4PDPA

Crystal structure of rad53 kinase domain and scd2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
304
structure length
261
Chain Sequence
TGIFKDFSIIATVKKAIERTTGKTFSVKIISKRKMDGVTRELEVLQKLNHPRIVRLKGFYEDSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITAFGLAKVQTLAYVAPEVIRRNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSPLYGDFSQISLSQSLSQQKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase RAD53
publication title Structural basis of Rad53 kinase activation by dimerization and activation segment exchange.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 77
structure length 261
sequence length 304
chains with identical sequence B
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pdpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pdpA01
5M09A 5I9YA 1YOLA 1Y6BA 3OW3A 3LFQA 4FTIA 3OC1A 2H34A 2CN5A 4GUBA 2LAVA 2W99B 4IWQA 5C9CA 3RAKA 2BFYA 4LOQA 4YJRA 4DEEA 4EEVA 4ZAUA 2UZUE 3LFCA 4AUAA 3R9DA 4O81A 3KF7A 1KSWA 2IW9A 3KK9A 3P7BA 4RIXA 5KE0A 4BC6A 3RI1A 3L9MA 2X2LA 4YC6A 4BTMA 4KRDA 3QX4A 5GINE 4OAVB 4DTKA 3QTZA 2ESMA 2WO6A 4ZZOA 4GT4A 3D9VA 4FUXA 3RPOA 1GIIA 3A4OX 4P5ZA 5E8WA 2IZSA 5DOSA 3ZUVA 2IWIA 3EFKA 4PL3A 3SW7A 3PXRA 3FLSA 4ITHA 4BBEA 1ZWSA 1Z5MA 3I79A 5L2SA 1MRVA 5F20A 1ZAOA 3FJQE 1OITA 4GYIA 3C4ZA 3VUIA 3VF8A 4CXAA 3LMIA 4ARKA 2A4LA 2UW0A 2VX3A 5M53A 2IPXA 4PDYA 3ZM9A 3AMBA 2X4ZA 1UKHA 5K3YA 1H0WA 2PTKA 2CLQA 2QLQA 4Z7HA 5HG5A 3LFAA 3IG7A 1XO2B 3VUKA 3W2OA 4L7SA 3F88A 5GJGA 3UBDA 2YIRA 3UIUA 2J0LA 2OJGA 3K3IA 2UZTA 3BCEA 2R3HA 1BI7A 3HA6A 3E64A 3LXLA 4O0XA 3RPSA 4FL2A 3FY0A 1JBPE 4FIEA 5I9ZA 2ZJWA 1PXKA 2BRNA 3MSSA 3VS3A 3R22A 1JSVA 4O27B 4A9TA 1NW1A 3HV5A 2VGPA 3OCSA 4OBOA 5AUVA 3UPZA 1R0EA 3VS6A 1QPDA 2IVTA 2YA9A 4ZZNA 1WBVA 4F9CA 4JOAA 1H01A 2X7GA 3KULB 5FXSA 4D1ZA 3I4BA 3OEZA 3V5WA 2PE1A 4W9XA 3ZFYA 3VW6A 2YM3A 4F1OA 2BTRA 3MN3A 4EORA 3HVCA 4O0RA 3AC8A 4S2ZA 4KA3A 4ZTHA 2BVAA 2X81A 3JY0A 3W55A 2PMNX 3D0EA 3S1HA 1PYEA 2CDZA 5C4LA 4S31A 3MA6A 5KZ0A 3RM6A 1ZYJA 2FO0A 1J91A 1XJDA 4A4OA 4TL0A 5IH5A 2IG7A 4AOJA 3R2YA 2GQRA 4DTAA 3TCPA 3IO7A 3RAHA 4F7SA 5EDPA 4FICA 3DBFA 5FQDC 1EH4A 2J7TA 4E6CA 3CEKA 3QRUA 3TV6A 4DT8A 4N6ZA 4WKQA 4EZ7A 2A2AA 3P4KA 5CY3A 4NJ3A 3EZRA 2YM7A 3U87A 4CEGA 4RX8A 4XG9A 2YZLA 3PXKA 2BRHA 4M68A 1Q8ZA 2PVFA 4IEBA 5BVEA 4RVKA 4B6LA 5A9UA 1ZZLA 4LUDA 3W10A 3R7VA 3TV7A 3R71A 4B7TA 2VTNA 5A4EA 4JDHA 1UNGA 4JL9A 3FHRA 3VHKA 3RHXA 1WZYA 3GB2A 1VYZA 5J79A 2W1FA 4NEUA 4NL0A 2R3KA 3QZGA 4O83A 2ZM1A 3V5PA 4CKJA 3DTWA 4N4SA 4W4YA 2C5OA 4JIAA 1AGWA 4LRJA 4NUSA 4EWQA 2OXYA 2PZRA 4AG8A 3UG1A 3OWLA 2XK9A 4L9IA 4I6QA 3DV3A 5FD2A 2ETKA 2J0JA 3H0ZA 5HTBA 2WIPA 3VJNA 3LFSA 1UKIA 1STCE 3GUBA 4YJPA 1A9UA 5L2WA 2P4IA 3HMOA 5HGIA 3OHTA 1J1BA 2UZEA 4O6LA 1PY5A 4FTRA 4RIWB 4XV9A 4YHFA 3SLSA 4DLJA 1J3HA 5L8LA 3N4UA 3QD2B 3MH2A 4GW8A 2JBPA 4R3RA 3QTSA 3MJ2A 3R8ZA 4FKSA 4ZJIA 5LQFA 4O6EA 4M0YA 3BLQA 1VEBA 4YTFA 5FTQA 1H24A 1OUYA 3FKOA 3VAPA 1O6KA 3ACJA 3NIZA 4CT2A 4D4YA 1Q5KA 3BHVA 4AACA 3V5TA 3RWQA 5C27A 4F9AA 4TZRA 5BNJA 3BV2A 3PWYA 4U9AA 1ZZ2A 4FGBA 4BDGA 4BY9E 4C34A 1Q24A 3U51A 3FV8A 5HCZA 3S95A 4Y72A 4E8AA 4EOMA 1E1XA 1XWSA 4FIGA 3CLYA 3GT8A 1OVEA 2BKZA 2WQEA 3VRYA 3TUBA 4JQ8A 3NAYA 5IQCA 5CEOA 3I81A 4LFIA 4V0GB 4PY1A 3OFMA 2PUPA 4IIRA 4NCTA 3PIXA 4BFMA 3ZS5A 1M14A 2YLEA 3RPVA 5IU2A 3ZC6A 1Q3DA 3PJ8A 4UXLA 5IDNA 4XHKB 3A61A 4AN3A 4NM7A 2VO7A 1JWHA 4S32A 5TO8A 4ANSA 4AU8A 3BZ3A 1YOJA 1YWNA 4L45A 4MXAA 5H8BA 4BKZA 4ANMA 3H30A 2C5XA 2W4OA 4DG2E 4WOVA 4I5HA 4HGSA 4BDHA 1SM2A 3AC1A 4BCMA 5AUTA 2PVHA 4AE9A 2YCFA 5HO6A 3VUTA 3PPKA 3GQLA 4G3CA 2X9EA 1WBNA 5L6PA 5LVNA 3BX5A 4J96A 3O2MA 1R0PA 4QP7A 4YPSA 4DE4A 4JR7A 3AT4A 3OMVA 4EQUA 3E3PA 2GNIA 2VN9A 4F1TA 3R9RA 5HBHA 3HP5A 2JKOA 3VQUA 5HG8A 5FGKA 2CGUA 1WVYA 2REIA 2F7ZE 4I94A 4YJNA 4QMOA 3ALNA 5TT7A 3EYGA 5GIOE 5CSHA 3CSVA 2C6EA 5KMJA 4YLJA 1WMKA 2W5BA 4LV8A 4X3JA 4AWIA 4EH9A 3DQWA 3IDCA 3ZO2A 3KEXA 4D2PA 4F99A 5I9VA 2NRUA 4U44A 4EJ7A 4YZDA 2JFMA 4ASZA 4ERKA 4CLIA 3WZDA 3CPCA 3CE3A 4ACMA 2WMSA 2ONLA 2YIXA 3LHJA 3OUNB 2WFYA 3F9NA 3FUPA 2Z2WA 3F3ZA 4FMQA 3SOAA 4E20A 4F0FA 1UVRA 5DGZA 3Q6UA 4Z9LA 4F6SA 4KAOA 4I5CA 2VTSA 4WIHA 2I0VA 5DT0A 3LFNA 4QRCA 5E92A 5CALA 2GHGA 1Y8YA 5AR8A 2BAQA 2Z7SA 4CRSA 4DH7A 1Q4LA 4C4JA 4N6YA 5BVDA 4TTHB 2W4JA 3O7LB 2OG8A 3NGAA 3KKVA 1IRKA 4PL5A 4XG8A 4GK2A 4O82A 5IMXA 4JQEA 3FYJX 1YWRA 3W16A 3FPMA 4A9UA 1YVJA 4R7HA 2PVLA 1GZNA 3KXHA 4MXYA 4OGRA 3MH0A 4EQCA 1LEWA 4UN0C 3A2CA 2W9FB 4ZS4A 4AGUA 2Z7LA 4APCA 4MYGA 3C4XA 2CKOA 2FSTX 3OXZA 4OT5A 4GK3A 3MFRA 3I1AA 4U80A 2OKRA 3TKHA 4JS8A 5LVPA 4DH1A 3D5XA 3CPBA 3QQFA 3WF6A 1SNXA 2E9NA 4O0TA 4YLKA 3WF9A 3SQQA 5HTIA 4C8BA 3H3CA 4QTEA 3R7YA 3SD0A 3FXWA 2ITVA 4BCNA 3DB6A 5A3XA 1FPUA 2PUIA 3L8VA 2PZ5A 5CU2A 3RCJA 5JH6A 3VUMA 1ZOGA 2G2HA 4DN5A 3NSZA 4R8QA 5HLNA 1OIQA 4XJ0A 5IH6A 4YR8A 4XYFA 4EK4A 5AR7A 1XH5A 1PXPA 3SGCA 1WAKA 3ZRKA 4HVIA 5ETFA 3C5UA 3I7CA 3W2QA 5EW3A 5J1WA 5J8IA 1U54B 1PMNA 4CV9A 4R3CA 3KXNA 2NO3A 3ORTA 4OTHA 3GCQA 3HMIA 5IQGA 2XB7A 4M8TA 3FZOA 3BGQA 1W83A 3A7HA 1DI8A 2IVUA 3RMFA 4AA4A 4AN9A 5AP6A 1Q8TA 4H1MA 4QPMA 4L6QA 5C8KA 4FV7A 3AMAA 4JNWA 4JRVA 5ETIA 2PVJA 1YQJA 4AN2A 4PP7A 5KKRC 4AT3A 3V5LA 5EI8A 2YCRA 1CKPA 2UZBA 4EZ5A 3C4WA 4FKTA 4DGNA 2ETRA 4OLIA 4O91A 3R00A 3QF9A 1J1CA 4BL1A 3CTHA 2X2KA 5CU3A 5D11A 4DITA 2YM5A 5CANA 3Q60A 4EH5A 4EOJA 2CPKE 5C8MA 4FBXA 3VBTA 4E5BA 4YUQA 4TYEA 3N4TA 4BCIA 5ANEA 4YP8A 4FT0A 4WRGA 3LMHA 1XKKA 2XF0A 2WTVA 3PY0A 3GEQA 4IAFA 3E7OA 3R9NA 5JFSA 1H1WA 3QFVA 3Q5ZA 4IB5A 4L3LA 5ANIA 3MJ1A 2WEVA 2VX1A 3CTQA 2WMBA 2BIKB 3R01A 4RX7A 4HYSA 3Q9XA 4CGAA 4IC7A 4NW6A 5E8UA 3PSBA 4QTCA 4ACGA 1VJYA 3BQRA 3MB7A 3KREA 1ERKA 1KOAA 5GJDA 5EM5A 3GGFA 4JDIA 4K33A 5CXZA 5HHWA 3KRLA 2OZAB 3DDQA 2V62A 2VO0A 3FZPA 3PJ1A 2W5AA 2QOBA 4I4EA 4QNAA 5DHJA 3COHA 3D7TA 3ZRMA 3ZUTA 4JBQA 5AP3A 3KRJA 2PE0A 4ANNA 4GT3A 4AZWA 3QUPA 2C6DA 4FTLA 4CFUA 2BZJA 3R30A 3HUCA 4C59A 2JDSA 3DLZA 3NMUF 3UQFA 2UZWE 3CIKA 1SVHA 3ZC5A 3UC3A 4CSVA 1W0XC 2PL0A 4XX9A 5AX3A 2B9HA 4JG6A 3RAIA 4BTKA 5ANJA 4BWPA 3AGLA 5KNJA 4NFNA 4FTQA 2QU5A 3R1NA 4CT1A 1LUFA 2WU6A 3DQXA 4FOBA 4PDOA 2YDIA 4X21A 5DLSA 1OKVA 5F1ZA 3NEWA 4RZWA 3RVGA 5M51A 5JRSA 3VBXA 1ND4A 4E1ZA 1R78A 1JPAA 5EOLA 5B2MA 4LGHA 3PG3A 4BWKA 4DF3A 4L01A 3KXZA 4ONAA 3UQGA 2X9FA 3TNWA 2O2UA 3NVKI 2YN8A 4E93A 2O3PA 4F65A 5IQIA 2C6OA 2Y4IC 3WBLA 3P86A 4XG4A 3BI6A 2JD5A 2XJ1A 5L2QA 4WNOA 4AF3A 1HOWA 4RX5A 3QTUA 4NTTA 4H58A 4YHTA 5ETCA 4EH6A 1XH8A 2W1EA 4PP9A 4IW0A 3U9NA 5IEVA 4U3ZA 4FE2A 1E1VA 2HIWA 1V1KA 4S34A 4R77A 5F95A 5M4UA 4D2RA 2B0QA 4CLJA 3P9JA 4HGTA 2PPQA 5CF4A 3HV7A 3QD3A 2B9IA 2YISA 2JAMA 3R7GA 4K6ZA 3F3TA 3LVPA 4P4CA 4EYMA 4B9DA 5C1QB 2WMXA 4FIIA 3OW4A 3KC3A 4TYHA 4DGMA 4RJ7A 4UZHA 4WT6A 3RKBA 3UMWA 4CFVA 2ZV8A 3E63A 3WOWA 4DEAA 2QCSA 2C0OA 3JVRA 3CKWA 2OIQA 4I20A 4FT5A 5AM6A 2ERZE 2OO8X 2XMYA 3RP9A 4BDAA 5J7BA 3V04A 5A14A 4OTIA 1DAYA 3MYGA 3ID6C 1YDSE 3FZ1A 1MQBA 3TTIA 3ROYA 5A4QA 3PVWA 3KF4A 5A4TA 2ITPA 2E2BA 1IAJA 4BBFA 2Y7JA 4YBJA 5LWMA 4XP3A 4IMYA 2RF9A 4AGWA 4K0YA 3LCTA 4BCPA 4TNDA 3MA3A 4V05A 3MY0A 4XEYA 2ITTA 3JS2A 4MF0A 5DRDA 1BUHA 2V0DA 2X6EA 1REKA 2YJSA 4Y8DA 4OW8A 4AE6A 4B4LA 3TZ8A 1H27A 3LW0A 4PF4A 5E8XA 3NUXA 4HGEA 2PULA 4JQ7A 4OTFA 4IX5A 3VF9A 3BYUA 3ENMA 3BKBA 4JRNA 5L3AA 4MWHA 3ZDUA 1PRYA 3M2WA 3EMGA 3ANQA 3EQDA 4RC4A 2ZM3A 3MGYA 3C1XA 1U46A 3H9RA 2WQOA 3H9OA 4PV0A 3HV3A 2G1TA 4GUEA 4MF1A 3LPBA 4ASXA 4D4SA 4QOXA 4FNYA 3RBWA 4WO5A 3QALE 4G3EA 3CCNA 3DJ5A 3L8SA 4FEQA 4WUNA 2PVYA 4KRCA 3TXOA 4E4MA 4CFFA 5HQ0A 4H3QA 2AUHA 4HCVA 4KD1A 4QQ5A 5CEPA 3DA6A 2QO9A 3OCTA 4FVQA 3OVVA 4BI2A 4C38A 3LCDA 4CTBA 3TTJA 4W4VA 4U97A 3O0GA 1M52A 4EK5A 2UZDA 3EIDA 3KGAA 1JNKA 4C4IA 4CFMA 4DAWA 2R3RA 2R0UA 1OIYA 4L46A 4IAYA 5CAQA 3G15A 4KBKA 3FDNA 2EXCX 5DVRA 3W2RA 3VBYA 3QZIA 3T8OA 3P7CA 5AAEA 1ZYCA 5HVKA 2R3PA 2BRGA 2UVZA 4G2FA 4E26A 2JC6A 3KCKA 4E4XA 5FM3A 3VQHA 2B54A 2XBJA 4LYNA 3GXLA 2QLUA 1JSUA 3ODYX 2BAKA 4A9SA 3GP0A 4DCAA 1CTPE 5HD7A 2ZOQA 5J1VA 3E93A 1P14A 4RMZA 2JLDA 3V6RA 3NUNA 5CXHA 3QD4A 1XBBA 3BELA 3VS4A 4ACHA 4DFLA 3W33A 1DS5A 3ELJA 2VWIA 4QQJA 3VUHA 3MWUA 5ANDA 1PHKA 2WTKB 5JSMA 4I41A 3UPXA 4YJSA 4FKQA 4X3FB 1QCFA 2FUMA 5HIEA 3SC1A 4O96A 4O7SA 1M7QA 1FVTA 4FZDB 1S9IA 4EQMA 2QODA 4MXZA 3HLLA 4X2JA 2PMIA 2QQ7A 3HX4A 1LP4A 4S33A 1P4FA 4IBMA 5E1EA 3ZCLA 1Y6AA 4AXAA 3MIAA 4F9WA 2NRYA 4GIIA 5JGDA 4Z55A 4QO9A 5HG7A 3F66A 4PPAA 3WZEA 4A4XA 5E8TA 3E3BX 3ORMA 1CM8A 4NM3A 3DT1A 1I09A 4TWNA 2VX0A 5B2KA 5TR6A 4FA2A 3PTGA 3KMUA 1F3MC 1XQZA 4ZTRA 4R78A 4KWPA 5L4QA 4AT5A 5IA4A 3GQIA 4NM5A 1V0BA 3VUGA 5F4NA 1Y8GA 4RA4A 2UW8A 5HNBA 1WBSA 3EQBA 2WZJA 4TT7A 3NUYA 4FL1A 4QYHA 3PJ2A 2O0UA 3R8UA 2XIYA 2UW6A 3DFCB 3MPAA 3K5UA 4JT3A 4PMPA 3DLSA 3LAUA 1A48A 3HYHA 3PVGA 3RGFA 4YSMA 4FK6A 3FZRA 5BVFA 4HVSA 3ZU7A 5FTOA 4U8ZA 4BBMA 1XH7A 4ANQA 4M69A 3C5IA 1BKXA 2IW8A 3FY2A 3HRCA 4O7LA 5LCJA 4GFOA 2CN8A 2JFLA 4UY9A 3UOLA 5HG9A 2BTSA 4C58A 3UTOA 5I5ZA 2GSFA 3ZO4A 3AOXA 3UDBA 5IEXA 4TWPA 4MX9A 2QOHA 5AIKA 4MBJA 4RIOA 2WMAA 3NLBA 3FZTA 2GS2A 3FMEA 3RJCA 1O9UA 1R39A 4ZTMA 2ZDTA 3OEFX 2Q0NA 5CENA 2X39A 2C3JA 4G17A 4IZ7A 3UNJA 4DG0E 2OF4A 4RWKA 5EK7A 4DEBA 3PE1A 3LLTA 1FMOE 3WE4A 4JX3A 3GU5A 4WSYA 5EKOA 2GMXA 2CCIA 4KIQA 4CZTA 5AV2A 5JMSA 3Q53A 3NZ0A 2SRCA 3CJGA 3FI8A 4R5SA 4MBIA 4FTKA 2EWAA 5H2UA 5LCKA 4IM2A 1MRUA 4PNIA 3NUAA 5DBXA 3KXGA 1CKIA 4I93A 2JDTA 2VTRA 5BUIA 4P90A 3RK7A 1H1RA 2JDOA 2NPQA 4J52A 4JIKA 3PXQA 3QGWA 3QQJA 3RCDA 3SG8A 5AM7A 4FC0A 4EOKA 5E8ZA 5EM7A 4R1VA 4RIYA 3C0GA 4HCUA 1BX6A 1UWHA 4A4LA 4LOPA 2PY3A 3ZSGA 1NVSA 2BFXA 4KUJA 4PPCA 4DGGA 5FBNC 2XCKA 5HNGA 4D4RA 3PDTA 4LRKA 2OZOA 5I3OA 1M2QA 1TQPA 3G2FA 4FTAA 4EBWA 1JAMA 2IJMA 4IC8A 4UX9A 3RNIA 4YTCA 4G9CA 3BYMA 3H10A 4JG7A 3V8WA 2BPMA 3CQEA 2XIRA 4ZY5A 2QOIA 4BCJA 2XNMA 4H39A 2YWVA 3QCXA 2PZIA 3PA5A 4DTBA 4FTCA 3K54A 2XNNA 3FI4A 1RW8A 4MXXA 4RC3A 3ET7A 3HDMA 3N9XA 4KSPA 4MD7E 5HE3A 4USEA 4ORKA 2RIOA 4KABA 1MRYA 3BHYA 4DBNA 4EOLA 2ACXA 3C50A 2ITQA 4YTHA 4D2SA 3RM7A 1P5EA 1UU3A 4RA5A 3NCZA 1K9AA 4MTAA 3LKMA 1SYKA 2Y0AA 3NNVA 3O7LD 1PXIA 3CD3A 3E7VA 2YDKA 3R02A 5LMKA 3Q2MA 4BHNA 4LOOA 4L7FA 2JDRA 4QMNA 3VBWA 3TIZA 1NT2A 3DXQA 4CMTA 4U79A 4XUFA 5D7VA 4DFUA 4OT6A 3IW5A 2OK1A 3LCKA 3C51A 3KU2A 3LFFA 2RG5A 4B8MA 2IO6A 4FV6A 4BYIA 4YMJA 5AP2A 3EQGA 1JSTA 1K2PA 4AS0A 4O7NA 4M84A 3EB0A 4CTCA 2J50A 4YJQA 3A8WA 1PF8A 4C4FA 1WBWA 5B7VA 4CMUA 1BL6A 3BYSA 3G90X 4Z3VA 2QO7A 2OJJA 3DBQA 3PG1A 4K18A 3IW6A 4XMOA 2HELA 4U3YA 4WG3A 4BCHA 1JVPP 4HJOA 3BPRA 4X6RA 3DGKA 2WQMA 3R0TA 4QT1A 4OBPA 1IR3A 5HI2A 2E9VA 5ANGA 3AD4A 4TYGA 4FODA 4WD5A 4FSYA 4GRBA 4IXPA 3WYXA 3MVLA 4Q5HA 3OP5A 3UVPA 3JYAA 4EHVA 3WZJA 1UU8A 3HGKA 1Q61A 2F4JA 5IZFA 4DFNA 4D0XA 4U81A 5IEYA 3TNIA 2C47A 3PZHA 4NIFA 5H9BA 4A9YA 4CVAA 3LOKA 5M08A 1PXJA 3FYKX 4PQNA 3ZHPC 1KE7A 4BIBA 2VNWA 2ITWA 3DFAA 2C5YA 5CEIA 2IVSA 3QLGA 4O0VA 3ZFMA 5J5TA 3BLRA 5B2LA 2EXEA 2VNYA 3ZLYA 4YPDA 5KMMA 4QPAA 1AQ1A 5BPYA 4G5PA 4EK8A 3IOPA 3PYYA 3IPHA 2EB2A 2JBOA 3F2NA 4FNWA 3PVUA 4I21A 4U0IA 4XS2A 1R1WA 3VBVA 3O71A 4ANLA 2NNWB 3R04A 4H3PA 4IWOA 4O1PA 3PP1A 4ZP5A 2OFVA 4YJOA 5CAUA 4BKJA 3E8NA 2FH9A 3OWKA 3NX8A 2OGVA 3P1AA 4N70A 3O96A 5KX8A 4I6FA 3BLHA 3LXPA 4O7WA 3PWDA 3R1YA 4ACCA 3ORPA 3HKOA 4DT9A 3NUPA 4IDVA 3KMMA 5I9UA 5I4NA 1ZXEA 1Y91A 5A6NA 4O0YA 2B55A 2ITOA 2VRXA 1SVEA 3KMWA 2VTHA 3F3VA 5CLPA 2XZSA 2G15A 4M13A 3QTQA 3H0YA 2WOTA 1R3CA 4PUZA 3ZLWA 4C3RA 3PPJA 3ZMMA 3RPRA 3FQEA 5CTPA 2WAJA 5AUWA 4UWCA 4QMXA 2R2PA 5ANOA 3QRIA 2VD5A 3QTXA 5CWZA 4GH2A 5J9ZA 2W1DA 3IOKA 3A8XA 3U6JA 4UMUA 3GENA 3EQFA 4JXFA 1XR1A 3GU8A 2Y6MA 3LCOA 4FG7A 3BE2A 4U7ZA 3TACA 4BCKA 3DZOA 4EHGA 2ITZA 1KV2A 3DU8A 4F4PA 3GOKA 4C36A 2QO2A 2QURA 5HKMA 3SX9A 2UW9A 3TI1A 4RWIA 2ZB1A 3WIGA 4EKKA 2QG5A 3BYOA 2J4ZA 5FP5A 3HAVA 3QL8A 3EN4A 3EQIA 2BDWA 4EOSA 2UV2A 3TT0A 3LXKA 2OI4X 4J8MA 1CKJA 3JY9A 3ZRLA 3TJDA 1OECA 3C4EA 4NK9A 5AP5A 2CKEA 5IA3A 3Q9YA 3SRVB 5K0KA 5EM6A 4JI9A 2OU7A 4X2FA 2QOQA 3NS9A 4HGLA 5DA3A 4R5YA 3ITZA 3P79A 4FVRA 4R6VA 5KHXA 4JDJA 4Y85A 1CMKE 3ENHA 4L67A 3Q4CA 3AMYA 4QMYA 3P0MA 5DPVA 4R7IA 3OS3A 5AP0A 5LMAA 1H0VA 4USDA 4XLVA 2X0GA 3TN8A 2OIDA 3MY5A 2BROA 2YCSA 5AJQA 4BDJA 2GU8A 5EHLA 4DCEA 2V55A 3HP2A 4FKWA 3NVMB 1WCCA 2O5KA 2OZAA 4I6BA 4RJ3A 4EJNA 4RLKA 5K0XA 5T6KA 3D4QA 3IW7A 4KKEA 3NWWA 2FVDA 2VTOA 1OM1A 2ZMCA 1YKRA 4LG4A 4I5MA 3IW4A 3PZEA 1YXTA 4NCTC 2RFEA 3L9NA 4R1YA 3W2CA 4B0GA 1RQQA 3EQCA 4FKJA 4TWOA 3SV0A 2V5QA 3FKNA 4C3FA 2QHNA 3C13A 4D2WA 4E6AA 5IISA 4L42A 4CCBA 3GU6A 2B9JA 3KB7A 3N51A 4PRJA 3THBA 4RFMA 4D5HA 4U45A 5M4FA 3HAMA 3L9LA 3POOA 1YRPA 3K5VA 3ODZX 3NAXA 3FMJA 3NW6A 4PTEA 2WMQA 2YABA 2XK6A 4MXCA 5IQBA 4NYEA 4BDDA 4C37A 5D10A 4FSQA 3SW4A 1CDKA 3HRFA 3EFJA 3QRKA 2W1ZA 3BBWA 3OZ6A 2XBAA 3DK6A 4EOPA 5EFQA 3Q9WA 4UBAA 3CXWA 4QP9A 2X6DA 3OOMA 5I0BA 3MDYA 4NWMA 5IPJA 3WE8A 1PKGA 3LFEA 2DYLA 5FRIA 3DTCA 2GQGA 2QOCA 1XH9A 2FSMX 3FQHA 4BF2A 3WARA 2UUEA 2XEZA 3PRFA 3LLAA 1OPLA 4O1OA 3EN5A 3KA0A 1GOLA 4IB0A 3T3UA 2CGVA 2HXLA 1FVRA 2R3IA 2XM9A 3ALOA 4O7VA 4BDCA 3U9CA 2J0MB 4UB7A 3JUHA 4ZY4A 3ZSHA 2XM8A 5HNIX 1H8FA 2C6IA 2WOUA 1H28A 3QC4A 4EUTA 4ZLZA 2WD1A 2QG7A 3PJ3A 3QRTA 4FKPA 4AW1A 4U5JA 4Y73A 4Y83A 1L3RE 2GFCA 4WNPA 3OWJA 4BGGA 4YU2A 3UVQA 1GIHA 3HEGA 3PUPA 4QP3A 4DEIA 2ONLC 2BZIB 2R3FA 2ZM4A 4AAAA 3MIYA 4YHJA 4LRMA 4IH8A 4TY1A 4GJ2A 5HVJA 3LM0A 4J97A 5CF8A 1FBNA 5M4CA 5E90A 2CNUA 2VWWA 3B8RA 3WIKA 5EW9A 3V51A 1YHWA 5LMBA 4O22A 4O0UA 4EYJA 3QXPA 3RZBA 3TNPC 4AW0A 2JGZA 4OTGA 4FKIA 4WRSA 4FG8A 2HY0A 1H25A 5KO1A 1NY3A 3RINA 5AUYA 4FIHA 3PIZA 4XG2A 1FOTA 2OSCA 3LJ1A 3PXFA 3ZEWA 5LOHA 2C30A 5EQYA 5HU3A 4W8EA 3LQ3A 1H1QA 4TN6A 5AUUA 3L9PA 4I4FA 1ZYLA 4OAUC 4G3FA 2R3GA 4XBRA 2W17A 4JBOA 5CT0A 1Q8WA 5LVLA 3WF7A 5DH3A 5HVYA 4ZSJA 1QPCA 4KB8A 1YDTE 4QPSA 4KS8A 3QUDA 5K5XA 5L8KA 5J9LA 3KRRA 2XYUA 3MY1A 3MTFA 3BEGA 3AC4A 3BHHA 1JLUE 3G9LX 3KRWA 3MW1A 4L44A 5BX0A 2XS0A 4IAAA 1Y57A 3S3IA 5F94A 2XNBA 3ZOSA 5JKGA 4GS6A 5JQ5A 1PXNA 3FLQA 5HCYA 2ZB0A 3WI6A 5IQHA 1FVVA 3K3JA 5GZ8A 4HZSA 4YZ9A 2YAAA 2EB3A 1TVOA 3DJ7A 4CQEA 3EZVA 3EFWA 3DB8A 4X2KA 4Y95A 3AC2A 5CZHA 5CU4A 3BRBA 2QOLA 4QTAA 1OIRA 5DYJA 4LL5A 4ZEGA 4KIPA 3FI3A 3QRJA 4FV8A 3OT3A 2R64A 2JEDA 2VWXA 3CD8A 2GCDA 4GG7A 4FSZA 5DI1A 1LEZA 4OTQA 5L2IA 4NZWB 4TW9A 5GIPE 3O23A 2O8YA 3L8PA 4RJ6A 4MWIA 3SAYA 4CG8A 4W9WA 4IDTA 1E9HA 3W1FA 4LI5A 4G6NA 3DAKA 4O0WA 3ORLA 1F0QA 1M17A 1OUKA 1NXKA 2J51A 1URWA 3ERKA 1FQ1B 3W2PA 2JIUA 2GFSA 4MBLA 2YIWA 4AOIA 3V5QA 2HWOA 4NKSA 3LQ5A 4BN1A 2GDOA 3BU6A 1RDQE 2XYNA 4XH6A 4MQ1A 1W98A 4ZSAA 4NSTA 4I0RA 2GHMA 4UALA 3LMGA 2AYPA 5HIDA 4F70A 5DEWA 2P3GX 3POZA 1M7NA 4GK4A 1IAHA 4DLIA 3TZ9A 3A99A 2PWLA 3CR0A 4MNEB 3O8PA 4J95A 2QNJA 3DPKA 3MFUA 3ORNA 4FF8A 3KN6A 5KZIA 4BI0A 3OOGA 2BKKA 2CGXA 2C6TA 2O65A 3QX2A 4GIHA 4AZEA 4DEDA 4RGJA 1P2AA 2QONA 3CS9A 4BKYA 5CI7A 4O2ZA 4HNIA 4Y5QA 3TV4A 3Q32A 3FL5A 4QP4A 4GL9A 5CEQA 2ERKA 1IASA 1G8SA 2WMUA 1WBOA 1NVRA 3PFQA 3UYTA 1UV5A 4BICA 4FYNA 2HY81 2XH5A 4ALWA 5IA1A 3D5VA 4O7TA 3KN5A 2W1HA 4FKVA 3BGZA 3UO6A 4F6WA 4CYIA 2GNFA 1APME 4BIDA 4FTOA 2FSOX 3ZUUA 4O84A 4LL0A 3EHAA 1Z57A 4IACA 3ZXTA 4WNMA 4EBVA 5A4LA 4QP6A 2HK5A 1H1SA 5HD4A 2UW5A 2HZ0A 4KIKA 3EJ1A 2ETMA 4PL4A 1UWJA 2OWBA 3NYXA 3NW7A 4U41A 4D1SA 5FXRA 3OY1A 3U6IA 2V7OA 2J6MA 2PHKA 4Q5EA 2W06A 3O17A 4YZCA 2J5FA 4Y46A 3R63A 1V0PA 3I60A 4XG6A 4NT4A 4HYUA 4FTTA 2XJ0A 2Q83A 4UXQA 3C0IA 1VZOA 5BVOA 4FT7A 2XA4A 2JIIA 4MD8E 4X2NA 4DGLC 3B2WA 3GOPA 4QMLA 3GC9A 4XP0A 2I6LA 5EYCA 3QUEA 4QYYA 4EH2A 3M1SA 3EKKA 5DE2A 4L52A 2C68A 2QVSE 3A7FA 3I7BA 4FZ6A 4MVFA 3GVUA 4G6OA 5FBOA 4ZXTA 3NIEA 5CASA 2GTMA 2YIYA 3PY3A 4YSJA 2XRUA 5EM8A 4C61A 4FOCA 2XK8A 2XNPA 4GCJA 3MPTA 2GNJA 3EL8A 2F2CB 4EKLA 5HBJA 4M14A 5K5NA 2OBJA 2OFUA 4JJRA 5FEDA 4D1XA 2RG6A 4MXOA 3OBJA 3CQWA 3UZPA 3ZM4A 4FEWA 2GQSA 4J98A 5AV4A 5KMNA 3HZTA 2OJ9A 5IG1A 1KE5A 4YTIA 5ACBC 5A46A 4E5AX 5JN2A 3HNGA 5IQFA 3E88A 4J99A 3NYVA 2UZVA 3KXXA 3QKMA 4EONA 3RZFA 3MH1A 1Q8YA 4BDFA 5IF1A 3FSFA 1JOWB 2WTDA 4BB4A 4D0WA 4FTJA 3E92A 2QR7A 2PU8A 2KTYA 1JKTA 2C6LA 3QHRA 3S4QA 5KKRB 2P2HA 4CYJA 3QWKA 4RJ5A 2PE2A 3FQSA 2H96A 4FIJA 5CSPA 3EN9A 1MP8A 3B8QA 2R3MA 3G6HA 2GNGA 4NJDA 2QD9A 4ZY6A 4D58A 5BQ0A 3MFSA 3F5UA 2VTLA 4I6HA 4CFXA 4L00A 5H8GA 4C62A 4RJ4A 4GJ3A 5C03A 4BGHA 4QMTA 3D15A 2WMRA 2VTPA 2YITA 2YDJA 4BZOA 3QQGA 4L8MA 4FKUA 3CY3A 1OPKA 4MQ2A 4NH1A 4IFGA 5FEEA 3OROA 3NYNA 3PLSA 4IX3A 1H1PA 1KE9A 3TWJA 2RFDA 3DK7A 3IDBA 4FT9A 5BVWA 1OPJA 1REJA 3QGYA 4B99A 4DFBA 1BL7A 3HMPA 3G0FA 5AV1A 2C6MA 4EH8A 2Y6OA 2XNGA 4RWJA 4U43A 4MHAA 1DI9A 3O8UA 5AR3A 3TNHA 2ZDUA 4CG9A 3MVHA 4G3GA 2HAKA 3C0HA 1HCLA 5E91A 2WNTA 3NNXA 3SKCA 1QPJA 1G5SA 2BILB 3HMNA 1TKIA 2HW6A 3FL4A 1RE8A 2J5EA 4J53A 4AGDA 4QTDA 4ASEA 5DR6A 4V01A 5KCVA 2UW4A 3MBLA 4E7WA 5IMEA 5TE0A 4ZJJA 2YHVA 2XNEA 1PXLA 2CMWA 3KULA 4PTCA 2VZ6A 2XIKA 2PVNA 4IZ5A 2YEXA 2HW7A 4NFMA 1FINA 4CNHA 2GNLA 1OGUA 5GZ9A 3R9HA 3QWJA 3RWPA 3AT3A 4FI1A 4FR4A 4EOQA 3EN7A 1ATPE 3UIBA 3VWAA 3TDVA 3ZLSA 2YWPA 3F61A 5M57A 3VO3A 4IX6A 2PVMA 5DN3A 5JGBA 4R7BA 2HENA 2XP2A 2ZV2A 3D5WA 3UNZA 4YNOA 3UYSA 3BU5A 1Q97A 1YXSA 2AC5A 2WTWA 2HOGA 3D7TB 4K9YA 2C5NA 5AMNA 1OL1A 5CAVA 1Q3WA 3QKKA 4GMYA 5EDRA 3UIXA 2Y4IB 5HE0A 3RPYA 5A6OA 5IUGA 4BR3A 4BRXA 1SVGA 2ZVAA 4QMSA 1ZLTA 4ZZMA 2X7OA 5FTGA 3PP0A 3IK3A 4GU9A 4RVMA 3VNTA 3FMKA 4FSNA 4LMNA 1WVWA 4EH4A 1JKKA 4UMRA 3KRXA 2PMOX 4FKRA 2GHLA 4G3DA 3BEAA 3BU3A 1SZMA 2CJMA 4RQVA 3QBNA 3VC4A 3ZYAA 4CD0A 4RZVA 2R3OA 4M15A 3SDJA 4OTPA 3TNQB 2BRBA 4IVAA 1PMEA 3ORXA 2W1GA 4JX7A 3ZO1A 2R4BA 5CF6A 3AD5A 2CNQA 4D9TA 3UP2A 3PIYA 4FG9A 3G9NA 3FMNA 2EXMA 5BYYA 3G51A 4ZTQA 3UODA 3F5PA 4I0SA 5GZAA 5J5SA 3FMDA 5FP6A 1Q8UA 5AP7A 2J2IB 3LE6A 3E87A 4RIWA 5EYDA 2OF2A 3QZHA 5CSXA 5HTCA 1M2RA 4GSBA 5JZNA 5CAOA 5F9EA 4GT5A 4IM0A 4XV1A 1H07A 5CNNA 2CSNA 3DKFA 4P7EA 2R3NA 3B2TA 3E8CA 3MV5A 4Y5HA 4YBKA 5J7HA 5LVOA 2VV9A 4N57A 1SNUA 4PMTA 5CZIA 5CX9A 4IJ9A 2Z7RA 3NR9A 3I5ZA 3QCSA 4KINA 4ENYA 3NDMA 4UWBA 5HE2A 4XG7A 4AFJA 3AC3A 4MNFA 4TYHB 4FV4A 4UMTA 3QTWA 2BCJA 3CJFA 2C3IB 2I0YA 4UV0A 4CRLA 1KWPA 4ID7A 4J7BA 5DIAA 5FDXA 3MH3A 4FKGA 4LQMA 3ULIA 1HCKA 2UZOA 5E7RA 3V6SA 4PTGA 3QQUA 4V0GA 3R6XA 4R3PA 4BWXA 4QQTA 3MVMA 3QCQA 3R7EA 1U5RA 3DXPA 3R28A 4FSWA 2A1AB 5C4KA 4PMMA 4U40A 2PK9A 1XBCA 5JQ8A 4LUEA 3A7IA 5TF9A 5DR2A 3SG9A 3VHEA 2Y4PA 2JKQA 2WQNA 5EYMA 4IJPA 4HVGA 4GU6A 3UZRA 2KULA 2J90A 4GKIA 4TYJA 1YI4A 4G1WA 4ZLYA 2BRMA 3QCYA 4RVTA 1OI9A 2RFSA 4FKOA 4EHZA 3ATSA 3RNYA 1PMUA 3KL8A 3VN9A 1ZY4A 1FGIA 4YZNA 5LARA 4LM5A 5CVFA 4ANBA 3U54A 4NTSA 2JIVA 2VWBA 4KKHA 4QP1A 2R7BA 2UZLA 4WHZA 2PZYA 4WG4A 4L43A 4E73A 4FL3A 3LZBA 3DY7A 3P23A 5JFWA 5JK3A 4UWYA 4O7ZA 4EOOA 1ZOEA 5IQEA 3I0QA 2F9GA 4H3BA 5IUIA 1GZOA 2W0JA 4BGQA 2Z7QA 3H9FA 4S30A 4YGAA 4UMPA 5L2TA 4BTJA 5TOZA 1WFCA 3FE3A 5EHOA 2E9PA 3BBTB 5FLFA 4O38A 2GS7A 3HUBA 4K8AA 3W32A 3NRMA 5H3QA 3HV6A 2F2UA 1B6CB 2HXQA 3R1QA 4G9RA 4HYIA 2G01A 2WXVA 2WB8A 3FMHA 5AV0A 4C33A 4DFYA 3C7QA 4HVDA 5DNRA 2JAVA 4DEHA 5IA0A 1YHVA 4O7YA 3KY2A 5FXQA 3R7UA 3EQHA 4JG8A 3DCVA 4DA5A 4M12A 5BYLA 3DBCA 5CS6A 5HIBA 2QOKA 3QQHA 2H6DA 2OLCA 4NM0A 4F09A 4DHFA 3OUKA 3VJOA 2Q0BA 1B38A 4IM3A 5BUJA 4ANOA 3CTJA 2JITA 3D7ZA 3AC5A 2WGJA 4JDKA 5C8NA 5KHWA 2BDFA 5AR2A 2C1AA 2WQBA 4IWDA 5AP1A 3CKXA 3U8WA 3AXWA 3OD6X 4BVUA 1UA2A 1VYWA 3TM0A 1OKYA 4G5JA 2YIQA 3TKIA 4CZUA 2C4GA 4AX8A 1FMKA 1CSNA 3HMMA 4IVDA 4C2VA 3GFWA 1V0OA 2IZUA 2I0EA 1L8TA 2A27A 4K77A 1W8CA 5LMKC 1YXVA 4TRLA 4DINA 4ZMEA 2R3LA 2W9ZB 1J7UA 5D41A 3Q5IA 4E6QA 4IAZA 1DM2A 3MI9A 5LJJA 3DXNA 2VO6A 5EI6A 2UVXA 2UW7A 3QYZA 1A06A 5FM2A 3BGPA 2F49A 3SVVA 2VU3A 4P2KA 4FTUA 3ZDIA 5HLPA 3OCGA 5AIRA 5B0XA 2XIXA 4AZSA 5KMLA 4DBXA 4FVPA 2I1MA 5ANKA 3OG7A 3PVBA 4RT7A 5HEZA 3WILA 4M3QA 1U5QA 3ZLXA 4C4HA 4CFWA 2UW3A 3F82A 2WMVA 3GC7A 4MAOA 2GTNA 3R7OA 4WA9A 2E9OA 2CCHA 3E5AA 5CVGA 2W05A 4FTMA 5BMSA 4ZOGA 4FEUA 5BYZA 3M11A 2GNHA 1OB3A 4PMSA 3COMA 4ENXA 4QMQA 5CU6A 5FG8A 3VS1A 5AUZA 2IVVA 3FLNC 4ZSEA 3PE2A 3LCSA 2G2FA 3PA3A 4KBAA 3VW8A 4YO4A 3QQLA 5M07A 2YCQA 5HBEA 4FV1A 3ZFXA 4HNFA 4IX4A 5DFPA 5CVHA 3DZQA 2YM6A 3Q4ZA 1P4OA 2CLXA 3FZSA 3VUDA 1Q99A 1U54A 3G0EA 3RTPA 1BI8A 4FZ7A 4FUYA 4D2VA 2VWYA 4XCUA 4TYIA 4A06A 4AZTA 5AA9A 5IH4A 3QKLA 4O2PA 3E8DA 4TPTA 3LIJA 1Q41A 1YI3A 3TZMA 2F57A 3CP9A 5AFVA 4FIFA 5E9EA 4M69B 3EKNA 5JFXA 5H8EA 3UZTA 5GJFA 4DH3A 4G6LA 2B53A 2J9MA 3GI3A 3GU4A 3O50A 1YDRE 4BDEA 4QYGA 3NUUA 3F2AA 4I0TA 4AZVA 2NP8A 2YERA 4KIOA 4LMUA 5EQEA 4L3JA 1W84A 3LXNA 4QYEA 4RPVA 4X0MA 2C69A 5CEKA 5HU9A 3NPCA 3IW8A 1GY3A 3CQUA 4IAKA 1J7IA 2H8HA 2W96B 5DRBA 4QMVA 3PSCA 4ZTSA 2B1PA 5D12A 4I5PA 3DJ6A 4XV3A 4YZBA 4PDPA 3O51A 2XEYA 4EUUA 2OH4A 1UNHA 4BI1A 2FA2A 2XUUA 5D9HA 4GG5A 3QXOA 2BALA 2C0TA 4EC8A 5JGAA 2YZAA 3CGFA 5EDQA 4IZYA 2XJ2A 4BYJA 5GNKA 5J87A 4FV0A 4M66A 1YOMA 2ITYA 4FX3A 4WSQA 2BAJA 5FWKK 3UMXA 4AP7A 5CEMA 4ZIMA 3ZONA 3ZH8A 3S00A 4EC9A 3H4JA 5DT4A 2DS1A 2GPHA 2UZNA 4C02A 4BCQA 4DFXE 3AQVA 4OUCA 5DWRA 4HOKA 1LR4A 4K11A 4HPTE 4FKLA 5DEYA 4PWNA 2PMLX 1OL7A 3GCPA 4RIYB 4KNBA 4RIXB 4V04A 4O0SA 4M97A 4ZSGA 1KV1A 4EK3A 4XLIA 2O63A 4EH7A 4NU1A 4MNEA 3DS6A 2OW3A 4F64A 3F3WA 4JLCA 3QYWA 5JT2A 3KVXA 3QTRA 2BUJA 4YURA 2JKKA 3II5A 3RALA 3UOHA 2B7AA 4QD6A 3OT8A 4MEDA 4YZMA 1OL2A 4J1RA 2YM4A 5L8JA 1OKWA 4BCOA 3GU7A 2QHMA 3G33A 5AWMA 3DKCA 4CKRA 4AQCA 2BZKB 2PVRA 1X8BA 2HYYA 2VWUA 2W5HA 4F6UA 3LM5A 3CY2A 3A4PA 3UJGA 4BIEA 2W1CA 3NW5A 3P78A 5LWNA 3QA0A 3HL7A 2FB8A 5L6OA 5IUHA 5FDPA 4EH3A 5AADA 4FEXA 5E1SA 4YJTA 4RFYA 4HYHA 3EL7A 4LGDA 4OTWA 1OBGA 2YACA 1T45A 3OBGA 4RSSA 4YNEA 3SOCA 2BDJA 5IQAA 5EKNA 3COIA 2I0HA 2XK4A 4WBBB 4C0TA 4W8DA 3P7AA 2GS6A 3O8TA 3SXFA 2JKMA 2VTJA 3L8XA 1S9JA 3ZZWA 4CFNA 3R8PA 4J71A 3JR1A 4AT4A 1OMWA 3DNDA 3MFTA 3BQCA 3F5XA 4QMUA 1OL5A 2UVYA 2HZIA 1W7HA 2QKRA 4IB3A 3S0OA 4IVCA 3ORZA 2CNVA 4IZAA 5KUPA 2WTJA 3GC8A 4AW2A 4C4GA 1U59A 2VTIA 4F7NA 2R9SA 3DKGA 5JRQA 3JXWA 3CBLA 4D28A 3ZBFA 3G6GA 4YJVA 4AA0A 4ZK5A 4JAJA 3TEIA 3LQ8A 3U4UA 3UOKA 1T46A 3R8VA 4G34A 2PUUA 1H4LA 3ZZEA 1KE6A 2VUWA 3COKA 4AZFA 4F7JA 3ULZA 5HOAA 3UE4A 4QMMA 4BCGA 5J9YA 2C1BA 3R73A 1IG1A 3FLZA 4EZ3A 4TNBA 3UGCA 2ITXA 2OICA 4N0SA 4U42A 3D2IA 4FT3A 2C3LA 3KQ7A 4UEUA 5D7AA 4KKGA 4QYFA 4CMOA 2FSLX 4PPBA 4BCFA 4MD9E 4NIFB 2HWPA 2ZV9A 5ACKA 1OL6A 4RC2A 2WMWA 4RWLA 2ITNA 4D9UA 5M4IA 5C26A 3WZUA 3UNKA 4NKAA 5LXMA 4EI4A 3MVJA 5KBRA 1GNGA 3OCBA 4FSUA 2PZPA 2EVAA 2WMTA 2YFXA 4FV5A 4MCVA 3ORKA 4XG3A 4A9RA 3D94A 4PNKA 2R3JA 3CC6A 3GFEA 2A0CX 5D1JA 2IN6A 1MQ4A 3OWPA 3F69A 3EFLA 4K2RA 1IEPA 4FYOA 3FI2A 5DG5A 5I3RA 4FV9A 2OH0E 3V01A 3T9TA 4QP8A 3W8LA 2QI8A 2HZNA 2G2IA 5CYIA 4ZSLA 2CGWA 5FUTA 2RSVA 4RFZA 3BWJA 4ERWA 3QTIA 3LFBA 3OXIA 3V5JA 1IA8A 3BWFA 3K2LA 4ALVA 2WHBA 3EYHA 2XK3A 5ITAA 1YHSA 5CI6A 4XBUA 2VO3A 3QU0A 2WIHA 3JVSA 3W2SA 2VWVA 2BZHB 3R21A 3D5UA 3ZBXA 4DH8A 2X7FA 1WBPA 3EQPA 3ORIA 2OJIA 5EW8A 3G5DA 1O6YA 4OTRA 3U6HA 4FK3A 5LVMA 1QMZA 4AOTA 4FSMA 4W4WA 2XNOA 3BE9A 4UMQA 3C4CA 3FC1X 3ZXZA 4F0IA 3ZO3A 2QC6A 5M44A 2A19B 4RX9A 3TDWA 1YXXA 5AAGA 5CNOA 5ICPA 5KMOA 3R8LA 2OIBA 3VBQA 3U55A 3KXMA 5BVKA 2XKEA 2QU6A 3PXZA 4I3ZA 5E8VA 5ETAA 3AGMA 5A4CA 3SHEA 3F2RA 2VTAA 3GBZA 5K4JA 3ETAA 3EN6A 3IQ7A 5CQWA 2CKQA 3DOGA 2X8IA 4IFCA 4JR3A 4WNKA 3UVRA 3MTLA 3VIDA 4D55A 4QNYA 4C4EA 2P55A 1ZYDA 4YLLA 5JEBA 2X4FA 2VTTA 4I92A 3DKOA 4OR5A 4X7QA 2ZV7A 4G31A 3VULA 3R2BA 2H9VA 3ACKA 5CT7A 4CV8A 2XKFA 4X3FA 4D2TA 3Q4UA 3FWQA 3FLYA 3P5KA 2QR8A 2J0IA 2R7IA 2Y9QA 1KE8A 2BHEA 4M7IA 2P33A 1YXUA 4GEOA 4G16A 2WPAA 3OXTA 3U4WA 4QTBA 3Q96A 1QPEA 4FGRA 4C3PA 4II5A 5JZJA 3HA8A 3VRZA 4OTDA 3SA0A 3PSDA 4DEGA 4X2GA 1PJKA 3R83A 4B8LA 5CAPA 1TQIA 2CHLA 2ZMDA 1BMKA 3EQRA 2W4KA 3AD6A 4UYAA 2I7QA 5G6VA 4EOIA 2DWBA 3W18A 4XRLA 4HPUE 4F7LA 2RFNA 4FNXA 3IKAA 3PJCA 3IONA 3UC4A 4ITJA 5HO8A 1G8AA 4O21A 2WTKC 4QP2A 4RRVA 2PYWA 3IS5A 3QLFA 2EU9A 3TL8A 4U6RA 3T9IA 4X3FC 1K3AA 3MS9A 4M67A 3MESA 4P5QA 1JKLA 4MKCA 1PW2A 3NCGA 3T3VA 3WZKA 4E4LA 2QKWB 2YLFA 2BIYA 4DC2A 4O7RA 4EL9A 2FGIA 3OTVA 1PKDA 5E8SA 2Y8OA 3RHKA 4GVAA 1UU9A 5CSWA 4C7TA 5IA5A 2V7AA 5EQPA 3R8MA 2DUVA 3V8SA 3KCFA 5AX9A 2RL5A 3A62A 4PDSA 5BMMA 3V3VA 4IB1A 5FEQA 1PXOA 2XKDA 3UO4A 3ZEPA 2W1IA 5HLWA 5HX6A 1JQHA 1NA7A 3DAEA 3QQKA 4Z16A 2WTIA 1G3NA 1Z9XA 2PSQA 3I5NA 5CF5A 2C0IA 4RJ8A 3WYYA 1OKZA 3DBEA 5HO7A 2Z02A 4DGOA 1BYGA 2Z8CA 2X8EA 3Q4TA 1SMHA 1GIJA 3DK3A 4ASDA 4I1ZA 4H05A 2VGOA 4IQ6A 2I40A 2XVDA 1NVQA 3EOCA 3KVWA 4YO6A 4GVJA 4BHZA 4ZJVA 3Q3BA 4YC8A 3QA8A 1AD5A 3BHTA 3R1SA 3FHIA 5IDPA 2WEIA 4FSTA 4ZMFA 5BVNA 4A07A 4E5WA 5HORA 4ALUA 5BUEA 3IECA 4AW5A 5AEPA 3Q52A 4FEVA 5I9XA 4HZRA 3PXYA 4XRJA 2X8DA 1XHAA 4IADA 3F7WA 2XIZA 3VS0A 1ZOHA 3GC0A 5K9IA 4IANA 1W82A 3QZFA 2X2MA 3OTUA 3PY1A 4EWHA 3LJ0A 3BYVA 2BR1A 3DBDA 2LGCA 3HRBA 4UYNA 1Q62A 4Z7GA 2WTCA 4MK0A 4F0GA 4I22A 5AR4A 3DDPA 3PLAE 4K1BA 4TXCA 5GHVA 4CCUA 4YJUA 3E62A 4BDKA 3CGOA 3TZ7A 1WBTA 4M0ZA 4DYMA 5K4IA 1RJBA 3WF5A 3P08A 3LFDA 5AP4A 4GYGA 4DFZE 4E3CA 5HZNA 1XH6A 3GNIB 4IHPA 3ROCA 1U4DA 2P2IA 1J7LA 1GZ8A 2ZYBA 5AUXA 4KBCA 3NUSA 1BLXA 3F6XA 4AA5A 4Q9SA 3I6WA 4FSRA 4ITIA 4QMZA 4BZNA 2XCHA 4E4NA 4IWPA 2VWZA 4FZFB 3ATTA 1ZYSA 4OBQA 1ZMUA 2B4SB 5EI2A 2YAKA 3FSKA 4RLLA 5DR9A 1I44A 2F7EE 3W8QA 2OXDA 3IGGA 5I9WA 3QC9A 5L6WL 4NW5A 2B9FA 3D83A 4C35A 4Q2AA 4XOZA 1YI6A 5EOBA 2IZTA 2IW6A 4AGCA 1UNLA 1ZMVA 4O86A 2G9XA 3VS7A 5JFVA 4JBPA 4FV2A 2RKUA 3HV4A 3L1SA 4HVHA 3OY3A 1ZMWA 2X1NA 3IGOA 3DAJA 2ITUA 1KUTA 3FAAA 3RK9A 2IZRA 2BMCA 3F5GA 4F1MA 3UOJA 3GCUA 1WVXA 3EWHA 3FMMA 4RQKA 2JDVA 1DAWA 2YM8A 4HCTA 1ZY5A 1UU7A 4MH7A 4BTFA 3REPA 4C2WA 1GZKA 1LPUA 3BIZA 2WKMA 4AFEA 4GKHA 2VTMA 4F9BA 2WU7A 3UQCA 3D2KA 4BZDA 3JPVA 3MB6A 5IQDA 3NNWA 3GCSA 5HESA 2C6KA 3KFAA 5AV3A 3VS2A 5IA2A 4I24A 3FXZA 5E4HA 1GAGA 3GCVA 4USFA 3LJ2A 4H1JA 4BDBA 4UZDA 3PA4A 4FNZA 4WG5A 1TQMA 4X6QC 1GJOA 1KOBA 4QQCA 5EHYA 5M55A 2CKPA 4F9YA 2HCKA 2VAGA 4IVBA 2PVKA 2J0KA 1JKSA 4BDIA 1H00A 1ZARA 4QMPA 4RVLA 3ZSIA 5T68A 1XH4A 3PPZA 5HE1A 5KMIA 4D5KA 3FKLA 2F7XE 3I0OA 4YC3A 5AA8A 5M06A 3ANRA 5J95A 1VR2A 4LV5A 2R3QA 2QOFA 4XV2A 3FXXA 4XNEA 4GFMA 2VTQA 3V8TA 3A7GA 3SXRA 4RG0A 1PMVA 4RBLA 2R5TA 3TJCA 4FV3A 2DQ7X 3EH9A 4A7CA 2E9UA 4GFGA 2WELA 3RAWA 3TIYA 4XOYA 5DMZA 3WF8A 3AT2A 4L68A 4HW7A 4C57A 1YWVA 4EK6A 5EYKA 3TUCA 2BHHA 3MPMA 5C01A 3QAME 3BV3A 3Q04A 3UG2A 3VVHA 4J8NA 4W4XA 2XRWA 2EUFB 3R7IA 3S2PA 1F5QA 2HZ4A 3AG9A 3R9OA 2P0CA 3C9WA 3D14A 1FGKA 3HECA 1H08A 3KK8A 4L53A 2PUNA 3VS5A 2XK7A 2C3KA 3NYOA 5TKDA 5CU0A 3FEGA 4XP2A 2ZAZA 5DT3A 1ZRZA 3TG1A 1IA9A 4KIKB 2O64A 5G1XA 1URCA 4DH5A 3UIMA 4FTNA 4TKSA 4QMWA 3IDPA 4KS7A 4D4VA 2R0IA 3QD0A 5T3QA 5IKWA 1OZ1A 4ZTLA 4IAIA 3UP7A 2OXXA 3UO5A 3PRIA 3FLWA 1MUOA 4KSQA 3A60A 1B39A 2RGPA 5EG3A 5E8YA 4F63A 1M2PA 1QL6A 5HICA 2W7XA 1XBAA 5M56A 3QHWA 4GV1A 3F7ZA 2FYSA 4F08A 5CQUA 2Z60A 3FMLA 4CKIA 5CSVA 2XKCA 4PX6A 4ZLOA 1OBDA 3I6UA 3Q9ZA 1H26A 4FZAB 4I23A 4WUAA 4L3PA 4ZTNA 4LGGA 4ZS0A 3SXSA 4DG3E 4E6DA 4IE9A 5AR5A 2OJFE 3ZTXA 3Q2JA 3TUDA 4CQGA 1OIUA 2AC3A 2YJRA 3A7JA 3FC2A 3BHUA 3F3UA 5KBQA 4ACDA 3NNUA 3FPQA 4JVGA 2C5VA 4TWCA 5EH0A 3TKUA 5A54A 1PYXA 3HDNA 3FBVA 1O6LA 2QOOA 4WBOA 3C4FA 3Q6WA 3RK5A 3OF0A 4JBVA 4JAIA 5AAFA 4APPA 4H36A 3SRVA 4EHEA 3N4VA 2B52A 3E8EA 3DNEA 5HX8A 1YW2A 5HCXA 3M42A 5KMKA 1PXMA 4Q9ZA 2V22A 4CZYB
chains in the Genus database with same CATH superfamily
5M09A 5I9YA 1YOLA 1Y6BA 3OW3A 3LFQA 4FTIA 3OC1A 2H34A 2CN5A 4GUBA 2LAVA 2W99B 4IWQA 5C9CA 3RAKA 2BFYA 4LOQA 4YJRA 4DEEA 4EEVA 3W0NA 4ZAUA 2UZUE 3LFCA 4AUAA 3R9DA 4O81A 3KF7A 1KSWA 2IW9A 3KK9A 3P7BA 4RIXA 5KE0A 4BC6A 3RI1A 2XAOA 3L9MA 2X2LA 4YC6A 4BTMA 4KRDA 3QX4A 5GINE 4OAVB 4DTKA 3QTZA 2ESMA 2WO6A 4ZZOA 4GT4A 3D9VA 4FUXA 3RPOA 1GIIA 3A4OX 4P5ZA 5E8WA 2IZSA 5DOSA 3ZUVA 2IWIA 3EFKA 4QEBA 4PL3A 4DHJA 3SW7A 3PXRA 3FLSA 4ITHA 4BBEA 1ZWSA 1Z5MA 3I79A 5L2SA 1MRVA 5F20A 1ZAOA 3FJQE 1OITA 4GYIA 3C4ZA 3VUIA 3VF8A 4CXAA 3LMIA 4ARKA 2A4LA 2UW0A 2VX3A 5M53A 2IPXA 4PDYA 3ZM9A 3AMBA 2X4ZA 1UKHA 5K3YA 1H0WA 2PTKA 2CLQA 2QLQA 4Z7HA 5HG5A 3LFAA 3IG7A 1XO2B 3VUKA 3W2OA 4L7SA 3F88A 5GJGA 3UBDA 2YIRA 3UIUA 2J0LA 2OJGA 3K3IA 2UZTA 3BCEA 2R3HA 1BI7A 3HA6A 3E64A 3LXLA 4O0XA 3RPSA 4FL2A 3FY0A 1JBPE 4FIEA 5I9ZA 2ZJWA 1PXKA 2BRNA 3MSSA 3VS3A 3R22A 1JSVA 4O27B 4A9TA 1NW1A 3HV5A 2VGPA 3OCSA 4OBOA 5AUVA 3UPZA 1R0EA 3VS6A 1QPDA 2IVTA 2YA9A 4ZZNA 1WBVA 4F9CA 4JOAA 1H01A 2X7GA 3KULB 5FXSA 4D1ZA 3I4BA 3OEZA 3V5WA 2PE1A 4W9XA 3ZFYA 3VW6A 2YM3A 4F1OA 2BTRA 3MN3A 4EORA 3HVCA 1XMLA 4O0RA 3AC8A 4S2ZA 4KA3A 4ZTHA 2BVAA 2X81A 3JY0A 3W55A 2PMNX 3D0EA 3S1HA 1PYEA 2CDZA 5C4LA 4S31A 3MA6A 5KZ0A 3RM6A 1ZYJA 2FO0A 1J91A 1XJDA 4A4OA 4TL0A 5IH5A 2IG7A 4AOJA 3R2YA 2GQRA 4DTAA 3TCPA 3IO7A 3RAHA 4F7SA 5EDPA 4FICA 3DBFA 5FQDC 1EH4A 2J7TA 4E6CA 3CEKA 3QRUA 3TV6A 4DT8A 4N6ZA 4WKQA 4EZ7A 2A2AA 3P4KA 5CY3A 4NJ3A 3EZRA 2YM7A 3U87A 4CEGA 4RX8A 4XG9A 2YZLA 3PXKA 2BRHA 4M68A 1Q8ZA 2PVFA 4IEBA 5BVEA 4RVKA 4B6LA 5A9UA 1ZZLA 4LUDA 3W10A 3R7VA 3TV7A 3R71A 4B7TA 2VTNA 5A4EA 4JDHA 1UNGA 4JL9A 3FHRA 3VHKA 3RHXA 1WZYA 3GB2A 1VYZA 5J79A 2W1FA 4NEUA 4NL0A 2R3KA 3QZGA 4O83A 2ZM1A 3V5PA 4CKJA 3DTWA 4N4SA 4W4YA 2C5OA 4JIAA 1AGWA 4LRJA 4NUSA 4EWQA 2OXYA 2PZRA 4AG8A 3UG1A 3OWLA 2XK9A 4L9IA 4I6QA 3DV3A 5FD2A 2ETKA 2J0JA 3H0ZA 5HTBA 2WIPA 3VJNA 3LFSA 1UKIA 1STCE 3GUBA 4YJPA 1A9UA 5L2WA 2P4IA 3HMOA 5HGIA 3OHTA 1J1BA 2UZEA 4O6LA 1PY5A 4FTRA 4RIWB 4XV9A 4YHFA 3SLSA 4DLJA 1J3HA 5L8LA 3N4UA 3QD2B 3MH2A 4GW8A 2JBPA 4R3RA 3QTSA 3MJ2A 3R8ZA 4FKSA 4ZJIA 5LQFA 4FRFA 4O6EA 4M0YA 3BLQA 1VEBA 3UDZA 4YTFA 5FTQA 1H24A 1OUYA 3FKOA 3VAPA 1O6KA 3ACJA 3NIZA 4CT2A 4D4YA 1Q5KA 3BHVA 4AACA 3V5TA 3RWQA 5C27A 4F9AA 4TZRA 5BNJA 3BV2A 3PWYA 4U9AA 1ZZ2A 4FGBA 4BDGA 4BY9E 4C34A 1Q24A 3U51A 3FV8A 5HCZA 3S95A 4Y72A 4E8AA 4EOMA 1E1XA 1XWSA 4FIGA 3CLYA 3GT8A 1OVEA 2BKZA 2WQEA 3VRYA 3TUBA 4JQ8A 3NAYA 5IQCA 5CEOA 3I81A 4LFIA 4V0GB 4PY1A 3OFMA 2PUPA 4IIRA 4NCTA 3PIXA 4BFMA 3ZS5A 1M14A 2YLEA 3RPVA 5IU2A 3ZC6A 1Q3DA 3PJ8A 4UXLA 5IDNA 4XHKB 3A61A 4AN3A 4NM7A 2VO7A 1JWHA 4S32A 5TO8A 4ANSA 3W0RA 4AU8A 3BZ3A 1YOJA 1YWNA 4L45A 4MXAA 5H8BA 4BKZA 4ANMA 3H30A 2C5XA 2W4OA 4DG2E 4WOVA 4I5HA 4HGSA 4BDHA 1SM2A 3AC1A 4BCMA 5AUTA 2PVHA 4AE9A 2YCFA 1W2FA 5HO6A 3VUTA 3PPKA 3GQLA 4G3CA 2X9EA 1WBNA 5L6PA 5LVNA 3BX5A 4J96A 3O2MA 1R0PA 4QP7A 4YPSA 4DE4A 4JR7A 3AT4A 3OMVA 4EQUA 3E3PA 2GNIA 2VN9A 4F1TA 3R9RA 5HBHA 3HP5A 2JKOA 3TMOA 3VQUA 5HG8A 5FGKA 2CGUA 1WVYA 2REIA 2F7ZE 4I94A 4YJNA 4QMOA 3ALNA 5TT7A 3EYGA 5GIOE 5CSHA 3CSVA 2C6EA 5KMJA 4YLJA 1WMKA 2W5BA 4LV8A 4X3JA 4AWIA 4EH9A 3DQWA 3IDCA 3ZO2A 3KEXA 4D2PA 4F99A 5I9VA 2NRUA 4U44A 4EJ7A 4YZDA 2JFMA 4ASZA 4ERKA 4CLIA 3WZDA 3CPCA 3CE3A 4ACMA 2WMSA 2ONLA 2YIXA 3LHJA 3OUNB 2WFYA 3F9NA 3FUPA 2Z2WA 3F3ZA 4FMQA 3SOAA 4E20A 4F0FA 1UVRA 5DGZA 3Q6UA 4Z9LA 4F6SA 4KAOA 4I5CA 2VTSA 4WIHA 2I0VA 5DT0A 3LFNA 4QRCA 5E92A 5CALA 2GHGA 1Y8YA 5AR8A 2BAQA 2Z7SA 4CRSA 4DH7A 1Q4LA 4C4JA 4N6YA 5BVDA 4TTHB 2W4JA 3O7LB 2OG8A 3NGAA 3KKVA 1IRKA 4PL5A 4XG8A 4GK2A 4O82A 5IMXA 4JQEA 3FYJX 1YWRA 3W16A 3FPMA 4A9UA 1YVJA 4R7HA 2PVLA 1GZNA 3KXHA 4MXYA 4OGRA 3MH0A 4EQCA 1LEWA 4UN0C 3A2CA 2W9FB 4ZS4A 4AGUA 2Z7LA 4APCA 4MYGA 3C4XA 2CKOA 2FSTX 3OXZA 4OT5A 4GK3A 3MFRA 3I1AA 4U80A 2OKRA 3TKHA 4JS8A 5LVPA 4DH1A 3D5XA 3CPBA 3QQFA 3WF6A 1SNXA 2E9NA 4O0TA 4YLKA 3WF9A 3SQQA 5HTIA 4C8BA 3H3CA 4QTEA 3R7YA 3SD0A 3FXWA 2ITVA 4BCNA 3DB6A 5A3XA 1FPUA 2PUIA 3L8VA 2PZ5A 5CU2A 3RCJA 5JH6A 3VUMA 1ZOGA 2G2HA 4DN5A 3NSZA 4R8QA 5HLNA 1OIQA 4XJ0A 5IH6A 4YR8A 4XYFA 4EK4A 5AR7A 1XH5A 1PXPA 3SGCA 1WAKA 3ZRKA 4HVIA 5ETFA 3C5UA 3I7CA 3W2QA 5EW3A 5J1WA 5J8IA 1U54B 1PMNA 4CV9A 4R3CA 3KXNA 2NO3A 3ORTA 4OTHA 3GCQA 3HMIA 5IQGA 2XB7A 4M8TA 2XARA 3FZOA 3BGQA 1W83A 3A7HA 1DI8A 2IVUA 3RMFA 4AA4A 4AN9A 5AP6A 1Q8TA 4H1MA 4QPMA 4L6QA 5C8KA 4FV7A 3AMAA 4JNWA 4JRVA 5ETIA 2PVJA 1YQJA 3TYKA 4AN2A 4PP7A 5KKRC 4AT3A 3V5LA 5EI8A 2YCRA 1CKPA 2UZBA 4EZ5A 3C4WA 4FKTA 4DGNA 2ETRA 4OLIA 4O91A 3R00A 3QF9A 5BV3A 1J1CA 4BL1A 3CTHA 2X2KA 4O4BB 5CU3A 5D11A 4DITA 2YM5A 5CANA 3Q60A 4EH5A 4EOJA 2CPKE 5C8MA 4FBXA 3VBTA 4QDVA 4E5BA 4YUQA 4TYEA 3N4TA 4BCIA 4BJJB 5ANEA 4YP8A 4FT0A 4WRGA 3LMHA 1XKKA 2XF0A 2WTVA 3PY0A 3GEQA 4IAFA 3E7OA 3R9NA 5JFSA 1H1WA 3QFVA 3Q5ZA 4IB5A 4L3LA 5ANIA 3MJ1A 2WEVA 2VX1A 3CTQA 2WMBA 2BIKB 3R01A 4RX7A 4HYSA 3Q9XA 4CGAA 4IC7A 4NW6A 5E8UA 3PSBA 4QTCA 4ACGA 1VJYA 3BQRA 3MB7A 3KREA 1ERKA 1KOAA 5GJDA 5EM5A 3GGFA 4JDIA 4K33A 2AEGA 5CXZA 5HHWA 3KRLA 2OZAB 3DDQA 2V62A 2VO0A 3FZPA 3PJ1A 2W5AA 2QOBA 4I4EA 4QNAA 5DHJA 3COHA 3D7TA 3ZRMA 3ZUTA 4JBQA 5AP3A 3KRJA 2PE0A 4ANNA 4GT3A 4AZWA 3QUPA 2C6DA 4FTLA 4CFUA 2BZJA 3R30A 3HUCA 4C59A 2JDSA 3DLZA 3NMUF 3UQFA 2UZWE 3CIKA 1SVHA 3ZC5A 3UC3A 4CSVA 1W0XC 2PL0A 4XX9A 5AX3A 2B9HA 4JG6A 3RAIA 4BTKA 5ANJA 4BWPA 3AGLA 5KNJA 4NFNA 4FTQA 2QU5A 3R1NA 4CT1A 1LUFA 2WU6A 3DQXA 4FOBA 4PDOA 2YDIA 4X21A 5DLSA 1OKVA 5F1ZA 3NEWA 4RZWA 3RVGA 5M51A 5JRSA 3VBXA 1ND4A 4E1ZA 1R78A 1JPAA 5EOLA 5B2MA 4LGHA 3PG3A 4BWKA 4DF3A 4L01A 3KXZA 4ONAA 3UQGA 2X9FA 3TNWA 2O2UA 3NVKI 2YN8A 4E93A 2O3PA 4F65A 5IQIA 2C6OA 2Y4IC 3WBLA 3P86A 4XG4A 3BI6A 2JD5A 2XJ1A 5L2QA 4WNOA 4AF3A 1HOWA 4RX5A 3QTUA 4NTTA 4H58A 4YHTA 5ETCA 4EH6A 1XH8A 2W1EA 4PP9A 4IW0A 3U9NA 5IEVA 4U3ZA 4FE2A 1E1VA 2HIWA 1V1KA 4S34A 4R77A 5F95A 5M4UA 3NFGB 4D2RA 2B0QA 4CLJA 3P9JA 4HGTA 2PPQA 5CF4A 3HV7A 3QD3A 2B9IA 2YISA 2JAMA 3R7GA 4K6ZA 3F3TA 3LVPA 4P4CA 4EYMA 4B9DA 5C1QB 2WMXA 4FIIA 3OW4A 3KC3A 4TYHA 4DGMA 4RJ7A 4UZHA 4WT6A 3RKBA 3UMWA 4CFVA 2ZV8A 3E63A 3WOWA 4DEAA 2QCSA 2C0OA 3JVRA 3CKWA 2OIQA 4I20A 4FT5A 5AM6A 2ERZE 2OO8X 2XMYA 3RP9A 4BDAA 5J7BA 3V04A 4LDTA 5A14A 4OTIA 1DAYA 3MYGA 3ID6C 1YDSE 3FZ1A 1MQBA 3TTIA 3ROYA 5A4QA 3PVWA 3KF4A 5A4TA 2ITPA 2E2BA 1IAJA 4BBFA 2XALA 2Y7JA 4YBJA 5LWMA 4XP3A 4IMYA 2RF9A 4AGWA 4K0YA 3LCTA 4BCPA 4TNDA 3MA3A 4V05A 3MY0A 4XEYA 2ITTA 3JS2A 4MF0A 5DRDA 1BUHA 2V0DA 2X6EA 1REKA 2YJSA 4Y8DA 4OW8A 4AE6A 4B4LA 3TZ8A 1H27A 3LW0A 4PF4A 5E8XA 3NUXA 4HGEA 2PULA 4JQ7A 4OTFA 4IX5A 3VF9A 3BYUA 3ENMA 3BKBA 4JRNA 5L3AA 4MWHA 3ZDUA 1PRYA 3M2WA 3EMGA 3ANQA 3EQDA 4RC4A 2ZM3A 3MGYA 3C1XA 1U46A 3H9RA 2WQOA 3H9OA 4PV0A 3HV3A 2G1TA 4GUEA 4MF1A 3LPBA 4ASXA 4D4SA 4QOXA 4FNYA 3RBWA 4WO5A 3QALE 4G3EA 3CCNA 3DJ5A 3L8SA 4FEQA 4MUQA 4WUNA 2PVYA 4KRCA 3TXOA 4E4MA 4CFFA 5HQ0A 4H3QA 2AUHA 4HCVA 4KD1A 4QQ5A 5CEPA 3DA6A 2QO9A 3OCTA 4FVQA 3OVVA 4BI2A 4C38A 3LCDA 4CTBA 3TTJA 4W4VA 4U97A 3O0GA 1M52A 4EK5A 2UZDA 3EIDA 3KGAA 1JNKA 4C4IA 4CFMA 4DAWA 2R3RA 2R0UA 1OIYA 4L46A 4IAYA 5CAQA 3G15A 4KBKA 1TFFA 2NYAA 3FDNA 2EXCX 5DVRA 3W2RA 3VBYA 3QZIA 3T8OA 3P7CA 5AAEA 1ZYCA 5HVKA 2R3PA 2BRGA 2UVZA 4G2FA 4E26A 2JC6A 3KCKA 4E4XA 5FM3A 3VQHA 2B54A 2XBJA 4LYNA 3GXLA 2QLUA 1JSUA 3ODYX 2BAKA 3AKLA 4A9SA 3GP0A 4DCAA 1CTPE 5HD7A 2ZOQA 5J1VA 3E93A 1P14A 4RMZA 2JLDA 3V6RA 3NUNA 5CXHA 3QD4A 1XBBA 3BELA 3VS4A 4ACHA 4DFLA 3W33A 1DS5A 3ELJA 2VWIA 4QQJA 3VUHA 3MWUA 5ANDA 1PHKA 2WTKB 5JSMA 4I41A 3UPXA 4YJSA 4FKQA 4X3FB 1QCFA 2FUMA 5HIEA 3SC1A 4O96A 4O7SA 1M7QA 1FVTA 4FZDB 1S9IA 1G8JA 4EQMA 2QODA 4MXZA 3HLLA 4X2JA 2PMIA 2QQ7A 3HX4A 1LP4A 4S33A 1P4FA 4IBMA 5E1EA 3ZCLA 1Y6AA 4AXAA 3MIAA 4F9WA 2NRYA 4GIIA 5JGDA 4Z55A 4QO9A 5HG7A 3F66A 4PPAA 3WZEA 4A4XA 5E8TA 3E3BX 3ORMA 1CM8A 4NM3A 3DT1A 1I09A 4TWNA 2VX0A 5B2KA 5TR6A 4FA2A 3PTGA 3KMUA 1F3MC 3UDSA 1XQZA 4ZTRA 4R78A 4KWPA 5L4QA 4AT5A 5IA4A 3GQIA 4NM5A 1V0BA 3VUGA 5F4NA 1Y8GA 4RA4A 2UW8A 5HNBA 1WBSA 3EQBA 2WZJA 4TT7A 3NUYA 2X0OA 4FL1A 4QYHA 3PJ2A 2O0UA 3R8UA 2XIYA 2UW6A 3DFCB 3MPAA 3K5UA 4JT3A 4PMPA 3DLSA 3LAUA 1A48A 3HYHA 3PVGA 3RGFA 4YSMA 4FK6A 3FZRA 5BVFA 4HVSA 3ZU7A 5FTOA 4U8ZA 4BBMA 1XH7A 4ANQA 4M69A 3C5IA 1BKXA 2IW8A 3FY2A 3HRCA 4O7LA 5LCJA 4GFOA 2CN8A 2JFLA 4UY9A 3UOLA 5HG9A 2BTSA 4C58A 3UTOA 5I5ZA 2GSFA 3ZO4A 3AOXA 3UDBA 4AQKA 5IEXA 4TWPA 4MX9A 2QOHA 5AIKA 4MBJA 4RIOA 2WMAA 3NLBA 3FZTA 2GS2A 3FMEA 3RJCA 1O9UA 1R39A 4ZTMA 2ZDTA 3OEFX 2Q0NA 5CENA 2X39A 2C3JA 4G17A 4IZ7A 3UNJA 4DG0E 2OF4A 4RWKA 5EK7A 4DEBA 3PE1A 3LLTA 1FMOE 3WE4A 4JX3A 3GU5A 4WSYA 5EKOA 2GMXA 2CCIA 4KIQA 4CZTA 5AV2A 5JMSA 3Q53A 3NZ0A 2SRCA 3CJGA 3FI8A 4R5SA 4MBIA 4FTKA 2EWAA 5H2UA 5LCKA 4IM2A 1MRUA 4PNIA 3NUAA 5DBXA 3KXGA 1CKIA 4I93A 2JDTA 2VTRA 5BUIA 4P90A 3W0QA 3RK7A 1H1RA 2JDOA 2NPQA 4J52A 4JIKA 3PXQA 3QGWA 3QQJA 3RCDA 3SG8A 5AM7A 4FC0A 4EOKA 5E8ZA 5EM7A 4R1VA 4RIYA 3C0GA 4HCUA 1BX6A 1UWHA 4A4LA 4LOPA 2PY3A 3ZSGA 1NVSA 2BFXA 4KUJA 4PPCA 4DGGA 5FBNC 2XCKA 5HNGA 4D4RA 3PDTA 4LRKA 2OZOA 5I3OA 1M2QA 1TQPA 3G2FA 4FTAA 4EBWA 1JAMA 2IJMA 4IC8A 4UX9A 3RNIA 4YTCA 4G9CA 3BYMA 3H10A 4JG7A 1ST4A 3V8WA 2BPMA 3CQEA 2XIRA 4ZY5A 2QOIA 4BCJA 2XNMA 4H39A 2YWVA 3QCXA 2PZIA 3PA5A 4DTBA 4FTCA 3K54A 2XNNA 3FI4A 1RW8A 4MXXA 4RC3A 3ET7A 3HDMA 3N9XA 4KSPA 4MD7E 5HE3A 4USEA 4ORKA 2RIOA 4KABA 1MRYA 3BHYA 4DBNA 4EOLA 2ACXA 3C50A 2ITQA 4YTHA 4D2SA 3RM7A 1P5EA 1UU3A 4RA5A 3NCZA 1K9AA 4MTAA 3LKMA 1SYKA 2Y0AA 3NNVA 3O7LD 1PXIA 3CD3A 3E7VA 2YDKA 3R02A 5LMKA 3Q2MA 4BHNA 4LOOA 4L7FA 3KIOC 2JDRA 4QMNA 3VBWA 3TIZA 1NT2A 3DXQA 4CMTA 4U79A 4XUFA 5D7VA 4DFUA 4OT6A 3IW5A 2OK1A 3LCKA 3C51A 3KU2A 3LFFA 2RG5A 4B8MA 2IO6A 4FV6A 4BYIA 4YMJA 5AP2A 3EQGA 1JSTA 1K2PA 4AS0A 4O7NA 4M84A 3EB0A 4CTCA 2J50A 4YJQA 3A8WA 1PF8A 4C4FA 1WBWA 5B7VA 4CMUA 1BL6A 3BYSA 3G90X 4Z3VA 2QO7A 2OJJA 3DBQA 3PG1A 4K18A 3IW6A 4XMOA 2HELA 4U3YA 4WG3A 4BCHA 1JVPP 4HJOA 3BPRA 4X6RA 3DGKA 2WQMA 3R0TA 4QT1A 4OBPA 1IR3A 5HI2A 2E9VA 5ANGA 3AD4A 4TYGA 4FODA 4WD5A 4FSYA 4GRBA 4IXPA 3WYXA 3MVLA 4Q5HA 3OP5A 3UVPA 3JYAA 4EHVA 3WZJA 1UU8A 3HGKA 1Q61A 2F4JA 5IZFA 4DFNA 4D0XA 4U81A 5IEYA 3TNIA 2C47A 3PZHA 4NIFA 5H9BA 4A9YA 4CVAA 3LOKA 5M08A 1PXJA 3FYKX 4PQNA 3ZHPC 1KE7A 4BIBA 2VNWA 2ITWA 3DFAA 2C5YA 5CEIA 2IVSA 3QLGA 4O0VA 3ZFMA 5J5TA 3BLRA 5B2LA 2EXEA 2VNYA 3ZLYA 4YPDA 5KMMA 4QPAA 1AQ1A 5BPYA 4G5PA 4EK8A 3IOPA 3PYYA 3IPHA 2EB2A 2JBOA 3F2NA 4FNWA 3PVUA 4I21A 4U0IA 4XS2A 1R1WA 3VBVA 3O71A 4ANLA 2NNWB 3R04A 4H3PA 4IWOA 4O1PA 3PP1A 4ZP5A 2OFVA 4YJOA 5CAUA 4BKJA 3E8NA 2FH9A 3OWKA 3NX8A 2OGVA 3P1AA 4N70A 3O96A 5KX8A 4I6FA 3BLHA 3LXPA 4O7WA 3PWDA 3R1YA 4ACCA 3ORPA 3HKOA 4DT9A 3NUPA 4IDVA 3KMMA 5I9UA 5I4NA 1ZXEA 1Y91A 5A6NA 4O0YA 2B55A 2ITOA 2VRXA 1SVEA 3KMWA 2VTHA 3F3VA 5CLPA 2XZSA 2G15A 4M13A 3QTQA 3H0YA 2WOTA 1R3CA 4PUZA 3ZLWA 4C3RA 3PPJA 3ZMMA 3RPRA 3FQEA 5CTPA 2WAJA 5AUWA 4UWCA 4QMXA 2R2PA 5ANOA 3QRIA 2VD5A 3QTXA 5CWZA 4GH2A 5J9ZA 2W1DA 3IOKA 3A8XA 3U6JA 4UMUA 3GENA 3EQFA 4JXFA 1XR1A 3GU8A 2Y6MA 3LCOA 4FG7A 3BE2A 4U7ZA 3TACA 4BCKA 3DZOA 4EHGA 2ITZA 1KV2A 3DU8A 4F4PA 3GOKA 4C36A 2QO2A 2QURA 5HKMA 3SX9A 2UW9A 3TI1A 4RWIA 2ZB1A 3WIGA 4EKKA 2QG5A 3BYOA 2J4ZA 5FP5A 3HAVA 3QL8A 3EN4A 3EQIA 2BDWA 4EOSA 2UV2A 3TT0A 3LXKA 2OI4X 4J8MA 1CKJA 2A98A 3JY9A 3ZRLA 3TJDA 1OECA 3C4EA 4NK9A 5AP5A 2CKEA 5IA3A 3Q9YA 3SRVB 5K0KA 5EM6A 4JI9A 2OU7A 4X2FA 2QOQA 3NS9A 4HGLA 5DA3A 4R5YA 3ITZA 3P79A 4FVRA 4R6VA 5KHXA 4JDJA 4Y85A 1CMKE 3ENHA 4L67A 3Q4CA 3AMYA 4QMYA 3P0MA 5DPVA 3PUFC 2AQXA 4R7IA 3OS3A 5AP0A 5LMAA 1H0VA 4USDA 4XLVA 2X0GA 3TN8A 2OIDA 3MY5A 2BROA 2YCSA 5AJQA 4BDJA 2GU8A 5EHLA 4DCEA 2V55A 3HP2A 4FKWA 3NVMB 1WCCA 2O5KA 2OZAA 4I6BA 4RJ3A 4EJNA 4RLKA 5K0XA 5T6KA 4F78A 3D4QA 3IW7A 4KKEA 3NWWA 2FVDA 2VTOA 1OM1A 2ZMCA 1YKRA 4LG4A 4I5MA 3IW4A 3PZEA 1YXTA 4NCTC 2RFEA 3L9NA 4R1YA 3W2CA 4B0GA 1RQQA 3EQCA 4FKJA 4TWOA 3SV0A 2V5QA 4AXCA 3FKNA 4C3FA 2QHNA 3C13A 4D2WA 4E6AA 5IISA 4L42A 4CCBA 3GU6A 2B9JA 3KB7A 3N51A 4PRJA 3THBA 4RFMA 4D5HA 4U45A 5M4FA 3HAMA 3L9LA 3POOA 1YRPA 3K5VA 3ODZX 3NAXA 3FMJA 3NW6A 4PTEA 2WMQA 2YABA 2XK6A 4MXCA 5IQBA 4NYEA 4BDDA 4C37A 5D10A 4FSQA 3SW4A 1CDKA 3HRFA 3EFJA 3QRKA 2W1ZA 3BBWA 3OZ6A 2XBAA 3DK6A 4EOPA 5EFQA 3Q9WA 4UBAA 3CXWA 4QP9A 2X6DA 3OOMA 5I0BA 3MDYA 4NWMA 5IPJA 3WE8A 1PKGA 3LFEA 2DYLA 5FRIA 3DTCA 2GQGA 2QOCA 1XH9A 2FSMX 3FQHA 4BF2A 3WARA 2UUEA 2XEZA 3PRFA 3LLAA 1OPLA 3AKKA 4O1OA 3EN5A 3KA0A 1GOLA 4IB0A 3T3UA 2CGVA 2HXLA 1FVRA 2R3IA 2XM9A 3ALOA 4O7VA 4BDCA 3U9CA 2J0MB 4UB7A 3JUHA 4ZY4A 3ZSHA 2XM8A 5HNIX 1H8FA 2C6IA 2WOUA 1H28A 3QC4A 4EUTA 4ZLZA 2WD1A 2QG7A 3PJ3A 3QRTA 4FKPA 4AW1A 4U5JA 4Y73A 4Y83A 1L3RE 2GFCA 4WNPA 3OWJA 4BGGA 4YU2A 3UVQA 1GIHA 3HEGA 3PUPA 4QP3A 4DEIA 2ONLC 2BZIB 2R3FA 2ZM4A 4AAAA 3MIYA 4YHJA 4LRMA 4IH8A 1G8KA 4TY1A 4GJ2A 5HVJA 3LM0A 4J97A 5CF8A 1FBNA 5M4CA 5E90A 2CNUA 2VWWA 3B8RA 3WIKA 5EW9A 3V51A 1YHWA 5LMBA 4O22A 4O0UA 4EYJA 3QXPA 3RZBA 3TNPC 4AW0A 2JGZA 4OTGA 4FKIA 4WRSA 4FG8A 2HY0A 1H25A 5KO1A 1NY3A 3RINA 5AUYA 4FIHA 3PIZA 4XG2A 1FOTA 2OSCA 3LJ1A 3PXFA 3ZEWA 5LOHA 2C30A 5EQYA 5HU3A 4W8EA 3LQ3A 1H1QA 4TN6A 5AUUA 3L9PA 4I4FA 1ZYLA 4OAUC 4G3FA 2R3GA 4XBRA 2W17A 4JBOA 5CT0A 1Q8WA 5LVLA 3WF7A 5DH3A 5HVYA 4ZSJA 1QPCA 4KB8A 1YDTE 4QPSA 4KS8A 3QUDA 5K5XA 5L8KA 5J9LA 3KRRA 2XYUA 3MY1A 3MTFA 3BEGA 3AC4A 3BHHA 1JLUE 3G9LX 3KRWA 3MW1A 4L44A 5BX0A 4DHIB 2XS0A 4IAAA 1Y57A 3S3IA 5F94A 2XNBA 3ZOSA 5JKGA 4GS6A 5JQ5A 1PXNA 3FLQA 5HCYA 2ZB0A 3WI6A 5IQHA 4O4DA 1FVVA 3K3JA 5GZ8A 4HZSA 4YZ9A 2YAAA 2EB3A 1TVOA 3DJ7A 4CQEA 3EZVA 3EFWA 3DB8A 4X2KA 4Y95A 3AC2A 5CZHA 5CU4A 3BRBA 2QOLA 4QTAA 1OIRA 5DYJA 4LL5A 4ZEGA 4KIPA 3FI3A 3QRJA 4FV8A 3OT3A 2R64A 2JEDA 2VWXA 3CD8A 2GCDA 4GG7A 4FSZA 5DI1A