2C1AA

Structure of camp-dependent protein kinase complexed with isoquinoline-5-sulfonic acid (2-(2-(4-chlorobenzyloxy)ethylamino) ethyl)amide
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title Structure-based design of isoquinoline-5-sulfonamide inhibitors of protein kinase B.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2c1aA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2c1aA02
1F0QA 3FKLA 3TDWA 4FSZA 4LV8A 1E1XA 3P7BA 2YM4A 4USEA 5KHXA 2X2KA 4O0UA 5CAVA 5CTPA 4NK9A 3RK9A 2C69A 3AC4A 4EOQA 4J7BA 1JKSA 5HNGA 5HG7A 5J8IA 3KC3A 4L8MA 4O0WA 1YWVA 3M1SA 2R3RA 4CCBA 2GS7A 2W5HA 3OXTA 3UOHA 2OJIA 4A06A 4F09A 3SOCA 5CU4A 5C8NA 5KX8A 4RX9A 2QCSA 4I41A 4FKVA 5DBXA 5ANJA 3ZC6A 4QP7A 4YNOA 3O23A 3ROYA 4NCTA 4X7QA 3ZU7A 2VWWA 5HVJA 3PSCA 1WFCA 4BICA 3KEXA 1P5EA 3P0MA 2BAKA 2E2BA 2BZIB 4O22A 1PMVA 4CXAA 3DT1A 3C4XA 4FL2A 4LV5A 4ITIA 4YC3A 3TEIA 3B2WA 3C50A 3OBGA 2HXLA 2PZRA 5C01A 4CYJA 4ZXTA 3T8OA 5K0KA 1FVTA 2C5VA 5HTCA 5L8JA 4BDIA 4DC2A 4BKJA 4E4LA 3P7AA 1GZ8A 3WYYA 4FSRA 4ASEA 4XV3A 4QPSA 2Y4IB 1OL6A 3TKHA 2IJMA 4BBMA 1OL7A 4AN9A 1CTPE 5EK7A 2QD9A 4JBVA 5EM8A 2B53A 2OGVA 5H2UA 4L67A 5AP5A 1JSTA 1KE8A 1Y91A 3B8RA 4PPCA 4D4VA 5EKNA 2PUNA 4H1JA 3LJ1A 1Y6AA 5LCKA 4EOSA 3AD5A 4FG7A 3MI9A 5A3XA 4XS2A 3ZCLA 2CKEA 2PVRA 4YGAA 1YOMA 4Z9LA 1TQPA 5BYYA 4ZLOA 4FV3A 3QZFA 1YI3A 3FYJX 5LVOA 4I92A 4YJRA 3R9OA 2QURA 1Y57A 4K6ZA 4ACMA 2JITA 3MB6A 4XMOA 4FUXA 3QTXA 3GFWA 1H28A 4I20A 4D1XA 3TM0A 4E5BA 4IJ9A 5IU2A 2WIHA 2CN5A 3ZOSA 1J7UA 3BIZA 2EU9A 3OD6X 5IMXA 3VUTA 2Q83A 4AFJA 4DEHA 4O7NA 4ZS0A 5C27A 3BWJA 4FSWA 2BTSA 3O7LB 4YJNA 5IA5A 3VUMA 5BUJA 1O6KA 3CKXA 4FL1A 3UIUA 1OL2A 4TXCA 3CD3A 4QRCA 3ZZEA 3PIXA 4IAFA 5IUHA 2ZM3A 3QUDA 3TKUA 3S1HA 4G1WA 3OWKA 4AS0A 3QD2B 4YP8A 1PF8A 5AUWA 1TVOA 2C4GA 2HZ0A 2VNYA 2VTPA 2Z60A 3DY7A 5CVGA 4RA5A 4A7CA 4D2WA 4F9AA 5KKRC 2VTJA 4ALWA 5IQDA 2UZUE 3BLRA 5DI1A 3FYKX 4XJ0A 2VZ6A 5DT3A 2Y4PA 4QMXA 4UMTA 2C3KA 1LUFA 4HOKA 3BPRA 3D7TB 4MNFA 3UC3A 4CKIA 2WQMA 1IAJA 4C02A 4QP9A 4BDBA 2WTDA 3HYHA 1WBPA 4BDKA 4R1VA 2XKDA 4AW0A 3FZTA 3Q60A 3E93A 4FV4A 3KF4A 5HBJA 5D7VA 4OTQA 4W4YA 5E8XA 4S32A 4PMSA 4IAIA 1YXVA 5IA0A 4DA5A 4R8QA 2FSOX 2YERA 3S95A 4BCPA 4FTIA 5AP0A 3NNVA 3QQKA 4YZ9A 2IZRA 2OW3A 1SNXA 3DTCA 3QQUA 5ANGA 3ID6C 4OBOA 2BKKA 2WB8A 3JVSA 1RDQE 3EQRA 3HECA 3QFVA 4N4SA 4L52A 4D9UA 1MUOA 3SG9A 4OUCA 3QQGA 2OZAA 2BILB 4G3DA 4AWIA 5CWZA 1GIHA 4KSPA 3VS0A 1NVRA 4NTSA 3A4PA 4XH6A 4EK6A 3LFSA 4WKQA 4BB4A 3OCGA 3ZBFA 1ZLTA 4AXAA 1SVGA 4ARKA 4K8AA 5BNJA 3PXRA 2VTHA 4LM5A 4I0TA 4QQTA 3NVMB 4IHPA 3VIDA 3BV3A 3RPYA 5BX0A 2XIRA 1SZMA 4D28A 2A1AB 3AD4A 4ENXA 3HMNA 1PXIA 4V0GB 2OZAB 3CR0A 2EXMA 4NTTA 4O0SA 1H0VA 1XH9A 3JPVA 4PP9A 5KCVA 3ZMMA 3ZM9A 5CANA 2JKKA 3UZTA 4MX9A 4I0RA 1JBPE 2C3JA 4BDAA 2C0TA 3QGYA 4ZTNA 3ULIA 3H9RA 3R0TA 3VS6A 2YM5A 5M53A 1PY5A 3A7IA 5T6KA 3WIKA 4FA2A 4F7SA 3SW4A 4FTKA 4D5KA 5M4UA 5CI7A 3RPOA 4CFFA 2B1PA 4IEBA 1VYWA 5J95A 1W8CA 4IIRA 4PV0A 4M8TA 4U6RA 5FG8A 5C03A 4QMMA 4BYIA 4F6UA 2F4JA 5IQGA 1ATPE 3QALE 4LG4A 5IQEA 2QKWB 4OTIA 5AX9A 1HCKA 3WZJA 1R1WA 4FKTA 4HJOA 4FMQA 2FGIA 3VBWA 2UW4A 2VTAA 3O8UA 3UQFA 1CKPA 1Y6BA 2QO2A 3D5XA 3GUBA 3I0OA 4OTWA 5LMKA 5C9CA 4WD5A 4XBRA 2VN9A 4NT4A 5BYZA 4FOCA 3E63A 3KK9A 4TYHB 2PMOX 2PVNA 3MVJA 3RPRA 1CKJA 4S33A 4YO6A 3BHVA 3EFWA 4BVUA 2JC6A 1DS5A 3E7VA 4QMZA 3CJGA 1BL6A 3OVVA 4UN0C 5LARA 3U8WA 3EZVA 4M0ZA 4BN1A 5M07A 2RF9A 1OIYA 4RC2A 4BYJA 4EEVA 2EB3A 4R5SA 5IUIA 5EQYA 4NM3A 3GGFA 4NJDA 1OZ1A 4C58A 1WBNA 4O7SA 4Y72A 1FOTA 3OY3A 4PL4A 1AQ1A 5CXHA 3GEQA 3FZRA 3PJ2A 2VWXA 2QO9A 1A48A 4TYEA 2CNUA 4CFXA 3R8PA 3V8WA 3DU8A 4RFMA 2PZ5A 4E6DA 3NDMA 1H1SA 3ACKA 4ZY5A 4RLLA 1PKDA 3CD8A 4L9IA 4IVAA 4IX4A 5GJFA 4AGWA 2XK8A 3C0IA 4WA9A 1PMNA 3RP9A 3KRWA 3M42A 3F5XA 4X6QC 5KNJA 3MESA 3MGYA 2JEDA 1H25A 1Z9XA 3PXFA 3MH2A 1J1CA 4UV0A 4GIHA 1CDKA 3PSBA 4FKOA 2X1NA 3TZ8A 4WG4A 2ETKA 1OUKA 4FKRA 2J7TA 4MQ1A 1Q3DA 2XYUA 2JDVA 3LHJA 1PJKA 3FXXA 3ZLWA 1JKLA 4QQ5A 4BR3A 4V01A 4B0GA 2QODA 4O0YA 4XV1A 4WNOA 3DLSA 2IZTA 3C0GA 4M84A 4RWIA 3TN8A 3QQJA 4UYAA 3UIBA 1PYXA 2W99B 4QYEA 4Z7HA 3VS3A 4MNEA 5J87A 4TWPA 2GPHA 4HCUA 2R3NA 2QQ7A 4FSUA 1OBGA 3FMJA 3OWLA 1A9UA 4JVGA 4EH9A 3CTQA 3RBWA 4FKIA 3V6SA 3VW8A 3R73A 5DRDA 4FTAA 4BCJA 3R1QA 5CU6A 5DT4A 5AUYA 1H01A 3EH9A 4WSYA 3NUAA 5L2QA 3LIJA 4CT2A 4J99A 1WBWA 3QL8A 1E9HA 2ZMDA 3FPQA 4H1MA 4WIHA 2VWYA 5E92A 3U4UA 2X9EA 2PTKA 2XKFA 3NAYA 4BDEA 3KMMA 5LMAA 3E8EA 3TCPA 4Z16A 4IACA 5B2MA 5D41A 3UODA 3COKA 2ZM4A 5FP5A 3UMXA 5CAQA 4AUAA 4BTKA 4IM2A 2RFSA 4EH2A 3SVVA 2UZOA 4TZRA 1WBTA 1OL5A 3ZEWA 1B39A 3C51A 3QXOA 3V3VA 1F3MC 2Y6OA 3A4OX 3EFJA 4LRJA 2JIVA 3DQXA 5LVLA 1QPDA 3R1YA 5ETFA 4CMUA 4OBQA 5IEXA 3HUCA 2WIPA 5CY3A 5E7RA 3SG8A 1KUTA 4FVPA 4MWIA 4Y5HA 2C6MA 5EHYA 3BHHA 4TYGA 5FTQA 5EW3A 3TACA 4AOJA 3GC8A 4C2VA 4F70A 5ITAA 3FAAA 2R3OA 3P79A 3AXWA 4HGLA 4R7BA 3FKNA 1YXXA 1BYGA 3O8TA 4FZ6A 4PY1A 4H05A 2XIYA 4RZWA 4C59A 3U54A 2R2PA 1HCLA 2ZV8A 4UB7A 2QU6A 3HRFA 3MB7A 4ZTSA 5L6WL 3NSZA 3ZZWA 4F1MA 5CVFA 3W32A 1ZY4A 4GT5A 2GHGA 4QMOA 4CFUA 3W8QA 2C3LA 4EWQA 4BIDA 4D4YA 3EQDA 2VWBA 2CN8A 5BVDA 1SNUA 1KV2A 2GNFA 4H58A 3HAVA 4FNWA 2XVDA 3NUPA 3VF9A 4HVSA 5IQFA 2HYYA 4RIOA 4AP7A 4XLIA 2ITOA 2XIKA 5DR9A 4C61A 2Z8CA 3CC6A 3HKOA 4ZK5A 5DR2A 5TT7A 4L00A 4D2VA 5L6OA 2IVSA 5ACBC 2EVAA 1YHWA 4WOVA 3MN3A 4AN3A 2R3MA 3PFQA 4DYMA 2DS1A 2BDFA 4RVTA 1Q8ZA 2YJSA 5EYMA 4AT4A 2YDJA 2YEXA 4CV8A 4C4FA 2OO8X 4B8LA 2RL5A 3IW6A 2PUPA 1P14A 4FV7A 3LE6A 5LQFA 2VO6A 4L3JA 4QP1A 4ZY4A 2O2UA 5IG1A 2R3LA 3AMYA 1SMHA 1RJBA 2F49A 2R3QA 3R7UA 3RTPA 3KREA 1Y8GA 1YI4A 4BGQA 2QKRA 3IDBA 4ANNA 4USFA 2EUFB 3BLHA 3IK3A 4X2JA 4DH3A 1FPUA 3VQHA 5EQPA 5DYJA 5L8KA 2R3KA 4A4LA 4E6AA 5DVRA 4AN2A 4HYUA 4C33A 1BI7A 4HYIA 4ZEGA 2PK9A 4IC8A 4W9XA 4BHNA 3KU2A 3CQWA 5HE3A 2CKPA 4PWNA 3VNTA 4FKSA 3H30A 3QTWA 3FUPA 5LVMA 2ZJWA 4WT6A 3U4WA 2GNJA 2WFYA 5A6NA 3FQSA 3O8PA 3MFUA 3VJOA 4YMJA 2X6DA 2YIQA 3CE3A 4CFMA 3V8SA 5HU9A 2XNNA 3QLFA 4HZSA 5CVHA 4JJRA 3ZFYA 2OF4A 1XBCA 2I40A 3QTZA 5E8ZA 4BZNA 3BYOA 1OECA 3NVKI 2XEYA 3EN5A 4FTLA 4ZLZA 4ERKA 5J7HA 3ZBXA 2QOOA 4RX8A 5HIBA 2B9JA 4BBEA 4RVKA 4NM0A 4ZSLA 4DITA 3GCQA 5HNIX 3OTUA 4RBLA 2BZHB 4MD9E 5CEMA 4MCVA 5IQAA 3GC7A 5I9UA 2HWOA 5JGBA 2O8YA 3HGKA 3SQQA 2UZDA 2W05A 4RMZA 2J0LA 3QRUA 2R9SA 4GEOA 2UUEA 2WEIA 4FIJA 3NW5A 3DGKA 3N9XA 3QRJA 2QR8A 4QTAA 3NNWA 2WQNA 4DFBA 1AD5A 4D2TA 1NY3A 4D1SA 5I9WA 1G8AA 2RFEA 4PL5A 4EJ7A 2PE2A 4D2PA 4QQCA 4MXCA 4P5QA 3QTRA 3WE8A 3PA3A 4YTCA 4OAVB 5EYDA 1PXNA 5JSMA 4CG8A 4L3LA 4MF0A 1S9IA 4RIXB 2Y7JA 5FD2A 3PXQA 4TWOA 4ZSGA 2HCKA 2GTMA 2ZM1A 3ACJA 4JT3A 4CV9A 4H3BA 4XP0A 4ZZMA 3EL8A 5CSHA 5I9XA 3LFFA 5IH5A 2A2AA 4FZFB 3IECA 4A9TA 3DPKA 3OUNB 2YAKA 4YHTA 1YDSE 3QCYA 4D2RA 3AC2A 4LL5A 5CASA 3R7OA 4XUFA 3W2RA 3F3VA 3GI3A 3OHTA 1UWHA 5EKOA 2VRXA 3L9MA 1Q41A 3V6RA 3R01A 3UJGA 4XP2A 2NP8A 4GW8A 4P90A 2X2MA 2X8IA 4HPTE 3TV7A 3DJ7A 4IDVA 2V62A 5HO6A 4AW2A 4IVCA 3U6IA 3RM7A 2VGOA 1GJOA 3D9VA 3FMEA 4KKHA 3FLZA 4FGBA 3QRTA 3AC8A 4GH2A 1H0WA 2I1MA 5FP6A 3BKBA 5D10A 4BDJA 3MA6A 2IPXA 1H8FA 1JAMA 3FXZA 3HV5A 5FM3A 4AOTA 2VO3A 4B7TA 4E73A 5E9EA 5B2LA 3UNZA 5IH6A 2XNEA 2X6EA 4Y85A 3HP5A 4RJ3A 5IISA 2GTNA 4FK3A 4H39A 3E5AA 4JX7A 4EOMA 1BMKA 4EZ7A 3NLBA 4RJ4A 1H1QA 3MH1A 4U81A 3D5VA 5HLNA 3QD4A 3UIMA 5HU3A 4JBOA 2JKQA 4YJSA 4FT0A 3WYXA 1ND4A 3TG1A 5C8MA 4IJPA 2VO0A 4QMPA 2WXVA 2ZV9A 4IAKA 5JRQA 4GV1A 4MBJA 3SXSA 3UVQA 4ZMEA 4W8DA 2VV9A 2WTCA 1ZOEA 2XJ2A 3GFEA 4WUNA 4APCA 2ITPA 4ZOGA 1ZMWA 2BZKB 4WRGA 4XG6A 2WGJA 3EZRA 3K2LA 3VN9A 3F61A 2OI4X 3E8NA 3BLQA 3EIDA 2ZDTA 4FBXA 3THBA 3W8LA 4E4NA 4O86A 4RRVA 3F69A 2UZEA 3QCXA 4B9DA 2QHMA 2VX0A 5FLFA 4UX9A 3N51A 2C6IA 3PJ1A 2J4ZA 5J1WA 3I81A 3FZOA 4H3QA 3W2PA 3C5UA 4E4XA 3GXLA 4G9CA 3KXXA 2WU6A 4C38A 4UMUA 4JDHA 4O84A 2Z7LA 3LKMA 3F9NA 1BLXA 1F5QA 3ANQA 5AP2A 4IAYA 4RT7A 4FTUA 4OTRA 2YZLA 5JFSA 4K9YA 3EB0A 4L68A 3UO6A 2J0MB 3FZPA 3PG1A 3FXWA 5ANEA 4MXAA 3UYSA 4X3JA 3ZFMA 3LZBA 3K5VA 5HORA 3OOGA 3ORLA 2EB2A 4HNIA 1WBSA 4TNBA 4TKSA 5HG9A 5HX6A 2WMUA 1RW8A 5DA3A 4YURA 1XKKA 2HAKA 1FMOE 4FEQA 4FODA 4RZVA 2YIWA 3OT8A 1JWHA 3B8QA 4UXLA 5ANOA 1WZYA 1OPJA 1H24A 2PYWA 5F9EA 4TT7A 1H4LA 3FJQE 4BC6A 3FPMA 2ITZA 1P2AA 1M7NA 3R8UA 4IB1A 4ZJIA 4O91A 4U9AA 4AA4A 3DK7A 2GQGA 3IKAA 5AAGA 2PVHA 3DBCA 2XKEA 4UBAA 4TY1A 4MBIA 2ONLA 3SC1A 3H3CA 4DGLC 2IVVA 4JRVA 3WILA 5L8LA 4ITHA 4RA4A 2JAMA 1KE5A 4FI1A 5KMMA 4QP4A 2PHKA 1PMUA 4ZSAA 2P33A 3LLTA 5DN3A 3BGZA 3G15A 3HV4A 2BMCA 3KY2A 4F0IA 2B55A 3EN7A 5IA1A 4AAAA 4QPMA 1X8BA 4RJ8A 3FQHA 4WNMA 4I4FA 3TDVA 2V5QA 3TNHA 4RVMA 5L2IA 4ANLA 3CY3A 2WELA 3HX4A 4PMTA 5KBQA 5LWNA 4U42A 2WZJA 2CGVA 4ORKA 4F6WA 3VS2A 1XH7A 5AV0A 2OICA 3HRBA 4CFVA 2G9XA 4BIEA 5H9BA 2OJFE 3REPA 3LFNA 4NKSA 4I4EA 4DCEA 4USDA 2C1AA 2PUUA 2ZV2A 1OL1A 3G6HA 3PXZA 4L7SA 4LGHA 4JR7A 3ALOA 4PL3A 5TKDA 4QMNA 2XK4A 3Q52A 4XV9A 3R9DA 2WMTA 4LL0A 2Y4IC 4W4VA 4MBLA 3SHEA 4EQMA 2X9FA 3VWAA 2YFXA 3LCOA 3RVGA 4ASZA 1FBNA 1LEZA 1IR3A 3QTQA 4FV5A 5HCXA 4LYNA 2RG5A 2QOFA 2Q0BA 4RJ5A 4DGGA 2OH0E 2JD5A 2PWLA 3HZTA 3NWWA 4XX9A 3D2KA 4J96A 3MBLA 3NIZA 4DG0E 2W9ZB 2C0OA 4FEVA 3TZ9A 1PYEA 3KGAA 5DWRA 3ZDUA 3R28A 4GUBA 5IA3A 4OT5A 3QCQA 2GNGA 5C4KA 2JBPA 4IZYA 4FF8A 5I4NA 4G34A 4RVLA 2VTLA 2BHHA 2UW0A 3P5KA 3LFAA 4NW6A 4RWJA 4IB5A 5A14A 2R7IA 4ANBA 1M2QA 4PDOA 3VW6A 4EBVA 3TUCA 3DKCA 2YIRA 1A06A 2GSFA 2W4KA 4X3FB 3QBNA 4G17A 1U54B 2VAGA 2X2LA 1J7IA 3ORNA 5L6PA 2X81A 2C6LA 5EDRA 2X8EA 2RFDA 4YJPA 1UU7A 2QU5A 3VHKA 4RWLA 4FTMA 4PTCA 2UVYA 4KB8A 2IW6A 2G2IA 4FICA 2P4IA 1YOJA 2B7AA 4RQKA 4IWDA 5IZFA 2CLQA 5I9VA 4U80A 4U5JA 4ZJJA 3HUBA 1FVVA 2E9VA 4IE9A 4JDKA 4EHGA 3AD6A 4IB0A 3FL4A 3CSVA 4O27B 5L2WA 4FNZA 3Q9ZA 3FMNA 3CPBA 5M08A 4A9RA 2UVZA 4RQVA 2R3IA 4E26A 3PWYA 5KMLA 4FG9A 4CZYB 3R63A 2VTIA 3E87A 3CGFA 3NNUA 4YSMA 5T3QA 5JQ5A 2OLCA 2W1CA 2VWUA 4W8EA 3VS5A 3G5DA 4O6EA 3A8XA 3WF7A 4F9BA 1QMZA 3DB6A 4M13A 2J5EA 5JQ8A 2ERZE 3RAHA 3BEGA 4GCJA 2IW8A 3EN9A 2WD1A 4M14A 3ETAA 3VBXA 1Q3WA 3LXKA 2OKRA 5FUTA 3C5IA 4FZAB 4CGAA 2XS0A 3UDBA 4L7FA 4AZTA 4OTFA 4O1PA 4MXYA 1U5QA 4ZTQA 3MY5A 5CEQA 4ANMA 4D55A 2J0IA 4R1YA 2JDTA 2QOIA 3IQ7A 3QYWA 4DFYA 4QMTA 4NIFB 1FINA 4YHFA 4L45A 2YDKA 1QPCA 4S30A 2G01A 3QKLA 4EOIA 3TNIA 3FKOA 3ZS5A 2BVAA 4CLIA 3GT8A 4NL0A 3Q96A 4JAIA 4QTBA 2FH9A 3ZFXA 4KIPA 4FVRA 4OBPA 1YI6A 4FKPA 3ORMA 3ZLYA 3R71A 4H36A 2UZLA 3AT3A 4IAAA 2OIBA 2OU7A 3CS9A 3QTUA 2ACXA 4NH1A 3UVRA 3IW7A 3D7TA 2W06A 4O38A 4OTHA 4PDPA 3KRJA 4O7YA 2ETRA 4FUYA 4I24A 4ZY6A 3DV3A 3BCEA 4FEUA 3BI6A 2QOLA 4MXOA 5KMJA 3LVPA 3HMIA 3GOPA 3Q53A 3OCTA 5HE1A 3T3VA 4FG8A 4F65A 4F7NA 5EOLA 3LM0A 4HVHA 1XBAA 5M56A 3HAMA 3ATTA 4DEGA 5AP3A 4IWQA 3P86A 4EH3A 1OUYA 4B6LA 2R3GA 3C7QA 1OKWA 3DDQA 3II5A 3RCDA 5E8TA 3O51A 4RWKA 3CP9A 1FVRA 2E9OA 2QO7A 3DNEA 3R7IA 1ZYDA 1DAWA 2P2HA 4IXPA 3AMBA 2CKQA 1ZARA 3DS6A 4YU2A 3EL7A 5CSXA 3F5UA 4HGTA 4Y73A 5DPVA 1XR1A 3IW8A 3D15A 4Y5QA 4AF3A 4R3PA 3ZXTA 5HO7A 4G9RA 5CENA 3AQVA 4AQCA 4D1ZA 5A54A 3P23A 4IX3A 5EDPA 3OP5A 5CT0A 5HBEA 1UKIA 3ERKA 3C4ZA 2YCRA 3SW7A 3O17A 2H8HA 4IM0A 5KO1A 4F9CA 1UVRA 4AE6A 5CAOA 5IPJA 1I09A 4BCGA 2CNQA 2WQEA 2CCIA 2HWPA 1R78A 2Z7SA 4V0GA 2I6LA 5A6OA 4G6LA 2Z7RA 5DEYA 3SGCA 1J91A 2OFUA 2R0UA 3ZLSA 3JS2A 4MEDA 2J5FA 1P4FA 4YLJA 4IZ5A 3CIKA 2P3GX 2WTKB 4J53A 4K1BA 4GG5A 5LJJA 3DKGA 4M68A 3EJ1A 3OG7A 5K4IA 5LMKC 2ZVAA 4FK6A 2WNTA 1R39A 2XCKA 4TWCA 4DFXE 3A7GA 3EQBA 1J1BA 4II5A 5E90A 5AR8A 4BCHA 3ZRKA 4E93A 2GHLA 3DFCB 1ZOGA 4W4XA 5AM6A 3TKIA 3TUDA 3E3BX 4O6LA 4JRNA 2AYPA 3UQCA 3O7LD 4F7LA 2HY81 1OITA 3NYXA 3L8PA 4M12A 4YO4A 3H10A 1OPKA 1PXMA 2CDZA 5CSWA 4AGCA 5EG3A 2V7OA 2KULA 5L3AA 3H4JA 4JBQA 4OGRA 5HVYA 3S3IA 4FV2A 4FT3A 4EYMA 5HIDA 3OROA 4G6NA 4UY9A 4Q5HA 5FEQA 3EQHA 2FSMX 4U44A 2VX3A 3KXMA 5CZHA 5CEOA 2GQRA 2JDSA 1XH8A 2R3HA 2XNOA 2YIYA 4O82A 4WHZA 3JVRA 4TYHA 4FT5A 3FHRA 5G6VA 3RK7A 4XP3A 3U87A 5ANKA 1NVSA 3UBDA 1OPLA 4A4OA 5H8EA 5CXZA 4E5AX 4R78A 3PP1A 2BFYA 3D5UA 3KA0A 4FC0A 3W2CA 1U4DA 4RC4A 4G5JA 3ENHA 4IZ7A 4BWPA 2UW6A 3ALNA 3UQGA 4BGHA 4XEYA 5DR6A 5AA9A 4EH5A 4HZRA 4ZJVA 1PXJA 1KSWA 3DZQA 3EWHA 3BRBA 3LQ3A 4N0SA 2BDWA 3I0QA 2IZUA 2X4ZA 3NIEA 2VTOA 3L8VA 4C36A 3LQ8A 3NUXA 4FTCA 2XK9A 5K3YA 5FDXA 4AG8A 2OJ9A 3OFMA 5BVOA 1XHAA 5LXMA 1M7QA 1NT2A 1SVEA 2AUHA 4GT3A 4X2KA 2PMNX 3OT3A 5HX8A 3UG1A 4EH4A 4MF1A 4G16A 4AA5A 2QOBA 3CTJA 3D5WA 4P4CA 4LUEA 3EQPA 2C5XA 4QMVA 2BRBA 3KL8A 4CEGA 3S2PA 3LFQA 4C8BA 4CZUA 4ANSA 3AC5A 4Y46A 4KD1A 1Q8YA 5JFWA 4R6VA 5IEVA 5A4EA 5G1XA 4CSVA 4BWKA 4YBJA 3CKWA 2CHLA 5AR3A 3N4UA 1H07A 3GCVA 4Q9SA 1W7HA 4IFGA 3PP0A 4FKUA 3GU8A 4GK2A 1UWJA 2R3JA 4O2PA 2PZYA 1CSNA 4E6QA 3MJ1A 4M3QA 3EQFA 5AP6A 1UA2A 4P2KA 3DFAA 1GY3A 4JS8A 5JN2A 5M57A 3DK3A 4EOKA 4MD7E 4DT8A 4BCOA 5IQIA 1PKGA 3R2YA 4XHKB 4C4EA 3MVLA 3ZM4A 2RG6A 4Q9ZA 4EH7A 2W0JA 4BY9E 1ZMUA 3PSDA 3LFEA 4IQ6A 2Q0NA 2JKMA 3S4QA 2Y0AA 3EQGA 2OWBA 1OGUA 2ZV7A 5FWKK 3F88A 5AA8A 3NUNA 3ZTXA 4EOLA 2XJ0A 5AUXA 4N6YA 3IGGA 1OVEA 2WAJA 4J8NA 4EKKA 5JT2A 4YHJA 2VGPA 4Z3VA 4X2GA 4L6QA 5JH6A 1PMEA 5DFPA 2P2IA 3UVPA 3H9OA 3PZHA 4C7TA 4RJ7A 1ZMVA 1IA8A 5KMNA 2X8DA 3H0ZA 4FGRA 5M4FA 3FDNA 3KXGA 3RK5A 1YHVA 2BCJA 4R3CA 4W4WA 3NUSA 1WVWA 3G51A 3HA8A 4QO9A 3GC9A 3V04A 2FA2A 1XJDA 4QMWA 4EK3A 3BBTB 2O63A 4BZDA 3HLLA 1GOLA 4FTRA 1NXKA 1M14A 1O6YA 5TO8A 2C30A 4AOIA 2XP2A 4BDDA 4BGGA 5D1JA 2X7FA 4I0SA 3JY0A 3G90X 5CNNA 5AR5A 2RIOA 2X0GA 3GCUA 2G2HA 5EYCA 4ENYA 5A46A 3V5PA 5FTGA 2OF2A 1WAKA 4JQ7A 3DAJA 4AZFA 3EYGA 5L2TA 4FE2A 2W1HA 4O81A 3IGOA 4DG2E 5CYIA 5JZJA 4QMSA 1V0OA 1ZY5A 2YWVA 3LW0A 5CSVA 2YHVA 3FY2A 3EN4A 5I9ZA 4IVDA 2W1FA 2GNIA 2XNMA 4ALVA 4Q2AA 4FKJA 3QX4A 2WMSA 5KMIA 3GU5A 4FTOA 5GINE 3FMLA 3GU7A 2J51A 3KB7A 4I6HA 3C4WA 3TXOA 2DQ7X 4RIYA 2CCHA 4WBOA 2BFXA 4DCAA 2VWZA 5FQDC 3TIZA 5DIAA 3ZLXA 4BDCA 4BZOA 1Q24A 3NEWA 3FEGA 4MQ2A 2A4LA 4C34A 1Q8WA 4O0TA 3I6WA 5GZ9A 2HW6A 2SRCA 5HZNA 2VTNA 4QYGA 4I21A 1LEWA 3PRIA 2JFMA 2HZNA 3ZSIA 1G3NA 5JFXA 5M51A 4BKYA 4UMQA 4O2ZA 4A9YA 5CQWA 3FLNC 3P08A 4XG8A 3AMAA 4RIYB 2LGCA 3IO7A 3PYYA 3QLGA 3QHRA 2WMWA 3R6XA 3GP0A 2XEZA 3Q5ZA 2XYNA 3TTJA 4DG3E 1YDTE 2HZ4A 3E92A 1JOWB 1GAGA 3L1SA 2WOTA 3G33A 3LQ5A 3P4KA 1G5SA 4G3CA 4K0YA 4QQJA 1B38A 3BZ3A 4AW1A 3RI1A 3KXZA 5HD4A 4KIKA 4M66A 1KOBA 3BYSA 4FTJA 3LXPA 3ROCA 3NYVA 4BTFA 3U6JA 3W2OA 1K2PA 4C3FA 3L9LA 5AIKA 4YTIA 3MTLA 4FNYA 4G6OA 3EQIA 3OUKA 4EHZA 5I3RA 3F82A 4V04A 3OBJA 3VBYA 4EHVA 3R83A 1W98A 4WG5A 5AEPA 5HTBA 1DI8A 4KBKA 1GZKA 4KIKB 2WMAA 2XBJA 5E8WA 3OOMA 4YZBA 5FM2A 3SDJA 3DAKA 5AIRA 2W96B 4QMQA 4OR5A 2YM3A 5JKGA 3L8XA 4DH5A 4IANA 4U97A 1W83A 4AW5A 3O96A 3D14A 3OZ6A 4R7IA 2YN8A 5HQ0A 1OKYA 4F9WA 2C6OA 3RPVA 3Q6UA 1PXKA 3U9CA 1U5RA 2ZB0A 2F7XE 3R04A 1MQ4A 3V51A 4BCNA 2W17A 3Q04A 2UW5A 5JGAA 2WTJA 3FI8A 4NM5A 4I5HA 4DINA 1E1VA 3E62A 4RIXA 2YM6A 3WZUA 4I6FA 4WUAA 4DH7A 4NFNA 5AV1A 4GFGA 3IW5A 2EWAA 3DCVA 3E7OA 5AAEA 2JBOA 3DBEA 3QQLA 3V5TA 4YJQA 4KSQA 2ZMCA 3LFCA 5EM6A 1Z5MA 2UW9A 1PXOA 3MSSA 3VRZA 4KRDA 4EOJA 3ZH8A 4GU6A 1O9UA 2UVXA 3PPZA 4L44A 4Y83A 2UW8A 4LMNA 4WBBB 5TF9A 5A4QA 4IMYA 4A07A 2Y8OA 3MS9A 4KNBA 3QF9A 3A99A 2WU7A 3FLYA 3GB2A 1UV5A 3BGQA 1STCE 2PVKA 3GBZA 3HP2A 3IOKA 3UZPA 3ZUVA 3ORKA 4FL3A 3C4FA 3ORXA 3R30A 3DBFA 5AUUA 5M4CA 3SRVB 2PULA 3G6GA 5HE2A 4KS7A 3TV4A 2UZVA 2YIXA 2HIWA 3KFAA 3NUYA 3PVGA 4U3ZA 3DTWA 4HYHA 3WF6A 5DT0A 3RAKA 4E7WA 3IONA 4XBUA 3DKOA 2RKUA 3F5PA 4X21A 5HCZA 3RZFA 4PMPA 4EQCA 4NEUA 3VO3A 4DGOA 5EI8A 5ACKA 5H8BA 4DEAA 3COHA 1GZNA 4QP2A 4CMTA 2E9UA 4FEWA 3KCFA 3PZEA 2B9FA 1WBOA 3GC0A 3R7GA 5LOHA 2PL0A 3PLAE 3QWJA 2OIDA 2OJJA 1AGWA 3K3JA 3R8MA 3RHKA 5BYLA 3PIZA 4DBNA 5HLPA 1NW1A 2OJGA 2BDJA 4XRLA 3L9NA 3QD3A 3RINA 4Z7GA 1L3RE 1YRPA 2YWPA 2IVTA 3AT2A 3BEAA 3QTSA 4U7ZA 2VTMA 1XO2B 3CCNA 3R00A 1JKKA 4R7HA 2HELA 4CQGA 4FYOA 5CF5A 4QP3A 2B4SB 1UKHA 3NPCA 3POZA 5D7AA 3UOJA 2OK1A 5E8VA 3OC1A 4F1OA 4G3FA 2HW7A 4GRBA 4EUTA 3FMKA 4E5WA 3TUBA 2R3FA 1URCA 4M69A 4O83A 2Y9QA 1YXTA 2XB7A 5GNKA 2UZBA 4J95A 1XH6A 3OTVA 3I60A 4HPUE 5K5NA 1W82A 4TTHB 4Z55A 5HEZA 5M55A 3UP7A 3ODYX 2F2UA 4U79A 2PY3A 3NCZA 1Q8TA 4DEIA 3HV6A 1ZYJA 2X4FA 3PVUA 4KINA 2XK3A 4CD0A 4GYIA 4EC8A 3KULB 3UC4A 3KRLA 3C1XA 4EONA 2WPAA 4FV8A 5J5TA 4KIQA 4GFMA 3TJCA 4M69B 2HXQA 4O7ZA 3QQHA 4D0WA 2BRGA 2HENA 2QI8A 5IDNA 4MVFA 2O65A 2YAAA 3PUPA 3MV5A 5EYKA 3LJ0A 1YW2A 1YHSA 3MWUA 1MRVA 4CT1A 2YACA 3GOKA 1MRUA 4A9SA 1VJYA 1VEBA 1T45A 1QCFA 3L8SA 4EOOA 3U6HA 2OSCA 1L8TA 3QZGA 2QOCA 2ONLC 3RAIA 4X2NA 2ITNA 5IA2A 2B9IA 5HNBA 4BDHA 5BQ0A 4O7TA 1FQ1B 4ONAA 4QP8A 4DFNA 4LUDA 3DQWA 2PUIA 2UZNA 5FXQA 5IEYA 5J7BA 5KBRA 1V1KA 3ET7A 3QQFA 3HV7A 4QMLA 3I5NA 4ALUA 3FI2A 4EK4A 3IOPA 4DTKA 4ZZOA 3NYNA 3RNYA 4BCMA 4D2SA 2WTIA 3D7ZA 4FZ7A 4J98A 2P55A 2CJMA 4TPTA 3M11A 5CX9A 5DLSA 3LPBA 4IX5A 2GS2A 3HDNA 1M52A 4IB3A 4FSNA 4E8AA 2BRHA 3F2RA 3PXYA 3NW6A 3UPZA 2BRNA 3C13A 3I6UA 3MY1A 4K33A 5CEPA 3N4TA 4K77A 3KMUA 4KABA 3OW3A 2C6DA 4WO5A 4GKHA 2BAJA 5HE0A 3WF8A 3KXNA 4NM7A 2PE1A 4BL1A 4YZDA 4OLIA 3BHYA 5HICA 2OH4A 4M7IA 5GZ8A 5JEBA 5GIOE 4FSQA 4U45A 3K3IA 3VRYA 3EKKA 4GT4A 4ANQA 3VULA 2O64A 4JBPA 3VS7A 4GSBA 1UNGA 2YCQA 4WNPA 2JGZA 3QZIA 4FVQA 2GDOA 1BKXA 4PRJA 5CAUA 1XH4A 3TL8A 1YQJA 3EN6A 3MVHA 2V7AA 5AR4A 4N6ZA 4OTGA 4W9WA 4PDYA 1YDRE 3HMMA 1JKTA 4CVAA 4G3EA 2GNHA 3BX5A 3MIAA 3ITZA 4IZAA 2YLEA 5AX3A 5LMBA 2QVSE 3HRCA 5GJGA 4DTAA 4U8ZA 2G1TA 3QC4A 3MVMA 5CF8A 3CLYA 3UTOA 5HBHA 1ERKA 3WIGA 4QD6A 4R77A 3ZSGA 3MA3A 2VTQA 1WMKA 4APPA 2BRMA 3LLAA 4E1ZA 3ZYAA 4EH8A 2LAVA 4XG2A 5D11A 3PVBA 1ZZ2A 2VD5A 4BTMA 2NRYA 4RGJA 2CMWA 5JRSA 3V01A 3QWKA 3PRFA 2ITTA 4IFCA 4IX6A 3NMUF 3PG3A 2GCDA 4JAJA 3R1SA 3Q5IA 4BCQA 2C0IA 4BF2A 1PW2A 1KWPA 2IVUA 4PP7A 3D83A 5AV4A 3BHUA 3PY3A 3V5JA 4G5PA 1JSVA 2XMYA 3HVCA 4RSSA 5E1EA 4YZCA 4X3FA 2J0KA 5GIPE 1U54A 4MTAA 4I5PA 5EHOA 2QG5A 3F5GA 5AP7A 4TNDA 2R0IA 3PLSA 4IWPA 1BL7A 3ULZA 3FHIA 4BRXA 2YM8A 4JG8A 5IQBA 2A0CX 4GYGA 5A4TA 4UMPA 4FIIA 3TNQB 1W0XC 4LOQA 2WKMA 4FT9A 4I23A 3BU3A 1XH5A 2ITYA 3P7CA 3RNIA 3FSFA 5FXSA 5CQUA 2PVFA 2X7OA 3EKNA 3MDYA 4KRCA 4D0XA 5A4CA 4I6BA 3BE9A 4D5HA 5H3QA 2B52A 1H1PA 1T46A 3ZO1A 3Q6WA 4HVGA 4YZNA 4P5ZA 1LR4A 2ZYBA 2QOQA 1QPJA 2YJRA 1URWA 3RKBA 3T9TA 3VJNA 5A9UA 5L4QA 4GKIA 1ZRZA 4EZ5A 2ERKA 4BI2A 3P78A 3UIXA 3R21A 2YDIA 4FIGA 4AE9A 2X39A 4PF4A 4XOYA 1JSUA 4BCFA 3JR1A 2XBAA 3TJDA 4C0TA 3BELA 1IASA 3F2NA 3DBDA 3KVXA 4E4MA 4KUJA 3FE3A 3LXLA 4IDTA 3RGFA 3DDPA 3A60A 3D2IA 5CU0A 4DGNA 5CI6A 4IAZA 3U55A 3ZC5A 4AA0A 4TWNA 5I3OA 3JUHA 2QG7A 3ORPA 1KE6A 5AR2A 4NIFA 5LVNA 3GNIB 2B0QA 2WQBA 2WMQA 5E91A 3FC1X 4GFOA 3OF0A 3FWQA 2JDOA 5EDQA 4FIEA 4N57A 4DLIA 2WHBA 4U3YA 3ZUUA 5IH4A 4O7WA 4FKWA 2IZSA 4F6SA 4ACGA 3SAYA 4DN5A 3VAPA 4O0XA 3BYMA 3R02A 3D0EA 4UZDA 3UYTA 2IO6A 3FC2A 2XH5A 2ZAZA 5KUPA 4ANOA 1WBVA 3HL7A 3OCBA 5EW8A 5HOAA 1OKZA 3L9PA 4EK5A 5BVFA 2QLUA 3OWPA 5J9ZA 5J79A 2GMXA 5I5ZA 2PE0A 4IW0A 2ETMA 4DFLA 5CALA 3RAWA 4UEUA 3ORTA 2NNWB 4RX7A 5EH0A 2YITA 5KZIA 4BDFA 2VWIA 4ZP5A 4MK0A 2R3PA 2WTKC 3LJ2A 3Q4TA 4LOOA 3H9FA 5FTOA 4C4IA 3FMHA 3OW4A 4JDIA 4ZIMA 3WBLA 4K2RA 4YZMA 5JK3A 4A4XA 2F57A 3MFRA 2BALA 4AFEA 4NUSA 4BKZA 5DMZA 1JNKA 5AWMA 1RQQA 3NZ0A 4KS8A 3W2QA 3BBWA 4N70A 5CT7A 1ZAOA 1MRYA 4JL9A 2C6EA 1OIUA 5HTIA 4U41A 3OWJA 5AR7A 5HCYA 3S00A 2PVLA 3GVUA 3JYAA 4I22A 2QC6A 1UU3A 4KKEA 4YSJA 3BE2A 3LFDA 4ZTMA 4GVAA 4JR3A 2PPQA 1V0BA 2J2IB 2YA9A 3H0YA 4JNWA 4AACA 4CLJA 2H6DA 1H26A 2BUJA 2EXCX 2IN6A 4RPVA 3Q4UA 4X6RA 3RCJA 4EKLA 1Z57A 4ZMFA 2J50A 3G0FA 5AUVA 1OIQA 4ZTRA 1M2RA 5M06A 3COIA 2A19B 3LXNA 4YLKA 2AC5A 3PXKA 3A7FA 4GK3A 4M0YA 3MTFA 1OMWA 3EHAA 4QP6A 2F7ZE 1NA7A 2I0VA 2PZIA 3Q9XA 4PPAA 5K4JA 5BUEA 2RFNA 4FNXA 2ZDUA 4ZTLA 4WNKA 4B99A 1S9JA 3QGWA 2VWVA 4RFZA 4CMOA 4CCUA 5EI6A 1LP4A 4AT3A 4E6CA 1Q97A 5BPYA 4F63A 4NYEA 3A61A 5F1ZA 4FZDB 4XG3A 3D4QA 5HKMA 5CEKA 4KWPA 2C6KA 2OIQA 2XK7A 3BHTA 3BYUA 2XZSA 3KMWA 2C3IB 2XIZA 4FKGA 4I94A 4ACCA 4QYHA 5D12A 4DGMA 4Y95A 2RSVA 4GUEA 5IF1A 3ZUTA 4I93A 5CNOA 2XNBA 4HCVA 2PVMA 4PQNA 5EFQA 4M97A 4JOAA 4GK4A 2NO3A 4JQ8A 3WI6A 4EI4A 5C4LA 4PNIA 4ERWA 2OXDA 4HGSA 2ITXA 4JDJA 4O0VA 4UYNA 3BU6A 3HMOA 1JVPP 3I7BA 5IA4A 4L43A 2YCFA 4X0MA 4CTBA 5KHWA 4TYIA 2HK5A 4PX6A 4QTEA 2NPQA 3FMMA 3QX2A 3HV3A 5GHVA 4DTBA 3DXQA 3FLWA 5IQHA 4FR4A 2H34A 2W4OA 3POOA 3I7CA 4FV1A 4DEDA 5ICPA 5B2KA 2F2CB 2W5AA 2E9NA 4JG6A 3TT0A 3A8WA 4C62A 4DAWA 3CGOA 3CXWA 5TR6A 3AGLA 3EYHA 4XV2A 4S34A 4B4LA 4DHFA 5AAFA 2FB8A 3UE4A 2OG8A 2BZJA 2KTYA 5CU3A 2FO0A 5AP1A 2PU8A 5AJQA 1EH4A 3ODZX 4XNEA 2ZB1A 2B9HA 5E8YA 3IG7A 4XG7A 3ORIA 1IEPA 5BMMA 3C0HA 3ZHPC 1MQBA 2J6MA 3UOLA 3FMDA 5GZAA 3OXZA 4G3GA 4GG7A 3F7ZA 3ZO2A 5KKRB 3WZEA 3TZ7A 4O0RA 5E8UA 3QKKA 4JQEA 2V22A 5J5SA 1FGIA 5EW9A 4DEEA 4K18A 4TW9A 1APME 2REIA 3G0EA 3R9NA 5JGDA 2Z02A 4UWBA 2A27A 2QOKA 4P7EA 2W7XA 4FSTA 5C26A 4BHZA 3IW4A 3NCGA 2GS6A 3FI4A 1GIJA 2PSQA 3LFBA 1K9AA 3LM5A 5KZ0A 4GMYA 3U51A 3R7VA 2ZOQA 3KN6A 3K54A 1I44A 3LMGA 4UWCA 5F4NA 5B0XA 4C4GA 3DK6A 1ZZLA 4YPDA 4CTCA 4CRSA 1IG1A 3CPCA 3A7HA 3IS5A 1TKIA 3R1NA 4MH7A 5EM7A 4BIBA 5BVWA 3CBLA 1QL6A 1K3AA 4PTEA 5EM5A 5IKWA 4C3RA 4DH8A 3QD0A 5DE2A 4YLLA 4L3PA 2ITQA 3BU5A 4E20A 3I1AA 3MPAA 2QLQA 3EFLA 4IVBA 5JZNA 2OXXA 3K5UA 4AX8A 2WQOA 5CF6A 4NZWB 3E64A 4R5YA 5HG8A 5IQCA 3OS3A 4FTTA 4NWMA 4MHAA 3WOWA 3PPKA 4QMYA 3TI1A 4WG3A 3VVHA 2IG7A 5DG5A 2OZOA 3RWQA 3WZDA 2W9FB 2AC3A 1OB3A 4QTDA 5HLWA 3QZHA 5H8GA 2G2FA 4HNFA 4YTHA 3SXRA 1KV1A 2Y6MA 4JLCA 1R0PA 4OTDA 3QCSA 2VO7A 4GIIA 1Q99A 3VQUA 2C1BA 2HZIA 4CYIA 5LCJA 3WF5A 3FSKA 3BWFA 4DLJA 4EC9A 1GZOA 4PUZA 4HVDA 2CNVA 4UZHA 3CJFA 2X7GA 1REJA 3WZKA 2PMLX 3QUEA 4I1ZA 2W1GA 3HDMA 2I7QA 1J7LA 4F9YA 4CZTA 2DYLA 2XA4A 2PVYA 4O7LA 4D9TA 3NW7A 3W33A 3WARA 2V0DA 2XM9A 3SKCA 5I9YA 3RWPA 3VUDA 1ZXEA 4KIOA 3O0GA 3Q4CA 4IH8A 1Q61A 4EHEA 5AM7A 3R8LA 4U40A 4DBXA 1R3CA 3I4BA 2VX1A 2XCHA 3O50A 3SXFA 2VNWA 3V5LA 3DXNA 5ANDA 3GCPA 1DI9A 3O2MA 1U46A 4BCIA 3RJCA 5CSPA 3GQIA 4G2FA 4F0FA 2JKOA 4GU9A 5A4LA 3RALA 2J9MA 4IM3A 3OY1A 3CTHA 3QRKA 4MXZA 3TZMA 1G8SA 3WE4A 4J52A 2J90A 3Q9YA 3PY0A 4UWYA 4EZ3A 2WEVA 4UMRA 2I0HA 4KA3A 4ZTHA 1XQZA 3DJ6A 5HI2A 4U43A 1PRYA 3ORZA 5AV3A 2PZPA 3BYVA 3W10A 3LCSA 4E3CA 4TL0A 4C4JA 3EFKA 2XK6A 5CU2A 4QYYA 5C8KA 2XNPA 2YCSA 5T68A 4FEXA 4L01A 2ITVA 2H9VA 2H96A 4MNEB 4D4SA 3GQLA 4U0IA 1YOLA 3U9NA 3S0OA 2BAQA 5E8SA 1H00A 3OEZA 2JFLA 5I0BA 3FLQA 4XG4A 3CQUA 4PMMA 4L42A 4O7RA 1FGKA 4HW7A 5M4IA 1VZOA 3TWJA 2ITUA 2O3PA 3AC3A 4JIAA 3Q32A 3AGMA 1WVYA 3T3UA 3OCSA 3NX8A 1PHKA 4I6QA 1Q5KA 4KAOA 5DRBA 2WMVA 4FSMA 3TTIA 4QMUA 4BCKA 5DEWA 2W1ZA 4M15A 3VS4A 4BBFA 4L46A 1KE7A 2FUMA 4BFMA 2XRWA 3DZOA 5FBNC 1WVXA 2F9GA 3MH0A 4LRMA 3RMFA 3R2BA 3QHWA 4I5CA 3R9HA 4RG0A 3F7WA 1CKIA 2YABA 4OW8A 4UALA 3HNGA 3Q2JA 4RJ6A 3VBVA 4AZEA 3KRRA 5FEEA 3FBVA 3MY0A 1Y8YA 4QNYA 4S2ZA 4C4HA 2J0JA 2YZAA 4CQEA 4V05A 4O7VA 1H08A 1B6CB 1IA9A 5AUTA 3ZO4A 3QC9A 1BUHA 5BVNA 3EQCA 3LMHA 5JFVA 4GVJA 1PXLA 3OMVA 1ZWSA 4Y8DA 4RIWA 3A7JA 3RHXA 3ZXZA 5K9IA 2W1DA 5EHLA 1KE9A 3FY0A 3PDTA 3BV2A 4J1RA 3FL5A 1UNHA 4DT9A 2JIUA 4FYNA 3LCKA 4YPSA 3W18A 3PIYA 4FKLA 3NAXA 4IBMA 3VUIA 4NFMA 3DLZA 3G9LX 2FSLX 4IWOA 1YVJA 4F1TA 2JAVA 5EQEA 4O96A 2BPMA 5DOSA 2BR1A 3NRMA 3VF8A 3DBQA 2QOHA 4LGGA 4YBKA 4I3ZA 5DGZA 4FIHA 2O5KA 4FV6A 4C57A 3RPSA 3R22A 4RIWB 3ZO3A 5JMSA 2GQSA 3G9NA 3VUGA 2UW3A 4FSYA 4MAOA 3TV6A 1LPUA 5AP4A 4AZWA 2QONA 4IADA 3KXHA 3LOKA 4KKGA 3LCDA 4JI9A 4YJVA 4EL9A 3W1FA 4K11A 2Z7QA 4C2WA 4RFYA 1H27A 1OKVA 4XOZA 1HOWA 3Q2MA 3PJCA 1IRKA 2XUUA 4HCTA 4LOPA 5FEDA 4J8MA 3W2SA 3KK8A 4ZLYA 2UZTA 4C35A 2V55A 3MFTA 3F3ZA 2VTSA 3UG2A 3OXIA 2W1IA 3SX9A 3F3UA 4QPAA 5DH3A 3UPXA 4G31A 4MKCA 5CAPA 4HGEA 4EORA 5CF4A 3QTIA 3CEKA 2P0CA 3C4CA 3SRVA 4EK8A 1ZOHA 1SYKA 4OT6A 3UMWA 4AU8A 5TOZA 3UZRA 2WMRA 3RM6A 3WF9A 1UU8A 1ZYCA 2CGXA 4LQMA 4PPBA 4ASDA 3ELJA 3PA4A 4NJ3A 1Q4LA 5EOBA 2VUWA 4YTFA 2HY0A 3PPJA 4DFZE 5J9YA 4FKQA 4CKRA 1XWSA 2QR7A 1YKRA 2R64A 1YWNA 3NYOA 3Q3BA 4XYFA 5HHWA 4D4RA 3VS1A 4MWHA 2I0YA 5GJDA 4F0GA 3NGAA 2XJ1A 1J3HA 3GU4A 4XG9A 2JDRA 1H1WA 3Q4ZA 4OTPA 3IPHA 1VYZA 3DNDA 2VU3A 2ESMA 3DA6A 1KOAA 3QAME 5BVKA 3F3WA 4C3PA 5IUGA 1R0EA 4KBCA 4A9UA 4QTCA 2B54A 2CLXA 2DWBA 4EJNA 4DH1A 5KMOA 2WOUA 5J1VA 2DUVA 2R5TA 2C5YA 4JX3A 3I5ZA 3LAUA 5AADA 4PDSA 4EWHA 4CG9A 3AT4A 3MH3A 3E88A 4RLKA 2NRUA 4UXQA 1V0PA 1W84A 3E8DA 3SOAA 5HIEA 3KF7A 5LWMA 3QA0A 2W4JA 3B2TA 3PE1A 3NR9A 5AV2A 2WMXA 2FSTX 3E3PA 4ZS4A 3PWDA 3FV8A 4NSTA 4FTQA 2VTTA 3BGPA 2OFVA 2C5NA 3DAEA 4LMUA 4FTNA 4ZSJA 2IW9A 3MIYA 3PTGA 4ACDA 3ATSA 5F94A 5M09A 1Q62A 3ENMA 3R7EA 1OI9A 4CFWA 3KVWA 2BROA 4LRKA 1BI8A 2GNLA 4MYGA 4F4PA 3V8TA 3TNWA 3W55A 3F6XA 5BVEA 5IMEA 4PTGA 1NVQA 3KULA 1ZYSA 4BWXA 3AG9A 3UOKA 5HVKA 2OBJA 3KKVA 1MP8A 3AC1A 4YJUA 3Q9WA 3DB8A 3SV0A 3O71A 2JLDA 5HO8A 5E4HA 2C5OA 3HMPA 3JXWA 5FRIA 3ZSHA 3NNXA 4FV0A 4J97A 3GCSA 4DEBA 4DE4A 5CS6A 3I79A 4GS6A 3JY9A 5KMKA 4ID7A 4DFUA 2WMBA 4BDGA 2C6TA 5ANIA 4QNAA 4JXFA 2FYSA 4O1OA 4BI0A 4AZSA 4GL9A 3HEGA 1OM1A 5HESA 4YNEA 4AGDA 2PVJA 2CKOA 3FZ1A 3DXPA 3SD0A 4M67A 5K0XA 2GU8A 3DOGA 3OEFX 4IC7A 2CPKE 3ZRMA 2QHNA 1UNLA 4TN6A 1REKA 4ZSEA 4FX3A 3QU0A 4FV9A 2XKCA 2PMIA 4O21A 5CEIA 2GFSA 4MXXA 5FBOA 5HGIA 4EQUA 2W1EA 4R3RA 4XCUA 3BQCA 5J9LA 4NKAA 4F64A 4CNHA 4S31A 3VC4A 5M44A 5BMSA 5AUZA 4LFIA 4KBAA 2C47A 2CGWA 4Q5EA 3IDPA 3MW1A 4YJTA 1VR2A 4FIFA 5HD7A 4EH6A 4CFNA 2BIYA 5CZIA 1BX6A 4HVIA 2GFCA 4XRJA 3ZDIA 3DJ5A 3P9JA 5ETAA 4X2FA 2QNJA 3COMA 5K5XA 3A62A 5DHJA 4AGUA 4CKJA 2BHEA 3PA5A 2G15A 2JIIA 1GNGA 3NS9A 3P1AA 4GJ2A 5FDPA 4ITJA 2XNGA 2WTWA 3VHEA 3KCKA 2IWIA 3R8VA 4AT5A 2GHMA 5EI2A 4ZAUA 1TQIA 3LMIA 2E9PA 1OIRA 3MPMA 2ITWA 5DNRA 4I5MA 5B7VA 1JQHA 4EOPA 4DF3A 5LVPA 3A2CA 4F99A 3PY1A 3PVWA 4YUQA 3V5QA 4TYJA 4XLVA 2WTVA 4B8MA 3EOCA 2R4BA 2YM7A 5AMNA 4EUUA 1PXPA 5FXRA 1YWRA 3PJ8A 2BIKB 1WCCA 4NW5A 1JPAA 4BTJA 3D94A 1FMKA 3VUKA 2BTRA 4X3FC 2R7BA 1GIIA 2CGUA 2XRUA 2YISA 3W16A 4ZZNA 2I0EA 1RE8A 3ZRLA 2UW7A 2O0UA 2XM8A 3F2AA 3AOXA 1ZYLA 4J71A 2XIXA 3R7YA 5TE0A 4TRLA 5F20A 2C68A 2XF0A 2Z2WA 4QT1A 1Q8UA 2FVDA 4GJ3A 3C9WA 1SM2A 2HOGA 3G2FA 2OXYA 4PNKA 1QPEA 5E1SA 2UV2A 5HG5A 4D58A 3DKFA 3ZONA 3QRIA 4QOXA 3UO5A 1IAHA 4YC6A 3VBTA 3PJ3A 3RZBA 3VUHA 3HA6A 4ACHA 4NU1A 3KQ7A 2WO6A 4WRSA 5C1QB 3TIYA 4RX5A 3KRXA 3R8ZA 3TNPC 4BI1A 2RGPA 1U59A 1H1RA 1CM8A 3E8CA 4JG7A 5BUIA 1O6LA 3M2WA 3F66A 3QUPA 3ANRA 3NUUA 2CSNA 5F95A 5AFVA 2UZWE 1TQMA 4YR8A 2W5BA 3IDCA 4C37A 1OBDA 1XBBA 3V5WA 4AZVA 4YJOA 5FGKA 4F7JA 4LI5A 3N4VA 4WSQA 4ASXA 2BKZA 2VTRA 4LGDA 4MD8E 3QYZA 5ETCA 3ZEPA 3SA0A 3T9IA 3UO4A 4FT7A 3UP2A 3BQRA 2YLFA 3SLSA 4CRLA 2F7EE 2EXEA 3PE2A 1SVHA 4YC8A 3MFSA 4F08A 1JLUE 3GU6A 4NCTC 1P4OA 3C4EA 5D9HA 3QKMA 4L53A 3EMGA 4QYFA 4HYSA 4EYJA 1M2PA 3F3TA 5CLPA 3GENA 1CMKE 5KE0A 4JIKA 4H3PA 5ETIA 4OAUC 1DAYA 3CY2A 3FQEA 3UNJA 1YXSA 3MJ2A 3CQEA 3UGCA 3VBQA 3LCTA 5IDPA 3FZSA 3FI3A 3FLSA 3KN5A 1UU9A 3QXPA 3MYGA 3QA8A 3MPTA 1YXUA 3UNKA 4RC3A 4FOBA 5L2SA 1M17A 1DM2A 4EBWA 3R9RA
chains in the Genus database with same CATH superfamily
1F0QA 3FKLA 3TDWA 4FSZA 4LV8A 1E1XA 3P7BA 2YM4A 4USEA 5KHXA 2X2KA 4O0UA 5CAVA 5CTPA 4NK9A 3RK9A 2C69A 3AC4A 4EOQA 4J7BA 1JKSA 5HNGA 5HG7A 5J8IA 3KC3A 4L8MA 4O0WA 1YWVA 3M1SA 2R3RA 4CCBA 2GS7A 2W5HA 3OXTA 3UOHA 2OJIA 4A06A 4F09A 3SOCA 5CU4A 5C8NA 5KX8A 3W0SA 4RX9A 2QCSA 4I41A 4FKVA 5DBXA 5ANJA 3ZC6A 4QP7A 4YNOA 3O23A 3ROYA 4NCTA 4X7QA 3ZU7A 2VWWA 5HVJA 3PSCA 1WFCA 4BICA 3KEXA 1P5EA 3P0MA 2BAKA 2E2BA 2BZIB 4O22A 1PMVA 4CXAA 3DT1A 3C4XA 4FL2A 4LV5A 4ITIA 4YC3A 3TEIA 3B2WA 3C50A 3OBGA 3W0PA 2HXLA 2PZRA 5C01A 4CYJA 4ZXTA 3T8OA 5K0KA 1FVTA 2C5VA 5HTCA 5L8JA 4BDIA 4DC2A 4BKJA 4E4LA 3P7AA 1GZ8A 3WYYA 4FSRA 2XAMA 4ASEA 4XV3A 4QPSA 2Y4IB 1OL6A 3TKHA 2IJMA 4BBMA 1OL7A 4AN9A 1CTPE 5EK7A 3W0QA 2QD9A 4JBVA 5EM8A 3AKKA 2B53A 2OGVA 5H2UA 4L67A 5AP5A 1JSTA 1KE8A 1Y91A 3B8RA 4PPCA 4D4VA 5EKNA 2PUNA 4H1JA 3LJ1A 1Y6AA 5LCKA 4EOSA 3AD5A 4FG7A 3MI9A 5A3XA 4XS2A 3ZCLA 2CKEA 2PVRA 4YGAA 1YOMA 4Z9LA 1TQPA 5BYYA 4ZLOA 4FV3A 3QZFA 1YI3A 3FYJX 5LVOA 4I92A 4YJRA 3R9OA 2QURA 1Y57A 4K6ZA 4ACMA 2JITA 3MB6A 4XMOA 4FUXA 3QTXA 3GFWA 1H28A 4I20A 4D1XA 3TM0A 4E5BA 4IJ9A 5IU2A 2WIHA 2CN5A 3ZOSA 1J7UA 3BIZA 2EU9A 3OD6X 5IMXA 3VUTA 2Q83A 4AFJA 4DEHA 4O7NA 4ZS0A 2XARA 5C27A 3BWJA 4FSWA 2BTSA 3O7LB 4YJNA 5IA5A 3VUMA 5BUJA 1O6KA 3CKXA 4FL1A 3UIUA 1OL2A 4TXCA 3CD3A 4QRCA 3ZZEA 3PIXA 4IAFA 5IUHA 2ZM3A 3QUDA 3TKUA 3S1HA 1G8KA 4G1WA 3OWKA 4AS0A 3QD2B 4YP8A 1PF8A 5AUWA 1TVOA 2C4GA 2HZ0A 2VNYA 2VTPA 2Z60A 3DY7A 5CVGA 4RA5A 4A7CA 4D2WA 4F9AA 5KKRC 2VTJA 4ALWA 5IQDA 2UZUE 3BLRA 5DI1A 3FYKX 4XJ0A 2VZ6A 5DT3A 2Y4PA 2X0PA 4QMXA 4UMTA 2C3KA 1LUFA 4HOKA 3BPRA 3D7TB 4MNFA 3UC3A 4CKIA 2WQMA 1IAJA 4C02A 4QP9A 4BDBA 2WTDA 3HYHA 1WBPA 4BDKA 4R1VA 2XKDA 4O4BB 4AW0A 3FZTA 3Q60A 3E93A 4FV4A 3KF4A 5HBJA 5D7VA 4OTQA 4W4YA 5E8XA 4S32A 4PMSA 4IAIA 1YXVA 5IA0A 4DA5A 4R8QA 2FSOX 2YERA 3S95A 4BCPA 4FTIA 5AP0A 3NNVA 3QQKA 4YZ9A 2IZRA 3PFYA 2OW3A 1SNXA 3DTCA 3QQUA 5ANGA 3ID6C 4OBOA 2BKKA 2WB8A 3JVSA 1RDQE 3EQRA 3HECA 3QFVA 4N4SA 4L52A 4D9UA 1MUOA 3SG9A 4OUCA 3QQGA 2OZAA 2BILB 4G3DA 4AWIA 5CWZA 1GIHA 4KSPA 3VS0A 1NVRA 4NTSA 3A4PA 4XH6A 4EK6A 3LFSA 4WKQA 4BB4A 3OCGA 3ZBFA 1ZLTA 4AXAA 4DHJA 1SVGA 4ARKA 4K8AA 5BNJA 3PXRA 2VTHA 4LM5A 4I0TA 4QQTA 3NVMB 4IHPA 3VIDA 3BV3A 3RPYA 5BX0A 2XIRA 1SZMA 4D28A 2A1AB 3AD4A 4ENXA 3HMNA 1PXIA 4V0GB 2OZAB 3CR0A 2EXMA 4NTTA 4O0SA 1H0VA 1XH9A 3JPVA 4PP9A 5KCVA 3ZMMA 3ZM9A 5CANA 2JKKA 3UZTA 4MX9A 4I0RA 1G8JA 1JBPE 2C3JA 4BDAA 2C0TA 3QGYA 4ZTNA 3ULIA 3H9RA 3R0TA 3VS6A 2YM5A 5M53A 1PY5A 3A7IA 5T6KA 3WIKA 4FA2A 4F7SA 3SW4A 4FTKA 4D5KA 5M4UA 5CI7A 3RPOA 4CFFA 2B1PA 4IEBA 1VYWA 5J95A 1W8CA 4IIRA 4PV0A 4M8TA 4U6RA 5FG8A 5C03A 4QMMA 4BYIA 4F6UA 2F4JA 5IQGA 1ATPE 3QALE 4LG4A 5IQEA 2QKWB 4OTIA 5AX9A 1HCKA 3WZJA 1R1WA 4FKTA 4HJOA 4FMQA 2FGIA 3VBWA 2UW4A 2VTAA 3O8UA 3UQFA 1CKPA 1Y6BA 2QO2A 3D5XA 3GUBA 3I0OA 4OTWA 5LMKA 5C9CA 4WD5A 4XBRA 2VN9A 4NT4A 5BYZA 4FOCA 3E63A 2IEWA 3KK9A 4TYHB 2PMOX 2PVNA 3MVJA 3RPRA 1CKJA 4S33A 4YO6A 3BHVA 3EFWA 4BVUA 2JC6A 1DS5A 3E7VA 4QMZA 3CJGA 1BL6A 3OVVA 4UN0C 5LARA 3U8WA 3EZVA 4M0ZA 4BN1A 5M07A 2RF9A 1OIYA 4RC2A 4BYJA 4EEVA 2EB3A 4R5SA 5IUIA 5EQYA 4NM3A 3GGFA 4NJDA 1OZ1A 4C58A 1WBNA 4O7SA 4Y72A 1FOTA 3OY3A 4PL4A 1AQ1A 5CXHA 3GEQA 3FZRA 3PJ2A 2VWXA 2QO9A 1A48A 4TYEA 2CNUA 4CFXA 3R8PA 3V8WA 3DU8A 4RFMA 2PZ5A 4E6DA 3NDMA 1H1SA 3ACKA 4ZY5A 4RLLA 1PKDA 3CD8A 4L9IA 4IVAA 4IX4A 5GJFA 4AGWA 2XK8A 3C0IA 4WA9A 1PMNA 3RP9A 3KRWA 3M42A 3F5XA 4X6QC 5KNJA 3MESA 3MGYA 2JEDA 1H25A 1Z9XA 3PXFA 3MH2A 1J1CA 4UV0A 4GIHA 1CDKA 3PSBA 4FKOA 2X1NA 3TZ8A 4WG4A 2ETKA 1OUKA 4FKRA 2J7TA 4MQ1A 1Q3DA 2XYUA 2JDVA 3LHJA 1PJKA 3FXXA 3ZLWA 1JKLA 4QQ5A 4BR3A 4V01A 4B0GA 2QODA 4O0YA 4XV1A 4WNOA 3DLSA 2IZTA 3C0GA 4M84A 4RWIA 3TN8A 3QQJA 4UYAA 3UIBA 1PYXA 2AQXA 2W99B 4QYEA 4Z7HA 3VS3A 4MNEA 5J87A 4TWPA 2GPHA 4HCUA 2R3NA 2QQ7A 4FSUA 1OBGA 3FMJA 3OWLA 1A9UA 4JVGA 4EH9A 3CTQA 3RBWA 4FKIA 3V6SA 3VW8A 3R73A 5DRDA 4FTAA 4BCJA 3R1QA 5CU6A 5DT4A 5AUYA 1H01A 3EH9A 4WSYA 3NUAA 5L2QA 3LIJA 4CT2A 4J99A 1WBWA 3QL8A 1E9HA 2ZMDA 3FPQA 4H1MA 4WIHA 2VWYA 5E92A 3U4UA 2X9EA 2PTKA 2XKFA 3NAYA 4BDEA 3KMMA 5LMAA 3E8EA 3TCPA 4Z16A 4IACA 5B2MA 5D41A 3UODA 3COKA 2ZM4A 5FP5A 3UMXA 5CAQA 4AUAA 4BTKA 4IM2A 2RFSA 4EH2A 3SVVA 2UZOA 4TZRA 3PUFC 1WBTA 1OL5A 3ZEWA 1B39A 3C51A 3QXOA 3V3VA 1F3MC 2Y6OA 3A4OX 3EFJA 4LRJA 2JIVA 3DQXA 5LVLA 1QPDA 3ML1A 3R1YA 5ETFA 4CMUA 4OBQA 5IEXA 3HUCA 2WIPA 5CY3A 5E7RA 3SG8A 1KUTA 4FVPA 4MWIA 4Y5HA 2C6MA 5EHYA 3BHHA 4TYGA 5FTQA 5EW3A 3TACA 4AOJA 3GC8A 4C2VA 4F70A 5ITAA 3FAAA 2R3OA 3P79A 3AXWA 4HGLA 4R7BA 3FKNA 1YXXA 1BYGA 3O8TA 4FZ6A 4PY1A 4H05A 2XIYA 4RZWA 4C59A 3U54A 2R2PA 1HCLA 2ZV8A 4UB7A 2QU6A 3HRFA 3MB7A 4ZTSA 5L6WL 3NSZA 3ZZWA 4F1MA 5CVFA 3W32A 1ZY4A 4GT5A 2GHGA 4QMOA 4CFUA 3W8QA 2C3LA 4EWQA 4BIDA 4D4YA 3EQDA 2VWBA 2CN8A 5BVDA 1SNUA 1KV2A 2GNFA 4H58A 3HAVA 4FNWA 2XVDA 3NUPA 3VF9A 4HVSA 5IQFA 2HYYA 4RIOA 4AP7A 4XLIA 2ITOA 2XIKA 5DR9A 4C61A 2Z8CA 3CC6A 3HKOA 4ZK5A 5DR2A 5TT7A 4L00A 4D2VA 5L6OA 2IVSA 5ACBC 2EVAA 1YHWA 4WOVA 3MN3A 4AN3A 2R3MA 3PFQA 4DYMA 2DS1A 2BDFA 4RVTA 1Q8ZA 2YJSA 5EYMA 4AT4A 2YDJA 2YEXA 4CV8A 4C4FA 2OO8X 4B8LA 2RL5A 3IW6A 2PUPA 1P14A 4FV7A 3LE6A 5LQFA 2VO6A 4L3JA 4QP1A 4ZY4A 2O2UA 5IG1A 2R3LA 3AMYA 1SMHA 1RJBA 2F49A 2R3QA 3R7UA 3RTPA 3KREA 1Y8GA 1YI4A 4BGQA 2QKRA 3IDBA 4ANNA 4USFA 2EUFB 1W2FA 3BLHA 3IK3A 4X2JA 4DH3A 1FPUA 3VQHA 5EQPA 5DYJA 5L8KA 2R3KA 4A4LA 4E6AA 5DVRA 4AN2A 4HYUA 4C33A 1BI7A 4HYIA 4ZEGA 1XMMA 2PK9A 4AQKA 4IC8A 4W9XA 4BHNA 3KU2A 3CQWA 5HE3A 2CKPA 4PWNA 3VNTA 4FKSA 3H30A 3QTWA 3FUPA 5LVMA 2ZJWA 4WT6A 3U4WA 2GNJA 2WFYA 5A6NA 3FQSA 3O8PA 3MFUA 3VJOA 4YMJA 2X6DA 2YIQA 3CE3A 4CFMA 3V8SA 5HU9A 2XNNA 3QLFA 4HZSA 5CVHA 4JJRA 3ZFYA 2OF4A 1XBCA 2I40A 3QTZA 5E8ZA 4BZNA 3BYOA 1OECA 3NVKI 2XEYA 3EN5A 4FTLA 4ZLZA 4ERKA 5J7HA 3ZBXA 2QOOA 4RX8A 5HIBA 2B9JA 4BBEA 4RVKA 4NM0A 4ZSLA 4DITA 3GCQA 5HNIX 3OTUA 4RBLA 2BZHB 4MD9E 5CEMA 4MCVA 5IQAA 3GC7A 5I9UA 2HWOA 5JGBA 2O8YA 3HGKA 3SQQA 2UZDA 2W05A 4RMZA 2J0LA 3QRUA 2R9SA 4GEOA 2UUEA 2WEIA 4FIJA 3NW5A 3DGKA 3N9XA 3QRJA 2QR8A 4QTAA 3NNWA 2WQNA 4DFBA 1AD5A 4D2TA 1NY3A 4D1SA 5I9WA 1G8AA 2RFEA 4PL5A 4EJ7A 2PE2A 4D2PA 4QQCA 4MXCA 4P5QA 3QTRA 3WE8A 3PA3A 4YTCA 4OAVB 1TFFA 5EYDA 1PXNA 5JSMA 4CG8A 2XALA 4L3LA 4MF0A 1S9IA 4RIXB 2Y7JA 5FD2A 3PXQA 4TWOA 4ZSGA 2HCKA 2GTMA 2ZM1A 3ACJA 4JT3A 4CV9A 4H3BA 4XP0A 4ZZMA 3EL8A 5CSHA 5I9XA 3LFFA 5IH5A 2A2AA 4FZFB 3IECA 4A9TA 3DPKA 3OUNB 2YAKA 4YHTA 1YDSE 3QCYA 4D2RA 3AC2A 4LL5A 5CASA 3R7OA 4XUFA 3W2RA 3F3VA 3GI3A 3OHTA 1UWHA 5EKOA 2VRXA 3L9MA 1Q41A 3V6RA 3R01A 4FRFA 3UJGA 4XP2A 2NP8A 4GW8A 4P90A 2X2MA 2X8IA 4HPTE 3TV7A 3DJ7A 4IDVA 2V62A 5HO6A 4AW2A 4IVCA 3U6IA 3RM7A 2VGOA 1GJOA 3D9VA 3FMEA 4KKHA 4AXEA 3FLZA 4FGBA 3QRTA 3AC8A 4GH2A 1H0WA 2I1MA 5FP6A 3BKBA 5D10A 4BDJA 3MA6A 2IPXA 1H8FA 1JAMA 3FXZA 3HV5A 5FM3A 4AOTA 2VO3A 4B7TA 4E73A 5E9EA 5B2LA 3UNZA 5IH6A 2XNEA 2X6EA 4Y85A 3HP5A 4RJ3A 5IISA 2GTNA 4FK3A 4H39A 3E5AA 4JX7A 4EOMA 3UDZA 1BMKA 4EZ7A 3NLBA 4RJ4A 1H1QA 3MH1A 4U81A 3D5VA 5HLNA 3QD4A 3UIMA 5HU3A 4JBOA 2JKQA 4YJSA 4AAYA 4FT0A 3WYXA 1ND4A 3TG1A 5C8MA 4IJPA 2VO0A 4QMPA 2WXVA 2ZV9A 4IAKA 5JRQA 4GV1A 4MBJA 3SXSA 3UVQA 4ZMEA 4W8DA 2VV9A 2WTCA 1ZOEA 2XJ2A 3GFEA 4WUNA 4APCA 2ITPA 4ZOGA 1ZMWA 2BZKB 4WRGA 4XG6A 2WGJA 3EZRA 3K2LA 3VN9A 3F61A 2OI4X 3E8NA 3BLQA 3EIDA 2ZDTA 4FBXA 3THBA 3W8LA 4E4NA 4O86A 4RRVA 3F69A 2UZEA 3QCXA 4B9DA 2QHMA 2VX0A 5FLFA 4UX9A 3N51A 2C6IA 3PJ1A 2J4ZA 5J1WA 3I81A 3FZOA 4H3QA 3W2PA 3C5UA 4E4XA 3GXLA 4G9CA 3KXXA 2WU6A 4C38A 4UMUA 4JDHA 4O84A 2Z7LA 3LKMA 3F9NA 3VONA 1BLXA 1F5QA 3ANQA 5AP2A 4IAYA 4RT7A 4FTUA 4OTRA 2YZLA 5JFSA 4K9YA 3EB0A 4L68A 3UO6A 2J0MB 3FZPA 3PG1A 3FXWA 4O4FA 4MXAA 5ANEA 3UYSA 4X3JA 3ZFMA 3LZBA 3K5VA 5HORA 3OOGA 3ORLA 2EB2A 3TYKA 4HNIA 1WBSA 4TNBA 4TKSA 5HG9A 5HX6A 2WMUA 1RW8A 5DA3A 4YURA 1XKKA 2HAKA 1FMOE 4FEQA 4FODA 4RZVA 2YIWA 3OT8A 1JWHA 3B8QA 4UXLA 5ANOA 1WZYA 1OPJA 1H24A 2PYWA 5F9EA 4TT7A 1H4LA 3FJQE 4BC6A 3FPMA 2ITZA 1P2AA 1M7NA 3R8UA 4IB1A 4ZJIA 4O91A 4U9AA 4AA4A 3DK7A 2GQGA 3IKAA 5AAGA 2PVHA 3DBCA 2XKEA 4UBAA 2AEGA 4TY1A 4MBIA 2ONLA 3SC1A 3H3CA 4DGLC 2IVVA 4JRVA 3WILA 5L8LA 4ITHA 4RA4A 2JAMA 1KE5A 4FI1A 5KMMA 4QP4A 2PHKA 1PMUA 4ZSAA 2P33A 3LLTA 5DN3A 3BGZA 3G15A 3HV4A 2BMCA 3KY2A 4F0IA 2B55A 3EN7A 5IA1A 4AAAA 4QPMA 1X8BA 4RJ8A 3FQHA 4WNMA 4I4FA 3TDVA 2V5QA 3TNHA 4RVMA 5L2IA 4ANLA 3CY3A 2WELA 3HX4A 4PMTA 5KBQA 5LWNA 4U42A 2WZJA 2CGVA 4ORKA 4F6WA 3VS2A 1XH7A 5AV0A 2OICA 3HRBA 4CFVA 2G9XA 4BIEA 5H9BA 2OJFE 3REPA 3LFNA 4NKSA 4I4EA 4DCEA 4USDA 2C1AA 2PUUA 2ZV2A 1OL1A 3G6HA 3PXZA 4L7SA 4LGHA 4JR7A 3ALOA 4PL3A 5TKDA 4QMNA 2XK4A 3Q52A 4XV9A 3R9DA 2WMTA 4LL0A 2Y4IC 4W4VA 4MBLA 3SHEA 4EQMA 2X9FA 3VWAA 2YFXA 3LCOA 3RVGA 4ASZA 1FBNA 1LEZA 1IR3A 3QTQA 4FV5A 5HCXA 4LYNA 2RG5A 2QOFA 2Q0BA 4RJ5A 4DGGA 2OH0E 2JD5A 2PWLA 3HZTA 3NWWA 4XX9A 3D2KA 4J96A 3MBLA 3NIZA 4DG0E 2W9ZB 2C0OA 4FEVA 3TZ9A 1PYEA 3KGAA 5DWRA 3ZDUA 3R28A 4GUBA 5IA3A 4OT5A 3QCQA 2GNGA 5C4KA 2JBPA 4IZYA 4FF8A 5I4NA 4G34A 4RVLA 2VTLA 2BHHA 2UW0A 3P5KA 3LFAA 4NW6A 4RWJA 4IB5A 5A14A 2R7IA 4ANBA 1M2QA 4PDOA 3VW6A 4EBVA 3TUCA 3DKCA 2YIRA 1A06A 2GSFA 2W4KA 4X3FB 3QBNA 4G17A 1U54B 2VAGA 2X2LA 1J7IA 3ORNA 5L6PA 2X81A 2C6LA 5EDRA 2X8EA 2RFDA 4YJPA 1UU7A 2QU5A 3VHKA 4RWLA 4FTMA 4PTCA 2UVYA 4KB8A 2IW6A 2G2IA 4FICA 2P4IA 1YOJA 2B7AA 4RQKA 4IWDA 5IZFA 2CLQA 5I9VA 4U80A 4U5JA 4ZJJA 3HUBA 1FVVA 2E9VA 4IE9A 4JDKA 4EHGA 3AD6A 4IB0A 3FL4A 3CSVA 4O27B 5L2WA 4FNZA 3Q9ZA 3FMNA 3CPBA 5M08A 4A9RA 2UVZA 4RQVA 2R3IA 4E26A 3PWYA 5KMLA 4FG9A 4CZYB 3R63A 2VTIA 3E87A 3CGFA 3NNUA 4YSMA 5T3QA 5JQ5A 2OLCA 2W1CA 2VWUA 4W8EA 3VS5A 3G5DA 4O6EA 3A8XA 3WF7A 4F9BA 1QMZA 3DB6A 4M13A 2J5EA 5JQ8A 2ERZE 3RAHA 3BEGA 4GCJA 2IW8A 3EN9A 2WD1A 4M14A 3ETAA 3VBXA 1Q3WA 3LXKA 2OKRA 5FUTA 3C5IA 4FZAB 4CGAA 2XS0A 3UDBA 4L7FA 4AZTA 4OTFA 4O1PA 4MXYA 1U5QA 4ZTQA 3MY5A 5CEQA 4ANMA 4D55A 2J0IA 4R1YA 2JDTA 2QOIA 3IQ7A 3QYWA 4DFYA 4QMTA 4NIFB 1FINA 4YHFA 4L45A 2YDKA 1QPCA 4S30A 2G01A 3QKLA 4EOIA 3TNIA 3FKOA 3ZS5A 2BVAA 4CLIA 3GT8A 4NL0A 3Q96A 4JAIA 4QTBA 2FH9A 3ZFXA 4KIPA 4FVRA 4OBPA 1YI6A 4FKPA 3ORMA 3ZLYA 3R71A 4H36A 2UZLA 3AT3A 4IAAA 2OIBA 2OU7A 3CS9A 3QTUA 2ACXA 4NH1A 3UVRA 3IW7A 3D7TA 2W06A 4O38A 4OTHA 4PDPA 4FJVA 3KRJA 3AKJA 4O7YA 2ETRA 4FUYA 4I24A 4ZY6A 4QDEA 3DV3A 3BCEA 4FEUA 3BI6A 2QOLA 4MXOA 5KMJA 3LVPA 3HMIA 3GOPA 3Q53A 3OCTA 5HE1A 3T3VA 4FG8A 4F65A 4F7NA 5EOLA 3LM0A 4HVHA 1XBAA 5M56A 3HAMA 3ATTA 4DEGA 5AP3A 4IWQA 3P86A 4EH3A 1OUYA 4B6LA 2R3GA 3C7QA 1OKWA 3DDQA 3II5A 3RCDA 5E8TA 3O51A 4RWKA 3CP9A 1FVRA 2E9OA 2QO7A 3DNEA 3R7IA 1ZYDA 1DAWA 2P2HA 4IXPA 3AMBA 2CKQA 1ZARA 3DS6A 4YU2A 3EL7A 5CSXA 3F5UA 4HGTA 4Y73A 5DPVA 1XR1A 3IW8A 3D15A 4Y5QA 4AF3A 4R3PA 3ZXTA 5HO7A 4G9RA 5CENA 3AQVA 4AQCA 4D1ZA 5A54A 3P23A 4IX3A 5EDPA 3OP5A 5CT0A 5HBEA 1UKIA 3ERKA 3C4ZA 2YCRA 3SW7A 3O17A 2H8HA 4IM0A 5KO1A 4F9CA 1UVRA 4AE6A 5CAOA 5IPJA 1I09A 4BCGA 2CNQA 2WQEA 2CCIA 2HWPA 1R78A 2Z7SA 4V0GA 2I6LA 5A6OA 4G6LA 2Z7RA 5DEYA 3SGCA 1J91A 2OFUA 2R0UA 3ZLSA 3JS2A 4MEDA 2J5FA 1P4FA 4YLJA 4IZ5A 3CIKA 2P3GX 2WTKB 4J53A 4K1BA 4GG5A 5LJJA 3DKGA 4M68A 3EJ1A 3OG7A 5K4IA 5LMKC 2ZVAA 4FK6A 2WNTA 1R39A 2XCKA 4TWCA 4DFXE 3A7GA 3EQBA 1J1BA 4II5A 5E90A 5AR8A 4BCHA 3ZRKA 4E93A 4LV7A 2GHLA 3DFCB 1ZOGA 4W4XA 5AM6A 3TKIA 1W2DA 3TUDA 3E3BX 4O6LA 4JRNA 2AYPA 3UQCA 3O7LD 4F7LA 2HY81 1OITA 3NYXA 3L8PA 4M12A 4YO4A 3H10A 1OPKA 1PXMA 2CDZA 5CSWA 4AGCA 5EG3A 2V7OA 2KULA 5L3AA 3H4JA 4JBQA 4OGRA 5HVYA 3S3IA 4FV2A 4FT3A 4EYMA 5HIDA 3OROA 4G6NA 4UY9A 4Q5HA 5FEQA 3EQHA 2FSMX 4U44A 2VX3A 3KXMA 5CZHA 5CEOA 2GQRA 2JDSA 1XH8A 2R3HA 2XNOA 2YIYA 4O82A 4WHZA 3JVRA 4TYHA 4FT5A 3FHRA 5G6VA 3RK7A 4XP3A 3U87A 5ANKA 1NVSA 3UBDA 1OPLA 4A4OA 5H8EA 5CXZA 4E5AX 4R78A 3PP1A 2BFYA 3D5UA 3KA0A 4FC0A 3W2CA 1U4DA 4RC4A 4G5JA 3ENHA 4IZ7A 4BWPA 2UW6A 3ALNA 3UQGA 4BGHA 4XEYA 5DR6A 5AA9A 4EH5A 4HZRA 4ZJVA 1PXJA 1KSWA 3DZQA 3EWHA 3BRBA 3LQ3A 4N0SA 2BDWA 3I0QA 3KIOC 2IZUA 2X4ZA 3NIEA 2VTOA 3L8VA 4C36A 3LQ8A 3NUXA 4FTCA 2XK9A 5K3YA 5FDXA 4AG8A 2OJ9A 3OFMA 5BVOA 1XHAA 5LXMA 1M7QA 1NT2A 1SVEA 2AUHA 4GT3A 4X2KA 2PMNX 3OT3A 5HX8A 3UG1A 4EH4A 4MF1A 4G16A 4AA5A 2QOBA 3CTJA 3D5WA 4P4CA 4LUEA 3EQPA 2C5XA 4QMVA 2BRBA 3KL8A 4CEGA 3S2PA 3LFQA 4C8BA 4CZUA 4ANSA 3AC5A 4Y46A 4KD1A 1Q8YA 5JFWA 4R6VA 5IEVA 5A4EA 5G1XA 4CSVA 4BWKA 4YBJA 3CKWA 2CHLA 5AR3A 3N4UA 1H07A 3GCVA 4Q9SA 1W7HA 4IFGA 3PP0A 4FKUA 3GU8A 4GK2A 1UWJA 2R3JA 4O2PA 2PZYA 1CSNA 4E6QA 3MJ1A 4M3QA 3EQFA 5AP6A 1UA2A 4P2KA 3DFAA 1GY3A 4JS8A 5JN2A 5M57A 3DK3A 4EOKA 4MD7E 4DT8A 4BCOA 5IQIA 1PKGA 3R2YA 4XHKB 4C4EA 3MVLA 3ZM4A 2RG6A 4Q9ZA 4EH7A 2W0JA 4BY9E 1ZMUA 3PSDA 3LFEA 4IQ6A 2Q0NA 2JKMA 3S4QA 2Y0AA 3EQGA 2OWBA 1OGUA 2ZV7A 5FWKK 3F88A 5AA8A 3NUNA 3ZTXA 4EOLA 2XJ0A 5AUXA 4N6YA 3IGGA 1OVEA 2WAJA 4J8NA 4EKKA 5JT2A 4YHJA 2VGPA 4Z3VA 4DDGA 4X2GA 4L6QA 5JH6A 1PMEA 5DFPA 2P2IA 3UVPA 3H9OA 3PZHA 4C7TA 4RJ7A 1ZMVA 1IA8A 5KMNA 2X8DA 3H0ZA 4FGRA 5M4FA 3FDNA 3KXGA 3RK5A 1YHVA 2BCJA 4R3CA 4W4WA 3NUSA 1WVWA 3G51A 3HA8A 4QO9A 3GC9A 3V04A 2FA2A 1XJDA 4QMWA 4EK3A 3BBTB 2O63A 4BZDA 3HLLA 1GOLA 4FTRA 1NXKA 1M14A 1O6YA 5TO8A 2C30A 4AOIA 2XP2A 4BDDA 4BGGA 5D1JA 2X7FA 4I0SA 3JY0A 3G90X 5CNNA 5AR5A 2RIOA 2X0GA 3GCUA 2G2HA 5EYCA 4ENYA 5A46A 3V5PA 5FTGA 2OF2A 1WAKA 4JQ7A 3UDTA 3DAJA 4AZFA 3EYGA 5L2TA 4FE2A 2W1HA 4O81A 3IGOA 4DG2E 5CYIA 5JZJA 4QMSA 1V0OA 1ZY5A 2YWVA 3LW0A 5CSVA 2YHVA 3FY2A 3EN4A 5I9ZA 4IVDA 2W1FA 2GNIA 2XNMA 4ALVA 4Q2AA 4FKJA 3QX4A 2WMSA 5KMIA 2IF8A 3GU5A 4FTOA 5GINE 3FMLA 3GU7A 2J51A 3KB7A 4I6HA 3C4WA 3TXOA 2DQ7X 4RIYA 2CCHA 4WBOA 2BFXA 4DCAA 2VWZA 5FQDC 3TIZA 5DIAA 3ZLXA 4BDCA 4BZOA 1Q24A 3NEWA 3FEGA 4MQ2A 1ST4A 2A4LA 4C34A 1Q8WA 4O0TA 3I6WA 5GZ9A 2HW6A 2SRCA 5HZNA 2VTNA 4QYGA