2C1AA

Structure of camp-dependent protein kinase complexed with isoquinoline-5-sulfonic acid (2-(2-(4-chlorobenzyloxy)ethylamino) ethyl)amide
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title Structure-based design of isoquinoline-5-sulfonamide inhibitors of protein kinase B.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2c1aA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2c1aA02
1H1SA 1OPJA 3B8RA 3BIZA 1QMZA 4HNFA 4DG3E 3LPBA 4O81A 4MD9E 5LOHA 1A48A 4OT5A 3QRKA 4RA5A 4HCTA 3SC1A 1T45A 3AD4A 3BV3A 1UU9A 3ORPA 4IWOA 5AFVA 4KINA 4ASDA 3R9OA 3LJ2A 4RX8A 3PYYA 3PPJA 5CF6A 1JSTA 2VU3A 1XH7A 3GU4A 2C5VA 3CGOA 2PMLX 3HMOA 4BTKA 2OW3A 3BU6A 3OXZA 2VNYA 4U0IA 4MHAA 1PRYA 4EOJA 3UIBA 4FVRA 5K5NA 3QRIA 1WAKA 4K6ZA 4O83A 2V7OA 3PY1A 2R9SA 4XS2A 3KKVA 4LUDA 2ERKA 4YJQA 4DTAA 3D5UA 2ZMDA 1H26A 3KXGA 3FLYA 2FSOX 4AX8A 4EJ7A 2QKWB 4TTHB 1ZLTA 3VBXA 3VUDA 2IVTA 3QA8A 4FKWA 1JKLA 2GNGA 4USDA 3VUIA 2YLEA 4GW8A 4BN1A 1PJKA 4BDIA 2UZEA 5I4NA 5GINE 5CVHA 5F94A 3BLHA 3RP9A 5EW3A 5M4UA 3F5UA 3QLGA 3D9VA 3TKIA 4F9AA 2B9JA 3DKCA 5H2UA 3NRMA 4RFYA 3GBZA 4W8EA 3GU5A 4NZWB 4UWBA 4CT1A 5CALA 2QO7A 4TW9A 5CVGA 1IA8A 2VTJA 4Y5QA 3OY1A 3FKNA 4EJNA 5EKNA 1OB3A 3R2YA 1OL7A 5FEEA 3R83A 3NNUA 4QMMA 3CKWA 3LE6A 3DQWA 4ID7A 2DYLA 3FC1X 2C68A 3OG7A 4QMTA 3ZZWA 2W4OA 5HBEA 4ERWA 5CF5A 3EH9A 1M14A 4GL9A 4LGGA 4YJOA 4IAFA 3LVPA 3R9NA 4DGLC 4EONA 3EN9A 3P7BA 4FL3A 4JDKA 5ANKA 5B2MA 3R7GA 2HENA 2X81A 2PZRA 5JEBA 4DE4A 2VX0A 3QCSA 2WOUA 2UW4A 1OMWA 4PDPA 3CIKA 4ZK5A 3UIMA 3DAKA 5LMAA 4FTCA 4RJ3A 5C03A 3CXWA 2QG5A 4I5CA 2IVUA 3UYTA 3QBNA 4K18A 5FM3A 3ODZX 4UMPA 3I6UA 3BELA 4FYNA 2RF9A 3HDMA 2VO0A 4Q2AA 2W1EA 3NVKI 4KIKB 5J87A 2JDRA 5CAPA 3ZM9A 2W7XA 2QONA 3DY7A 5IA3A 2BZJA 4CYJA 1JPAA 1M52A 3HNGA 4MQ2A 1O6YA 3FL4A 3OW4A 5FEDA 3W10A 5JFXA 2YWVA 2YAKA 5M4FA 4MK0A 4QP7A 2BDJA 3C4FA 4ANNA 5M4IA 2JBOA 4PPAA 2CNQA 4IJPA 3DK7A 4U42A 3VAPA 4BICA 3UODA 4BTMA 4NL0A 2OU7A 2VO7A 4FL1A 2J50A 4WIHA 5CSXA 4CRSA 4EBVA 4ZTQA 4V0GB 4I92A 1MRUA 3ULZA 2NO3A 4QTBA 3GP0A 4L67A 5AA8A 4K11A 3ENHA 3TUBA 5ACKA 3GXLA 2ZM3A 3KF4A 4CG9A 2GNLA 3MJ1A 4H05A 4XLIA 3NW7A 4FV8A 5BVKA 4EC8A 4L7FA 4U9AA 5IZFA 3O8UA 3MJ2A 4G9CA 3ID6C 1URWA 3ZSHA 4E1ZA 2YABA 4IZAA 3ORTA 4G34A 2HZIA 2VWVA 3M1SA 3DGKA 2W96B 4FIJA 3FY2A 4LUEA 1KE5A 5KUPA 4G6LA 4R5SA 1Q3DA 2JIUA 4M66A 4N6YA 4J8MA 3UPXA 3S2PA 4QP6A 2XH5A 4DEIA 1IAJA 1PXPA 4PWNA 3FDNA 4JT3A 3PXRA 4BYIA 4CYIA 1R0PA 2JBPA 2PZPA 2PULA 3QTQA 4KKEA 5CT7A 2W4KA 4PDSA 5IQBA 5AP6A 2BTRA 1W83A 3FPMA 1U5QA 2EB2A 4C4FA 2I0YA 3DTWA 4RBLA 4DEHA 3KK9A 1NVRA 3AC3A 4YHFA 1E9HA 2XNEA 4DFNA 3GT8A 5AX9A 3KN5A 2PVFA 2QU5A 4IAKA 1SZMA 4ZSLA 4WO5A 4OGRA 4BBFA 3CTHA 1YDTE 4OTPA 4CMUA 3QWJA 4DG2E 4FZ6A 3AQVA 2JDOA 4DH3A 5KKRC 4B99A 4QMPA 1V0BA 4BZNA 2CLQA 3V8WA 3VHKA 2C6TA 4EL9A 4NUSA 5A6OA 4AZSA 2FUMA 4R7HA 2ONLC 2PE1A 4GS6A 4QYYA 5M09A 4FODA 4NM3A 3P79A 2F4JA 1GNGA 2REIA 5HVJA 1OUKA 3QZFA 4MQ1A 3ZDUA 3FYKX 4D0XA 3MFTA 4L45A 4A9YA 5IQAA 3LXKA 5FXQA 5FXSA 4Y83A 2YIYA 2B1PA 3LLTA 4LG4A 2ITPA 3QXOA 4IWDA 3LCKA 4CGAA 5AV2A 4CXAA 1K3AA 4W8DA 4XV2A 4ZJJA 3QTZA 2RL5A 4CV9A 4FI1A 1MUOA 2CCIA 4RMZA 5CQUA 4DGNA 2PWLA 3BYVA 4K2RA 3KXNA 3RHXA 4FVPA 3KRLA 4QQCA 2CSNA 2VTRA 3EJ1A 5IU2A 4FKOA 1H1RA 5HX6A 3NVMB 5F95A 5EDQA 1P5EA 4R5YA 4QPAA 4CFVA 4CFNA 2EB3A 4FT0A 3F3UA 4JAIA 5HHWA 4BCOA 4PTGA 5BVEA 5KX8A 3OOGA 5AM7A 4XHKB 2I1MA 4L9IA 4BB4A 3MVMA 2C6LA 4AW1A 2VD5A 5HE0A 3W8QA 3HP2A 1WMKA 2ZDUA 2UV2A 4CCBA 2BVAA 4C34A 3DFAA 5IEVA 3CPCA 5JMSA 2PMNX 1YDSE 4WRGA 5KE0A 2WGJA 2BAKA 3A7GA 2E9NA 4FT7A 4U79A 3TKHA 4O1OA 3OW3A 1TQIA 4QMZA 4C4EA 3LQ3A 1YHWA 2CDZA 4J7BA 4RLLA 4QMWA 3I1AA 3MI9A 3QU0A 4FNWA 3UO6A 4E6DA 3DBDA 4FIIA 4S2ZA 3OD6X 3AC5A 4NEUA 3BGQA 3QTRA 1KE6A 2F7EE 2H8HA 3UNZA 1M7QA 1PYXA 2JKMA 5E8ZA 3VRZA 4O0XA 2XNGA 5M44A 5M08A 4A9UA 3A8XA 3QYZA 4ZJIA 1XQZA 2O64A 1VR2A 1GJOA 1PXIA 2R3QA 4YZCA 4R1YA 4C7TA 4AT5A 1XKKA 4IADA 4MEDA 5TO8A 5I9ZA 3HV7A 5H8EA 5IEXA 2WKMA 4AA5A 2J6MA 3GB2A 1K2PA 1H0VA 3PG1A 4ZLYA 1KE8A 4CG8A 4MD7E 4ZSGA 2XM8A 4ANSA 4GEOA 4DHFA 5DFPA 2R3GA 1PXLA 2UZLA 4KSQA 4NM0A 5K4JA 3FL5A 4FV0A 4WG5A 4FF8A 5HG8A 3LCSA 3SVVA 2DUVA 1L8TA 2RKUA 4ARKA 3OEZA 4C3PA 2OJ9A 2ITYA 4BCQA 2ZB0A 3BHHA 3R73A 4MTAA 5FXRA 4MWHA 3W8LA 3ZBFA 2PZYA 3ACJA 3DLZA 4XP2A 5IUGA 4BCJA 4K1BA 4YBKA 5DN3A 1TKIA 4YSJA 3FLNC 2CHLA 2HAKA 1R39A 2IW8A 1ZYCA 1KWPA 3FZPA 3EL7A 4BYJA 2C0TA 5I9XA 3PVBA 2UZVA 2BMCA 2IO6A 2BHEA 4ZZNA 3ZLYA 1QPCA 5DA3A 4NM5A 2WMAA 3R02A 4YLJA 2XIRA 2R3IA 5GZ9A 5KMOA 3QZHA 1Q61A 1ZOHA 3GU6A 1J7LA 5EG3A 1YXTA 3FWQA 4G3EA 4RPVA 5AV4A 5IDNA 4DTBA 4ZTHA 3V5LA 4TWNA 4CQEA 4FNYA 3QD2B 4X3JA 4MXZA 3WI6A 1YW2A 2E9UA 4TZRA 2QOBA 3COKA 5HE1A 5HLWA 1Y91A 4EH5A 4F63A 3MA6A 2BAQA 3UVRA 3PJ1A 5HNGA 2BUJA 5HO8A 5E8VA 4I4EA 1PXNA 2PU8A 3DKFA 4H1MA 5HIBA 3QD3A 3VNTA 3L9NA 3KRRA 3V6SA 5M06A 3BU5A 5LCKA 3TL8A 1OL6A 3GOKA 3R8UA 4QMXA 2GS2A 3MY0A 5J5TA 2VGOA 4DA5A 4FV4A 4CTBA 5FEQA 4EQMA 2XIXA 3D2KA 1S9IA 3LFCA 5KMMA 1JKSA 4Y5HA 3OUKA 4U8ZA 5AUYA 1YOLA 2G15A 2GTMA 4A9SA 2OSCA 3MBLA 4LOOA 4CFMA 1ZOEA 4M0ZA 3PVWA 2XK9A 3FMNA 4RIYA 2BZIB 1PYEA 2OJJA 3FBVA 4IH8A 2CNVA 4JG6A 3RPOA 2FB8A 3E3BX 3VS1A 2QLUA 3H9OA 3Q2MA 4ANBA 4K9YA 1QPDA 2JAVA 4D9TA 2X2LA 2QO2A 3IONA 2J51A 2YZAA 3WBLA 4C33A 4IDTA 4O0YA 5HCYA 3JR1A 4HYHA 3ANQA 3F5XA 5B0XA 4C2WA 5IDPA 4F64A 3F6XA 3HRBA 3V01A 4JDHA 3HV3A 4RWKA 3VUHA 3MPAA 3S00A 3VULA 4FBXA 3RVGA 3UIUA 4LMNA 2WMXA 2I6LA 2IZSA 2VUWA 1JBPE 3F82A 5HGIA 4CLJA 5GIOE 5AP1A 5DMZA 4FZ7A 4DAWA 4BCFA 2QHNA 1MQBA 2BAJA 3O96A 3R71A 4OBPA 5CAVA 4QMUA 4XV3A 5CI7A 5CANA 5JFWA 2R3KA 1PMVA 1SVGA 4RLKA 4UEUA 4DFYA 2J7TA 2P0CA 4NT4A 4BI2A 4U3YA 4BDHA 5JGDA 2O63A 3AMAA 1WVWA 3JVSA 1I44A 4XRLA 2Y8OA 4UX9A 4QTCA 4YJUA 5L2IA 3BEAA 3FMMA 2HY81 2OG8A 2C6KA 3EHAA 3OTUA 2EWAA 5C8KA 3KXMA 5BVOA 3A99A 4IM2A 2HELA 3M2WA 3FZOA 2WTKB 2CNUA 4U40A 2AYPA 4YTIA 4FOBA 5G1XA 5DYJA 3KN6A 4WKQA 2WELA 1SNXA 3DJ6A 4HGLA 4EC9A 1LP4A 2GNFA 4EH2A 5A4CA 5L2WA 2W1GA 3Q60A 5AR8A 1OL1A 2V22A 2Y0AA 2IG7A 3UNKA 5LCJA 2V5QA 4UMRA 3OWPA 4I0SA 1PXOA 1REKA 5HLPA 3WF7A 5IQCA 4FG9A 3ET7A 3HA8A 3L1SA 2VWUA 4FTMA 4UMQA 3PA3A 3GC7A 3GCPA 5D9HA 3ROYA 5C27A 3QX4A 4M0YA 5AV0A 3NIZA 5KCVA 1TVOA 3CY2A 3Q4CA 3NEWA 2VN9A 3PRIA 2QR8A 1XO2B 3CQEA 3T9TA 2JDVA 4H3QA 4PMTA 3ERKA 3TACA 1H24A 3PY0A 4FKTA 4JG8A 3NW6A 4KAOA 4TPTA 1DAYA 4EOSA 5AIRA 3GNIB 4FSWA 3SDJA 4DBXA 3JVRA 1Q24A 4HGEA 4DTKA 4AZFA 5IUHA 2Z7RA 5FQDC 3AD6A 5I9UA 1FOTA 4U80A 4DEEA 2WQMA 2UW8A 4JI9A 4L44A 4QYFA 4ZTRA 3RTPA 2VTPA 3H3CA 5LMBA 4BKJA 1WVYA 2R64A 2VAGA 2ITVA 3LXPA 4MVFA 3RI1A 3A60A 2XP2A 4A9RA 4F6UA 4FOCA 2GNIA 3DAEA 3NAXA 5M55A 3R7OA 2VTAA 5BMSA 1J7UA 4GFGA 5BVDA 5M56A 3ZS5A 2XK3A 3SGCA 5J79A 4NH1A 4Q5HA 4PL3A 3ORKA 3Q53A 4ZMEA 4GYIA 3QD4A 1GY3A 4NK9A 2V62A 3QQJA 3UOHA 4LL0A 3DXNA 3GC8A 4O0UA 4BGQA 4C3RA 4IWQA 3VO3A 4EK8A 4EOPA 1S9JA 2CGVA 3HMMA 1KOBA 3EQCA 2PUIA 2VTTA 2OH0E 3DAJA 2JFLA 4CT2A 4QD6A 1STCE 2G01A 3FI3A 4AN3A 1O9UA 3FE3A 5AM6A 3QQKA 5IA0A 4IQ6A 5AADA 3C4ZA 2R3FA 4N4SA 5CVFA 3HP5A 1OIYA 2ETKA 5HOAA 2Q0NA 3DKOA 2XVDA 3KCKA 3QRJA 4RFZA 4BRXA 5GIPE 2F2CB 2B4SB 2R2PA 3N9XA 4CTCA 2OIQA 3MY5A 2PPQA 2J5FA 2OI4X 3Q4TA 3RCDA 3BWJA 2XKCA 3DPKA 3F66A 5ANEA 4L3PA 3WE4A 5IPJA 4ALUA 2ITQA 4AW2A 3F61A 3KVWA 4FE2A 3VUMA 2XB7A 3MFUA 3QKKA 3RK7A 2ITTA 4XOYA 3KMUA 4Z3VA 3DB6A 3ORXA 4L46A 2PHKA 4CVAA 5CY3A 1ZMVA 4ZY4A 4E4XA 1DI8A 2C5YA 3F9NA 1J1BA 3OXTA 4XLVA 3TXOA 4EH9A 4BIEA 3PXZA 2QODA 4LOPA 1IG1A 5DEYA 1XH6A 2UVXA 3NWWA 4IZ5A 4FT3A 2QOLA 2XNMA 2PVLA 4XJ0A 1OL5A 3PLAE 1JNKA 5AR3A 5EQYA 3WZUA 3MFSA 2X7FA 3UOKA 1XWSA 3I5ZA 3AD5A 3H0ZA 2WNTA 3LFNA 4FEQA 2XBJA 3MDYA 2X4FA 4AF3A 1W7HA 2VO3A 1UVRA 3BHUA 3HL7A 2WMWA 4OTRA 3UC3A 3QUEA 5T68A 2VO6A 1OKYA 4D4VA 5IQIA 4I6HA 2ZV8A 3DS6A 4AW0A 5F9EA 3G9LX 4JRNA 2C6DA 4IX5A 4CFXA 3PUPA 3IDPA 3UOLA 2X7GA 1YHSA 3D15A 4NTSA 5JH6A 4TWPA 4H39A 4OTDA 4U7ZA 3JS2A 3OZ6A 2W1ZA 4DEAA 4QT1A 3DOGA 5FP6A 4EOMA 3DK6A 2C6MA 3IO7A 4NFMA 2VTMA 2XNOA 3P86A 5I9WA 5J9LA 2XJ1A 2AC5A 3GCUA 3VWAA 5H9BA 3LJ1A 2R3NA 2XS0A 3R1YA 3KF7A 4D1SA 3ZC6A 3V6RA 3ZRMA 3LM5A 4E4NA 3OCSA 4JRVA 3OP5A 5D12A 4FTUA 4GT3A 4OTGA 2W05A 1Y6BA 4W9XA 4RIYB 4KRCA 1WBVA 4RVLA 3QTXA 3QRUA 4YTCA 3GU7A 2QC6A 5CLPA 4D2PA 2YM5A 3S3IA 3VN9A 3OBGA 2QOKA 4G5JA 4K33A 2JGZA 4OUCA 4QQ5A 2QOIA 1BL6A 4X2GA 5LVNA 2C6EA 4PMMA 3PTGA 5CT0A 1SMHA 4YLKA 4YZ9A 5I9VA 2YM4A 2EVAA 5GJDA 3DFCB 3Q32A 4MXAA 1NXKA 5ACBC 4QMSA 4ZTSA 4JIKA 3ZRKA 1UWHA 1PMNA 4K0YA 4G5PA 2XMYA 4X3FB 3WIGA 5C4KA 5JFSA 3FAAA 3KMWA 5K5XA 1F3MC 1XHAA 4P4CA 5E90A 5CEMA 4QMNA 3FSFA 4ITHA 4AT3A 3F69A 3EB0A 1HOWA 4UB7A 4E5BA 4DFBA 1YWVA 4FSZA 4HYIA 4TYGA 4EI4A 3FMDA 1XH8A 4OBOA 1RE8A 2PVKA 5A4TA 1MP8A 3CCNA 4QPMA 3ZC5A 1ATPE 3UG2A 3QUPA 5HNIX 4N6ZA 1FPUA 5C01A 3QGYA 3TEIA 3CY3A 4F65A 3D94A 4C4IA 5KBRA 3GENA 3FI8A 1IR3A 3LXLA 3PIYA 3W2CA 4W4YA 1F5QA 3FLQA 5LVLA 1WCCA 3F2NA 3O17A 3IW6A 4OTWA 3UOJA 4USFA 3QAME 5AP4A 2LGCA 5D7VA 2IZRA 2I0EA 3ROCA 2OLCA 2ERZE 2VV9A 3HV6A 2J2IB 3L9MA 1YDRE 2C3KA 5AP0A 5T3QA 3WZEA 5DR9A 4YR8A 2OBJA 5LWNA 2P2HA 2PL0A 4RWIA 5J1VA 2BPMA 2FSTX 4IXPA 4FK6A 4ANOA 3G6GA 4TYHB 5FGKA 1DS5A 4KBKA 4WNOA 1CMKE 2O5KA 2PVRA 3NS9A 5A46A 5LQFA 5T6KA 3NYNA 4YJNA 2HK5A 4NTTA 4K77A 3SLSA 4BDCA 4E20A 3EL8A 4KRDA 4YC6A 3UP7A 4HYSA 4J52A 3A62A 3BKBA 3MY1A 4F70A 5KBQA 2VWWA 4FICA 3EQGA 4PV0A 2UW9A 3QZIA 4FV3A 3RALA 3DZQA 4TNDA 4E6AA 4YC3A 4C36A 5DRBA 5K0XA 2QOOA 3UZTA 3DT1A 5CEPA 3F7WA 4X2FA 1KE7A 3DBQA 3ALNA 1GAGA 4DGOA 2JAMA 4O0RA 2QLQA 4FVQA 3PPKA 5C8MA 3QC4A 4RIWA 2CKOA 1ZXEA 3O2MA 4QP3A 5AUVA 1NT2A 2YAAA 3HAVA 3W33A 3OROA 4G2FA 2HW6A 5EKOA 3R7VA 3WZKA 4IDVA 4C57A 5IEYA 4FKVA 3P5KA 4QNYA 4EOLA 1V0PA 4KUJA 3OWLA 3ATSA 2NPQA 5CNNA 3FI4A 5JN2A 3SW7A 4CKRA 2ZMCA 1ZARA 3DJ5A 5D41A 3E8NA 4PF4A 4TWCA 5CEQA 3DBFA 3IDBA 1NVSA 3HGKA 3FMKA 5HX8A 1NY3A 3BGPA 2QG7A 3PFQA 2YM3A 3AG9A 4DCEA 4H58A 1OBDA 5AP2A 4F7LA 4J96A 3WZJA 2BIKB 4IVCA 4RX9A 1JWHA 3FEGA 2UZTA 4RX5A 4D1ZA 4KA3A 3G0FA 3WILA 4IZYA 1UNGA 2J4ZA 2HOGA 4C38A 3RHKA 4BWPA 1PXJA 4I3ZA 2OO8X 3QX2A 5KMLA 1O6LA 3VUGA 4EK5A 4NU1A 3NIEA 1RJBA 2GFCA 3Q04A 2EXEA 4W4WA 2OFUA 4HYUA 3NUYA 4AOIA 4ACDA 3PA5A 4YURA 4RZWA 5J7BA 1ZY4A 3RJCA 3C0HA 3CE3A 3I7CA 3RPVA 2IVVA 3RPYA 3OFMA 3DBEA 5IQGA 3U8WA 3FLWA 4ZLZA 4MH7A 4EHZA 2E9OA 3TJCA 4E6CA 4AGUA 4H1JA 4ACMA 5L6PA 3E64A 1H1WA 4FNZA 2IZTA 3CKXA 3U9NA 4C59A 2PYWA 3VBQA 4N70A 3LIJA 3WOWA 4DEGA 4FV9A 2VTOA 3MVHA 4WRSA 3V5JA 4F7SA 4WUAA 2W9ZB 3MIAA 4IB5A 3ORMA 2XYNA 3VS6A 3W1FA 4FX3A 1YXUA 2FA2A 3NZ0A 1FQ1B 4A07A 2OXYA 3RPRA 4RJ6A 1ZMUA 4GUEA 1ZZ2A 3ZDIA 3MH3A 3GCSA 5ANJA 1ZMWA 2VWXA 3UNJA 4C8BA 5BUEA 2GU8A 3Q9YA 2BKKA 4ERKA 2W4JA 3C5IA 5TKDA 4JOAA 4P5ZA 3CR0A 4C35A 1E1VA 2X39A 4ORKA 4YUQA 4ITJA 5DG5A 5M07A 4HGSA 3PZEA 3RZFA 3P4KA 3ZLSA 2WQBA 4EH6A 5M57A 2C1BA 3LMHA 2UZOA 2BRMA 3M11A 4EOKA 5J5SA 4KS7A 3V8TA 5KZ0A 3VHEA 1JSUA 5E8TA 3BGZA 1JQHA 4KIPA 4NCTA 4IX6A 2OZOA 5HCZA 4F1OA 4FUXA 3CTQA 3COMA 2C5XA 1UA2A 3F7ZA 5HVKA 1IRKA 4XCUA 1OL2A 2JKOA 4IWPA 3G6HA 4UZHA 4XV9A 4YO6A 5CI6A 4IACA 4ACCA 3TUCA 3MFRA 5IA5A 4MXOA 3U6HA 3U54A 1DM2A 5J9ZA 4BDJA 4E6QA 4O2PA 5DGZA 3VUKA 4BGHA 5KMNA 2IW6A 2GSFA 4RC3A 1OGUA 3ORIA 3VS7A 1FMOE 4O7VA 3EQPA 3BHTA 4BR3A 5KZIA 1ND4A 2PUUA 2HIWA 3SW4A 1PXKA 4ZAUA 5H8GA 4KSPA 5J8IA 2UZBA 2A27A 3H10A 3PLSA 4R3PA 4UMTA 2CCHA 5CXZA 2R3JA 2JDTA 1REJA 2NNWB 4O84A 2JLDA 1RQQA 3KC3A 3VBVA 2Y4PA 4MXXA 4CZYB 2YERA 3BEGA 3CD3A 2J0JA 3UQFA 2HZNA 3JY0A 2JITA 3PXFA 4FSYA 4FZAB 4G16A 3HVCA 2Y4IC 3IG7A 3IOKA 3FXZA 5TT7A 4FTLA 4M69A 4DT9A 4A4LA 3LAUA 3PY3A 5E8SA 4F0GA 4I6FA 5JRQA 4IIRA 3N4VA 5IQFA 4DH8A 4MBIA 2JC6A 3EQRA 2JKQA 3KU2A 4KKHA 3FKLA 2QVSE 3AT2A 1VZOA 3KL8A 4PY1A 4ALWA 3QCXA 3R30A 4YJTA 4RSSA 5IF1A 2G9XA 3WIKA 3ZRLA 4G3CA 5CSVA 1BYGA 5E1SA 4AN9A 2UW7A 4KABA 4D28A 5CSPA 5BYLA 3COHA 3LQ8A 4IAAA 3BWFA 5DT4A 5L6WL 1TQPA 1UU8A 2BKZA 4FKLA 5CF8A 4MWIA 5HU3A 1AQ1A 4C4GA 3Q9ZA 1Y57A 3CQWA 2OIBA 1JKKA 4DGGA 5JFVA 4CKIA 3IOPA 4GFMA 4BCIA 3VS5A 4RJ7A 2EXCX 4B8LA 4GSBA 1KV2A 3FQSA 1ZOGA 4RJ8A 1H01A 4UYNA 5LARA 1ERKA 4O7ZA 2OZAA 3VUTA 3QKLA 3MGYA 4UXLA 4BZDA 4PP7A 4BHZA 2F7XE 4O7TA 1HCKA 3NCGA 2XNPA 3C4XA 3LLAA 4OLIA 4M14A 3PE1A 4X2JA 3TNQB 4FV1A 4TXCA 3UIXA 2P3GX 3KFAA 4U97A 4UZDA 4EKLA 1OIUA 4I93A 3F3TA 3UMXA 4BFMA 4QMVA 4DFUA 4L3LA 3A2CA 3C5UA 3G9NA 4QYEA 2UW3A 2PUNA 4GT4A 1IEPA 2PK9A 2YN8A 3Q3BA 5EYDA 1CDKA 5AUXA 4EUUA 4ZY6A 5CWZA 4JR7A 3W16A 4IE9A 3FUPA 4IM3A 1HCLA 4GT5A 4I22A 1W0XC 5K3YA 4D4RA 3K3JA 3EN5A 3NAYA 3D5WA 4RIWB 1AD5A 1XBBA 4N0SA 3R0TA 4F4PA 4M3QA 1IA9A 4CSVA 3O23A 4P90A 5GJFA 3V8SA 2O65A 3GC9A 2G1TA 4BDDA 3HMIA 3L8SA 4IHPA 4MF1A 3ORZA 2XYUA 4JAJA 3R8ZA 4RRVA 2WU6A 4XP3A 3FXWA 4UALA 4XYFA 4BDGA 4AW5A 2WO6A 3BV2A 4YPSA 3SQQA 1ZY5A 4I41A 4EOIA 3CPBA 4HVHA 1G8SA 2VRXA 3DDQA 2XM9A 5AWMA 2ITOA 4M12A 3L9LA 4J53A 4KNBA 3FI2A 4MD8E 2QO9A 2WMSA 2ZVAA 4PQNA 3OY3A 3F2AA 4QMOA 1LEWA 4EBWA 4U43A 4Z7GA 4S30A 3KCFA 1ZYLA 3HRFA 4YNOA 5HG5A 3KREA 3N4TA 3WE8A 1WBWA 3A61A 3EYGA 2GCDA 3OWJA 4HOKA 4MXYA 4DH5A 3W2RA 4XMOA 4ZP5A 3E7VA 2UW5A 4UMUA 3VJOA 3SOCA 5HD4A 4PTEA 1Q5KA 1CSNA 2X9FA 2VWYA 4ACHA 2X0GA 3Q5ZA 4FL2A 5BVFA 2GTNA 3I5NA 3TZ9A 1FGIA 3RMFA 3HZTA 4FSNA 3POZA 4APCA 4IANA 4U41A 5HQ0A 4ZSEA 4LM5A 4L53A 3MH0A 4C02A 4HVSA 3FHRA 3OT8A 4FKSA 4E73A 3NR9A 4O0VA 1PY5A 2BALA 2QQ7A 3A4OX 3UE4A 4FTIA 4FTAA 4CFUA 4ANQA 4AG8A 3V5WA 3TT0A 1FVTA 3F5GA 2AC3A 4A4OA 3MW1A 3QA0A 2A1AB 4CRLA 5BNJA 5IH5A 2UZUE 4JX3A 5JQ8A 3KGAA 2I0VA 2ONLA 3VF9A 5CXHA 3EN6A 3P78A 4WBBB 3PWDA 2XK8A 3O7LD 1U54A 4PRJA 4DFLA 3QXPA 2XJ0A 1M17A 2BR1A 1ZZLA 2PTKA 5CS6A 3PXKA 5HD7A 2OXXA 5IUIA 1YHVA 5EHOA 3QCYA 3D2IA 2C47A 5HCXA 4L43A 3FZRA 3MS9A 3Q9WA 1J1CA 1UKHA 3QTIA 5HE3A 5LVMA 1XBCA 3WYXA 2IN6A 4RIXA 2WQNA 3LZBA 3NUUA 3T9IA 4F09A 4NYEA 1V0OA 5KMKA 5AUTA 2WEVA 3DKGA 2QCSA 1RDQE 3M42A 3WF9A 2X1NA 1Y6AA 5E8XA 2GMXA 3D83A 3VBYA 3JXWA 2Z7LA 2HWPA 5DVRA 3I0QA 4XUFA 4D55A 2JIVA 2J0LA 2BIYA 2R3HA 2ZDTA 4WNPA 4X3FA 4D2VA 2VWIA 3LOKA 3GOPA 3PZHA 2Z60A 1DI9A 2GFSA 3PVGA 3V5TA 5L2SA 2XKEA 3EOCA 1BI8A 2CLXA 2BZHB 2OJGA 3KA0A 4AAAA 4CLIA 3KY2A 3HKOA 4QP8A 4RG0A 3ZO3A 2R5TA 3H9FA 2WU7A 5AIKA 4A9TA 2QKRA 4AUAA 4M7IA 5IH4A 4D0WA 4R7BA 3FZTA 5GZ8A 2QHMA 2YISA 5IMXA 4HZSA 4MKCA 5H8BA 2JIIA 2FVDA 2WFYA 4FTJA 4XG8A 5FDXA 5DT0A 3DZOA 4JBOA 4D2TA 4G6OA 5L8LA 1PKGA 4NIFA 2BCJA 4AU8A 2DWBA 2GQGA 5BYZA 3ZH8A 3OCTA 1OI9A 2WQOA 1GIIA 4O86A 5JKGA 4C58A 4O21A 2B54A 3GCQA 3E3PA 5KMIA 2VTLA 1W82A 3O0GA 2YFXA 4G3DA 3EFLA 3LW0A 1KSWA 3IW7A 3R8PA 3UBDA 3QQUA 2UUEA 4EWHA 2GHLA 4KB8A 3A7FA 4NKAA 4A06A 5KHXA 3DNDA 4PPCA 3OMVA 4PNIA 4BBMA 1R0EA 3A7JA 3NYOA 4D9UA 2X7OA 2OWBA 3QQHA 5LMKC 3SA0A 1G3NA 3MIYA 4UY9A 2F57A 2PZ5A 4TYHA 3NYXA 4M69B 5LXMA 4ZMFA 5IQDA 4KBCA 4R6VA 5ANGA 2R0IA 1J7IA 3DDPA 3OF0A 2E2BA 2W9FB 5DE2A 4EEVA 2C5OA 4ZY5A 2YCQA 4FV2A 4BIDA 3D0EA 4FG8A 4FKRA 1FBNA 4EYMA 3HAMA 4GJ3A 3E88A 3WARA 4I0RA 4BKZA 4IM0A 4V01A 3DLSA 3E8EA 2RFEA 3LFDA 2EUFB 2I0HA 2XCKA 4FSRA 5K9IA 4DCAA 3PVUA 5HIEA 4EWQA 2UW0A 3U6IA 3KB7A 4GFOA 4RVTA 4XP0A 4EQUA 4QMQA 5CEKA 1FGKA 1W84A 4IVDA 2XEYA 3VBWA 3K5UA 5C26A 4IVBA 1H0WA 1GZKA 5AR7A 2OZAB 2UZNA 3C0IA 4TWOA 4EOOA 2VTQA 3C4CA 2C0IA 4GU9A 4NWMA 4Q5EA 4YZNA 4EZ5A 1YI6A 3LFEA 4H3BA 4BY9E 3P0MA 5HNBA 2XF0A 4HVIA 4Y73A 3TI1A 1NVQA 5AUWA 4C0TA 3NUAA 4PL5A 2XBAA 3L8PA 1OUYA 2WTDA 2JEDA 4AFJA 3QZGA 3RGFA 4C61A 2OFVA 2F49A 4FV5A 2Z2WA 4FKGA 4O6EA 3TV6A 2VGPA 4RJ5A 4O27B 4C4HA 3KMMA 3OXIA 3I7BA 3MSSA 3P7CA 3ZHPC 4LRMA 5I0BA 3PJ3A 3V5QA 3E93A 1R1WA 3FZ1A 3V5PA 4R8QA 1LUFA 3NGAA 5L2QA 2C30A 4PDYA 2WAJA 3V04A 3EQBA 1SNUA 2P55A 4LFIA 2W1FA 2Z7QA 4M97A 2OGVA 4FIEA 4K8AA 5AP7A 2UVYA 3EQFA 3DBCA 1K9AA 3RWQA 1I09A 3FLZA 4L68A 4YSMA 4ZLOA 5EOBA 2RFDA 2ACXA 4BTJA 4G3GA 2F9GA 3EFKA 5L8JA 4FTQA 2LAVA 2R3PA 3CGFA 1LR4A 4HGTA 2XRWA 4RQKA 3FLSA 3I6WA 4IEBA 2RFNA 4O6LA 3E5AA 2WB8A 4FKQA 4YNEA 4EUTA 4F9YA 4F0IA 1VEBA 2JKKA 2WMVA 3QRTA 5E8WA 3RBWA 4DINA 2E9PA 3VIDA 3MYGA 3R00A 1AGWA 3SD0A 3PDTA 3CJFA 5FM2A 4RT7A 3PJCA 5A54A 2R0UA 3CD8A 2ETRA 5AR4A 2WIHA 3NNXA 3OTVA 3R1NA 5DRDA 4ZSJA 1GZOA 5AAGA 3QGWA 1APME 4YTFA 3ZM4A 3VQHA 1KE9A 4YBJA 4PTCA 5IMEA 4OAVB 2H96A 4JG7A 2ITXA 1Q8ZA 2XCHA 2XIZA 2HW7A 3AGMA 4PMSA 3C1XA 3PWYA 4YJRA 4G9RA 4F9WA 3F3WA 4D2RA 3I79A 3CEKA 4YP8A 3HEGA 4LGDA 4TYJA 1M7NA 4F0FA 3R04A 5DLSA 3ZTXA 3DXPA 1YWNA 3H30A 1ZAOA 2VTIA 3FQEA 3LJ0A 3BU3A 4GU6A 5CENA 5B7VA 2PE2A 4ENYA 4PDOA 3W32A 1UU7A 2W1IA 1H08A 2YJRA 1ZWSA 2ZM1A 3EZVA 4AT4A 4OW8A 4EK3A 1Q8UA 4YU2A 2W1HA 2AUHA 4GJ2A 3RPSA 5KKRB 2VTSA 1V1KA 4J1RA 3R63A 4PX6A 5HIDA 2X2MA 5K4IA 3VS4A 3ULIA 4IMYA 4PNKA 2VTNA 3VJNA 4TN6A 5HEZA 3PE2A 3Q2JA 4X2KA 3A7IA 4HW7A 3OEFX 5ANOA 5HG9A 3ZO2A 3S0OA 1J3HA 1U54B 4JBQA 3DV3A 3PPZA 4FTNA 4WNKA 5ANIA 5JT2A 4O7SA 3TDVA 3BPRA 5JGBA 1M2RA 4EH7A 3E92A 3R8MA 2VWZA 4WSQA 5A4LA 4QMLA 2WOTA 3TNIA 4FGBA 5D1JA 2B9HA 1XBAA 2PVMA 4O1PA 3BYSA 4RIXB 4XRJA 5TF9A 3UDBA 4BDEA 4GG5A 3RK5A 1JVPP 5EDRA 3HYHA 4DFXE 2RG6A 1U59A 3U4WA 2GHGA 3QHWA 4CCUA 2BRGA 1Q97A 2IVSA 1T46A 2GDOA 4EKKA 2XA4A 3EFWA 4QRCA 3FXXA 2FO0A 4GIIA 4IAZA 4R1VA 3TTIA 1O6KA 3LFBA 5HTBA 4GKIA 4GVJA 5CQWA 1YWRA 5H3QA 4FTKA 1Z9XA 1OECA 5CZIA 4CMTA 3V51A 5BMMA 4QQJA 3VW8A 4AS0A 4FT5A 3R1SA 3PXQA 5FUTA 3MPMA 2ZOQA 4YC8A 2YHVA 4B4LA 4XG7A 1A9UA 2GHMA 4OTHA 3RNIA 2CKPA 4ZTLA 3Q6UA 4A7CA 4QQTA 4MBJA 2VTHA 4MXCA 2C69A 5CYIA 3N4UA 1GIHA 3UZPA 4GKHA 4X6QC 3CP9A 4TY1A 4NIFB 3MWUA 2XK4A 3NDMA 4L3JA 3AXWA 4TYEA 5AX3A 3SXFA 3L9PA 3TZMA 1BI7A 3T3VA 2PUPA 2WQEA 4R77A 4AGWA 5BPYA 3P9JA 2UZDA 1WBSA 3ZSIA 1OVEA 4LRKA 4BBEA 4U5JA 3IKAA 4C3FA 2I7QA 3AC4A 3BZ3A 3MVJA 3QD0A 5EFQA 4WG3A 3AC8A 2GNJA 2I40A 4YLLA 4CV8A 4IX3A 4XG9A 2X4ZA 5EI6A 4AE9A 5HORA 5M51A 5J1WA 4XEYA 2JFMA 3QC9A 1XJDA 3AC2A 3NNVA 4D1XA 3B8QA 3EKNA 4NM7A 1H4LA 3ORNA 4YPDA 1OBGA 2OIDA 4GK4A 1E1XA 2XUUA 3Q52A 5DHJA 4KD1A 5EQEA 4QNAA 3CSVA 4ZJVA 3DQXA 1UNLA 1WFCA 4YZMA 1KV1A 3SRVA 2H34A 5HKMA 5GZAA 4O7NA 1Q8TA 4BDKA 1JSVA 2W1DA 5FDPA 1YOMA 4ASZA 1G8AA 2C0OA 1TQMA 2CJMA 1X8BA 4BC6A 2RSVA 4MYGA 2R7BA 3G15A 1UNHA 4OTFA 1U4DA 2YM7A 2WXVA 3ZEWA 2OICA 3FQHA 3MV5A 3PSDA 4OBQA 2XIYA 5FRIA 2ZV2A 5I3RA 4ANMA 2W0JA 5K0KA 3E63A 2NRUA 3IS5A 5EW9A 5AEPA 1XH4A 1YVJA 4M84A 4S32A 4JVGA 4BF2A 4I23A 2VNWA 4P5QA 2QR7A 3A4PA 2YA9A 4QP4A 2C1AA 3EN7A 1JOWB 3LXNA 2VX3A 4XNEA 4J71A 1Q8WA 4O82A 3HX4A 4JDIA 1ZYDA 4BDAA 4DLIA 3Q9XA 2WTKC 4AXAA 3UZRA 1SVHA 1W98A 4IVAA 2CGXA 4BGGA 2V55A 3IGGA 4BCMA 4E4MA 5CEIA 5DPVA 3D7TA 2OH4A 3E8CA 2W99B 3BYUA 4I1ZA 4FUYA 3U51A 4JXFA 4B0GA 5IQEA 4QPSA 2IJMA 4AOJA 4EH8A 4I5PA 4WG4A 3PP1A 3SG8A 1P14A 1PW2A 3ELJA 3S4QA 4BCHA 4UN0C 4DGMA 4GV1A 3K5VA 4CZTA 5FBOA 3DB8A 3MH2A 1MRYA 5F4NA 3TV4A 1H28A 2R3OA 3WF6A 3G0EA 4FA2A 2IPXA 4N57A 3LMIA 3GQIA 4V04A 3I4BA 5CASA 4UBAA 2HWOA 2Y6OA 4XH6A 4BCPA 1BLXA 2YACA 3ZYAA 5HICA 5I9YA 4ITIA 3I81A 4FT9A 3BYMA 4GVAA 3QF9A 4EQCA 3NNWA 2UW6A 2Y7JA 4ZS0A 3LM0A 4JBVA 3TUDA 1R3CA 4CFFA 3BQCA 4D4SA 4RQVA 1GIJA 3S95A 4F08A 3QALE 2ETMA 3GUBA 2WMRA 4J95A 4E3CA 5BX0A 1P4FA 2X8EA 4L42A 1NA7A 4AACA 4FK3A 2ZB1A 4S31A 2ZYBA 2P2IA 2CGWA 2C6IA 4O0TA 4FMQA 3QQFA 3ZUTA 4W9WA 4I0TA 2HZ0A 4QO9A 2XEZA 4RWJA 2QOFA 4UV0A 3KULB 4I6BA 3O51A 4ONAA 5JZNA 1H00A 5B2LA 3TIYA 2BFYA 4IB0A 3Q96A 4F6WA 4FTRA 3TM0A 4J98A 4UWCA 2C3JA 2C5NA 5ANDA 3D4QA 4I5HA 4B9DA 4U81A 4BIBA 2A0CX 3DNEA 4WNMA 3U55A 2C3IB 2YCRA 3R28A 2ITWA 3R8VA 2A2AA 1WVXA 2YDKA 3FHIA 2B9FA 2DS1A 2XK7A 3HUBA 4OTQA 4YMJA 4ZZOA 1FVRA 4W4VA 3WYYA 3RNYA 4JNWA 4Z55A 2YDIA 3ALOA 3AGLA 3PIZA 4QTAA 4EH4A 3DK3A 3JY9A 3ODYX 4IFCA 4FSMA 4XG2A 4BCGA 3NUSA 4YTHA 3G2FA 5E8YA 3ZO4A 4U3ZA 3ZUVA 3LFSA 5CSWA 4YJVA 4BZOA 1YXXA 4JQ8A 3UG1A 1WBTA 2YCFA 3QTUA 4Y8DA 1SYKA 2VX1A 2KULA 2B9IA 2WMBA 4DITA 4C62A 2XK6A 3QTSA 2HY0A 4S33A 4RWLA 4WA9A 4EORA 3UO4A 3R9DA 4U44A 3U6JA 4RVKA 4U6RA 4CD0A 2G2IA 3ANRA 3F88A 1YI3A 4CEGA 3SG9A 4DT8A 5CTPA 4BDFA 2CN8A 3K2LA 4E4LA 5HLNA 1Q4LA 3Q4ZA 4F99A 5B2KA 2HXQA 3FMLA 2CMWA 4DH1A 4TT7A 3O8TA 4J8NA 1VYZA 4LMUA 2R3RA 2B52A 4HJOA 4L8MA 2CPKE 3CS9A 5HE2A 3R8LA 4AA0A 5CAUA 5A3XA 2HZ4A 2EU9A 3E7OA 4J99A 4IAYA 1R78A 1OZ1A 2YEXA 5GHVA 2Z02A 3C9WA 3BLQA 3Q6WA 3PSBA 4QP1A 2CKEA 5DH3A 3U87A 2FH9A 4FKPA 5CEOA 2HYYA 2FSMX 4ZTNA 2O2UA 3LFQA 2Z7SA 5LWMA 3OOMA 1OIRA 3TCPA 3OWKA 3UJGA 4XBRA 4FIGA 4F1TA 1BL7A 3EQHA 2ZJWA 3PXYA 3W55A 2DQ7X 5EDPA 3R7IA 4ACGA 3TJDA 4BHNA 1M2PA 3I0OA 1LPUA 4YZBA 1FMKA 4IJ9A 1YXVA 2ITZA 2O3PA 3AC1A 4PL4A 4PPBA 5CU3A 1ZRZA 1ZYJA 5IISA 5FTOA 3S1HA 4PUZA 1EH4A 1G5SA 3TNPC 3RM6A 3LFFA 5AAFA 5CX9A 3VC4A 2YM8A 3THBA 1BX6A 3EN4A 3MB7A 5LJJA 3VS0A 4LI5A 4DG0E 4Q9SA 4E26A 3NX8A 2WMQA 2JDSA 3BBTB 1H25A 2BRBA 5GJGA 5FTGA 2B55A 5AR2A 5CNOA 4KIQA 3MESA 5HVYA 1OKWA 3EYHA 4EHEA 5CU0A 4JIAA 2J0KA 3MPTA 4USEA 2XNBA 4RZVA 5DEWA 5AP3A 4NFNA 5EHLA 3OUNB 4ZEGA 3HV4A 3ZUUA 4Z16A 2H6DA 4UXQA 3OT3A 3NPCA 2YIRA 3W2OA 4HVDA 4O38A 3ZFMA 4IX4A 5FG8A 5ETFA 4BDBA 5F20A 3VS3A 3QHRA 2B7AA 4FR4A 1CKJA 2PY3A 5EI8A 4FG7A 2XRUA 2GS7A 4FNXA 4Z7HA 1OKVA 5DI1A 4X3FC 5DNRA 2GQRA 1GOLA 1JKTA 3SRVB 3ZCLA 4M13A 3U4UA 3ZU7A 1NW1A 2XIKA 3NYVA 4FYOA 4IBMA 3QQGA 4KKGA 4FKIA 4M15A 4XV1A 5AV3A 3RZBA 4ALVA 5CF4A 1JLUE 3HECA 3JUHA 3H0YA 1OKZA 2X9EA 3AMYA 2WTIA 3IK3A 3MTFA 3QFVA 5I5ZA 2QD9A 4AP7A 3TKUA 3NUXA 5J9YA 4D4YA 3T8OA 5E91A 5EM6A 3RCJA 4NSTA 4R78A 2R3MA 3FY0A 5FBNC 5ETAA 5EOLA 4RFMA 3TZ8A 4ASEA 1H8FA 3R21A 4G3FA 4OTIA 2XKDA 3BHYA 5EYKA 3UVPA 2E9VA 3IECA 3QUDA 3LQ5A 1VJYA 3L8VA 2HXLA 5CSHA 3SX9A 4EK6A 3KRWA 4H36A 3D5XA 1WZYA 3OBJA 5HI2A 3BX5A 2B53A 3LFAA 2UZWE 3OS3A 3PJ8A 3QCQA 3QL8A 5EM5A 3RKBA 4EOQA 3MN3A 3TNHA 3VS2A 4BTFA 4BWKA 5L4QA 1GZ8A 3LHJA 4FKJA 4KIOA 3ZLXA 3HMNA 4GRBA 5J95A 2QOCA 4FTOA 3KXHA 3D7TB 3QWKA 4MNFA 4QYHA 2YITA 4YO4A 4H3PA 1YKRA 3ETAA 1W8CA 3OCBA 4BKYA 3L8XA 4TRLA 4WHZA 4YHJA 3BCEA 2IW9A 4DLJA 3KRJA 4WOVA 5BVWA 1B39A 4IC7A 4F1MA 3DU8A 2C3LA 2Q83A 4GK2A 5DR6A 3ZZEA 3ZXZA 1H1QA 4Y72A 4BL1A 3ZEPA 4JX7A 4MF0A 4LRJA 4V05A 3NLBA 4FGRA 4LQMA 5TR6A 3VQUA 2F2UA 2ZM4A 3R22A 3BI6A 4C2VA 4JS8A 3KQ7A 2ZV9A 2Y9QA 3AT3A 3P7AA 5IKWA 2PZIA 4O0SA 4CFWA 3FV8A 5EI2A 4Y46A 4JR3A 4AZEA 1OPKA 4CQGA 5JK3A 3C13A 5AUUA 1OM1A 2P33A 3F5PA 3A8WA 1CM8A 4WSYA 3TTJA 3OCGA 3PRFA 5JSMA 4BI1A 3RINA 4E5WA 3IPHA 3LCTA 4X6RA 2UVZA 2B0QA 5AP5A 2ITUA 3EFJA 2C6OA 4AA4A 3DCVA 4X7QA 3EQDA 4F9CA 3RAKA 4GIHA 3H4JA 3HMPA 4I94A 4JQ7A 2NRYA 4M67A 3EWHA 2XZSA 3COIA 3PSCA 4FZDB 2OF2A 1B6CB 3DTCA 3R1QA 4Q9ZA 4UWYA 5A9UA 3GFWA 3F3ZA 4O7LA 3R6XA 4JDJA 2Q0BA 3UP2A 2BRHA 2GPHA 4EYJA 3ATTA 4JL9A 3NUNA 5CZHA 1L3RE 3ZXTA 3OHTA 3I60A 3BYOA 4FSUA 2C4GA 2O8YA 2JD5A 4AZTA 4G31A 4WBOA 2X6EA 4O7WA 4EHGA 2RGPA 4E5AX 1YRPA 4JJRA 4AQCA 5A4EA 4OR5A 4FSTA 3SV0A 3UO5A 2QU6A 2X8IA 4KS8A 5HTIA 3QTWA 4F6SA 4BWXA 2RFSA 4OAUC 5KHWA 4I6QA 1P2AA 1VYWA 4FV7A 2W5AA 5E8UA 5L8KA 2BROA 3R9HA 4DH7A 4C37A 3DJ7A 3FMJA 1PMUA 4GMYA 5E7RA 5E4HA 1UU3A 4YJPA 5IQHA 3ZBXA 5D11A 3P23A 1Q99A 4I24A 4PP9A 5G6VA 4AWIA 4D2SA 5L2TA 2W5BA 1YI4A 3G33A 5JGAA 5IA4A 3RK9A 3RAWA 1H1PA 2YWPA 2W5HA 4CMOA 3GI3A 4ZIMA 5C8NA 3F2RA 1CKIA 1Y8YA 3NW5A 3QYWA 2IZUA 3GCVA 3CC6A 4RC4A 4AZWA 5ETIA 4MNEA 4NJDA 3B2TA 1FINA 1PXMA 1MQ4A 4L6QA 5D7AA 5D10A 2GS6A 5HO7A 3C4WA 1PHKA 2CGUA 5HU9A 3MH1A 5DR2A 1YXSA 3VW6A 4GH2A 4Y85A 4D5KA 4F9BA 3ORLA 3CQUA 4WD5A 3G5DA 3IW8A 4GCJA 4ZXTA 3ZOSA 3W2SA 4QMYA 2Z8CA 4I20A 3G90X 3BE9A 2J90A 3O8PA 3GU8A 4FC0A 3BBWA 5CU2A 3W18A 2BDWA 3W2PA 4DEDA 1JAMA 4X0MA 4PMPA 2ZAZA 4RIOA 3JYAA 4RVMA 1OITA 5HG7A 5IH6A 2A4LA 5BUIA 1MRVA 5EW8A 3MB6A 4EZ7A 5E9EA 3ZFXA 2YLFA 3OVVA 3FKOA 3MTLA 4DC2A 1QPJA 2WTVA 4IAIA 1GZNA 1BMKA 5KMJA 3HRCA 4I21A 1P4OA 4O7YA 4EZ3A 3R2BA 2W1CA 3NCZA 5HO6A 1PMEA 2PMOX 2WHBA 4FKUA 3TN8A 3ZLWA 3IQ7A 3GQLA 5BVNA 1Q8YA 2ESMA 3AOXA 3JPVA 5FTQA 5JQ5A 5M4CA 3IGOA 1WBNA 2PMIA 3POOA 2H9VA 3MVLA 3Q5IA 4RX7A 1B38A 4MCVA 4MAOA 3NSZA 4O22A 1H07A 4KBAA 4Y95A 4M8TA 3PJ2A 2WTWA 4JBPA 1Y8GA 4YHTA 4C4JA 1QCFA 1UV5A 4M68A 5AMNA 4ZOGA 4YZDA 4KWPA 4QP9A 2VZ6A 1CKPA 4B8MA 4MBLA 3ITZA 3E87A 3FZSA 5AA9A 2W06A 3C0GA 4HNIA 4TYIA 3TG1A 4TL0A 4L7SA 3FC2A 3N51A 2OJFE 1Q41A 5EM7A 4E93A 4P7EA 4QYGA 3ACKA 3BE2A 5EH0A 3T3UA 3V3VA 1XH9A 3C4EA 4R3CA 1H27A 1IAHA 2X6DA 3E62A 3II5A 5CAQA 2PSQA 4LYNA 2O0UA 3HA6A 5A6NA 3VVHA 3C51A 4FV6A 4E7WA 5BQ0A 3EZRA 2BHHA 3SKCA 2PVJA 1F0QA 2OF4A 3UMWA 4QTEA 1Q62A 3QQLA 4FEWA 4YGAA 3ZMMA 2YJSA 3UC4A 5CAOA 3HUCA 2VWBA 3KXXA 4Z9LA 3RAHA 4ZSAA 3FSKA 4O91A 4LL5A 5HTCA 3C50A 5JRSA 1UWJA 4LOQA 3BRBA 1RW8A 2BFXA 3HDNA 4AFEA 3HLLA 1U46A 3SXRA 2P4IA 4A4XA 1WBPA 3MA3A 5AUZA 5DIAA 5F1ZA 1FVVA 3Q4UA 5FLFA 3PIXA 2J9MA 4L00A 5A14A 3KEXA 4RC2A 1QPEA 2XNNA 3EQIA 4O2ZA 4AOTA 4BCNA 5EK7A 3PP0A 3R7EA 5EQPA 5AV1A 1XR1A 1WBOA 2BILB 5A4QA 1PKDA 1QL6A 2NP8A 3KRXA 2WPAA 4TKSA 3O7LB 4IB1A 2FGIA 2XJ2A 4XOZA 3SAYA 3CLYA 2EXMA 1CTPE 1XH5A 3BLRA 4LV8A 2J0IA 4XX9A 5HESA 4AN2A 2PVNA 4HCVA 2FSLX 5FP5A 4G1WA 3R01A 3UQGA 3OC1A 2PE0A 2YM6A 3QLFA 3PA4A 3E8DA 3UYSA 4NW6A 4HCUA 1A06A 3VBTA 4D2WA 3R9RA 5EM8A 1LEZA 2Y6MA 3FYJX 3KULA 5FWKK 4RA4A 2XKFA 2YIQA 4MX9A 3U9CA 4ZTMA 3LMGA 4LGHA 4FEVA 3P1AA 5DT3A 1Q3WA 2QOQA 4DYMA 3TWJA 1U5RA 5GNKA 1SM2A 2FYSA 5EHYA 2BRNA 4ZS4A 1J91A 4O0WA 2OJIA 3C7QA 4L52A 3TV7A 3O50A 5CU6A 4G6NA 4EK4A 5DWRA 2X2KA 3ZO1A 3VF8A 4KIKA 3W2QA 3FJQE 3GFEA 3BQRA 3ENMA 3GC0A 2WEIA 2RIOA 5HBHA 2GQSA 4FEXA 1UKIA 2IWIA 2YIWA 3CBLA 4E8AA 5LVOA 4DF3A 3LCDA 2F7ZE 5J7HA 1Z5MA 5CU4A 3FPQA 5ICPA 2QURA 1KOAA 1BKXA 2WIPA 4WT6A 3GVUA 5AJQA 4HPTE 4I4FA 3VRYA 4XG6A 2WTCA 3ZFYA 3FMHA 3CJGA 3WF5A 4XG3A 1OPLA 4GG7A 4W4XA 5AR5A 3ZONA 4WUNA 4AZVA 4V0GA 4X21A 1Z57A 2OKRA 4YJSA 4F7JA 4RJ4A 3R7YA 3SOAA 4DEBA 4CKJA 3UQCA 4ENXA 1SVEA 2J5EA 4O96A 5TOZA 3D14A 3D5VA 4NW5A 3SHEA 2Y4IB 3WZDA 2WTJA 5LMKA 2R3LA 3H9RA 5IG1A 2BDFA 4BVUA 5C4LA 2BZKB 4R7IA 4GYGA 4J97A 4QTDA 3RAIA 3UVQA 2W17A 5L6OA 2R7IA 5C9CA 4B6LA 4ANLA 3F3VA 3PG3A 3KXZA 1BUHA 3NUPA 3ZSGA 3A7HA 5E1EA 2QNJA 2GNHA 3WF8A 5C1QB 4LV5A 4ZZMA 2WZJA 2RG5A 3UGCA 4EHVA 5IA2A 4OT6A 4L01A 4P2KA 4F7NA 4IW0A 2ITNA 4HVGA 1KUTA 5KNJA 3IW5A 3IDCA 3TZ7A 2QOHA 5E92A 4GUBA 2A19B 2R4BA 4HPUE 5EYCA 5FD2A 4AGDA 5M53A 1PF8A 4BCKA 2KTYA 2QI8A 5ETCA 2PVYA 4FIHA 5IA1A 3UPZA 4O7RA 5I3OA 2WD1A 3REPA 5AAEA 3CTJA 3NMUF 3SXSA 1M2QA 3KK8A 4AGCA 2PVHA 4MNEB 5ITAA 3EIDA 4FTTA 4G17A 2J0MB 4FIFA 4JQEA 2YDJA 4ASXA 5L3AA 3D7ZA 4UYAA 2OXDA 3BHVA 3R7UA 4IB3A 3DA6A 4XG4A 5DBXA 2OK1A 1OIQA 1ZYSA 5DOSA 2X8DA 5BUJA 4R3RA 3B2WA 4B7TA 3HV5A 4IFGA 4U45A 2ZV7A 4XBUA 5HZNA 3EMGA 1YQJA 3AMBA 1YOJA 3AT4A 4S34A 4AE6A 4APPA 4DFZE 2CN5A 4IZ7A 2YCSA 4GK3A 4I5MA 5KO1A 4QOXA 3GEQA 4CZUA 2YZLA 4D5HA 2G2FA 4FSQA 2WMTA 5TE0A 4DN5A 4FEUA 3G51A 4IC8A 4NJ3A 3O71A 3K3IA 2WMUA 4BI0A 4X2NA 4D58A 2HCKA 3UTOA 4II5A 5EYMA 3TIZA 4RGJA 3KVXA 3FMEA 3RWPA 3GGFA 3TDWA 2BTSA 4QP2A 2V0DA 2SRCA 4EH3A 3TNWA 1URCA 5JZJA 3K54A 3QKMA 3EKKA 1DAWA 2CKQA 5HBJA 1IASA 5LVPA 4DBNA 4JLCA 4TNBA 3LCOA 2G2HA 3RM7A 2YIXA 4NCTC 2V7AA 3IW4A 4NKSA 4CNHA 5BYYA 3P08A 4HZRA 3DXQA 3LKMA 4FZFB
chains in the Genus database with same CATH superfamily
1H1SA 1OPJA 3B8RA 3BIZA 1QMZA 4HNFA 4DG3E 3LPBA 4O81A 4MD9E 5LOHA 1A48A 4OT5A 3QRKA 4RA5A 4HCTA 3SC1A 1T45A 3AD4A 3BV3A 1UU9A 3ORPA 4IWOA 5AFVA 4KINA 4ASDA 3R9OA 3LJ2A 4RX8A 3PYYA 3PPJA 5CF6A 1JSTA 2VU3A 1XH7A 3GU4A 2C5VA 3CGOA 2PMLX 3HMOA 4BTKA 2OW3A 3BU6A 3OXZA 2VNYA 4U0IA 4AAYA 4MHAA 1PRYA 4EOJA 3UIBA 4FVRA 5K5NA 3QRIA 1WAKA 4K6ZA 4O83A 2V7OA 3PY1A 2R9SA 4XS2A 3KKVA 4LUDA 2ERKA 4YJQA 4DTAA 3D5UA 2ZMDA 1H26A 3KXGA 3FLYA 2FSOX 4AX8A 4EJ7A 2QKWB 4TTHB 1ZLTA 3VBXA 3VUDA 2IVTA 3QA8A 4FKWA 1JKLA 2GNGA 4USDA 3VUIA 2YLEA 4GW8A 4BN1A 1PJKA 4BDIA 2UZEA 5I4NA 5GINE 5CVHA 5F94A 3BLHA 3RP9A 5EW3A 5M4UA 3F5UA 3QLGA 3D9VA 3TKIA 4O4DA 2B9JA 4F9AA 3DKCA 5H2UA 3NRMA 4RFYA 3GBZA 4W8EA 3GU5A 4NZWB 4UWBA 4CT1A 5CALA 2QO7A 4TW9A 5CVGA 1IA8A 2VTJA 4Y5QA 3OY1A 3FKNA 4EJNA 5EKNA 1OB3A 3R2YA 1OL7A 5FEEA 3R83A 3NNUA 4QMMA 3CKWA 3LE6A 3DQWA 4ID7A 2DYLA 3FC1X 2C68A 3OG7A 4QMTA 3ZZWA 2W4OA 5HBEA 4ERWA 5CF5A 3EH9A 1M14A 4GL9A 4LGGA 4YJOA 4IAFA 3LVPA 3R9NA 4DGLC 4EONA 3EN9A 3P7BA 4FL3A 4JDKA 5ANKA 5B2MA 3R7GA 2HENA 2X81A 2PZRA 5JEBA 4DE4A 2VX0A 3QCSA 2WOUA 2UW4A 1OMWA 4PDPA 3CIKA 4ZK5A 3UIMA 3DAKA 5LMAA 4FTCA 4RJ3A 5C03A 3CXWA 2QG5A 4I5CA 2IVUA 3UYTA 3QBNA 4K18A 5FM3A 3ODZX 4UMPA 3BL7A 3I6UA 3BELA 4FYNA 2RF9A 3HDMA 2VO0A 4Q2AA 2W1EA 3NVKI 4KIKB 5J87A 2JDRA 5CAPA 3TYKA 3ZM9A 2W7XA 2QONA 3DY7A 5IA3A 2BZJA 4CYJA 1JPAA 1M52A 3HNGA 4MQ2A 1O6YA 3FL4A 3OW4A 5FEDA 3W10A 5JFXA 2YWVA 2YAKA 5M4FA 4MK0A 4QP7A 2BDJA 3C4FA 4ANNA 5M4IA 2JBOA 4PPAA 2CNQA 4IJPA 3DK7A 4U42A 3VAPA 1XMMA 4BICA 3UODA 4BTMA 4NL0A 2OU7A 2VO7A 4FL1A 2J50A 4WIHA 5CSXA 4CRSA 4EBVA 4ZTQA 3PFYA 4V0GB 4I92A 1MRUA 3ULZA 2NO3A 4QTBA 3GP0A 4L67A 5AA8A 4K11A 3ENHA 3TUBA 5ACKA 3GXLA 2ZM3A 3KF4A 4CG9A 2GNLA 3MJ1A 4H05A 4XLIA 3NW7A 4FV8A 5BVKA 4EC8A 4L7FA 4U9AA 5IZFA 3O8UA 3MJ2A 4G9CA 3ID6C 1URWA 3ZSHA 4E1ZA 2YABA 4IZAA 4AXEA 3ORTA 4G34A 2HZIA 2VWVA 3M1SA 3DGKA 2W96B 4FIJA 3FY2A 4LUEA 1KE5A 5KUPA 4G6LA 4R5SA 1Q3DA 2JIUA 4M66A 4N6YA 4J8MA 3UPXA 3S2PA 4QP6A 2XH5A 4DEIA 1IAJA 1PXPA 4PWNA 3FDNA 4JT3A 3PXRA 4BYIA 4CYIA 1R0PA 2JBPA 2PZPA 2PULA 3QTQA 4I6LA 4KKEA 5CT7A 2W4KA 4PDSA 5IQBA 5AP6A 2BTRA 1W83A 3FPMA 1U5QA 2EB2A 4C4FA 2I0YA 3DTWA 4RBLA 4DEHA 3KK9A 1NVRA 3AC3A 4YHFA 1E9HA 2XNEA 4DFNA 3GT8A 5AX9A 3KN5A 2PVFA 2QU5A 4IAKA 1SZMA 4ZSLA 4WO5A 4OGRA 4BBFA 3CTHA 1YDTE 4OTPA 4CMUA 3QWJA 4DG2E 4FZ6A 3AQVA 2JDOA 4DH3A 5KKRC 4B99A 4QMPA 1V0BA 4BZNA 2CLQA 3V8WA 3VHKA 2C6TA 4EL9A 4NUSA 5A6OA 4AZSA 2FUMA 4R7HA 2ONLC 2PE1A 4GS6A 4QYYA 5M09A 4FODA 4NM3A 3P79A 2F4JA 1GNGA 2REIA 5HVJA 1OUKA 3QZFA 4MQ1A 3ZDUA 3FYKX 4D0XA 3MFTA 4L45A 4A9YA 5IQAA 3LXKA 5FXQA 5FXSA 4Y83A 2YIYA 2B1PA 3LLTA 4LG4A 2ITPA 3QXOA 4IWDA 3LCKA 4CGAA 5AV2A 4CXAA 1K3AA 4W8DA 4XV2A 4ZJJA 3QTZA 2RL5A 4CV9A 4FI1A 1MUOA 2CCIA 4RMZA 5CQUA 4DGNA 2PWLA 3BYVA 4K2RA 3KXNA 3RHXA 4FVPA 3KRLA 4QQCA 2CSNA 2VTRA 3EJ1A 5IU2A 4FKOA 1H1RA 5HX6A 3NVMB 5F95A 5EDQA 1P5EA 4R5YA 4QPAA 4CFVA 4CFNA 2EB3A 4FT0A 3F3UA 4JAIA 5HHWA 4BCOA 4PTGA 5BVEA 5KX8A 3OOGA 5AM7A 4XHKB 2I1MA 4L9IA 4BB4A 3MVMA 2C6LA 4AW1A 2VD5A 5HE0A 3W8QA 3HP2A 1WMKA 2ZDUA 2UV2A 4CCBA 5BV3A 2BVAA 4C34A 3DFAA 5IEVA 3CPCA 5JMSA 2PMNX 1YDSE 4WRGA 5KE0A 2WGJA 2BAKA 3A7GA 2E9NA 4FT7A 4U79A 3TKHA 4O1OA 3OW3A 1TQIA 4QMZA 4C4EA 3LQ3A 1YHWA 2CDZA 4J7BA 4RLLA 4QMWA 3I1AA 3MI9A 3QU0A 4FNWA 3UO6A 4E6DA 3DBDA 4FIIA 4S2ZA 3OD6X 3AC5A 4NEUA 3BGQA 3QTRA 1KE6A 2F7EE 2H8HA 3UNZA 1M7QA 1PYXA 2JKMA 5E8ZA 3VRZA 4O0XA 2XNGA 5M44A 5M08A 4A9UA 3A8XA 3QYZA 4ZJIA 1XQZA 2O64A 3P5JC 1VR2A 1GJOA 1PXIA 2R3QA 4O4EA 4R1YA 4YZCA 4AT5A 4C7TA 1XKKA 4IADA 4MEDA 5TO8A 5I9ZA 3HV7A 5H8EA 5IEXA 2WKMA 4AA5A 2J6MA 3GB2A 1K2PA 1H0VA 3PG1A 4ZLYA 1KE8A 4CG8A 4MD7E 4ZSGA 2XM8A 4ANSA 4GEOA 4DHFA 5DFPA 2R3GA 1PXLA 2UZLA 4KSQA 4NM0A 5K4JA 3FL5A 4FV0A 4WG5A 4FF8A 5HG8A 3ML1A 3LCSA 3SVVA 2DUVA 1L8TA 2RKUA 4ARKA 3OEZA 4C3PA 2OJ9A 2ITYA 4BCQA 2ZB0A 3BHHA 3R73A 4MTAA 5FXRA 4MWHA 3W8LA 3ZBFA 2PZYA 3ACJA 3DLZA 4XP2A 5IUGA 4BCJA 4K1BA 4YBKA 5DN3A 1TKIA 4YSJA 3FLNC 2CHLA 2HAKA 1R39A 2IW8A 1ZYCA 1KWPA 3FZPA 3EL7A 4BYJA 2C0TA 5I9XA 3PVBA 2UZVA 2BMCA 2IO6A 2BHEA 4ZZNA 3ZLYA 1QPCA 5DA3A 4NM5A 2WMAA 3R02A 4YLJA 2XIRA 2R3IA 5GZ9A 5KMOA 3QZHA 1Q61A 1ZOHA 3GU6A 1J7LA 5EG3A 1YXTA 3FWQA 4G3EA 4RPVA 5AV4A 5IDNA 4DTBA 4ZTHA 3V5LA 4TWNA 4CQEA 4FNYA 3QD2B 4X3JA 4MXZA 3WI6A 1YW2A 2E9UA 4TZRA 2QOBA 3COKA 5HE1A 5HLWA 1Y91A 3NFGB 4EH5A 4F63A 3MA6A 2BAQA 3UVRA 3PJ1A 5HNGA 2BUJA 5HO8A 5E8VA 4I4EA 1PXNA 2PU8A 3DKFA 4H1MA 5HIBA 3QD3A 3VNTA 3L9NA 3KRRA 3V6SA 4F78A 5M06A 3BU5A 5LCKA 3TL8A 1OL6A 3GOKA 3R8UA 4QMXA 2GS2A 3MY0A 5J5TA 2VGOA 4DA5A 4FV4A 4FRFA 4CTBA 5FEQA 4EQMA 2XIXA 3D2KA 1S9IA 3LFCA 5KMMA 1JKSA 4Y5HA 3OUKA 4U8ZA 5AUYA 1YOLA 2G15A 2GTMA 4A9SA 2OSCA 3MBLA 4LOOA 4CFMA 1ZOEA 4M0ZA 3PVWA 2XK9A 3FMNA 4RIYA 4MUQA 2BZIB 1PYEA 2OJJA 3FBVA 4IH8A 2CNVA 4JG6A 3RPOA 2FB8A 3E3BX 3VS1A 2QLUA 3H9OA 3Q2MA 4ANBA 4K9YA 1QPDA 2JAVA 4D9TA 2X2LA 2QO2A 3IONA 2J51A 2YZAA 3WBLA 4C33A 4IDTA 4O0YA 5HCYA 3JR1A 4HYHA 3ANQA 3F5XA 5B0XA 4C2WA 5IDPA 4F64A 3F6XA 3HRBA 3V01A 4JDHA 3HV3A 4RWKA 3VUHA 3MPAA 3S00A 3VULA 4FBXA 3RVGA 3UIUA 4LMNA 2WMXA 2I6LA 2IZSA 2VUWA 1JBPE 3F82A 5HGIA 4CLJA 5GIOE 5AP1A 5DMZA 4FZ7A 4DAWA 4BCFA 2QHNA 1MQBA 2BAJA 3O96A 3R71A 4OBPA 5CAVA 4QMUA 4XV3A 5CI7A 5CANA 5JFWA 2R3KA 1PMVA 1SVGA 4RLKA 4UEUA 4DFYA 2J7TA 2P0CA 4NT4A 4BI2A 4U3YA 4BDHA 5JGDA 2O63A 3AMAA 1WVWA 3JVSA 1I44A 4XRLA 2Y8OA 4UX9A 4QTCA 4YJUA 5L2IA 3BEAA 3FMMA 2HY81 2OG8A 2C6KA 3EHAA 3OTUA 2EWAA 5C8KA 3KXMA 5BVOA 3A99A 4IM2A 2HELA 3M2WA 3FZOA 2WTKB 2CNUA 4U40A 2AYPA 4YTIA 4FOBA 5G1XA 5DYJA 3KN6A 4WKQA 2WELA 1SNXA 3DJ6A 4HGLA 4EC9A 1LP4A 2GNFA 4EH2A 5A4CA 5L2WA 2W1GA 3Q60A 5AR8A 1OL1A 2V22A 2Y0AA 2IG7A 3UNKA 5LCJA 2V5QA 4UMRA 3OWPA 4I0SA 1PXOA 1REKA 5HLPA 3WF7A 5IQCA 4FG9A 3ET7A 3HA8A 3L1SA 2VWUA 4FTMA 4UMQA 3PA3A 3GC7A 3GCPA 5D9HA 3ROYA 5C27A 3QX4A 4M0YA 5AV0A 3NIZA 5KCVA 1TVOA 3CY2A 3Q4CA 3NEWA 2VN9A 3PRIA 2QR8A 1XO2B 3CQEA 3T9TA 2JDVA 4H3QA 4DHJA 4PMTA 3ERKA 3TACA 1H24A 3AKLA 3PY0A 4FKTA 4JG8A 3NW6A 4KAOA 4TPTA 1DAYA 4EOSA 5AIRA 3GNIB 4FSWA 3SDJA 4DBXA 3JVRA 1Q24A 4HGEA 4DTKA 4AZFA 5IUHA 2Z7RA 5FQDC 3AD6A 5I9UA 1FOTA 4U80A 4DEEA 2WQMA 2UW8A 4JI9A 4L44A 4QYFA 4ZTRA 3RTPA 2VTPA 3H3CA 5LMBA 4BKJA 1WVYA 2R64A 2VAGA 2ITVA 3LXPA 4MVFA 3RI1A 3A60A 2XP2A 4A9RA 4F6UA 4FOCA 2GNIA 3DAEA 3NAXA 5M55A 3R7OA 3UDZA 2VTAA 5BMSA 1J7UA 4GFGA 5BVDA 5M56A 3ZS5A 2XK3A 3SGCA 5J79A 4NH1A 4Q5HA 4PL3A 3ORKA 3Q53A 2XARA 4ZMEA 4GYIA 3QD4A 1GY3A 4NK9A 2V62A 3QQJA 3UOHA 4LL0A 3DXNA 3GC8A 4O0UA 4BGQA 4C3RA 4IWQA 3VO3A 4EK8A 4EOPA 1S9JA 2CGVA 3HMMA 1KOBA 3EQCA 2PUIA 2VTTA 2OH0E 3DAJA 2XAMA 2JFLA 4CT2A 4QD6A 1STCE 2G01A 3FI3A 4AN3A 1O9UA 3FE3A 5AM6A 3QQKA 5IA0A 4IQ6A 5AADA 3C4ZA 2R3FA 4N4SA 5CVFA 3HP5A 1OIYA 2ETKA 5HOAA 2Q0NA 3DKOA 2XVDA 3KCKA 3QRJA 4RFZA 4BRXA 5GIPE 2F2CB 2B4SB 2R2PA 3N9XA 4O4BB 2OIQA 4CTCA 3MY5A 2PPQA 2J5FA 2OI4X 3Q4TA 3RCDA 3BWJA 2XKCA 3DPKA 3F66A 5ANEA 4L3PA 3WE4A 5IPJA 4ALUA 2ITQA 4AW2A 3F61A 3KVWA 4FE2A 3VUMA 2XB7A 3MFUA 3QKKA 3RK7A 2ITTA 4XOYA 3KMUA 4Z3VA 3DB6A 3ORXA 4L46A 2PHKA 4CVAA 5CY3A 1ZMVA 4ZY4A 4E4XA 1DI8A 2C5YA 3F9NA 1J1BA 3OXTA 4XLVA 3TXOA 4EH9A 4BIEA 3PXZA 2QODA 4LOPA 1IG1A 5DEYA 1XH6A 2X0OA 2UVXA 3NWWA 4IZ5A 4FT3A 2QOLA 2XNMA 2PVLA 4XJ0A 1OL5A 3PLAE 1JNKA 5AR3A 5EQYA 3WZUA 3MFSA 2X7FA 3UOKA 1XWSA 3I5ZA 3AD5A 3H0ZA 2WNTA 3LFNA 4FEQA 2XBJA 3MDYA 2AQXA 2X4FA 1VLRA 4AF3A 1W7HA 2VO3A 1UVRA 3BHUA 3HL7A 2WMWA 4OTRA 3UC3A 3QUEA 5T68A 2VO6A 1OKYA 4D4VA 5IQIA 4I6HA 2ZV8A 3DS6A 4AW0A 5F9EA 3G9LX 4JRNA 2C6DA 4IX5A 4CFXA 3PUPA 3IDPA 3UOLA 2X7GA 1YHSA 3D15A 4NTSA 5JH6A 4TWPA 4H39A 4OTDA 4U7ZA 3JS2A 3OZ6A 2W1ZA 4DEAA 4QT1A 3DOGA 5FP6A 4EOMA 3DK6A 2C6MA 3IO7A 4NFMA 2VTMA 2XNOA 3P86A 5I9WA 5J9LA 3UDSA 2XJ1A 2AC5A 3GCUA 3VWAA 5H9BA 3LJ1A 2R3NA 2XS0A 3R1YA 4DHZA 3KF7A 4D1SA 3ZC6A 3V6RA 3ZRMA 3LM5A 4E4NA 3OCSA 4JRVA 3OP5A 5D12A 4FTUA 4GT3A 4OTGA 2W05A 1Y6BA 4W9XA 3BL9A 4RIYB 4KRCA 1WBVA 4RVLA 3QTXA 3QRUA 4YTCA 3GU7A 2QC6A 5CLPA 4D2PA 2YM5A 3S3IA 3VN9A 3OBGA 2QOKA 4G5JA 4K33A 2JGZA 4OUCA 4QQ5A 2QOIA 1BL6A 4X2GA 1W2CA 5LVNA 2C6EA 4PMMA 3PTGA 5CT0A 1SMHA 4YLKA 4YZ9A 1XMLA 5I9VA 2YM4A 2EVAA 5GJDA 3DFCB 3Q32A 4MXAA 1NXKA 5ACBC 4QMSA 4ZTSA 4JIKA 3ZRKA 1UWHA 1PMNA 4K0YA 4G5PA 2XMYA 4X3FB 3WIGA 5C4KA 5JFSA 3FAAA 3KMWA 5K5XA 1F3MC 1XHAA 4P4CA 5E90A 5CEMA 4QMNA 3FSFA 4ITHA 4AT3A 3F69A 3EB0A 1HOWA 4UB7A 4E5BA 4DFBA 1YWVA 4FSZA 4HYIA 4TYGA 4EI4A 3FMDA 1XH8A 4OBOA 1RE8A 2PVKA 5A4TA 1MP8A 3CCNA 4QPMA 3ZC5A 1ATPE 3UG2A 3QUPA 5HNIX 4N6ZA 1FPUA 5C01A 3QGYA 3TEIA 3CY3A 4F65A 3D94A 4C4IA 5KBRA 3GENA 3FI8A 1IR3A 3LXLA 3PIYA 3W2CA 4W4YA 1F5QA 3FLQA 5LVLA 1WCCA 3F2NA 3O17A 3IW6A 4OTWA 3UOJA 4USFA 3QAME 5AP4A 2LGCA 5D7VA 2IZRA 2I0EA 3ROCA 2OLCA 2ERZE 2VV9A 3HV6A 2J2IB 3L9MA 1YDRE 2C3KA 5AP0A 5T3QA 3WZEA 5DR9A 4YR8A 2OBJA 5LWNA 2P2HA 2PL0A 4RWIA 5J1VA 2BPMA 2FSTX 4IXPA 4FK6A 4ANOA 3G6GA 4TYHB 5FGKA 1DS5A 4KBKA 4WNOA 1CMKE 2O5KA 2PVRA 3NS9A 5A46A 5LQFA 5T6KA 3NYNA 4YJNA 2HK5A 4NTTA 4K77A 3SLSA 4BDCA 4E20A 3EL8A 4KRDA 4YC6A 3UP7A 4HYSA 3W0MA 4J52A 3A62A 3BKBA 3MY1A 4F70A 4AXDA 5KBQA 2VWWA 4FICA 3EQGA 4PV0A 2UW9A 3QZIA 4FV3A 3RALA 3DZQA 4TNDA 4E6AA 4YC3A 4C36A 5DRBA 5K0XA 2QOOA 3UZTA 3DT1A 5CEPA 3F7WA 4X2FA 1KE7A 3DBQA 3ALNA 1GAGA 4DGOA 2JAMA 4O0RA 2QLQA 4FVQA 3PPKA 5C8MA 3QC4A 4RIWA 2CKOA 1ZXEA 3O2MA 4QP3A 5AUVA 1NT2A 2YAAA 3HAVA 3W33A 3OROA 4G2FA 2HW6A 5EKOA 3R7VA 3WZKA 4IDVA 4C57A 5IEYA 4FKVA 3P5KA 4QNYA 4EOLA 1V0PA 4KUJA 3OWLA 3ATSA 2NPQA 5CNNA 3FI4A 5JN2A 3SW7A 4CKRA 2ZMCA 1ZARA 3DJ5A 5D41A 3E8NA 4PF4A 4TWCA 5CEQA 3DBFA 3IDBA 1NVSA 3HGKA 1G8KA 3FMKA 5HX8A 1NY3A 3BGPA 2QG7A 3PFQA 2YM3A 3AG9A 4DCEA 4H58A 1OBDA 5AP2A 4F7LA 4J96A 3WZJA 2BIKB 4IVCA 4RX9A 1JWHA 3FEGA 2UZTA 4RX5A 4D1ZA 4KA3A 3G0FA 3WILA 4IZYA 1UNGA 2J4ZA 2HOGA 4C38A 3RHKA 4BWPA 1PXJA 4I3ZA 2OO8X 3QX2A 5KMLA 1O6LA 3VUGA 4EK5A 4NU1A 3NIEA 1RJBA 2GFCA 3Q04A 2EXEA 4W4WA 2OFUA 4HYUA 3NUYA 4AOIA 4ACDA 3PA5A 4YURA 4RZWA 5J7BA 1ZY4A 3RJCA 3C0HA 3CE3A 3I7CA 3RPVA 2IVVA 3RPYA 3OFMA 3DBEA 5IQGA 3U8WA 3FLWA 4ZLZA 4MH7A 4EHZA 2E9OA 3TJCA 4E6CA 4AGUA 4H1JA 4ACMA 5L6PA 3E64A 1H1WA 4FNZA 2IZTA 3CKXA 3U9NA 4C59A 2PYWA 3VBQA 4N70A 3UDTA 3LIJA 3WOWA 4DEGA 4FV9A 2VTOA 3MVHA 4WRSA 3V5JA 4F7SA 4WUAA 2W9ZB 3MIAA 4IB5A 3ORMA 2XYNA 3VS6A 3W1FA 4FX3A 1YXUA 2FA2A 3NZ0A 1FQ1B 4A07A 2OXYA 3RPRA 4RJ6A 1ZMUA 4GUEA 1ZZ2A 3ZDIA 3MH3A 3GCSA 5ANJA 1ZMWA 2VWXA 3UNJA 4C8BA 5BUEA 2GU8A 3Q9YA 2BKKA 4ERKA 2W4JA 3C5IA 5TKDA 4JOAA 4P5ZA 3CR0A 4C35A 1E1VA 2X39A 4ORKA 4YUQA 4ITJA 5DG5A 5M07A 4HGSA 3PZEA 3RZFA 3P4KA 3ZLSA 2WQBA 4EH6A 5M57A 2C1BA 3LMHA 2UZOA 2BRMA 3M11A 4EOKA 5J5SA 4KS7A 3V8TA 5KZ0A 3VHEA 1JSUA 5E8TA 3BGZA 1JQHA 3W0NA 4KIPA 4NCTA 4IX6A 2OZOA 5HCZA 4F1OA 4FUXA 3CTQA 3COMA 2C5XA 1UA2A 3F7ZA 5HVKA 1IRKA 4XCUA 1OL2A 2JKOA 4IWPA 3G6HA 4UZHA 4XV9A 4YO6A 5CI6A 4IACA 4ACCA 3TUCA 3MFRA 5IA5A 4MXOA 3U6HA 3U54A 1DM2A 5J9ZA 4BDJA 4E6QA 4O2PA 5DGZA 3VUKA 4BGHA 5KMNA 2IW6A 2GSFA 4RC3A 1OGUA 3ORIA 3VS7A 1FMOE 4O7VA 3EQPA 3BHTA 4BR3A 5KZIA 1ND4A 2PUUA 2HIWA 3SW4A 1PXKA 4ZAUA 5H8GA 4KSPA 5J8IA 2UZBA 4DHIB 2A27A 3H10A 3PLSA 4R3PA 4UMTA 2CCHA 5CXZA 2R3JA 2JDTA 1REJA 2NNWB 4O84A 2JLDA 1RQQA 3KC3A 3VBVA 2Y4PA 4MXXA 4CZYB 2YERA 3BEGA 3CD3A 2J0JA 3UQFA 2HZNA 3JY0A 2JITA 3PXFA 4FSYA 4FZAB 3W0RA 4G16A 3HVCA 2Y4IC 3IG7A 3IOKA 3FXZA 5TT7A 4FTLA 4M69A 4DT9A 4A4LA 3LAUA 3PY3A 5E8SA 4F0GA 4I6FA 5JRQA 4IIRA 3N4VA 5IQFA 4DH8A 4MBIA 2JC6A 3EQRA 2JKQA 3KU2A 4KKHA 3FKLA 2QVSE 3AT2A 1VZOA 3KL8A 4PY1A 4ALWA 3QCXA 3R30A 4YJTA 4RSSA 5IF1A 2G9XA 3WIKA 3ZRLA 4G3CA 5CSVA 1BYGA 5E1SA 4AN9A 2UW7A 4KABA 4D28A 5CSPA 5BYLA 3COHA 3LQ8A 4IAAA 3BWFA 5DT4A 5L6WL 1TQPA 1UU8A 2BKZA 4AXFA 4FKLA 5CF8A 4MWIA 5HU3A 1AQ1A 4C4GA 3Q9ZA 1Y57A 3CQWA 2OIBA 1JKKA 4DGGA 5JFVA 4CKIA 3IOPA 4GFMA 4BCIA 3VS5A 4RJ7A 2EXCX 4B8LA 4GSBA 1G8JA 1KV2A 3FQSA 1ZOGA 4RJ8A 1H01A 4UYNA 5LARA 1ERKA 4O7ZA 2OZAA 3VUTA 3QKLA 3MGYA 4UXLA 4BZDA 4PP7A 4BHZA 2F7XE 4O7TA 1HCKA 3NCGA 2XNPA 3C4XA 3LLAA 4OLIA 4M14A 3PE1A 4X2JA 3TNQB 4FV1A 4TXCA 3UIXA 2P3GX 3KFAA 4U97A 4UZDA 4EKLA 1OIUA 4I93A 3F3TA 3UMXA 4BFMA 4QMVA 4DFUA 4L3LA 3A2CA 3C5UA 3G9NA 4QYEA 2UW3A 2PUNA 4GT4A 1IEPA 2PK9A 2YN8A 3Q3BA 5EYDA 1CDKA 5AUXA 4EUUA 4ZY6A 5CWZA 4JR7A 3W16A 4IE9A 3FUPA 4IM3A 1HCLA 4GT5A 4I22A 1W0XC 5K3YA 4D4RA 2IEWA 3K3JA 3EN5A 3NAYA 3D5WA 4RIWB 1AD5A 1XBBA 4N0SA 3R0TA 4F4PA 4M3QA 1IA9A 4CSVA 3O23A 4P90A 5GJFA 3V8SA 2O65A 3GC9A 2G1TA 4BDDA 3HMIA 3L8SA 4IHPA 4MF1A 3ORZA 2XYUA 4JAJA 3R8ZA 4RRVA 2WU6A 4XP3A 3FXWA 4UALA 4XYFA 4BDGA 4AW5A 2WO6A 3BV2A 4YPSA 3SQQA 1ZY5A 4I41A 4EOIA 3CPBA 4HVHA 1G8SA 2VRXA 3DDQA 2XM9A 5AWMA 2ITOA 4M12A 3L9LA 4J53A 4KNBA 3FI2A 4MD8E 2QO9A 2WMSA 2ZVAA 4PQNA 3OY3A 3F2AA 4QMOA 1LEWA 4EBWA 4U43A 4Z7GA 4S30A 3KCFA 1ZYLA 3HRFA 4YNOA 5HG5A 3KREA 3N4TA 3WE8A 1WBWA 3A61A 3EYGA 2GCDA 3OWJA 4HOKA 4MXYA 4DH5A 3W2RA 4XMOA 2X0QA 4ZP5A 3E7VA 2UW5A 4UMUA 3VJOA 3SOCA 5HD4A 4PTEA 1Q5KA 1CSNA 1W2FA 2VWYA 2X9FA 4ACHA 2X0GA 3Q5ZA 4FL2A 5BVFA 2GTNA 3I5NA 3TZ9A 1FGIA 3RMFA 3HZTA 4FSNA 3POZA 4APCA 4IANA 4U41A 5HQ0A 4ZSEA 4LM5A 4L53A 3MH0A 4C02A 4HVSA 3FHRA 3OT8A 4FKSA 4E73A 3NR9A 4O0VA 1PY5A 2BALA 2QQ7A 3A4OX 3UE4A 4FTIA 4FTAA 4CFUA 4ANQA 4AG8A 3V5WA 3TT0A 1FVTA 3F5GA 2AC3A 4A4OA 3MW1A 3QA0A 2A1AB 4CRLA 5BNJA 5IH5A 2UZUE 4JX3A 5JQ8A 3KGAA 2I0VA 2ONLA 3VF9A 5CXHA 3EN6A 3P78A 4WBBB 3PWDA 2XK8A 3O7LD 1U54A 4PRJA 4DFLA 3QXPA 2XJ0A 1M17A 2BR1A 1ZZLA 2PTKA 5CS6A 3PXKA 5HD7A 2OXXA 5IUIA 1YHVA 5EHOA 3QCYA 3D2IA 2C47A 5HCXA 4L43A 3FZRA 3MS9A 3Q9WA 1J1CA 1UKHA 3QTIA 5HE3A 5LVMA 1XBCA 3WYXA 2IN6A 4RIXA 2WQNA 3LZBA 3NUUA 3T9IA 4F09A 4NYEA 1V0OA 5KMKA 5AUTA 2WEVA 3DKGA 2QCSA 1RDQE 3M42A 3WF9A 2X1NA 1Y6AA 5E8XA 2GMXA 3D83A 3VBYA 3JXWA