4BC6A

Crystal structure of human serine threonine kinase-10 bound to novel bosutinib isoform 1, previously thought to be bosutinib
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
293
structure length
285
Chain Sequence
EHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
publication title Crystal Structure of Human Serine Threonine Kinase- 10 Bound to Novel Bosutinib Isoform 1, Previously Thought to be Bosutinib
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 285
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bc6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bc6A01
2IWIA 2BRMA 3WF5A 1PXNA 3V8WA 2GNJA 3ZO4A 3VS6A 1RDQE 3OEFX 4U3ZA 3BHVA 4D1ZA 4UYNA 3R2BA 5CAVA 3BQRA 3LMHA 2I0EA 3KXXA 5EDQA 4ENYA 5A6OA 4PDOA 4KWPA 3MYGA 4LL5A 5KBRA 5B2KA 1ND4A 3G6HA 4BCPA 4MWHA 4IB5A 2XUUA 3OROA 1ZMWA 3D7TB 4I4EA 5AUYA 1FVTA 5IQBA 5IA1A 2OG8A 3GEQA 3F3ZA 3MPTA 4RIXA 5CT7A 3AD4A 3QUPA 4NUSA 5L6WL 5M56A 4GL9A 3VRZA 3GCVA 5IQFA 3IDCA 3ZZEA 3CTJA 4DCAA 1MP8A 3QLFA 1JKTA 2QI8A 3RM6A 2NRUA 3RPYA 3ZRKA 3NW6A 4EH2A 5CENA 3B8RA 5AJQA 5L2QA 5ETFA 4GW8A 2QC6A 5CEIA 2BR1A 2VV9A 4IAFA 3NSZA 4HZSA 4MD7E 3RPSA 5LJJA 3DK3A 1KE6A 1OECA 2C47A 4RJ6A 3CTQA 2VTNA 4BTJA 4DT9A 3BLHA 3POOA 3W2PA 4AFJA 3EMGA 4BDHA 4L3JA 1MUOA 3RAHA 2XK3A 2O2UA 2QG5A 2VD5A 3DTWA 1ZZLA 3KGAA 3CD3A 3UVQA 5M57A 1QPCA 3R7UA 4CFFA 3FMDA 3F9NA 3G90X 2WOUA 2B55A 2HWPA 3DB6A 1L3RE 3QQKA 3C0IA 1WBOA 1YWRA 3OT3A 4MCVA 5AIRA 4E93A 4IC8A 4WT6A 5IA4A 5ICPA 4EYJA 2BAQA 5BQ0A 2YDKA 4PPAA 2J0KA 3AMYA 2VO0A 3PJ1A 5C26A 4BDDA 1R39A 3RBWA 2C5VA 3NUPA 4MK0A 3P79A 4FBXA 2ZB1A 3KN6A 4K77A 2I40A 2Y8OA 3OOGA 2C5NA 4GYIA 4JIKA 4X3FA 1W82A 5J9ZA 2BTSA 3SW4A 3HUCA 4F0IA 2PYWA 2UW7A 4YPDA 4RVMA 2YISA 5HQ0A 1WFCA 4QQJA 4APPA 4USEA 5E8SA 3VW6A 5KMLA 2Y4IB 1WVYA 3H30A 4OTHA 4XOZA 4EZ3A 2X2LA 3EQGA 3LXPA 1XWSA 2GNHA 3ZOSA 4EK3A 3FWQA 3QTRA 4IDTA 3Q9WA 5CZIA 3AC8A 3II5A 3RCJA 4JOAA 5E1EA 2WXVA 4TN6A 4EOIA 4DC2A 5IEXA 2PY3A 2HXQA 3AC4A 3QTUA 4BI0A 4PDPA 4F9AA 1OMWA 4I21A 4OTPA 3CGFA 1PXKA 1YXUA 3NNVA 5AWMA 1H0WA 3SOCA 3WE4A 4L3PA 4RJ3A 5JN2A 1NVQA 1RW8A 2XNEA 2GQGA 3KRRA 3UNKA 1JKKA 4RPVA 3G6GA 3UOHA 4BRXA 3AC5A 3LQ5A 2DWBA 3GCPA 4IZYA 2BAJA 4YO6A 4O7ZA 3PPKA 3VO3A 3F3WA 3ERKA 1ZYJA 4F7NA 3UYTA 2ERZE 1NT2A 3Q6WA 3K54A 5DIAA 2VGPA 1Q24A 3UOLA 5FXSA 1WBNA 2UVYA 3QCXA 4F6SA 1OL2A 4WOVA 4RMZA 4YZ9A 4MXCA 3ZBXA 5L2TA 4AW0A 2B9JA 5EI2A 1HCLA 2W7XA 4ZXTA 2WTCA 4IB3A 4AZSA 1TQMA 4F1TA 3PSDA 4FSRA 4CT2A 4MBLA 1FVVA 4NU1A 5DG5A 2Y7JA 4FV1A 4H39A 3UVRA 4QMXA 1Q61A 5H3QA 1H1PA 3GU6A 4UWCA 2EXMA 1MRVA 4TPTA 3S1HA 2F2UA 4ZZNA 1UU8A 1I09A 4G3FA 4F1MA 3KA0A 3T3VA 3R8ZA 4AW5A 4KSQA 3M2WA 4NTSA 4G9RA 3MESA 5J9YA 5AM6A 5KUPA 1M7QA 5BVWA 2XYNA 2IZRA 5FBNC 2QONA 2PSQA 4MXYA 2YZAA 3QWKA 4JX7A 1W8CA 4GT5A 3A7HA 4ZTQA 2FSOX 2CGVA 4BDEA 1Q8YA 4X0MA 1IASA 4RIOA 4PMTA 4APCA 3DY7A 3QQLA 3MFSA 4E5AX 4IZ7A 5HNGA 3U51A 4JR7A 3UJGA 3UO6A 2JBOA 4ANNA 3RM7A 4HCUA 1FVRA 3QALE 4O2ZA 4FKTA 4FV9A 1H1SA 4G5PA 4LRKA 3UZRA 4UMPA 4E3CA 3OD6X 4PL3A 2QD9A 4L67A 3H9FA 5DMZA 5GIOE 3VW8A 2VZ6A 1G8AA 3RAIA 3PPZA 2Z7SA 2PZPA 3NUSA 3D7TA 4I5MA 1L8TA 3CTHA 4Q5EA 5CWZA 3REPA 2ZV7A 5CF4A 1FQ1B 3QA0A 3SC1A 3QKKA 2WQOA 2UW4A 4HCVA 4X2KA 5L2IA 2WMBA 4JX3A 3TKHA 3EN7A 3EQHA 3I7BA 4BKZA 2UUEA 3O8PA 4BL1A 1LEZA 4I1ZA 4WG4A 3DBFA 5CU2A 4GKIA 2PMLX 2XIZA 3OFMA 3PVUA 4AP7A 4C4JA 1GJOA 1H1WA 3R71A 4BZDA 4FEUA 2QOCA 4Z7HA 4O83A 1IG1A 4V04A 3HDMA 1ZYSA 3ZH8A 2ACXA 2P33A 2Z8CA 3CY2A 2RGPA 2PZ5A 4X6RA 5D1JA 5DN3A 2XNNA 1P5EA 3W32A 3R0TA 3GCSA 5LWNA 3FV8A 3WYYA 1Y8YA 4N6ZA 5CANA 4CZTA 2O8YA 4QTDA 4FF8A 4AOTA 4CSVA 2WEVA 1PXOA 4FGBA 2Z60A 3PP1A 3P1AA 4DA5A 3O17A 5C03A 5JSMA 3TIYA 1LEWA 2W1IA 3QX2A 4G3EA 4D5HA 3A8WA 3DFCB 3R30A 3E64A 1E1VA 3QTWA 2V55A 4FKSA 3R8UA 4KUJA 4I4FA 4IW0A 3MDYA 4D1XA 3R04A 3LFCA 3BV3A 4Y72A 2P4IA 4M13A 4OTFA 2FVDA 4Y8DA 2V5QA 1DS5A 3PSBA 3F69A 4D5KA 3QQHA 4JG8A 3H9OA 4CGAA 4MXZA 3LXKA 3O51A 4PTCA 4O6LA 2HW6A 3VUTA 4FSUA 3BCEA 1CTPE 3P7BA 4JDIA 2IPXA 2GS7A 3L8PA 2W4JA 3LCOA 4U0IA 1YKRA 4K8AA 4R1YA 2J51A 2JDRA 2VTMA 4QNYA 3VN9A 2QOKA 3E8NA 2QU5A 2X6DA 2XMYA 2GNFA 3EN5A 4L3LA 3ZZWA 5I9VA 5IQEA 4NK9A 3AOXA 3OY1A 4P90A 4YSMA 3R9DA 3DNEA 2CGUA 2OF4A 3ZFMA 1GIJA 4KD1A 4H05A 4C61A 4WD5A 5HGIA 2JDOA 4GCJA 2HYYA 3I60A 4DHFA 3NZ0A 3FAAA 1OZ1A 5K0XA 4KKEA 4U79A 4CXAA 5K5NA 3EFKA 4ZSAA 3W33A 4JI9A 4PP9A 5JKGA 1LUFA 2GS2A 4H3PA 4IVDA 2EWAA 4OTWA 2R7BA 3ZBFA 3R63A 4C38A 4O7WA 2ETMA 3PLSA 1H26A 1WVXA 2EUFB 4RG0A 2C6TA 1YVJA 4BIBA 5AV0A 4X2GA 1FGKA 4AA5A 3MSSA 3P78A 3AGLA 3TXOA 2ITTA 3C13A 4I22A 4HNIA 4J7BA 3TNPC 3DKCA 3KXMA 4IX3A 3S95A 4CFVA 3OC1A 1BUHA 3F5XA 5F95A 3MGYA 5HI2A 3VBTA 3EN9A 3HV7A 2V0DA 4Y5HA 4CKJA 2FH9A 3GCQA 3OWKA 1AD5A 4IB1A 4BTMA 5KNJA 3CKXA 1KWPA 5DT3A 4XG6A 5A6NA 5JFSA 2GHLA 3UZPA 2BVAA 5IA0A 1J3HA 3OWJA 4JRNA 5DA3A 5HG7A 3EB0A 3CPBA 3UTOA 2ITYA 3FQEA 4IH8A 4IZAA 4ZSGA 4E6QA 4XNEA 3TN8A 1OKZA 3ZO3A 3TDWA 4DH8A 5CEMA 4F6WA 4S32A 4K0YA 4S2ZA 3MY5A 3OF0A 3QX4A 4IVAA 4DFLA 4QMSA 1LR4A 2YM4A 4H58A 3OBGA 4YJPA 3PIYA 2XF0A 4ARKA 4D4VA 3ORLA 4LGGA 2IG7A 3EQRA 4ID7A 4ORKA 4G6LA 4ZTNA 5LMKC 4JJRA 2XCHA 4JXFA 1KOBA 3C0GA 5HVYA 3UIXA 1U5RA 1ZYCA 2ITOA 2IVVA 2VTOA 3G51A 3MWUA 5LVPA 3GI3A 4NH1A 4R5SA 4U44A 4EONA 3I0OA 5CVFA 4B8LA 4BCGA 2BALA 4YC6A 3TZMA 4G3GA 3ZEPA 5ANIA 4AT4A 3L9LA 1K9AA 1REKA 3UOJA 1VYZA 1GZOA 5BPYA 3QQUA 2WKMA 5HESA 3F7WA 2CNVA 2UZDA 3VUHA 5EW8A 5IUIA 4JR3A 5KKRC 2J5FA 2E9VA 5EDPA 3U6HA 2WTWA 2X4FA 3AT3A 3MPMA 4EHEA 2OH0E 4X2NA 2O3PA 5F20A 5HKMA 5BYYA 5AUZA 5LQFA 3PJCA 3QYWA 3ALOA 4NZWB 3B2WA 3LW0A 4OBOA 2YCSA 1PXPA 1NA7A 3F7ZA 3O7LB 5CTPA 3FZSA 3Q53A 4PX6A 3BU6A 5HO7A 1M52A 2X6EA 3BKBA 3FKOA 4KIPA 5HNIX 5K4JA 3I5ZA 5AUXA 4CFUA 4E6CA 1APME 3R02A 4CKRA 3L8VA 3OCTA 2E9PA 1LPUA 2VWBA 3FHRA 5GZ8A 2R3IA 2PVHA 5D11A 3LFEA 3GB2A 4GS6A 5HOAA 2XA4A 4FSZA 3VS7A 2X1NA 2B9FA 4RLLA 3NYXA 4JAJA 3SDJA 4BC6A 5C8MA 3CJGA 4BDKA 5CAUA 4YZBA 2PULA 3ITZA 3QAME 5HE1A 3W2CA 3IW8A 4C62A 3HP2A 3E7VA 2OLCA 4EKLA 3IKAA 3TDVA 5A4QA 3HA8A 4XV3A 1PMEA 3HECA 5A14A 1YI3A 5AP4A 3QTSA 4GYGA 4RVTA 4FT5A 4QP3A 5EYKA 4AZVA 5JEBA 4MYGA 2OZOA 2XJ1A 2FSLX 3IQ7A 5DPVA 2J5EA 5KCVA 4XP0A 2WTJA 5G6VA 3NAXA 4UY9A 2BHHA 4O1OA 2ZM4A 3VWAA 2J90A 3H0ZA 4F0GA 1KV1A 5HU9A 4U8ZA 5H8GA 2BDFA 4A7CA 3QKLA 4FTKA 3Q4TA 4BDJA 1V1KA 2I0YA 4CG9A 3ZUVA 4O0WA 3QZFA 2UZLA 3F82A 4BFMA 4C0TA 3TTJA 3AC2A 3D15A 4YZCA 3QXPA 4Z9LA 3V8SA 4EQUA 3ATTA 1WAKA 5KZIA 4FEWA 2XCKA 4K6ZA 4IB0A 3BZ3A 5HBJA 2R3QA 4G6NA 3ACKA 4QYFA 1Z9XA 4AU8A 4FK3A 3S2PA 2AC5A 3PTGA 4IX6A 4IM3A 4EHVA 3ACJA 4O82A 4JG7A 2W9ZB 4UWBA 3R7OA 4DGLC 4EWHA 3VNTA 5IZFA 5FP6A 4O7VA 3UO4A 1Y8GA 4N0SA 4EC8A 2RG5A 3R7GA 3U55A 3QCQA 1UA2A 2EXEA 3CJFA 4J8MA 4DGNA 2Y6OA 4MWIA 4C4FA 3TL8A 3E8EA 2RIOA 4A9TA 4BICA 3AMAA 4L45A 5HD7A 1OL6A 2BRNA 1U5QA 3NMUF 4CZYB 3UE4A 3W10A 3TJDA 2CKEA 5AUVA 3TT0A 4ZLYA 2YM8A 2QLUA 4ALUA 3E7OA 4C4HA 3FMLA 2BPMA 4ZTSA 3HMIA 4AA0A 2BFYA 4RFMA 4FL2A 4LG4A 4RFYA 4FVRA 4WUAA 4RC3A 4E7WA 4DFBA 4ANBA 2YABA 4EORA 3LCKA 4L00A 2F7ZE 4EH6A 4IQ6A 3ZM9A 4YURA 5ETAA 4A4XA 3C50A 2OWBA 4AN9A 4BTFA 4CYJA 4EH8A 4FIEA 4ASZA 2JIIA 3EOCA 4EOMA 4CTBA 1ERKA 4FMQA 5CASA 4DH7A 1JSVA 3NNUA 4HPTE 1KE9A 2P2HA 3D2KA 3RAWA 4IJ9A 1GAGA 4ITHA 2XH5A 2OO8X 2IZTA 2CJMA 2ONLA 4FKQA 3PJ2A 3OY3A 4A06A 3OCBA 1CKPA 3RCDA 4D4SA 4ZIMA 4OUCA 5IA5A 3RK9A 4X6QC 4MQ1A 4P5ZA 4QP8A 3OVVA 2VRXA 4NSTA 4BWXA 1OGUA 3TUCA 5KMMA 2F57A 5AX9A 2UZEA 3RP9A 2QO2A 3F2AA 3GC9A 5J1VA 3M11A 3MY1A 4MH7A 2BZKB 2RKUA 3MV5A 4IWDA 3ZSIA 3QU0A 1GZNA 3DQWA 4E5BA 5A9UA 5KO1A 1ZOEA 4JBQA 2VWWA 2YIRA 2DUVA 4EK8A 1YXTA 2XK4A 3HV3A 3EL7A 4J98A 4C59A 2W4OA 3KF7A 3E88A 4OBQA 4KABA 1YDTE 5E1SA 3RI1A 3MIAA 4FV8A 3EN6A 3LQ8A 4P2KA 2R64A 2W1DA 3DJ6A 5ETIA 3GFWA 3DPKA 5JMSA 3F3UA 4J95A 3LJ1A 1F5QA 5AA8A 3GUBA 3BYOA 4F99A 2GTNA 4JL9A 4IHPA 2W1FA 3E93A 5I3OA 3RZFA 3TJCA 1GIHA 2Q0NA 5C1QB 4MNFA 4ANSA 2IW8A 3OTVA 2PVLA 2NO3A 3FKNA 3V5WA 4W8DA 3W2RA 3ZUUA 4J52A 2HXLA 4LQMA 3NYOA 3NUNA 4C36A 3ORTA 1XH9A 5C8KA 1JWHA 5CF8A 3UC4A 3TTIA 3GU5A 5BNJA 3KXHA 3ZCLA 5I9UA 4QD6A 2VO6A 3VBXA 3RK7A 3QZHA 4B9DA 2H8HA 5J95A 5AIKA 2R9SA 1R78A 3T8OA 5M53A 3IDPA 1YDRE 1URCA 5DH3A 4LOOA 1F3MC 4O7RA 1BMKA 5DRBA 4J96A 3FHIA 4ZSLA 2R3NA 2QVSE 4YNOA 4NKSA 5KX8A 4GKHA 2GHMA 2XNMA 2J0MB 3GP0A 4FVPA 1PMNA 3W55A 4I41A 3TUDA 2WU6A 2FUMA 1ZYLA 1REJA 2W5BA 5JRSA 1ZMUA 4O0RA 1UV5A 3LFBA 4X2FA 5J5TA 2PVFA 3CQEA 5L3AA 5A3XA 2Y4PA 5ANKA 4ACGA 3MTLA 2O65A 3BHHA 3BYVA 5BUJA 2QOLA 3PY3A 2VTIA 4L7SA 4NCTC 4CV8A 4R78A 2OJGA 4M7IA 4FEXA 4JQ7A 4W4VA 1HCKA 3GBZA 4RQVA 4FGRA 3HRFA 1FGIA 2YLEA 3NIZA 1VEBA 2DQ7X 3FPMA 3UODA 3A7IA 3CKWA 4C3PA 2R3FA 3U9CA 3DK7A 3IW7A 5IQIA 2R3LA 4RX8A 5K4IA 3C4ZA 4EH7A 3IG7A 3GC0A 4C4EA 4KKHA 4I92A 2GFCA 3PLAE 3ZC5A 1MRYA 1U59A 4DN5A 5CSVA 4R6VA 1OIRA 2GU8A 4MF1A 3QHRA 5CEQA 5CAOA 4IXPA 3QUDA 3P86A 4F0FA 2HK5A 1IR3A 3AD5A 3C7QA 4FKOA 4PWNA 2GTMA 3RNIA 2ZMCA 1A06A 4QQCA 3QCSA 5AR3A 3ORMA 3BWJA 3NEWA 3R7YA 3IONA 3C4EA 1QPDA 4FV2A 4AA4A 3PG1A 4ZLZA 5FXRA 1J7UA 4EH4A 4FTUA 3QL8A 3DBQA 3BGZA 4R1VA 2QR8A 2R3JA 5FTOA 2Z2WA 1SMHA 5EYMA 3WZDA 4DEBA 5BVFA 3LCDA 5M55A 4QMUA 2WTKC 3LFQA 3PA4A 3FKLA 2VX3A 4IWPA 4YBJA 3MFUA 2C3JA 4C2VA 4BCMA 4YMJA 5CAQA 3KREA 3QRUA 1YRPA 2XB7A 3FZ1A 2HZIA 4O0XA 3GOKA 1H24A 3KRWA 3NGAA 3GOPA 4MAOA 3WE8A 1EH4A 2A1AB 2WTDA 4F64A 2WMRA 3DJ7A 4IACA 4HYUA 3AMBA 4FZFB 4BGQA 3QQJA 3HZTA 4M12A 5A4CA 2VNYA 2X9EA 4ANMA 4DEIA 5C4KA 2CPKE 1QMZA 2YITA 4FT7A 3R21A 2HZ4A 2WIHA 4GG7A 2PVYA 4RVKA 3V04A 2OICA 4EEVA 3DDPA 3DAKA 4QQTA 2EVAA 4U81A 3UQCA 4HYHA 2V7OA 3WZUA 3CEKA 4KAOA 3ODZX 3G5DA 3CSVA 2JITA 3WZEA 5KMIA 1Q4LA 4D4RA 3V8TA 3ZDUA 5KMKA 3SGCA 4IWQA 2HW7A 3MH3A 3NX8A 4FL3A 3C4WA 5DOSA 4ZJVA 2XRUA 1FMOE 5I0BA 5HBHA 4GK4A 2JIUA 2EB2A 4XV9A 4DEEA 3GU8A 1K2PA 4WSQA 3VHEA 3NYVA 4MHAA 3C9WA 4XP2A 4YLJA 3ZXTA 5IUGA 4UMUA 2CHLA 4RWKA 4E6AA 1YDSE 3Q2MA 4MF0A 4TL0A 4O7NA 5AAFA 4EQCA 2H6DA 4YZNA 3E8CA 4IBMA 5IKWA 4EWQA 5HIDA 4L9IA 5H2UA 4CKIA 3GCUA 2UZNA 2OKRA 3F3VA 4IAAA 4L42A 1UNHA 1XH6A 3RAKA 1P14A 3UG1A 4GIHA 4EQMA 4Q9ZA 3QD4A 1OIQA 4U43A 3MH2A 3L9NA 4GG5A 4NFMA 3TV4A 1ZRZA 3AQVA 2JD5A 2WMSA 2Q83A 3BE9A 3RPVA 5LVOA 4Y73A 4M84A 4FVQA 4YHFA 3R8LA 3VS2A 1XR1A 4CLJA 5T6KA 1VR2A 4NT4A 3PY1A 4NW6A 4P4CA 1Z57A 5BVKA 3LKMA 3BELA 3Q2JA 4E73A 3DXNA 4R7IA 5H8EA 4A4LA 4BDGA 2XKEA 5JH6A 2YIXA 2XK9A 5FDPA 2RG6A 4FTJA 4WSYA 2QR7A 1GZ8A 3BHYA 1JPAA 2FYSA 3VBWA 3SAYA 2AC3A 3G15A 3PSCA 4DG3E 4BY9E 4D9UA 2VWIA 3D94A 4IVBA 3LE6A 2XKDA 4JVGA 5EDRA 4BBFA 4M68A 3I6WA 5HIEA 5AV2A 4DLIA 5CF5A 4K2RA 3IW6A 2AYPA 2R0UA 4JG6A 4CRSA 4QMLA 2VU3A 4KSPA 4TNDA 2HY0A 5A54A 3R9RA 4L6QA 5CI6A 2XS0A 3Q6UA 3O8TA 4WUNA 2C3LA 3CQWA 5E92A 1H1RA 4YUQA 3QUEA 5E8UA 5FTGA 2WQMA 4DH1A 3W8QA 1ZYDA 3WIGA 3L1SA 5TE0A 5CAPA 2OFUA 4E20A 3FDNA 3G9LX 1SVHA 2BAKA 4S34A 1X8BA 4LL0A 5M08A 1PMVA 2WAJA 3AG9A 3DLZA 3COHA 4M66A 3VF8A 5J5SA 1OM1A 4GVAA 2KULA 4U41A 4G3CA 2Q0BA 4EK5A 2B1PA 4EH5A 3P08A 4UX9A 3UP7A 4E8AA 4LFIA 3Q04A 1OIYA 4FIGA 3AC3A 4UBAA 4UALA 2IVUA 4OTQA 4UV0A 3ZLXA 3EIDA 4LI5A 4BDAA 4BZNA 3A7JA 3F88A 4YGAA 5JGBA 5CXHA 3K3IA 4TWCA 2X4ZA 2OK1A 4ALVA 2J7TA 3TNQB 1O6KA 4BTKA 3FYJX 3QGWA 4AW1A 4QMVA 3GT8A 5AP1A 3U8WA 5DR6A 5C8NA 2C1AA 5HX8A 5TR6A 3LFFA 1IRKA 3DQXA 4IE9A 5J9LA 2QKRA 3EN4A 2UVZA 4MBIA 5CSHA 3CC6A 5CNOA 5AR8A 2WZJA 4II5A 4QPSA 4G5JA 3RJCA 3LXLA 1A9UA 4U7ZA 5CX9A 3FLZA 2YWPA 2RFSA 3F2RA 3QHWA 1XHAA 4DFZE 4Y5QA 3EWHA 2ZVAA 3UBDA 2J6MA 4JIAA 5M4CA 3KXNA 1UWHA 2QG7A 2JAVA 2R3MA 3FYKX 5H8BA 2UZWE 3Q9XA 3ULIA 3UPXA 3QD2B 4UMTA 4W4WA 4NJ3A 2W1EA 5HTIA 1O6LA 4PNIA 3OXZA 4BB4A 2OXXA 1E9HA 5JFXA 1V0OA 3OS3A 3CS9A 1MQ4A 4G16A 5CVGA 5LVMA 4KRDA 4IFCA 2J9MA 5B2MA 2F4JA 2XEZA 3RWQA 4NM0A 2X0GA 3BYMA 3I79A 4CYIA 5TOZA 4WA9A 4F08A 2CLQA 2XP2A 2XM9A 1XBCA 4XUFA 2YAKA 3ZS5A 5I9WA 4A9SA 2RF9A 1PXMA 3MJ1A 3O7LD 3VF9A 5KE0A 4HVIA 4BDBA 4CV9A 4L53A 1GNGA 5M4IA 3NPCA 3G9NA 4XLIA 2B4SB 5EM6A 3UO5A 3BX5A 3HNGA 5M44A 3C4FA 2BHEA 2RSVA 4P5QA 3SD0A 3WZKA 1PXJA 2PVJA 4ZS4A 4FKJA 3GENA 4CD0A 3G0EA 3DS6A 3I6UA 2OZAB 3N9XA 3MVJA 4X3FC 3HUBA 1GIIA 2YZLA 3VBVA 4RA4A 4N4SA 1UKIA 1Q97A 3E62A 3OUNB 2HY81 4TW9A 5AP5A 3U4UA 2OIBA 2W05A 3FXXA 4JNWA 4WNKA 2VWVA 3TZ9A 5I3RA 3N4VA 3SG9A 4FUYA 5JFWA 2ZDTA 3KC3A 2WU7A 4TXCA 5HX6A 1PYEA 1NW1A 2VX1A 2IZUA 4CMUA 5E91A 3MPAA 4MEDA 3KK9A 3R28A 3Q32A 5E8XA 3TZ7A 1M7NA 2YDJA 4EI4A 1UNGA 1OKVA 3ZO1A 4H1JA 4I6BA 4AFEA 1M2PA 3UG2A 4O86A 4ZP5A 2JC6A 3A7GA 3C1XA 4S31A 4MXXA 2ZV8A 2X8IA 3LFNA 3Q60A 3ZLWA 2UVXA 3EQBA 5K9IA 4OTDA 4BDIA 2PMOX 5H9BA 3RZBA 3UQFA 4QMNA 3GQIA 4DGMA 3R7IA 2GDOA 2YCRA 1OPLA 3D5WA 4M0YA 4OR5A 4WNMA 4ZS0A 4AGCA 4CEGA 1YI4A 1JOWB 2ZV2A 4I5HA 3LMIA 4ZTLA 4KNBA 2C5OA 3O96A 3UIMA 3FXZA 2B0QA 5BYZA 3MN3A 3KVXA 3A60A 3ORZA 4RJ5A 2CNUA 3FMMA 3RALA 3MH1A 3HMMA 3KXGA 4HJOA 3BQCA 3OOMA 2E2BA 2I0HA 2FB8A 3MW1A 4DTAA 4YTCA 5J8IA 5EH0A 4RGJA 2CN8A 2ITUA 2XNOA 4TKSA 5EHLA 3DLSA 5IQAA 3DB8A 2CGWA 4E5WA 4F6UA 2SRCA 1BKXA 4MXAA 4FIFA 3DXQA 3HGKA 3F6XA 3MVHA 5L6OA 4XG3A 4MQ2A 2WTVA 1BYGA 3BI6A 4CVAA 4LOQA 5TT7A 3UIBA 2G2IA 4JS8A 4O96A 4AZWA 4X21A 5DT4A 2G2FA 3ULZA 2PUUA 2XK8A 3LM0A 4ALWA 1OUYA 3FC1X 4F1OA 2VTSA 3QF9A 3E8DA 1B38A 4D9TA 3COMA 3PVGA 3QC4A 4FR4A 4LGHA 4ZZMA 3FUPA 1P4FA 1YQJA 3H4JA 3D0EA 3NUXA 1XH4A 3AT2A 4QMTA 4I94A 4D55A 5E8ZA 5EI6A 4CQGA 1W83A 5HICA 1YWNA 4OBPA 3P4KA 3HVCA 4I5PA 4UN0C 5JQ5A 4C7TA 4O1PA 1XKKA 1OL7A 3L9MA 3I4BA 2W0JA 3DZQA 4RLKA 4FSQA 4CRLA 5AEPA 5JZNA 3FQSA 5L4QA 4TYEA 5E8TA 3PPJA 3PRFA 4AGDA 2HCKA 2PWLA 3R22A 5L2WA 3ALNA 2YIWA 5ANEA 3UYSA 5KHXA 3FY0A 4BHNA 2FSMX 4Z55A 2F9GA 3ORPA 3C5IA 3PP0A 4GIIA 3QKMA 3MA6A 4K11A 2GNLA 1UWJA 4F7JA 2C6KA 2VO3A 5DT0A 3ANRA 4E1ZA 3GU4A 4ASDA 3OUKA 3OXIA 4CT1A 2QOQA 4FOBA 5C27A 4HVDA 5HVJA 2QU6A 5EFQA 2J0JA 4E26A 2VTLA 3R8VA 1YW2A 5EW9A 4FSTA 3V51A 4ZJJA 3SXSA 5IG1A 1PJKA 3LQ3A 3Q96A 5GJGA 4DGOA 2BIYA 2VN9A 2ITXA 1XO2B 3IGOA 2HELA 4IX5A 4XH6A 3MFRA 3NR9A 5L2SA 3A4OX 3VBQA 4B4LA 3OCGA 2JDSA 1DI8A 4E4LA 2RFEA 1P4OA 2YM3A 2CSNA 3OZ6A 4C33A 5AADA 4JAIA 4ENXA 4S33A 2JDTA 4FV3A 3DOGA 3FSFA 5DEWA 4BF2A 4BDFA 4FI1A 4BCIA 3W2OA 4GK3A 4R3RA 1URWA 4O7TA 3ANQA 3I7CA 3ENHA 4O7LA 4AOJA 3CPCA 3FI8A 4PQNA 4HGEA 4GFMA 2C6OA 2YWVA 2PK9A 5IDNA 3ENMA 2PUPA 2BDWA 3BE2A 2OZAA 3PA5A 4UEUA 4XBUA 3O2MA 3KRXA 3R00A 5B7VA 3LIJA 5I9ZA 3NUAA 3NCZA 3VULA 2C4GA 4O2PA 3DCVA 4DF3A 2XVDA 2Y4IC 4O0VA 4ZSJA 5IDPA 3OG7A 4O0YA 2IJMA 3W18A 2C0IA 2CCHA 4DFNA 3R8PA 2O5KA 3SLSA 3CIKA 2DYLA 2ESMA 1JKSA 3CGOA 3MBLA 4GEOA 4WBBB 1Y57A 5FEDA 2CKOA 4M15A 3EKNA 4I0RA 5CQWA 5C01A 1VJYA 3F66A 1UU3A 5HCYA 2JKOA 2NP8A 2OU7A 3SG8A 5EK7A 2X8EA 4FX3A 4RVLA 1J1CA 3LVPA 4CMTA 3BYSA 4BKYA 3OP5A 3THBA 3SXFA 4UYAA 4XG8A 3H0YA 5HORA 1R0PA 1SYKA 2B54A 1NY3A 1M2QA 4H3BA 2AUHA 2UZUE 1H07A 3Q5ZA 4EH3A 4XG9A 5HE0A 4DE4A 4FKWA 4GK2A 5HHWA 4ZMEA 3Q4UA 4IEBA 4IC7A 5E8WA 5BUIA 2VTPA 2XK7A 3HV6A 4XOYA 4F9BA 3WARA 4O7SA 2UZVA 4QMMA 5KBQA 4XEYA 2XKCA 2JKQA 1WBPA 3V3VA 4BN1A 4QYGA 4WG5A 4XV1A 4HVSA 4JBPA 3QD0A 2F49A 4AZFA 2GS6A 5GINE 2W1CA 3DKOA 3TV7A 4B6LA 2WQNA 4BGHA 3KMUA 4O38A 1FOTA 1WBTA 2VTHA 4OT5A 3FZTA 2R3OA 4QMPA 3RINA 4GT4A 3KK8A 2X9FA 4KBAA 1UNLA 3FLWA 3FL5A 4HGSA 3C4CA 3TNHA 2JKKA 5CSPA 4O21A 4F9CA 2XJ2A 2C1BA 5ANGA 3VAPA 2PZYA 5HE3A 1TQIA 4I24A 2HOGA 2WNTA 3BBTB 4DG0E 2QODA 4KIOA 2JFMA 4A9RA 2JBPA 4FZ6A 5IU2A 3GGFA 3UP2A 4AG8A 3FZRA 4J97A 4BKJA 4FG9A 1G3NA 2W1ZA 3E5AA 4FNXA 2ZM3A 4K18A 5HTBA 3KRLA 4LV5A 4EHZA 4QMQA 2WMTA 3MH0A 3EH9A 5K3YA 4OTGA 3D14A 5EI8A 4AX8A 3PA3A 5HG8A 3DKGA 1OUKA 4RA5A 1Q41A 5GNKA 4F7LA 5AP2A 1AQ1A 2LGCA 3GFEA 4F9YA 5EKNA 4XMOA 5I4NA 4XHKB 4FIIA 4IZ5A 4IM2A 4DT8A 4QMOA 4DLJA 2E9OA 4PTEA 2I1MA 4AN2A 3DKFA 1ZOHA 5CU0A 4CFXA 1SZMA 2J0LA 3DBEA 4FICA 3F61A 4O22A 3U87A 1DI9A 4PF4A 4QO9A 2ETKA 1QCFA 4IADA 5FBOA 4ERKA 3VVHA 3FLNC 4NCTA 1PKGA 4CMOA 5D41A 4KBCA 1ZOGA 4O91A 3ZUTA 4WIHA 3ETAA 4ANLA 4E4NA 4G1WA 1PY5A 3EL8A 1BI8A 1V0PA 3NNXA 2OJ9A 3PXRA 3MB6A 5D9HA 4RIYB 4QP1A 3R1SA 5AP6A 2WMUA 4KINA 3VHKA 4FG8A 4I0TA 4C02A 3O50A 4QPAA 4O84A 2OIDA 2QOOA 5CSWA 3R8MA 3FXWA 3M1SA 4EUTA 2YLFA 2R3RA 3EZVA 4RX9A 2YJRA 4GMYA 4UXLA 3RKBA 4DEHA 2R3HA 3SKCA 5LCJA 3EKKA 4IAIA 3FZOA 4F9WA 3WF8A 2UV2A 1R3CA 4PY1A 4OTIA 2IZSA 4PNKA 4USFA 4GRBA 3Q9ZA 1YI6A 2JKMA 4XG2A 3KFAA 4NM7A 4E6DA 2C68A 2BUJA 2W17A 3PXYA 2RFDA 4LMUA 4U40A 4QT1A 1OKYA 3HV5A 4PUZA 3ZMMA 5AR5A 4F4PA 4R5YA 5CLPA 2ZMDA 1YOJA 3SRVB 3CLYA 4O0UA 3OW3A 3K5VA 2R7IA 5LCKA 4Q5HA 3QTIA 1WMKA 5CYIA 3K5UA 4BBEA 3P7AA 1BL7A 5CNNA 4LV8A 4EBVA 1YHSA 2E9NA 4K9YA 3WOWA 3PIZA 1F0QA 3CCNA 3IGGA 2GFSA 3JUHA 2QCSA 1XJDA 3PXFA 5D7VA 4L46A 2A19B 1JLUE 2E9UA 3IPHA 1BX6A 4L52A 5HLPA 3VS4A 4ACDA 2PVKA 2BRGA 2VWYA 2VTJA 1OKWA 5B2LA 4GFOA 4EUUA 2UW6A 4F65A 3ATSA 4D2WA 5HZNA 5M06A 3PYYA 2XIXA 4FA2A 2IVSA 5HNBA 4N70A 2B9IA 3ORXA 3UOKA 1TQPA 4LUEA 4XG7A 4NM3A 4WKQA 3VJNA 2EB3A 4QTAA 5BVNA 2P2IA 3R1YA 1ZLTA 4EC9A 1ZWSA 5CZHA 4BHZA 5BVDA 1CKJA 1H28A 4QP2A 5FM3A 4NL0A 2BRHA 3GC7A 5BUEA 5CS6A 3VUDA 3D7ZA 3KVWA 3UMWA 4EH9A 3PUPA 2EU9A 3ORIA 4RJ7A 2P3GX 1VYWA 4QTBA 5EHYA 3RWPA 3R2YA 3BGPA 5LWMA 2UW0A 1Z5MA 2C6IA 4QTEA 2UZTA 1G8SA 4M0ZA 4ACCA 4ZZOA 4GU6A 3FEGA 4C3RA 1QPEA 3FMKA 2W96B 5KZ0A 3U6JA 5AV3A 3CR0A 3ZFXA 2LAVA 3MY0A 4FL1A 3VJOA 4DAWA 5CEOA 3IO7A 2WOTA 3OW4A 4U42A 3A61A 3FLYA 3O71A 5BX0A 2Z7RA 5KMOA 2ONLC 3SW7A 4BI1A 1OI9A 4P7EA 2YM7A 1YXSA 4AQCA 1W7HA 4YR8A 5IPJA 5M4UA 2OH4A 3DV3A 2CN5A 3NWWA 4JLCA 4AT5A 5CXZA 3FSKA 5GHVA 5E4HA 2IW6A 3KB7A 2ETRA 3TCPA 5CU4A 1Y6BA 2G1TA 3OXTA 2UW3A 3TKIA 1KE8A 5JGAA 2B53A 4NWMA 4MKCA 4UZHA 4XV2A 3WF7A 3GNIB 4ZSEA 1JAMA 3WF6A 4FZ7A 2XM8A 3GC8A 4AAAA 1VZOA 4E4XA 5HG5A 2QQ7A 3LM5A 3V6SA 2I7QA 3E63A 3HMPA 4FT9A 3KKVA 4ZLOA 4ZTMA 2EXCX 4LGDA 3POZA 4D2VA 3PXKA 2XNPA 3QA8A 4C57A 3NNWA 3A4PA 4LRMA 5JK3A 1YOLA 4WBOA 5DI1A 3ORNA 2YAAA 4D4YA 4BCHA 1WCCA 3EJ1A 3C4XA 4PL5A 4ZOGA 1OPKA 3KCKA 1KE7A 3R6XA 1NXKA 2OGVA 3PZHA 1Q8UA 2G2HA 3PG3A 3ZU7A 3FMJA 3UDBA 1V0BA 2WMWA 4UWYA 5HTCA 5EHOA 5JQ8A 4RIYA 4CFMA 4USDA 3A2CA 4Y85A 2IW9A 1H0VA 4AWIA 2PUIA 1CSNA 2B52A 3FY2A 5BVOA 4MNEB 5IMXA 2BFXA 4ZY5A 2BZJA 4NFNA 3U6IA 4QRCA 2V62A 3PE1A 3SV0A 2VTAA 3PIXA 4B8MA 2XYUA 2PVNA 4K1BA 5CF6A 2XBJA 4I6HA 4PDSA 3OTUA 3VUIA 3VC4A 3V5QA 2FSTX 1ZARA 3JVRA 3LFSA 4ASEA 4U45A 3A62A 3P9JA 3TI1A 3FC2A 4PV0A 4G3DA 4DCEA 5I5ZA 2UZOA 2NRYA 4EK6A 5HG9A 3E3BX 4RFZA 4Y46A 3QGYA 4PMPA 3C0HA 4AF3A 4H36A 2OBJA 3ZXZA 3PJ8A 3FL4A 2V22A 2QO7A 4Q9SA 4FKIA 5CEPA 4RZWA 4LUDA 4YJNA 3IOKA 5CU3A 4D2PA 2G9XA 3SRVA 1ZMVA 1BL6A 4DGGA 5JGDA 2WD1A 3HRBA 3FZPA 2IO6A 1GZKA 4FYOA 2G15A 3QRKA 2XNBA 2BMCA 2Y6MA 4GUEA 1Q5KA 3BBWA 5LXMA 5DNRA 3L9PA 4YBKA 2C6EA 4XCUA 4ASXA 4Z7GA 2PVMA 4O27B 2GNGA 4D58A 5A4TA 4AZTA 2OXYA 3BV2A 5I9YA 1OB3A 1YXVA 2ZV9A 2H34A 2BTRA 3LMGA 3TIZA 4NM5A 4JT3A 1RE8A 4YTHA 5DVRA 4PP7A 2ITWA 4PDYA 3T9IA 3Q4ZA 2DS1A 2J4ZA 4FTQA 3MI9A 4AGUA 2YIYA 4O0TA 3FLQA 4FKVA 3DNDA 3Q52A 4IAKA 1RQQA 1OBDA 3ZEWA 2CCIA 4MD8E 4MTAA 5F4NA 3NLBA 1ZY4A 3DTCA 4LYNA 4CCBA 4FTRA 3ZTXA 2H96A 4KA3A 1TKIA 1R1WA 3GXLA 4R8QA 3HEGA 3HYHA 5KKRB 5C4LA 3I81A 3HDNA 4FSYA 3WILA 2GMXA 5CVHA 4MX9A 4DTKA 2YFXA 3KXZA 5AR4A 5K5XA 4Y83A 3CBLA 5FG8A 3JR1A 4JRVA 5J87A 1I44A 1JSUA 3BEGA 4XG4A 4LMNA 2R2PA 1OITA 4L01A 3O0GA 1XBAA 2VTRA 3TKUA 4Q2AA 5DYJA 1LP4A 3P0MA 4TWOA 5IH4A 4YJUA 2IVTA 4Z16A 2G01A 5IEYA 2GQRA 4YO4A 1CKIA 2PE0A 3D2IA 3FLSA 1WVWA 3KY2A 4GJ2A 3VS1A 3OHTA 3KMMA 2OW3A 3Q5IA 3VUMA 4IAYA 3QQFA 1Y91A 4ZK5A 5EYCA 4YP8A 2WFYA 4YLLA 5EQYA 4LM5A 1XBBA 3L8SA 2A0CX 3V5PA 2R0IA 2QOBA 4L8MA 4GSBA 3QZIA 4YC8A 5IQHA 5HIBA 5K0KA 4MBJA 3RPRA 1P2AA 3D5VA 4KIQA 5AV4A 3KCFA 3AC1A 4AOIA 2QLQA 3JY0A 4FKRA 5J79A 3OWLA 5CY3A 5I9XA 4DFUA 1Q99A 3G33A 4EOPA 3DAJA 1IAJA 4RC2A 2YM6A 4I23A 5D7AA 3HX4A 5F9EA 4GV1A 2BDJA 5TF9A 3CE3A 2B9HA 2C3IB 3EZRA 2OJIA 5IQGA 1R0EA 2PVRA 4YJRA 3ZONA 3LHJA 3MJ2A 3U9NA 2BROA 5ETCA 2C30A 2CKQA 4GUBA 4BCFA 4RIWB 3FI3A 3DT1A 5EKOA 1JKLA 3QWJA 1M17A 3KULB 3MB7A 2WQBA 4O81A 4B7TA 5AV1A 3C5UA 4RJ4A 3ZO2A 3LPBA 3QTQA 4FT3A 3FJQE 2VGOA 3W16A 2ERKA 1PMUA 2REIA 3PRIA 5DR9A 5EOBA 4FOCA 5JFVA 2PPQA 1FPUA 2CDZA 1B6CB 4X3JA 2YN8A 4ZMFA 4HZRA 5AX3A 5HO6A 4EOKA 3V01A 4F09A 4D2SA 5FM2A 5AAEA 5IH6A 2OF2A 3CXWA 3F5PA 3OEZA 4TYJA 4TT7A 2OXDA 5E8YA 5HEZA 4HVGA 5AM7A 4NEUA 3BWFA 4YJVA 2O64A 4QQ5A 1J1BA 5L8JA 4YNEA 1WBWA 3WI6A 4EBWA 5AUUA 1W84A 1IA8A 4R7HA 4AGWA 5LVNA 3DXPA 2UW8A 3HP5A 2FA2A 2PMIA 4MNEA 4PPBA 4NW5A 1SVGA 3NAYA 3V5LA 3VS3A 1FINA 3QTZA 5G1XA 4DINA 3PDTA 4IVCA 3S3IA 3R1NA 3PWDA 4XRJA 4OAVB 4D0XA 4EL9A 2R4BA 1GOLA 1Y6AA 2OFVA 3DJ5A 5FP5A 3ZSHA 2YEXA 5CSXA 2X2KA 4WO5A 4HCTA 3ROYA 2VWUA 2C6DA 4BIEA 3GQLA 2GNIA 4J1RA 3PVBA 2HZ0A 3EQFA 4ITJA 4C8BA 4D0WA 4HW7A 1CDKA 1OL1A 3NVMB 4HGTA 4J53A 4NKAA 4PL4A 1H08A 2FGIA 4TWNA 4TTHB 4YTIA 3SQQA 3TNIA 3RGFA 3I1AA 3F5GA 4UMRA 1KUTA 4FYNA 1T45A 2ITPA 2BCJA 1U4DA 3D5XA 1YXXA 4XBRA 2QNJA 4R3CA 3HL7A 5HBEA 4ANQA 4FIJA 2C5YA 3UNZA 4AZEA 4QPMA 5CT0A 2BILB 4FSNA 4Z3VA 4I20A 2J50A 3ZLSA 4YSJA 2OIQA 2ZJWA 4Y95A 1T46A 4HOKA 4XJ0A 5CQUA 3SXRA 4DITA 4CG8A 4DG2E 4IIRA 3WF9A 4KS7A 4I0SA 3NUYA 4M3QA 5J7BA 5L8LA 2ITQA 5LMKA 3D9VA 5FEQA 2R3KA 2VAGA 2WMVA 4G17A 4A9YA 2X8DA 4D1SA 1FMKA 3TUBA 3E92A 1Q3DA 1QPJA 4G2FA 5AA9A 5HVKA 3COKA 4FKUA 1W0XC 3CY3A 3JY9A 3QXOA 4FNYA 4FK6A 5C9CA 2CMWA 2R3PA 3FQHA 5LMBA 5AP0A 3UC3A 3UNJA 4NJDA 2WMQA 2YA9A 2A2AA 4DFXE 3PVWA 3Q4CA 4GVJA 3LCTA 3QQGA 3LJ2A 4C4IA 3EFLA 2PZIA 4M67A 3JPVA 2J2IB 4RWJA 5FWKK 5TO8A 3S4QA 4YZDA 5A4LA 1AGWA 3Q9YA 2CLXA 3ZYAA 3DU8A 3QRTA 2RL5A 2WELA 2WPAA 3UIUA 4ZY6A 2ITNA 4L68A 2PU8A 4GJ3A 3IS5A 5DWRA 2V7AA 3CQUA 2PL0A 3O23A 4S30A 1STCE 2WTIA 4RBLA 4TYIA 2BKKA 4G6OA 3QYZA 4JQEA 4IAZA 3N4TA 2HWOA 5DBXA 3LZBA 4I93A 2W1HA 2HIWA 5KMNA 4BI2A 3TEIA 2F7XE 3HRCA 5CALA 3BGQA 4YJSA 3NUUA 5M09A 1IEPA 1UVRA 2C6MA 3PZEA 3T9TA 5T68A 2Y9QA 1JSTA 2XIYA 4R3PA 4RQKA 4HPUE 4BGGA 2WO6A 4FC0A 3V5JA 3OWPA 3KL8A 3A7FA 4J99A 4YHJA 1XQZA 3G2FA 3EQCA 3QD3A 3B8QA 3ORKA 4TZRA 3ZHPC 4EK4A 3LAUA 4BYIA 2QOHA 5A46A 4HVHA 2QURA 4RC4A 1U54B 4EOJA 2PUNA 4BR3A 2W4KA 1M14A 4QYHA 5F94A 3OBJA 2C6LA 1Q62A 5FEEA 3HAMA 4RIWA 2X7OA 4TNBA 3RVGA 4XS2A 5ANOA 3KULA 3GVUA 4TYGA 1O9UA 2C3KA 4U9AA 3C51A 3ID6C 3R7VA 1DAYA 2VTTA 2YDIA 3KMWA 4V01A 2JFLA 4LOPA 1XH5A 2W5HA 4RT7A 3TV6A 2R5TA 3DBCA 3CD8A 4W9XA 5AMNA 1GY3A 1JVPP 3P5KA 4FTMA 2GCDA 4J8NA 4QP7A 3W1FA 4ANOA 4BCJA 1M2RA 3P7CA 3R1QA 5LVLA 4GFGA 3RHKA 4DFYA 2C5XA 3DFAA 3JYAA 1S9JA 2QHNA 3EQPA 3UPZA 4YHTA 3K2LA 4DBXA 3UMXA 1PYXA 2Z7QA 4FKGA 5GJDA 2GQSA 2UW5A 2KTYA 3ZRLA 4XLVA 3O8UA 5E9EA 1CMKE 3IK3A 4O6EA 3V6RA 3ZSGA 5M4FA 1FBNA 4RSSA 3ZM4A 4F7SA 3MIYA 3SA0A 1H25A 4EKKA 2B7AA 4BYJA 4DBNA 2BZIB 5BMSA 2ITZA 2CNQA 4AE9A 3QZGA 3IW4A 4RX7A 1ZZ2A 4BZOA 2VO7A 3HMOA 3BIZA 3F3TA 4UZDA 2GHGA 5ANDA 2GPHA 2X81A 2XIRA 3QRJA 4FG7A 4FZDB 3BLRA 4KB8A 3MS9A 4YJTA 3T3UA 1J91A 1H27A 2ZYBA 4MXOA 1PRYA 5IISA 3LLAA 3W2QA 4IX4A 2XBAA 3TG1A 2YERA 1Q3WA 2ZM1A 3B2TA 2WTKB 4WRSA 3BU3A 4U97A 5GZ9A 1XH8A 4FIHA 3SHEA 4BWPA 4M14A 4DTBA 4HGLA 4YJOA 4IM0A 4ZY4A 1W98A 2ZDUA 3HLLA 4NIFB 5DHJA 4WRGA 4HYIA 4TYHB 4D2RA 3LLTA 4QMWA 4HNFA 4E4MA 5LOHA 2XEYA 3I5NA 3DAEA 2NNWB 3COIA 3D4QA 4DYMA 4FV0A 3OCSA 4FTNA 2RFNA 2WIPA 3EFWA 4KS8A 5ANJA 1CM8A 5J1WA 3PY0A 3SX9A 3LXNA 4TWPA 5JT2A 3FMNA 3MVLA 4AW2A 1YHWA 4FTAA 4FEQA 3DZOA 3NRMA 2WQEA 4FTCA 4NTTA 4PPCA 4CTCA 2YHVA 4AS0A 5HCXA 5L8KA 5DR2A 4FNWA 4FZAB 4NYEA 2ZOQA 1Q8ZA 2F2CB 3KF4A 1PHKA 5EYDA 5FGKA 3QFVA 4BIDA 2JLDA 1IA9A 1U46A 2QO9A 4UMQA 4CQEA 4AT3A 1OIUA 1YWVA 3R73A 4WG3A 4ZTHA 3TACA 3IW5A 5E90A 4FTIA 3NS9A 4I5CA 3BEAA 4G9CA 4CFWA 4QYEA 4C58A 5IF1A 5AP3A 5EM5A 1PKDA 3OT8A 4H1MA 5CI7A 3V5TA 3AXWA 1PW2A 5HD4A 3FBVA 4FV5A 3R9OA 4KKGA 3RK5A 5EM7A 5FLFA 4ERWA 5IEVA 2WHBA 4HYSA 5DEYA 3RMFA 3KEXA 3LFAA 4G31A 1BI7A 4X2JA 4CCUA 4M69B 2IN6A 4U80A 4EJ7A 4FNZA 1H00A 2W5AA 3DK6A 3FPQA 1OBGA 5FTQA 2XIKA 3D5UA 2Z7LA 5BYLA 2BKZA 2O0UA 3NW7A 5EQEA 3PJ3A 4JBVA 4W4XA 3EYHA 3VS0A 1DAWA 3R01A 4R7BA 3A8XA 1H4LA 4IJPA 3R9NA 4PRJA 2P0CA 3SOAA 1DM2A 2XNGA 5A4EA 4I3ZA 3R7EA 3FE3A 3LJ0A 4WHZA 1JNKA 3UQGA 1ZAOA 1RJBA 2VX0A 4QMYA 4EOLA 3F2NA 5IMEA 2WB8A 2W1GA 3F5UA 3RPOA 3EHAA 3H10A 3GU7A 3IOPA 4JDHA 4DEAA 3ZDIA 4FUXA 2VUWA 5J7HA 3QBNA 4KIKB 2VWZA 3JXWA 3AD6A 5EQPA 1U54A 2YJSA 3WYXA 1Q8WA 2VNWA 2W9FB 4PTGA 3MVMA 4FKLA 5KHWA 1ZY5A 4X7QA 4ZTRA 1J7LA 3HKOA 5M07A 1OL5A 3WIKA 3P23A 2JEDA 3PWYA 3S0OA 5IQDA 1SNXA 1XH7A 5DE2A 4JDJA 4L7FA 3VUGA 2BIKB 4XX9A 3N4UA 4FT0A 3VUKA 3ZRMA 5GIPE 2VWXA 4L44A 4EZ5A 2WGJA 2XK6A 5F1ZA 1OPJA 5EW3A 5D12A 3OMVA 4ONAA 1PF8A 4V0GB 3ZLYA 3UZTA 4IANA 3A99A 2C0OA 3VRYA 2PTKA 2XZSA 5B0XA 4CZUA 4FODA 4B0GA 4D28A 3MFTA 3RTPA 4IDVA 4CNHA 5JZJA 5DRDA 4YPSA 1YOMA 3SVVA 4RRVA 1PXLA 2QOIA 2W99B 3NDMA 2OJJA 4UXQA 1H1QA 4U6RA 2C69A 5FRIA 2Z02A 4M8TA 3NVKI 2X7GA 4RWIA 4EOOA 3VQHA 3BPRA 1PXIA 3NCGA 1OVEA 2ZAZA 4WNPA 4OAUC 4U3YA 3EQDA 5AR7A 4FV7A 3ZC6A 4EOQA 4XP3A 4QTCA 4GH2A 2A4LA 3QTXA 3QRIA 2VTQA 2OJFE 5AAGA 2PHKA 2CGXA 1TVOA 3ROCA 4H3QA 5BMMA 4BCNA 2A27A 4EZ7A 2XJ0A 4ACMA 4R77A 3FMEA 5FQDC 4KBKA 4GT3A 2NPQA 3UGCA 3AT4A 5DFPA 3DA6A 4KRCA 4IMYA 4EOSA 4NIFA 3KRJA 4L43A 1MRUA 2R3GA 4TYHA 5DGZA 4IFGA 5FUTA 3EFJA 2QOFA 4RIXB 5EOLA 5AR2A 4FE2A 4YTFA 5JRQA 3HAVA 1H8FA 4U5JA 2BRBA 2GSFA 5E8VA 4C34A 5CEKA 1SNUA 3M42A 3QC9A 5E7RA 2J0IA 3QCYA 3ZFYA 2UZBA 4WNOA 1NVRA 4JDKA 2X2MA 4G34A 4TY1A 4OW8A 5LARA 2PZRA 4BCKA 4YC3A 4BVUA 5ACKA 3CP9A 4C3FA 2WMAA 3BLQA 3JVSA 4W4YA 3R9HA 4C35A 3BHTA 4V05A 4OLIA 3W8LA 3AGMA 4IWOA 4CLIA 4DH5A 2F7EE 4QP6A 5CU6A 1WZYA 2HENA 1MQBA 4K33A 3DDQA 3BHUA 3IDBA 4BDCA 5HLWA 4AXAA 5ITAA 1JQHA 2O63A 4YU2A 3NIEA 3UVPA 5D10A 3PXQA 3RHXA 2Y0AA 3D83A 1KSWA 2W06A 3E87A 4JQ8A 3TZ8A 3BU5A 4AUAA 3NYNA 3E3PA 4B99A 3FMHA 4EHGA 2JAMA 5M51A 2QHMA 1SVEA 4O7YA 4DH3A 1JBPE 2PE1A 5HU3A 1K3AA 3U54A 2P55A 2OI4X 5LMAA 4ACHA 3RNYA 4A07A 4BWKA 5HO8A 4FKPA 4DEDA 4C2WA 5AUTA 4BBMA 1E1XA 2X7FA 3EQIA 4PMSA 1UKHA 1H01A 4ZAUA 1KV2A 2WEIA 4OGRA 4FV4A 2XKFA 1UU7A 2UW9A 4X3FB 1WBVA 1QL6A 3N51A 4CFNA 1WBSA 4RX5A 5FD2A 3DBDA 1BLXA 1SM2A 4M69A 2X39A 3PXZA 4W9WA 3ET7A 2YCQA 3LOKA 5AP7A 3VS5A 5GZAA 4QNAA 2YCFA 3HA6A 3DGKA 1O6YA 5FDXA 4OT6A 4EJNA 2FO0A 4AACA 2JDVA 4MVFA 3KU2A 3ELJA 4BCQA 2WMXA 4YLKA 4N6YA 5BVEA 5IUHA 3LCSA 3IECA 3L8XA 4QOXA 3PE2A 4UB7A 3U4WA 2C0TA 4MD9E 5AUWA 5DLSA 4F70A 4F63A 3PFQA 4GU9A 4PMMA 5KMJA 4W8EA 3HMNA 2OSCA 4FTTA 3W2SA 5TKDA 5GJFA 1NVSA 3MTFA 2YACA 5IA3A 4FSWA 4AE6A 2YIQA 4AN3A 1S9IA 5HE2A 2JIVA 3QLGA 2I6LA 4KIKA 5T3QA 1J7IA 5AFVA 4TRLA 2PE2A 4I6QA 3LFDA 3JS2A 3S00A 4JBOA 4M97A 1IAHA 4O0SA 3TNWA 4N57A 3FI2A 4C37A 4FEVA 3WZJA 4RZVA 4QYYA 5HLNA 1KOAA 5L6PA 2YM5A 5ACBC 2CKPA 4A4OA 1UU9A 4A9UA 2HAKA 4RJ8A 3I0QA 4QP4A 5IA2A 2JGZA 4I6FA 1YHVA 4FTOA 3EYGA 5HCZA 3H3CA 1ATPE 1KE5A 4XRLA 2HZNA 4C4GA 3TWJA 4FSMA 3KN5A 1A48A 4YZMA 4ZJIA 3R83A 3NW5A 5FXQA 3VIDA 4FTLA 4V0GA 3VBYA 2QKWB 2BZHB 3WBLA 4DEGA 3Q3BA 4FV6A 2XRWA 5EG3A 1B39A 3BYUA 3H9RA 4LRJA 3KQ7A 3FI4A 4QMZA 2ITVA 4ZEGA 3TM0A 1ZXEA 2PMNX 5EM8A 2H9VA 3K3JA 4BCOA 1G5SA 4OTRA 3G0FA 3VQUA 1HOWA 4D2TA 4YJQA 3HV4A 2I0VA 4ITIA 5IQCA 2ZB0A 5IH5A 4QP9A 4XYFA 3MA3A 3ODYX 4RWLA 4J71A 4EYMA 1Q8TA 3BRBA
chains in the Genus database with same CATH superfamily
2IWIA 2BRMA 3WF5A 1PXNA 3V8WA 2GNJA 3ZO4A 3VS6A 1RDQE 3OEFX 4U3ZA 3BHVA 4D1ZA 4UYNA 3R2BA 5CAVA 3PFYA 3BQRA 3LMHA 2I0EA 3KXXA 5EDQA 4ENYA 5A6OA 4PDOA 4KWPA 3MYGA 4LL5A 5KBRA 5B2KA 1ND4A 4LV7A 3G6HA 4BCPA 4MWHA 4IB5A 2XUUA 3OROA 1ZMWA 3D7TB 4I4EA 4O4FA 1FVTA 5AUYA 5IQBA 5IA1A 2OG8A 3GEQA 3F3ZA 3MPTA 4RIXA 5CT7A 3AD4A 3QUPA 4NUSA 5L6WL 5M56A 4GL9A 3VRZA 3GCVA 5IQFA 3IDCA 3ZZEA 3CTJA 4DCAA 1MP8A 3QLFA 1JKTA 2QI8A 3RM6A 2NRUA 3RPYA 3ZRKA 3NW6A 4EH2A 5CENA 3B8RA 5AJQA 5L2QA 5ETFA 4GW8A 2QC6A 5CEIA 2BR1A 2VV9A 4IAFA 3NSZA 4HZSA 4MD7E 3RPSA 5LJJA 3DK3A 1KE6A 1OECA 2C47A 4RJ6A 3CTQA 2VTNA 4BTJA 4DT9A 3BLHA 3POOA 3W2PA 4AFJA 3EMGA 4BDHA 4L3JA 1MUOA 3RAHA 2XK3A 2O2UA 2QG5A 2VD5A 3DTWA 1ZZLA 3KGAA 3CD3A 3UVQA 5M57A 1QPCA 3R7UA 4CFFA 3FMDA 3F9NA 3G90X 2WOUA 2B55A 2HWPA 3DB6A 1L3RE 3QQKA 3C0IA 1WBOA 1YWRA 3OT3A 4MCVA 5AIRA 4E93A 4IC8A 4WT6A 5IA4A 5ICPA 4EYJA 2BAQA 5BQ0A 2YDKA 4PPAA 3NFFB 2J0KA 3AMYA 2VO0A 3PJ1A 5C26A 4BDDA 1R39A 3RBWA 2C5VA 3NUPA 4MK0A 3P79A 4FBXA 2ZB1A 3KN6A 4K77A 2I40A 2Y8OA 3OOGA 2C5NA 4GYIA 4JIKA 4X3FA 1W82A 5J9ZA 2BTSA 3SW4A 3HUCA 4F0IA 2PYWA 2UW7A 4YPDA 4RVMA 2YISA 5HQ0A 1WFCA 4QQJA 4APPA 4USEA 5E8SA 3VW6A 5KMLA 2Y4IB 1WVYA 3H30A 4OTHA 4XOZA 4EZ3A 2X2LA 3EQGA 3LXPA 3W0SA 1XWSA 2GNHA 3ZOSA 4EK3A 3FWQA 3QTRA 4IDTA 3Q9WA 5CZIA 3AC8A 3II5A 3RCJA 4JOAA 5E1EA 2WXVA 4TN6A 4EOIA 4DC2A 5IEXA 2PY3A 2HXQA 3AC4A 3QTUA 4BI0A 4PDPA 4F9AA 1OMWA 4I21A 4OTPA 3CGFA 1PXKA 1YXUA 3NNVA 5AWMA 1H0WA 3SOCA 3WE4A 4L3PA 4RJ3A 5JN2A 1NVQA 1RW8A 2XNEA 2GQGA 3KRRA 3UNKA 1JKKA 4RPVA 3G6GA 3UOHA 4BRXA 3AC5A 3LQ5A 2DWBA 3GCPA 4IZYA 2BAJA 4YO6A 4O7ZA 3PPKA 3VO3A 3F3WA 3ERKA 1ZYJA 4F7NA 3UYTA 2ERZE 1NT2A 3Q6WA 3K54A 5DIAA 2VGPA 1Q24A 3UOLA 5FXSA 1WBNA 2UVYA 3QCXA 4F6SA 1OL2A 4WOVA 4RMZA 4YZ9A 4MXCA 3ZBXA 5L2TA 4AW0A 1TFFA 2B9JA 5EI2A 1HCLA 2W7XA 4ZXTA 2WTCA 4IB3A 4AZSA 1TQMA 4F1TA 3PSDA 4FSRA 4CT2A 4MBLA 1FVVA 4NU1A 5DG5A 2Y7JA 4FV1A 4H39A 3UVRA 4QMXA 1Q61A 5H3QA 1H1PA 3GU6A 4UWCA 2EXMA 1MRVA 4TPTA 3S1HA 2F2UA 4ZZNA 1UU8A 1I09A 4G3FA 4F1MA 3KA0A 3T3VA 3R8ZA 4AW5A 4KSQA 3M2WA 4NTSA 4G9RA 3MESA 5J9YA 5AM6A 5KUPA 1M7QA 5BVWA 2XYNA 2IZRA 5FBNC 2QONA 2PSQA 4MXYA 2YZAA 1W2FA 3QWKA 1W8CA 4GT5A 3A7HA 4JX7A 2FSOX 2CGVA 4ZTQA 4BDEA 1Q8YA 4X0MA 1IASA 4RIOA 4PMTA 4APCA 3DY7A 3QQLA 3MFSA 4E5AX 4IZ7A 5HNGA 3U51A 4JR7A 3UJGA 3UO6A 2JBOA 4ANNA 3RM7A 4HCUA 1FVRA 3QALE 4O2ZA 4FKTA 4FV9A 1H1SA 4G5PA 4LRKA 3UZRA 4UMPA 4E3CA 3OD6X 4PL3A 2QD9A 4L67A 3H9FA 5DMZA 5GIOE 3VW8A 2VZ6A 1G8AA 3RAIA 3PPZA 2Z7SA 2PZPA 3NUSA 3D7TA 4I5MA 1L8TA 3CTHA 4Q5EA 5CWZA 3REPA 2ZV7A 5CF4A 1FQ1B 3QA0A 3SC1A 3QKKA 2WQOA 2UW4A 4HCVA 4X2KA 5L2IA 2WMBA 4JX3A 3TKHA 3EN7A 3EQHA 3I7BA 4BKZA 2UUEA 3O8PA 4BL1A 1LEZA 4I1ZA 4WG4A 3DBFA 5CU2A 4GKIA 2PMLX 2XIZA 3OFMA 3PVUA 4AP7A 4C4JA 1GJOA 1H1WA 3R71A 4BZDA 4FEUA 2QOCA 4Z7HA 4O83A 1IG1A 4V04A 3HDMA 1ZYSA 3ZH8A 2ACXA 2P33A 2Z8CA 3CY2A 2RGPA 2PZ5A 4X6RA 5D1JA 5DN3A 2XNNA 2IF8A 1P5EA 3W32A 3R0TA 3GCSA 5LWNA 3FV8A 3WYYA 1Y8YA 4N6ZA 5CANA 4CZTA 2O8YA 4QTDA 4FF8A 4AOTA 4CSVA 2WEVA 1PXOA 4FGBA 2Z60A 3PP1A 3P1AA 4DA5A 3O17A 5C03A 5JSMA 3TIYA 1LEWA 2W1IA 3QX2A 4G3EA 4D5HA 3A8WA 3DFCB 3R30A 3E64A 1E1VA 3QTWA 2V55A 4FKSA 3R8UA 4KUJA 4I4FA 4IW0A 3MDYA 4D1XA 3R04A 3LFCA 3BV3A 4Y72A 2P4IA 4M13A 4OTFA 2FVDA 4Y8DA 2V5QA 1DS5A 3PSBA 3F69A 4D5KA 2XARA 3QQHA 4JG8A 3H9OA 4CGAA 4MXZA 3LXKA 3O51A 4PTCA 4O6LA 2HW6A 3VUTA 4FSUA 3BCEA 1CTPE 3P7BA 4JDIA 2IPXA 2GS7A 3L8PA 2W4JA 3LCOA 4U0IA 1YKRA 4AXFA 4K8AA 4R1YA 2J51A 2JDRA 2VTMA 4QNYA 3VN9A 2QOKA 3E8NA 2QU5A 2X6DA 2XMYA 2GNFA 3EN5A 4L3LA 3ZZWA 5I9VA 5IQEA 4NK9A 3AOXA 3OY1A 4P90A 4YSMA 3R9DA 3DNEA 2CGUA 2OF4A 3ZFMA 1GIJA 4KD1A 4H05A 4C61A 4WD5A 5HGIA 2JDOA 4GCJA 2HYYA 3I60A 4DHFA 3NZ0A 3FAAA 1OZ1A 5K0XA 4KKEA 4U79A 4CXAA 5K5NA 3EFKA 4ZSAA 3W33A 4JI9A 4PP9A 5JKGA 1LUFA 2GS2A 4H3PA 4IVDA 2EWAA 4OTWA 2R7BA 3ZBFA 3R63A 4C38A 4O7WA 2ETMA 3PLSA 1H26A 1WVXA 2EUFB 4RG0A 2C6TA 1YVJA 4BIBA 5AV0A 4X2GA 1FGKA 4AA5A 3MSSA 3P78A 3AGLA 3TXOA 2ITTA 3C13A 4I22A 4HNIA 4J7BA 3TNPC 3DKCA 3KXMA 4IX3A 3S95A 4CFVA 3OC1A 1BUHA 3F5XA 5F95A 3MGYA 5HI2A 3VBTA 3EN9A 3HV7A 2V0DA 4Y5HA 4CKJA 2FH9A 3GCQA 3OWKA 1AD5A 4IB1A 4BTMA 5KNJA 3CKXA 1KWPA 5DT3A 4XG6A 5A6NA 5JFSA 2GHLA 3UZPA 2BVAA 5IA0A 1J3HA 3OWJA 4JRNA 5DA3A 5HG7A 3EB0A 3CPBA 3UTOA 2ITYA 3FQEA 4IH8A 4IZAA 4ZSGA 4E6QA 4XNEA 3TN8A 1OKZA 3ZO3A 3TDWA 4DH8A 5CEMA 4F6WA 4S32A 4K0YA 4S2ZA 3MY5A 3OF0A 3QX4A 4IVAA 4DFLA 4QMSA 1LR4A 2YM4A 4H58A 3OBGA 4YJPA 3PIYA 2XF0A 4ARKA 4D4VA 3ORLA 4LGGA 2IG7A 3EQRA 4ID7A 4ORKA 4G6LA 4ZTNA 5LMKC 4JJRA 2XCHA 4JXFA 1KOBA 3C0GA 5HVYA 3UIXA 4AXCA 1U5RA 1ZYCA 2ITOA 2IVVA 2VTOA 3G51A 3MWUA 5LVPA 3GI3A 4NH1A 4R5SA 4U44A 4EONA 3I0OA 5CVFA 4B8LA 4BCGA 2BALA 4YC6A 3TZMA 4G3GA 3ZEPA 5ANIA 4AT4A 3L9LA 1K9AA 1REKA 3UOJA 1VYZA 1GZOA 5BPYA 3QQUA 2WKMA 5HESA 3F7WA 2CNVA 2UZDA 3VUHA 5EW8A 5IUIA 4JR3A 5KKRC 2J5FA 2E9VA 5EDPA 3U6HA 2WTWA 2X4FA 3AT3A 3MPMA 4EHEA 2OH0E 4X2NA 2O3PA 5F20A 5HKMA 5BYYA 5AUZA 5LQFA 3PJCA 3QYWA 3ALOA 4NZWB 3B2WA 3LW0A 3AKJA 4OBOA 2YCSA 1PXPA 1NA7A 3F7ZA 3O7LB 5CTPA 3FZSA 3Q53A 4PX6A 3BU6A 5HO7A 1M52A 2X6EA 3BKBA 3FKOA 4KIPA 5HNIX 5K4JA 3I5ZA 5AUXA 4CFUA 4E6CA 1APME 3R02A 4CKRA 3L8VA 3OCTA 2E9PA 1LPUA 2VWBA 3FHRA 5GZ8A 2R3IA 2PVHA 5D11A 3LFEA 3GB2A 4GS6A 5HOAA 2XA4A 4FSZA 3VS7A 2X1NA 2B9FA 4RLLA 3NYXA 4JAJA 3SDJA 4BC6A 5C8MA 3CJGA 4BDKA 5CAUA 4YZBA 2PULA 4FJVA 3ITZA 3QAME 5HE1A 3W2CA 3IW8A 4C62A 3HP2A 3E7VA 2OLCA 2XALA 4EKLA 3IKAA 3TDVA 5A4QA 3HA8A 4XV3A 1PMEA 3HECA 5A14A 1YI3A 5AP4A 3QTSA 4DHIB 4GYGA 4RVTA 4FT5A 4QP3A 5EYKA 4AZVA 5JEBA 4DDIA 4MYGA 2OZOA 2XJ1A 2FSLX 3IQ7A 5DPVA 2J5EA 5KCVA 4XP0A 2WTJA 5G6VA 3NAXA 4UY9A 2BHHA 4O1OA 2ZM4A 3VWAA 2J90A 3H0ZA 4F0GA 1KV1A 4O4CA 5HU9A 4U8ZA 5H8GA 2BDFA 4A7CA 3QKLA 4FTKA 3Q4TA 4BDJA 1V1KA 2I0YA 4CG9A 3ZUVA 4O0WA 3QZFA 2UZLA 3F82A 4BFMA 4C0TA 3BLAA 3TTJA 3AC2A 3D15A 4YZCA 3QXPA 4Z9LA 3V8SA 4EQUA 3ATTA 1WAKA 5KZIA 4FEWA 2XCKA 4K6ZA 4IB0A 3BZ3A 5HBJA 2R3QA 4G6NA 3ML1A 3ACKA 4QYFA 1Z9XA 4AU8A 4FK3A 3S2PA 2AC5A 3PTGA 4IX6A 4IM3A 4EHVA 3ACJA 4O82A 4JG7A 2W9ZB 4UWBA 3R7OA 4DGLC 4EWHA 3VNTA 5IZFA 5FP6A 4O7VA 3UO4A 1Y8GA 4N0SA 4EC8A 2RG5A 3R7GA 3U55A 3QCQA 1UA2A 2EXEA 3CJFA 4J8MA 4DGNA 2Y6OA 4MWIA 4C4FA 3TL8A 3E8EA 2RIOA 4A9TA 4BICA 3AMAA 4L45A 5HD7A 1OL6A 2BRNA 1U5QA 3NMUF 4O4DA 4CZYB 3UE4A 3W10A 4AXEA 3TJDA 2CKEA 5AUVA 3TT0A 4ZLYA 2YM8A 2QLUA 4ALUA 3E7OA 4C4HA 3FMLA 2BPMA 4ZTSA 3HMIA 4AA0A 2BFYA 4RFMA 4FL2A 4LG4A 4RFYA 4FVRA 4WUAA 4RC3A 4E7WA 4DFBA 4ANBA 2YABA 4EORA 3LCKA 4L00A 2F7ZE 4EH6A 4IQ6A 3ZM9A 4YURA 5ETAA 4A4XA 3C50A 2OWBA 4AN9A 4BTFA 4CYJA 4EH8A 4FIEA 4ASZA 2JIIA 3EOCA 4EOMA 4CTBA 1ERKA 4FMQA 5CASA 4DH7A 1JSVA 3NNUA 4HPTE 1KE9A 2P2HA 3D2KA 3RAWA 4IJ9A 1GAGA 4ITHA 2XH5A 2OO8X 2IZTA 2CJMA 2ONLA 4FKQA 3PJ2A 3OY3A 4A06A 3OCBA 1CKPA 3RCDA 4D4SA 4ZIMA 4OUCA 5IA5A 3RK9A 4X6QC 4MQ1A 4P5ZA 4QP8A 3OVVA 2VRXA 4NSTA 4BWXA 1OGUA 3TUCA 5KMMA 2F57A 5AX9A 2UZEA 3RP9A 2QO2A 3F2AA 3GC9A 5J1VA 3M11A 3MY1A 4MH7A 2BZKB 2RKUA 3MV5A 4IWDA 3ZSIA 3QU0A 1GZNA 3DQWA 4E5BA 5A9UA 5KO1A 1ZOEA 4JBQA 2VWWA 2YIRA 2DUVA 4EK8A 1YXTA 2XK4A 3HV3A 3EL7A 4J98A 4C59A 2W4OA 3KF7A 3E88A 4OBQA 4KABA 1YDTE 5E1SA 3RI1A 3MIAA 4FV8A 3EN6A 3LQ8A 4P2KA 2R64A 2W1DA 3DJ6A 5ETIA 3GFWA 3DPKA 5JMSA 3F3UA 4J95A 3LJ1A 1F5QA 5AA8A 3GUBA 3BYOA 4F99A 2GTNA 4JL9A 4IHPA 2W1FA 3E93A 5I3OA 3RZFA 3TJCA 1GIHA 2Q0NA 5C1QB 4MNFA 4ANSA 2IW8A 3OTVA 2PVLA 2NO3A 3FKNA 3V5WA 4W8DA 3W2RA 3ZUUA 4J52A 2HXLA 4LQMA 3NYOA 3NUNA 4C36A 3ORTA 1XH9A 5C8KA 1JWHA 5CF8A 3UC4A 3TTIA 3GU5A 5BNJA 3KXHA 3ZCLA 5I9UA 4QD6A 2VO6A 3VBXA 3RK7A 3QZHA 4B9DA 2H8HA 5J95A 5AIKA 2R9SA 1R78A 3T8OA 5M53A 3IDPA 1YDRE 1URCA 5DH3A 4LOOA 1F3MC 4O7RA 1BMKA 5DRBA 4J96A 3FHIA 4ZSLA 2R3NA 2QVSE 4YNOA 4NKSA 5KX8A 4GKHA 2GHMA 2XNMA 2J0MB 3GP0A 4FVPA 1PMNA 3W55A 4I41A 3TUDA 2WU6A 2FUMA 1ZYLA 1REJA 2W5BA 5JRSA 1ZMUA 4O0RA 1UV5A 3BL9A 3LFBA 4X2FA 5J5TA 2PVFA 3CQEA 5L3AA 5A3XA 2Y4PA 5ANKA 4ACGA 3MTLA 2O65A 3BHHA 3BYVA 5BUJA 2QOLA 3PY3A 2VTIA 4L7SA 4NCTC 4CV8A 4R78A 2OJGA 4M7IA 4FEXA 4JQ7A 4W4VA 1HCKA 3GBZA 4RQVA 4FGRA 3HRFA 1FGIA 2YLEA 3NIZA 1VEBA 2DQ7X 3FPMA 3UODA 3A7IA 3CKWA 4C3PA 2R3FA 3U9CA 3TYKA 3UDZA 3DK7A 3IW7A 3AKKA 5IQIA 2R3LA 4RX8A 5K4IA 2XANA 3C4ZA 4EH7A 3IG7A 3GC0A 4C4EA 4KKHA 4I92A 2GFCA 4AXDA 3PLAE 3ZC5A 1MRYA 1U59A 4DN5A 5CSVA 4R6VA 1OIRA 2GU8A 4MF1A 3QHRA 5CEQA 5CAOA 4IXPA 3QUDA 3P86A 4F0FA 2HK5A 1IR3A 3AD5A 3C7QA 4FKOA 4PWNA 2GTMA 3RNIA 2ZMCA 1A06A 4QQCA 3QCSA 5AR3A 3ORMA 3BWJA 3NEWA 3R7YA 3IONA 3C4EA 1QPDA 4FV2A 4AA4A 3PG1A 4ZLZA 5FXRA 1J7UA 4EH4A 4FTUA 3QL8A 3DBQA 3BGZA 4R1VA 2QR8A 2R3JA 5FTOA 2Z2WA 1SMHA 5EYMA 3WZDA 4DEBA 5BVFA 3LCDA 5M55A 4QMUA 2WTKC 3LFQA 3PA4A 3FKLA 2VX3A 4IWPA 4YBJA 3MFUA 2C3JA 4C2VA 4BCMA 4YMJA 5CAQA 3KREA 3QRUA 1YRPA 2XB7A 3FZ1A 2HZIA 4O0XA 3GOKA 1H24A 3KRWA 3NGAA 3GOPA 4MAOA 3WE8A 1EH4A 2A1AB 2WTDA 4F64A 2WMRA 3DJ7A 4IACA 4HYUA 3AMBA 4FZFB 4BGQA 3QQJA 3HZTA 4M12A 5A4CA 2VNYA 2X9EA 4ANMA 4DEIA 5C4KA 2CPKE 1QMZA 2YITA 4FT7A 3R21A 2HZ4A 2WIHA 4GG7A 2PVYA 4RVKA 3V04A 2OICA 4EEVA 3DDPA 3DAKA 4QQTA 2EVAA 4U81A 3UQCA 4HYHA 2V7OA 3WZUA 3CEKA 4KAOA 3ODZX 3G5DA 3CSVA 2JITA 3WZEA 5KMIA 1Q4LA 4D4RA 3V8TA 3ZDUA 5KMKA 3SGCA 4IWQA 2HW7A 3MH3A 3NX8A 4FL3A 3C4WA 5DOSA 4ZJVA 2XRUA 1FMOE 5I0BA 5HBHA 4GK4A 2JIUA 2EB2A 4XV9A 4DEEA 3GU8A 1K2PA 4WSQA 3VHEA 3NYVA 4MHAA 3C9WA 4XP2A 4YLJA 3ZXTA 5IUGA 4UMUA 2CHLA 4RWKA 4E6AA 1YDSE 3Q2MA 4MF0A 4TL0A 4O7NA 5AAFA 4EQCA 2H6DA 4YZNA 3E8CA 4IBMA 5IKWA 4EWQA 5HIDA 4L9IA 5H2UA 4CKIA 3GCUA 2UZNA 2OKRA 3F3VA 4IAAA 4L42A 1UNHA 1XH6A 3RAKA 1P14A 3UG1A 4GIHA 4EQMA 4Q9ZA 3QD4A 1OIQA 4U43A 3MH2A 3L9NA 4GG5A 4NFMA 3TV4A 1ZRZA 3AQVA 2JD5A 2WMSA 2Q83A 3BE9A 3RPVA 5LVOA 4Y73A 4M84A 4FVQA 4YHFA 3R8LA 3VS2A 1XR1A 4CLJA 5T6KA 1VR2A 4NT4A 3PY1A 4NW6A 4P4CA 1Z57A 5BVKA 3LKMA 3BELA 3Q2JA 4E73A 3DXNA 4R7IA 5H8EA 4A4LA 4BDGA 2XKEA 5JH6A 4DDGA 2YIXA 2XK9A 5FDPA 2RG6A 4FTJA 4WSYA 2QR7A 1GZ8A 3BHYA 1JPAA 2FYSA 3VBWA 3SAYA 2AC3A 3G15A 3PSCA 4DG3E 4BY9E 4D9UA 2VWIA 3D94A 4IVBA 3LE6A 2XKDA 4JVGA 5EDRA 4BBFA 4M68A 3I6WA 5HIEA 5AV2A 4DLIA 5CF5A 4K2RA 3IW6A 2AYPA 2R0UA 4JG6A 4CRSA 4QMLA 2VU3A 4KSPA 4TNDA 2HY0A 5A54A 3R9RA 4L6QA 5CI6A 2XS0A 3Q6UA 3O8TA 4WUNA 2C3LA 3CQWA 5E92A 1H1RA 4YUQA 3QUEA 5E8UA 5FTGA 2WQMA 4DH1A 3W8QA 1ZYDA 3WIGA 3L1SA 5TE0A 3VONA 5CAPA 2OFUA 4E20A 3FDNA 3G9LX 1SVHA 2BAKA 4S34A 1X8BA 4LL0A 5M08A 1PMVA 2WAJA 3AG9A 3DLZA 3COHA 4M66A 3VF8A 5J5SA 1OM1A 4GVAA 2KULA 4U41A 4G3CA 2Q0BA 4EK5A 1W2DA 2B1PA 4EH5A 3P08A 4UX9A 3UP7A 4E8AA 4LFIA 3Q04A 1OIYA 4FIGA 3AC3A 4UBAA 4UALA 2IVUA 4OTQA 4UV0A 3ZLXA 3EIDA 4LI5A 4BDAA 4BZNA 3A7JA 3F88A 4YGAA 5JGBA 5CXHA 3TMOA 3K3IA 1XMMA 4TWCA 2X4ZA 2OK1A 4ALVA 2J7TA 3TNQB 1O6KA 4BTKA 3FYJX 3QGWA 1OGYA 4AW1A 4O4EA 4QMVA 3GT8A 5AP1A 3U8WA 5DR6A 5C8NA 2C1AA 5HX8A 5TR6A 3LFFA 1IRKA 3DQXA 4IE9A 5J9LA 2QKRA 3EN4A 2UVZA 4MBIA 5CSHA 3CC6A 5CNOA 5AR8A 2WZJA 4II5A 4QPSA 4G5JA 3RJCA 3LXLA 1A9UA 4U7ZA 4F78A 5CX9A 3FLZA 2YWPA 2RFSA 3F2RA 3QHWA 1XHAA 4DFZE 4Y5QA 3EWHA 2ZVAA 3UBDA 2J6MA 4JIAA 5M4CA 3KXNA 1UWHA 2QG7A 2JAVA 2R3MA 3FYKX 5H8BA 2UZWE 3Q9XA 3ULIA 3UPXA 3QD2B 4UMTA 1G8JA 4W4WA 4NJ3A 2W1EA 5HTIA 1O6LA 4PNIA 3OXZA 4BB4A 2OXXA 1E9HA 5JFXA 1V0OA 3OS3A 1MQ4A 3CS9A 4G16A 5CVGA 5LVMA 4KRDA 4IFCA 2J9MA 5B2MA 2F4JA 2XEZA 3RWQA 4NM0A 2X0GA 3BYMA 3I79A 4CYIA 5TOZA 4WA9A 4F08A 2CLQA 2XP2A 2XM9A 1XBCA 4XUFA 2YAKA 3ZS5A 5I9WA 4A9SA 2RF9A 1PXMA 3MJ1A 3O7LD 3VF9A 5KE0A 4HVIA 4BDBA 4CV9A 4L53A 1GNGA 5M4IA 3AKLA 3NPCA 3G9NA 4XLIA 2B4SB 5EM6A 3UO5A 3BX5A 3HNGA 5M44A 3C4FA 2BHEA 2RSVA 4P5QA 3SD0A 3WZKA 1PXJA 2PVJA 4ZS4A 4FKJA 3GENA 4CD0A 3G0EA 3DS6A 3I6UA 2OZAB 3N9XA 3MVJA 4X3FC 3HUBA 1GIIA 2YZLA 3VBVA 4RA4A 4N4SA 1UKIA 1Q97A 3E62A 3OUNB 3W0QA 2HY81 4TW9A 5AP5A 3U4UA 2OIBA 2W05A 2A98A 3FXXA 4JNWA 4WNKA 2VWVA 3TZ9A 5I3RA 3N4VA 3SG9A 4FUYA 5JFWA 2ZDTA 3KC3A 2WU7A 4TXCA 5HX6A 1PYEA 1NW1A 2VX1A 2IZUA 4CMUA 5E91A 3MPAA 4MEDA 3KK9A 3R28A 3Q32A 5E8XA 3TZ7A 1M7NA 2YDJA 4EI4A 1UNGA 1OKVA 3ZO1A 4H1JA 4I6BA 4AFEA 1M2PA 3UG2A 4O86A 4ZP5A 2JC6A 3A7GA 3C1XA 4S31A 4MXXA 2ZV8A 2X8IA 3LFNA 3Q60A 3ZLWA 2UVXA 3EQBA 5K9IA 4OTDA 4BDIA 2PMOX 5H9BA 3RZBA 3UQFA 4QMNA 3GQIA 4DGMA 3R7IA 2GDOA 4LDTA 2YCRA 1OPLA 3D5WA 4M0YA 4OR5A 4WNMA 4ZS0A 4AGCA 4CEGA 1YI4A 1JOWB 2ZV2A 4I5HA 3LMIA 4ZTLA 4KNBA 2C5OA 3O96A 3UIMA 3FXZA 2B0QA 5BYZA 3MN3A 3KVXA 3A60A 3ORZA 4RJ5A 2CNUA 3FMMA 3RALA 3MH1A 3HMMA 3KXGA 4HJOA 3BQCA 3OOMA 2E2BA 2I0HA 2FB8A 3MW1A 4DTAA 4YTCA 5J8IA 5EH0A 4RGJA 2CN8A 2ITUA 2XNOA 4TKSA 5EHLA 3DLSA 5IQAA 3DB8A 2CGWA 4E5WA 4F6UA 2SRCA 1BKXA 4MXAA 4FIFA 3DXQA 3HGKA 3F6XA 3MVHA 5L6OA 4XG3A 4MQ2A 2WTVA 1BYGA 3BI6A 4CVAA 4LOQA 5TT7A 3UIBA 2G2IA 4JS8A 4O96A 4AZWA 4X21A 5DT4A 2G2FA 3ULZA 2PUUA 2XK8A 3LM0A 4ALWA 1OUYA 3FC1X 4F1OA 2VTSA 3QF9A 3E8DA 1B38A 4D9TA 3COMA 3PVGA 3QC4A 4FR4A 4LGHA 4ZZMA 3FUPA 1P4FA 1YQJA 3H4JA 3D0EA 3NUXA 1XH4A 3AT2A 4QMTA 4I94A 4D55A 5E8ZA 5EI6A 4CQGA 1W83A 5HICA 1YWNA 4OBPA 3P4KA 3HVCA 4I5PA 4UN0C 5JQ5A 4C7TA 4O1PA 1XKKA 1OL7A 3L9MA 3I4BA 2W0JA 3DZQA 4RLKA 4FSQA 4CRLA 5AEPA 5JZNA 3FQSA 5L4QA 4TYEA 5E8TA 3PPJA 3PRFA 4AGDA 2HCKA 2PWLA 3R22A 5L2WA 3ALNA 2YIWA 5ANEA 2IEWA 3UYSA 5KHXA 3FY0A 4BHNA 2FSMX 4Z55A 2F9GA 3ORPA 3C5IA 3PP0A 4GIIA 3QKMA 3MA6A 4K11A 2GNLA 1UWJA 4F7JA 2C6KA 2VO3A 5DT0A 2ZFYA 3ANRA 4E1ZA 3GU4A 4ASDA 3OUKA 3OXIA 4CT1A 2QOQA 4FOBA 5C27A 4HVDA 5HVJA 2QU6A 5EFQA 2J0JA 4E26A 2VTLA 3R8VA 1YW2A 5EW9A 4FSTA 3V51A 4ZJJA 3SXSA 5IG1A 1PJKA 3LQ3A 3Q96A 5GJGA 4DGOA 2BIYA 2VN9A 2ITXA 1XO2B 3IGOA 2HELA 4IX5A 4XH6A 1TZDA 3MFRA 3NR9A 5L2SA 3A4OX 3VBQA 4B4LA 3OCGA 2JDSA 1DI8A 4E4LA 2RFEA 1P4OA 2YM3A 2CSNA 3OZ6A 4C33A 5AADA 4JAIA 4ENXA 4S33A 2JDTA 4FV3A 3DOGA 3FSFA 5DEWA 4BF2A 4BDFA 4FI1A 4BCIA