2C1AA

Structure of camp-dependent protein kinase complexed with isoquinoline-5-sulfonic acid (2-(2-(4-chlorobenzyloxy)ethylamino) ethyl)amide
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title Structure-based design of isoquinoline-5-sulfonamide inhibitors of protein kinase B.
pubmed doi rcsb
source organism Bos taurus
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2c1aA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2c1aA02
2UVYA 4C2VA 3SXFA 2XCHA 2ETRA 3QHRA 4QP6A 3FL5A 3C13A 4DYMA 3U54A 2ZDUA 2P2HA 3D14A 5DRBA 5T3QA 4CFMA 5B7VA 4J98A 4BBFA 3KVWA 3REPA 5K9IA 4A9SA 5HCYA 3KXHA 2VTPA 4DH3A 3P7CA 4DH5A 1Q8TA 2NRYA 3FYKX 5FWKK 5BQ0A 2BILB 3AQVA 3MFUA 1PJKA 4ANBA 4DN5A 4BBEA 2QU5A 2QVSE 4XG2A 1PY5A 4O86A 1YI4A 3WIGA 3W2CA 3R9HA 3ZSIA 4XG7A 3WF8A 3Q4TA 2YACA 5ANEA 3CBLA 4AE6A 3WBLA 2B9HA 2EXCX 2GNIA 5HIBA 4DGGA 1FVTA 5AUYA 4Z3VA 1P14A 3TN8A 2E9PA 2F7ZE 2XA4A 3LFSA 4M97A 4AT4A 5EKNA 4MKCA 5EDRA 2XKDA 2I0EA 4U42A 3ZUVA 4FTOA 4O6EA 5J7BA 1VEBA 5C03A 4A9YA 3KULA 2XJ2A 3E63A 5HNGA 2YZLA 2VO3A 3OWKA 3CJFA 3BGZA 2CGXA 2IVTA 2UZLA 4FKIA 4AOJA 3A99A 4FA2A 2ITZA 4O0RA 4CZYB 2QODA 3GC9A 1OIUA 2OWBA 4J96A 4R78A 3ZM9A 3R8MA 5A4CA 5FM3A 3SG9A 3LXNA 3KA0A 4RGJA 3AD5A 4WO5A 1Q62A 5CF4A 5KMIA 3P7AA 5AP5A 5FXRA 4OTDA 3UO6A 2VWBA 3EMGA 3NNUA 2R0IA 3FWQA 3EZRA 2X39A 1WBVA 5HVYA 2ZAZA 5E8SA 1K3AA 3N9XA 3NAXA 1VYWA 2UZVA 4F08A 2G01A 2YLFA 3VJNA 4KBCA 3UJGA 3TNPC 2W96B 4RIYA 4JDIA 5CVFA 5AR3A 3HAMA 3ZO3A 1Y8YA 2IWIA 3N4UA 2PULA 2O0UA 3CC6A 3DS6A 5AMNA 4YU2A 4DTKA 1NW1A 3LLTA 4EQCA 4N0SA 4M67A 1KE9A 3L9LA 5E1SA 3A7HA 3NIZA 2J50A 4EH2A 2V62A 3IONA 4MD7E 2J2IB 3V01A 3QALE 4EBWA 3RNIA 3P5KA 2GTNA 2W17A 4WD5A 4EH7A 4EZ7A 1OECA 2PUUA 4I6QA 4Q9SA 3BGPA 3I5NA 3I81A 3IW7A 3QD3A 4YNEA 4BWPA 4RFMA 1B39A 3DFCB 4YZDA 3RBWA 5CS6A 4U5JA 4DFZE 3LKMA 3VVHA 5FQDC 2J0LA 3KXMA 2RFNA 1ZYSA 2YCFA 5EYCA 4RVMA 3R63A 5FXQA 4ALUA 2ONLC 4QT1A 4TNDA 4IX3A 4AS0A 5HHWA 5LMKA 4LM5A 4BZNA 1O6KA 2B7AA 2EUFB 5LVMA 2QOHA 4FEVA 3QXOA 4GIHA 3VUTA 3GCUA 5GIOE 4YJNA 3CXWA 2IPXA 3PP1A 4E73A 4FKQA 2C5OA 3G6GA 3R7OA 4C34A 2YN8A 3BCEA 2VWYA 5KBQA 4YSMA 5CSHA 4XUFA 5K0XA 5E8ZA 4FTNA 4FNWA 4HJOA 5C01A 3UIUA 2C6DA 1OBDA 5LVLA 5AAGA 3OVVA 5M4UA 3OROA 3ZSHA 4U7ZA 1UKIA 4GU6A 3R1NA 4ZJJA 2WAJA 5AAEA 2HXQA 2J7TA 4G17A 4QMOA 1RE8A 1ZMWA 2CNQA 2GNJA 2WTJA 5FBNC 4ZY4A 3E7OA 3CPCA 4FIFA 1CKIA 4PL3A 2W4OA 2O2UA 3ULIA 1KE6A 3PY1A 3C4WA 4MF1A 4TZRA 5L8JA 3NZ0A 5CSXA 3L8VA 4X21A 2CKEA 2C6IA 4QMVA 3V5TA 1Q8UA 4UB7A 5HE0A 3UNJA 4I5HA 4NJ3A 1YI3A 4ZK5A 3TNWA 3HAVA 2VTRA 4JL9A 5AUTA 4YP8A 2XNPA 3QL8A 1A48A 4FSMA 2W1IA 3DBQA 3PPZA 4O0TA 2Y0AA 3F2NA 4YBKA 4X3JA 1G8AA 4RX8A 4ZS4A 1UA2A 2BFXA 3I0QA 4X0MA 1Q8ZA 4RC3A 3LJ1A 4BIEA 3OD6X 4J52A 3KL8A 1Y6BA 3ZZWA 4AACA 4HVGA 3PP0A 1XH6A 3AMYA 2EVAA 3NAYA 4FSRA 5T6KA 2XUUA 5T68A 4BVUA 3GNIB 4PF4A 3EQBA 4DLIA 4B9DA 4MNFA 1LEWA 1QPCA 3ITZA 1JSVA 5KZIA 4BCQA 5BVNA 4HGEA 4R3CA 1TQMA 3C9WA 4HVIA 3W32A 1U46A 2UZWE 3R9RA 4I24A 2NRUA 3F3TA 5HIDA 3UOLA 1KOBA 5JKGA 3PXRA 3UZRA 2QR8A 4FV1A 5AX3A 2J90A 3VAPA 5M4IA 2BROA 2ZM3A 3LCKA 3ORMA 4FGRA 4G3EA 3Q32A 1YXTA 4IWQA 1ZYCA 5HG5A 1JKSA 1H25A 4FTUA 4M0ZA 2GNGA 4NUSA 4GKIA 3V5PA 4FE2A 4LGGA 4I6BA 3G2FA 2WOUA 3PA4A 4FOCA 3VRZA 3WF9A 5A4LA 2B1PA 3E62A 3TUDA 2R2PA 3PUPA 3TZ8A 3ENHA 2VTHA 4L8MA 3QRUA 3V6SA 4U79A 2BVAA 4TT7A 4ZTQA 4I4EA 4CEGA 2XNNA 4WHZA 2W05A 4GS6A 3P79A 4P2KA 4D4SA 3PTGA 4WBOA 1WVWA 1P4FA 2W0JA 4HGSA 3HYHA 1JSUA 5IA3A 3FEGA 5DNRA 1H28A 4E8AA 2XK8A 5LMBA 4F9WA 4YTHA 2J9MA 2UW0A 4XYFA 4DC2A 2OK1A 4Y83A 4A9RA 5IA5A 4AT5A 3G15A 5E1EA 1OGUA 1XO2B 4BCPA 4RJ5A 3HDNA 5EQEA 2CCIA 5KO1A 5AUVA 1WBSA 4YLKA 5A4EA 2GTMA 5KCVA 3MSSA 3A4OX 3HRBA 3DFAA 3UG1A 3LHJA 3ATTA 3OWJA 4BZDA 3OUNB 1YXUA 4NM3A 4TXCA 2UW5A 3QCQA 4Q2AA 1JWHA 3WIKA 4BFMA 4C38A 4HVDA 3UPZA 4KIPA 3DKFA 2C1AA 3MBLA 3K54A 5A6NA 2ITNA 5D11A 4XV3A 5EW9A 4CLIA 3HUBA 2YWPA 4KIKA 3FQEA 4QYFA 2QG5A 3G51A 4CMUA 3ET7A 3FMMA 3QCXA 3DK6A 1H07A 3OS3A 4KABA 3VUDA 2YHVA 3LZBA 2HIWA 4IANA 4TYIA 5F20A 3Q6WA 4RIXA 3W18A 4R1VA 4ZZNA 2IZTA 5AA9A 3KGAA 3DKCA 2RSVA 4LOQA 3V3VA 2ZDTA 3CD8A 1M7QA 3IECA 3QTXA 4F99A 4EEVA 3BLHA 1OKYA 4APCA 1BMKA 3EQDA 3RCJA 5CEOA 4XP0A 1JKTA 2C4GA 2F2UA 3KXNA 3OBGA 2PHKA 4CQEA 4UXQA 3MVJA 3MA6A 4BI2A 5KMJA 3NGAA 4FKJA 4UN0C 5IG1A 3GU4A 1X8BA 3R21A 5IEYA 2UW7A 3SD0A 5KNJA 4NH1A 2RFSA 3MGYA 4BF2A 3HP5A 4EOPA 3OCBA 4FIEA 2BUJA 3QQUA 1WZYA 3AT3A 1WCCA 1FPUA 4FV3A 1H01A 2YAKA 5EFQA 3OCTA 1R39A 2IW6A 3CD3A 4C4JA 2VTIA 4JG7A 4M0YA 2WU7A 2R3HA 3C51A 3QHWA 3RALA 3QCYA 3QTZA 5AP4A 1QPJA 3U9NA 1FGKA 1JNKA 3VUHA 5GZAA 2JDSA 4U3YA 5IF1A 3FMNA 4GFGA 4NFNA 3S3IA 5IQEA 3PSBA 4HZSA 3TG1A 2CGVA 4JRNA 5CQWA 3DBFA 3R2YA 3FMDA 3HDMA 3FMHA 5DGZA 4DH1A 3AC2A 4YTFA 5AWMA 5BVWA 3R8ZA 4X7QA 2XYNA 4G31A 4CFFA 3RWPA 4HYHA 3ZUTA 4OAVB 1ATPE 1KSWA 2YIQA 3LVPA 3CQWA 2GQSA 4TTHB 5C8MA 5LOHA 4FT5A 3VWAA 3CP9A 4MBJA 3TL8A 5HD7A 3M11A 4EYMA 4GEOA 3LCTA 3FPMA 3MPTA 3MTFA 4RX7A 3C4FA 4RBLA 3QZHA 3T9IA 4DGOA 3U4WA 4HGTA 2XYUA 4PV0A 2YDJA 5E8YA 2AUHA 1BUHA 3GOKA 4Y8DA 2Y4IB 3S4QA 4AG8A 3UQCA 4YZMA 4TYGA 5HX8A 4XRJA 4ARKA 1R78A 3W8LA 3FSKA 5AX9A 3VUGA 2QOKA 5C9CA 5TOZA 4EC8A 2C68A 4G3DA 4N4SA 1YHSA 2ITUA 3OT8A 4CD0A 4EUTA 5IEXA 5JFSA 5K5NA 3DK7A 4MD8E 3EQPA 4NCTA 2BMCA 4RJ3A 2YIYA 1PRYA 4QTBA 3LFBA 1JOWB 3Q9YA 5AP3A 3UBDA 1MQ4A 3EKKA 2XBAA 3ZTXA 4R7HA 4CFUA 2ZV9A 3HVCA 4FG8A 3H10A 5G1XA 4NJDA 3BELA 1ZYLA 4UV0A 3UIMA 3QCSA 5HD4A 3ACKA 2IO6A 5AP6A 1J91A 2GMXA 4BGQA 4X2FA 3U8WA 5IZFA 3KRRA 4M8TA 5KMNA 5IQIA 1OBGA 2LAVA 3QYWA 4RA5A 3UIXA 3WI6A 5J1WA 2VTJA 4XHKB 4D55A 4D2PA 3ANRA 4OTGA 3D9VA 2FH9A 4D0WA 3DKGA 5CSWA 4FC0A 5M4CA 3QKKA 4V04A 3PSDA 5AIKA 4C58A 3FQSA 2QO9A 2YLEA 2OXYA 4FL2A 3KF7A 5LVPA 5KHWA 3R7GA 3BEGA 5L3AA 4FTTA 3QZGA 3RM7A 2F7XE 4RVLA 4FUYA 2F4JA 3GU8A 5EOLA 3COIA 2QO2A 1U54A 4H3BA 4IW0A 3BU6A 3HMPA 4O21A 2FSOX 4K0YA 1OIRA 3R02A 4CTCA 2BAJA 4TWNA 1H4LA 1YXVA 3L9MA 4ZSGA 3TTJA 3KREA 2PE1A 2IZRA 3DGKA 3W1FA 3W8QA 2ITQA 4C36A 4DCAA 4RVTA 3QU0A 1XH9A 2A27A 3NX8A 4DE4A 2GFCA 3O71A 1UNGA 2G1TA 4IWDA 4U3ZA 5HO7A 5DYJA 4BYIA 3IW4A 3OF0A 3QC4A 5BUIA 4MXZA 5FTOA 3UGCA 4R7BA 3U51A 2A4LA 3ZFYA 3SHEA 2BKZA 2PVMA 3Q2MA 4H58A 2X9EA 4ID7A 3HV7A 4OAUC 4I20A 2I6LA 3UOHA 4EK3A 3R01A 4E4NA 3GU5A 3SOCA 1DAYA 2LGCA 3F5PA 4S2ZA 5EI2A 1OI9A 2RIOA 4I5MA 4U97A 2PTKA 3DLSA 4XV1A 4ACMA 2XIKA 2GCDA 1H1QA 3GBZA 4P5ZA 4F0GA 4DCEA 2FGIA 2CNUA 1M2QA 5JRQA 3VBYA 2XIXA 1VYZA 4W4XA 4BCNA 4FV8A 3PJ1A 4YJUA 4FTAA 4E1ZA 3DDPA 2YJRA 3BPRA 1ZOEA 4DEHA 3HRFA 3NRMA 5H8GA 4ZEGA 2XNBA 3FLZA 3VBTA 1XH4A 1B6CB 1GJOA 3ZC5A 3LJ2A 4KINA 4K11A 4LRJA 4HNFA 3UP7A 1TVOA 1S9IA 3D15A 5CASA 3QX4A 4UEUA 4PPAA 3N4VA 1PXKA 3QLGA 4HCTA 5FEDA 3AG9A 3AMAA 3PJCA 4FG7A 1YQJA 1YRPA 1ZLTA 3MWUA 2GQGA 1Q24A 2OICA 2W1EA 4M14A 2WIPA 5ETFA 3TI1A 3RCDA 5JSMA 1FMOE 3F3ZA 3ZC6A 4C4IA 4O7YA 3FPQA 3A7GA 1GIIA 3G33A 5JFVA 4AGWA 4XOZA 2YEXA 2PMIA 3RPYA 1YHVA 4K18A 5JQ5A 2UW9A 5CF8A 1YKRA 2GU8A 2W06A 4OTWA 4FZ6A 5E8TA 3W2QA 4JI9A 4QMMA 3CR0A 4PX6A 2IW8A 3OWPA 4ANOA 5IPJA 5E4HA 1E9HA 5J5TA 2XKCA 2ITOA 3FZRA 4IFCA 1ZWSA 3GCPA 3VHEA 2Y8OA 5HI2A 3LQ8A 4RIWA 3PSCA 2X6DA 4EOOA 5IA2A 4ZJIA 5IA0A 3TKIA 3LFDA 4TYEA 2I7QA 2UUEA 5IQHA 4P7EA 2BAQA 4O38A 3RPVA 4ASEA 4LRKA 3RPSA 5EM5A 4GUBA 2C1BA 5I0BA 3UYTA 4XP2A 3AGLA 2XK4A 2W4JA 3NUUA 5BUJA 2JIIA 3IO7A 2BRBA 3DJ5A 1UNHA 4MWHA 3WYYA 5L8LA 4K9YA 4XJ0A 4FKGA 1AQ1A 4CT2A 4EONA 2BDFA 2J0IA 5DFPA 4BI1A 2W5HA 4GW8A 3VS7A 4WG3A 2H96A 3HUCA 2Z7QA 2JKQA 5IH5A 4A4LA 4FTQA 4IVBA 3EYHA 5AV1A 2ERKA 5ACBC 3ZMMA 4BYJA 3OW4A 5DE2A 2BKKA 2QU6A 1OL1A 2FYSA 3D2IA 4GG7A 5HLNA 4CCBA 3FC1X 3C50A 3WZDA 5BUEA 3DB6A 4OGRA 4ZTLA 4YO4A 3LM5A 4ZLOA 4FVRA 5J9YA 4FTRA 2QD9A 3DKOA 4G1WA 1PYEA 3QF9A 3NVMB 1NA7A 3E8DA 3JS2A 2HWPA 4QMLA 5ANOA 2WMQA 3EQFA 3ROYA 4Z55A 3OC1A 2BZIB 2C69A 2CLXA 3F3VA 3QRIA 3K3IA 4JVGA 3F7WA 3HX4A 2WELA 3LFEA 4QMUA 4WG5A 4JJRA 3VQHA 3UQFA 2VRXA 4IB0A 2GSFA 5J79A 3BQCA 3VS2A 2Z7RA 4JBPA 4U80A 2J6MA 4ACCA 5A54A 4OTHA 2RG5A 2HW7A 3F88A 4A9TA 4G3CA 2G2HA 3CCNA 3FKNA 3BWFA 5CVHA 2XIZA 5JEBA 1ZZLA 3UOKA 4OUCA 4GT5A 2XJ0A 2QKWB 3LMHA 3SV0A 4GK4A 2VZ6A 4EH8A 2JEDA 3H9RA 4CLJA 3QWKA 2PYWA 2BTRA 3A60A 4IX5A 4D28A 4DT9A 4KIOA 4OW8A 1WAKA 2Z2WA 5HORA 3D7TA 1IA8A 3TWJA 3H9OA 5AR7A 4ALWA 3COKA 4WNMA 4TY1A 3KRWA 3KMUA 5CU3A 2H8HA 1UU7A 3F5UA 5AR8A 4BCMA 4L42A 3S1HA 2R3JA 3RAHA 3DTWA 2X4ZA 4KB8A 3JXWA 3A2CA 1A06A 3V5LA 4Y85A 5E91A 3F6XA 2WMUA 3VULA 1AD5A 1GNGA 5AFVA 3Q04A 4DINA 1URWA 5FG8A 1PMNA 4NW6A 2QLUA 3IK3A 2ITPA 4DBXA 3KXGA 3Q4ZA 4R6VA 3ZLYA 5J9ZA 1QPEA 1OKZA 4IAZA 4QMSA 3TV7A 3M1SA 1PXOA 2W1DA 3AC5A 3IW6A 4AAAA 4F7LA 1W7HA 2X4FA 2IG7A 2OGVA 2OF2A 3FUPA 5E8XA 4J95A 2YERA 5DHJA 5KMLA 3OOGA 3E8CA 3O23A 4LRMA 3T3UA 3EQGA 2F49A 4XG6A 4CCUA 2VGPA 2WPAA 3QQGA 4AN9A 5CQUA 4E26A 2WMSA 4IQ6A 3MI9A 4KRCA 4XX9A 5CVGA 3DJ7A 3F61A 4APPA 4DG3E 2O64A 2OG8A 3NW5A 1PHKA 2ITWA 4KKHA 4V01A 3ZRMA 4AZFA 4BCOA 2IZUA 3COMA 2R3RA 3I79A 5CXHA 5I5ZA 4BWXA 1L8TA 2A19B 3SW4A 5EM7A 5GJGA 3IGGA 1V0BA 3NR9A 4YR8A 5J8IA 3O8UA 1WVYA 3FMEA 3PE1A 4YTCA 3DQWA 2ESMA 4QMYA 5I9XA 4YO6A 4YHTA 3V8TA 1CSNA 2BIKB 3PVUA 3QWJA 4MXOA 4A7CA 2CNVA 3WZEA 3SGCA 4D2VA 4B0GA 4I23A 2WMWA 5CY3A 3FSFA 4F1TA 4DFNA 1YVJA 3JPVA 4XLVA 5EYKA 5AUXA 5CF5A 3N51A 5GIPE 1M14A 1MRVA 4MAOA 1YOLA 5CX9A 3V5JA 5CU2A 3AC1A 2WU6A 3VBQA 4X2JA 1CKPA 3PJ2A 5ANKA 3DNDA 2ZB1A 3D7ZA 3C5IA 2WIHA 3QTSA 4YBJA 3SAYA 4L44A 3E7VA 4TYHA 3PZEA 3NUNA 2UVXA 3Q4CA 3AC4A 2PUPA 2VU3A 2REIA 3UNKA 3PXQA 2YWVA 4RJ7A 1ZMVA 1FMKA 3KRXA 3I7CA 2QO7A 2W5AA 3QGWA 4FKSA 5G6VA 4BC6A 4RLKA 4PNKA 3FBVA 4HCVA 1LEZA 2GS7A 3BLQA 3LFAA 4EQUA 1Q5KA 3PWYA 4I6HA 4R8QA 5LARA 2HZ4A 3PIZA 3LFFA 4FTLA 5BVOA 5GINE 3FI3A 1ND4A 4V0GB 2XS0A 4IEBA 4BI0A 2XIYA 4G34A 5LQFA 5L6WL 4KIQA 1BLXA 3FHIA 3BBWA 1J1CA 1LP4A 1NY3A 5A6OA 2QOBA 4JR7A 3Q6UA 2A1AB 2DS1A 3KFAA 4WG4A 3ODYX 4M68A 4JBQA 4L3JA 4NU1A 4OTQA 3F2RA 4FNYA 3SX9A 2PK9A 3ZRKA 4FSWA 5AUWA 1WFCA 3NCGA 2BPMA 5L6PA 3PXKA 4JAIA 3OCGA 5DR9A 3FXZA 3WZJA 5BYZA 2V7AA 3UOJA 2Z02A 4Q5HA 2X8EA 1PMEA 3NYOA 4DA5A 1XQZA 4ZLYA 4FTJA 3U9CA 4AZEA 1YWVA 5AUZA 2XNMA 2B4SB 3TNQB 1H1WA 3BZ3A 3EFLA 1UV5A 3TNHA 4AOTA 2FSMX 4RX5A 2JDTA 2XM8A 1E1VA 3BE9A 3HA8A 4KKGA 5HE3A 2WFYA 3H0ZA 4QYHA 2GS2A 3NCZA 3FZOA 5D10A 1RJBA 1YDSE 4IDVA 5KUPA 2F2CB 4FZ7A 2R5TA 4WNKA 5E90A 5CSPA 5M53A 2P4IA 3EFJA 2XK9A 1TKIA 4G5PA 3OEZA 4MXAA 5L2IA 3ALOA 4CYIA 3MESA 3BYVA 3KVXA 4RQVA 3C4XA 3VS1A 4BCHA 1QCFA 2R4BA 5FRIA 1WBPA 2X8DA 4F1OA 4F7SA 1M17A 4FIIA 3KN6A 4H3QA 2E9OA 3NYNA 4WRGA 3ORTA 4AW1A 3BHTA 3SLSA 4XBRA 4IM0A 3DCVA 1SMHA 3LXKA 3OZ6A 2X9FA 3VBVA 3POOA 5DR6A 4HOKA 2GQRA 3ORKA 3LAUA 2PVNA 4BDDA 3NEWA 2ZB0A 3QD4A 1DI9A 4OTPA 4CFWA 1W8CA 4UYNA 2ZOQA 3U55A 4PPCA 1CDKA 2QOLA 5DIAA 2UZOA 2XH5A 3A7IA 2GHLA 4NIFA 3W55A 4XBUA 4FEUA 3NUYA 5D41A 2XNOA 5GJFA 1ZY4A 5JRSA 1WBTA 4Z7GA 1RW8A 2PY3A 1ZOHA 4YZNA 4ALVA 2QOFA 3H0YA 1UU9A 3OXIA 4EOMA 2O8YA 3RAKA 1V1KA 3F2AA 5JK3A 2W1ZA 5HU9A 2ZYBA 2YJSA 4EBVA 2G15A 4LI5A 4DEAA 3MFRA 1XHAA 4C4HA 5I9ZA 2YIXA 3IPHA 3PWDA 5KKRC 2OO8X 5FM2A 4RX9A 1OL6A 1Q99A 4ZTMA 2OIDA 5DR2A 1O9UA 3G9NA 4MH7A 2ZM1A 4ITHA 1KOAA 3PLAE 2IZSA 4O96A 5M09A 2YM7A 4MBIA 4WIHA 1Z9XA 5EHLA 2GFSA 5H8EA 4D1ZA 3KXXA 3VHKA 3EJ1A 3RAWA 4F70A 1GY3A 4DAWA 3NUSA 4WSYA 3MYGA 3UMWA 2CLQA 3MJ1A 4L67A 4QMQA 5L2TA 5A4QA 2OW3A 4UMPA 4EWQA 4KUJA 3C4ZA 3VF9A 2C6EA 2XMYA 2NPQA 4ASDA 5LMKC 4NTSA 4R5YA 4FSUA 3TUCA 4QYGA 2E9NA 4MXCA 4CZUA 3R7EA 5A9UA 2YCRA 3O2MA 1OPKA 2Q0NA 3HZTA 3OWLA 4EHZA 3BBTB 3BIZA 5HE2A 3TZMA 3H3CA 4D2SA 3L9NA 4JT3A 3MH2A 2YIWA 4II5A 4IVCA 3R9NA 2JDRA 3PY3A 2G2FA 4GIIA 5CLPA 5CU6A 5AAFA 3TKHA 5IQBA 3C4EA 4RLLA 4IAAA 4IVDA 4IWPA 4FZAB 5CTPA 3QAME 2CKPA 3R7VA 2BALA 3LMGA 3LXLA 5JQ8A 3MW1A 4W9WA 5B2LA 5L2SA 4L68A 2VWUA 3FL4A 3QD0A 4X3FA 3W10A 2XRWA 4FT0A 3UVRA 4NKAA 3FLYA 3Q3BA 4O1PA 2WB8A 2UZTA 2DQ7X 2PZRA 3FY0A 1JSTA 2ZV2A 3R0TA 3WARA 1STCE 1TQIA 3B8RA 3E87A 2PZ5A 1XWSA 1V0OA 1U4DA 2J0MB 3DAEA 3MS9A 4YJRA 4MBLA 2HWOA 4NT4A 3FZSA 4GUEA 5HICA 4BL1A 3F5GA 2JDOA 3D5VA 1R3CA 3TKUA 1J7LA 2BFYA 3UO4A 4CQGA 1L3RE 4JAJA 4IDTA 4RIOA 4IAKA 3UE4A 2V22A 1HCKA 4B99A 3ORLA 3FXWA 4XG4A 4O81A 5CI6A 4QP7A 4BHNA 3FDNA 4U0IA 2BRGA 5AA8A 4U9AA 4LYNA 3RVGA 3D5UA 5K4IA 4YLJA 2I40A 3PXFA 4AT3A 3A8XA 3P7BA 3TZ9A 1JKLA 2JLDA 3CE3A 4M69A 1REJA 4PTEA 2PWLA 2R3LA 4XRLA 5H8BA 2JFMA 4ASXA 4P90A 4ANLA 4F7JA 3ZXZA 4GVJA 3P9JA 4IVAA 4ANNA 3QRKA 3WILA 2HY81 3LCOA 3MFTA 5I3OA 4BDBA 1NVQA 2R3OA 3E5AA 3A7FA 2QONA 4E6AA 3TJCA 1ZARA 1FINA 4IZ5A 4EHVA 3I0OA 2B9FA 3UZPA 5EW8A 3GI3A 3TUBA 4FTIA 4OT6A 4BWKA 5I3RA 5CAVA 4R77A 2VAGA 4HGLA 4U45A 3DLZA 3P86A 4XCUA 5H2UA 1R0EA 2WTIA 2W99B 2CN8A 4L01A 3SDJA 4JG6A 4LFIA 3F3WA 4PMTA 4F9YA 3DQXA 3VUIA 2ZJWA 4EORA 2E9VA 5M06A 1H27A 2XBJA 3EN9A 4QNAA 4BKJA 3HMOA 3OOMA 4YJQA 5DVRA 3Q60A 3WZUA 4DFUA 4M84A 4LQMA 3C0HA 3FLWA 5ETIA 3EN7A 4E7WA 2Z60A 4FI1A 2XVDA 4R5SA 4ZIMA 1I44A 2R3QA 3ZEWA 4MNEB 3SQQA 3DK3A 4EZ5A 3AD6A 2GNLA 4UWBA 1FBNA 4A9UA 5FD2A 1PXMA 3AD4A 5DA3A 3LMIA 2HELA 5CWZA 4DGLC 3FI8A 1Y8GA 3I6WA 5FDXA 3HMIA 4EH5A 2EXEA 1YOMA 4LUDA 4PDYA 5H3QA 4F7NA 3IDBA 1VJYA 2AYPA 4QTCA 2C6TA 4RG0A 4DGNA 4H1JA 1G5SA 3PG1A 4KS8A 4GYGA 2VO6A 4NZWB 4C8BA 5ICPA 4ZSEA 4FUXA 4C35A 4UBAA 3ZEPA 3KN5A 2B52A 2EB2A 3FAAA 2C6LA 5DOSA 1S9JA 2GHGA 1R1WA 4HNIA 1OL2A 4O0SA 5HZNA 1G8SA 1F3MC 1MUOA 3QQHA 4AFJA 3JR1A 3NPCA 2JIVA 3NNVA 4EQMA 2QG7A 2OKRA 4U81A 2QOOA 3TACA 3KMMA 4BCKA 4BTFA 3QGYA 4USFA 4WKQA 2BDWA 3VF8A 3WF5A 2P33A 4KBKA 4C2WA 4A4XA 3AC3A 3L9PA 2B55A 4EI4A 5AUUA 4L53A 4AGUA 3F82A 2HYYA 1CMKE 2C5XA 3KF4A 4FEWA 4MD9E 2ZV7A 3ZUUA 3A7JA 4ANSA 4Z16A 2OZAB 5CZIA 3FQHA 5CALA 4BR3A 5DBXA 2RFEA 4JNWA 4AZWA 1OZ1A 3HEGA 4O0XA 3PPKA 5JGAA 2C0IA 4KAOA 4DH8A 3NDMA 2C3KA 3IDCA 1XH7A 2JDVA 3UG2A 3EQCA 4M12A 4P5QA 5CT0A 3Q5ZA 3LQ3A 3OY3A 3TDWA 3NLBA 2ITYA 2YM8A 4RRVA 5BVKA 1DM2A 5CAQA 4BN1A 2ZV8A 3KK9A 1XBAA 4XLIA 4XV2A 2BZJA 4GG5A 3S95A 1GZOA 3AMBA 4ITJA 3IOPA 2JD5A 4FT7A 4IXPA 4CNHA 4ACHA 4PDSA 5IQGA 2J51A 2R3GA 3AT2A 2YDIA 2O5KA 2OJFE 4XOYA 3PVWA 3ACJA 4G9RA 5ETAA 4KS7A 3RZFA 3GGFA 3TTIA 2JAMA 5EOBA 4O0YA 4BDKA 4C37A 3DXPA 4EK6A 3DXQA 2R64A 3Q5IA 1H00A 4S32A 2X81A 1BL7A 3HL7A 3PIXA 1BX6A 2WOTA 1KE8A 2WMVA 4I93A 4QQ5A 4BICA 4GSBA 2XRUA 4E6DA 1JKKA 2EWAA 5K0KA 3V6RA 4IM2A 1HOWA 3E3PA 4PDPA 1APME 2PSQA 4QP4A 4CMTA 3QA8A 3SRVB 5AP2A 3ZO2A 4FEXA 2BTSA 2C0TA 4JXFA 3EH9A 3PJ3A 4XG8A 3BU3A 5LCKA 2XKEA 3F9NA 4R1YA 5HTIA 3CTQA 4IH8A 4ANQA 4U41A 2JAVA 2XKFA 4NM7A 4NSTA 4FBXA 1CKJA 1EH4A 3BV2A 2VTAA 3DU8A 4QP8A 3V51A 2ETMA 2E2BA 3UP2A 4QD6A 3EIDA 4JQEA 5AV3A 2QR7A 4O7VA 5IUHA 5IDNA 5KX8A 3AOXA 4RWIA 4QP3A 1H0WA 3G6HA 2V55A 3IQ7A 4NM0A 5HO8A 3W2PA 5CT7A 2BAKA 1R0PA 2W9ZB 2OH4A 2YZAA 3BHVA 2PVKA 4DG2E 3OUKA 4FSYA 2YM3A 4XP3A 5EDQA 2VD5A 4NCTC 4F1MA 3MY1A 1GIHA 5AEPA 4IB3A 4TWCA 3LLAA 2R3NA 2X8IA 3B2WA 4WSQA 4FKLA 1VZOA 2X6EA 2HY0A 4BGHA 5HVKA 3QZIA 3ORZA 3HP2A 4OR5A 4A06A 4EOSA 3S00A 3OW3A 4JX7A 2XM9A 3GP0A 4I5PA 4YMJA 4JS8A 1JQHA 3L8PA 3QFVA 2I0YA 4BKZA 3OG7A 5L8KA 5M44A 1U5RA 3PRIA 5HOAA 4U8ZA 2W1FA 1OPJA 5E92A 5HO6A 2C47A 4IE9A 4YJPA 3SC1A 1ZXEA 3TZ7A 4HYUA 3FY2A 4NM5A 5AV0A 4C4EA 4AZSA 2VGOA 3EKNA 3C7QA 4FV2A 4YJSA 3DAJA 4BIDA 2WTVA 3C0IA 4Y46A 3RGFA 5JT2A 3UDBA 1PF8A 3W2OA 4A07A 3UC3A 4E4MA 5CZHA 2DUVA 4QTDA 4I1ZA 3V5QA 5CEPA 2F9GA 4K1BA 4BIBA 4XG9A 4TRLA 3ZDIA 3ZS5A 1REKA 2H34A 3R8LA 3O0GA 4QRCA 3MTLA 5B0XA 2CSNA 1OKWA 3OHTA 1FGIA 3CKXA 4FODA 4MEDA 4PPBA 1IAHA 3KK8A 5EQPA 2HZ0A 2XIRA 3LFNA 1KE5A 3RZBA 1OUYA 4DF3A 2WQEA 3KULB 3ROCA 1XBBA 4FMQA 1IASA 1PXIA 3T8OA 4KA3A 4AF3A 4EHGA 2J4ZA 4W4WA 2QURA 3TV6A 1AGWA 1PXLA 4I4FA 3O17A 4L43A 4FYNA 3WZKA 4D4RA 3R7YA 2WO6A 4V05A 1JAMA 3JVRA 3RHXA 4IIRA 4L52A 4L7FA 3W33A 5DG5A 2WTWA 3GQLA 3TM0A 2UW6A 4XMOA 3MH1A 3LJ0A 3NIEA 1J7IA 2WQOA 3KCFA 4G6NA 2YCQA 5I4NA 3VNTA 3QTUA 3PE2A 1Y91A 3FV8A 4RWKA 4YC8A 5EM8A 3RAIA 1FOTA 3SOAA 3TEIA 4DLJA 3ODZX 2WTKC 2X2LA 2IVUA 4FKVA 5HVJA 2SRCA 3I5ZA 4B8MA 3D5XA 5KMKA 4NKSA 5EHOA 2CGUA 1I09A 4IZAA 2QHMA 3HV6A 1OUKA 4RFZA 4RIYB 1SNUA 2ETKA 2V5QA 3EN4A 1KV2A 1JPAA 3GU6A 3R04A 4WUAA 3LCSA 4O82A 5JH6A 5BVEA 5KMMA 3SKCA 3W16A 5H9BA 3BX5A 3SG8A 4JR3A 2FSLX 4QMPA 2YM5A 4QMXA 5KKRB 4CXAA 5HQ0A 4I0SA 5D9HA 3DA6A 4O84A 5LVOA 1JLUE 3QTWA 4LGDA 3DNEA 5CNOA 3U87A 5I9YA 4ZSLA 4FEQA 5IISA 1M2PA 2PUIA 5HX6A 4ZZOA 3QC9A 5AR5A 2GPHA 1WBNA 2WZJA 4RPVA 5IMXA 4J7BA 1NT2A 1J1BA 4OTFA 4CMOA 3UPXA 3DTCA 5DLSA 5KMOA 3BWJA 3KC3A 3ZO4A 4NIFB 2CCHA 5LMAA 4ZTRA 3GQIA 3EQIA 4BY9E 2YA9A 4LV8A 2UW4A 1XH8A 3HKOA 1H08A 2XK7A 3NNWA 1IA9A 3R9DA 4XNEA 4ZY5A 4N6ZA 4O1OA 3FXXA 3UNZA 1DAWA 5JFXA 2H6DA 2R3MA 3AXWA 3BHYA 3SVVA 1XR1A 3UZTA 3DBCA 1P4OA 5DT0A 5C8NA 4USEA 2HCKA 3HV4A 4HZRA 1ZYJA 5IH4A 5C4LA 4USDA 5ANJA 1YXSA 1PXPA 4AU8A 5DEWA 4K2RA 3ZRLA 2C6KA 3RTPA 2J5FA 2CDZA 4A4OA 3PVGA 4NFMA 5I9VA 4HPTE 3VN9A 4O7RA 4C62A 3UIBA 1H26A 2PVFA 2OXDA 3U4UA 4AGCA 2VO0A 2BZKB 2VX0A 5BVFA 4FZDB 4DFXE 4GKHA 3NW6A 4GRBA 2VO7A 4I6FA 4YNOA 5M55A 2FO0A 2B0QA 2XF0A 4TW9A 4FTKA 4ZSJA 3ZBFA 2PMOX 3FHRA 4Z7HA 1KV1A 5FEQA 4GT4A 5A46A 4W4VA 5FXSA 3VUKA 2YAAA 3ALNA 5I9UA 3ZM4A 1NVRA 4PRJA 3VS0A 1GZKA 4FV4A 5E8VA 3HECA 2X2MA 4YZ9A 3QUDA 4ZZMA 3BKBA 4HCUA 3NUXA 4UMRA 4J97A 3NYVA 3MIAA 4GU9A 4JX3A 2VTTA 5DI1A 4FKWA 2BZHB 4K6ZA 3R8PA 4ENYA 3ZLWA 4C57A 3UTOA 5FUTA 3JVSA 3ZFXA 1F0QA 3PZHA 3Q96A 3EL8A 1YHWA 5HG7A 4CV8A 3MB6A 1BI7A 4RSSA 4MQ2A 4ZSAA 3LFCA 3RNYA 2VWVA 3DJ6A 1SYKA 4F0IA 3CLYA 4YUQA 2XK3A 3CJGA 5KE0A 4KSPA 4DEGA 2CKOA 3DB8A 1YDTE 4QOXA 3C4CA 1QMZA 2CPKE 2PE2A 4FSQA 3KCKA 1GAGA 5FTQA 4FSZA 3QQKA 5HBJA 3ORNA 3W2SA 3E93A 3R8VA 4E20A 3W2RA 2Y7JA 1OMWA 3P78A 3QD2B 2VTNA 3ORIA 4K33A 4TYJA 3CGFA 4YC3A 4YJTA 5EI6A 5F1ZA 2WMTA 3MFSA 3ZO1A 3R7IA 5ETCA 4F9CA 5TT7A 4HPUE 3VUMA 4WRSA 4AXAA 4S31A 4DFLA 2PVLA 4D2TA 2WGJA 2BIYA 3BYUA 4AA4A 3D94A 4AUAA 2OJ9A 5GJDA 2OBJA 3M2WA 5M08A 2QOQA 5GNKA 1PXJA 4OBPA 4I22A 3FLQA 3PG3A 2PVJA 3PLSA 4PQNA 3ZBXA 2BDJA 1W83A 5IQAA 2R0UA 4EHEA 4RWLA 3DV3A 3RK5A 2PVHA 3BHUA 4JIKA 1GZ8A 3TCPA 3DOGA 4Y95A 5CYIA 5E7RA 2Z7LA 5BMMA 4AN3A 2YFXA 3TIYA 1Q3DA 4GCJA 3V8SA 1Z57A 2WMBA 4YJOA 5HTCA 5C4KA 2R3FA 4MHAA 4ONAA 5BYLA 4L9IA 3EZVA 3GFEA 4UYAA 2JIUA 2RG6A 4IAFA 2G2IA 4CG9A 1B38A 1GZNA 3MJ2A 3EWHA 3FLSA 3OXZA 3POZA 4WA9A 5EK7A 5J87A 2C0OA 4D4VA 5DMZA 5HCXA 4FL1A 4YPSA 4FV5A 3N4TA 5JFWA 3E8EA 1YDRE 3LM0A 3VO3A 3R1YA 1FQ1B 4RZWA 3RJCA 3VS4A 4RFYA 2C30A 2X2KA 3V04A 4BCGA 2WXVA 4ZAUA 4RC2A 4KNBA 4J8MA 5HESA 3VC4A 5CAUA 1E1XA 3FMJA 3QRTA 3ULZA 1FVRA 4KIKB 3G5DA 4LG4A 4O7SA 3KMWA 2AC3A 4YTIA 3BYSA 2H9VA 2ZVAA 4U40A 4FNZA 4DFYA 2WQBA 3NUAA 1SVEA 4E93A 2VUWA 3UO5A 4RIXB 4XG3A 4ZJVA 1J3HA 5JGBA 2YM4A 5LXMA 4QNYA 2RF9A 2VWWA 4IAIA 4FSTA 4WBBB 3RK7A 4ACDA 2J5EA 4LOPA 4ERKA 4BTJA 4AX8A 2XP2A 3UQGA 3LFQA 3EHAA 1H0VA 1GOLA 3NW7A 2OFUA 4H3PA 3VS3A 4C02A 5AV4A 4MTAA 2QLQA 4Y73A 4BDFA 2PZYA 3KY2A 4HYSA 4YSJA 4NL0A 4ASZA 3DBEA 3GFWA 4O91A 4UWCA 2WMAA 3IG7A 1H1PA 3VS6A 4B7TA 3BHHA 4G6LA 4C0TA 4JOAA 3H4JA 3G0FA 3MY0A 4WUNA 4D5HA 5AR4A 5C1QB 1JBPE 4W8EA 3ZHPC 5CEQA 2ITXA 5AR2A 4CTBA 4F9BA 3ANQA 4O0UA 1Y57A 3GT8A 4O2PA 4EOLA 4EZ3A 3FYJX 2WTDA 4FR4A 3SXSA 5KZ0A 3VBXA 1KWPA 4I0RA 3GC7A 5L4QA 3PDTA 2C6OA 2VTMA 2WMXA 2UW8A 1OVEA 4QO9A 2PUNA 5CU4A 2NO3A 3DZOA 4QP1A 4BKYA 3KRJA 3WOWA 2YCSA 5IQDA 1OB3A 3GC0A 5AP1A 3DPKA 1YWRA 2CJMA 2NP8A 4ZTSA 5M56A 2C5YA 3ZYAA 2ERZE 4OBQA 4AWIA 3ZDUA 3UVQA 2ONLA 5CF6A 2VWIA 4B4LA 1WVXA 3OFMA 3Q53A 4GVAA 4RJ8A 3U6HA 4RC4A 2Y6OA 3RP9A 2GS6A 2ZM4A 5BX0A 2OJIA 2QQ7A 5IUGA 3IW8A 1HCLA 1YI6A 1W98A 3EYGA 4DITA 1ZZ2A 4QP9A 4FSNA 4FK3A 2F57A 2GDOA 5EI8A 5FP5A 2I1MA 4QYEA 4S30A 4BBMA 5JMSA 4CRSA 2OLCA 4DFBA 1JVPP 3QYZA 1PW2A 2E9UA 2UZDA 3LE6A 4X2KA 4C59A 4EOKA 2HZNA 2GHMA 3VBWA 1SZMA 4O7NA 3K3JA 1SNXA 4FTCA 2CGWA 4IMYA 4QQCA 4BTKA 1IR3A 5M51A 3OY1A 4UXLA 4O27B 4XEYA 3CEKA 1ZOGA 4IM3A 5AP7A 4AP7A 4J8NA 2OJJA 4CGAA 1H8FA 4I92A 4IHPA 5DWRA 1WMKA 2XNEA 3TV4A 3QQLA 1M52A 4O83A 2OU7A 4FIGA 4QPMA 4DEEA 3R71A 3CTJA 1ERKA 2BRNA 4F0FA 1U5QA 3R1QA 4F6SA 4HW7A 3Q9WA 4BHZA 3F66A 2UZEA 3E88A 4YZBA 3S0OA 3VW8A 4AA5A 3HA6A 4FKPA 4F65A 3P0MA 1BYGA 5L2WA 2P0CA 2Y6MA 3NYXA 5A4TA 2HW6A 4FNXA 4K77A 2RL5A 3L1SA 1W0XC 2FVDA 2OH0E 3IGOA 4ZP5A 3UC4A 4GT3A 4F6WA 4GFOA 4PMSA 3U6JA 3RMFA 3PFQA 4F64A 5LCJA 3PYYA 3ZONA 4AZVA 2QOIA 3D2KA 3RI1A 4AW5A 4L00A 3H9FA 5HTBA 4JRVA 4NW5A 4FV6A 2DWBA 4E3CA 5AM6A 4NK9A 1XKKA 4UWYA 4E6CA 4KD1A 4B8LA 4EK8A 4PTGA 3QTIA 5LWMA 2O65A 4G3FA 3ZZEA 4R7IA 2OFVA 3OTUA 1U54B 5BYYA 4FKRA 2J0JA 3ZXTA 3AC8A 3EFWA 4QTEA 3EQHA 4ZS0A 4F6UA 5HCZA 4AW2A 3D83A 1RQQA 4J71A 4CZTA 3RHKA 4QQTA 1UKHA 3QLFA 4IJ9A 3RWQA 4BCFA 2QNJA 4OTRA 5CXZA 5LVNA 2DYLA 2P2IA 2JBPA 1T46A 1FVVA 4LGHA 4I21A 4IB1A 1YWNA 1G3NA 3UMXA 3RK9A 3GOPA 2VTOA 5FEEA 2P55A 3DDQA 1PKDA 3IDPA 1KUTA 3PA3A 4G2FA 3KKVA 2Z7SA 3PPJA 4B6LA 3UYSA 4AGDA 4G6OA 4PTCA 3A61A 4LL0A 1PMVA 3PJ8A 5ANDA 3THBA 4GFMA 2YM6A 5FLFA 2W7XA 3ZLSA 4IACA 2UVZA 1UNLA 2Y9QA 3WYXA 5IKWA 2R3PA 4Y5QA 2WTKB 2GNFA 5J1VA 2XJ1A 2VN9A 3UODA 3O51A 2PZPA 3JY9A 2B9JA 4X3FC 2W1GA 2C5NA 4FIJA 4DTAA 4F4PA 3JYAA 2HK5A 4QMNA 2OXXA 3R6XA 3I6UA 1LPUA 4YHJA 5L2QA 1SM2A 2JFLA 4DHFA 5K5XA 3MA3A 4CV9A 4C7TA 2I0VA 4PP9A 4QYYA 4EH6A 4ZLZA 4FV7A 4KKEA 4RWJA 4TN6A 4E4XA 3HV3A 3KEXA 4MWIA 4C33A 1H1RA 5A14A 4JBVA 1O6LA 4FL3A 4ZMFA 4X2GA 4O22A 2C3LA 1Q3WA 1Q61A 4L3PA 4DEDA 3F7ZA 5JGDA 2VWZA 2BRMA 3MPMA 3ZFMA 1BL6A 2UW3A 3Q52A 5HG8A 2QI8A 4W9XA 2QOCA 4EYJA 2UZUE 5F94A 3WF7A 4PMPA 4X6RA 4IZYA 1IG1A 3FZTA 4J99A 5DRDA 3E3BX 4EH3A 5JZJA 4MQ1A 4RIWB 3RPOA 3A62A 3ETAA 2ITTA 5JN2A 5IA4A 5DT4A 4BDAA 2VNWA 2YIRA 4FV0A 3RKBA 4W4YA 2CKQA 2QC6A 3QQFA 4H05A 2VTQA 3LPBA 4I5CA 3JY0A 5CNNA 3FMKA 4D0XA 3MV5A 3R22A 4CFVA 4AZTA 3CQUA 2WQMA 3MVHA 3O8TA 3VW6A 4QPSA 3KU2A 5DH3A 3BYMA 1PMUA 3OMVA 1OL7A 2GNHA 4EKLA 1OIYA 2R3KA 2W1CA 1ZMUA 3R28A 4FX3A 2F7EE 5TO8A 3D5WA 4JQ8A 3IS5A 4JDKA 4UZDA 3VRYA 4O7ZA 2V7OA 4UMUA 4V0GA 4PUZA 2FB8A 3HLLA 4TKSA 4G3GA 4IBMA 5M57A 1MP8A 2P3GX 3GXLA 2O3PA 4LOOA 4YZCA 5EKOA 4LV5A 4G16A 3ELJA 4BCIA 5FTGA 1J7UA 2IVSA 3LXPA 2PMLX 3R1SA 5HU3A 2IN6A 4LMNA 3OXTA 1UWHA 3E92A 4RMZA 4PWNA 4AOIA 2XZSA 3KB7A 2HAKA 4O6LA 4PL5A 5A3XA 4ZMEA 4RVKA 4FF8A 3P08A 4IWOA 2FA2A 4EOIA 1Q8YA 3BV3A 4MXXA 4D1SA 2WQNA 3I1AA 5IMEA 4NWMA 4UY9A 4RT7A 2X7OA 3PXYA 2R3IA 4BCJA 4D9TA 4EL9A 3PIYA 3DY7A 2PZIA 3Q9ZA 2HENA 2JGZA 3G0EA 4OTIA 4JDJA 3ERKA 5J7HA 5CANA 4D58A 4RA4A 5IUIA 5HGIA 4BTMA 2BR1A 2VWXA 2RKUA 4MYGA 3D7TB 4TPTA 2VV9A 3I60A 2I0HA 1WBOA 4JLCA 2WEIA 3LCDA 3EN6A 3MB7A 2PVRA 5CSVA 5GHVA 5DT3A 3FZ1A 4CT1A 1DI8A 1OIQA 2JKOA 3WE8A 2EU9A 3DBDA 4PNIA 2Z8CA 5J95A 5C27A 1ZRZA 4UALA 3ID6C 2W9FB 4J53A 4C3FA 3PY0A 5JZNA 4IJPA 3SXRA 4PP7A 4I0TA 4R3PA 2Q83A 3B2TA 3PRFA 3EQRA 5EG3A 5F9EA 2JKKA 3EN5A 2PL0A 3QRJA 4I3ZA 1M7NA 3MVLA 3QA0A 5BPYA 4FGBA 4NYEA 1RDQE 1LR4A 5F95A 1M2RA 3DZQA 4RJ6A 4ZOGA 1CM8A 5EDPA 2OZOA 4TNBA 1H1SA 2WD1A 3BGQA 3GENA 5HNIX 4U6RA 4O7LA 3QTQA 2VTSA 2YABA 4YPDA 3A4PA 5BNJA 3QTRA 4DT8A 4MCVA 2X1NA 3MH0A 2OIBA 2ZMDA 4E5WA 3DAKA 3GVUA 3E64A 1Q97A 3F3UA 2VTLA 5CEIA 4EKKA 5BVDA 5M07A 3VIDA 3K5UA 1Y6AA 4M7IA 4C3PA 4GJ3A 5K4JA 4JIAA 1W84A 4O7WA 5EYDA 3MVMA 1YXXA 2QKRA 3GC8A 5DPVA 1OITA 4EK5A 2EXMA 5FDPA 4CFNA 3VJOA 5IH6A 4EC9A 4D5KA 5L6OA 2CMWA 3I7BA 2FSTX 5KBRA 2C3IB 4D9UA 4OLIA 1UVRA 3IOKA 3NSZA 4PDOA 1OL5A 3HGKA 4TWPA 2YITA 4QPAA 3R7UA 3R73A 4ANMA 3R9OA 4D4YA 3QBNA 4BB4A 2QCSA 4WNPA 4EH9A 4BZOA 4BDEA 1MQBA 3MH3A 3C5UA 2RGPA 4ITIA 3GU7A 4HVHA 2JITA 4M66A 4BRXA 3GCSA 1UU3A 4L7SA 1F5QA 2JKMA 3O96A 4PMMA 5EM6A 5CENA 4BDHA 5HBHA 4HYIA 1ZY5A 2CN5A 3MN3A 3R8UA 4U44A 5ITAA 3LQ5A 4JBOA 4TYHB 4QTAA 3M42A 3NUPA 4O2ZA 5LJJA 2J0KA 3LIJA 3FC2A 2QHNA 3E8NA 5E8UA 4G5JA 3D0EA 1OM1A 2WTCA 5C8KA 5FP6A 3OTVA 5I9WA 2R9SA 3II5A 3ZLXA 3VS5A 4FVQA 1MRYA 2C3JA 3MY5A 4FICA 4L6QA 3AGMA 1YW2A 4M15A 4ZY6A 1K9AA 4FG9A 4IX4A 2JBOA 4M3QA 3NNXA 3PXZA 4QMWA 4R3RA 5HBEA 2PE0A 3PA5A 3SA0A 2OIQA 1U59A 3R00A 3CS9A 4IC8A 4O0WA 3QZFA 4AN2A 3I4BA 3O7LD 3BE2A 3QUEA 5E8WA 3FLNC 5BMSA 5DN3A 1TQPA 2X7GA 3MPAA 4GK3A 3HNGA 4L45A 3GCVA 3O50A 3BEAA 2YISA 4P4CA 3HV5A 3WE4A 4EJ7A 1P2AA 3GUBA 4EJNA 3DXNA 3GCQA 4FTMA 4IAYA 3A8WA 4FVPA 4C3RA 3QXPA 4E4LA 3B8QA 4TL0A 4IFGA 2BHEA 5AM7A 2ACXA 3EOCA 1T45A 5J9LA 2W5BA 1SVHA 2C6MA 3KXZA 4NTTA 3CIKA 3FKOA 4I94A 4WNOA 4F9AA 1BI8A 3CSVA 2PVYA 5B2MA 4FK6A 4RJ4A 5EW3A 2CHLA 4CRLA 5TKDA 1IEPA 5GZ9A 3T3VA 4EK4A 4EWHA 4EUUA 4E5AX 4NEUA 4CFXA 2A0CX 4IZ7A 3TT0A 4MF0A 4PY1A 3QQJA 4D1XA 5CAOA 1SVGA 3CGOA 1OPLA 4XH6A 1UWJA 3HMMA 1GIJA 5AIRA 4CG8A 4KRDA 4CVAA 2ITVA 5M4FA 4EOJA 2HOGA 4Y5HA 1Q8WA 1MRUA 5CAPA 1P5EA 4UZHA 5AJQA 3U6IA 3Q9XA 2BCJA 5EH0A 4C61A 4ACGA 3FMLA 4QP2A 4FT9A 4DG0E 3FI2A 4LUEA 3Q4UA 1Q4LA 3BU5A 5IU2A 3P23A 1KE7A 3CY2A 3GB2A 4UMQA 3UVPA 1XJDA 5HIEA 1BKXA 1OKVA 4AE9A 4QMTA 3NMUF 2R7BA 4ORKA 2NNWB 3BRBA 5IA1A 2WEVA 2XCKA 5CEKA 3F5XA 4WOVA 4XV9A 1XBCA 4GJ2A 5HKMA 5GZ8A 4IC7A 2W1HA 5D12A 3FZPA 2WNTA 2IW9A 4AFEA 2HXLA 4AW0A 1NVSA 3ORXA 3LW0A 4M13A 5J5SA 2YDKA 5TF9A 1CTPE 4MNEA 5FBOA 4DEBA 3COHA 2WHBA 4N70A 5ACKA 1PXNA 3WF6A 2UZBA 4GV1A 1Q41A 5B2KA 2VX1A 3TXOA 4F63A 2Q0BA 2O63A 2WMRA 3BQRA 3ZSGA 4AQCA 4BDCA 4BDIA 3IW5A 3ENMA 2OJGA 1ZAOA 4OT5A 4CYJA 5FGKA 4L3LA 4UMTA 2G9XA 4Q9ZA 4BGGA 4FV9A 3CY3A 3O8PA 4ZXTA 2X7FA 4S33A 3RPRA 5HNBA 3NS9A 4ENXA 4QQJA 2ZMCA 3MIYA 3RM6A 4RZVA 2XEYA 5EYMA 4D2RA 5IQFA 1Z5MA 5D7AA 2UZNA 1URCA 3BYOA 4YLLA 2IJMA 4OBOA 5DEYA 4YJVA 5IEVA 2B54A 4YGAA 4O0VA 3NVKI 1O6YA 2WKMA 4FOBA 3LOKA 5D1JA 4MX9A 4FT3A 2PU8A 4YC6A 2AC5A 5HEZA 4UX9A 5CI7A 3ZOSA 2Y4PA 5IDPA 1W82A 3G90X 3EFKA 4D2WA 3OCSA 4H36A 4EH4A 2V0DA 3Q2JA 2BHHA 2OZAA 4IX6A 3OT3A 4LL5A 4GL9A 3V8WA 3EL7A 1PYXA 3OEFX 3T9TA 3ZCLA 4CKRA 4CKJA 5ANIA 3OBJA 2B9IA 5EHYA 2EB3A 5F4NA 3TJDA 4O7TA 3O7LB 3BLRA 4X3FB 2OSCA 2PMNX 3R83A 3SW7A 5HE1A 4DEIA 4IB5A 2XK6A 3G9LX 1ZYDA 4FKTA 3K5VA 4FKOA 4AA0A 5KHXA 3CKWA 2X0GA 2XB7A 1V0PA 3KQ7A 3C1XA 4N57A 2B53A 4YURA 3GEQA 4EOQA 4GH2A 3QX2A 4JDHA 4RQKA 5AV2A 4F09A 4IADA 5D7VA 4N6YA 5HLWA 2VX3A 5HG9A 5EQYA 4C4FA 4XS2A 3TNIA 4CKIA 4BDGA 4E6QA 4DTBA 1LUFA 3DT1A 3D4QA 5C26A 4X6QC 3FJQE 1NXKA 2RFDA 3AT4A 3MDYA 2R7IA 4QMZA 4CSVA 3FE3A 4ZTNA 1VR2A 2XEZA 3QKLA 4K8AA 4MK0A 4BDJA 1XH5A 4FYOA 4GYIA 4DH7A 3H30A 3K2LA 3KRLA 1WBWA 3PVBA 4FZFB 3CPBA 5ANGA 4ERWA 4DBNA 3IKAA 5TR6A 4YHFA 4H1MA 4U43A 1K2PA 5CU0A 4I41A 1DS5A 2UV2A 3HMNA 2VNYA 4S34A 1PKGA 3NWWA 3P1AA 5K3YA 3S2PA 4JG8A 5IQCA 3SRVA 4X2NA 3QUPA 3VQUA 2W4KA 3CTHA 4M69B 3ATSA 5LWNA 4JQ7A 3P4KA 1IRKA 4WT6A 5CEMA 3L8SA 3HRCA 3R30A 1IAJA 2PPQA 3TDVA 4KBAA 5TE0A 3TIZA 3BI6A 4W8DA 3V5WA 2JC6A 3C0GA 4G9CA 5AP0A 3ZH8A 5HLPA 2XNGA 4MXYA 3ZU7A 4H39A 4GK2A 4FIHA 3R2BA 2OI4X 1A9UA 2Y4IC 3OP5A 5AADA 4PL4A 4ZTHA 4Y72A 1QPDA 4GMYA 2OF4A 3L8XA 4MVFA 1YOJA 4FKUA 4Z9LA 2BRHA 4HVSA 4TWOA 4E5BA 3FKLA 2KTYA 3CQEA 2IVVA 3QKMA 4L46A 1H24A 3FI4A 4C4GA 1UU8A 2A2AA 1QL6A 4LMUA 4KSQA 2C5VA 2HZIA 4J1RA 4KWPA 4Q5EA 3F69A 3ORPA 3JUHA 3RINA 2FUMA 4DGMA 2KULA 5E9EA 3EB0A
chains in the Genus database with same CATH superfamily
2UVYA 4C2VA 3SXFA 2XCHA 2ETRA 3QHRA 4QP6A 3FL5A 3C13A 4DYMA 2IF8A 3U54A 2ZDUA 2P2HA 3D14A 5DRBA 5T3QA 4CFMA 5B7VA 4J98A 4BBFA 3KVWA 3REPA 5K9IA 4A9SA 5HCYA 3KXHA 2VTPA 4DH3A 3P7CA 4DH5A 1Q8TA 2NRYA 3FYKX 5FWKK 5BQ0A 2BILB 3AQVA 3MFUA 1PJKA 4ANBA 4DN5A 4BBEA 2QU5A 2QVSE 4XG2A 1PY5A 4O86A 1YI4A 3WIGA 3W2CA 3R9HA 3ZSIA 4XG7A 3WF8A 3Q4TA 2YACA 5ANEA 3CBLA 4AE6A 3WBLA 2B9HA 2EXCX 2GNIA 5HIBA 4DGGA 1FVTA 5AUYA 4Z3VA 1P14A 3TN8A 2E9PA 2F7ZE 2XA4A 3LFSA 4M97A 4AT4A 5EKNA 4MKCA 5EDRA 2XKDA 2I0EA 4U42A 3ZUVA 4FTOA 4O6EA 5J7BA 1VEBA 5C03A 4A9YA 3KULA 2XJ2A 3E63A 5HNGA 2YZLA 2VO3A 3OWKA 3CJFA 3BGZA 2CGXA 2IVTA 2UZLA 4FKIA 4AOJA 3A99A 4FA2A 2ITZA 4O0RA 4CZYB 2QODA 3GC9A 1OIUA 2OWBA 4J96A 4R78A 3ZM9A 3R8MA 5A4CA 5FM3A 3SG9A 3LXNA 3KA0A 4RGJA 3AD5A 4WO5A 1Q62A 5CF4A 5KMIA 3P7AA 5AP5A 5FXRA 4OTDA 3UO6A 4LV7A 2VWBA 3EMGA 3NNUA 2R0IA 3FWQA 3EZRA 2X39A 1WBVA 5HVYA 2ZAZA 5E8SA 1K3AA 3N9XA 3NAXA 1VLRA 1VYWA 2UZVA 4F08A 2G01A 2YLFA 3VJNA 4KBCA 3UJGA 3TNPC 2W96B 4RIYA 4JDIA 5CVFA 5AR3A 3HAMA 3ZO3A 4O4FA 1Y8YA 2IWIA 3N4UA 2PULA 2O0UA 3CC6A 3DS6A 5AMNA 4YU2A 4DTKA 1NW1A 3LLTA 4EQCA 4N0SA 4M67A 1KE9A 3L9LA 5E1SA 3A7HA 3NIZA 2J50A 4EH2A 2V62A 3IONA 4MD7E 2J2IB 3V01A 3QALE 4EBWA 3RNIA 3P5KA 2GTNA 2W17A 4WD5A 4EH7A 4EZ7A 1OECA 2PUUA 4I6QA 4Q9SA 3BGPA 3I5NA 3I81A 3IW7A 3QD3A 4YNEA 4BWPA 4RFMA 1B39A 3DFCB 4YZDA 3RBWA 5CS6A 4U5JA 4DFZE 3LKMA 3VVHA 5FQDC 2J0LA 3KXMA 2RFNA 1ZYSA 2YCFA 5EYCA 4RVMA 3R63A 5FXQA 4ALUA 3AKLA 2ONLC 4QT1A 4TNDA 4IX3A 4AS0A 5HHWA 5LMKA 4LM5A 4BZNA 1O6KA 2B7AA 2EUFB 5LVMA 2QOHA 4FEVA 3QXOA 4GIHA 3VUTA 3GCUA 5GIOE 4YJNA 3CXWA 2IPXA 3PP1A 4E73A 4FKQA 2C5OA 3G6GA 3R7OA 4C34A 2YN8A 3BCEA 2VWYA 5KBQA 4YSMA 5CSHA 4XUFA 5K0XA 5E8ZA 4FTNA 4FNWA 4HJOA 5C01A 3UIUA 2C6DA 1OBDA 5LVLA 5AAGA 3OVVA 5M4UA 3OROA 3ZSHA 4U7ZA 1UKIA 4GU6A 3R1NA 4ZJJA 2WAJA 5AAEA 2HXQA 2J7TA 4G17A 4QMOA 1RE8A 1ZMWA 2CNQA 2GNJA 2WTJA 5FBNC 4ZY4A 3E7OA 3CPCA 4FIFA 1CKIA 4PL3A 2W4OA 2O2UA 3ULIA 1KE6A 3PY1A 3C4WA 4MF1A 4TZRA 5L8JA 3NZ0A 5CSXA 3L8VA 4X21A 2CKEA 2C6IA 4QMVA 3V5TA 1Q8UA 4UB7A 5HE0A 3UNJA 4I5HA 4NJ3A 1YI3A 4ZK5A 3TNWA 3HAVA 2VTRA 4JL9A 5AUTA 4YP8A 2XNPA 3QL8A 1A48A 4FSMA 2W1IA 3DBQA 3PPZA 4O0TA 2Y0AA 3F2NA 4YBKA 4X3JA 1G8AA 4RX8A 4ZS4A 1UA2A 2BFXA 3I0QA 4X0MA 1Q8ZA 4RC3A 3LJ1A 4BIEA 3OD6X 4J52A 3KL8A 1Y6BA 3ZZWA 4AACA 4HVGA 3PP0A 1XH6A 3AMYA 2EVAA 3NAYA 4FSRA 5T6KA 2XUUA 5T68A 4BVUA 3GNIB 4PF4A 3EQBA 4DLIA 4B9DA 1OGYA 4MNFA 1LEWA 1QPCA 3ITZA 1JSVA 5KZIA 4BCQA 5BVNA 4HGEA 4R3CA 1TQMA 3C9WA 4HVIA 3W32A 1U46A 2UZWE 3R9RA 4I24A 2NRUA 3F3TA 5HIDA 3UOLA 1KOBA 5JKGA 2AEGA 3PXRA 3UZRA 2QR8A 4FV1A 5AX3A 2J90A 3VAPA 5M4IA 2BROA 2ZM3A 3LCKA 3ORMA 3W0PA 4FGRA 4G3EA 3Q32A 1YXTA 4IWQA 1ZYCA 5HG5A 1JKSA 1H25A 4FTUA 4M0ZA 2GNGA 4NUSA 4GKIA 3V5PA 4FE2A 4LGGA 4I6BA 3G2FA 2WOUA 3PUFC 3PA4A 4FOCA 3VRZA 3WF9A 5A4LA 2B1PA 3E62A 3TUDA 2R2PA 3PUPA 3TZ8A 3ENHA 2VTHA 4L8MA 3QRUA 3V6SA 4U79A 2BVAA 4TT7A 4ZTQA 4I4EA 4CEGA 2XNNA 4WHZA 2W05A 4GS6A 3P79A 4P2KA 4D4SA 3PTGA 4WBOA 1WVWA 1P4FA 2W0JA 4HGSA 3HYHA 1JSUA 5IA3A 3FEGA 5DNRA 1H28A 4E8AA 2XK8A 5LMBA 4F9WA 4YTHA 2J9MA 2UW0A 4XYFA 4DC2A 2OK1A 4Y83A 4A9RA 5IA5A 4AT5A 3G15A 5E1EA 1OGUA 1XO2B 4BCPA 4RJ5A 3HDNA 5EQEA 2CCIA 5KO1A 5AUVA 1WBSA 4YLKA 5A4EA 2GTMA 5KCVA 3MSSA 3A4OX 3HRBA 3DFAA 3UG1A 3LHJA 3ATTA 3OWJA 4BZDA 3OUNB 1YXUA 4NM3A 4TXCA 2UW5A 3QCQA 4Q2AA 1JWHA 3WIKA 4BFMA 4C38A 4HVDA 3UPZA 4KIPA 3DKFA 2C1AA 3MBLA 3K54A 5A6NA 2ITNA 5D11A 4XV3A 5EW9A 4CLIA 3HUBA 2YWPA 4KIKA 3FQEA 4QYFA 2QG5A 3G51A 4CMUA 3ET7A 3FMMA 3QCXA 3DK6A 2NYAA 1H07A 3OS3A 4KABA 3VUDA 2YHVA 3LZBA 2HIWA 4IANA 4TYIA 5F20A 3Q6WA 4RIXA 3W18A 4R1VA 4ZZNA 2IZTA 5AA9A 3KGAA 3DKCA 2RSVA 4LOQA 3V3VA 4DHZA 2ZDTA 3CD8A 1M7QA 3IECA 3QTXA 4F99A 4EEVA 3BLHA 1OKYA 4APCA 1BMKA 3EQDA 3RCJA 5CEOA 4XP0A 1JKTA 2C4GA 2F2UA 3KXNA 3OBGA 4DDIA 2PHKA 4CQEA 4UXQA 3KIOC 3MVJA 3MA6A 4BI2A 3W0MA 5KMJA 3NGAA 4FKJA 4UN0C 5IG1A 3GU4A 1X8BA 3R21A 5IEYA 2UW7A 3SD0A 5KNJA 4NH1A 3BL7A 2RFSA 3MGYA 4BF2A 3HP5A 4EOPA 3OCBA 4FIEA 2BUJA 4O4EA 3QQUA 1WZYA 3AT3A 1WCCA 1FPUA 4FV3A 1H01A 2YAKA 5EFQA 3OCTA 1R39A 2IW6A 3CD3A 4C4JA 2VTIA 4JG7A 4M0YA 2WU7A 2R3HA 3C51A 3QHWA 3RALA 3QCYA 3QTZA 5AP4A 1QPJA 3U9NA 1FGKA 1JNKA 3VUHA 5GZAA 2JDSA 4U3YA 5IF1A 3FMNA 4GFGA 4NFNA 3S3IA 5IQEA 3PSBA 4HZSA 3TG1A 2CGVA 4JRNA 5CQWA 3DBFA 3R2YA 3FMDA 3HDMA 3FMHA 5DGZA 4DH1A 3AC2A 4YTFA 5AWMA 5BVWA 3R8ZA 4X7QA 2XYNA 4G31A 4CFFA 3RWPA 4HYHA 3ZUTA 4OAVB 1ATPE 1KSWA 2YIQA 3LVPA 3CQWA 2GQSA 4TTHB 5C8MA 5LOHA 4FT5A 3VWAA 3CP9A 4MBJA 3TL8A 5HD7A 3M11A 4EYMA 4GEOA 3LCTA 3FPMA 3MPTA 3MTFA 4RX7A 3C4FA 4RBLA 3QZHA 3T9IA 4DGOA 3U4WA 4HGTA 2XYUA 4PV0A 2YDJA 5E8YA 2AUHA 1BUHA 3GOKA 4Y8DA 2Y4IB 3S4QA 4AG8A 3UQCA 4YZMA 4TYGA 5HX8A 4XRJA 4ARKA 1R78A 3W8LA 3FSKA 5AX9A 3VUGA 2QOKA 5C9CA 5TOZA 4EC8A 2C68A 4G3DA 4N4SA 4DHJA 1YHSA 2ITUA 3OT8A 4CD0A 4EUTA 5IEXA 5JFSA 5K5NA 3DK7A 4MD8E 1ST4A 3EQPA 4NCTA 2BMCA 4RJ3A 2YIYA 1PRYA 4QTBA 3LFBA 1JOWB 3Q9YA 5AP3A 3UBDA 1MQ4A 3EKKA 2XBAA 3ZTXA 4R7HA 4CFUA 2ZV9A 3HVCA 4FG8A 3H10A 5G1XA 4NJDA 3BELA 1ZYLA 4UV0A 3UIMA 3QCSA 5HD4A 3ACKA 2IO6A 5AP6A 1J91A 2GMXA 4BGQA 4X2FA 3U8WA 5IZFA 3KRRA 4M8TA 5KMNA 5IQIA 1OBGA 2LAVA 3QYWA 4RA5A 3UIXA 3WI6A 5J1WA 2VTJA 4XHKB 4D55A 4D2PA 3ANRA 4OTGA 3VONA 3D9VA 2FH9A 4D0WA 3DKGA 5CSWA 4FC0A 5M4CA 3QKKA 4V04A 3PSDA 5AIKA 4C58A 3FQSA 2QO9A 2YLEA 2OXYA 4FL2A 3KF7A 5LVPA 5KHWA 3R7GA 3BEGA 5L3AA 4FTTA 3QZGA 3RM7A 2F7XE 4RVLA 4FUYA 2F4JA 3GU8A 5EOLA 3COIA 4O4BB 2QO2A 1U54A 4H3BA 4IW0A 3BU6A 3HMPA 4O21A 2FSOX 4K0YA 1OIRA 3R02A 4CTCA 2BAJA 4TWNA 1H4LA 1YXVA 3L9MA 4ZSGA 3TTJA 3KREA 2PE1A 2IZRA 3DGKA 3W1FA 3W8QA 2ITQA 4C36A 4DCAA 4RVTA 3QU0A 1XH9A 2A27A 3NX8A 4DE4A 2GFCA 3O71A 1UNGA 2G1TA 4IWDA 4U3ZA 5HO7A 5DYJA 4BYIA 3IW4A 3OF0A 3QC4A 5BUIA 4MXZA 5FTOA 3UGCA 4R7BA 3U51A 2A4LA 3ZFYA 3SHEA 2BKZA 2PVMA 3Q2MA 4H58A 2X9EA 4ID7A 3HV7A 4OAUC 4I20A 2I6LA 3UOHA 4EK3A 3R01A 4E4NA 3GU5A 3SOCA 1DAYA 2LGCA 3F5PA 4S2ZA 5EI2A 1TFFA 1OI9A 2RIOA 4I5MA 4U97A 2PTKA 3DLSA 4XV1A 4ACMA 2XIKA 2GCDA 1H1QA 3GBZA 4P5ZA 4F0GA 4DCEA 2FGIA 2CNUA 1M2QA 5JRQA 3VBYA 2XIXA 1VYZA 4W4XA 4BCNA 4FV8A 3PJ1A 4YJUA 4FTAA 4E1ZA 3DDPA 2YJRA 3BPRA 1ZOEA 4DEHA 3HRFA 3NRMA 5H8GA 4QEBA 4ZEGA 2XNBA 3FLZA 3VBTA 1XH4A 1B6CB 1GJOA 3W0OA 3ZC5A 3LJ2A 4KINA 4K11A 4LRJA 4HNFA 3UP7A 1TVOA 1S9IA 3D15A 5CASA 3QX4A 4UEUA 4PPAA 3N4VA 1PXKA 3QLGA 4HCTA 5FEDA 3AG9A 3AMAA 3PJCA 4FG7A 1YQJA 1YRPA 1ZLTA 3MWUA 2GQGA 1Q24A 2OICA 2W1EA 4M14A 2WIPA 5ETFA 3TI1A 3RCDA 5JSMA 1FMOE 3F3ZA 3ZC6A 4C4IA 4O7YA 3FPQA 3A7GA 1GIIA 3G33A 5JFVA 4AGWA 4XOZA 2YEXA 2PMIA 3RPYA 1YHVA 4K18A 5JQ5A 2UW9A 5CF8A 1YKRA 2GU8A 2W06A 4OTWA 4FZ6A 5E8TA 3W2QA 4JI9A 4QMMA 3W0QA 3CR0A 4PX6A 2IEWA 2IW8A 3OWPA 4ANOA 5IPJA 5E4HA 1E9HA 5J5TA 2XKCA 2ITOA 3FZRA 4IFCA 1ZWSA 3GCPA 3VHEA 2Y8OA 5HI2A 3LQ8A 4RIWA 3PSCA 2X6DA 4EOOA 5IA2A 4AAYA 4ZJIA 5IA0A 3TKIA 3LFDA 4TYEA 2I7QA 2UUEA 5IQHA 4P7EA 2BAQA 4O38A 3RPVA 4ASEA 4LRKA 3RPSA 2ZFYA 5EM5A 4GUBA 2C1BA 5I0BA 3UYTA 4XP2A 3AGLA 2XK4A 2W4JA 3NUUA 5BUJA 2JIIA 3IO7A 2BRBA 3DJ5A 1UNHA 4MWHA 3WYYA 5L8LA 4K9YA 4XJ0A 4FKGA 1AQ1A 4CT2A 4EONA 2BDFA 2J0IA 5DFPA 4BI1A 2W5HA 4GW8A 3VS7A 4WG3A 2H96A 3HUCA 2Z7QA 2JKQA 5IH5A 4A4LA 4FTQA 4IVBA 3EYHA 5AV1A 2ERKA 5ACBC 3ZMMA 4BYJA 3OW4A 5DE2A 3ML1A 2BKKA 2QU6A 1OL1A 2FYSA 3D2IA 4GG7A 5HLNA 4CCBA 3FC1X 3C50A 3WZDA 5BUEA 3DB6A 4OGRA 4ZTLA 4YO4A 3LM5A 4ZLOA 4FVRA 5J9YA 4FTRA 2QD9A 3DKOA 4DHIB 4G1WA 1PYEA 3QF9A 3NVMB 1NA7A 3E8DA 3JS2A 2HWPA 4QMLA 5ANOA 4AXEA 2WMQA 3EQFA 3ROYA 4Z55A 3OC1A 2BZIB 2C69A 2CLXA 3F3VA 3QRIA 3K3IA 4JVGA 3F7WA 3HX4A 2WELA 3LFEA 4QMUA 4WG5A 4JJRA 3VQHA 3UQFA 2VRXA 4IB0A 2GSFA 5J79A 3BQCA 3VS2A 2Z7RA 4JBPA 4U80A 2J6MA 4ACCA 5A54A 4OTHA 2RG5A 2HW7A 3F88A 4A9TA 4G3CA 2G2HA 3CCNA 3FKNA 3BWFA 5CVHA 2XIZA 5JEBA 1ZZLA 3UOKA 4OUCA 4GT5A 2XJ0A 2QKWB 3LMHA 3SV0A 4GK4A 2VZ6A 4EH8A 2JEDA 3H9RA 4CLJA 3QWKA 2PYWA 2BTRA 3A60A 4IX5A 4D28A 4DT9A 4KIOA 4OW8A 1WAKA 2Z2WA 5HORA 3D7TA 1IA8A 3TWJA 3H9OA 5AR7A 4ALWA 3COKA 4WNMA 4TY1A 3KRWA 3KMUA 5CU3A 2H8HA 1UU7A 3F5UA 5AR8A 4BCMA 1TZDA 4L42A 3S1HA 2R3JA 3RAHA 3DTWA 2X4ZA 4KB8A 3JXWA 3NFGB 3A2CA 1A06A 3V5LA 4Y85A 5E91A 3F6XA 2WMUA 3VULA 1AD5A 1GNGA 5AFVA 3Q04A 2AQXA 4DINA 1URWA 5FG8A 1PMNA 4NW6A 2QLUA 3IK3A 2ITPA 4DBXA 3KXGA 3Q4ZA 4R6VA 3ZLYA 5J9ZA 1QPEA 1OKZA 4IAZA 4QMSA 3TV7A 3M1SA 1PXOA 2W1DA 3AC5A 3IW6A 4AAAA 4F7LA 1W7HA 2X4FA 2IG7A 2OGVA 2OF2A 3FUPA 5E8XA 4J95A 2YERA 5DHJA 5KMLA 3OOGA 3E8CA 3O23A 4LRMA 3T3UA 3EQGA 5BV3A 2F49A 4XG6A 4CCUA 2VGPA 2WPAA 3QQGA 4AN9A 5CQUA 4E26A 2WMSA 4IQ6A 3MI9A 4KRCA 4XX9A 5CVGA 3DJ7A 3F61A 4APPA 4DG3E 2O64A 2OG8A 3NW5A 1PHKA 2ITWA 4KKHA 4V01A 3ZRMA 4AZFA 4BCOA 2IZUA 3COMA 2R3RA 3I79A 5CXHA 5I5ZA 4BWXA 1L8TA 2A19B 3SW4A 5EM7A 5GJGA 3IGGA 1V0BA 3NR9A 4YR8A 5J8IA 3O8UA 1WVYA 3FMEA 3PE1A 4YTCA 3DQWA 2ESMA 4QMYA 5I9XA 4YO6A 4YHTA 3V8TA 1CSNA 2BIKB 3PVUA 3QWJA 4MXOA 4A7CA 2CNVA 3WZEA 3SGCA 3TMOA 4D2VA 4B0GA 4I23A 2WMWA 5CY3A 3FSFA 4F1TA 4DFNA 1YVJA 3JPVA 4XLVA 5EYKA 5AUXA 5CF5A 3N51A 5GIPE 1M14A 1MRVA 4MAOA 1YOLA 5CX9A 3V5JA 5CU2A 3AC1A 2WU6A 3VBQA 4X2JA 1CKPA 3PJ2A 5ANKA 3DNDA 2ZB1A 3D7ZA 3C5IA 2WIHA 3QTSA 4YBJA 3SAYA 4L44A 3E7VA 4TYHA 3PZEA 3NUNA 2UVXA 3Q4CA 3AC4A 2PUPA 2VU3A 2REIA 3UNKA 3PXQA 2YWVA 4RJ7A 1ZMVA 1FMKA 3KRXA 3I7CA 2QO7A 2W5AA 3QGWA 4FKSA 5G6VA 4BC6A 4RLKA 4PNKA 3FBVA 4HCVA 1LEZA 2GS7A 3BLQA 3LFAA 4EQUA 1Q5KA 3PWYA 4I6HA 4R8QA 5LARA 2HZ4A 3PIZA 3LFFA 4FTLA 5BVOA 5GINE 3FI3A 1ND4A 4V0GB 2XS0A 4IEBA 4BI0A 2XIYA 4G34A 5LQFA 5L6WL 4KIQA 1BLXA 3FHIA 4FRFA 3BBWA 1J1CA 1LP4A 1NY3A 5A6OA 2QOBA 4JR7A 3Q6UA 2A1AB 2DS1A 3KFAA 4WG4A 3ODYX 4M68A 4JBQA 4L3JA 4NU1A 4OTQA 3F2RA 4FNYA 3SX9A 2PK9A 3ZRKA 4FSWA 5AUWA 1WFCA 3NCGA 2BPMA 5L6PA 3PXKA 4AQKA 4JAIA 3OCGA 5DR9A 3FXZA 3WZJA 5BYZA 2V7AA 3UOJA 2Z02A 4Q5HA 2X8EA 1PMEA 3NYOA 4DA5A 1XQZA 4ZLYA 4FTJA 3U9CA 4AZEA 1YWVA 5AUZA 2XNMA 2B4SB 3TNQB 1H1WA 3BZ3A 3EFLA 1UV5A 3TNHA 4AOTA 2FSMX 4RX5A 2JDTA 2XM8A 1E1VA 3BE9A 3HA8A 4KKGA 5HE3A 2WFYA 3H0ZA 4QYHA 2GS2A 3NCZA 3FZOA 5D10A 1RJBA 1YDSE 4IDVA 5KUPA 2F2CB 4FZ7A 2R5TA 4WNKA 5E90A 5CSPA 5M53A 2P4IA 3EFJA 2XK9A 1TKIA 4G5PA 3OEZA 4MXAA 5L2IA 3BLAA 3ALOA 4CYIA 3MESA 3BYVA 3KVXA 4RQVA 3C4XA 3VS1A 4BCHA 1QCFA 2R4BA 5FRIA 1WBPA 2X8DA 4F1OA 4F7SA 1M17A 4FIIA 4BJJB 3KN6A 4H3QA 2E9OA 3NYNA 4WRGA 3ORTA 4AW1A 3BHTA 3SLSA 4XBRA 4O4DA 4IM0A 3DCVA 1SMHA 3LXKA 3OZ6A 2X9FA 3VBVA 3POOA 5DR6A 4HOKA 2GQRA 3ORKA 3LAUA 2PVNA 4BDDA 3NEWA 2ZB0A 3QD4A 1DI9A 4OTPA 4CFWA 1W8CA 4UYNA 2ZOQA 3U55A 4PPCA 1CDKA 2QOLA 5DIAA 2UZOA 2XH5A 3A7IA 2GHLA 4NIFA 3W55A 4XBUA 4FEUA 3NUYA 5D41A 2XNOA 5GJFA 4AXCA 1ZY4A 5JRSA 1WBTA 4Z7GA 1RW8A 2PY3A 1ZOHA 4YZNA 4ALVA 2QOFA 3H0YA 1UU9A 3OXIA 4EOMA 2O8YA 3RAKA 1V1KA 3F2AA 5JK3A 2W1ZA 5HU9A 2ZYBA 2YJSA 4LDTA 4EBVA 2G15A 4LI5A 4DEAA 3MFRA 1XHAA 4C4HA 5I9ZA 2YIXA 3IPHA 3PWDA 5KKRC 2OO8X 5FM2A 4RX9A 1OL6A 1Q99A 4ZTMA 2OIDA 5DR2A 1O9UA 3G9NA 4MH7A 2ZM1A 4ITHA 1KOAA 3PLAE 2IZSA 4O96A 5M09A 2YM7A 4MBIA 4WIHA 1Z9XA 5EHLA 2GFSA 5H8EA 4D1ZA 3KXXA 3VHKA 3EJ1A 3RAWA 4F70A 1GY3A 4DAWA 3NUSA 4WSYA 3MYGA 3UMWA 2CLQA 3MJ1A 4L67A 4QMQA 5L2TA 5A4QA 2OW3A 4UMPA 4EWQA 4KUJA 3C4ZA 3VF9A 2C6EA 2XMYA 2NPQA 4ASDA 5LMKC 4NTSA 4R5YA 4FSUA 3TUCA 4QYGA 2E9NA 4MXCA 4CZUA 3R7EA 5A9UA 2YCRA 3O2MA 1OPKA 2Q0NA 3HZTA 3OWLA 4EHZA 3BBTB 3BIZA 5HE2A 3TZMA 3H3CA 4D2SA 3L9NA 4JT3A 3MH2A 2YIWA 4II5A 4IVCA 3R9NA 2JDRA 3PY3A 2G2FA 4GIIA 5CLPA 5CU6A 5AAFA 3TKHA 5IQBA 3C4EA 4RLLA 4IAAA 4IVDA 4IWPA 4FZAB 5CTPA 3QAME 2CKPA 3R7VA 2BALA 3LMGA 3LXLA 3PFYA 5JQ8A 3MW1A 4W9WA 5B2LA 5L2SA 4L68A 2VWUA 3FL4A 3QD0A 4X3FA 3W10A 2XRWA 4FT0A 3UVRA 4NKAA 3FLYA 3Q3BA 4O1PA 2WB8A 2UZTA 2DQ7X 2PZRA 3FY0A 1JSTA 2ZV2A 3R0TA 3WARA 1STCE 1TQIA 3B8RA 3E87A 2PZ5A 1XWSA 1V0OA 1U4DA 2J0MB 3DAEA 3MS9A 4YJRA 4MBLA 2HWOA 4NT4A 3FZSA 4GUEA 5HICA 4BL1A 3F5GA 2JDOA 3D5VA 1R3CA 3TKUA 1J7LA 2BFYA 3UO4A 4CQGA 1L3RE 4JAJA 4IDTA 4RIOA 2X0PA 4IAKA 3UE4A 2V22A 1HCKA 4B99A 3ORLA 3FXWA 4XG4A 4O81A 5CI6A 4QP7A 4BHNA 3FDNA 4U0IA 2BRGA 5AA8A 4U9AA 4LYNA 3RVGA 3P5JC 3D5UA 5K4IA 4YLJA 2I40A 3PXFA 4AT3A 3A8XA 3P7BA 3TZ9A 1JKLA 2JLDA 3CE3A 4M69A 1REJA 4PTEA 2PWLA 2R3LA 4XRLA 5H8BA 2JFMA 4ASXA 4P90A 4ANLA 4F7JA 3ZXZA 4GVJA 3P9JA 4IVAA 4ANNA 3QRKA 3WILA 2HY81 3LCOA 3MFTA 5I3OA 4BDBA 1NVQA 2R3OA 3E5AA 3A7FA 2QONA 4E6AA 3TJCA 1XMLA 1ZARA 1FINA 4IZ5A 4EHVA 3I0OA 2B9FA 3UZPA 5EW8A 3GI3A 3TUBA 4FTIA 4OT6A 4BWKA 5I3RA 5CAVA 4R77A 2VAGA 4HGLA 4U45A 3DLZA 3P86A 4XCUA 5H2UA 1R0EA 2WTIA 2W99B 2CN8A 4L01A 3SDJA 4JG6A 4LFIA 3F3WA 4PMTA 4F9YA 3DQXA 3VUIA 2ZJWA 4EORA 2E9VA 5M06A 1H27A 2XBJA 3EN9A 4QNAA 4BKJA 3HMOA 3OOMA 4YJQA 5DVRA 3Q60A 3WZUA 4DFUA 4M84A 4LQMA 3C0HA 3FLWA 5ETIA 3EN7A 4E7WA 2Z60A 4FI1A 2XVDA 4R5SA 4ZIMA 1I44A 2R3QA 3ZEWA 4MNEB 3SQQA 3DK3A 4EZ5A 3AD6A 2GNLA 4UWBA 1FBNA 4A9UA 5FD2A 1PXMA 3AD4A 5DA3A 3LMIA 2HELA 5CWZA 4DGLC 3FI8A 1Y8GA 3I6WA 5FDXA 3HMIA 4EH5A 2EXEA 1YOMA 4LUDA 4PDYA 5H3QA 4F7NA 3IDBA 1VJYA 2AYPA 4QTCA 2C6TA 4RG0A 4DGNA 4H1JA 1G5SA 3PG1A 4KS8A 4GYGA 2VO6A 4NZWB 4C8BA 5ICPA 1ST0A 4ZSEA 4FUXA 4C35A 4UBAA 3ZEPA 3KN5A 2B52A 2EB2A 3FAAA 2C6LA 5DOSA 1S9JA 2GHGA 1R1WA 4HNIA 1OL2A 4O0SA 5HZNA 1G8SA 1F3MC 1MUOA 3QQHA 4AFJA 3JR1A 3NPCA 2JIVA 3NNVA 4EQMA 2QG7A 2OKRA 4U81A 2QOOA 3TACA 3KMMA 4BCKA 4BTFA 3QGYA 4USFA 4WKQA 2BDWA 3VF8A 3WF5A 2P33A 4KBKA 4C2WA 4A4XA 3AC3A 3L9PA 2B55A 4EI4A 5AUUA 4L53A 4AGUA 3F82A 2HYYA 1CMKE 2C5XA 3KF4A 4FEWA 4MD9E 2ZV7A 3ZUUA 3A7JA 4ANSA 4Z16A 2OZAB 5CZIA 3FQHA 5CALA 4BR3A 5DBXA 2RFEA 4JNWA 4AZWA 1OZ1A 3HEGA 4O0XA 3PPKA 5JGAA 2C0IA 4KAOA 4DH8A 3NDMA 2C3KA 3IDCA 1XH7A 2JDVA 3UG2A 3EQCA 4M12A 4P5QA 5CT0A 3Q5ZA 3LQ3A 3OY3A 3TDWA 3NLBA 2ITYA 2YM8A 4RRVA 5BVKA 1DM2A 5CAQA 4BN1A 2ZV8A 3KK9A 1XBAA