4BC6A

Crystal structure of human serine threonine kinase-10 bound to novel bosutinib isoform 1, previously thought to be bosutinib
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
293
structure length
285
Chain Sequence
EHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
publication title Crystal Structure of Human Serine Threonine Kinase- 10 Bound to Novel Bosutinib Isoform 1, Previously Thought to be Bosutinib
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 285
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bc6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bc6A01
3KN5A 3RK7A 3Q3BA 4GKHA 5IH5A 2ZMDA 3BLHA 3RZBA 4BBFA 3GCVA 3HA8A 4QP3A 4GIHA 2X9EA 3A2CA 4QMMA 2FB8A 3ACKA 4IB0A 5HE1A 1YXXA 5AFVA 4RX5A 2WIPA 4QTBA 1O6LA 3OXTA 2FSMX 3ODYX 3PPJA 3R73A 2GCDA 2VZ6A 4FKGA 4LUEA 5F94A 4YR8A 3LKMA 4RWKA 2Z60A 2V0DA 4I20A 4USDA 4BRXA 4FSYA 2RFSA 3V8TA 3OMVA 3QQFA 3FZOA 4PMTA 2UZTA 4QP8A 1Q8UA 2RFEA 3V5PA 5AAGA 3VS0A 4FZ6A 3R2YA 4F0GA 3VIDA 4JIKA 3TN8A 3ZZEA 2HYYA 3LCDA 4BIBA 5BVOA 3BV3A 1OIYA 3HNGA 2OIQA 5CYIA 3HV4A 3SW7A 5T6KA 5HG5A 2J2IB 4NW6A 2GNGA 4FV4A 2DQ7X 5D41A 2Z2WA 1FOTA 4MD8E 4UMQA 2IW8A 3VS6A 4CQEA 1U46A 3O8TA 3PIZA 1PRYA 5E9EA 3BLRA 4AOIA 1H28A 4L3JA 4Y95A 1JWHA 4J1RA 2PTKA 3QX2A 4EH3A 2YCQA 3SD0A 5IZFA 4G34A 3RVGA 3LCTA 3MIAA 4DFZE 3PP1A 4X6QC 4DYMA 4EONA 4AX8A 3QZGA 5LCJA 5CSHA 5LMKC 3ZO2A 3A7GA 4V0GB 5E4HA 4FKPA 1NVRA 4TYJA 5TF9A 3VBTA 4FL1A 3E87A 3WF6A 4EWQA 1PXPA 5EYDA 3MVHA 4AG8A 4IM0A 4MF1A 3U51A 4E1ZA 1KV1A 4X3FB 2CKPA 1PYXA 4W4YA 3R1NA 4LV5A 5E8YA 4F70A 4KB8A 3VS2A 2CCIA 3L9MA 3R83A 2PVKA 1JQHA 4BVUA 4Q5HA 4X6RA 4F0IA 2I0HA 4ANBA 2I0YA 3EN7A 3QKKA 1XWSA 4NM0A 5CSXA 3COMA 4YTIA 2X6DA 4ASEA 4D9TA 2YIWA 3WZEA 1H27A 3LZBA 2W1IA 4U79A 4EK5A 4TW9A 3N4TA 1UKIA 5AADA 2YACA 1MP8A 5AA8A 4XX9A 1R39A 2FYSA 3GUBA 4XEYA 4C8BA 4YLKA 3TDWA 2XCKA 3HV7A 4MXCA 4ZZNA 4NKSA 3C13A 4G3GA 4BDFA 5HD4A 4Y5QA 2C5NA 3A4OX 1ZARA 3IDCA 1IAHA 2HZ4A 3F88A 2QO2A 2FO0A 4DEBA 2EXMA 2IZUA 2QOFA 4AZEA 5JT2A 4IFCA 1XKKA 5M56A 3OBJA 2XJ2A 2BHHA 3LW0A 5C4LA 3C4WA 3AT4A 3RWQA 2C30A 4WSYA 4AGCA 5D12A 1STCE 1REJA 3CEKA 3W33A 3D2IA 3ZEWA 4AE6A 2IO6A 5CXHA 4DTBA 2AYPA 3TV7A 4FTIA 2OJFE 2PVMA 4DAWA 4U6RA 3U87A 4ASZA 5J7HA 4B4LA 4NWMA 4BWKA 3GFEA 4KSPA 5LWMA 3HMNA 4O2PA 2E9OA 1MRUA 3I79A 4C33A 1MRVA 5AAEA 3I0QA 4QMVA 4CFFA 3DV3A 5L2QA 4DCEA 3S1HA 4WBBB 2PWLA 4DTAA 3CE3A 1TVOA 4A9RA 5DR6A 5FLFA 2XKEA 4J99A 5AM7A 3O7LD 1YI3A 4BCOA 4ZIMA 4U80A 4ZJJA 1FMKA 2KTYA 3EOCA 3PYYA 2PZYA 1J1CA 3GU8A 3O23A 4LGDA 3GNIB 3KU2A 5AP3A 4ZTSA 1NY3A 1XH9A 4R1VA 4LOQA 5DR9A 4F9CA 4GEOA 3ZRMA 3GCPA 4EYMA 4F9AA 4FTUA 4CGAA 4IXPA 1OUYA 3D14A 4S34A 3ULZA 3A7HA 3R9RA 2OH4A 5EG3A 3UQGA 3CJGA 2UVYA 4FV2A 4XJ0A 2OI4X 2W5HA 3REPA 5DG5A 5HNIX 4YHJA 4V0GA 3CBLA 3FL5A 4WO5A 4R7BA 4M67A 3FJQE 3AD6A 5IQEA 4XV2A 3OT8A 2QOBA 4ZZMA 3TZ8A 3RPRA 4X3FA 5EH0A 5EI2A 3TG1A 3NNXA 5KKRB 5E91A 4HNFA 2IVUA 4D2PA 1PMEA 2CMWA 2E9VA 4IM3A 3VO3A 4FTKA 4C62A 3QWKA 4B8MA 2WMVA 1YOMA 4IWOA 2JIVA 3OUNB 4FZ7A 4K0YA 3HUBA 2I7QA 3FZPA 4ACCA 5HTCA 2F57A 2XRUA 5J1VA 3IOPA 1VR2A 3MI9A 4IANA 3ERKA 1ZZ2A 4MBIA 5A3XA 3VUTA 1BL6A 3LE6A 2QOIA 4QMLA 2I0VA 4FV6A 4NK9A 5HEZA 3POZA 5CSVA 5BYYA 4WIHA 2PULA 3BI6A 5M57A 5JGAA 1OIQA 4GFMA 3BU6A 1OGUA 2WQBA 2XM9A 4ERKA 4MBJA 3U4UA 4ITIA 3P08A 3CP9A 3D7TB 3EKNA 4D4RA 2CHLA 3COKA 3C0HA 1XHAA 1FGIA 3PJ2A 4C3FA 4CZYB 3BBTB 2IWIA 1YWVA 2UW4A 3HGKA 3SHEA 2OH0E 4M14A 5DBXA 4I0TA 5DLSA 5EYMA 3MA6A 4FVPA 3IW4A 2QR8A 1R1WA 1YI4A 3SW4A 2J7TA 1OKZA 2GMXA 4GVAA 4HVDA 4YJUA 2IPXA 1MQBA 3OXZA 4O0TA 1XH7A 4FODA 5BVWA 4KBAA 4DFBA 3LXNA 4WRSA 4FKLA 2C6LA 3MTFA 4JDIA 3MV5A 2F49A 3C4XA 4GRBA 4LYNA 1OL7A 4GH2A 3QQKA 5EOLA 3FV8A 3EQDA 4RJ7A 3JYAA 3OCTA 3IECA 4FSNA 4YC6A 2EWAA 3HZTA 2ZJWA 3PA5A 3PPZA 1U59A 4JDKA 3D9VA 2VTTA 4TWCA 3DDPA 5CI7A 4I23A 3QUEA 2QI8A 3QD3A 3G0FA 4MX9A 2VO6A 4BTMA 3H30A 2XMYA 2UZEA 2PE1A 3KXHA 3R28A 4QMWA 5GHVA 4D58A 1Y8GA 3T3UA 3F6XA 3DXQA 3C1XA 2V7OA 4CFVA 2AC5A 4CTBA 2VNYA 4R7HA 4A9YA 1ZLTA 5HESA 2E2BA 5CVHA 4BFMA 4HVSA 2WPAA 5HIEA 3E63A 3UJGA 4R78A 3QF9A 3QRJA 4DE4A 3DTCA 3GU5A 3R9OA 5C03A 5AP0A 3ZLWA 1WBSA 1AGWA 4C34A 3Q6WA 4AWIA 3I6WA 1BLXA 2I0EA 3DNEA 2QONA 3F7WA 3AMYA 4U97A 5HLPA 5HE0A 3VWAA 5C8NA 1F3MC 2X2KA 2CCHA 3HAMA 3C7QA 3B2TA 2B52A 4RGJA 5FDXA 5J79A 2GQSA 4BKJA 4BZNA 3WZDA 3FI8A 4MXAA 2OLCA 4QYFA 2YFXA 2OJ9A 3VS7A 3QHRA 4NCTC 3F5GA 3OTVA 2R3RA 3BYSA 3RPOA 4JL9A 3ZBFA 5GNKA 2ZYBA 3QAME 4FKJA 1SNXA 4RMZA 2REIA 2W0JA 3K3IA 5J95A 3VUHA 4L7FA 4G6OA 4PL3A 3EFWA 3TZ7A 2BHEA 4D2TA 2PZIA 2HZ0A 5LVOA 2NP8A 1UNHA 3TNQB 3PG1A 1WVYA 3IW7A 2IW6A 4MHAA 5CVFA 3D7TA 4I22A 1Z9XA 2WTDA 3F3UA 4CFWA 2XBAA 2VX1A 5DH3A 4DH7A 4EWHA 3F2AA 3AXWA 4P2KA 3E8NA 3ZRKA 4AA5A 2PVLA 2VTIA 4NT4A 4U41A 3RZFA 3FHIA 1QL6A 1RE8A 5AR3A 3HMPA 3TV6A 3NLBA 4L00A 4O7YA 3VNTA 4IACA 4JX7A 3OP5A 5EW9A 5CNOA 4USEA 2OO8X 3PFQA 4TKSA 3RAHA 4YJSA 1XR1A 3LCOA 4GUEA 4QP7A 3RBWA 3ZXZA 3ITZA 3NYOA 3FZSA 4FMQA 3ZUTA 2C4GA 4MXZA 3QGYA 3UIXA 4XP3A 5CEIA 2HOGA 5HICA 1XO2B 2BIKB 4IWPA 2UV2A 1SMHA 3IW5A 3ZO3A 4F08A 4ANMA 4U81A 3RNIA 3ZTXA 4H3BA 4EOPA 5KHWA 1XH5A 3W2RA 5CEOA 2PYWA 3QLGA 3LFEA 2W1DA 5HG9A 1WBTA 4D2VA 4ASXA 3E64A 4ZS0A 5CLPA 4EK4A 1H1RA 4OTDA 5HOAA 2GNLA 3DFAA 4ZTHA 4JJRA 4C4JA 5I9YA 4QMOA 4E4MA 1NVSA 3KRXA 2J0JA 3BYVA 4IJPA 4E8AA 5AIKA 3ORLA 2VTLA 2BFYA 3TACA 3EL7A 4ZZOA 4O22A 1RQQA 3D83A 4AZTA 5B0XA 4F99A 1NW1A 2YEXA 4PL4A 3QCSA 2QC6A 3U9CA 1W83A 3F61A 4XBRA 4D5KA 3UQCA 2UW9A 2BUJA 4OTFA 2C5VA 2I6LA 4O21A 5M4IA 1LR4A 4FV8A 1Q5KA 3C4FA 4S30A 4GFOA 3I5ZA 3H9RA 3FPMA 4BGGA 4JBPA 2H34A 4GT4A 2PZPA 4Q9ZA 2ITUA 5CAVA 2BTSA 5JMSA 4DEHA 4BDEA 1R0PA 5KZIA 3FXXA 1V0OA 1ZYSA 3TZ9A 2W1EA 3ANQA 3DB8A 5DVRA 3R01A 4FV7A 1SVEA 3ZFYA 1W0XC 5AIRA 5E8SA 4TYHB 1R78A 2BRHA 4F4PA 1KOBA 3DAJA 2VTRA 2F7XE 3FSKA 3S4QA 1E9HA 3GQIA 4FZDB 2ZV9A 1P4FA 1OI9A 4F09A 4OTIA 5E90A 3BHUA 5IMEA 5ANJA 1YDSE 3OT3A 2YJRA 2VWXA 4JR7A 2BDWA 4I6BA 5BUEA 5L4QA 3EQGA 3NX8A 3TL8A 5DYJA 4BCNA 1H4LA 4I94A 4BIEA 2YCSA 2QG7A 3PE1A 2X8IA 3HVCA 3PVUA 5AV0A 4EUUA 1IA9A 1TKIA 3RAKA 3DJ5A 3R04A 4IW0A 5FP6A 3WILA 1LEZA 2ERZE 4CYIA 2UW7A 5M51A 2WQOA 1K9AA 4W4WA 3ZO4A 3VUGA 3LQ3A 4EJ7A 4LL5A 3BRBA 4G2FA 4O1PA 4Q5EA 3FMHA 5FWKK 3FXZA 3OF0A 4EK6A 2ZV2A 5AWMA 3LFQA 4EJNA 4GUBA 3R8PA 3WF9A 2OWBA 3AC3A 4JDJA 4CTCA 4OR5A 4EEVA 3N4UA 3O8UA 4WNOA 2HZNA 3SXSA 1E1XA 2BKZA 2BZIB 2YM8A 3ENHA 3I4BA 2YCRA 2XNOA 5HBEA 3NAXA 3WF7A 2PE2A 4FVQA 4NFMA 4CNHA 2R3PA 4BZDA 1DM2A 5I4NA 3LCSA 2B4SB 2QODA 4BCKA 2C68A 3IO7A 4MTAA 5HG7A 2XIXA 3D7ZA 4E4XA 5D1JA 3RWPA 5IH4A 2CJMA 5HNBA 3WE4A 4FTOA 2O63A 3QTXA 3NYNA 5EK7A 4WHZA 1VYZA 2XK4A 3FL4A 3EZRA 3BHHA 3HECA 4BCIA 3G2FA 3LXKA 3MS9A 5IA0A 3HYHA 4MQ2A 2QOCA 3DCVA 3GEQA 4DGOA 4DH1A 3F7ZA 3RHXA 3IW8A 4S2ZA 2UZNA 4XG2A 4YPDA 2VTOA 3W8QA 4LL0A 4O96A 1WZYA 2VTHA 1WVXA 4J8NA 2BDJA 2W1ZA 3CKXA 2RG5A 4LOOA 4A9SA 2IZRA 2GQRA 4ERWA 4FNZA 4CXAA 4I6FA 3RM7A 3RAWA 5H2UA 3CQEA 1ZY4A 2GHGA 2XIZA 3KRJA 4MNFA 4QPMA 5GJGA 2HY0A 3RP9A 4NM7A 4WG5A 1ZOHA 3Q9YA 5ANGA 4BI2A 3QTWA 1M2QA 3PLAE 3ANRA 2HELA 4YUQA 3KEXA 4L45A 1JOWB 4TYHA 4BN1A 1ZY5A 3QCYA 4FV0A 5EQPA 4O2ZA 2WTJA 3QC4A 4OTWA 3GCQA 4ZK5A 4FIGA 4YZDA 1KSWA 3LVPA 4IJ9A 4RLKA 3V6SA 2C6TA 4CKIA 5C4KA 5HCZA 3NMUF 4AN9A 2HXQA 5FG8A 3W8LA 1H1SA 1OMWA 5A54A 3FI3A 4PF4A 5I9WA 3SKCA 1H26A 1CKIA 2ZOQA 2WXVA 3DXNA 2WMSA 3EN6A 4FBXA 5M4CA 3UVPA 4YO6A 4F1TA 1Q97A 2YDKA 3MJ1A 4AT5A 3NZ0A 4C38A 4X21A 1OIUA 2BAKA 2XIYA 4U40A 3ZEPA 2O2UA 1PY5A 1Y8YA 3GGFA 3ORTA 5IUGA 3FUPA 4F9BA 4TWOA 2OICA 4ACGA 5EI8A 3FMNA 2PVNA 3QRIA 5HBHA 3TNWA 1WVWA 5CU4A 1H07A 4BYIA 2UW6A 2XEYA 4RFYA 2BAJA 2OXYA 2ITOA 2GHMA 3LQ8A 3ZUVA 2G9XA 3EQPA 3EZVA 5ACKA 1BKXA 3EN5A 4D0WA 4YPSA 4FYNA 3QUPA 2VN9A 3OHTA 4G3CA 3FLZA 2CGXA 4PP9A 4ALVA 5FTOA 5L3AA 3RALA 4EOJA 4K18A 5E8UA 4J95A 1ZOEA 4RLLA 2YISA 2C3KA 5L8KA 2VRXA 3IGGA 3KN6A 3PA4A 3PIYA 4FT9A 4L67A 2IJMA 5EM8A 4AGDA 2XJ1A 4CG8A 4OBQA 1Z57A 2G2FA 3U9NA 5AUXA 4HZRA 2Y8OA 3RCDA 1UWJA 4ZP5A 2BRGA 4KSQA 1JVPP 2BDFA 3OUKA 2OJIA 4C4FA 1OKYA 1G5SA 3CPBA 3OW4A 3H3CA 4IX3A 3DT1A 2YHVA 3FQEA 3I81A 5CAOA 2JC6A 5M07A 3C9WA 4LM5A 5J9LA 3V01A 1PJKA 2V5QA 2YWPA 2JKOA 2UZVA 2CKEA 4OW8A 3CS9A 3FMEA 4U7ZA 3RAIA 4E20A 4UZDA 5HHWA 4EHZA 4HOKA 4QYGA 1KWPA 2BCJA 4JX3A 3BIZA 4KIPA 5AUTA 3NWWA 3NCGA 4ZXTA 3LMIA 3PSCA 4OAVB 4RJ6A 2VWYA 4YJPA 3QA0A 4O0RA 4ZTLA 5AUYA 3ZC6A 1A06A 4IMYA 4XHKB 2AC3A 2JAVA 5E1EA 5BUJA 4FTCA 3A61A 3PE2A 3DU8A 3E7OA 3UMWA 4DEIA 2XK9A 4O0VA 2Y6MA 4HGTA 4DGGA 5EM6A 5LVPA 2PSQA 5HO6A 3OWLA 2GNHA 2X7FA 4DEDA 5I9VA 1BL7A 3ZUUA 4JBOA 4UEUA 2W1CA 4AN3A 4QTDA 3KRLA 3BGQA 2ITQA 2FVDA 4BCHA 2JLDA 5KO1A 2OF2A 4DFLA 4Q2AA 4W8DA 4C4GA 3UIBA 5TT7A 4YHTA 1Z5MA 2XBJA 2C5XA 4FTTA 3Q4CA 1YW2A 3R8LA 4P4CA 4CFXA 4M3QA 2X39A 1J7UA 5IUHA 1XBCA 5M53A 5B2MA 1NA7A 2P55A 2V7AA 5TO8A 5CEMA 3R30A 4MXOA 5CQUA 3R7OA 2YABA 5IQBA 4NM5A 3VJOA 5HTIA 3D5UA 4PPCA 5HIBA 3WYYA 2WB8A 5ICPA 1BMKA 4IB1A 4XS2A 4CRLA 4QMXA 5L6OA 3GVUA 5M4FA 4O27B 2QVSE 2VX0A 2R3GA 2G15A 1WBVA 3JUHA 3LFDA 3ORXA 4H36A 4IIRA 3V8WA 4BCPA 3K54A 4QP1A 3L8SA 3BKBA 2PUIA 5M4UA 2UW8A 4FSTA 4JR3A 3VW8A 4BCGA 1J7IA 3EN9A 3QCQA 5JGBA 2XM8A 3QTSA 4OGRA 3DLSA 2WTKC 2G2IA 4HYUA 1PKGA 4D4VA 3DS6A 4YURA 2JEDA 2WOTA 2W4KA 5IQCA 5M09A 4NH1A 4XG3A 5IA5A 4R3PA 3SRVA 3FEGA 4O84A 2NO3A 3HDMA 4EHEA 4ZAUA 5HU9A 4Y46A 1PYEA 2V55A 5CSWA 3MVLA 4E5BA 3QU0A 1KE8A 3JPVA 1J91A 4L42A 3F82A 1UU8A 3A8WA 4WA9A 2X0GA 3DJ6A 2GNJA 1M17A 4LRJA 2XJ0A 4M12A 4DT9A 2DUVA 3Q2MA 2W7XA 3QKLA 4KBKA 5CZIA 5H9BA 4O7VA 4JG6A 5E7RA 3BE2A 5HZNA 3FWQA 3DBFA 4KNBA 4YO4A 4O7NA 2YCFA 5DI1A 1X8BA 4DFYA 4JNWA 5J1WA 3QYWA 3VC4A 2BAQA 2BMCA 2B9JA 2WTVA 1IA8A 5EYKA 4MXXA 5H8GA 3T8OA 4ALUA 5CF6A 5J5SA 4QNYA 4DFXE 5HU3A 5AM6A 5DWRA 3P4KA 4OT6A 4CFNA 3NNUA 5CANA 4ZY5A 3S0OA 4PP7A 4O0UA 3ALOA 3VRZA 3IK3A 2Q0NA 4X3JA 4QPAA 3TIZA 4AA4A 4UMTA 5C1QB 3WYXA 4BIDA 1AQ1A 3V5TA 5K5NA 4FL2A 2X6EA 4N4SA 3TKIA 2G1TA 3EQRA 3ELJA 3PLSA 2EB2A 3VHKA 4YBKA 4AFEA 4C35A 3MWUA 5HVKA 5K3YA 1JKLA 3EYHA 3NVKI 2LGCA 3T3VA 4YSJA 3K2LA 2R0IA 4K77A 3FLWA 4EHVA 4FEXA 3KK8A 1OL1A 3LXPA 4PNKA 3LFAA 3NUYA 3TUBA 3MVMA 3UODA 1OECA 2WQMA 3T9IA 5DEYA 3DLZA 3N4VA 5CU6A 3GT8A 3PY3A 3U6HA 4LG4A 2CKOA 4IAIA 1AD5A 3OG7A 3P5KA 1ZYJA 3G51A 3MH3A 4R5YA 3HMIA 3I7BA 3ZYAA 4RBLA 3GBZA 3R8UA 2JFLA 3TM0A 2XNPA 3R0TA 3E8CA 5FUTA 4R7IA 3R6XA 1KE9A 3UMXA 4E93A 3NUPA 1O6YA 2C1AA 3GU7A 3V04A 4C4EA 3ORNA 4GKIA 4RC2A 4GYIA 1YI6A 3SOCA 4OBOA 5A4QA 4X2FA 2V62A 3AC4A 3WE8A 5CF8A 3TUCA 3FPQA 3U6IA 1OBGA 5A9UA 3R1YA 1LEWA 4XUFA 5D7VA 3KQ7A 4EH7A 3BHVA 3E3PA 4TL0A 3IGOA 2O5KA 3ZONA 3U54A 4FKIA 3PXQA 4FKVA 2IG7A 3SOAA 4GJ2A 3RTPA 1KE7A 4O83A 1ZRZA 3PY1A 4BI1A 2QU6A 5C26A 2I40A 5HORA 4TWPA 2C3LA 2R64A 5FM2A 3H9FA 4K8AA 4CSVA 5B7VA 4RFMA 3PDTA 5M08A 4O6LA 1ZYCA 2OXXA 5F95A 1IG1A 2OJJA 3AG9A 3LJ1A 3MA3A 4X3FC 5KBRA 1F5QA 4O1OA 5CU2A 1KE6A 3ZSIA 2PK9A 1H8FA 3FAAA 3P86A 4ZJIA 5AUWA 5EW3A 4BKYA 5D11A 4CLIA 2P0CA 4JAJA 3FMLA 4XOZA 3QTQA 5E8TA 4E73A 3RMFA 5KMLA 3BEAA 3UPZA 4V01A 1QMZA 4M15A 4E4NA 5EM7A 4FSZA 4ZTNA 4DBXA 2GFCA 3WZJA 5BQ0A 5JZJA 3S2PA 4IVCA 3CCNA 4RVLA 2I1MA 4FNYA 3W2OA 4EI4A 3W2SA 2HK5A 3FZTA 3LM5A 3R22A 3BELA 2J4ZA 3NR9A 4I0SA 2WU7A 4PDOA 4P90A 4R3CA 5CXZA 3AT2A 2JDOA 1JKSA 5KNJA 5CF5A 5ACBC 4APCA 4GCJA 4MQ1A 4IADA 4RPVA 1OL6A 3CQUA 3VBVA 2C3IB 4AACA 5E8WA 1TQPA 3KVWA 3KB7A 4PTEA 4R77A 5HVYA 2C0OA 4EOQA 3DBDA 4FC0A 5IUIA 3JS2A 3RJCA 3TTJA 2QO9A 4G6LA 4IBMA 4B8LA 4M0YA 2FSLX 2QOOA 1DI9A 4NSTA 4QQ5A 5HX8A 4NZWB 3SAYA 3TNHA 3NVMB 3MFSA 5CTPA 2AUHA 1YKRA 3JY0A 3QTIA 4NJ3A 3UIMA 1JKKA 3EYGA 3FLNC 2BZKB 2JDSA 2ZB0A 4F6SA 3EFKA 4EL9A 4MD9E 4E6QA 2OZAB 5AJQA 4QMTA 1Q41A 4L43A 3I0OA 2ZDTA 1O6KA 1U4DA 3R1QA 5IKWA 4AS0A 4DG0E 3R7GA 2QOHA 1P2AA 1DI8A 4L8MA 5FGKA 4RSSA 2C6KA 3EQBA 5J87A 5DT4A 5CEQA 3C0IA 3M11A 5DA3A 4YGAA 3ZLSA 1XJDA 3H10A 5E1SA 5F1ZA 3R8MA 4ACMA 5BX0A 1U5QA 4USFA 2GNFA 3UP2A 2VTAA 4LGGA 2F2CB 3G33A 4BWPA 5CU0A 5L6WL 1OB3A 2Z8CA 4QYEA 3TI1A 5A4LA 5DHJA 2EXCX 3SC1A 5HX6A 4X2NA 4NKAA 4TYIA 3DBQA 1JLUE 3HMOA 4U45A 1GIJA 4CZUA 1PF8A 4JAIA 4E5WA 2XYUA 3MGYA 4AW0A 4NM3A 3F3VA 5G1XA 3L8XA 4YJVA 3VBYA 3Q5IA 5FTQA 3EQIA 3M2WA 3A7IA 2J0MB 3KF4A 4H58A 3UOKA 4EOLA 5H8EA 5IMXA 2X7GA 3HDNA 4PQNA 5KE0A 4ZSAA 4HGSA 4O86A 5KKRC 4KKHA 2W1FA 4DG2E 5FXSA 1NXKA 3O71A 2JIUA 3LM0A 4RC4A 4WT6A 2CKQA 2XRWA 2PVHA 3NDMA 5AA9A 5CEKA 4JBQA 2H96A 3MTLA 4FF8A 3KY2A 2OXDA 3B8RA 2JKMA 5LXMA 3O0GA 4YC8A 3RK5A 3MB7A 4AW5A 3DPKA 2GHLA 4EZ7A 4GG7A 1OL2A 2WOUA 4FKWA 2PPQA 3WARA 2R7BA 3C50A 1OVEA 4HCTA 1SZMA 3FLSA 4PRJA 4C2VA 3P79A 4FEQA 3ZFMA 2VGPA 2WTCA 2VO0A 5ETFA 1ZMVA 2R3JA 4QPSA 4UY9A 2EUFB 3V3VA 5J8IA 3VVHA 5BVFA 1K2PA 4ZSEA 4AZWA 4JQEA 5HBJA 1FVRA 2B9IA 5DPVA 1H1QA 4C3PA 4L3PA 3OCBA 4I6HA 2JAMA 1ZWSA 5HLWA 3MVJA 4KS7A 3QRKA 4BC6A 1LPUA 4ASDA 4FG9A 1DS5A 3ID6C 5AR4A 1DAYA 4PY1A 4YC3A 5IEXA 1SVHA 4AUAA 4A07A 4RQVA 4XG9A 3LFBA 1WFCA 5FBOA 3E62A 4U3ZA 5FEDA 5AUVA 4ALWA 2C6MA 4N6ZA 3JR1A 4S32A 2WNTA 4BGHA 2R3LA 2JBPA 1WBOA 3UBDA 3BYOA 5AV4A 2R4BA 3VBXA 3SVVA 1K3AA 5JFXA 3UZPA 2OZAA 2R3OA 4O0YA 4OTRA 1OBDA 2ZM1A 2O8YA 4IX5A 4IX4A 4KUJA 3MB6A 1VJYA 3BQRA 2XUUA 3U55A 4BZOA 5AX3A 2BPMA 4TNBA 4TNDA 3RCJA 2BZJA 4FV3A 4FYOA 3SLSA 1H24A 3OD6X 2CN5A 3ROCA 4LRMA 2FH9A 5JFSA 2X2MA 4GW8A 4I21A 3EQCA 3VS3A 2CDZA 2VNWA 2ZMCA 4EKKA 2C69A 4QMNA 4I0RA 2JD5A 4JQ8A 2BTRA 2RF9A 1J1BA 2QHMA 2WQNA 3AD5A 3CKWA 3OY3A 5HNGA 1SM2A 4FKTA 4YTCA 1IAJA 4YJTA 5FP5A 3DNDA 4QO9A 2Y4IC 3FI4A 2WD1A 3IONA 3D2KA 5HVJA 5H3QA 3L1SA 5T3QA 2W1HA 4AT4A 4DF3A 4DGLC 2GNIA 3CD3A 3GXLA 1GJOA 3HP2A 3Q5ZA 4IHPA 3SDJA 4BTKA 3KXNA 4L53A 2XIKA 3Q4UA 1MQ4A 3ENMA 4EK8A 5IDNA 2XB7A 2CNVA 3ATTA 2UZBA 3R7YA 3FZ1A 2WTIA 3CLYA 2VO7A 2WMQA 3QALE 2QHNA 4F64A 5JGDA 3UVRA 4AZFA 4C02A 1PXOA 1XBAA 4MH7A 5I3OA 4O6EA 4DTKA 4YZMA 5I9UA 3W2QA 3VULA 2J50A 2YIRA 4H05A 4C36A 5LOHA 4D0XA 5K0KA 3PVWA 4WRGA 1Y6AA 4CCBA 4FUYA 4F7JA 4M97A 4OTGA 4DBNA 2BIYA 2RL5A 4PPBA 4HJOA 4AFJA 2W5BA 5DE2A 4FG8A 4DH5A 2X9FA 4L68A 4AXAA 1IR3A 3ZH8A 3IW6A 4FVRA 2OF4A 5A4CA 4NJDA 3PZEA 3FKOA 5FXQA 3OCSA 2WMUA 2QLUA 1DAWA 1VYWA 3TV4A 4A9UA 1XH4A 4RWLA 5L8LA 2BZHB 3ETAA 3L9LA 3LIJA 3MPMA 4XLVA 3TT0A 5HCXA 5DOSA 3KL8A 4GS6A 4CMUA 4UN0C 3LQ5A 4Y8DA 2QQ7A 2JITA 4DEGA 2CNUA 4I41A 3FKNA 2R9SA 5JRQA 2Z7LA 2CPKE 2PMIA 2ETRA 5A6OA 4FKQA 4O0SA 4S33A 4Y72A 4CMOA 2ONLA 3CJFA 3EH9A 2J9MA 3G5DA 3HX4A 2R3QA 3K5VA 4YJRA 3TZMA 4ZTMA 2QCSA 4L46A 3KXZA 3JVSA 4OUCA 3VUKA 1XH8A 2ZB1A 2X1NA 4V04A 4ZOGA 4IVBA 5DRBA 4K1BA 3L9NA 3PSBA 4JDHA 2ITYA 4ENXA 3VN9A 3UQFA 4XG7A 4K33A 4AN2A 4M13A 3F2NA 4YNEA 3Q2JA 3WIKA 2VD5A 4NYEA 3EN4A 2A0CX 5IQGA 2YWVA 4UMUA 3AC1A 2CLXA 4W4XA 5AMNA 5EI6A 4CMTA 4HNIA 4YU2A 5K4JA 3TXOA 2ITZA 4NL0A 5IQDA 2JGZA 4EHGA 4KBCA 2O0UA 2X7OA 3M1SA 5DR2A 2VU3A 1BUHA 1OITA 4BHZA 4CVAA 3SG8A 4LUDA 5DIAA 5JQ8A 4G5PA 4GG5A 2BRMA 4EYJA 3V5JA 3HV5A 4XRLA 1UV5A 3DY7A 4QQJA 4RJ4A 1YXVA 4L3LA 3SXRA 4BF2A 3C0GA 4EBVA 4N57A 1GZKA 4JRNA 2HZIA 1OZ1A 3HA6A 4FI1A 4L7SA 5EYCA 5C27A 3ULIA 1PXMA 3UG2A 4IVAA 2JDTA 4WUNA 1GZOA 5L2IA 3RPYA 3F5PA 2PUUA 3OS3A 3DAEA 4FZAB 4EZ3A 2VWZA 4OLIA 3O8PA 4UBAA 3UOLA 4AE9A 3V51A 4EC8A 3D5XA 3DKGA 3GU6A 5M55A 2VTMA 4YZCA 5AX9A 1OKVA 4XV3A 3OWJA 4PMMA 5AP1A 3G9LX 5DFPA 3P9JA 3NUSA 5ETIA 3ZO1A 4U9AA 1M7QA 3R8ZA 2OZOA 3MJ2A 4XYFA 4QTCA 4V05A 4DITA 4EH5A 2VWBA 4KA3A 4L6QA 4FT5A 3NUAA 2VWWA 4IWQA 4IH8A 1Y91A 4RZWA 3F3WA 2X4ZA 3P23A 4A9TA 5FEEA 3QWJA 3EKKA 4JQ7A 3T9TA 1CM8A 1ZMUA 2RKUA 4KD1A 3VUDA 4DEEA 5GZAA 3GQLA 4AW1A 2WMWA 2QO7A 3QTUA 5CZHA 2ITNA 4D2SA 3Q32A 4YNOA 3PRIA 3KCFA 3R00A 4I93A 3PXFA 4EQMA 4W8EA 1ERKA 4EUTA 2W99B 3COIA 4I24A 2XNGA 2WFYA 3VS5A 4ID7A 5DT3A 5DMZA 2F2UA 2YZAA 4O0XA 3E8DA 3VBWA 1BYGA 2Y6OA 3GC9A 3N51A 2JDRA 3BV2A 4FIIA 3L8VA 2XA4A 5IA2A 4X7QA 3BE9A 4NU1A 3VJNA 2X2LA 3ZZWA 4FICA 5AV3A 2HY81 3HP5A 2VUWA 1ZAOA 3QBNA 4WNKA 3MH0A 5K4IA 2GTMA 2QG5A 3UG1A 4QT1A 3LCKA 2CSNA 1NT2A 4H3PA 3CGFA 1KE5A 4E4LA 4HYIA 3OEFX 5KCVA 4IZ7A 2A1AB 2DS1A 5DN3A 4M8TA 3W10A 2J6MA 4FEWA 4BCJA 2X8DA 2B0QA 3EWHA 3QFVA 1GY3A 5AR5A 5A4TA 2B7AA 2OG8A 2XF0A 3QGWA 1P5EA 4FTMA 4BB4A 1H25A 3F3ZA 3V8SA 1H1WA 4U3YA 3AC8A 3ZDUA 4AA0A 1G3NA 4MD7E 5EKOA 4P7EA 4MXYA 3RNYA 4ZLOA 3AMAA 2E9PA 1S9IA 4BKZA 4WNPA 4UMRA 4M84A 2R7IA 5EFQA 3E3BX 4APPA 2VWVA 5TOZA 5D9HA 3CY2A 1UNGA 3MH1A 3V5LA 4FV1A 2JIIA 4MWHA 2OFUA 3TEIA 2PE0A 3E5AA 4XRJA 4G17A 1WAKA 2XEZA 5JFVA 5CI6A 3KVXA 1OKWA 3NSZA 2J5FA 1CSNA 4Z7GA 2IN6A 3BYMA 4E26A 3MESA 1CTPE 1MRYA 3DOGA 2JKKA 4KWPA 4BDIA 4ENYA 1XQZA 4KIKB 1UKHA 5EDQA 4QNAA 2WHBA 3RM6A 3LJ2A 3FYJX 3C4EA 3W2CA 3N9XA 3WZUA 4I4FA 4GU6A 3R2BA 5DT0A 5AP4A 4DH3A 2VAGA 4J98A 4LMNA 3JY9A 5EOBA 5HKMA 5C8KA 3TCPA 1YVJA 4GK3A 1QPCA 4PDPA 5AV1A 4DH8A 4C57A 4GT3A 4XCUA 3UTOA 4OAUC 2Y4PA 4YZBA 2NRUA 4II5A 3DJ7A 2QURA 1YHVA 3QQUA 4MWIA 4XNEA 2BROA 4KIOA 1JSUA 4JBVA 3VW6A 2IVVA 3BWJA 4IVDA 3BCEA 4RG0A 5AR2A 1H1PA 4AP7A 5G6VA 5GJFA 3B8QA 2VTSA 4EZ5A 5EQEA 3LJ0A 4HVGA 4A4LA 3BEGA 4IM2A 2W5AA 3GFWA 5CVGA 3QD0A 4BR3A 5CT7A 4RVKA 4IZ5A 4PNIA 5E8XA 5LVLA 5GZ8A 2VO3A 2OU7A 4TWNA 1NVQA 4G6NA 2H9VA 4IAZA 4NTTA 2HWOA 1H0WA 3DGKA 5GIOE 1S9JA 4CV9A 4EH2A 4YBJA 3PIXA 3JVRA 2H8HA 4YMJA 3BHYA 2XNBA 4UXLA 3L8PA 1WBPA 2YM5A 5A4EA 3QZIA 2VV9A 1Q8WA 2GPHA 4O7ZA 4GV1A 4DFUA 5CT0A 3QCXA 2C6OA 2ZAZA 1UWHA 3KULB 4D2RA 2Z7QA 5EM5A 3ORMA 3EIDA 2PVYA 2FUMA 3BHTA 3OW3A 4PTCA 4QP6A 4O7SA 3G15A 3V6RA 5HO7A 5TKDA 3TJCA 5EHYA 3NIZA 4RIYB 2UVZA 2WTKB 2O3PA 3NAYA 3QTRA 1V0BA 5HG8A 3RKBA 3WBLA 4AOTA 3HMMA 3I7CA 3UP7A 2WIHA 3FC2A 2ITPA 1OL5A 2JBOA 3ALNA 2PMLX 4FR4A 4I5HA 5BMMA 3WF8A 1PXKA 4QOXA 4IDVA 3FQHA 4DG3E 3PP0A 4HGEA 3S00A 1GZNA 4ARKA 4C2WA 4DGNA 4CV8A 4FSRA 4UMPA 2XK3A 2YM4A 3KFAA 1YQJA 4BDBA 1RJBA 2UZLA 3DK6A 5AP6A 4GL9A 2QLQA 4CFUA 4EBWA 2ETKA 3RPSA 1OIRA 1PXLA 4FTJA 4LOPA 5DGZA 3TKHA 2IVSA 4CZTA 2HENA 4I5CA 4Z9LA 4H3QA 2YM3A 3MY5A 5ETCA 4FK6A 5T68A 2YA9A 3EHAA 1UA2A 3TNPC 4D9UA 4GT5A 2GS2A 1IRKA 3PRFA 4ANSA 3U6JA 3KCKA 1XH6A 4KKEA 4BDDA 2PMOX 5CX9A 4A4OA 2XKFA 5I9XA 4G3FA 5EHOA 4XP0A 3DBEA 4MVFA 1YXTA 4XBUA 4UWBA 3UDBA 4QTAA 2BALA 5FD2A 2WMTA 4E5AX 1FMOE 4FOCA 3BPRA 3TDVA 5F9EA 5KMKA 4QQCA 3II5A 1GAGA 4FTRA 3FXWA 3GC8A 3F5UA 4RJ5A 5IQHA 5A6NA 3QXPA 3R9NA 3DBCA 3EFLA 2YAKA 1PMUA 4AU8A 2C0TA 3OOMA 3F66A 2FA2A 4Z16A 3OROA 4EC9A 4EOMA 2KULA 4U5JA 5CWZA 3R1SA 3EJ1A 4QYYA 5HI2A 3UC3A 1YWRA 4WSQA 4LGHA 2RG6A 4DC2A 2YAAA 3HKOA 5I0BA 3GCSA 4HYHA 3W2PA 1URCA 2WMRA 4QMUA 3ZDIA 2F7EE 2P33A 4YJQA 2JKQA 4BDCA 1ND4A 4GFGA 5HO8A 5BVKA 4W4VA 4CKRA 3D4QA 3DK3A 4ZLZA 4OT5A 4Z55A 5I9ZA 5FRIA 4C4IA 3BWFA 5HCYA 3CSVA 4FTNA 1Q3DA 3G6GA 3I60A 5KMJA 4YSMA 3QD2B 4ORKA 5GJDA 5K5XA 3KULA 2YJSA 3R63A 5D7AA 1Y57A 2LAVA 3UO4A 4DINA 4ANQA 4B9DA 4O7WA 3WZKA 4HCUA 4RJ3A 5C01A 3MPTA 4RIYA 1VEBA 1SVGA 5HGIA 4F63A 2XCHA 3MW1A 4U44A 2EU9A 3V5QA 4QYHA 3CTQA 3B2WA 4EOOA 4IAAA 4IB3A 3QUDA 2C5OA 5CALA 2PZRA 3QA8A 4AZVA 2P3GX 3NUNA 1YXUA 4NTSA 4JG7A 5BYLA 3PTGA 4KAOA 3CGOA 2SRCA 5IH6A 3KXGA 3VAPA 4PX6A 4M0ZA 3FMMA 4FKSA 3UPXA 3O7LB 1QPDA 4YP8A 3ZHPC 2GS7A 4AF3A 1ZYDA 4G16A 3ZLYA 4K11A 1M52A 5ITAA 1Q8ZA 2DYLA 4J52A 3PZHA 5JH6A 3NS9A 3U4WA 5AP5A 1UU7A 4CCUA 4PMPA 3OWKA 3BX5A 2YIQA 3GC7A 1APME 1Q61A 4PDYA 1LP4A 3EFJA 5AUUA 2J0LA 1YXSA 4N70A 5A46A 3I1AA 4TY1A 5ANDA 2WAJA 4Z7HA 4RFZA 2C0IA 1GOLA 4RIWA 5IDPA 4O7TA 2XP2A 2R3MA 5BMSA 1I44A 2FGIA 3D5VA 5I5ZA 3EQHA 4R6VA 2RFNA 3QQJA 4RT7A 2Z7SA 4RWIA 3ATSA 1Q8YA 4ITJA 4L52A 4I92A 5IQFA 4PMSA 1J3HA 1P14A 5FEQA 1E1VA 2BKKA 4UXQA 5AAFA 3QC9A 2VTQA 3DQXA 1ZZLA 4MYGA 4NIFB 2PU8A 3KXXA 3OY1A 1UVRA 1YHSA 2O64A 3DZQA 1G8AA 5C9CA 3C5IA 2WMBA 3EQFA 2ACXA 4BBMA 4FEVA 4QMYA 4WD5A 4BCQA 2PVJA 4FSWA 4KABA 3TWJA 5JRSA 2C5YA 2ZV7A 1OPLA 2HXLA 3E93A 3GI3A 4AZSA 5CQWA 2WEVA 3AGLA 1WBNA 4C0TA 3LMHA 3R7VA 2UZDA 3P7CA 4FT0A 2F4JA 4S31A 4YTHA 3S3IA 1YWNA 4F65A 5LMKA 5KMMA 5EKNA 1YOJA 3GCUA 4AOJA 2NNWB 1QCFA 4K2RA 1O9UA 2QNJA 3BZ3A 5I3RA 2WZJA 3BBWA 4G1WA 3TTIA 1BI7A 3TKUA 4D1SA 3KC3A 1TQIA 3FSFA 1JBPE 4ONAA 4EOKA 4UYAA 4HPTE 3WF5A 2VTPA 5KX8A 4CT1A 4HVHA 4U43A 3QZFA 3SQQA 4ANLA 3FE3A 3M42A 5L2TA 4LI5A 3ZBXA 4HW7A 3A60A 4KRCA 1Q8TA 3Q9WA 4EQCA 3R02A 4QMZA 3AOXA 3OFMA 5LMAA 5TE0A 1ZYLA 5DEWA 4UYNA 4RRVA 5CNNA 4QQTA 4UV0A 4A4XA 3OVVA 1V1KA 3CR0A 4GK4A 5KZ0A 3A62A 3ZLXA 2YZLA 2OJGA 2CGUA 4UALA 5GIPE 1W84A 3CIKA 3UOHA 2UW3A 4C61A 4D1ZA 5EDRA 4E6AA 4BCFA 1KV2A 3IG7A 2BRNA 4EOIA 3PWYA 1QPEA 1MUOA 5ETAA 2Y9QA 4WG4A 2F9GA 3QHWA 2C3JA 4PPAA 3FZRA 2CGWA 3GOPA 2P2IA 3C5UA 3ET7A 4JVGA 3VQUA 5E92A 1A9UA 3O51A 4B7TA 1IEPA 4RJ8A 3QRUA 2YM6A 4WKQA 4BL1A 4FG7A 4TN6A 3PXZA 4YLJA 4EH9A 5M06A 5AEPA 4GU9A 4KINA 1YDTE 5F20A 5IA1A 3UZTA 3C51A 5HLNA 2VWUA 4K9YA 4XOYA 4DFNA 3PJ8A 4RX9A 4YJOA 4DEAA 1P4OA 4Y83A 1Q62A 1GZ8A 3FQSA 2WTWA 3KK9A 3IDPA 4FKUA 4E6DA 3POOA 4IDTA 2XNMA 3DZOA 4EK3A 1CDKA 4TTHB 4EORA 4F1OA 3ROYA 4M66A 4F0FA 4G31A 3BU5A 3KMUA 4NIFA 5IQIA 4JOAA 2BFXA 4DGMA 4WG3A 2J0IA 2UVXA 4BY9E 2QKWB 4IZYA 4RC3A 2VTNA 3PJ3A 3HLLA 2WKMA 4G3EA 3HV3A 5AV2A 4ZY6A 3TUDA 2B55A 3ZFXA 3ZM4A 1PXNA 2GSFA 4IQ6A 5IPJA 2RSVA 3EB0A 4FT7A 2WMXA 4L01A 4MNEB 5ANOA 2QD9A 2Z02A 3LFNA 4RWJA 4IE9A 4FTLA 1XBBA 5FM3A 4IX6A 3LXLA 1FVTA 4DHFA 4FIFA 2WO6A 3ZCLA 1YOLA 4FE2A 4WBOA 2CNQA 1KUTA 3NYVA 4BDJA 3SG9A 2PHKA 2QOKA 5LMBA 4YZ9A 4GYGA 3GENA 3HV6A 1OM1A 1UU9A 4G9RA 5F4NA 2C6IA 2WGJA 3BQCA 4BHNA 4YLLA 3VUIA 5CS6A 1WMKA 3IOKA 3RPVA 2A2AA 2Y0AA 4G3DA 2QR7A 4JRVA 3MFTA 2A27A 3OEZA 4I1ZA 1CMKE 1VZOA 3EL8A 3PPKA 4FV5A 3R7IA 4OTHA 5AR8A 3RGFA 3VUMA 4QP2A 4O7RA 3G0EA 3D0EA 1L3RE 2OSCA 2J0KA 2Y4IB 3E92A 4UB7A 5FQDC 2ONLC 1M2RA 4CFMA 2CGVA 4HPUE 4FSQA 4MK0A 4O81A 3PA3A 3UNZA 2EXEA 2ITTA 1U5RA 4BTJA 3O2MA 4C59A 3GB2A 4ZEGA 2YM7A 4C7TA 5M44A 2VGOA 5JFWA 3CC6A 2ETMA 5L2SA 2CN8A 3V5WA 4HYSA 3R8VA 4FX3A 3QZHA 1W98A 4RIOA 4TZRA 4ZTQA 4GK2A 4ZTRA 4E7WA 4DA5A 4FA2A 1B6CB 2A19B 4AQCA 1ZXEA 3PY0A 4G9CA 3CD8A 2ITXA 2VTJA 4QMPA 4FUXA 3P0MA 2BRBA 5EQYA 2A4LA 3KMWA 2J51A 3UYSA 3WOWA 3DKFA 3NGAA 4Y5HA 1T45A 5AP2A 3VF8A 2PUPA 3A8XA 5GINE 3DQWA 3CY3A 5KHXA 4J96A 5CENA 4D2WA 2H6DA 3VS4A 3O96A 2Q0BA 2Q83A 3HRBA 4H1JA 1UU3A 2Z7RA 4AT3A 2OBJA 4I4EA 2X81A 4HVIA 4F1MA 4OBPA 2XNNA 4ITHA 3OCGA 5EDPA 3SGCA 3NW5A 1H01A 1YRPA 5CAUA 3NCZA 3ACJA 3PG3A 4QP4A 4CLJA 2Y7JA 2W4JA 3D5WA 2YDJA 4UX9A 1PXIA 5CAQA 3R7EA 4ZSGA 4UZHA 2G2HA 2R3IA 5FTGA 5LARA 4MNEA 4RA4A 3WIGA 4EOSA 3P78A 2WMAA 3CQWA 3E88A 3FI2A 3VQHA 1F0QA 3KXMA 4BICA 4CQGA 4E6CA 5IQAA 2UZUE 3KF7A 3ORIA 1JNKA 4J97A 3TJDA 1M7NA 3MFRA 5JEBA 3UNJA 3UIUA 3LOKA 3ZMMA 3PXKA 4A7CA 3UO5A 5B2LA 5CSPA 2YDIA 4DLIA 5JN2A 3FBVA 5KMNA 3UGCA 3AMBA 5ANIA 4BTFA 3DXPA 5FBNC 3HEGA 4BWXA 3OTUA 3P7BA 4NCTA 2FSOX 2XK8A 3DA6A 3NNWA 4ACDA 2ESMA 2R3NA 3QD4A 1HOWA 2O65A 4O82A 4ZMFA 4MF0A 1FVVA 2R3FA 4HZSA 2ZM3A 3RI1A 2GDOA 1CKJA 2HAKA 2B53A 4ZY4A 5IEVA 3P1AA 4H39A 4GSBA 1ATPE 2QOQA 1M2PA 3BYUA 3Q4ZA 1PXJA 4NFNA 4X0MA 3TNIA 4D1XA 4IAKA 3C4CA 3MY0A 2OW3A 1PHKA 2ZVAA 4UWYA 4QTEA 4YHFA 1J7LA 1B39A 2IVTA 2XK6A 3KKVA 3F2RA 3FYKX 2DWBA 4N6YA 4W9WA 5K0XA 3HAVA 3BU3A 2GFSA 4J7BA 4F7SA 3PVBA 1Q99A 2XIRA 3FHRA 4FTAA 4FKOA 3P7AA 5HE3A 4JI9A 3PJCA 4B99A 1L8TA 3BGZA 4X2KA 4XP2A 5EW8A 4B6LA 2GU8A 4J8MA 4PV0A 3KGAA 4XLIA 5BVEA 4G5JA 1JSTA 3F3TA 3NEWA 5LVMA 3FLYA 4KS8A 3Q96A 1RW8A 2QOLA 3O50A 5FDPA 1U54B 3FDNA 1JPAA 3IPHA 4MEDA 4FZFB 2NRYA 1H00A 2V22A 2XS0A 3LMGA 3R7UA 1ZOGA 1V0PA 2XYNA 4I5MA 3MY1A 3Q53A 3FC1X 4F6WA 3SA0A 3PUPA 4RIXB 5IG1A 1Y6BA 2UUEA 5AP7A 2VX3A 3NUXA 4FIJA 1Q4LA 1JSVA 2GS6A 2UZWE 1SYKA 3LAUA 4GVJA 1YHWA 4R5SA 4RQKA 5J5TA 4LFIA 4FSUA 3W18A 2PMNX 2W9ZB 3E8EA 4Y85A 2IW9A 4QP9A 3OWPA 3COHA 4I5PA 4N0SA 1W7HA 4MAOA 4X2GA 3VS1A 4L9IA 4DCAA 2IZTA 3ZC5A 4FOBA 3ZS5A 3HUCA 3LPBA 3NW7A 3PWDA 2PL0A 4XG8A 1EH4A 3NW6A 3QL8A 1SNUA 3QLFA 4U0IA 5BVDA 2R3KA 3KREA 4FT3A 4P5ZA 4XH6A 3OC1A 3Q9XA 5E8ZA 1LUFA 3R9DA 3F9NA 4FNWA 4FTQA 5KUPA 1GIHA 3AC5A 4IAFA 1JAMA 3Q9ZA 4QMSA 1W82A 5HQ0A 3OOGA 4LV8A 3ORPA 2ERKA 2VWIA 3LFCA 3VHEA 2W4OA 5AUZA 4CD0A 2B9HA 2HW7A 3AD4A 3MSSA 4ZSJA 3JXWA 4H1MA 3UO6A 4W9XA 3ZRLA 3G90X 4D4SA 5IEYA 1TQMA 3PXRA 5L8JA 3F5XA 2B9FA 2R0UA 3C4ZA 3NYXA 3KA0A 3CPCA 5BUIA 3NNVA 4C37A 5BNJA 1BX6A 3UZRA 3OZ6A 2ZM4A 2WQEA 2WU6A 3FKLA 4F9WA 5JSMA 5LVNA 3W1FA 4CT2A 4FKRA 3AC2A 4M69B 3THBA 2GTNA 1FGKA 2R3HA 2E9NA 3Q60A 3ZU7A 5JK3A 5KMOA 3QKMA 4KRDA 4F7NA 5L6PA 4QRCA 3F69A 3DB6A 2BVAA 3EMGA 3GOKA 3NIEA 4JS8A 2W17A 1GIIA 4TXCA 3RINA 3DKCA 2XKDA 4NUSA 4XV9A 3Q04A 2PZ5A 3ZSGA 5J9ZA 3GU4A 4FIEA 4JIAA 2RGPA 2ZDUA 5L2WA 2R2PA 4AW2A 5K9IA 3MFUA 1I09A 4XMOA 2OK1A 3CXWA 5ANEA 4EKLA 3K3JA 2OKRA 2P4IA 1PMNA 4FNXA 4IAYA 4FL3A 4IZAA 4JT3A 4IEBA 4RVTA 3U8WA 4FEUA 4J53A 2YITA 3UE4A 5JKGA 5IF1A 2HIWA 5BPYA 3HL7A 3G9NA 4Q9SA 1CKPA 2IZSA 3HRFA 5HD7A 3KMMA 5HE2A 2PUNA 5BYZA 3UVQA 4RA5A 4B0GA 3NRMA 2BILB 3IS5A 1U54A 2XK7A 3PSDA 5TR6A 2E9UA 2R5TA 2CLQA 4FK3A 4WOVA 4PWNA 4L44A 5HIDA 4D4YA 5CEPA 5CU3A 4K6ZA 3QQLA 2XKCA 5DNRA 2W9FB 4Z3VA 4TPTA 4KIQA 3GC0A 3LHJA 2ITWA 4TYGA 5H8BA 4RIXA 4MBLA 3VF9A 3FMKA 4X2JA 5AR7A 4NEUA 4BDAA 3RK9A 4LQMA 4MKCA 5J9YA 4IC8A 4D55A 1GNGA 3DK7A 5CAPA 5CASA 2PY3A 1H0VA 4BDGA 2UW5A 1Q24A 3FY2A 4EQUA 2PVFA 2J90A 5LQFA 2F7ZE 3NPCA 4PUZA 4E3CA 5LWNA 4AGWA 1UNLA 4U42A 2C6DA 4TYEA 4DN5A 3RHKA 3QRTA 3W16A 2X8EA 1G8SA 3UOJA 4HCVA 3BLQA 2P2HA 4BCMA 2JDVA 2NPQA 3SRVB 3MYGA 3Q6UA 2J5EA 3H9OA 4JLCA 3LLTA 4RX8A 4U8ZA 3K5UA 2HW6A 3A7FA 3DKOA 2OIDA 4OTPA 1FINA 3UC4A 4EH6A 3H0ZA 3Q52A 1REKA 1FQ1B 2QU5A 3UYTA 2B1PA 5B2KA 5C8MA 4ACHA 4RVMA 2JFMA 3MDYA 2YERA 4PTGA 3PXYA 4D5HA 4C3RA 5DRDA 3G6HA 4F9YA 1RDQE 2OIBA 1HCKA 5IISA 3UNKA 5LCKA 4ZJVA 1PMVA 3QYZA 3QX4A 4BYJA 4R3RA 4LRKA 4RIWB 1T46A 3ZXTA 4M69A 4RX7A 4ZLYA 3IQ7A 3MPAA 4C58A 2W05A 3GP0A 1PW2A 4F6UA 4XV1A 4YZNA 1B38A 4YTFA 3PVGA 1KOAA 5JZNA 4PL5A 3D15A 3ZSHA 3ZOSA 3ORKA 1H08A 4ANNA 4O38A 1URWA 3A99A 4UWCA 4CG9A 3H0YA 3MBLA 4LMUA 4DT8A 4JXFA 2WELA 2YN8A 3DTWA 3MH2A 4ZSLA 4BI0A 3IKAA 5A14A 2UZOA 3QQHA 1ZMWA 3PJ1A 3R21A 4EH8A 1M14A 1W8CA 5JQ5A 3LLAA 2C47A 4YJNA 3I6UA 3R9HA 5IU2A 2PVRA 4D28A 1FPUA 4M68A 5LJJA 2HWPA 2ITVA 4NW5A 4WUAA 3SV0A 1OUKA 3VRYA 1JKTA 2G01A 3WI6A 2W96B 5KMIA 2YLFA 3AQVA 2FSTX 5E8VA 3SX9A 4ZS4A 2RFDA 4C4HA 4PDSA 4FGBA 4RZVA 1OPJA 2W06A 2EVAA 4A06A 2WEIA 4CKJA 2XH5A 5D10A 3A4PA 2BR1A 3E7VA 3AT3A 2XNEA 3AGMA 2YIYA 3CTJA 4GIIA 4IFGA 1IASA 5J7BA 5BVNA 4FGRA 5IA4A 4BDHA 3FLQA 4P5QA 4EH4A 3QTZA 3CTHA 4I6QA 4O7LA 4R8QA 3Q4TA 3BGPA 3ORZA 1FBNA 4XG6A 2W1GA 5HTBA 5GZ9A 1R0EA 3H4JA 3SXFA 3IDBA 1R3CA 4TT7A 4CYJA 3LFFA 3QQGA 2XVDA 3MIYA 1OPKA 4OTQA 4F7LA 2C1BA 1WCCA 2X4FA 3DFCB 3OXIA 1HCLA 2OGVA 3MN3A 4J71A 1A48A 4KIKA 5ANKA 3I5NA 3W55A 3FMJA 2YIXA 2RIOA 3LFSA 3OBGA 3ODZX 4FV9A 4FSMA 4XG4A 2XZSA 3FY0A 4ZMEA 3NUUA 4JG8A 4O91A 4WNMA 4BDKA 3QXOA 4MCVA 3S95A 4M7IA 1WBWA 3TIYA 4DLJA 3R71A 2GQGA 3D94A 4QD6A 4TRLA 4Y73A 3VBQA 5FXRA 3ZM9A 4GJ3A 1QPJA 3A7JA 1YDRE 1Q3WA 4IC7A 1PKDA 2YLEA 3DAKA 3L9PA 3HRCA 4CRSA 4GMYA 4AGUA 3DDQA 4BBEA 3KRWA 2QKRA 2EB3A 4R1YA 3W32A 1BI8A 2ZV8A 4I3ZA 2UW0A 2C6EA 5CY3A 4QMQA 2OFVA 4FIHA 3FMDA 4HGLA 3KRRA 2B54A 4IWDA 5EHLA 4BGQA 5IA3A 3O17A 5KBQA 4ANOA 4KKGA 4IB5A 4O0WA 4CEGA 2HCKA 4AAAA 5CF4A
chains in the Genus database with same CATH superfamily
3KN5A 3RK7A 3Q3BA 4GKHA 5IH5A 2ZMDA 3BLHA 3RZBA 4BBFA 3GCVA 3HA8A 4QP3A 4GIHA 2X9EA 3A2CA 4QMMA 2FB8A 3ACKA 4IB0A 5HE1A 1YXXA 5AFVA 4RX5A 2WIPA 4QTBA 1O6LA 3OXTA 4AXFA 2FSMX 3ODYX 3PPJA 3R73A 2GCDA 2VZ6A 4FKGA 4LUEA 5F94A 4YR8A 1ST0A 3LKMA 4RWKA 2Z60A 2V0DA 4I20A 4USDA 4BRXA 4FSYA 2RFSA 3V8TA 3OMVA 3QQFA 3FZOA 4PMTA 2UZTA 4QP8A 1Q8UA 2RFEA 3V5PA 5AAGA 3VS0A 4FZ6A 3R2YA 4F0GA 3VIDA 4JIKA 3TN8A 3ZZEA 2HYYA 3LCDA 4BIBA 5BVOA 3BV3A 1OIYA 3HNGA 2OIQA 5CYIA 3HV4A 3SW7A 5T6KA 5HG5A 2J2IB 4NW6A 2GNGA 4FV4A 2DQ7X 5D41A 2Z2WA 1FOTA 4MD8E 4UMQA 2IW8A 3VS6A 4CQEA 1U46A 3O8TA 3PIZA 1PRYA 5E9EA 4O4DA 3BLRA 4AOIA 1H28A 4L3JA 4Y95A 4LDTA 1JWHA 4J1RA 2PTKA 3QX2A 4EH3A 2YCQA 3SD0A 5IZFA 4G34A 3RVGA 3LCTA 3MIAA 4DFZE 3PP1A 4X6QC 4DYMA 4EONA 4AX8A 3QZGA 5LCJA 5CSHA 5LMKC 3ZO2A 3A7GA 4V0GB 5E4HA 4FKPA 1NVRA 4TYJA 5TF9A 3VBTA 4FL1A 3E87A 3WF6A 4EWQA 1PXPA 5EYDA 3MVHA 4AG8A 4IM0A 4MF1A 3U51A 4E1ZA 1KV1A 4X3FB 2CKPA 1PYXA 4W4YA 3R1NA 4LV5A 5E8YA 4F70A 4KB8A 3VS2A 2CCIA 3L9MA 3R83A 2PVKA 1JQHA 4BVUA 4Q5HA 4X6RA 4F0IA 2I0HA 4ANBA 2I0YA 3EN7A 3QKKA 1XWSA 4NM0A 5CSXA 3COMA 4YTIA 2X6DA 4ASEA 4D9TA 2YIWA 3WZEA 1H27A 3LZBA 2W1IA 4U79A 4EK5A 4TW9A 3N4TA 1UKIA 5AADA 2YACA 1MP8A 5AA8A 4XX9A 1R39A 2FYSA 3GUBA 4XEYA 4C8BA 4YLKA 3BLAA 2XCKA 3HV7A 4MXCA 4ZZNA 4NKSA 3TDWA 3C13A 4G3GA 4BDFA 5HD4A 4Y5QA 2C5NA 3A4OX 1ZARA 3IDCA 1IAHA 2HZ4A 3F88A 2QO2A 2FO0A 4DEBA 2EXMA 2IZUA 2QOFA 4AZEA 5JT2A 4IFCA 1XKKA 5M56A 3OBJA 2XJ2A 2BHHA 3LW0A 5C4LA 3C4WA 3AT4A 3RWQA 2C30A 4WSYA 4AGCA 5D12A 1STCE 1REJA 3CEKA 3W33A 3D2IA 3ZEWA 4AE6A 2IO6A 5CXHA 4DTBA 2AYPA 3TV7A 4FTIA 2OJFE 2PVMA 4DAWA 4U6RA 3U87A 4ASZA 5J7HA 4B4LA 4NWMA 4BWKA 3GFEA 4KSPA 5LWMA 3HMNA 4O2PA 2E9OA 1MRUA 3I79A 4C33A 1MRVA 5AAEA 3I0QA 4QMVA 4CFFA 3DV3A 5L2QA 4DCEA 3S1HA 4WBBB 2PWLA 4DTAA 3CE3A 1TVOA 4A9RA 5DR6A 5FLFA 2XKEA 4J99A 5AM7A 3O7LD 1YI3A 4BCOA 4ZIMA 4U80A 4ZJJA 1FMKA 2KTYA 3EOCA 3PYYA 2PZYA 1J1CA 3GU8A 3O23A 4LGDA 3GNIB 3KU2A 5AP3A 4ZTSA 1NY3A 1XH9A 4R1VA 4LOQA 5DR9A 4F9CA 4GEOA 3P5JC 3ZRMA 3GCPA 4EYMA 4F9AA 4FTUA 4CGAA 4IXPA 1OUYA 3D14A 4S34A 3ULZA 3A7HA 3R9RA 2OH4A 5EG3A 3UQGA 3CJGA 2UVYA 4FV2A 4XJ0A 2OI4X 2W5HA 3REPA 5DG5A 5HNIX 4YHJA 4V0GA 3CBLA 3FL5A 4WO5A 4R7BA 4M67A 3FJQE 3AD6A 5IQEA 4XV2A 3OT8A 2QOBA 4ZZMA 3TZ8A 3RPRA 4X3FA 5EH0A 5EI2A 3TG1A 3NNXA 5KKRB 5E91A 4HNFA 2IVUA 4D2PA 1PMEA 2CMWA 2E9VA 4IM3A 3VO3A 4FTKA 4C62A 3QWKA 4B8MA 2WMVA 1YOMA 4IWOA 2JIVA 3OUNB 4FZ7A 4K0YA 3HUBA 2I7QA 3FZPA 4ACCA 5HTCA 2F57A 2XRUA 5J1VA 3IOPA 1VR2A 3MI9A 4IANA 3ERKA 1ZZ2A 4MBIA 5A3XA 3VUTA 1BL6A 3LE6A 2QOIA 4QMLA 2I0VA 4FV6A 4NK9A 5HEZA 3POZA 5CSVA 5BYYA 4WIHA 2PULA 3BI6A 5M57A 5JGAA 1OIQA 4GFMA 3BU6A 1OGUA 2WQBA 2XM9A 4ERKA 4MBJA 3U4UA 4ITIA 3P08A 3CP9A 3D7TB 3EKNA 4D4RA 2CHLA 3COKA 3C0HA 1XHAA 1FGIA 3PJ2A 4C3FA 4CZYB 3BBTB 2IWIA 1YWVA 2UW4A 3HGKA 3SHEA 1XMLA 2OH0E 4M14A 5DBXA 4I0TA 5DLSA 5EYMA 3MA6A 4FVPA 3IW4A 2QR8A 1R1WA 1YI4A 3SW4A 2J7TA 1OKZA 2GMXA 4GVAA 4HVDA 4YJUA 2IPXA 1MQBA 3OXZA 4O0TA 1XH7A 4FODA 5BVWA 4KBAA 4DFBA 3LXNA 4WRSA 4FKLA 2C6LA 3MTFA 4JDIA 3MV5A 2F49A 3C4XA 4GRBA 4LYNA 1OL7A 4GH2A 3QQKA 5EOLA 3FV8A 3EQDA 4RJ7A 3JYAA 3OCTA 3IECA 4FSNA 4YC6A 2EWAA 3HZTA 2ZJWA 3PA5A 3PPZA 1U59A 4JDKA 3D9VA 2VTTA 4TWCA 3DDPA 5CI7A 4I23A 3QUEA 2QI8A 3QD3A 3G0FA 4MX9A 2VO6A 4BTMA 3H30A 2XMYA 2UZEA 2PE1A 3KXHA 3R28A 4QMWA 5GHVA 4D58A 1Y8GA 3T3UA 3F6XA 3DXQA 3C1XA 2V7OA 4CFVA 2AC5A 4CTBA 2VNYA 4R7HA 4A9YA 1ZLTA 5BV3A 5HESA 2E2BA 5CVHA 4BFMA 4HVSA 2WPAA 5HIEA 3E63A 3UJGA 4R78A 3QF9A 3QRJA 4DE4A 3DTCA 3GU5A 3R9OA 5C03A 5AP0A 3ZLWA 1WBSA 1AGWA 4C34A 3Q6WA 4AWIA 3I6WA 1BLXA 2I0EA 3DNEA 2QONA 3F7WA 3AMYA 4U97A 5HLPA 5HE0A 3VWAA 5C8NA 1F3MC 2X2KA 2CCHA 3HAMA 3C7QA 3B2TA 2B52A 4RGJA 5FDXA 5J79A 2GQSA 4BKJA 4BZNA 3WZDA 3FI8A 4MXAA 2OLCA 4QYFA 2YFXA 2OJ9A 3VS7A 3QHRA 4NCTC 3F5GA 3OTVA 2R3RA 3BYSA 3RPOA 4JL9A 3ZBFA 5GNKA 2ZYBA 3QAME 4FKJA 1SNXA 4RMZA 2REIA 2W0JA 3K3IA 5J95A 3VUHA 4L7FA 4G6OA 4PL3A 3EFWA 3TZ7A 2BHEA 4D2TA 2PZIA 2HZ0A 5LVOA 2NP8A 1UNHA 3TNQB 3PG1A 1WVYA 3IW7A 2IW6A 4MHAA 5CVFA 3D7TA 4I22A 1Z9XA 2WTDA 3F3UA 4CFWA 2XBAA 2VX1A 5DH3A 4DH7A 4EWHA 1G8KA 3F2AA 3AXWA 4P2KA 3E8NA 3ZRKA 4AA5A 2PVLA 2VTIA 4NT4A 4U41A 3RZFA 3FHIA 1QL6A 1RE8A 5AR3A 3HMPA 3TV6A 3NLBA 4L00A 4O7YA 3VNTA 4IACA 4JX7A 3OP5A 5EW9A 5CNOA 4USEA 2OO8X 3PFQA 4TKSA 3RAHA 4YJSA 1XR1A 3LCOA 4GUEA 4QP7A 3RBWA 3ZXZA 3ITZA 3NYOA 3FZSA 4FMQA 3ZUTA 2C4GA 4MXZA 3QGYA 3UIXA 4XP3A 5CEIA 2HOGA 5HICA 1XO2B 2BIKB 4IWPA 2UV2A 1SMHA 3IW5A 3ZO3A 4F08A 4ANMA 4U81A 3RNIA 3ZTXA 4H3BA 4EOPA 5KHWA 1XH5A 3W2RA 5CEOA 2PYWA 3QLGA 3LFEA 2W1DA 5HG9A 1WBTA 4D2VA 4ASXA 3E64A 4ZS0A 5CLPA 4EK4A 1H1RA 4OTDA 5HOAA 2GNLA 3DFAA 4ZTHA 4JJRA 4C4JA 5I9YA 4QMOA 4E4MA 1NVSA 3KRXA 2J0JA 3BYVA 4IJPA 4E8AA 5AIKA 3ORLA 2VTLA 2BFYA 3TACA 3EL7A 4ZZOA 4O22A 1RQQA 3D83A 4AZTA 5B0XA 4F99A 1NW1A 2YEXA 4PL4A 3QCSA 2QC6A 3U9CA 1W83A 3F61A 4XBRA 4D5KA 3UQCA 2UW9A 2BUJA 4OTFA 2C5VA 2I6LA 4O21A 5M4IA 1LR4A 4FV8A 1Q5KA 3C4FA 4S30A 4GFOA 3I5ZA 3H9RA 3FPMA 4BGGA 4JBPA 2H34A 4GT4A 2PZPA 4Q9ZA 2ITUA 5CAVA 2BTSA 5JMSA 4DEHA 4BDEA 1R0PA 5KZIA 3FXXA 1V0OA 1ZYSA 3TZ9A 2W1EA 3ANQA 3DB8A 5DVRA 3R01A 4FV7A 1SVEA 3ZFYA 1W0XC 5AIRA 5E8SA 4TYHB 1R78A 2BRHA 4F4PA 1KOBA 3DAJA 2VTRA 2F7XE 3FSKA 3S4QA 1E9HA 3GQIA 4FZDB 2AQXA 2ZV9A 1P4FA 1OI9A 4F09A 4OTIA 5E90A 3BHUA 5IMEA 5ANJA 1YDSE 3OT3A 4LV7A 2YJRA 2VWXA 4JR7A 2BDWA 4I6BA 5BUEA 5L4QA 3EQGA 3NX8A 3TL8A 5DYJA 4BCNA 1H4LA 4I94A 4BIEA 2YCSA 2QG7A 3PE1A 2X8IA 3HVCA 3PVUA 5AV0A 4EUUA 1IA9A 1TKIA 3RAKA 3DJ5A 3R04A 4IW0A 5FP6A 3WILA 1LEZA 2ERZE 4CYIA 2UW7A 5M51A 2WQOA 1K9AA 4W4WA 3ZO4A 3VUGA 3LQ3A 4EJ7A 4LL5A 3BRBA 4G2FA 4O1PA 4Q5EA 3FMHA 5FWKK 3FXZA 3OF0A 4EK6A 2ZV2A 5AWMA 3LFQA 4EJNA 4GUBA 3R8PA 3WF9A 2OWBA 3AC3A 4JDJA 4CTCA 4OR5A 4EEVA 3N4UA 3O8UA 2NYAA 4WNOA 2HZNA 3SXSA 1E1XA 2BKZA 2BZIB 2YM8A 3ENHA 3I4BA 2YCRA 2XNOA 5HBEA 3NAXA 3WF7A 2PE2A 4FVQA 4NFMA 4CNHA 2R3PA 4BZDA 1DM2A 5I4NA 3LCSA 2B4SB 2QODA 4BCKA 2C68A 3IO7A 4MTAA 5HG7A 2XIXA 3D7ZA 4E4XA 5D1JA 3RWPA 5IH4A 2CJMA 5HNBA 3WE4A 4FTOA 2O63A 3QTXA 3NYNA 5EK7A 4WHZA 1VYZA 2XK4A 3FL4A 3EZRA 3BHHA 3HECA 4BCIA 3G2FA 3LXKA 3MS9A 5IA0A 3HYHA 4MQ2A 2QOCA 3W0RA 3DCVA 3GEQA 4DGOA 4DH1A 3F7ZA 3RHXA 3IW8A 4S2ZA 2UZNA 4XG2A 4YPDA 2VTOA 3W8QA 4LL0A 4O96A 1WZYA 2VTHA 1WVXA 4J8NA 2BDJA 2W1ZA 3CKXA 2RG5A 4LOOA 4A9SA 2IZRA 2GQRA 4ERWA 4FNZA 4CXAA 4I6FA 3RM7A 3RAWA 5H2UA 3CQEA 1ZY4A 2GHGA 2XIZA 3KRJA 4MNFA 4QPMA 5GJGA 3AKKA 2HY0A 3RP9A 4NM7A 4WG5A 1ZOHA 3Q9YA 5ANGA 4BI2A 3QTWA 1M2QA 3PLAE 3ANRA 2HELA 4YUQA 3KEXA 4L45A 1JOWB 4TYHA 4BN1A 1ZY5A 3QCYA 4FV0A 5EQPA 4O2ZA 2WTJA 3QC4A 4MUQA 4OTWA 3GCQA 4ZK5A 4FIGA 4YZDA 1KSWA 3LVPA 4IJ9A 4RLKA 3V6SA 2C6TA 4CKIA 5C4KA 5HCZA 3NMUF 4AN9A 2HXQA 5FG8A 3W8LA 1H1SA 1OMWA 5A54A 3FI3A 4PF4A 5I9WA 3SKCA 1H26A 1CKIA 2ZOQA 2WXVA 3DXNA 2WMSA 3EN6A 4FBXA 5M4CA 3UVPA 4YO6A 4F1TA 1Q97A 2YDKA 3MJ1A 4AT5A 3NZ0A 4C38A 4X21A 1OIUA 2BAKA 2XIYA 4U40A 3ZEPA 2O2UA 1PY5A 1Y8YA 3GGFA 3ORTA 5IUGA 3FUPA 4F9BA 4TWOA 2OICA 4ACGA 5EI8A 3FMNA 2PVNA 3QRIA 5HBHA 3TNWA 1WVWA 5CU4A 1H07A 4BYIA 2UW6A 2XEYA 4RFYA 2BAJA 2OXYA 2ITOA 2GHMA 3LQ8A 3ZUVA 2G9XA 3EQPA 3EZVA 5ACKA 1BKXA 3EN5A 4D0WA 4YPSA 3PUFC 4FYNA 3QUPA 2VN9A 3OHTA 4G3CA 3FLZA 4DDGA 2CGXA 3KIOC 4PP9A 4ALVA 5FTOA 5L3AA 3RALA 4EOJA 4K18A 5E8UA 4J95A 1ZOEA 4RLLA 2YISA 2C3KA 5L8KA 2VRXA 3IGGA 3KN6A 3PA4A 3PIYA 4FT9A 4L67A 2IJMA 5EM8A 4AGDA 2XJ1A 4CG8A 4OBQA 1Z57A 2G2FA 3U9NA 5AUXA 4HZRA 2Y8OA 3RCDA 1UWJA 4ZP5A 2BRGA 4KSQA 1JVPP 2BDFA 3OUKA 2OJIA 4C4FA 1OKYA 1G5SA 3CPBA 3OW4A 3H3CA 4IX3A 3DT1A 2YHVA 3FQEA 3I81A 5CAOA 2JC6A 4AAYA 5M07A 3C9WA 4LM5A 5J9LA 3V01A 1PJKA 2V5QA 2YWPA 2JKOA 2UZVA 2CKEA 4OW8A 3CS9A 3FMEA 4U7ZA 3RAIA 4E20A 4UZDA 5HHWA 4EHZA 4HOKA 4QYGA 1KWPA 2BCJA 4JX3A 3BIZA 4KIPA 5AUTA 3NWWA 3VONA 3NCGA 4ZXTA 3LMIA 3PSCA 4OAVB 4RJ6A 2VWYA 4YJPA 3QA0A 4O0RA 4ZTLA 5AUYA 3ZC6A 1A06A 4IMYA 4XHKB 2AC3A 2JAVA 5E1EA 5BUJA 4FTCA 3A61A 3PE2A 3DU8A 3E7OA 3UMWA 4DEIA 2XK9A 4O0VA 2Y6MA 4HGTA 4DGGA 5EM6A 5LVPA 2PSQA 5HO6A 3OWLA 2GNHA 2X7FA 4DEDA 5I9VA 1BL7A 3ZUUA 4JBOA 4UEUA 2W1CA 4AN3A 4QTDA 3KRLA 3BGQA 2ITQA 2FVDA 4BCHA 2JLDA 5KO1A 2OF2A 4DFLA 4Q2AA 4W8DA 4C4GA 3UIBA 5TT7A 4YHTA 1Z5MA 2XBJA 2C5XA 4FTTA 2A98A 3Q4CA 1YW2A 3R8LA 4P4CA 4CFXA 4M3QA 2XANA 2X39A 1J7UA 5IUHA 1XBCA 5M53A 5B2MA 1NA7A 2P55A 2V7AA 5TO8A 5CEMA 3R30A 4MXOA 5CQUA 3R7OA 2YABA 5IQBA 4NM5A 3VJOA 5HTIA 3D5UA 1W2FA 4PPCA 5HIBA 2WB8A 3WYYA 5ICPA 1BMKA 4IB1A 4XS2A 4CRLA 4QMXA 5L6OA 3GVUA 3NFFB 5M4FA 4O27B 2QVSE 2VX0A 2R3GA 2G15A 1WBVA 3JUHA 3LFDA 3ORXA 4H36A 4IIRA 3V8WA 4BCPA 3K54A 4QP1A 3L8SA 3BKBA 2PUIA 5M4UA 1W2CA 2UW8A 4FSTA 4JR3A 3VW8A 4BCGA 1J7IA 3EN9A 3QCQA 5JGBA 2XM8A 3QTSA 4OGRA 3NFGB 3DLSA 2WTKC 2G2IA 4HYUA 1PKGA 4D4VA 3DS6A 4YURA 2JEDA 2WOTA 2W4KA 5IQCA 5M09A 4NH1A 4XG3A 5IA5A 4R3PA 3SRVA 3FEGA 4O84A 2NO3A 3HDMA 4EHEA 4ZAUA 5HU9A 4Y46A 1PYEA 2V55A 5CSWA 3MVLA 4E5BA 3QU0A 1KE8A 3JPVA 1J91A 4L42A 3F82A 1UU8A 3A8WA 4WA9A 2X0GA 3DJ6A 3AKLA 2GNJA 1M17A 4LRJA 2XJ0A 4M12A 4DT9A 2DUVA 3Q2MA 2W7XA 3QKLA 4KBKA 5CZIA 5H9BA 4O7VA 4JG6A 5E7RA 3BE2A 5HZNA 3FWQA 3DBFA 4KNBA 4YO4A 4O7NA 2YCFA 5DI1A 1X8BA 4DFYA 4JNWA 5J1WA 3QYWA 3VC4A 2BAQA 2BMCA 2B9JA 2WTVA 1IA8A 5EYKA 4MXXA 5H8GA 3T8OA 4ALUA 5CF6A 5J5SA 4QNYA 4DFXE 5HU3A 5AM6A 5DWRA 3P4KA 4OT6A 4CFNA 3NNUA 5CANA 4ZY5A 3S0OA 4PP7A 4O0UA 3ALOA 3VRZA 3IK3A 2Q0NA 4X3JA 4QPAA 3TIZA 4AA4A 4UMTA 5C1QB 3WYXA 4BIDA 1AQ1A 3V5TA 5K5NA 4FL2A 2X6EA 4N4SA 3TKIA 2G1TA 3EQRA 3ELJA 4F78A 3PLSA 4O4BB 2EB2A 3VHKA 4YBKA 4AFEA 4C35A 3MWUA 4AXDA 5HVKA 5K3YA 1JKLA 3EYHA 3NVKI 2LGCA 3T3VA 4YSJA 3K2LA 2R0IA 4K77A 3FLWA 4EHVA 4FEXA 3KK8A 4DHIB 1OL1A 3LXPA 4PNKA 3LFAA 3NUYA 3TUBA 3MVMA 3UODA 1OECA 2WQMA 3T9IA 5DEYA 3DLZA 3N4VA 5CU6A 3GT8A 3PY3A 3U6HA 4LG4A 2CKOA 4IAIA 1AD5A 3OG7A 3P5KA 1ZYJA 3G51A 3MH3A 4R5YA 3HMIA 3I7BA 3ZYAA 4RBLA 3GBZA 3R8UA 2JFLA 3TM0A 2XNPA 3R0TA 3E8CA 5FUTA 4R7IA 3R6XA 1KE9A 2X0PA 3UMXA 3NUPA 1O6YA 4E93A 2C1AA 3GU7A 3V04A 4C4EA 3ORNA 4GKIA 4RC2A 4GYIA 1YI6A 3SOCA 4OBOA 5A4QA 4X2FA 2V62A 3AC4A 3WE8A 5CF8A 3TUCA 3FPQA 3U6IA 1OBGA 5A9UA 3R1YA 1LEWA 4XUFA 5D7VA 3KQ7A 4EH7A 3BHVA 3E3PA 4TL0A 3IGOA 2O5KA 3ZONA 3U54A 4FKIA 3PXQA 4FKVA 2IG7A 3SOAA 4GJ2A 3RTPA 1KE7A 4O83A 1ZRZA 3PY1A 4BI1A 2QU6A 5C26A 2I40A 5HORA 4TWPA 2C3LA 2R64A 5FM2A 3H9FA 4K8AA 4CSVA 5B7VA 4RFMA 3PDTA 3W0MA 5M08A 4O6LA 1ZYCA 2OXXA 5F95A 1IG1A 2OJJA 3AG9A 3LJ1A 3MA3A 4X3FC 5KBRA 1F5QA 4O1OA 5CU2A 1KE6A 3ZSIA 2PK9A 1H8FA 3FAAA 3P86A 4ZJIA 5AUWA 5EW3A 4BKYA 5D11A 4CLIA 2P0CA 4JAJA 3FMLA 4XOZA 3QTQA 5E8TA 4E73A 3RMFA 5KMLA 3BEAA 3UPZA 4V01A 1QMZA 4M15A 4E4NA 5EM7A 4FSZA 4ZTNA 4DBXA 2GFCA 3WZJA 5BQ0A 5JZJA 3S2PA 4IVCA 3CCNA 4RVLA 2I1MA 4FNYA 3W2OA 4EI4A 3W2SA 2HK5A 3FZTA 3LM5A 3R22A 3BELA 2J4ZA 3NR9A 4I0SA 2WU7A 4PDOA 4P90A 4R3CA 5CXZA 3AT2A 2JDOA 1JKSA 5KNJA 5CF5A 5ACBC 4APCA 4GCJA 4MQ1A 4IADA 4RPVA 1OL6A 3CQUA 3VBVA 2C3IB 4AACA 5E8WA 1TQPA 3KVWA 3KB7A 4PTEA 4R77A 5HVYA 2C0OA 4EOQA 3DBDA 4FC0A 5IUIA 3JS2A 3RJCA 3TTJA 2QO9A 4G6LA 4IBMA 4B8LA 4M0YA 2FSLX 2QOOA 1DI9A 4NSTA 4QQ5A 5HX8A 4NZWB 3SAYA 3TNHA 3NVMB 3MFSA 5CTPA 2AUHA 1YKRA 3JY0A 3QTIA 4NJ3A 3UIMA 1JKKA 3EYGA 3FLNC 2BZKB 2JDSA 2ZB0A 4F6SA 3EFKA 4EL9A 4MD9E 4E6QA 2OZAB 5AJQA 4QMTA 1Q41A 4L43A 3I0OA 2ZDTA 1O6KA 1U4DA 3R1QA 5IKWA 4AS0A 4DG0E 3R7GA 2QOHA 4O4FA 1P2AA 1DI8A 4L8MA 5FGKA 4RSSA 2C6KA 2ZFYA 4AQKA 3EQBA 5J87A 5DT4A 5CEQA 3C0IA 3M11A 5DA3A 4YGAA 3ZLSA 1XJDA 3H10A 5E1SA 5F1ZA 3R8MA 4ACMA 5BX0A 4DDIA 1U5QA 4USFA 2GNFA 3UP2A 2VTAA 4LGGA 2F2CB 3G33A 4BWPA 5CU0A 5L6WL 1OB3A 2Z8CA 4QYEA 3TI1A 5A4LA 5DHJA 2EXCX 3SC1A 5HX6A 4X2NA 4NKAA 4TYIA 3DBQA 1JLUE 3HMOA 4U45A 1GIJA 4CZUA 1PF8A 4JAIA 4E5WA 2XYUA 3MGYA 4AW0A 4NM3A 3F3VA 5G1XA 3L8XA 4YJVA 3VBYA 3Q5IA 5FTQA 3EQIA 3M2WA 3A7IA 2J0MB 3KF4A 4H58A 3UOKA 4EOLA 5H8EA 5IMXA 2X7GA 3HDNA 4PQNA 5KE0A 4ZSAA 4HGSA 4O86A 5KKRC 4KKHA 2W1FA 4DG2E 5FXSA 1NXKA 3O71A 2JIUA 3LM0A 4RC4A 4WT6A 2CKQA 2XRWA 2PVHA 4DHZA 3NDMA 5AA9A 5CEKA 4JBQA 2H96A 3MTLA 4FF8A 3KY2A 2OXDA 3B8RA 2JKMA 5LXMA 3O0GA 4YC8A 3RK5A 3MB7A 4AW5A 3DPKA 2GHLA 4EZ7A 4GG7A 1OL2A 2WOUA 4FKWA 2PPQA 3BL7A 3WARA 2R7BA 3C50A 1OVEA 4HCTA 1SZMA 3FLSA 4PRJA 4C2VA 3P79A 4FEQA 3ZFMA 2VGPA 2WTCA 2VO0A 5ETFA 1ZMVA 2R3JA 4QPSA 4UY9A 2EUFB 3V3VA 5J8IA 3VVHA 5BVFA 1K2PA 4ZSEA 4AZWA 4JQEA 5HBJA 1FVRA 2B9IA 5DPVA 1H1QA 4C3PA 4L3PA 3OCBA 4I6HA 2JAMA 1ZWSA 5HLWA 3MVJA 4KS7A 3QRKA 4BC6A 1LPUA 4ASDA 4FG9A 1DS5A 3ID6C 5AR4A 1DAYA 4PY1A 4YC3A 5IEXA 1SVHA 4AUAA 4A07A 4RQVA 4XG9A 3LFBA 1WFCA 5FBOA 3E62A 4U3ZA 5FEDA 5AUVA 4ALWA 2C6MA 4N6ZA 3JR1A 4S32A 2WNTA 4BGHA 2R3LA 2JBPA 1WBOA 3UBDA 3BYOA 5AV4A 2R4BA 3VBXA 3SVVA 1K3AA 5JFXA 3UZPA 2OZAA 2R3OA 4O0YA 4OTRA 1OBDA 2ZM1A 2O8YA 4IX5A 4IX4A 4KUJA 3MB6A 1VJYA 3BQRA 2XUUA 3U55A 4BZOA 5AX3A 2BPMA 4TNBA 4TNDA 3RCJA 2BZJA 4FV3A 4FYOA 3SLSA 1H24A 3OD6X 2CN5A 3ROCA 4LRMA 2FH9A 5JFSA 2X2MA 4GW8A 4I21A 3EQCA 3VS3A 2CDZA 2VNWA 2ZMCA 4EKKA 2C69A 4QMNA 4I0RA 2JD5A 4JQ8A 2BTRA 2RF9A 1J1BA 2QHMA 2WQNA 3AD5A 3CKWA 3OY3A 5HNGA 1SM2A 4FKTA 4YTCA 1IAJA 4YJTA 5FP5A 3DNDA 4QO9A 2Y4IC 3FI4A 2WD1A 3IONA 3D2KA 5HVJA 5H3QA 3L1SA 5T3QA 2W1HA 4AT4A 4DF3A 4DGLC 2GNIA 3CD3A 3GXLA 1GJOA 3HP2A 3Q5ZA 4IHPA 3SDJA 4BTKA 3KXNA 4L53A 2XIKA 3Q4UA 1MQ4A 3ENMA 4EK8A 5IDNA 2XB7A 2CNVA 3ATTA 2UZBA 3R7YA 3FZ1A 2WTIA 3CLYA 2VO7A 2WMQA 3QALE 2QHNA 4F64A 5JGDA 3UVRA 4AZFA 4C02A 1PXOA 1XBAA 4MH7A 5I3OA 4O6EA 1OGYA 4DTKA 4YZMA 5I9UA 3W2QA 3VULA 2J50A 2YIRA 4H05A 4C36A 5LOHA 4D0XA 5K0KA 3PVWA 4WRGA 1Y6AA 4CCBA 4FUYA 4F7JA 4M97A 4OTGA 4DBNA 2BIYA 2RL5A 4PPBA 4HJOA 4AFJA 2W5BA 5DE2A 4FG8A 4DH5A 2X9FA 4L68A 4AXAA 1IR3A 3ZH8A 3IW6A 4FVRA 2OF4A 5A4CA 4NJDA 3PZEA 3FKOA 5FXQA 3OCSA 2WMUA 2QLUA 1DAWA 1VYWA