4BC6A

Crystal structure of human serine threonine kinase-10 bound to novel bosutinib isoform 1, previously thought to be bosutinib
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
293
structure length
285
Chain Sequence
EHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
publication title Crystal Structure of Human Serine Threonine Kinase- 10 Bound to Novel Bosutinib Isoform 1, Previously Thought to be Bosutinib
rcsb
source organism Homo sapiens
total genus 78
structure length 285
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bc6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bc6A01
2UW9A 4XS2A 3R9OA 3TV4A 3LMHA 4UMRA 5AA8A 3C5IA 4BCGA 4DGNA 3R9NA 1KV1A 3EN4A 4DG0E 5KMLA 4FGRA 2BZJA 2X7OA 3BU3A 2XNBA 4XNEA 4QMVA 3R22A 2PTKA 1PRYA 3WIKA 2J5EA 3BQRA 4PNKA 3ZTXA 1R78A 3DNDA 3IW8A 4HZSA 4J97A 2PE0A 3RZFA 4E6QA 3C4EA 1R1WA 4EJNA 5KMJA 1NW1A 2XKDA 4AT3A 3OCGA 2I0YA 2JKMA 3QCYA 3GU8A 2VTQA 4KD1A 2RSVA 3CC6A 4A9RA 2WMAA 3HDMA 4FYOA 3MV5A 4Y5QA 4DT8A 2YZLA 4IE9A 4C0TA 5IUHA 3UDBA 3L9NA 3WYXA 3N4TA 2PL0A 2BAQA 2Z7QA 4MHAA 4RJ8A 3E8CA 1IAJA 4BWPA 1M7NA 3VBTA 3CJFA 2W17A 4U44A 4KBKA 3D94A 2F7XE 3EFWA 3PSDA 4YJRA 4I0SA 2QOLA 5FG8A 2QOQA 4BTJA 4HPUE 3ZEWA 4D4VA 2QOKA 4RJ6A 1YI4A 4RSSA 3O17A 3S2PA 4CKRA 3QRUA 4KIKA 3VIDA 3JYAA 4BY9E 2JBPA 5EKOA 2Y7JA 5HU3A 4N70A 3GC8A 2R3HA 4X0MA 3R7IA 4R7BA 4QP3A 1E9HA 4ITIA 4DFNA 4OBQA 4YPSA 2BALA 4B7TA 2CKPA 2YABA 3OWPA 3EL7A 2CCIA 4IBMA 5DR2A 1Q41A 4IX4A 4P4CA 4UYNA 4XG4A 5HNIX 1WVWA 4Z7HA 4WNMA 5E8XA 3MFUA 4O7TA 5G6VA 4CVAA 3A61A 2VO3A 4I3ZA 4R3PA 3C7QA 4HZRA 3BHTA 4U3YA 4M14A 3HMNA 2XJ0A 3TACA 4DITA 5AUVA 4EK4A 4HGEA 3DLZA 3VJOA 4I5PA 3TDWA 2QOFA 1LEZA 3NW5A 3SD0A 4BHZA 2PUPA 2IVUA 3O51A 3MY1A 2OF4A 4EH4A 4TYIA 3DFCB 1IAHA 2QONA 1V0PA 4ZLZA 4S31A 3SOCA 4RWJA 4UXLA 2VNWA 5M51A 3Q04A 4YHFA 2R3OA 4N6ZA 5KMMA 3DFAA 4BCMA 3FC1X 3LFNA 4JX7A 1OKZA 4Y73A 2OG8A 2J0MB 4ANBA 2C6DA 1OL6A 2WAJA 5DEYA 3VW6A 3GEQA 3PXRA 4PDYA 1JWHA 3DDQA 2QOHA 3N51A 3F5XA 3IGGA 3CP9A 2NPQA 1M52A 3OG7A 1OIRA 2IN6A 2UZLA 1CTPE 3FI4A 5AP7A 5AAGA 4G2FA 5JMSA 3HNGA 4EUUA 2YWVA 2ITYA 3PWDA 4HOKA 4C7TA 4UWBA 1M17A 4AA0A 5BMSA 3RAHA 3LE6A 3OMVA 4XUFA 3WF5A 3B2WA 5TT7A 2HZNA 4YZCA 3UOLA 4HVIA 3HGKA 1F3MC 4FZDB 3K5UA 3EH9A 4W4WA 2G2IA 4DCEA 4G6LA 4DG2E 1GZNA 4E26A 4OUCA 2PU8A 3R9DA 3KRRA 4C38A 5A46A 2HZIA 3PJ1A 3DXQA 3NUUA 5FBOA 4CT2A 4O7SA 1W83A 4LV5A 3NUYA 2YFXA 4GUBA 2R7BA 4CTCA 4ERKA 5HTCA 4CNHA 1ATPE 1G5SA 1IA9A 5CF8A 3T9IA 3Q5ZA 2ETMA 1H24A 4YUQA 3W2OA 2BMCA 2JDRA 3GCSA 3TZ8A 3MW1A 4FSUA 4KBCA 5JH6A 5DT3A 2PPQA 4QTEA 4TTHB 2FA2A 4RFZA 3W10A 3FMHA 3E3PA 3MI9A 2BDWA 2YLFA 3NW6A 3WF8A 3L8VA 4G16A 4DEAA 3PVGA 3UIMA 4I4FA 2FB8A 1BKXA 1SVGA 2ACXA 2JAVA 3IDCA 2FO0A 2VGPA 3LQ5A 1W84A 2FSTX 2J6MA 3NUPA 3RWPA 2GHGA 4M3QA 3UG2A 1BLXA 3QXPA 4W9WA 3W32A 4KSPA 3MPMA 4DH3A 5JGAA 1BI7A 1H1RA 2OJGA 3DPKA 3VBQA 1H1QA 3ALOA 4QTCA 4QPMA 4D1SA 3ORKA 5EQYA 3QCXA 4M0ZA 4DFUA 2HOGA 4FEQA 3V5TA 5F9EA 5HBHA 4FC0A 3R73A 4JR3A 2BFYA 2ITOA 5LARA 1WBTA 5I9WA 4DEEA 3U6IA 3AMYA 4XG9A 2R9SA 1NA7A 4FMQA 4JBQA 4IVBA 1YXUA 2OU7A 2XUUA 3EJ1A 4XG8A 1JNKA 2QU5A 2XBJA 3FDNA 2G9XA 4BDGA 4IVCA 3FUPA 4PL3A 4DFYA 3U6JA 5HESA 4P7EA 1YOMA 4XV3A 5EM6A 4RA4A 4U8ZA 5DT0A 4FICA 5M4CA 2XA4A 4WHZA 4E5BA 5ITAA 5J5SA 4CFVA 1XWSA 3DBFA 3C13A 5J9ZA 3ACJA 1UV5A 3L9LA 5L3AA 4R77A 2YDJA 2DUVA 4GL9A 2UW6A 3V6SA 4RZWA 5J87A 4A9TA 4YJTA 3WBLA 1J7IA 3MVJA 3EQPA 2BCJA 1VR2A 3O8UA 3MA6A 3R1NA 3DDPA 4MWHA 4NM7A 4R5YA 3KFAA 5AMNA 5H9BA 2XJ2A 2BRBA 5ANOA 3RBWA 3TZ9A 3W8LA 2UZBA 3ZFXA 3NUNA 2F7EE 4A7CA 3GU6A 2CGWA 4DEHA 2E9NA 5AP3A 5AUYA 5ICPA 3AOXA 1JKSA 2VN9A 4NFMA 2IJMA 2VZ6A 3UZRA 2X2LA 3AD6A 3BV3A 4L68A 3LCKA 3GCPA 3O8TA 4FEWA 3DV3A 3IO7A 4RA5A 4AF3A 1Q8WA 4PWNA 3I7CA 3R7OA 2JFMA 3I79A 5IMEA 3A7IA 4FEUA 4WO5A 4B4LA 3FZOA 3TG1A 3V8WA 2VWIA 3DXNA 5IA1A 3HV4A 3QUPA 4D4RA 2QG7A 3AGMA 3FMJA 4FKRA 3EKKA 4YGAA 1V1KA 4L52A 5DI1A 4FTJA 4FZFB 4OTRA 2X9FA 5IH4A 4U40A 4MK0A 2WQMA 3OD6X 3PXYA 3MY0A 5CSHA 2GS2A 3ATSA 4ZSGA 2WGJA 3FKNA 4F09A 4O0XA 5J9YA 5HO6A 3TN8A 4PL5A 3R8PA 4I21A 3KGAA 1Y8GA 3RCJA 4BCNA 4C57A 2RG6A 4EH7A 3QD2B 4FIEA 3B2TA 4M12A 5HBEA 2XKEA 2VWVA 3D7ZA 3RHXA 5DMZA 4Z55A 5IG1A 3DXPA 3MTLA 4F4PA 5E92A 3UE4A 4I93A 5IPJA 3Q52A 4IZ7A 1TQMA 3KQ7A 4GU6A 3E7VA 3K3JA 5CEIA 2GQSA 5DN3A 3LLAA 2RFNA 3CY2A 2HCKA 3VN9A 2C3IB 2XB7A 4AT5A 4E4NA 2Z60A 3MFSA 4EK6A 4FT0A 2RFDA 2WMWA 2X7GA 5F4NA 3R7VA 3UNKA 5IISA 4K2RA 4QQ5A 4CMTA 3BRBA 3VJNA 5TF9A 2JLDA 3TNIA 1WBPA 3NRMA 3UVPA 3U9CA 2ZYBA 3D15A 3ZZEA 3QZIA 2W4OA 5ANDA 4W8DA 3W1FA 3FYKX 4ACMA 4QP1A 4EQUA 5HD4A 3MBLA 3ANRA 4HGSA 2V7OA 3E63A 4S30A 4IAFA 3SW7A 4JXFA 3A8XA 2IZTA 3KVXA 2AUHA 3EWHA 3FLNC 4G6NA 2Y6OA 4GK4A 5LOHA 3OXZA 3DB8A 5GHVA 2R3RA 1K3AA 4RIWA 1H00A 5I9VA 5M4FA 2QO7A 2GTNA 3EMGA 4FZAB 4O2PA 2C6OA 5LJJA 3BLQA 4GH2A 2YM3A 5FEQA 3IW7A 4YJVA 2O64A 4FNYA 5GJFA 1P4FA 2CJMA 2X2MA 4FUYA 4O38A 4BC6A 4B8LA 3EN6A 2WMTA 3D5XA 1BMKA 3RALA 2EUFB 2XNEA 5E8UA 4EHZA 4ZZNA 3ZFYA 3UOHA 2NRYA 4K11A 2QHMA 2YM8A 3UPXA 4D2VA 2X8DA 2X6EA 3F3ZA 2JIVA 4CLJA 4H39A 4CV9A 3Q96A 1WVYA 3I0OA 5LCJA 3K2LA 4IAIA 4Y83A 3P9JA 4F0IA 2QC6A 1M2PA 2YIWA 3R1SA 4CMUA 5I3RA 5E1SA 3V3VA 4ALVA 3DTCA 3PA3A 2BUJA 3F66A 2XRUA 3QTUA 3QX2A 3EQDA 4QOXA 3UQCA 2WMXA 3ZM9A 2J51A 3PDTA 4FV4A 3KKVA 4S34A 4IZAA 4APCA 4E5AX 2R3FA 3MH1A 4F9CA 4O83A 5M55A 1PKGA 3ZONA 1GAGA 5A6NA 2BTSA 2ITQA 3UQGA 2I1MA 3R71A 4DGOA 3KB7A 2YIQA 3QQFA 5GZAA 5T6KA 3V51A 5IA0A 4LV8A 4V01A 4F0FA 4GKHA 2GU8A 1Z57A 3PRIA 4FG7A 4FVPA 5T68A 2VTJA 3C1XA 4G1WA 4O0UA 1OMWA 5LCKA 5HG8A 4MXCA 3D2KA 4FIFA 1YDSE 5HG5A 1H1WA 3RP9A 3R28A 3FY0A 1OIUA 5TE0A 3EN7A 4QD6A 3MVMA 2VO6A 2E9PA 3OROA 4OBOA 5EG3A 3R8VA 2XCHA 4TYHA 4MNEA 4ZTLA 3WZKA 1G8SA 2OJFE 4RIYA 4GSBA 1YOJA 5M08A 2UV2A 4E5WA 4X21A 3ORIA 5IDPA 3L9PA 3ZO2A 1JAMA 4O6LA 4TXCA 4D2WA 2ITNA 1XH7A 3PP0A 3PXKA 4PTEA 5EK7A 3WYYA 3ZSHA 1H1PA 2WMRA 2X6DA 3LCOA 4BN1A 5EDRA 5DFPA 1CKPA 4I6QA 4IX5A 4EOMA 1BL6A 3F61A 3IOPA 5K0XA 4DF3A 1WBNA 5EDQA 3V5QA 4ANLA 4IB5A 5L2TA 4AX8A 2B0QA 3C4ZA 4RFMA 3ZU7A 4CD0A 5CENA 3EKNA 4UYAA 3LFAA 5ANKA 4F0GA 5L2SA 3P5KA 3MIAA 4AT4A 2R3IA 2ITXA 1B39A 3DT1A 2I7QA 4ZIMA 5M56A 4I6HA 3NWWA 5L4QA 4C3FA 4QQTA 2EXEA 2ITPA 2CNUA 3FQSA 4A9YA 4EK8A 2WTIA 4D55A 2JGZA 3VO3A 3LMIA 3E87A 5CF6A 3PJCA 4IM3A 4H1MA 1RW8A 3IONA 4BDIA 4BBMA 5M4IA 4RVMA 3F5PA 3VBYA 4WNKA 4FKOA 3RJCA 1M14A 1PXKA 4GT5A 4YTIA 3VBWA 2QLQA 5IMXA 3ATTA 4DH7A 4DINA 3PG1A 4V0GB 1CSNA 1Q3WA 2QKWB 5BUIA 1WBSA 4L46A 5IA5A 4BCJA 1XH6A 3FSKA 2CLQA 2ZMCA 2XK3A 3VS1A 4YJOA 3TCPA 4V05A 3MESA 2YZAA 2IW6A 3HMPA 4D4YA 4CZTA 3QCSA 2F9GA 4QTAA 3NIEA 5C8NA 3G9NA 3VWAA 3QTSA 2PVYA 4PNIA 1IR3A 5CT7A 3UC3A 2GQRA 4LL5A 5HQ0A 3R83A 1HOWA 4K18A 4C4JA 5BX0A 4BBEA 2SRCA 3SXSA 4C2WA 2OFVA 5ACBC 3HAVA 4PPCA 5I4NA 4J98A 2XJ1A 3NCZA 4AZVA 5JZNA 4DGGA 4G17A 4RX7A 2ZB1A 4JDJA 3TV6A 3E62A 4MBLA 3ULZA 3H3CA 2HZ4A 4AZTA 2DYLA 3FZRA 3EQCA 2YWPA 4J8MA 4U97A 4CFNA 2C6TA 3S95A 5LMKC 1OIYA 4IHPA 2I0EA 4CYIA 1FPUA 2BPMA 1M2QA 4I5MA 2R0IA 4IAAA 2WMQA 3UO4A 4DEDA 3TUBA 4EJ7A 3H10A 4K6ZA 4Z3VA 3WZJA 5D41A 3P78A 4RIXA 1VYZA 2Y8OA 3UOKA 4BIEA 5HX6A 4M66A 1ZY5A 4FNZA 4MKCA 3W2RA 3WIGA 3CIKA 2QOIA 3NMUF 4QMUA 3RCDA 3TJDA 1KE7A 4DN5A 3DJ6A 4D9UA 5FQDC 4RC2A 3VS3A 2Y0AA 3LJ1A 2PZYA 4HCTA 2P2HA 5KKRC 3TI1A 3ZS5A 4DHFA 3E8NA 4AACA 1FGIA 3HECA 3Q9ZA 4PMSA 1PMEA 3TUCA 3ZSGA 2I0VA 4A4LA 4PDPA 3VNTA 4P5QA 3W2CA 3ZYAA 3D7TA 3L9MA 3EZRA 4BDAA 4LM5A 1BX6A 4MVFA 2CDZA 2ZM1A 1YKRA 1CMKE 3MIYA 4QMYA 1H1SA 2B9IA 5DHJA 4ALUA 4F1MA 1YI3A 2CNQA 3DTWA 4KRCA 2CKOA 4M69A 1K9AA 4FV2A 4NWMA 5KUPA 5E8VA 3S4QA 3W18A 1OBGA 3GOPA 3MA3A 3FMNA 1P4OA 4PMTA 4CFMA 3VBVA 2OH4A 3BGZA 2CN5A 4IIRA 2A19B 1Q99A 4HVSA 3O96A 2QOCA 2PE2A 4FUXA 3TTJA 3AG9A 4F65A 3AD5A 4E8AA 4FSMA 1GIHA 1W0XC 1ZARA 4LFIA 4O0RA 2EVAA 3OBJA 3A4PA 5GJDA 1GY3A 3BU6A 2B52A 2WZJA 4GFMA 4O27B 4WSQA 4HVGA 3GXLA 4NM3A 1UKIA 1XH8A 5CQUA 3IS5A 3GCUA 2VX0A 2QLUA 4PTGA 5EI8A 4QYYA 4BTMA 2IPXA 4XG3A 4YLKA 2ONLA 3RM6A 2UZVA 3FLYA 2J0LA 4B8MA 3ZZWA 3UIUA 4D0WA 5LWNA 3WF9A 2F2CB 1XBBA 4BBFA 5KMIA 3R30A 3FHRA 5B2LA 4IFGA 1ZRZA 1WBWA 2F4JA 1XH5A 5HCYA 5LVPA 1MP8A 3E3BX 3R2BA 3IECA 5IH6A 4AW1A 4ACCA 5M07A 5CSPA 4C4IA 4ZS0A 4B6LA 4EH5A 1GZKA 4I5HA 1UWHA 2X2KA 3QYZA 4O7NA 3A7HA 3UO6A 3R21A 3R00A 4PF4A 4YO4A 3R7EA 4WBBB 5CY3A 5DIAA 4BRXA 1U54A 3L8SA 1LR4A 4XBRA 4QP4A 4RJ5A 1ZWSA 4YO6A 1JSUA 2PVHA 2EB2A 3ACKA 4EWQA 5AA9A 5BVNA 4HNIA 1ZZ2A 3QHWA 4X3FA 2YCFA 4RX9A 3ZO3A 5EW3A 3GGFA 3R1QA 3UVQA 3FQEA 2JIIA 3VC4A 3QA0A 3K5VA 3QFVA 4B99A 1J1BA 2IVSA 3LJ0A 1QPEA 3G0FA 5FP6A 3CTJA 4LRMA 3BEAA 3QD0A 3F88A 1JLUE 5CI6A 4J8NA 1VJYA 2PMNX 4DE4A 3PXQA 4MTAA 2BR1A 4JDIA 3PPKA 2NP8A 4L9IA 5CXHA 5HTIA 5K5NA 5M44A 4L01A 2JEDA 3LFBA 1ZOGA 3ZLYA 2W1DA 4NIFA 4LUEA 3OP5A 4ENXA 3LXNA 4FNWA 2W1GA 4QMPA 2W1FA 1ZMVA 4GEOA 4EOPA 3QQUA 2XK9A 3KY2A 3NNXA 1PKDA 4UX9A 3ZRMA 3LQ3A 1ZYSA 4GCJA 3HV5A 4YJNA 5D7AA 4XCUA 3KMUA 3F9NA 3PY1A 2UZTA 3O8PA 3UBDA 3HV6A 1QCFA 3OWKA 2QNJA 2ZM3A 4XLVA 2G2HA 3A60A 4IADA 4PRJA 4BKZA 4ZZMA 5GINE 2O65A 3GFEA 4G34A 3DK6A 2P2IA 3N9XA 4MD7E 5BYLA 5C4KA 3AGLA 3QKMA 4FKIA 2EXMA 3D0EA 2X39A 2LAVA 3CKWA 2YLEA 5C8KA 5KMKA 1K2PA 4C02A 4PP7A 3VQUA 4GK3A 5FBNC 4IMYA 3VUTA 3NW7A 4UZDA 5TKDA 4CCUA 4QMXA 1YXSA 3BHHA 4J1RA 2B9HA 5HI2A 4FA2A 4D28A 1A9UA 5CS6A 3NDMA 3OUKA 4YZBA 2KTYA 4QRCA 5A4EA 5TR6A 4ANOA 4E73A 2C5VA 2REIA 5JZJA 2XIKA 4XV2A 5CSWA 3KF7A 4C4GA 3IOKA 3ORLA 3OHTA 3B8RA 4G3GA 3ZLWA 5DNRA 2W0JA 5DRBA 3RAIA 5HIBA 3VS4A 4IC7A 3MSSA 4AOTA 4F1TA 4FEVA 4XP3A 5TOZA 3BELA 2C6EA 3SRVB 3JR1A 2OGVA 5EFQA 3QCQA 4LL0A 5HBJA 4K1BA 3H30A 1YQJA 1FVTA 3FE3A 3BWJA 3U4WA 4TT7A 4S33A 4ANSA 1Q5KA 1OKYA 3ORXA 4F6SA 3LCSA 3EFKA 2JITA 3R02A 4CFWA 4F9BA 2OICA 4UMPA 5AFVA 4QYGA 1AQ1A 2HW6A 2OXXA 4KIQA 5EDPA 3FXWA 4EKKA 4ERWA 2H9VA 3HRBA 3QHRA 3D83A 4G3FA 2JDOA 2W05A 4R3CA 1FQ1B 3RNIA 5KKRB 1ZAOA 4OR5A 2PULA 3BYVA 2CCHA 3AT2A 2WFYA 3EQGA 3UTOA 5FDPA 5JGBA 4YC8A 4BF2A 2ZV7A 4GK2A 4BCOA 3FZTA 3KULB 3RPOA 1YW2A 2C5YA 3GENA 2CPKE 3QQJA 2C0IA 3UMWA 2Y9QA 4RG0A 2X0GA 3OS3A 5DLSA 2EWAA 1AD5A 2GFSA 2QR8A 2IG7A 1JBPE 5DG5A 3TKHA 2RG5A 3KXXA 5KE0A 2YM6A 5AR2A 2V5QA 2XH5A 5D7VA 3V8TA 4IX3A 3POZA 5LVMA 2BRHA 2BRMA 5FM2A 4AOJA 4G5PA 2BAKA 4FE2A 3FMDA 1Q8UA 5GIOE 3VF8A 4N4SA 2Q0BA 4WKQA 4ONAA 3PJ8A 3M2WA 4FV6A 4GFGA 2CGVA 1JVPP 1OITA 4YTCA 1H01A 4WOVA 3EQRA 2BHEA 4ZOGA 5GJGA 2CGXA 4XEYA 1P14A 4L00A 2W5HA 3GBZA 2VNYA 4QMWA 4A06A 2ETRA 4OTQA 4YNOA 1BYGA 2WU6A 3QKKA 4GT4A 4TPTA 2FSMX 5HEZA 4H05A 4E20A 4F7JA 1UNGA 4RC4A 2A2AA 4JIKA 1F0QA 4F99A 5DOSA 4E6DA 2W7XA 4PQNA 5LVNA 4KWPA 1VYWA 1U5QA 2R3KA 3KRLA 1GIIA 2GNHA 2QOBA 4JG7A 5FTGA 3MH2A 5DA3A 1PHKA 3ID6C 3BIZA 3P4KA 1SM2A 4MBIA 4Y46A 3RI1A 3M1SA 5K4JA 3V04A 4EI4A 3OVVA 5K0KA 4BTFA 3NVMB 3LFEA 3NYOA 5HOAA 5FXRA 3QQLA 3QWJA 3SV0A 3S0OA 3ZXTA 3PYYA 5J7BA 1WMKA 2V7AA 2Y6MA 3EN5A 4OW8A 1UU8A 2GHMA 5CU0A 4ZTSA 4FG9A 4EEVA 2OH0E 5EW9A 1APME 2BDFA 2IZUA 4QMLA 5KNJA 2XKCA 4FKTA 1PMUA 1TKIA 1S9JA 4Q9SA 1PXPA 3PIYA 1SNXA 4CSVA 5HLNA 4BDKA 4BICA 4Q9ZA 3VS5A 3ZCLA 5JFWA 3HLLA 3NSZA 4O91A 4XRJA 4CV8A 2WD1A 4OTDA 5EYDA 1W82A 4JS8A 2JAMA 4CG9A 3COHA 4FV3A 4QNYA 3FXZA 1A48A 2W9FB 4JDHA 4L7SA 1PXJA 3PXZA 2CSNA 4C33A 1U46A 4YU2A 3BV2A 4C35A 5JFVA 3QRKA 5I5ZA 5IQDA 4USDA 4D1XA 1URWA 4J99A 2C4GA 2BRNA 2JKQA 1MUOA 3NYXA 3QRIA 2XEYA 3QXOA 2PVMA 5E8YA 3PVBA 4GV1A 5KBQA 3M11A 4TKSA 3DB6A 3O23A 3LCTA 4C58A 4HCVA 5IA4A 4H36A 4CFUA 4MQ2A 3MH0A 4G3EA 3Q5IA 2H96A 4IB1A 5FP5A 5JQ8A 3RPSA 4AA5A 2J0IA 2A0CX 3H0YA 5DWRA 4IX6A 3GFWA 5AR8A 3ZUTA 2YIYA 3R8ZA 3TL8A 2H6DA 3I0QA 5J79A 1F5QA 4AN3A 4F64A 1UU3A 5JRSA 3AC5A 3ELJA 5J5TA 4DTBA 2UVZA 1GNGA 3ZO1A 3E92A 3ZDIA 2C47A 2A27A 2B1PA 1U5RA 3F2NA 4F7SA 3QA8A 4NKAA 5GIPE 4NK9A 4JBPA 3L8XA 5KBRA 4EUTA 4JQ7A 5BVDA 4FV9A 5BNJA 3AMAA 1R3CA 1HCKA 3AXWA 4YLLA 4QP6A 3V6RA 2C1AA 5JK3A 1PXNA 5JFXA 1J3HA 3QTXA 5J8IA 4V04A 1ZOHA 4ZJJA 4AW0A 5FLFA 4BCHA 3OXTA 2IZRA 4QQCA 2B9FA 4F7LA 3PVUA 3JY0A 4C8BA 1Q4LA 4DEBA 3HL7A 4F63A 2I40A 5HVYA 3G15A 2OXDA 3CSVA 4LGHA 4CKIA 5A14A 2ZVAA 4WT6A 4AFJA 4RQVA 3QQKA 1DI8A 3QZHA 2C0TA 2HELA 5CANA 5E91A 3UQFA 2BIYA 4HYHA 4F1OA 5DR6A 2VV9A 2B4SB 4BDBA 4USEA 4ZK5A 4FTMA 4WG3A 2JKKA 5CQWA 1JOWB 2R3LA 4AE9A 3N4VA 3G0EA 4IFCA 4FTKA 1WAKA 2X81A 3VUKA 2J5FA 5ACKA 3FMEA 3MPAA 4RLKA 4AGCA 1OL1A 3HKOA 4XMOA 2P55A 4XG7A 5J95A 3UP7A 4ARKA 5CU3A 2BVAA 2WMVA 3SHEA 4AOIA 1ZMWA 5GZ8A 2OJJA 1OBDA 3Q4TA 3VUHA 1DM2A 4U43A 2BZIB 2XIYA 3FZ1A 3NGAA 3KXGA 4D4SA 3LLTA 2VO7A 5AV0A 2RIOA 4KIKB 4ENYA 3RWQA 3KMMA 4R7HA 2VWXA 5C27A 3V5LA 3QC4A 1CKIA 1UKHA 4NFNA 5AP5A 5KMOA 5M57A 2XKFA 5JEBA 3MFTA 4ZP5A 3BLHA 1O6YA 3BYUA 3IW6A 4CXAA 4EZ7A 1DAWA 1H08A 4EQMA 3L1SA 2WQEA 3PP1A 4QP7A 1TQIA 2BHHA 1DAYA 2F49A 3F3WA 3IK3A 4XX9A 1Y6BA 3UGCA 2QO9A 4IWPA 5JQ5A 1YXTA 2C69A 2UUEA 4R1YA 3C50A 4I4EA 1OB3A 2GMXA 3QF9A 4DAWA 3TKIA 2XYUA 4IWQA 1PXIA 3E64A 3FZPA 2VWUA 2C6MA 3QBNA 1ZYCA 4GVJA 3E5AA 2HIWA 4WD5A 5H3QA 5TO8A 2GSFA 1TQPA 2PSQA 3DZQA 3EL8A 3LM5A 3GCQA 4JIAA 4MYGA 4FKVA 4WUNA 3UP2A 1E1VA 4FK6A 4OBPA 2VTLA 1M2RA 4JX3A 3VUIA 3PFQA 1H0WA 5EYMA 3SDJA 1PYXA 3RZBA 3ORPA 4ASDA 4O22A 4RMZA 1AGWA 4KAOA 4N6YA 3VS2A 2QOOA 2W4KA 4IB0A 5EOLA 3EQFA 5L6OA 1NVQA 3TNWA 4O0YA 3PWYA 5LMBA 4D5HA 3R7UA 1O6LA 3GOKA 4FSQA 4FTIA 4WA9A 4C3RA 3IPHA 2CKEA 3G2FA 3D9VA 4KKHA 1JQHA 3AT4A 4FKSA 4FTTA 4U0IA 1J7UA 4UN0C 1W7HA 3CLYA 3U6HA 4GKIA 3CD3A 5E7RA 4FSTA 4CFFA 2O8YA 2GPHA 2PE1A 5E4HA 2JD5A 4M67A 4QO9A 4AXAA 4D0XA 1XJDA 5BMMA 2IW9A 2XF0A 3R8UA 2UW4A 3EFJA 4NKSA 4R78A 3OWJA 3NUSA 5AX9A 4GJ2A 3V01A 4A4XA 4QMTA 2AC3A 4LQMA 2WTKC 3U4UA 2VTAA 3K54A 3H0ZA 4ZY6A 2VTOA 4FKQA 5BYYA 3LKMA 3NUXA 4I94A 3F5GA 2IO6A 4GIHA 4IAKA 5L2QA 5AR5A 2UW3A 2YEXA 1OI9A 3CKXA 5D12A 2O5KA 4I0TA 2PMIA 2XMYA 4G5JA 4Y8DA 4MXYA 3KCFA 4NT4A 2YAKA 3G6GA 2HXLA 2WO6A 3R1YA 4ASZA 5IA2A 3DJ7A 4H3BA 4RWKA 2C0OA 4F6WA 3E8DA 3GC7A 2XRWA 3KRWA 1NT2A 3BHYA 5L6PA 3WZUA 2PUUA 5LQFA 4EORA 3TM0A 3PE1A 3SC1A 3V5PA 1H8FA 2OIDA 3P79A 2AC5A 3ERKA 3HRFA 4BIDA 4F9YA 2HXQA 2VD5A 3A7GA 3FHIA 4L3LA 4EC9A 2ITUA 3SOAA 5JKGA 1S9IA 3KK9A 5CNNA 5HIEA 4ANQA 4MX9A 3NVKI 2JIUA 3UJGA 3VS0A 4FIGA 4HGLA 2C3LA 4BYJA 4D2PA 3BCEA 1WFCA 2VO0A 2ESMA 5ETAA 3W16A 3PZEA 3PA5A 3QX4A 3VRYA 1YWNA 2WMBA 4QNAA 1OKVA 4YPDA 1CKJA 4TW9A 5FGKA 5T3QA 3DK3A 3O71A 3H9FA 4F7NA 4FTAA 4R7IA 5DGZA 3ZUUA 1FVRA 3QGWA 3ZOSA 4BDCA 3A99A 3UIBA 4QMSA 3G51A 5IDNA 3ZHPC 4TWOA 1MRVA 5HKMA 5M09A 3QAME 2HWOA 4UMTA 2XK7A 4IDVA 4LOPA 4QP9A 4RVLA 3VW8A 1O9UA 1I44A 2PY3A 4XH6A 4ASXA 2R64A 2ZM4A 1YI6A 3LVPA 3PJ3A 2G2FA 4MBJA 5KHXA 5L8LA 2R3MA 3SQQA 3HV3A 2OXYA 3DKCA 5AAFA 2DWBA 3FY2A 3SVVA 2V55A 4A9SA 3G6HA 3OY3A 4DEIA 3UNJA 2J0JA 3FPMA 5E90A 3D5WA 3EFLA 3D2IA 4A4OA 3KL8A 5C1QB 3HV7A 2GFCA 5K4IA 3Q6WA 5CU2A 3I60A 3NS9A 4LGGA 5IUGA 1YDTE 3DOGA 3TXOA 3FAAA 5AX3A 3RTPA 2VTIA 1B6CB 4HGTA 4EQCA 3NYVA 1Z5MA 3TV7A 3RK9A 3GB2A 4G3DA 2C3KA 3W2SA 3AQVA 2FGIA 5HNBA 3KN5A 3QALE 4I6FA 3ROYA 4ZJVA 3GU5A 1Y6AA 4AFEA 3F2RA 4MAOA 3QZGA 4EONA 4WG5A 4ANMA 5DEWA 1KUTA 2OK1A 2GHLA 5D9HA 5A4CA 2JDSA 4RWIA 2PVRA 4RWLA 4JDKA 3CTHA 2KULA 2W1ZA 4OTIA 4U9AA 2Z2WA 1ZZLA 3MVHA 4OTGA 5CT0A 4XYFA 3DQWA 4YC6A 5C26A 3D5VA 3DKFA 3I6WA 5L8JA 3QC9A 3UYTA 4UMUA 4E7WA 5DRDA 4QMQA 4IWOA 4E93A 3HMOA 2Y4IC 3ULIA 4EOIA 2XP2A 4YLJA 3SG8A 5HG7A 4GG5A 1PMVA 2GCDA 3LPBA 4FKLA 3A8WA 3AC1A 4MWIA 4NW6A 3WE4A 4AN9A 4ANNA 4FF8A 5F20A 2PUIA 2C68A 3OT3A 2VWZA 2W99B 5EW8A 3CGOA 3AD4A 2OZAA 3BI6A 5FD2A 1UNHA 3HP5A 4FOBA 4JQEA 4BDJA 3HUBA 1OKWA 4AZWA 4Z16A 5CXZA 4OTPA 4I41A 2H34A 4X7QA 1GIJA 4WNOA 1VZOA 2QCSA 2YHVA 5KMNA 4CT1A 4GT3A 5KZIA 3U55A 3CQEA 3DNEA 2QO2A 3OF0A 4EH6A 4NL0A 1SZMA 1WBOA 2ZV9A 4GYGA 4BWXA 1LPUA 4O81A 4CQGA 3MFRA 2R7IA 4GS6A 3UYSA 4MEDA 4ACDA 3LMGA 4CZUA 3C5UA 2LGCA 2YITA 4GYIA 3NYNA 3UNZA 5EQEA 1FGKA 3PIZA 2QKRA 3R6XA 3SW4A 2OLCA 1OPJA 2F7ZE 3G5DA 1GJOA 3FJQE 3A2CA 4U41A 3RPVA 5IQFA 4AW5A 2C30A 3R2YA 3TNHA 5CEPA 3DBEA 3FQHA 1Q8YA 3QTZA 3FYJX 5E8TA 2VUWA 5I9YA 3DKOA 3ROCA 4WRSA 5LXMA 2F57A 2WTKB 5CZHA 4DTKA 4OLIA 1IG1A 2O63A 4HPTE 4O7LA 4RIWB 1A06A 4BDEA 4PTCA 5J1VA 4ZTQA 3KREA 4O96A 2HENA 4TYJA 4M97A 4MXZA 3VS7A 5M4UA 4HNFA 4G3CA 5A54A 4E6AA 2XVDA 3Q4CA 4FTQA 1STCE 4XOYA 3P7AA 4K0YA 3T3VA 4BCKA 4O2ZA 2ZB0A 4JAJA 3TNQB 4AGUA 1XQZA 3P7BA 4AW2A 4O86A 4CMOA 1PY5A 3AC8A 3UG1A 3BYOA 1BL7A 4J96A 4UXQA 2C6LA 4QMMA 5HE2A 4EKLA 2XM9A 2ZAZA 3EYGA 4ZSLA 4Q5HA 2Z7RA 2V22A 4C4HA 1URCA 1NVSA 4FIJA 4XHKB 4IDTA 4U80A 4ZJIA 4U79A 3P86A 4YJPA 2O0UA 1H26A 2BFXA 2A4LA 5EHYA 2YN8A 3JY9A 4ZMFA 3JS2A 3REPA 3DKGA 4YZDA 2GNIA 4S2ZA 1V0OA 2VTMA 4FZ6A 4E3CA 5C4LA 4GRBA 1YRPA 1R39A 2V62A 2ITVA 3GU7A 3IW4A 3WOWA 4MCVA 2RFEA 2ONLC 3TZMA 4U5JA 1OL7A 4BCQA 3BX5A 1FOTA 3B8QA 3DJ5A 2GNJA 3DZOA 3R01A 5AUWA 4OAVB 4HYSA 4O7VA 1WZYA 1YHSA 2OO8X 2PHKA 1XBCA 4YZNA 5C9CA 5ANGA 3RNYA 2ZMDA 5CVGA 2G15A 3KEXA 2QQ7A 5JN2A 2G1TA 1WBVA 4FIIA 4MNFA 4TYHB 4MNEB 2UW0A 3ZO4A 3ZMMA 4RIYB 4CRLA 5BPYA 3A4OX 4M7IA 4IANA 5HLWA 4P90A 4BL1A 4JAIA 3QTWA 4UALA 3FBVA 2R3NA 1ZYDA 4ITJA 2WEIA 3FMLA 4TN6A 1JKKA 1MQ4A 4X3FC 1R0PA 4ORKA 3EHAA 1LUFA 4L3PA 5AWMA 2UZNA 1T46A 3BHUA 3ZLSA 4CCBA 5IQEA 3OEZA 1MRYA 4F70A 5AV2A 3PRFA 4NEUA 3EZVA 5CTPA 4DLJA 2PZRA 1R0EA 2WTWA 5FWKK 2VTSA 3U87A 2XNNA 5K3YA 3HX4A 1RDQE 3P1AA 1FBNA 3QKLA 2OWBA 3PSCA 3P0MA 4LRJA 4X2JA 5D11A 5FEEA 4XP2A 5KO1A 4JQ8A 2CLXA 5EM5A 2WU7A 2CMWA 3JVRA 3MJ1A 3OOMA 3TIZA 1KE6A 4FODA 2XEZA 5AP1A 3FSFA 3R8MA 5IQCA 3UZTA 3GNIB 2W1HA 3Q3BA 2UW7A 4TWNA 4W4VA 3DAKA 4FYNA 4CTBA 4NCTA 2X8EA 3FLWA 2QURA 3BHVA 3VS6A 1YXVA 1YDRE 2A1AB 3KXZA 4X2NA 2QI8A 4PMMA 1U4DA 3PLSA 4DH5A 2HW7A 2ERKA 2PVFA 4FKJA 4CYJA 4TNDA 3LXLA 4IB3A 1QPCA 1B38A 4W4YA 1PW2A 3SLSA 4AE6A 3T3UA 1IEPA 4FL3A 4ID7A 4EHGA 3MB6A 4YNEA 5FUTA 5AR3A 4MF1A 2P3GX 5CAOA 1RQQA 3AMBA 4YHTA 2HWPA 3GQIA 2J0KA 4H58A 3DAEA 4G9RA 5KX8A 3VUGA 1SYKA 3MWUA 3RM7A 5HX8A 4ZS4A 4L45A 3U8WA 2B7AA 3E8EA 3EQHA 2VX3A 4D2TA 3BYSA 3I5ZA 3ZH8A 2QD9A 2ETKA 3CCNA 1Y8YA 4FL1A 5AM7A 1JKTA 5C8MA 1XHAA 2F2UA 4IVAA 5IEVA 5I3OA 3ZLXA 1JSVA 4YURA 1NXKA 3F3UA 4FBXA 5A9UA 4BWKA 3MN3A 4B0GA 3CEKA 2YISA 4XRLA 2J90A 3LFDA 5ANJA 3PZHA 3R63A 2XBAA 4EOQA 2YJSA 1H27A 3A7FA 4JRNA 3UC4A 4FNXA 3OTVA 4QYHA 5HE3A 5EHLA 4AQCA 5A4QA 4ZTMA 2XK8A 3UODA 3OY1A 4IM0A 3F7WA 3SKCA 4AS0A 4RJ4A 3I81A 1XR1A 3WARA 4RIXB 2BKKA 4TRLA 3ORTA 1X8BA 3ZEPA 3KU2A 4BDDA 4YMJA 2WMUA 3QYWA 4AGDA 3QQHA 2GNGA 2YCSA 3RK5A 5EYKA 5I9UA 3ENMA 4WUAA 2RL5A 3TKUA 5F95A 2W5BA 4A07A 3CPCA 4Y95A 5ANEA 1L8TA 4YTHA 2GS7A 2OIBA 4MH7A 4OTWA 4CEGA 2WQNA 5K5XA 2X4FA 4YJQA 3NAYA 2BZHB 2NRUA 3HDNA 5HNGA 3TDVA 3CY3A 3IDPA 4IXPA 3D4QA 1FMKA 3D7TB 5HLPA 4P5ZA 5EM7A 4A9UA 1KSWA 4CQEA 1BI8A 3PPZA 4U3ZA 4RFYA 4Q5EA 4NTSA 4NU1A 4MXXA 1SVHA 2UVXA 3VHEA 3ET7A 4BTKA 1XKKA 3P08A 4IAZA 5HD7A 4EYJA 5I0BA 2FYSA 4LGDA 4M69B 5CSVA 4CZYB 2ITTA 4K8AA 1GOLA 2CGUA 1XBAA 2PVLA 4WBOA 4YR8A 2UW5A 4MD8E 3I7BA 5H8EA 5CEQA 2W4JA 5JT2A 2X1NA 3M42A 2VTNA 4RQKA 5AJQA 2PVJA 4USFA 3CE3A 2PMLX 4K77A 1W98A 3LXKA 4FTCA 3LJ2A 4IQ6A 5G1XA 4M68A 3OTUA 4LMNA 4YBJA 3F69A 1REJA 3GC0A 4Y5HA 2XYNA 3FMKA 3BKBA 3QQGA 4FOCA 4JJRA 1PJKA 4F08A 5BUEA 3UOJA 2RGPA 4D2SA 4OGRA 1NY3A 2Z7LA 4BZDA 2VU3A 3BLRA 4PV0A 3R8LA 4C61A 5L2IA 3UIXA 2WQOA 3DGKA 4O7WA 4JBOA 4XOZA 2VTPA 5IQHA 3DU8A 2PMOX 3GQLA 4CKJA 1Q62A 4NW5A 3G33A 3RINA 4EH8A 5I9ZA 2QR7A 3GT8A 1W8CA 5F94A 1YHVA 5A3XA 1Z9XA 4ITHA 3ORNA 5E9EA 4XV1A 2FUMA 3CD8A 4MQ1A 3O2MA 4IM2A 3VQHA 3DBCA 4RVKA 5CF5A 3RK7A 5HU9A 2VAGA 2X9EA 3FV8A 4RBLA 4R8QA 5AP4A 2C5XA 1OL2A 4H1JA 5EM8A 2JBOA 3W2PA 5J1WA 1U54B 3DAJA 4DYMA 3KXNA 3ZM4A 5B2KA 5CEKA 4EK5A 2GDOA 4H3QA 4Q2AA 4ZTRA 5CASA 2R4BA 3C4FA 4WG4A 3FEGA 4EOLA 4X3FB 3TNPC 3NNUA 4RGJA 3BPRA 3BQCA 3DBDA 2XNOA 2J4ZA 3QTIA 2ZV8A 4I23A 2VWBA 3KC3A 4BHNA 5IQBA 5D1JA 3FLZA 3OT8A 2W1EA 4IZYA 3EN9A 3Q4ZA 2YIRA 3WZDA 5IH5A 4GG7A 4DH1A 2GS6A 4U6RA 5DH3A 2YM7A 3OBGA 5CSXA 4UWYA 1KOAA 5IA3A 3Q2JA 2QVSE 4ZY4A 5IQGA 4NIFB 3F2AA 2HK5A 4IWDA 5ETFA 5EI2A 4JT3A 3WE8A 3HVCA 5H8BA 2CKQA 1Q8ZA 3RKBA 3CTQA 3ZFMA 4R3RA 1YWRA 2WTVA 2NO3A 4DGMA 3MYGA 4BKYA 3W8QA 5AM6A 1SNUA 2RF9A 5HE0A 4J52A 1ZMUA 3H9OA 1IA8A 4AZEA 4FTNA 2AYPA 2ZOQA 3BU5A 5ANIA 5CAUA 5FXQA 2YJRA 5LVLA 5HO8A 2BAJA 3RPYA 2OSCA 3NUAA 4IJ9A 4ZSAA 5FM3A 1WVXA 5CU4A 4C62A 3Q6UA 3LAUA 4TYEA 2YAAA 2PZPA 4JLCA 2PVNA 5KHWA 1O6KA 2JFLA 3JVSA 2ZDUA 3U54A 3IW5A 4KS8A 3E93A 4BB4A 1UVRA 4MF0A 4JG6A 5AIKA 4HVDA 2WOUA 1CDKA 4ZXTA 5BYZA 2J50A 5AIRA 4BDFA 4IVDA 2OBJA 4YC3A 2BTRA 2R0UA 3Q53A 3Q60A 4NH1A 2GTMA 2IWIA 5CU6A 3OXIA 4CLIA 4EOKA 4QMZA 1LP4A 5CAPA 4Y72A 4IH8A 3PIXA 3UO5A 4FI1A 4FKGA 4W8EA 5BVKA 2VTTA 4DC2A 4BI1A 3HUCA 4C34A 5KZ0A 4DGLC 2OJIA 2WOTA 1U59A 3KK8A 5DR9A 5CF4A 4XV9A 4E4LA 5FTQA 1DS5A 3KRJA 4KKGA 2OF2A 3VUDA 3W33A 4BDHA 1WCCA 4KA3A 4O6EA 3EQBA 3U9NA 1FINA 2GNFA 3BE2A 4KB8A 4ACGA 4NJ3A 4YJUA 1T45A 3QUDA 3QU0A 3HZTA 1ZLTA 2C6IA 4AGWA 3LFSA 3MDYA 3Q2MA 3R7YA 3BEGA 3NX8A 2C1BA 2OW3A 3P23A 3PLAE 3T8OA 3S1HA 3FWQA 3GUBA 3PA4A 4QP8A 5EOBA 5HG9A 2YM4A 4BZNA 2R3GA 3COKA 4LOOA 4EH2A 2ITWA 3SG9A 4QMOA 3BE9A 4O1OA 1QL6A 5HE1A 2QG5A 3MVLA 3S3IA 3FLQA 4GVAA 3ZBFA 4DG3E 3FLSA 2WB8A 1PXLA 1UU7A 2BILB 3LQ8A 5IKWA 3BBWA 3AC4A 4Z7GA 1ZYLA 3AC3A 4DT9A 4QPSA 2OI4X 3FL5A 3FI3A 3RGFA 3FKLA 2I6LA 3GU4A 3SX9A 4WNPA 5CEOA 3A62A 2FVDA 4YSJA 4DBXA 3HRCA 3KCKA 4V0GA 2C5OA 4K33A 3RMFA 3CBLA 3OC1A 5AUZA 5EKNA 1L3RE 3COIA 4KNBA 5CNOA 1KE9A 5EI6A 2P0CA 5J7HA 3TJCA 3MY5A 4D5KA 2PK9A 2Q0NA 5L6WL 3TTIA 4O0TA 4DCAA 1KE8A 1ZYJA 1V0BA 2PWLA 2HAKA 1PXMA 4OT6A 2QODA 3Q9YA 4GIIA 3VULA 4G6OA 5CYIA 3L8PA 5BVWA 4FGBA 2BRGA 1YVJA 2IW8A 3PVWA 4CRSA 2BIKB 3R0TA 4N0SA 5GNKA 3VUMA 4BKJA 4FT7A 1XH9A 4M13A 4FVRA 4OAUC 2YCQA 4M84A 3OOGA 3C9WA 4YP8A 2NNWB 4GFOA 4HCUA 4TWCA 3OW4A 1EH4A 2VWYA 1OVEA 4U42A 2GNLA 1MRUA 4AZSA 4E4XA 2R5TA 3KXHA 4I5CA 4TNBA 3ZXZA 4X6QC 3QL8A 4R5SA 3WZEA 5HICA 3VRZA 3R9HA 4Z9LA 3NEWA 5AUTA 3G90X 5CVFA 2BZKB 3QRTA 4PX6A 5AV3A 3PTGA 4BIBA 5A4TA 2IVVA 3LHJA 1P5EA 2O3PA 4YTFA 4MD9E 4L67A 4X2GA 1Y91A 3ZBXA 2YACA 4QQJA 3QUEA 4UZHA 4FIHA 5CALA 4EL9A 3D5UA 4ZTNA 1SMHA 5AP0A 2UVYA 3I1AA 4RZVA 2BDJA 3FZSA 4FTLA 5BVFA 5K9IA 2UZUE 4YJSA 5EHOA 2PZIA 1IASA 4NM5A 3IGOA 3KXMA 3ORZA 1G3NA 3E88A 4JRVA 4PDOA 5CX9A 3V5WA 1GZOA 3FI8A 4JOAA 4IEBA 3R9RA 5AEPA 5AAEA 4KKEA 3MS9A 1Y57A 2UW8A 4HVHA 4RC3A 1XO2B 3C0HA 5CAQA 3UMXA 5H2UA 4RJ3A 3Q9WA 3FL4A 3NNVA 4RJ7A 5LWMA 1Q61A 2UZWE 2XM8A 2YERA 4FT9A 3EOCA 3GI3A 4ZTHA 4BI0A 4AUAA 3F3TA 3ALNA 3GC9A 4U45A 4J95A 5HO7A 3RAWA 1PMNA 4XLIA 3UVRA 1E1XA 1OM1A 1OPLA 4FT3A 4X2FA 3ZUVA 1JKLA 5CI7A 4DH8A 2O2UA 5HGIA 5JRQA 4O0VA 1H4LA 3NIZA 4L3JA 2VTHA 5HZNA 4MXOA 4UWCA 3TWJA 3ZC6A 4YZ9A 3HA8A 4PL4A 4M8TA 3BZ3A 3JUHA 4FSWA 4L42A 2WEVA 4EHVA 2YDKA 4GU9A 4FTUA 2XIZA 3FPQA 2DQ7X 3VBXA 4JG8A 3C4CA 4FG8A 5DBXA 4AZFA 3G9LX 3VF9A 2HY81 5AV4A 4I24A 5M06A 3HEGA 4KIPA 4GUEA 3BGQA 2VX1A 4DFZE 3IKAA 1G8AA 4HW7A 1IRKA 2G01A 3C0IA 3K3IA 4F9WA 3AC2A 3C4XA 4FV8A 4QP2A 5E8ZA 3ITZA 3ZRKA 4D1ZA 4D58A 5J9LA 1JPAA 2IVTA 2XNMA 2VTRA 4XJ0A 1Q24A 3KN6A 2QHNA 3Q32A 4UMQA 4RIOA 1P2AA 4EZ3A 5BQ0A 2Y4PA 4CG8A 1JSTA 3OEFX 4LI5A 5EH0A 2WNTA 4U81A 5E8SA 3RAKA 3F82A 5CZIA 3VHKA 2XIRA 3QRJA 1UU9A 4FTRA 2EXCX 3GVUA 3LFFA 4I22A 2R3QA 1RJBA 2UZOA 1QPJA 4PPBA 1ZOEA 3F5UA 4RT7A 4EYMA 4KINA 4O21A 3DK7A 3C51A 4NM0A 2XNPA 4OTHA 1OIQA 2VWWA 3NNWA 2E9UA 2EB3A 4AWIA 3AT3A 4KABA 1XH4A 3D14A 4EH9A 3O7LD 3TUDA 4AG8A 3OFMA 1BUHA 4FSYA 3MGYA 3DBQA 4HYIA 2W96B 4IACA 4C37A 4XBUA 4FEXA 4UBAA 5AP6A 2WIHA 4X6RA 1CM8A 4FV1A 1UA2A 4JBVA 1OPKA 4UY9A 4EOSA 1LEWA 4EOJA 4J71A 3LM0A 5FEDA 3F6XA 3ZC5A 3F7ZA 4BYIA 5DPVA 4FV7A 4M0YA 5FXSA 5HIDA 2CHLA 4LMUA 4QT1A 4C3PA 5B0XA 5KCVA 1J7LA 4TWPA 1REKA 5DVRA 2OIQA 5EQPA 4ASEA 3PPJA 1OECA 2WHBA 2WKMA 4NJDA 4RLLA 4LG4A 4S32A 1KOBA 4RPVA 3HMIA 1UWJA 3QTRA 4WSYA 3H4JA 4L7FA 3WILA 3SGCA 2VGOA 3BBTB 1PYEA 4IW0A 2Z8CA 2E9VA 4ZSEA 3TEIA 4AA4A 4MXAA 3F3VA 3OUNB 1OUKA 2DS1A 4KS7A 1H25A 4I1ZA 5AP2A 4EK3A 2ERZE 4P2KA 5AUUA 3QLGA 4ZMEA 3R7GA 1MQBA 4EC8A 4AU8A 5IF1A 3T9TA 4O7ZA 4X2KA 2X7FA 4JNWA 3WF7A 4ZY5A 4TYGA 3BWFA 3UZPA 4FX3A 5JSMA 4OT5A 5HORA 2W5AA 2WTCA 2H8HA 1QMZA 4D2RA 4DBNA 2J7TA 2XS0A 4QPAA 2JDVA 4G9CA 2WMSA 4FR4A 3EIDA 1FMOE 2QU6A 1YWVA 4H3PA 5LVOA 4FKPA 4KRDA 5HCZA 5CEMA 2YM5A 4PPAA 2W1IA 2YIXA 1OUYA 1YOLA 3JXWA 4NZWB 3HAMA 1J91A 3ZRLA 4RX8A 4WIHA 3EYHA 3SRVA 5L2WA 3OWLA 3CXWA 4LOQA 4ACHA 1Q3DA 2RFSA 4TY1A 2W06A 4X3JA 4NTTA 4NSTA 3ETAA 4APPA 4KUJA 4XP0A 3VVHA 3SA0A 2UZEA 4BCPA 4JVGA 4IC8A 4DLIA 5LMKA 4NYEA 2W9ZB 3OCSA 2XK4A 4PP9A 5A4LA 2C3JA 1Q8TA 3HMMA 3V5JA 4JL9A 5L8KA 5BVEA 5DYJA 2WTDA 4RVTA 1KWPA 4U7ZA 1RE8A 4QYFA 3V8SA 5IQAA 5FDXA 4FSRA 4EBWA 2V0DA 3KA0A 2Q83A 4KIOA 4BCIA 5AUXA 3W55A 4AN2A 3TIYA 4TL0A 4QTBA 5CVHA 4J7BA 3SXFA 4E4MA 5IEYA 5AV1A 5E8WA 3ZDUA 3CQUA 3I4BA 3KULA 3NCGA 2Z7SA 2B54A 3THBA 2BROA 2X8IA 3GCVA 3BYMA 3O50A 5FTOA 4BVUA 2I0HA 3OW3A 5BUJA 2CNVA 4FK3A 3S00A 3CQWA 4TZRA 2B55A 4YBKA 3ODZX 3RHKA 4N57A 4DFBA 1UNLA 5A6OA 4ZLYA 1I09A 4PY1A 4XG2A 5CWZA 4YZMA 4JR7A 5E1EA 2XCKA 4WRGA 2HZ0A 4YHJA 2WIPA 2FSLX 4O7RA 3DCVA 3C4WA 3ODYX 4BR3A 3DS6A 4Y85A 2E2BA 3KMWA 1OZ1A 5B2MA 4BFMA 3HP2A 3CR0A 1FVVA 3C0GA 1OGUA 3ENHA 3SAYA 2WQBA 2WELA 3WF6A 4F9AA 1QPDA 3KRXA 3JPVA 4L6QA 3IG7A 3FI2A 4FSNA 1YHWA 1H07A 1ERKA 1VEBA 4DEGA 4ZEGA 2XNGA 5BVOA 3CPBA 4D9TA 3NZ0A 1SVEA 2ZJWA 4E6CA 3LW0A 5H8GA 3LCDA 5FRIA 1M7QA 2JKOA 2WPAA 5IU2A 2R3PA 4II5A 4R1VA 5DT4A 1H0VA 4CFXA 4W9XA 5B7VA 3DQXA 5F1ZA 3QGYA 4LRKA 5CLPA 2E9OA 3FC2A 4K9YA 2X4ZA 3ORMA 2R2PA 1OL5A 4GW8A 4DFXE 4O1PA 3NPCA 4FKWA 3POOA 3NAXA 3OZ6A 3LXPA 3Q4UA 3CGFA 3PXFA 4BI2A 4LUDA 3II5A 4O82A 1Q97A 2B53A 2GQGA 3WI6A 5HVKA 3COMA 4KSQA 4PUZA 2JC6A 4FVQA 4EWHA 2W1CA 4ZLOA 3EQIA 5IQIA 2OZOA 2OKRA 2UZDA 2ITZA 1TVOA 3MTFA 4OTFA 5IZFA 3QTQA 4QYEA 4ZZOA 2Z02A 3KVWA 4I92A 2XIXA 4FV0A 3MJ2A 4KBAA 3QZFA 4BGQA 4AAAA 4F6UA 2PUNA 1PF8A 3BGPA 3O7LB 3MB7A 4UB7A 5IUIA 3RVGA 3NR9A 4I6BA 2P4IA 3W2QA 3LFCA 4HJOA 5EYCA 5C03A 2ZDTA 2JDTA 4IAYA 4XG6A 3VAPA 3UPZA 5IEXA 4O7YA 5CAVA 5D10A 4O0WA 3LIJA 4W4XA 3QWKA 5C01A 3QD3A 4IZ5A 3I6UA 4FSZA 2XZSA 4PMPA 5I9XA 4FZ7A 4BZOA 3IQ7A 2HY0A 3TT0A 4QMNA 5AR7A 3OCBA 1H28A 1GZ8A 1KE5A 2J9MA 4I20A 4C2VA 4E1ZA 4RX5A 4O84A 4CGAA 2RKUA 2EU9A 1PXOA 2R3JA 5JFSA 3PG3A 2YA9A 5HTBA 3U51A 1YXXA 2FSOX 3LZBA 3Q9XA 5HVJA 4LYNA 4C36A 5ETCA 2XK6A 3RPRA 1ZXEA 2FH9A 3FXXA 4ZAUA 4DA5A 3MH3A 4AP7A 3FKOA 4O0SA 5LMAA 3CS9A 4L53A 1J1CA 3IDBA 4GJ3A 4DTAA 4FKUA 4BCFA 3O0GA 1NVRA 3ANQA 3HA6A 3HYHA 4C4EA 4BGGA 5JGDA 4L43A 2B9JA 4NUSA 3NLBA 3SXRA 2WTJA 2YDIA 4EHEA 4GMYA 2CN8A 3PJ2A 4ALWA 3PSBA 4FL2A 4J53A 3E7OA 3QD4A 4M15A 4HYUA 2Y4IB 2C6KA 3EB0A 4ZSJA 5M53A 3P7CA 2HYYA 4FV5A 3DY7A 1ZY4A 4NCTC 4EH3A 3DA6A 5ETIA 3TZ7A 2ZV2A 4EOOA 2PZ5A 4RRVA 4C4FA 4DFLA 2PVKA 3H9RA 4G31A 3DLSA 4BGHA 3MPTA 2OJ9A 5HCXA 4C59A 4UV0A 2BKZA 2OFUA 1HCLA 3PY3A 3QLFA 1DI9A 2WXVA 4IJPA 4EBVA 5AADA 3I5NA 2YCRA 4B9DA 3GP0A 4R6VA 4I0RA 3LOKA 1KV2A 3PE2A 4JI9A 4L44A 4L8MA 5AR4A 4PDSA 3ZSIA 2PYWA 2P33A 3KF4A 3R04A 4FT5A 4YSMA 5GZ9A 1ND4A 5HHWA 2OZAB 4EZ5A 3N4UA 4QTDA 2J2IB 2VRXA 4FTOA 3FMMA 3LFQA 3PY0A 3CJGA 2IZSA 2C5NA 3A7JA 3PUPA 3OCTA 5DE2A 4UEUA
chains in the Genus database with same CATH superfamily
2UW9A 4XS2A 3R9OA 3TV4A 3LMHA 4UMRA 5AA8A 3C5IA 4BCGA 4DGNA 3R9NA 1KV1A 3EN4A 4DG0E 5KMLA 4FGRA 2BZJA 2X7OA 3BU3A 2XNBA 4XNEA 4QMVA 3R22A 2PTKA 1PRYA 3WIKA 2J5EA 3BQRA 4PNKA 3ZTXA 1R78A 3DNDA 3IW8A 4HZSA 4J97A 2PE0A 3RZFA 4E6QA 3C4EA 1R1WA 4EJNA 5KMJA 1NW1A 2XKDA 4AXFA 4BJJB 4AT3A 3OCGA 2I0YA 2JKMA 3QCYA 3GU8A 2VTQA 4KD1A 2RSVA 3CC6A 4A9RA 2WMAA 3HDMA 4FYOA 3MV5A 4Y5QA 4DT8A 2YZLA 4IE9A 4C0TA 5IUHA 3UDBA 3L9NA 3WYXA 3N4TA 2PL0A 2BAQA 2Z7QA 4MHAA 4RJ8A 3E8CA 1IAJA 4BWPA 1M7NA 3VBTA 3CJFA 2W17A 4U44A 4KBKA 3D94A 2F7XE 4FRFA 3EFWA 3PSDA 4YJRA 4I0SA 2QOLA 5FG8A 2QOQA 4BTJA 4HPUE 3ZEWA 4D4VA 2QOKA 4RJ6A 1YI4A 4RSSA 3O17A 3S2PA 4CKRA 3QRUA 4KIKA 3VIDA 3JYAA 4BY9E 2JBPA 5EKOA 2Y7JA 5HU3A 4N70A 3GC8A 2R3HA 4X0MA 3R7IA 4R7BA 4QP3A 1E9HA 4ITIA 4DFNA 4OBQA 4YPSA 2BALA 4B7TA 2CKPA 2YABA 3OWPA 3EL7A 2CCIA 4IBMA 5DR2A 1Q41A 4IX4A 4P4CA 4UYNA 4XG4A 5HNIX 1WVWA 4Z7HA 4WNMA 5E8XA 3MFUA 4O7TA 5G6VA 4CVAA 3A61A 2VO3A 4I3ZA 4R3PA 3C7QA 4HZRA 3BHTA 4U3YA 4M14A 3HMNA 2XJ0A 3TACA 4DITA 4AQKA 5AUVA 4EK4A 4HGEA 3DLZA 3VJOA 4I5PA 4CYJA 3TDWA 2QOFA 1LEZA 3NW5A 3SD0A 4BHZA 2PUPA 2IVUA 3NFGB 3O51A 3MY1A 2OF4A 4EH4A 4TYIA 3DFCB 1IAHA 2QONA 1V0PA 4ZLZA 4S31A 3SOCA 4RWJA 4UXLA 2VNWA 5M51A 3Q04A 4YHFA 2R3OA 1TFFA 4N6ZA 5KMMA 3DFAA 4BCMA 3FC1X 3LFNA 4JX7A 1OKZA 4Y73A 2OG8A 2J0MB 4ANBA 2C6DA 1OL6A 2WAJA 5DEYA 3VW6A 3GEQA 3PXRA 4PDYA 1JWHA 3DDQA 2QOHA 3N51A 3F5XA 3IGGA 3CP9A 2NPQA 1M52A 2XANA 3OG7A 1OIRA 2IN6A 2UZLA 1CTPE 3FI4A 5AP7A 5AAGA 4G2FA 5JMSA 3AKKA 3HNGA 4EUUA 2YWVA 2ITYA 3PWDA 4HOKA 4C7TA 4UWBA 1M17A 4AA0A 5BMSA 4LDTA 3RAHA 3LE6A 3OMVA 4XUFA 3WF5A 3B2WA 5TT7A 2HZNA 4YZCA 3UOLA 4HVIA 3HGKA 1F3MC 4FZDB 3K5UA 3EH9A 4W4WA 2G2IA 4DCEA 4G6LA 4DG2E 1GZNA 4E26A 4OUCA 2PU8A 3R9DA 3KRRA 4C38A 5A46A 2HZIA 3PJ1A 3DXQA 3NUUA 5FBOA 4CT2A 4O7SA 1W83A 4LV5A 3NUYA 2YFXA 4GUBA 2R7BA 4CTCA 4ERKA 5HTCA 4CNHA 1ATPE 1G5SA 1IA9A 5CF8A 3T9IA 3Q5ZA 2ETMA 1H24A 4YUQA 3W2OA 2BMCA 2JDRA 3GCSA 3TZ8A 3P5JC 3MW1A 4FSUA 4KBCA 5JH6A 5DT3A 2PPQA 4QTEA 4TTHB 2FA2A 4RFZA 3W10A 3FMHA 3E3PA 3MI9A 2BDWA 2YLFA 3NW6A 3WF8A 3L8VA 4G16A 4DEAA 3PVGA 3UIMA 4I4FA 2FB8A 1BKXA 1SVGA 2ACXA 2JAVA 3IDCA 2FO0A 2VGPA 3LQ5A 1W84A 2FSTX 2J6MA 3NUPA 3RWPA 2GHGA 4M3QA 3UG2A 1BLXA 3QXPA 4W9WA 3W32A 4KSPA 3MPMA 4DH3A 5JGAA 1BI7A 1H1RA 2OJGA 3DPKA 3VBQA 1H1QA 3ALOA 4QTCA 4QPMA 4D1SA 3ORKA 5EQYA 3QCXA 4M0ZA 4DFUA 2HOGA 4FEQA 3V5TA 5F9EA 5HBHA 4FC0A 3R73A 4JR3A 2BFYA 2ITOA 5LARA 1WBTA 5I9WA 4DEEA 3U6IA 3AMYA 4XG9A 2R9SA 1NA7A 4FMQA 4JBQA 4IVBA 1YXUA 2OU7A 2XUUA 3EJ1A 4XG8A 1JNKA 2QU5A 2XBJA 3FDNA 2G9XA 4BDGA 4IVCA 3FUPA 4PL3A 4DFYA 3U6JA 5HESA 4P7EA 1YOMA 4XV3A 5EM6A 4RA4A 4U8ZA 5DT0A 4FICA 5M4CA 2XA4A 4WHZA 4E5BA 5ITAA 5J5SA 4CFVA 1XWSA 3DBFA 3C13A 5J9ZA 3ACJA 1UV5A 3L9LA 5L3AA 4R77A 2YDJA 2DUVA 4GL9A 2UW6A 3V6SA 4RZWA 5J87A 4A9TA 4YJTA 3WBLA 1J7IA 3MVJA 3EQPA 2BCJA 1VR2A 3O8UA 3MA6A 3R1NA 3DDPA 4MWHA 4NM7A 4R5YA 3KFAA 5AMNA 5H9BA 2XJ2A 2BRBA 5ANOA 3RBWA 3TZ9A 3W8LA 2UZBA 3ZFXA 3NUNA 2F7EE 4A7CA 3GU6A 2CGWA 4DEHA 2E9NA 5AP3A 5AUYA 5ICPA 3AOXA 1JKSA 2VN9A 4NFMA 2IJMA 2VZ6A 3UZRA 2X2LA 3AD6A 3BV3A 4L68A 3LCKA 3VONA 3GCPA 3O8TA 4FEWA 3DV3A 3IO7A 4RA5A 4AF3A 1Q8WA 4PWNA 3I7CA 3R7OA 1VLRA 2JFMA 3I79A 5IMEA 3A7IA 4FEUA 4WO5A 4B4LA 3FZOA 3TG1A 3V8WA 2VWIA 3DXNA 5IA1A 3HV4A 3QUPA 4D4RA 2QG7A 3AGMA 3FMJA 4FKRA 3EKKA 4YGAA 1V1KA 4L52A 5DI1A 4FTJA 4FZFB 4OTRA 2X9FA 5IH4A 4U40A 4MK0A 2WQMA 3OD6X 3PXYA 3MY0A 5CSHA 2GS2A 3ATSA 4ZSGA 2WGJA 3FKNA 4F09A 4O0XA 5J9YA 5HO6A 3TN8A 4PL5A 3R8PA 4I21A 3KGAA 1Y8GA 3RCJA 4BCNA 4C57A 2RG6A 4EH7A 3QD2B 1XMMA 4FIEA 3B2TA 4M12A 5HBEA 2XKEA 2VWVA 3D7ZA 3RHXA 5DMZA 4Z55A 5IG1A 3DXPA 3MTLA 4F4PA 5E92A 3UE4A 4I93A 5IPJA 3Q52A 4IZ7A 1TQMA 3KQ7A 4GU6A 3E7VA 3K3JA 5CEIA 2GQSA 5DN3A 3LLAA 2RFNA 3CY2A 2HCKA 3VN9A 2C3IB 2XB7A 4AT5A 4E4NA 2Z60A 3MFSA 4EK6A 4FT0A 2RFDA 2WMWA 2X7GA 5F4NA 3R7VA 3UNKA 5IISA 4K2RA 4QQ5A 4CMTA 3BRBA 3VJNA 5TF9A 2JLDA 3TNIA 1WBPA 3NRMA 3UVPA 3U9CA 2ZYBA 3D15A 3ZZEA 3UDZA 3QZIA 2W4OA 5ANDA 4W8DA 3W1FA 3FYKX 4ACMA 4QP1A 4EQUA 5HD4A 3MBLA 3ANRA 4HGSA 2V7OA 3E63A 4S30A 4IAFA 3SW7A 4JXFA 3A8XA 2IZTA 3KVXA 2AUHA 3EWHA 3FLNC 4G6NA 2Y6OA 4GK4A 5LOHA 3OXZA 3DB8A 5GHVA 2R3RA 1K3AA 4RIWA 1H00A 5I9VA 5M4FA 2ZFYA 2QO7A 2GTNA 3EMGA 4FZAB 4O2PA 2C6OA 5LJJA 3BLQA 4GH2A 2YM3A 5FEQA 3IW7A 4YJVA 2O64A 4FNYA 5GJFA 2XARA 1P4FA 2CJMA 2X2MA 4FUYA 4O38A 4BC6A 4B8LA 3EN6A 2WMTA 3D5XA 1BMKA 3RALA 2EUFB 2XNEA 5E8UA 4EHZA 4ZZNA 3ZFYA 3UOHA 2NRYA 4K11A 2QHMA 2YM8A 3UPXA 4D2VA 2X8DA 2X6EA 3F3ZA 2JIVA 4CLJA 4H39A 4CV9A 3Q96A 1WVYA 3I0OA 5LCJA 3K2LA 4IAIA 4Y83A 3P9JA 4F0IA 2QC6A 1M2PA 2YIWA 3R1SA 4CMUA 5I3RA 5E1SA 3V3VA 4ALVA 3DTCA 3PA3A 2BUJA 3F66A 2XRUA 3QTUA 3QX2A 3EQDA 4QOXA 3UQCA 2WMXA 3W0SA 2J51A 3PDTA 3ZM9A 4FV4A 3KKVA 4S34A 4IZAA 4APCA 4E5AX 2R3FA 3MH1A 4F9CA 4O83A 5M55A 1PKGA 3ZONA 1GAGA 5A6NA 2BTSA 2ITQA 3UQGA 2I1MA 3R71A 4DGOA 3KB7A 2YIQA 3QQFA 5GZAA 5T6KA 3V51A 5IA0A 4LV8A 4V01A 4F0FA 4GKHA 2GU8A 1Z57A 3PRIA 4FG7A 4FVPA 5T68A 2VTJA 3C1XA 4G1WA 4O0UA 1OMWA 5LCKA 5HG8A 4MXCA 3D2KA 4FIFA 1YDSE 5HG5A 1H1WA 3RP9A 3R28A 3FY0A 1OIUA 5TE0A 3EN7A 4QD6A 3MVMA 2VO6A 2E9PA 3OROA 4OBOA 5EG3A 3R8VA 2XCHA 4TYHA 4MNEA 4ZTLA 3WZKA 1G8SA 2OJFE 4RIYA 4GSBA 1YOJA 1W2DA 5M08A 2UV2A 4E5WA 4X21A 3ORIA 5IDPA 4DDIA 3L9PA 3ZO2A 1JAMA 4O6LA 4TXCA 4D2WA 2ITNA 1XH7A 3PP0A 3PXKA 4PTEA 5EK7A 3WYYA 3ZSHA 1H1PA 2WMRA 2X6DA 3LCOA 4BN1A 5EDRA 5DFPA 1CKPA 4I6QA 4IX5A 4EOMA 1BL6A 3F61A 3IOPA 5K0XA 4DF3A 1WBNA 5EDQA 3V5QA 4ANLA 4IB5A 5L2TA 4AX8A 2B0QA 3C4ZA 4RFMA 3ZU7A 4CD0A 5CENA 3EKNA 4UYAA 3LFAA 5ANKA 4F0GA 5L2SA 3P5KA 3MIAA 4AT4A 2R3IA 2ITXA 1B39A 3DT1A 2I7QA 4ZIMA 5M56A 4I6HA 3NWWA 5L4QA 4C3FA 4QQTA 2EXEA 2ITPA 2CNUA 3FQSA 4AXCA 4A9YA 1TZDA 4EK8A 2WTIA 4D55A 2JGZA 3VO3A 3LMIA 3E87A 5CF6A 3PJCA 4IM3A 4H1MA 1RW8A 3IONA 4BDIA 4BBMA 5M4IA 4O4EA 4RVMA 4MUQA 3F5PA 3VBYA 4WNKA 4FKOA 3RJCA 1M14A 1PXKA 4GT5A 4YTIA 3VBWA 2QLQA 5IMXA 3ATTA 4DH7A 4DINA 3PG1A 4V0GB 1CSNA 1Q3WA 2QKWB 5BUIA 1WBSA 4L46A 5IA5A 4BCJA 1XH6A 3FSKA 2CLQA 2ZMCA 2XK3A 3VS1A 4YJOA 3TCPA 4V05A 3MESA 2YZAA 2IW6A 3HMPA 4D4YA 4CZTA 3QCSA 2F9GA 4QTAA 3NIEA 5C8NA 3G9NA 3VWAA 3QTSA 2PVYA 4PNIA 1IR3A 5CT7A 3UC3A 2GQRA 4LL5A 5HQ0A 3R83A 1HOWA 4K18A 4C4JA 5BX0A 4BBEA 2SRCA 3SXSA 4C2WA 2OFVA 5ACBC 3HAVA 4PPCA 5I4NA 4J98A 2XJ1A 3NCZA 4AZVA 5JZNA 4DGGA 4G17A 4RX7A 2ZB1A 4JDJA 2IEWA 3TV6A 3E62A 4MBLA 3ULZA 3H3CA 2HZ4A 4AZTA 2DYLA 3FZRA 3EQCA 2YWPA 4J8MA 4U97A 4CFNA 4AXDA 2C6TA 3S95A 5LMKC 1OIYA 4IHPA 2I0EA 4CYIA 1FPUA 2BPMA 1M2QA 4I5MA 2R0IA 4IAAA 2WMQA 3UO4A 4DEDA 3TUBA 4EJ7A 3H10A 4K6ZA 4Z3VA 3WZJA 5D41A 3P78A 4RIXA 1VYZA 2Y8OA 3UOKA 4BIEA 5HX6A 4M66A 1ZY5A 4FNZA 4MKCA 3W2RA 3WIGA 3CIKA 2QOIA 3NMUF 4QMUA 3RCDA 3TJDA 1KE7A 4DN5A 3DJ6A 4D9UA 5FQDC 4RC2A 3VS3A 2Y0AA 3LJ1A 2PZYA 4HCTA 4DHZA 2P2HA 5KKRC 3TI1A 3ZS5A 4DHFA 3E8NA 4AACA 1FGIA 3HECA 3Q9ZA 4PMSA 1PMEA 3TUCA 3ZSGA 2I0VA 3TMOA 4A4LA 4PDPA 3VNTA 4P5QA 3W2CA 3ZYAA 3D7TA 3L9MA 3EZRA 4BDAA 4LM5A 1BX6A 4MVFA 2CDZA 2ZM1A 1YKRA 1CMKE 3MIYA 4QMYA 1H1SA 2B9IA 5DHJA 4ALUA 4F1MA 1YI3A 2CNQA 3DTWA 4KRCA 2CKOA 4M69A 1K9AA 4FV2A 4NWMA 5KUPA 1XMLA 5E8VA 3S4QA 3W18A 1OBGA 3GOPA 3MA3A 3FMNA 1P4OA 4PMTA 4CFMA 3VBVA 2OH4A 3BGZA 2CN5A 4IIRA 2A19B 1Q99A 4HVSA 3O96A 4DHJA 2QOCA 2PE2A 4FUXA 3TTJA 3AG9A 4F65A 3AD5A 4E8AA 4FSMA 1GIHA 1W0XC 1ZARA 4LFIA 4O0RA 2EVAA 3OBJA 3A4PA 5GJDA 1GY3A 3BU6A 2B52A 2WZJA 4GFMA 4O27B 4WSQA 4HVGA 3GXLA 4NM3A 1UKIA 1XH8A 5CQUA 3IS5A 3GCUA 2VX0A 2QLUA 4PTGA 5EI8A 4QYYA 4BTMA 2IPXA 4XG3A 4YLKA 2ONLA 3RM6A 2UZVA 3FLYA 2J0LA 4B8MA 3ZZWA 3UIUA 4D0WA 5LWNA 3WF9A 2F2CB 1XBBA 4BBFA 5KMIA 3R30A 3FHRA 5B2LA 4IFGA 1ZRZA 1WBWA 2F4JA 3TYKA 1XH5A 5HCYA 5LVPA 1MP8A 3E3BX 3R2BA 3IECA 4QEBA 5IH6A 4AW1A 4ACCA 5M07A 5CSPA 4C4IA 4ZS0A 4B6LA 4EH5A 1GZKA 4I5HA 1UWHA 2X2KA 3QYZA 4O7NA 3A7HA 3UO6A 3R21A 3R00A 4PF4A 4YO4A 3R7EA 4QDVA 4WBBB 5CY3A 5DIAA 4BRXA 1U54A 3L8SA 1LR4A 4XBRA 4QP4A 4RJ5A 1ZWSA 4YO6A 1JSUA 2PVHA 2EB2A 3ACKA 4EWQA 5AA9A 5BVNA 4QDEA 4HNIA 1ZZ2A 3QHWA 4X3FA 2YCFA 4RX9A 3ZO3A 5EW3A 3GGFA 3R1QA 3UVQA 3FQEA 3BLAA 2JIIA 3VC4A 3QA0A 3K5VA 3QFVA 4B99A 1J1BA 2IVSA 3LJ0A 1QPEA 3G0FA 5FP6A 3CTJA 4LRMA 3BEAA 3QD0A 3F88A 1JLUE 5CI6A 4J8NA 1VJYA 2PMNX 4DE4A 3PXQA 4MTAA 2BR1A 4JDIA 3PPKA 2NP8A 4L9IA 5CXHA 5HTIA 5K5NA 5M44A 4L01A 2JEDA 3LFBA 1ZOGA 3ZLYA 2W1DA 4NIFA 4LUEA 3OP5A 4ENXA 3LXNA 4FNWA 2W1GA 4QMPA 2W1FA 1ZMVA 4GEOA 4EOPA 3QQUA 2XK9A 3KY2A 3NNXA 1PKDA 4UX9A 2XALA 3ZRMA 3LQ3A 1ZYSA 4GCJA 3HV5A 4YJNA 5D7AA 4XCUA 3KMUA 3F9NA 3PY1A 2UZTA 3O8PA 3UBDA 3HV6A 1QCFA 3OWKA 2QNJA 2ZM3A 4XLVA 2G2HA 3A60A 4IADA 4PRJA 4BKZA 4ZZMA 5GINE 2O65A 3GFEA 4G34A 3DK6A 2P2IA 3N9XA 4MD7E 2AEGA 5BYLA 3AGLA 3QKMA 5C4KA 4FKIA 2EXMA 3D0EA 2X39A 2LAVA 3CKWA 2YLEA 5C8KA 5KMKA 1K2PA 4C02A 4PP7A 3VQUA 4GK3A 5FBNC 4IMYA 3VUTA 3NW7A 4UZDA 5TKDA 4CCUA 4QMXA 1YXSA 3BHHA 4J1RA 2B9HA 5HI2A 4FA2A 4D28A 1A9UA 5CS6A 3NDMA 3OUKA 4YZBA 2KTYA 4QRCA 5A4EA 5TR6A 4ANOA 4E73A 2C5VA 2REIA 5JZJA 2XIKA 4XV2A 5CSWA 3KF7A 4C4GA 3IOKA 3ORLA 3OHTA 3B8RA 4G3GA 3ZLWA 5DNRA 2W0JA 5DRBA 3RAIA 5HIBA 3VS4A 4IC7A 3MSSA 4AOTA 4F1TA 3O5AA 4XP3A 5TOZA 3BELA 4FEVA 2C6EA 3SRVB 3JR1A 2OGVA 5EFQA 3QCQA 4LL0A 5HBJA 4K1BA 3H30A 1YQJA 1FVTA 3FE3A 3BWJA 3U4WA 4TT7A 4S33A 4ANSA 1Q5KA 1OKYA 3ORXA 4F6SA 3LCSA 3EFKA 2JITA 3R02A 4CFWA 4F9BA 2OICA 4UMPA 5AFVA 4QYGA 1AQ1A 2HW6A 2OXXA 4KIQA 5EDPA 3FXWA 4EKKA 4ERWA 2H9VA 3HRBA 3QHRA 3D83A 4G3FA 2JDOA 2W05A 4R3CA 1FQ1B 3RNIA 5KKRB 1ZAOA 4OR5A 2PULA 3BYVA 2CCHA 3AT2A 2WFYA 3EQGA 3UTOA 5FDPA 5JGBA 4YC8A 4BF2A 2ZV7A 4GK2A 4BCOA 3FZTA 3KULB 3RPOA 1YW2A 2C5YA 3GENA 2CPKE 3QQJA 2C0IA 1G8KA 3UMWA 2Y9QA 4RG0A 2X0GA 3OS3A 5DLSA 2EWAA 1AD5A 2GFSA 2QR8A 2IG7A 1JBPE 5DG5A 3TKHA 2RG5A 4AAYA 3KXXA 5KE0A 2YM6A 5AR2A 2V5QA 2XH5A 5D7VA 3V8TA 4IX3A 3POZA 5LVMA 2BRHA 2BRMA 5FM2A 4AOJA 4G5PA 2BAKA 4FE2A 3ML1A 3FMDA 1Q8UA 5GIOE 3VF8A 4N4SA 2Q0BA 4WKQA 4ONAA 3PJ8A 3M2WA 4FV6A 4GFGA 2CGVA 1JVPP 1OITA 4YTCA 1H01A 4WOVA 3EQRA 2BHEA 4ZOGA 5GJGA 2CGXA 4XEYA 1P14A 4L00A 2W5HA 3GBZA 2VNYA 4QMWA 4A06A 2ETRA 4OTQA 4YNOA 1BYGA 2WU6A 3QKKA 4GT4A 4TPTA 2FSMX 5HEZA 4H05A 4E20A 4F7JA 1UNGA 4RC4A 2A2AA 4JIKA 1F0QA 4F99A 5DOSA 4E6DA 2W7XA 4PQNA 5LVNA 4KWPA 1VYWA 1U5QA 2R3KA 3KRLA 1GIIA 2GNHA 2QOBA 4JG7A 5FTGA 3MH2A 5DA3A 1PHKA 3ID6C 3BIZA 3P4KA 1SM2A 4MBIA 4Y46A 3RI1A 3M1SA 5K4JA 3V04A 4EI4A 3OVVA 5K0KA 4BTFA 3NVMB 3LFEA 3NYOA 5HOAA 5FXRA 3QQLA 3QWJA 3SV0A 3S0OA 3ZXTA 3PYYA 5J7BA 1WMKA 2V7AA 2Y6MA 3EN5A 4OW8A 1UU8A 2GHMA 5CU0A 4ZTSA 4FG9A 4EEVA 2OH0E 5EW9A 1APME 2BDFA 2IZUA 4QMLA 5KNJA 2XKCA 4FKTA 1PMUA 1TKIA 1S9JA 4Q9SA 1PXPA 3PIYA 1SNXA 4CSVA 5HLNA 4BDKA 4BICA 4DDGA 4Q9ZA 3VS5A 3ZCLA 5JFWA 3HLLA 3NSZA 4O91A 4XRJA 4CV8A 2WD1A 4OTDA 5EYDA 1W82A 4JS8A 2JAMA 4CG9A 3COHA 4FV3A 4QNYA 3FXZA 1A48A 2W9FB 4JDHA 3BL9A 4L7SA 1PXJA 3PXZA 2CSNA 4C33A 1U46A 4YU2A 3BV2A 4C35A 5JFVA 3QRKA 5I5ZA 5IQDA 4USDA 4D1XA 1URWA 4J99A 2C4GA 2BRNA 2JKQA 1MUOA 3NYXA 3QRIA 2XEYA 3QXOA 2PVMA 5E8YA 3PVBA 4GV1A 5KBQA 3M11A 4TKSA 3DB6A 3O23A 3LCTA 4C58A 4HCVA 5IA4A 4H36A 4CFUA 4MQ2A 3MH0A 4G3EA 3Q5IA 2H96A 4IB1A 5FP5A 5JQ8A 3RPSA 4AA5A 2J0IA 2A0CX 3H0YA 5DWRA 4IX6A 3GFWA 5AR8A 3ZUTA 2YIYA 3R8ZA 3TL8A 2H6DA 3I0QA 5J79A 1F5QA 4AN3A 4F64A 1UU3A 5JRSA 3AC5A 3ELJA 5J5TA 4DTBA 2UVZA 1GNGA 3ZO1A 3E92A 3ZDIA 2C47A 3PUFC 2A27A 2B1PA 1U5RA 3F2NA 4F7SA 3QA8A 4NKAA 5GIPE 4NK9A 4JBPA 3L8XA 5KBRA 4EUTA 4JQ7A 5BVDA 4FV9A 5BNJA 3AMAA 1R3CA 1HCKA 3AXWA 4YLLA 4QP6A 3V6RA 2C1AA 5JK3A 1PXNA 5JFXA 1J3HA 3QTXA 5J8IA 4V04A 1ZOHA 4ZJJA 4AW0A 5FLFA 4BCHA 3OXTA 2IZRA 4QQCA 2B9FA 4JMQA 4F7LA 3PVUA 3JY0A 4C8BA 1Q4LA 4DEBA 3HL7A 4F63A 2I40A 5HVYA 3G15A 2OXDA 3CSVA 4LGHA 4CKIA 5A14A 2ZVAA 4WT6A 4AFJA 4RQVA 3QQKA 1DI8A 3QZHA 2C0TA 2HELA 5CANA 5E91A 3UQFA 2BIYA 4HYHA 4F1OA 5DR6A 2VV9A 2B4SB 4BDBA 4USEA 4ZK5A 4FTMA 4WG3A 2JKKA 5CQWA 1JOWB 2R3LA 4AE9A 3N4VA 3G0EA 4IFCA 4FTKA 1WAKA 2X81A 3VUKA 2J5FA 5ACKA 3FMEA 3MPAA 4RLKA 4AGCA 1OL1A 3HKOA 4XMOA 2P55A 4XG7A 5J95A 3UP7A 4ARKA 5CU3A 2BVAA 2WMVA 3SHEA 4AOIA 1ZMWA 5GZ8A 2OJJA 1OBDA 3Q4TA 3VUHA 1DM2A 4U43A 2BZIB 2XIYA 3FZ1A 3NGAA 3KXGA 4D4SA 3LLTA 2VO7A 5AV0A 2RIOA 4KIKB 4ENYA 3RWQA 3KMMA 4R7HA 2VWXA 5C27A 3V5LA 3QC4A 1CKIA 1UKHA 4NFNA 5AP5A 5KMOA 5M57A 2XKFA 5JEBA 3MFTA 4ZP5A 3BLHA 1O6YA 3BYUA 3IW6A 4CXAA 4EZ7A 2IF8A 1DAWA 1H08A 4EQMA 3L1SA 2WQEA 3PP1A 4QP7A 1TQIA 2BHHA 1DAYA 2F49A 3F3WA 3IK3A 4XX9A 1Y6BA 3UGCA 2QO9A 4IWPA 5JQ5A 1YXTA 2C69A 2UUEA 4R1YA 3C50A 4I4EA 1OB3A 2GMXA 3QF9A 4DAWA 3TKIA 2XYUA 4IWQA 1PXIA 3E64A 3FZPA 2VWUA 2C6MA 3QBNA 1ZYCA 4GVJA 3E5AA 2HIWA 4WD5A 5H3QA 5TO8A 2GSFA 1TQPA 2PSQA 3DZQA 3EL8A 3LM5A 3GCQA 4JIAA 4MYGA 4FKVA 4WUNA 3UP2A 1E1VA 4FK6A 4OBPA 2VTLA 1M2RA 4JX3A 3VUIA 3PFQA 1H0WA 5EYMA 3SDJA 1PYXA 3RZBA 3ORPA 4ASDA 4O22A 4RMZA 1AGWA 4KAOA 4N6YA 3VS2A 2QOOA 2W4KA 4IB0A 5EOLA 3EQFA 5L6OA 1NVQA 3TNWA 4O0YA 3PWYA 5LMBA 4D5HA 3R7UA 1O6LA 3GOKA 4FSQA 4FTIA 4WA9A 4C3RA 3IPHA 2CKEA 3G2FA 3D9VA 4KKHA 1JQHA 3AT4A 4FKSA 4FTTA 4U0IA 1J7UA 4UN0C 1W7HA 3CLYA 3U6HA 4GKIA 3CD3A 5E7RA 4FSTA 4CFFA 2O8YA 2GPHA 2PE1A 5E4HA 2JD5A 4M67A 4QO9A 4AXAA 4D0XA 3AKLA 1XJDA 5BMMA 2IW9A 2XF0A 3R8UA 2UW4A 3EFJA 4NKSA 4R78A 3OWJA 3NUSA 5AX9A 4GJ2A 3V01A 4A4XA 4QMTA 2AC3A 4LQMA 2WTKC 3U4UA 2VTAA 3K54A 3H0ZA 4ZY6A 2VTOA 4FKQA 5BYYA 3LKMA 3NUXA 4I94A 3F5GA 2IO6A 1ST4A 4GIHA 4IAKA 5L2QA 5AR5A 2UW3A 2YEXA 1OI9A 3CKXA 2NYAA 5D12A 2O5KA 4I0TA 2PMIA 2XMYA 4G5JA 4Y8DA 4MXYA 3KCFA 4NT4A 2YAKA 3G6GA 2HXLA 2WO6A 3R1YA 4ASZA 2AQXA 5IA2A 3DJ7A 4H3BA 4RWKA 2C0OA 4F6WA 3E8DA 3GC7A 2XRWA 3KRWA 1NT2A 3BHYA 5L6PA 3WZUA 2PUUA 5LQFA 4EORA 3TM0A 3PE1A 3SC1A 3V5PA 1H8FA 2OIDA 3P79A 2AC5A 3ERKA 3HRFA 4BIDA 4F9YA 2HXQA 2VD5A 3A7GA 3FHIA 4L3LA 4EC9A