJA 3G0FA 2XMYA 1M2PA 3DJ5A 1YXXA 2IVTA 3RCDA 4AF3A 4BC6A 5FWKK 4YU2A 4FKVA 1NVSA 3VRYA 4IB1A 5E8TA 1YHVA 2CNUA 2Z7QA 1XO2B 1UNLA 2B9HA 1DAYA 1KE9A 4QNAA 3WE4A 4QQCA 4FTQA 3RHXA 3WBLA 4BB4A 2ESMA 5EW8A 2VNYA 4FGBA 5HG5A 1VZOA 2BDWA 3RHKA 5AV4A 1ND4A 2WELA 3NSZA 4RIWB 4LMUA 5HIBA 2WMSA 2W05A 3QTXA 3ROCA 2IZUA 2RFEA 3IW5A 5ANEA 5C8MA 3UIMA 1RW8A 1JSUA 1XH8A 5ACKA 3OBJA 1H25A 5IQHA 4MXOA 3C0GA 4JBQA 3BHYA 4FNXA 2R2PA 2XK9A 4E4NA 4RPVA 4OTHA 2WO6A 3ZRLA 3WIKA 5H2UA 2X2MA 3GU6A 5AUWA 3UYSA 4EQMA 5DIAA 3UDBA 4FL3A 4PL3A 4G3EA 3DBCA 4FKIA 4AGDA 3QZHA 4QTBA 1JBPE 4UB7A 5AM6A 1XBCA 2CDZA 2ETRA 2PUUA 4EK8A 4FEVA 2J2IB 3QRTA 2WIHA 3MIYA 4YJNA 3ORIA 2YWVA 1ZWSA 4WUAA 1GJOA 4K2RA 3CKWA 5F1ZA 3ZEWA 2ITVA 5HORA 3MB6A 3BE2A 5CEOA 2X9FA 1OKVA 4TY1A 1FVTA 2PMIA 1KOBA 3MY1A 4FV2A 4FKQA 1YI4A 5CXHA 4E6QA 4O7WA 3IW7A 3KCFA 3N9XA 2C5NA 3FL4A 4FKPA 4C4IA 4GCJA 5CASA 3H0YA 1L8TA 3ZH8A 2R5TA 5I0BA 3ID6C 2E9VA 3MVMA 1YOMA 3ORKA 4C4HA 5A4TA 3BLQA 4AOJA 3WF7A 3HA8A 4J1RA 3JYAA 4X3JA 2BKKA 1UKIA 3UPZA 1MP8A 2VUWA 4AW0A 1OECA 3VQUA 2WB8A 5DYJA 4AOIA 2O64A 2J0KA 2YAAA 3EHAA 4YJPA 3LQ8A 2WQEA 4B6LA 3W10A 3CGOA 5AMNA 5L4QA 3FLSA 4IACA 2IPXA 5FD2A 3U8WA 2C6EA 2VX1A 3SRVB 3U51A 4FT9A 3GB2A 4EH3A 2O2UA 4K6ZA 5CF5A 2PWLA 4FKLA 2WU6A 3PIXA 4YLLA 5TR6A 4CKJA 3LFCA 3JVRA 4D58A 2UZTA 3R7GA 5I3RA 3W2OA 3WZUA 4CCUA 1H27A 3MYGA 1ZOEA 2BALA 4DGOA 5KMJA 4S30A 5HZNA 3UZTA 1CKIA 1ZYCA 3QQJA 4FKSA 4E73A 1OBGA 3VS4A 4FT5A 4J8MA 2YCFA 1VEBA 3OS3A 3GI3A 5E8VA 3G2FA 5HGIA 3NCZA 4FKJA 3DU8A 3FC2A 4CRLA 3PZEA 3MB7A 3QAME 3L9LA 3R63A 3DOGA 4D4YA 3VAPA 4PNIA 3LLTA 3FZOA 3DNDA 3GT8A 5HIDA 2UW7A 3CJFA 2IW6A 3KMUA 4Y72A 5H8GA 3QFVA 4I0RA 3MESA 5LCJA 5T6KA 5DT3A 1H07A 3RK9A 4YHJA 4F1OA 3B8QA 3O23A 3O7LB 5M44A 2BZHB 3LFSA 1UU8A 2RFSA 3HEGA 5IH4A 1GZOA 4EEVA 4NM0A 4D5HA 4MVFA 4FGRA 3IW4A 2WEIA 3DCVA 5L6WL 4ZY5A 2ZV2A 3BI6A 2OZAA 2WTCA 4FYOA 4MH7A 3Q96A 2XF0A 4O0VA 4RZVA 4C61A 1NW1A 4M68A 1Z57A 3D5VA 3ZO3A 2PZ5A 3WZJA 3R9HA 3F9NA 4IC8A 2Y0AA 4W9XA 1E1XA 1VJYA 4KBCA 1PMVA 1YW2A 3AMBA 3G15A 1H24A 5CENA 4PMTA 3TZ9A 3VNTA 4R7IA 5J1VA 4AN2A 1ATPE 1JWHA 3EN6A 4LRKA 3W2QA 3KN5A 4RA4A 5E91A 3BU5A 3PDTA 1W84A 3R8MA 5FM2A 2X8DA 4EONA 4KRCA 3OP5A 5FDXA 4EHVA 3O96A 2XNOA 1ZY4A 1XH9A 4OTRA 4FEXA 4QP8A 4EQUA 3ZCLA 4OBQA 4C37A 4QMPA 5I9ZA 3BBWA 2R0IA 4J53A 4BZOA 3PIYA 3AXWA 5I5ZA 3LXPA 5IUHA 1G5SA 3Q3BA 4PF4A 2JAMA 4AP7A 2HIWA 2JDOA 2IN6A 2JFMA 4G9CA 4M12A 3C4XA 4GVJA 2QOIA 4FSQA 2YCSA 4CZYB 1FOTA 2ZM4A 3R30A 2R3MA 3CE3A 4G3GA 4CVAA 4XNEA 3PJ8A 3FKNA 1H26A 3D7ZA 3TV6A 5LMBA 4Q5HA 2Z02A 3D7TB 3O71A 4G3DA 4ZSGA 2YM5A 3FI2A 3ULZA 3SQQA 1MQ4A 3BYMA 3UPXA 3WF9A 4DFUA 3F5XA 4M13A 1R0PA 2RL5A 3ROYA 5AR8A 3UJGA 4A9RA 3SXFA 2XK3A 5A14A 2XKCA 1UV5A 2IVUA 3LCSA 4FTUA 3PSDA 3QC4A 3QU0A 4AN9A 5EDQA 3ZU7A 5GIOE 2UZLA 2X6DA 4XUFA 4CT1A 2HW6A 2YDJA 3TUDA 1W0XC 3DFAA 3LFBA 4U3YA 5ANIA 1XR1A 2YM7A 2C6TA 5CLPA 5G6VA 3MI9A 3LJ1A 4R3CA 4R1YA 4TYHA 4IZAA 1CKPA 2A19B 2GNHA 3DT1A 3LXNA 4J8NA 2CHLA 4RVTA 3PA3A 2CGWA 3MFRA 3KQ7A 3WE8A 5I9XA 4B4LA 5M09A 3T9IA 3SLSA 3BU3A 3MV5A 5AV0A 5JQ5A 1KWPA 2CLQA 2XRUA 4MXYA 4ZZNA 5IA2A 4IFGA 3Q6WA 2VWUA 3TACA 4BCJA 4OR5A 5EOLA 4TXCA 3EFLA 4XOZA 4ZOGA 2BRNA 4O83A 5L2TA 4RJ6A 1KV2A 5D11A 1K2PA 2B53A 4HYHA 5HESA 2WEVA 4R78A 3HMPA 2YIXA 5AP0A 4F63A 1FINA 2HXLA 2OIBA 4QP7A 1BL6A 1L3RE 3DBDA 3PXFA 4L8MA 1JKSA 1YHWA 3I4BA 4UYAA 4D2PA 4R77A 1B6CB 3HRFA 4RVKA 3O7LD 3IECA 1IA8A 5HBJA 4ZSEA 3HUBA 3QX4A 5D1JA 4HVDA 1EH4A 3D5XA 3LHJA 3FLZA 3NW6A 3RM6A 3F7ZA 4QMOA 3ORPA 2AYPA 1CSNA 2RGPA 4J52A 5BNJA 3PE1A 2WTKC 4DFBA 1ZLTA 3HGKA 3G9NA 4GK4A 2CKEA 2W1GA 3FY0A 3E8CA 3PZHA 4NIFA 4F6SA 4IZYA 3CIKA 3L9NA 2UV2A 3R02A 4FV4A 3R21A 3ZFXA 5FEDA 2PUNA 2BILB 1JKKA 2A4LA 1GZNA 3TJCA 4ACDA 4IZ5A 5F9EA 2GNJA 3V5QA 3C5IA 4C2VA 4BI2A 5KKRB 3TDWA 5JH6A 3GC7A 5CI7A 4BCHA 4X21A 3BGZA 1M7NA 2XBJA 4ZZMA 5DMZA 3HYHA 4A9SA 2Y8OA 3I5ZA 4C58A 3QQLA 4RC4A 4JIKA 4FV5A 3FPMA 3P5KA 4YNOA 3GGFA 3GUBA 4C62A 3JY0A 3A61A 3LFFA 4GEOA 4QMLA 2O65A 2W4KA 4JVGA 4ASXA 3HZTA 4UWBA 4QP6A 1OIYA 5A4CA 3CQUA 1FMKA 1IR3A 2X2LA 5T68A 2BVAA 3SDJA 3ACKA 3HKOA 2ZMDA 1NT2A 4BR3A 4LYNA 4PRJA 2GFCA 3WIGA 4USEA 4HCVA 5CVGA 1AD5A 4IEBA 4UEUA 5L2WA 2UZUE 3UQFA 1JPAA 2XEYA 3REPA 4RJ7A 3PA5A 5I9WA 3QL8A 5IQAA 2YM4A 3TZ8A 3QWKA 4GVAA 5FRIA 5CT0A 4NEUA 4PTEA 2XS0A 5A6OA 1GIHA 4EYJA 4O7YA 5LQFA 2R3QA 4FG7A 4P2KA 3UIUA 2W1IA 2XK4A 4FYNA 3R7VA 2BTSA 3D94A 3KEXA 5L2SA 2B9FA 3CTHA 4MXXA 4D4RA 2Q0BA 1F3MC 4ZLYA 3H0ZA 3E5AA 4PQNA 3W2CA 4Z3VA 2XNPA 3QTZA 4H1JA 5AR4A 2OJJA 5IQCA 2Y4IC 5H3QA 4O0WA 1J3HA 4MNEB 4RX7A 5CU2A 4AE9A 2WKMA 2XK8A 3RBWA 3RKBA 4ZSAA 2R3FA 3FV8A 5HO6A 3IGOA 1ERKA 4G16A 3OTUA 2OI4X 3BV3A 4RIXA 3FPQA 4Z7HA 1Y57A 2ITUA 3IO7A 4M8TA 3E3BX 1W83A 2VWWA 4QT1A 5CEIA 3OT3A 3ZBFA 4OGRA 5EYKA 2ERKA 4UY9A 2Q0NA 3VWAA 2F57A 1Q8YA 2VTIA 5HTBA 2F2UA 2HY81 4Y5QA 3E93A 3SGCA 3WILA 4CEGA 3PJCA 4D4VA 5D7VA 3PJ1A 4HW7A 4JAJA 2ITOA 4JX7A 2Z7LA 2OU7A 3EQBA 3LM0A 4TNDA 3PXYA 4W4VA 1TKIA 4ZTMA 3DXPA 2QOBA 3V51A 4HZSA 3EN5A 4V04A 5L2IA 1XBAA 3KVWA 2RFDA 3C1XA 4GUEA 5CF8A 5CQWA 1ZYLA 1HCLA 3NNUA 4WG5A 3UIXA 4FIIA 5I9VA 2C5VA 5KMMA 4G6NA 3V3VA 4XP2A 4CCBA 3ZUTA 4EH8A 1YDTE 2I6LA 2CGVA 4Q9SA 3UVPA 3SA0A 4Y83A 3PSBA 5HNGA 2I7QA 4H3PA 5L3AA 5E9EA 3LFAA 3Q5ZA 4ZSJA 1FVRA 4AQCA 2QOCA 3OWLA 5GJFA 4C34A 4CNHA 4DH7A 3TZ7A 4EI4A 4KD1A 5A6NA 1R39A 4X2FA 4ANBA 4UMQA 5C1QB 3Q52A 4XOYA 2BZIB 3I0QA 3MFUA 3O8PA 4R3PA 4YZCA 3V5PA 2XRWA 5EQEA 5CF4A 2C5YA 3FQEA 1Q3WA 5DR6A 4D2TA 1UWJA 3FXWA 3PVBA 3BBTB 3FZTA 4Q5EA 3LAUA 4FTMA 1W98A 3NYOA 4AA5A 1XH5A 1OIRA 3NYVA 3P7AA 4YZDA 3R9RA 1P4OA 4QMZA 4X2KA 5CS6A 3ZLWA 4DFZE 4F7LA 1UKHA 5BVDA 4CFFA 5LMKC 3A4PA 4GW8A 3DZOA 1O6KA 2B9JA 4D1SA 5C03A 4AUAA 4I6QA 4O7LA 4KABA 3Q60A 3KRJA 4OBOA 5A4EA 2CCIA 3KL8A 3F2NA 4FVQA 4NU1A 3OT8A 5AAFA 5AUUA 4GIHA 5KCVA 3DXNA 4APPA 2W4OA 4AA4A 4R6VA 4QMUA 5FEEA 1U5QA 3UC4A 2OK1A 3QQHA 4EBWA 5CAQA 4BDDA 4ZAUA 3V8WA 3AD4A 3DGKA 3PPZA 3KF7A 2VWBA 1IEPA 4EOIA 4RX5A 3FAAA 3FL5A 5EM7A 4ZJVA 3CQWA 3FLWA 3FLNC 5EKOA 4AW5A 3RINA 4F9BA 4IE9A 5C26A 3R8LA 4E6CA 1YDRE 4YJQA 5M51A 1DI8A 4JQ8A 4U9AA 2JDRA 3PLSA 3RK5A 3SX9A 4NW6A 4A9TA 2BRHA 1O6YA 4J97A 4I23A 2B0QA 4ZJIA 4BDJA 2HOGA 5CEPA 3ATTA 2WU7A 1B38A 4O7VA 2JKKA 4YZ9A 1F5QA 3LCKA 4BGQA 3C7QA 4LMNA 1MRUA 2BDFA 4IHPA 3UVRA 4BZNA 4M69B 2V7AA 3C0HA 3KB7A 4C8BA 4AE6A 3O8UA 4JR7A 4O0RA 4QPMA 3R7OA 4EHGA 5KZ0A 4A4XA 4GV1A 4FBXA 4CFNA 5M56A 4YHFA 3LMIA 1JQHA 4JS8A 3HMOA 4BBMA 3PXRA 5KBQA 3RP9A 3BHVA 3AT4A 2LAVA 3A7GA 4I0TA 2P0CA 4P4CA 3NW7A 3M2WA 3OCGA 4HGSA 3BWJA 3P0MA 2YAKA 5AUXA 3F7WA 2E9UA 4PV0A 5E7RA 3MH3A 3D5UA 5DNRA 4BTFA 4D0XA 2WGJA 2VTTA 1WMKA 3KXGA 4OTDA 3QTQA 4JDJA 3F2RA 3E7VA 2WTJA 4RFZA 1BKXA 3VBQA 4BCNA 2CMWA 3PUPA 4OTIA 5EYDA 4DFNA 5ICPA 3VHEA 3C0IA 3TL8A 4P5QA 3UG1A 4DYMA 4F0FA 1PW2A 3ZMMA 4NKAA 4D0WA 3OBGA 3EN9A 5LWNA 5IQIA 1G3NA 3CPBA 4V0GA 4YO6A 2Z7RA 4I41A 5LVPA 3R1QA 5I3OA 4R7HA 3ZXZA 4QYGA 5DOSA 1T45A 4NTSA 1FPUA 2B9IA 1Q5KA 2OJFE 2UVYA 4LQMA 3BYOA 3OY1A 1R0EA 2OF2A 2QOFA 4I6HA 1URCA 3UOLA 1FQ1B 5KO1A 4IVDA 2VTAA 3KCKA 4OT6A 1YOLA 3LM5A 3AC3A 2QONA 3KXMA 4XG6A 4YTFA 5HLNA 4HVIA 3MA6A 4PUZA 5LMKA 4FIHA 5E90A 3I6WA 3DDPA 4YZNA 3KF4A 4QMXA 5HVKA 1SNUA 5IMEA 3O50A 3VUIA 4LOOA 2X0GA 5CSHA 3AC1A 3HRCA 5DG5A 3MFTA 2HZ0A 4HCUA 2EVAA 1REJA 4LUDA 3BQCA 5ETIA 3RM7A 1UA2A 4GL9A 4DFLA 4CRSA 4EOLA 4YTIA 4X6QC 4ZTNA 3G90X 3WYYA 3RMFA 3QYZA 1U54A 3H4JA 5AP2A 3KA0A 3VC4A 3LIJA 3VW6A 1H00A 3ORNA 4NSTA 3TM0A 3GFEA 4D2VA 1BL7A 3DKGA 3WF6A 4EJ7A 3R8ZA 3BGQA 3GEQA 2YHVA 2W1FA 2GMXA 3BRBA 5FXRA 1H28A 1NY3A 5TT7A 1RQQA 3LXLA 5TOZA 1JAMA 4E5WA 3M42A 3O8TA 1YQJA 3ZZWA 5ETCA 2E2BA 2QNJA 3A7JA 4BCOA 2G2HA 3ULIA 4XEYA 1H8FA 3V5WA 2JBPA 4KSQA 2UZDA 4BCQA 2J0JA 4EC8A 2C6OA 2EXCX 4X2NA 4DEAA 1KUTA 5AEPA 2VO7A 4I5MA 3ZDIA 3EZRA 4YJRA 1ZZ2A 4WG4A 3D14A 5DT0A 4DH1A 4UMUA 4O7ZA 5KUPA 3HRBA 3R1NA 4DTAA 2XP2A 3CGFA 2O8YA 2QOLA 3IS5A 2OJIA 2O63A 4FIJA 4JR3A 5FP5A 3QYWA 5L8JA 4P7EA 5AIRA 2C1AA 2VZ6A 4EHZA 1CTPE 5HBEA 2YIWA 3JPVA 2PVNA 3U4WA 4NL0A 4KBAA 4ORKA 4FTTA 4HNFA 4GT4A 3TCPA 2X9EA 1QMZA 3TT0A 4MWIA 5LXMA 3TZMA 3E8DA 3W8LA 4KB8A 3BCEA 3FC1X 1STCE 4FEQA 4GIIA 2AC3A 3QWJA 4HVHA 1OPJA 3E3PA 3G33A 2ZOQA 4H1MA 4IW0A 3U87A 3DY7A 4O2PA 3V04A 2UVXA 1YWRA 2W06A 3U4UA 3V8TA 3F5GA 3OFMA 4OTQA 1UU3A 1U5RA 4MX9A 4FV1A 4FTOA 3VS1A 4YP8A 2PZYA 3RAIA 4C33A 4JX3A 4C59A 3FWQA 4TYJA 3N4TA 3QUEA 2DYLA 1TQIA 4O91A 1O6LA 2ZMCA 4FMQA 5BUEA 1PXPA 2PK9A 4FL2A 2CSNA 4XLVA 4C4FA 5AFVA 3HAMA 4X2GA 2H34A 4U40A 2VWVA 3EQGA 4U79A 3NIZA 3IKAA 4PNKA 1BYGA 2C5XA 2QODA 3BEAA 3IK3A 2VX3A 4H3BA 3ZZEA 4BBFA 4MBLA 5KMOA 3NZ0A 4F6UA 1V0OA 4FUXA 3VUGA 4E1ZA 1S9JA 3PIZA 2OH4A 3LJ2A 2JKQA 3P86A 1OL7A 2PVLA 3UNKA 1GZ8A 2P4IA 5GNKA 2W9FB 3MH0A 1BI8A 5J9LA 2HZNA 2BIYA 2C0IA 2CN8A 2CCHA 3N51A 5BVOA 3B2TA 3ACJA 4BI0A 4DAWA 4TPTA 3COHA 5HU9A 2OZAB 4C4GA 1Q24A 3F2AA 3IQ7A 4FNWA 3ORMA 3VJOA 3UOKA 5J5TA 3LZBA 2PVKA 3KRLA 3E62A 3NIEA 2JDSA 4RIYA 4JNWA 2OO8X 3PXKA 5AV1A 3ZSGA 3N4UA 1H1PA 4JXFA 5HCYA 4IX6A 2WZJA 4LRMA 4E4LA 2R3NA 3OD6X 2WOUA 4KAOA 2YWPA 4WNKA 4F1TA 4D2SA 1JLUE 2FA2A 4AGCA 3PTGA 3PWYA 4FICA 2GCDA 3H9FA 2B1PA 4FL1A 5CEMA 3AOXA 3FDNA 4NFMA 2YACA 3DKCA 4B7TA 3ZTXA 4EOJA 4CFXA 2QCSA 2HWOA 3QALE 2GHGA 4XBUA 1RE8A 5TO8A 4L67A 4QTDA 3SHEA 4DINA 3BLRA 4FTRA 3EKNA 3L9PA 4YPSA 2J5EA 3TNIA 3WF8A 1OL6A 1X8BA 3HMIA 4JG8A 1OITA 4MKCA 4DN5A 3SW7A 5CXZA 2ETMA 3F3UA 3AT2A 3PXZA 5BUIA 3LFQA 3MTLA 3NAXA 4YC6A 2CLXA 5AX9A 5BX0A 4K0YA 2XIXA 3QQUA 2PZPA 3BWFA 3TWJA 2B54A 2RFNA 4I93A 3UZRA 2ZAZA 3GOPA 3R0TA 4JBPA 3FYJX 2VN9A 4XYFA 4PDYA 2CGXA 2WMWA 3EL7A 4ANSA 4TWCA 1SZMA 1SNXA 4ALUA 3KC3A 4CTBA 2BPMA 5D10A 5EKNA 4L44A 4ZZOA 1OL2A 2JITA 3O17A 2JLDA 4AGUA 2BAJA 3OWPA 3TUBA 3PPKA 4YJVA 2XIYA 4TTHB 3I1AA 3R73A 2EXMA 3HNGA 3D5WA 1P14A 3LFEA 5EDPA 3ZDUA 4OTWA 3QCQA 1OZ1A 2R3PA 3AQVA 4FTNA 4Z55A 3E7OA 4O6LA 2QOOA 1AGWA 4H36A 4PP7A 3TV4A 3L8VA 4DEHA 3QUPA 3VHKA 4FTIA 4TYHB 5E8WA 3EMGA 4V01A 3H30A 4UXQA 3PP1A 4NTTA 4W9WA 4MNFA 3BX5A 3EQIA 2VWIA 4PPAA 3ODYX 2YLEA 3FLYA 4QPSA 1KV1A 3QTWA 5CWZA 3KN6A 3VUKA 4AA0A 3HP5A 4HPUE 2YITA 3LFNA 4BCPA 2EXEA 3UNZA 3FMHA 5DA3A 5HD7A 4EL9A 4DCAA 4DFXE 3ENMA 4FZDB 4ZTQA 5KBRA 3LQ3A 1W7HA 2Q83A 4DGMA 4EK6A 2P33A 3EQPA 5EQPA 3IOKA 5D41A 1YXTA 2I0HA 3PWDA 2R7IA 4M84A 4TRLA 4ARKA 4RJ3A 3OEFX 2FSMX 5HD4A 3GC8A 2YN8A 4QTAA 3LLAA 4I0SA 5CAOA 3BGPA 1GAGA 3W2RA 4QP2A 4D5KA 1QCFA 1ZRZA 4MD7E 4E26A 3FMJA 3PY3A 4NWMA 3ZBXA 2ZDTA 4UALA 4ANMA 2C3KA 4RX8A 5IQGA 2PE0A 3CD3A 3I60A 4HYIA 4IJ9A 1QPJA 4KIPA 4O21A 4BDEA 1M17A 2JIUA 2BTRA 3QBNA 3KMMA 4BDFA 4NIFB 4R8QA 3RPOA 5BQ0A 3EFKA 4AG8A 4ZS4A 1DM2A 3QZGA 4FUYA 5GIPE 4JIAA 4MYGA 3S1HA 3R22A 4U45A 4XRLA 4KINA 2V7OA 2DS1A 3FHIA 2JFLA 2XIKA 2YM3A 3KRRA 4GRBA 4TYEA 3KREA 4QYFA 3SOCA 1KE6A 4F9WA 1XJDA 2VAGA 3T3VA 2XIZA 3Q4TA 3GBZA 3R7UA 4L42A 1FBNA 2VTNA 3DB8A 2YZAA 4CFUA 2RIOA 3THBA 3F88A 4CTCA 5HHWA 4EOQA 4QNYA 3ERKA 4GYIA 3VF8A 3LMHA 2WAJA 2QQ7A 2C6LA 5FXSA 4PPCA 5HLPA 4NJDA 4DH5A 4RX9A 3R6XA 4RIOA 2C1BA 5CI6A 5M06A 3RVGA 4PTCA 5HIEA 4O0UA 4F0IA 4G6OA 3B8RA 3R8VA 4AW2A 4ACHA 3T3UA 5BYLA 5HG7A 2EB3A 4GU6A 4I6BA 5CU4A 2V5QA 2EB2A 2G2FA 2VTJA 3EYGA 2YFXA 3L8SA 2WOTA 4EZ5A 4YUQA 4KSPA 4RJ5A 1KE7A 2P55A 2QOQA 3D0EA 2XNGA 5EDRA 5I4NA 4HJOA 3QCYA 3UZPA 4EUUA 4IAZA 1KSWA 4EOMA 3ZSIA 5A9UA 4L3PA 4EORA 4ASEA 3KK8A 1LPUA 4DEIA 2OF4A 4KIOA 4BWKA 2WMBA 1TVOA 1PHKA 5CVFA 2BAKA 2G01A 5IU2A 4M7IA 5FTOA 1W82A 5C01A 2QU5A 3HA6A 4NJ3A 2VTPA 2YZLA 1A9UA 4LG4A 3PSCA 4BIDA 4PMSA 1ZXEA 4ACCA 4AZEA 4E6AA 3NNVA 3H10A 5J9ZA 4PWNA 3NVMB 1Q8ZA 2PHKA 5GJDA 4FK3A 3AC4A 4I4FA 1Q61A 2VGOA 5C9CA 2PMNX 2C6DA 3CTQA 3PG3A 3V8SA 2YIRA 1UU7A 4DEDA 5DH3A 4GJ3A 5GZ9A 3EJ1A 5BVFA 1R3CA 3FJQE 1J7IA 5JK3A 3E64A 3ANQA 4FTJA 5AR2A 4DEGA 5IEYA 5HE0A 3C9WA 3NVKI 1Z9XA 2XB7A 3DBEA 3A8WA 4K33A 2J5FA 4PMPA 3V01A 3DKOA 2PUIA 3CKXA 3G6HA 4W8EA 1VR2A 2DQ7X 3WZEA 3DV3A 2J0IA 4F4PA 3NPCA 4WNOA 4S32A 4CV9A 3JR1A 4D2WA 1YHSA 4IDVA 2F7XE 3NYNA 3W18A 2WTKB 1YXVA 1YWNA 2C3LA 5A4QA 5J5SA 3K54A 4Y8DA 3SD0A 2W1DA 2DUVA 4EUTA 4FKWA 2QKRA 5M4IA 4O0YA 4MEDA 1WBWA 1ZMWA 4Y5HA 5H8EA 3PE2A 4CFVA 4EJNA 4ZEGA 4YMJA 5AM7A 5JRQA 4PMMA 4RWIA 4RWJA 5HG8A 4QMYA 3R83A 4LL5A 2XYUA 3AT3A 2XBAA 1P5EA 2NRUA 5CAUA 2CNQA 4ITHA 4M0ZA 3LQ5A 3FI8A 5AUVA 1PKGA 2Y9QA 1PYXA 2IVVA 3KVXA 1LUFA 4JG7A 2WD1A 3K3JA 3Q53A 3QA0A 4FV7A 2SRCA 4H3QA 4KRDA 4Q2AA 3R8UA 2GNFA 4AW1A 3PVGA 3IOPA 5E8YA 5ACBC 5AUTA 3OXTA 2BROA 2QC6A 4BKZA 2WNTA 5IQDA 2J7TA 3NLBA 5D9HA 4GFGA 3VF9A 2X6EA 5D7AA 1WVXA 5L6PA 5EG3A 4BI1A 4H05A 1J7UA 4N70A 3U6JA 3EFWA 3BLHA 3HV5A 3Q4UA 2H96A 3FSKA 1KE8A 1QL6A 3OMVA 4I4EA 4RRVA 5ETFA 4EOOA 2ZVAA 4GK2A 4C38A 5IZFA 3U55A 3MW1A 2OFVA 3R7YA 3TN8A 4RFMA 4MBJA 5I9YA 3ZFMA 3FKOA 4NYEA 2FH9A 2WMQA 3F66A 5LOHA 2FSTX 4RGJA 4HGEA 4L7FA 1APME 4L00A 3I6UA 3S00A 3R01A 4FT3A 1GIIA 4AZWA 4XHKB 4YBJA 4CMOA 4JRVA 4BIEA 1Q62A 4D28A 2WMRA 2C3IB 2OICA 4Z9LA 5EI2A 3R9OA 1OKWA 2ACXA 3FI4A 2WXVA 3L1SA 4Y95A 3CPCA 3MTFA 4O96A 5LVLA 2REIA 1OKZA 4E5AX 4O0XA 4U42A 3TKHA 1UNGA 2B52A 3Q9WA 4JDIA 2OXDA 3DAKA 4UZHA 4BKYA 5BVNA 5HTIA 5DN3A 5E1EA 2AC5A 3VBTA 4BHNA 2OLCA 3EYHA 3KKVA 3MVJA 1WVWA 4DGLC 5EI6A 4ZLOA 3LXKA 3BZ3A 3UG2A 3D7TA 2W0JA 3AC8A 1PXIA 4IANA 3RWQA 2Y4IB 4KKGA 2WQMA 3B2WA 4IB3A 3BQRA 3FMMA 3QXPA 4RA5A 2IO6A 4J71A 2J50A 4DLIA 5A54A 4EYMA 3D83A 4MHAA 1IRKA 4EQCA 3G5DA 4TYGA 1ZYSA 2VO0A 4TW9A 5M07A 2HENA 3ZC6A 5IKWA 1NA7A 4OUCA 1YWVA 3HX4A 5H9BA 4FNYA 3ZC5A 4MQ1A 4QYHA 5FP6A 2PVYA 4FSWA 3H3CA 2GTMA 2BZKB 3R2YA 4LGDA 4C02A 1Q8WA 4BDAA 2ZM3A 3CD8A 2W1EA 1JNKA 2G15A 3A4OX 3BYSA 2VRXA 4YSJA 4BDGA 4YHTA 4ZMFA 5JFXA 3C50A 4IWQA 5J79A 1U59A 1UU9A 2QOHA 2UZOA 3HV4A 4FI1A 4FOBA 5K3YA 2OFUA 3VS3A 4XJ0A 1Q99A 3PY0A 4OLIA 4BCMA 2YCQA 5J1WA 3SXSA 5E4HA 1VYZA 3P08A 1GZKA 4CZUA 1H1QA 2C68A 3N4VA 2XNEA 4RZWA 4I21A 4EH2A 4I5HA 5EM5A 3P9JA 5IDNA 2R3HA 4BGGA 5FEQA 4BDBA 4YPDA 3NEWA 3P7CA 4YBKA 2IZSA 4E8AA 4FZ7A 2OIQA 2HYYA 4L68A 3VRZA 5CU0A 3NUPA 1XBBA 4IAKA 2BMCA 5A46A 3C51A 5AR3A 1I09A 4E7WA 5AX3A 1PXJA 4FT0A 4O7TA 5BPYA 3E92A 2NO3A 3EZVA 4FX3A 2FO0A 5M4CA 2OKRA 3OXIA 5BMSA 2IZTA 3EH9A 3NX8A 4ASZA 4EOPA 4FKRA 4NK9A 5FDPA 4CGAA 5DFPA 3MJ1A 3HDMA 5LARA 4V0GB 3QKKA 1WAKA 2A2AA 2VTOA 3PVWA 4FSUA 4C3FA 3A7IA 4FODA 2BRMA 3D9VA 2JKMA 4HYSA 3ZO1A 5TE0A 3P1AA 5IH6A 3QUDA 3R9NA 2VTMA 4ZY6A 5GINE 4DBXA 2XUUA 3MN3A 3H9RA 3U9CA 4TKSA 4U81A 1TQMA 4MXZA 3VS2A 3TXOA 3E8EA 3S4QA 5ANOA 3QCXA 4NCTC 2ZV8A 1ZY5A 2HW7A 4Y85A 4DG2E 1UNHA 2GDOA 3EQFA 3QD2B 2R3IA 3FXZA 3RWPA 4ANNA 5KE0A 3QTIA 4EHEA 3AC5A 3DJ6A 3GVUA 4FV8A 1WFCA 4MD8E 4G2FA 2OWBA 4KIQA 4XLIA 5C27A 3ZLYA 3EWHA 4ITJA 5HCXA 5D12A 4N6YA 4ZSLA 2VTLA 4IVBA 2YJRA 4FKUA 4EK4A 3TDVA 3E63A 4K8AA 5DEYA 4RJ8A 4RLLA 2QLQA 4X2JA 4O38A 1BX6A 4QPAA 1MUOA 3BV2A 1T46A 5CTPA 4DF3A 1URWA 4ZK5A 1U54B 5M55A 3GXLA 5CSWA 1PMEA 2W99B 4DHFA 2O3PA 4HGTA 5E8XA 2J6MA 5T3QA 3AD5A 4ZTRA 3GU7A 4FSRA 1BMKA 3TNQB 3ZLSA 5AADA 3Q4ZA 5AWMA 5HE1A 4E5BA 4R7BA 3DFCB 2W5HA 3NNWA 3POZA 2CKQA 3PJ3A 4CFWA 3KMWA 1M52A 4IM2A 4TYIA 5EW9A 3U54A 4JRNA 2J9MA 2RG5A 4MCVA 3OC1A 4BN1A 5AAEA 4G17A 5IMXA 4A7CA 5HVYA 4FV0A 5EFQA 4UZDA 4P90A 3S0OA 2UZWE
chains in the Genus database with same CATH superfamily
4FTAA 2P2HA 5FGKA 3VUMA 4TNBA 5L8LA 2ZB0A 5F95A 3A2CA 3NUYA 2WIPA 3FI3A 3Q4CA 4I24A 2JDTA 2VTSA 3I7BA 2XNMA 2C3JA 3BHHA 2XKFA 4WO5A 5ANDA 4AT5A 3PVUA 4X3FC 5C8KA 3W0NA 1ZYJA 5I9UA 5K4JA 2QI8A 2YCRA 4I94A 4JT3A 4L52A 4EZ3A 3FZ1A 1RDQE 3TTJA 1PMUA 4A9UA 3F69A 1GIJA 4QQ5A 1KE5A 4XG3A 2C30A 2QURA 3SVVA 4WSQA 4DCEA 2GNLA 1IG1A 3PP0A 4L43A 4R5YA 2WMXA 3JXWA 5CSXA 3O5AA 3OOMA 3VO3A 4E93A 1E1VA 2BFYA 4U3ZA 3TI1A 4AN3A 4B8MA 1SVHA 3F6XA 1GOLA 4KS7A 4F9CA 2PY3A 3MPMA 4JLCA 4AOTA 5J8IA 3CY2A 5JEBA 3ZM9A 2Y7JA 4XP3A 2QO2A 2X81A 3LCTA 2PUPA 4S31A 2ETKA 5HTCA 2GNIA 3MVHA 4IX4A 2VGPA 3EQHA 4KIKA 1CDKA 2OJ9A 2JIIA 2FB8A 3JY9A 4L3LA 4QP3A 5AJQA 4C4JA 2QD9A 1Q41A 4C3PA 3NAYA 1MQBA 4USFA 1RJBA 4KS8A 4BTJA 3W2PA 3CLYA 4J95A 4AT3A 1PXKA 4NCTA 3WI6A 2XIRA 4F9AA 4YJUA 3MPTA 3CEKA 4GT5A 2NYAA 5EQYA 5CAPA 2HY0A 1JKLA 4EOKA 4WT6A 4XV3A 4PDPA 4W4XA 5AP3A 3K2LA 4J96A 2IZRA 5CALA 2ITNA 2R3GA 2X7OA 3VVHA 4CKRA 5K5NA 3WOWA 5M08A 2H6DA 4M67A 3LVPA 3UE4A 4CT2A 1O9UA 3O2MA 4Q9ZA 4CG8A 1J91A 2BRGA 5DEWA 3ITZA 4NFNA 5AUYA 3UVQA 4E4XA 1OMWA 4I5PA 4OTPA 4IH8A 4OW8A 5FBNC 3S3IA 4FEUA 2W1ZA 2WFYA 4XG2A 4FZAB 5B0XA 1G8SA 1R1WA 2WTWA 4CZTA 1YDSE 3DBQA 4WNMA 3HECA 4U80A 5A4LA 2OXXA 2J0MB 3JUHA 3FZRA 3QZFA 3BLAA 4HZRA 3VBXA 3AMYA 3I79A 2IWIA 2BR1A 3VUHA 2YM8A 4NKSA 4DH8A 4DG3E 1KOAA 3FMEA 5E8UA 5IQFA 4GSBA 2JGZA 5FM3A 4D2RA 2Y4PA 4ANQA 3NNXA 3AKLA 3KRWA 4EWQA 5J7HA 3SG8A 4LUEA 4RIYB 4AXAA 2C69A 2FVDA 3PY1A 4FG8A 5DT4A 3GCVA 1GNGA 2XZSA 3ZLXA 3RALA 4ZLZA 2H9VA 2V0DA 3FMLA 1OB3A 4F08A 5CEKA 2YABA 3QD0A 4DEBA 3SW4A 4M3QA 3W8QA 4MF1A 3P7BA 3QTRA 2OH0E 3OCBA 3UOHA 3C4EA 3HUCA 4JMQA 5IUIA 4X3FA 3SXRA 3QTUA 4ZMEA 3PPJA 2QR8A 2DWBA 3FBVA 1NVQA 2F7ZE 3Q2JA 4QTCA 2G2IA 2A0CX 3RPYA 4BTKA 4DEEA 1XHAA 4BDCA 3FYKX 5EHLA 4JI9A 3KU2A 4IQ6A 4CLIA 4II5A 3NGAA 4QO9A 3OCTA 2NNWB 3OWJA 2WHBA 4UXLA 3BHTA 1Q4LA 3QRIA 3I81A 4YGAA 3CBLA 1IASA 2OJGA 4RQVA 4UWYA 4EC9A 4O84A 2RKUA 4GYGA 4O7RA 4O81A 2F2CB 2LGCA 3F3TA 4FTKA 4I1ZA 3W2SA 2GQRA 2PL0A 4EH7A 3Q9XA 2JD5A 4FV6A 5IA5A 4ZIMA 2XKDA 3ZOSA 3QZIA 4YZMA 2ZV9A 4GFOA 2ZDUA 3TTIA 3AGLA 5E8SA 3RI1A 2GHMA 5CF6A 4WSYA 4XMOA 4N4SA 2BUJA 4GKIA 1LP4A 3GU4A 4LGGA 5AR5A 2QLUA 2GNGA 3SG9A 4QDEA 4PTGA 3DKFA 3IW6A 3MY5A 1W8CA 1PKDA 2VO6A 3Q5IA 3UO6A 4LGHA 4X0MA 4AX8A 4HPTE 3GU5A 4GH2A 4IVAA 4EBVA 4UN0C 4M66A 2FSOX 3IDCA 4F78A 5M4FA 3ATSA 4MQ2A 4UX9A 5IQEA 2HCKA 3LMGA 4CSVA 5DR2A 5KHWA 5LMAA 1PMNA 4C7TA 5KMKA 4I20A 2QHNA 5F4NA 1XH6A 4GUBA 4BCGA 3V6RA 2OG8A 2IW9A 3V5LA 5HU3A 5KHXA 4O4DA 4QMMA 1DS5A 2BDJA 2WMUA 1VYWA 4FTLA 5FTQA 3W0SA 4WBBB 3ZXTA 1Q3DA 2UW9A 2O5KA 3D15A 2RF9A 4ONAA 4BL1A 3GCUA 3OW4A 4AZFA 4LOPA 3ORLA 3TJDA 2VNWA 4AXDA 2WMVA 3A62A 4M15A 5E1SA 3RTPA 5HQ0A 4FSZA 4FZ6A 3ORXA 2HWPA 2C47A 3COIA 4V05A 5CVHA 3ZO4A 4E6DA 3VS7A 1F0QA 1M14A 3I7CA 3TIZA 3UMXA 4QP1A 4HOKA 5IH5A 3BL9A 2YEXA 1Z5MA 2YA9A 3UO4A 2B7AA 5FXQA 3GCSA 4DC2A 4ENYA 3L9MA 3LFDA 1JVPP 4FSMA 3VW8A 2PULA 2PZIA 2JEDA 4DGNA 4FV9A 5IA1A 2PMLX 3R00A 4CFMA 1HCKA 2Y6OA 1PJKA 4MUQA 1XKKA 5CZIA 2UW3A 4JBOA 4IIRA 5DWRA 3KXNA 4CG9A 3DQXA 3JS2A 4IDTA 4TL0A 2PE1A 3LCOA 3P78A 4M14A 3R71A 4AS0A 4BRXA 2ONLA 5B2LA 4OTFA 4RMZA 4UBAA 4F64A 4U41A 4QQTA 3OROA 2R3LA 3GENA 3ZONA 3KRXA 1MRYA 3BELA 4FIGA 4IVCA 2QO7A 5AP5A 4QEBA 3WZKA 5AP1A 3FZSA 3P79A 4NW5A 2J0LA 3KULA 4N6ZA 1CM8A 1LR4A 4LFIA 4HYUA 4RJ4A 5DBXA 1U46A 4WHZA 2JKOA 3FQHA 2PVFA 5EW3A 1TFFA 4G9RA 4EZ7A 5KMNA 4OAVB 5ANGA 3BU6A 4FIFA 3OF0A 2R7BA 4AT4A 4O7SA 1CMKE 4KA3A 4IX5A 2V55A 5FG8A 1W2FA 3COKA 1K9AA 3DTCA 5EK7A 3UMWA 5LVNA 3ORZA 3QTSA 4BWPA 4APCA 3U6IA 1GY3A 5HKMA 3VULA 3R7EA 3C13A 3JVSA 4A4OA 4F6WA 4HCTA 4E3CA 2W9ZB 4E4MA 1Y6BA 2J90A 3GC0A 1P4FA 3O0GA 4O1PA 5IPJA 1A06A 2ZV7A 3NUUA 5E8ZA 4UMPA 5LVMA 2W1HA 4FG9A 1Y91A 5CU3A 2I1MA 4CKIA 2ZJWA 5C8NA 2IVSA 3Q6UA 2CGUA 3BIZA 2PE2A 1MRVA 3DXQA 4IWOA 3HV7A 3HV6A 3RJCA 3PXQA 4D4SA 4WKQA 4Y73A 3D4QA 5BVWA 4F09A 4FE2A 4LRJA 5KNJA 3BHUA 2C6KA 2XCHA 5B2MA 3DAEA 4DT8A 4QMVA 2XM9A 2PSQA 4FKGA 3LW0A 2W7XA 4YR8A 4GT3A 4TWPA 3WF5A 4G31A 5ITAA 4HGLA 4RC2A 4BZDA 3OY3A 3RAWA 3DAJA 4IBMA 2QO9A 4RVMA 3UBDA 2IG7A 2XAOA 4J7BA 3NMUF 5L2QA 4QMTA 2GHLA 4PL5A 5BMMA 3F82A 4U0IA 5AP6A 5AV2A 4AXCA 3UTOA 2YLFA 2P3GX 4OBPA 4OT5A 1XH4A 3AC2A 3EN7A 4KKHA 3W32A 1B39A 1PF8A 4BF2A 4EKLA 4ZY4A 3K3IA 4U5JA 4CLJA 4P5ZA 5JFVA 3QD3A 5J7BA 1AQ1A 3MFSA 5IUGA 4C0TA 3BKBA 4H39A 5HCZA 2VTQA 4FIEA 3ANRA 5M4UA 3ZFYA 3EQCA 3O51A 2WQOA 4L9IA 2R9SA 3G51A 5CYIA 2JC6A 4U6RA 3TNPC 4NH1A 4LOQA 4DA5A 2UUEA 3PG1A 5B7VA 4HVGA 5JKGA 4IFCA 4O82A 4G34A 5CZHA 4DTKA 3TV7A 3II5A 4FVRA 2GS2A 2PZRA 5FLFA 4QMQA 3RPRA 2W5BA 3C5UA 4C36A 5J95A 4R5SA 2C6MA 3R9DA 5DRDA 3VIDA 4G3FA 1YKRA 4MAOA 1ZYDA 4B8LA 2PVMA 3FMKA 3QRUA 1HOWA 5CY3A 4AFEA 3K5VA 4RIWA 1H1SA 4CQEA 1FMOE 4PPBA 5H8BA 4LM5A 2I0VA 1H0WA 1SMHA 4BGHA 1M2RA 4F7NA 2YIYA 2Z8CA 3UP2A 5CU6A 4J98A 2YM6A 3GOKA 1FGIA 2R64A 2QVSE 4L7SA 5HE3A 4BHZA 4S34A 4MK0A 4XV9A 3KK9A 5KMLA 1OVEA 2A27A 5HE2A 1Q97A 4EK5A 4U44A 2IW8A 3WZDA 3A7HA 2QR7A 1YVJA 1V1KA 1ZZLA 2F49A 4WIHA 2BKZA 4GG5A 5F94A 3V6SA 3TG1A 5ETAA 4EWHA 5HEZA 2UZVA 2Z2WA 4JQ7A 4W8DA 3ZUVA 2VWYA 3R1YA 4DTBA 2HELA 2XK6A 4XH6A 1SYKA 2J4ZA 5C4KA 2C4GA 1H1WA 1Y6AA 3R7IA 1YI3A 4BWXA 4PX6A 4IM0A 3GQIA 4I92A 1OKYA 2UZBA 2QU6A 3OUNB 3IGGA 4AFJA 4BICA 3T9TA 2GQSA 3QKLA 3D2KA 2HXQA 1TZDA 2A98A 1J7LA 2J51A 4JOAA 3ZO2A 3LCDA 4X6RA 4HVSA 3OWKA 4PDOA 2WTIA 4EH4A 1PRYA 5BUJA 2BCJA 3RAKA 4WOVA 3W16A 3FHRA 4ZTHA 5BVEA 4FK6A 3NUXA 4MF0A 3RNIA 5K9IA 3DLSA 4C4EA 3W1FA 3Q32A 3POOA 2ITZA 4S33A 4FJVA 3IG7A 3RGFA 2UW5A 4O0SA 3OTVA 4GMYA 1XQZA 3OCSA 5JRSA 3SRVA 5LJJA 4EKKA 4A4LA 3FXXA 3TMOA 2JIVA 3V5TA 3EQDA 4MD9E 2YJSA 4F65A 3VJNA 3L8PA 2PVRA 5JGAA 4FR4A 2GSFA 1Y8GA 3KXZA 5TKDA 1H08A 3QGWA 5FQDC 2PMOX 2UW8A 3UODA 4L01A 4L3JA 4NUSA 2XALA 4X7QA 3PLAE 5K5XA 4RIXB 2W96B 3DA6A 2BRBA 3HDNA 4G5PA 5BYZA 4JL9A 4B0GA 1G8AA 2FUMA 4O1OA 4XCUA 4AZSA 3SV0A 4CYIA 4CYJA 4ZP5A 3RAHA 4XX9A 4BYIA 4M0YA 5DRBA 4G5JA 1OGUA 5EOBA 5GZ8A 4MTAA 4PP9A 1NXKA 3E88A 3P23A 2C6IA 3DS6A 3GU8A 4LV5A 1ZMVA 1LEZA 3EB0A 4GU9A 3VUDA 3DPKA 2XEZA 3NUSA 4IX3A 3HVCA 3ZUUA 4U97A 4KBKA 3AMAA 3NCGA 3KIOC 2QG5A 4QP4A 3CP9A 4RLKA 2VO3A 4K11A 4C2WA 2GS7A 1WBSA 2OW3A 3NDMA 1ZMUA 3ENHA 3I5NA 4R1VA 3TKUA 3G6GA 4IXPA 3OZ6A 5AV3A 4A06A 2R3KA 3BE9A 2KULA 4XS2A 3C4CA 4I22A 4O0TA 3BYVA 3Q2MA 4I6FA 4A9YA 2YIQA 4DT9A 3QX2A 3AG9A 3ZS5A 2W5AA 4BCFA 3S95A 3I0OA 4GK3A 4TZRA 1UWHA 2OBJA 1YOJA 4QMWA 2VD5A 4U43A 3M11A 4YLJA 2YERA 2CKOA 1QPCA 3OW3A 4O86A 4TWOA 3MH2A 2OGVA 2XJ1A 3F5PA 3LPBA 5LWMA 3QA8A 4YLKA 4ACGA 4YSMA 2ITPA 1V0BA 3ALOA 3QRKA 4ZS0A 3PYYA 4C3RA 4UMRA 2ITTA 3WYXA 2WMAA 4GS6A 2W1CA 4F9YA 2Z7SA 5IQBA 4RWKA 2BIKB 3EIDA 2X4ZA 3FQSA 2VX0A 3F5UA 4IWPA 4YURA 4NT4A 3H9OA 2X39A 4L46A 5J87A 4CMTA 2XJ2A 5KKRC 4UMTA 3FEGA 1WBTA 4FF8A 4KKEA 3ZEPA 3DLZA 4N0SA 4NM7A 5IA0A 4B9DA 3FMNA 4K9YA 5GJGA 5JSMA 2IF8A 3NUAA 4LI5A 4Z7GA 1IAHA 2XNNA 3VS6A 4FKTA 2R0UA 5EI8A 1OBDA 5LCKA 1PYEA 5DI1A 2CJMA 5M57A 1IAJA 4NZWB 5A3XA 2F7EE 2R4BA 1S9IA 3GCQA 1ZARA 3A8XA 3HMNA 2KTYA 5AP4A 5CANA 1IA9A 3NFGB 4JAIA 2CPKE 4CXAA 4NM5A 4LV7A 3COMA 3SOAA 3DK7A 4WRSA 5HOAA 5EYCA 4BIBA 5EH0A 3NYXA 2ZFYA 3QXOA 4ERKA 5K0XA 4F0GA 1XMLA 1M2QA 3RPSA 4Y46A 3UP7A 3D2IA 1R78A 3UYTA 2I0YA 3L8XA 2VTRA 3F3ZA 4ITIA 5IG1A 3QKMA 3ZM4A 4MWHA 4F7SA 4C57A 3CSVA 2CNVA 3KGAA 1WBVA 3QQGA 4ANOA 3GC9A 1PXOA 2YDIA 3K5UA 5IA3A 4I3ZA 5FTGA 4KNBA 3ET7A 4ZTSA 3ZRKA 4A07A 1ZOGA 4IWDA 2FYSA 3DZQA 4XP0A 5M53A 2UVZA 5FUTA 3BYUA 4AWIA 2W17A 1WZYA 3CY3A 5GZAA 3OUKA 2XYNA 5ANJA 3UC3A 4KIKB 4WD5A 1H01A 2OSCA 4QMNA 2PYWA 1DI9A 4YTCA 3QC9A 3DB6A 4ANLA 3DBFA 4AZVA 2C5OA 3C4FA 4FC0A 3A60A 3BPRA 3CXWA 3DTWA 3GFWA 1H1RA 3HMMA 2VU3A 2ITWA 5AP7A 4YNEA 2V22A 5B2KA 1WBOA 2B55A 3LOKA 3RZFA 3MGYA 4D9UA 3NS9A 5HLWA 2UZEA 4FT7A 4Z16A 4YC3A 2V62A 3FUPA 5CSVA 4IB5A 3FSFA 3AD6A 3MVLA 4JG6A 4XG9A 4BDHA 1UVRA 4GG7A 4IAAA 1A48A 2X4FA 3CCNA 1J1BA 5DE2A 3ALNA 3GP0A 3R04A 5HG9A 2C0TA 4L45A 3OXZA 3EL8A 2H8HA 3EQRA 2G1TA 3SKCA 3TNHA 2GFSA 2X8IA 1BI7A 3MDYA 2VWZA 2F9GA 3ETAA 1H0VA 2EWAA 2ITYA 3MSSA 4WUNA 4D9TA 2QKWB 3RZBA 3HLLA 4AACA 5DPVA 5DLSA 1U4DA 2VV9A 3IDPA 4U7ZA 4WBOA 5AA9A 2UW0A 2GS6A 3Q9ZA 4DLJA 4UV0A 4JQEA 4YJSA 3R28A 3EN4A 5JN2A 4F7JA 4UYNA 1E9HA 2E9NA 2A1AB 2W4JA 2YDKA 4FSNA 5AR7A 4ALVA 4TN6A 3MJ2A 5CNNA 4JDKA 5DVRA 4EK3A 3Q9YA 4QYEA 1JOWB 1OIUA 3KFAA 1SVEA 5EHOA 5G1XA 2R3RA 3FY2A 3UGCA 2I40A 2QHMA 4FOCA 4WG3A 4CMUA 4BCIA 3E8NA 4L6QA 3TNWA 5IDPA 3FKLA 3OHTA 3TKIA 4ACMA 3HAVA 3IONA 2OXYA 5HX8A 4M97A 1OM1A 4KWPA 5E92A 4FKOA 4K1BA 3ZHPC 4DFYA 3KY2A 2VWXA 2R3OA 4G1WA 4BKJA 3LKMA 3DK6A 2PVJA 1WBPA 4IM3A 4X3FB 3CC6A 4XG4A 1REKA 4YZBA 3U9NA 4F70A 3MS9A 4PY1A 5IEXA 3TUCA 1I44A 2BFXA 5JFWA 5L6OA 3LE6A 2X1NA 3MH1A 4IAYA 2B4SB 3KXXA 3CJGA 2UW4A 3OVVA 3NUNA 4RT7A 2HZIA 2BHHA 5CEQA 3Q04A 4YTHA 2WQNA 4D1XA 4J99A 4JBVA 3VBYA 2YISA 4YC8A 2ZM1A 3RK7A 3HV3A 1TQPA 3ODZX 3VQHA 2XA4A 3PA4A 2X7GA 1Q8UA 3FMDA 4FA2A 4MNEA 3RCJA 4FVPA 2WTDA 3R1SA 1YRPA 5BVKA 2BHEA 5IISA 3QD4A 4WRGA 1PXMA 4B99A 4NM3A 1OUKA 4AAAA 3GQLA 2CKPA 3TIYA 3ORTA 4XV2A 4D1ZA 3MWUA 3W33A 4W4WA 3G0EA 4O2ZA 3VBVA 4AU8A 5HO8A 3QCSA 4H58A 3ELJA 2C0OA 2X0QA 4QP9A 5KZIA 3A99A 1K3AA 1XWSA 3OOGA 4XG8A 1QPDA 5HNIX 4USDA 5GHVA 1Y8YA 1OL1A 3F3VA 4FNZA 2JDVA 4IAIA 4RFYA 2PVHA 4EH6A 4GKHA 3ZRMA 4BDKA 4FEWA 3UQCA 5F20A 1SVGA 2XJ0A 3W55A 3C4WA 4TT7A 5BYYA 5HI2A 5DR9A 4BCKA 3TEIA 4N57A 2ITQA 4BFMA 4JDHA 3UQGA 3C4ZA 5HVJA 3NW5A 3MPAA 4DH3A 1CKJA 1V0PA 2JBOA 2NP8A 4QQJA 3EFJA 4IZ7A 4QRCA 3WARA 4BY9E 5TF9A 2E9OA 4XV1A 3RNYA 1XH7A 4XBRA 5CNOA 5JFSA 4CQGA 4ALWA 4PL4A 4AZTA 1NVRA 1OUYA 3PRFA 4GJ2A 3QF9A 3NR9A 4QD6A 5IA4A 4FTCA 4BDIA 5EM8A 5IF1A 2FGIA 1DAWA 2HAKA 2NRYA 3IPHA 3QGYA 2RSVA 4IMYA 5K0KA 4E20A 4RWLA 4F99A 5LVOA 3QQFA 5CT7A 4ZJJA 3P5JC 4U8ZA 3SAYA 3S2PA 3P4KA 1JSTA 4OAUC 2XCKA 3UIBA 3NFFB 1P2AA 3E87A 4OTGA 3UDSA 4BTMA 3U6HA 3PJ2A 4K18A 1PXLA 1ZAOA 2I0EA 5DHJA 4FZFB 3NRMA 4DG0E 2EU9A 1Q8TA 2P2IA 3CR0A 4QTEA 2WPAA 5ANKA 1LEWA 5CSPA 3DDQA 4EH5A 3ZYAA 3NWWA 3QQKA 1OL5A 4AGWA 2F4JA 4MXCA 2ERZE 3FLQA 4YJTA 2QG7A 3M1SA 2ZB1A 5HBHA 4QMSA 2PPQA 3VUTA 4CD0A 3KULB 1J1CA 3KXHA 5JGDA 1OPKA 3CTJA 4YJOA 4IC7A 2ONLC 3MY0A 3G9LX 4CV8A 1OPLA 3OG7A 4TWNA 2UZNA 3MIAA 5C4LA 4MXAA 4JJRA 4I5CA 2G9XA 2VTHA 2WTVA 3V5JA 3HL7A 4QYYA 5CX9A 2WQBA 4ERWA 1JSVA 2BAQA 4IADA 2FSLX 1W2DA 3RPVA 1OIQA 2O0UA 3AGMA 1M7QA 4DE4A 5EYMA 1YXUA 5K4IA 3UO5A 4RQKA 2HZ4A 3FE3A 5KX8A 5JMSA 4S2ZA 4EH9A 2QOKA 3LJ0A 2XNBA 1PY5A 1BUHA 1PXNA 3MBLA 2UW6A 4DBNA 3GCPA 2OIDA 1SM2A 5JT2A 1BLXA 4XG7A 5EM6A 3QLGA 1H4LA 4IB0A 4O6EA 2CN5A 5HNBA 2XK7A 3SC1A 1FVVA 4BVUA 2EUFB 3MA3A 5J9YA 1FGKA 2R3JA 3DJ7A 1WBNA 2ITXA 3QRJA 1WVYA 3HP2A 2X8EA 4M69A 5CQUA 4RSSA 3R2BA 4ASDA 3EKKA 5HICA 4ZXTA 4G3CA 2OZOA 4GFMA 4XRJA 4G6LA 4RBLA 2PTKA 2NPQA 3IW8A 2GPHA 2XM8A 4IJPA 5BV3A 4ENXA 5JQ8A 3A7FA 3QHRA 4PDSA 4O27B 4R3RA 4DGGA 4K77A 5L8KA 3PRIA 4IAFA 4WNPA 5JZNA 2ZYBA 4ZTLA 4MBIA 3OEZA 1YI6A 1WCCA 4UWCA 1ZOHA 3VBWA 4BBEA 2RG6A 3DNEA 4FV3A 4RG0A 4EOSA 1QPEA 2XVDA 2E9PA 3GNIB 5CAVA 2PU8A 3DQWA 4O7NA 3VONA 5KMIA 2HK5A 5DGZA 5IEVA 5AA8A 3F61A 1YXSA 4HNIA 2X7FA 4BYJA 4DITA 5HX6A 3BEGA 4RC3A 4F1MA 2Y6MA 5HO7A 1OI9A 5AAGA 4L53A 2XKEA 4FSYA 2X2KA 3PFQA 2IJMA 4LL0A 5AIKA 4LV8A 5JGBA 5JZJA 3VN9A 3QLFA 4KUJA 1JKTA 2XH5A 4D55A 5EHYA 3IDBA 4ID7A 4C35A 2AUHA 4YO4A 3VS0A 4O22A 5AUZA 3ZSHA 3EOCA 3F3WA 3FZPA 3VS5A 3UOJA 4FSTA 2GU8A 3QHWA 3DK3A 4WA9A 3R8PA 2WMTA 4RVLA 2JAVA 2GTNA 2GQGA 4W4YA 4QOXA 3CQEA 3CS9A 5FBOA 2Z60A 2BZJA 3T8OA 3UNJA 3G0FA 2XMYA 1M2PA 3DJ5A 1YXXA 2IVTA 3RCDA 4AF3A 4BC6A 1VLRA 1ST0A 5FWKK 4YU2A 4FKVA 1NVSA 3VRYA 4IB1A 5E8TA 1YHVA 2CNUA 2Z7QA 1XO2B 1UNLA 2B9HA 1DAYA 1KE9A 4QNAA 3WE4A 4QQCA 4FTQA 3RHXA 3WBLA 4BB4A 2ESMA 5EW8A 2VNYA 4FGBA 5HG5A 1VZOA 2BDWA 3RHKA 5AV4A 1ND4A 2WELA 3NSZA 4RIWB 4LMUA 5HIBA 2WMSA 2W05A 3QTXA 3ROCA 2IZUA 2RFEA 3IW5A 5ANEA 5C8MA 3UIMA 1RW8A 1JSUA 1XH8A 5ACKA 3OBJA 1H25A 5IQHA 4MXOA 3C0GA 4JBQA 3BHYA 4FNXA 2R2PA 2XK9A 4E4NA 4RPVA 4OTHA 2WO6A 3ZRLA 3WIKA 5H2UA 2X2MA 3GU6A 5AUWA 3UYSA 4EQMA 5DIAA 3UDBA 4FL3A 4PL3A 4G3EA 3DBCA 4FKIA 4AGDA 3QZHA 4I6LA 4QTBA 1JBPE 4UB7A 5AM6A 1XBCA 2CDZA 2ETRA 2PUUA 4EK8A 4FEVA 2J2IB 3QRTA 2WIHA 3MIYA 4YJNA 3ORIA 2YWVA 1ZWSA 4WUAA 1GJOA 4K2RA 3CKWA 5F1ZA 3ZEWA 2ITVA 5HORA 1ST4A 3MB6A 3BE2A 5CEOA 2X9FA 1OKVA 4TY1A 1FVTA 2PMIA 1KOBA 3MY1A 4FV2A 4FKQA 1YI4A 5CXHA 4E6QA 4O7WA 3IW7A 3KCFA 3N9XA 2C5NA 3FL4A 4FKPA 4C4IA 4GCJA 5CASA 3H0YA 1L8TA 3ZH8A 2R5TA 5I0BA 3ID6C 2E9VA 3MVMA 1YOMA 3ORKA 4C4HA 5A4TA 3BLQA 4AOJA 3WF7A 3HA8A 4J1RA 3JYAA 4X3JA 2BKKA 1UKIA 3UPZA 1MP8A 2VUWA 4AW0A 1OECA 3VQUA 2WB8A 5DYJA 4AOIA 2O64A 2J0KA 2YAAA 3EHAA 4YJPA 3LQ8A 2WQEA 4B6LA 3W10A 3CGOA 5AMNA 5L4QA 3FLSA 4IACA 2IPXA 5FD2A 3U8WA 2C6EA 2VX1A 3SRVB 3U51A 4FT9A 3GB2A 4EH3A 2O2UA 4AQKA 4K6ZA 5CF5A 2PWLA 4FKLA 2WU6A 3PIXA 4YLLA 5TR6A 4CKJA 3LFCA 3JVRA 4D58A 2UZTA 3R7GA 5I3RA 3W2OA 3WZUA 4CCUA 1H27A 3MYGA 1ZOEA 2BALA 4DGOA 5KMJA 4S30A 5HZNA 3UZTA 1CKIA 1ZYCA 3QQJA 4FKSA 4E73A 1OBGA 3VS4A 4FT5A 4J8MA 2YCFA 1VEBA 3OS3A 3GI3A 5E8VA 3G2FA 5HGIA 3NCZA 4FKJA 3DU8A 3FC2A 4CRLA 3PZEA 3MB7A 3QAME 3L9LA 3R63A 3DOGA 4D4YA 3VAPA 4PNIA 3LLTA 3FZOA 3DNDA 3GT8A 5HIDA 2UW7A 3CJFA 2IW6A 3KMUA 4Y72A 5H8GA 3QFVA 4I0RA 3MESA 5LCJA 5T6KA 5DT3A 1H07A 3RK9A 4YHJA 4F1OA 3B8QA 3O23A 3O7LB 5M44A 3AKKA 2BZHB 3LFSA 1UU8A 2RFSA 3HEGA 5IH4A 1GZOA 2XARA 4EEVA 4NM0A 4D5HA 4MVFA 4FGRA 3IW4A 2WEIA 3DCVA 5L6WL 4ZY5A 2ZV2A 3BI6A 2OZAA 2WTCA 4FYOA 4MH7A 3Q96A 2XF0A 4O0VA 4RZVA 4C61A 1NW1A 1OGYA 4M68A 1Z57A 3D5VA 3ZO3A 2PZ5A 3WZJA 3R9HA 3F9NA 4IC8A 2Y0AA 4W9XA 1E1XA 1VJYA 4KBCA 1PMVA 1YW2A 3AMBA 3G15A 1H24A 5CENA 4PMTA 3TZ9A 3VNTA 4R7IA 5J1VA 4AN2A 4DHIB 1ATPE 1JWHA 3EN6A 4LRKA 3W2QA 3KN5A 4RA4A 5E91A 3BU5A 3PDTA 1W84A 3R8MA 5FM2A 2X8DA 4EONA 4KRCA 3OP5A 5FDXA