4BC6A

Crystal structure of human serine threonine kinase-10 bound to novel bosutinib isoform 1, previously thought to be bosutinib
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
293
structure length
285
Chain Sequence
EHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Serine Threonine Kinase- 10 Bound to Novel Bosutinib Isoform 1, Previously Thought to be Bosutinib
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
total genus 78
structure length 285
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bc6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bc6A01
3BHTA 3AC2A 5KKRC 4DCAA 1DM2A 2BCJA 5EI6A 2RFEA 5EM8A 3C4EA 4XG2A 3ZM4A 4YMJA 2XRWA 3KY2A 4JDKA 4LMUA 4EK5A 5E1SA 2YIYA 3Q2MA 5FXSA 1NY3A 2BIKB 3QU0A 4EZ5A 2GHMA 3AMAA 3HMPA 3DQXA 4BDIA 3OVVA 4EUUA 4BGHA 2QG7A 3D7TA 4H3PA 4QMTA 4E93A 4KKEA 4FUXA 1B38A 3ORXA 1UWHA 4WNPA 5CU6A 5F95A 3HLLA 3DBFA 1YXUA 3LMHA 3K5VA 3LFSA 4BDEA 3F5GA 5EOLA 5IQFA 2JAMA 1M17A 3FKNA 3P08A 5I9ZA 3UOKA 2IZRA 4WG5A 5KNJA 4PY1A 3ZBFA 2BKKA 2VWZA 1MRVA 3FMMA 3T9IA 4H05A 3IK3A 1H00A 3ZM9A 3S2PA 3F3VA 4UYAA 2ZJWA 3EL7A 1STCE 3V5TA 1YQJA 2E9VA 2F57A 3QTWA 5D12A 5AA8A 2A1AB 5K4JA 4I1ZA 4YSMA 1ZXEA 4F6WA 4FEUA 2YEXA 2XB7A 3OXZA 3QD4A 2W4KA 4FKUA 5IKWA 3ZDIA 1AGWA 2H9VA 3LMGA 2J0JA 3KRJA 4IDTA 4YHTA 3UIBA 2P33A 3QZIA 1MP8A 1P4OA 3L9LA 4W8DA 4FT3A 2DUVA 4M0YA 5EW3A 4J8NA 2Q0NA 3N9XA 4S31A 1NVRA 1PXMA 3PA5A 3T3UA 4E6CA 5M55A 4R7BA 5ANEA 3TNPC 2PU8A 5HIBA 5FP5A 4O0UA 4GYGA 5JN2A 2XP2A 3OT3A 3IGOA 4M66A 3ZLSA 2VTLA 5GZ8A 4NCTC 1W83A 2WIHA 4TN6A 3U55A 4X3FB 1FVTA 5GHVA 4AE9A 1GAGA 3GP0A 4MD8E 4FEXA 4F7LA 4PL4A 3V01A 2W1ZA 2A19B 3EJ1A 4PPBA 4X2JA 1GZOA 2WQOA 5A9UA 1ZARA 3AC1A 4I6HA 2IW8A 2PVJA 4WO5A 5TE0A 4IWPA 4YJVA 2XNNA 4NK9A 3ZLWA 3NRMA 5IMXA 2C5YA 2XNMA 3UZTA 4ZS4A 5AR3A 4BTFA 4IX4A 2V0DA 4DEIA 2W9ZB 1R39A 5AUVA 3UZPA 2PTKA 2CJMA 2Q0BA 2QNJA 2WMBA 4IB1A 4D2PA 3D5WA 3QTIA 4FG8A 3CD8A 4DG3E 3O7LD 2WMUA 3PPZA 2B54A 4L44A 3VULA 3EMGA 1FOTA 3QTXA 3BWJA 3T8OA 5EHLA 3TXOA 4FVQA 4L42A 3TT0A 4B6LA 5I9VA 3ANRA 5AUTA 2CLQA 5E8YA 4CFFA 3OWPA 5HNIX 3QF9A 1KE8A 4G3EA 5IISA 3LVPA 4IAZA 4QP4A 4FEVA 4QPSA 3U4WA 4I5PA 3MY0A 2X4ZA 3DCVA 4RBLA 5EKNA 1APME 1ZOGA 4WA9A 3F5PA 1F0QA 4M84A 3QBNA 1VR2A 3KRXA 2XCKA 5ICPA 4JBPA 2QVSE 2UV2A 4NCTA 4O1PA 5JFWA 3F2RA 3TJDA 3TV7A 3D4QA 3H9RA 4KD1A 4WSYA 2C0TA 3NPCA 2OI4X 2G1TA 3HDMA 4MWIA 4I92A 2Z7RA 4LUEA 4RIWA 5K3YA 3SW4A 3IW4A 3QQFA 4DG0E 2JKMA 3ZXZA 4FIJA 1KUTA 3SG8A 2W4OA 2UZEA 4W8EA 4FK3A 4TZRA 4CT2A 3RNIA 2ZM3A 1A9UA 2BTSA 2C0IA 4FT7A 3W1FA 4N4SA 2BRBA 3E93A 4J71A 3R9NA 1J91A 2QO7A 3UBDA 3VBYA 3WF6A 3WZUA 2X8EA 1SMHA 5D9HA 1PXPA 2HWPA 4LOQA 3A7FA 3QKMA 5ANDA 4CZUA 3VW8A 3AD4A 4TYIA 4MWHA 4DFBA 3F2AA 3HP5A 3NSZA 4GIHA 4EOOA 2GMXA 5AJQA 3TNWA 4YSJA 2IVSA 3KU2A 4O83A 3E3PA 4KIKA 3TCPA 3A7IA 4U7ZA 4C4IA 4RRVA 2O64A 2QU6A 2XJ2A 3IO7A 2OZOA 4QMWA 2FA2A 5CANA 3ALNA 3SC1A 2REIA 4ASEA 2PMOX 4UALA 4PV0A 2JDVA 3FHRA 2C6LA 3IGGA 4X7QA 5ETIA 3CLYA 2WOUA 4U3YA 4RIXB 1H25A 1JPAA 1Q8UA 2JBPA 4ZOGA 4BBMA 5KMIA 4ZEGA 4L8MA 4OW8A 4UWCA 5CXHA 3WIKA 3LFEA 4O7SA 3FXXA 3E8CA 1Q62A 3RZFA 4EI4A 4BCGA 2XUUA 3LZBA 2NNWB 2GS6A 3VO3A 4BCKA 5AR4A 2GHLA 4KRCA 5CEQA 3MVMA 4QP9A 3QZGA 4AFEA 4O7LA 1YDTE 1K3AA 2R64A 3H4JA 3QA0A 2YAKA 2YM4A 3R2YA 2I6LA 3AT4A 3PZHA 2XA4A 3P9JA 4U44A 5ANGA 2LAVA 4FKIA 2VO0A 4F1MA 3SW7A 4UMRA 3MFTA 3QRJA 4YNOA 3RAKA 5K0XA 3LFDA 4XV3A 4K77A 2X0GA 5IQBA 4LM5A 3VW6A 4ANMA 4BL1A 1PXIA 4IACA 3UMXA 2HAKA 3QTZA 5E92A 2HW7A 2R7BA 2YA9A 2YITA 4IE9A 4BKZA 3VN9A 4RX8A 1A48A 5EYCA 1R1WA 2IVUA 2QONA 4TTHB 4ACGA 4BY9E 4HGEA 3R73A 5C8KA 1AD5A 3QKLA 4OAVB 3NEWA 2EVAA 4JT3A 4RZWA 3N51A 5T3QA 4ACMA 5AADA 2BIYA 4CG9A 1H1WA 4E6QA 3BBWA 2J90A 3BRBA 2OLCA 2XRUA 4JNWA 5M57A 2CMWA 4C0TA 4XOYA 5BUJA 4ACDA 2VTSA 4LRMA 4XG4A 4I94A 3WF7A 4BBEA 2JFLA 5J87A 2H6DA 3GCQA 1J1BA 3R02A 3R63A 4ZY5A 3HMNA 5CU4A 3OUNB 3MTFA 3VWAA 2W05A 1W84A 1ZRZA 1UNGA 3FLNC 2OJIA 5HG8A 3OTVA 5KMJA 2YCFA 4BR3A 3NZ0A 2OK1A 4PUZA 3ZLXA 4ZZOA 1E1XA 3PUPA 4YC6A 4IWOA 4MKCA 4D9TA 3F3WA 3TEIA 4C2WA 3TNHA 2J0LA 4YU2A 2DS1A 3A4PA 4JR7A 2R0IA 4ALUA 3ORPA 4D1ZA 2P55A 1JNKA 3BELA 3U9NA 3VS0A 1UU9A 5G1XA 4MTAA 3VUDA 3RWQA 3CY2A 4Z55A 3HX4A 2QLQA 4NZWB 4HVSA 5HIEA 2CGXA 1Y6BA 4X2NA 4YHFA 4UXQA 4I0RA 3U87A 5DG5A 4XG9A 3MB7A 4Y5QA 5M06A 1OL5A 3LJ1A 2RFNA 4CG8A 2EU9A 2G2IA 3V5PA 3D15A 4TYEA 3L9MA 3FI2A 1GJOA 3UMWA 1PMEA 5H8GA 3K5UA 3U51A 3HKOA 2QHMA 3EQBA 3OOGA 3QD2B 2FB8A 1PXKA 3LFNA 3SV0A 4R1VA 4BDHA 5FLFA 1XH4A 2UZVA 4G3DA 3ORLA 5EYDA 5AUWA 2XS0A 4DTAA 2GNIA 2QOCA 3H9FA 3G0FA 2BRMA 4DCEA 1FQ1B 4O0TA 2WTKC 3P86A 2VN9A 3EQIA 2QOOA 5GJGA 1ZYDA 1KE6A 4WRGA 4D9UA 2YDJA 3NCZA 3QKKA 1ATPE 3R1QA 4C7TA 1BMKA 5AV3A 3PY0A 5HE0A 3GOPA 3DLZA 3BPRA 4YLJA 4NUSA 3BLRA 2UVZA 4DGLC 2VUWA 5ANIA 3CQEA 4O81A 3NUXA 3R71A 4BTKA 2YWPA 4G6NA 2XNBA 5DT0A 3LCTA 3RK5A 4BIDA 3UIMA 2O5KA 4FNXA 2OBJA 5FEDA 1UU8A 1LUFA 4FI1A 4IB5A 4FA2A 4RVTA 2YM3A 5DGZA 4ZTSA 3C50A 1H0WA 1H0VA 3FZPA 4F0GA 3GEQA 3A7HA 3VBVA 4RPVA 1G8AA 1OBDA 4ITJA 4PMTA 4GK3A 3MA6A 3GU6A 2XYUA 4OBQA 3QXOA 3ZBXA 4EOJA 2WMVA 3NYVA 3FMKA 4C33A 4CTCA 2EXEA 4AFJA 2WTJA 4CT1A 5IUGA 5L6OA 3PXQA 4BYJA 2XVDA 2B9JA 5FTGA 4DBXA 4W4VA 5J5TA 5C4LA 1FGKA 3LM5A 4RLKA 4O21A 3OCGA 3QX4A 5FXQA 1UNLA 4YC8A 3LM0A 1URWA 4AX8A 5BNJA 5CTPA 2X7GA 4S2ZA 2J0IA 4AZVA 4DH1A 4NU1A 2BVAA 4QOXA 1PF8A 3KVWA 4QTBA 2XK6A 1H27A 4JG7A 4KS8A 4O82A 3TJCA 4AZWA 5HVJA 5GNKA 3SX9A 4ARKA 3F7ZA 2QKRA 2WTKB 4IZ5A 4O6LA 3NNUA 4UMPA 4ANOA 3OXTA 3VBXA 4FV2A 2PVRA 2XJ1A 1J7IA 5TKDA 2JAVA 1ZMUA 3FZSA 3FQHA 4XV9A 5IA2A 4DT9A 1NVQA 4FTRA 4FVRA 3DNEA 4JQ7A 3DBEA 3R04A 3A61A 4RIOA 5T6KA 4P5ZA 2BRNA 4Y83A 3MVJA 4AA4A 5ANKA 3QD3A 2QHNA 1IEPA 1UA2A 4G3GA 4L01A 3B8RA 1U54A 3MPTA 4EL9A 4TL0A 3GOKA 5M4FA 3A7JA 1PW2A 4FV4A 4EH8A 4YPSA 1MRYA 1REKA 3AC3A 4WNKA 2UZUE 3OD6X 3F5UA 4XHKB 4RVLA 3MFUA 4HYSA 2X2MA 5E7RA 5E91A 4D58A 2ITQA 4FZAB 5AP4A 3WF8A 4FV5A 5CAOA 3RPRA 2AYPA 2WIPA 3NUPA 3L8VA 4HOKA 5I3RA 3PP0A 4HCVA 4WG3A 4EKLA 3ZXTA 2GNGA 1M2QA 4C4FA 2PPQA 2WNTA 1OITA 2Y6MA 1W7HA 4FIGA 1IA8A 4Z9LA 4OTHA 4C59A 3KXXA 3BYVA 5D7VA 3ZZEA 4LV8A 3FMJA 1FMOE 3QTQA 2YM8A 4IX5A 1YXVA 4JLCA 5TT7A 3DAKA 4EJ7A 2FGIA 2F7XE 3QQGA 2VTIA 4FTKA 3R7GA 2OG8A 5C8NA 3CJFA 3I5ZA 4IAIA 4IANA 3I6WA 5EW9A 3ODZX 3O7LB 1I44A 4G6OA 3E63A 3HDNA 5I9UA 1RDQE 1YVJA 4J96A 4OBOA 2IW6A 3UPZA 4CMOA 2B9IA 3C0IA 4FKGA 3OW4A 4IM3A 4O7RA 2YIWA 4RX7A 5HLNA 3CCNA 3A4OX 1W82A 3UQFA 4JX7A 2JGZA 4IC8A 5BYLA 3Q4TA 3W10A 3MESA 4TNBA 5IDPA 3MFSA 2XK4A 2J9MA 4G9CA 5CU3A 5C03A 4E4MA 3R7UA 5HZNA 4IFCA 1CKPA 4RZVA 4XP3A 2LGCA 3RTPA 2JDRA 3O0GA 4CLIA 2P2IA 4CKRA 5KUPA 4WUNA 4GL9A 3LLTA 4D1XA 5TR6A 4F09A 3DXQA 4CCUA 4CKJA 4FTMA 3OOMA 3QD0A 2UVYA 5AV4A 4YC3A 1KOAA 4GW8A 4XBUA 2XZSA 3HMIA 4XX9A 4CQEA 5EOBA 4USEA 5JEBA 3WZKA 1H24A 5EDQA 4AZFA 3V04A 5CAVA 5FUTA 1U5RA 3TDVA 4BB4A 3QYWA 4RWJA 4V05A 1FVVA 3ZH8A 4R7IA 5HTIA 2OKRA 1IASA 4RT7A 4FUYA 4GYIA 4XMOA 3R8PA 4D2VA 3B2TA 4I0SA 2X39A 4OTRA 5E8TA 3ZHPC 5DR6A 2WO6A 3Q60A 2VWIA 4C58A 3KXHA 2RKUA 2YJSA 3IDCA 4O0SA 4RFZA 5CSXA 4KSPA 5GZAA 1OUYA 2XKEA 3HA8A 3DK7A 4GIIA 4S34A 4YJNA 3FMDA 1PXLA 5IG1A 3RJCA 3ORNA 4RWIA 2O0UA 3E8DA 3ZEPA 1JKSA 3ZMMA 2EUFB 3QTRA 4IM2A 3BHUA 2C5XA 2ERZE 5LWMA 5JK3A 5DVRA 2C4GA 3E3BX 4WUAA 3ZLYA 1MRUA 2PVMA 5M44A 3R1SA 3G2FA 3BIZA 3CTJA 1FGIA 3M42A 5KKRB 5L6PA 4LOOA 4DFNA 1FMKA 4QP1A 3WIGA 2RFSA 4QP6A 4FNYA 2GQSA 3O51A 5ETFA 4FL1A 3ID6C 4QTDA 3KFAA 4JS8A 4ZTQA 4U41A 3AMBA 4Y8DA 5JRSA 4F99A 4ZAUA 1JBPE 3N4TA 1WBVA 1ZMVA 1WBSA 3PA3A 2OF4A 3R21A 4U42A 4KS7A 4LG4A 1YW2A 4BZDA 4W9WA 3VS2A 3MY1A 5CT7A 4YTHA 5AMNA 2ZV7A 5HICA 3HRBA 4U5JA 5AP1A 5H3QA 5I3OA 5CXZA 1IA9A 4Y5HA 5HGIA 3KN6A 5M4UA 2VO3A 1JAMA 4M67A 2ACXA 4ZIMA 5BQ0A 4DFUA 3R9DA 2XK7A 4ZY4A 3V51A 2B7AA 4YURA 5IQIA 4CCBA 4L6QA 5CS6A 2UVXA 5KMMA 1HOWA 5KMLA 3VS3A 1P2AA 3BU5A 4RGJA 3VRZA 4IWQA 4BICA 4LUDA 4BVUA 3BYOA 4AAAA 2YCSA 3K54A 2C3JA 3C4FA 4XV2A 3NS9A 1CKJA 5L8KA 4J98A 3UO4A 2GQRA 1EH4A 1TQMA 4FGBA 2JKKA 4YJTA 2VTPA 3O8PA 5LVPA 3PRFA 3C9WA 3I4BA 2XIXA 2XNPA 4U6RA 3V6SA 5JKGA 2I0YA 5JGAA 4BCHA 3FL4A 5IH4A 5KHWA 4U80A 1FINA 2YM6A 4XG8A 3UTOA 5JGDA 3R8ZA 5JFXA 4U9AA 1GOLA 3BLQA 5CI6A 1NXKA 5HO7A 5HHWA 3LLAA 4FE2A 2JD5A 2ZV2A 4NWMA 3E64A 4XLVA 2VTOA 4E5AX 5KO1A 5DMZA 3FMNA 4FGRA 2XK8A 4PNIA 2IWIA 2UW0A 2ZDTA 4BCJA 2V7AA 4ZJJA 4ORKA 5EM7A 3AC8A 5CEKA 1WMKA 3GFEA 3VQHA 5FM2A 3FY0A 4QO9A 2FSTX 1QPEA 4U45A 1YI6A 2BAKA 4QNYA 3ORTA 4IJPA 4YPDA 1DI8A 3SXSA 5J9YA 3PIXA 4C4HA 5CALA 4QP7A 2AC3A 4YNEA 4EOKA 3HMMA 5KCVA 2BPMA 2PVYA 4XCUA 5FWKK 5C1QB 4WNMA 4TWOA 5BVDA 3REPA 4DINA 2VX0A 3BX5A 1RQQA 4L9IA 2OWBA 2QD9A 3BE2A 3Q04A 4GFOA 3D94A 1W0XC 4A9TA 4IB3A 4C4GA 4QYFA 4D2RA 3MIYA 5IA1A 3W8LA 2GCDA 3E7VA 3DXPA 5BMMA 4C8BA 5EH0A 4I3ZA 5JRQA 2C68A 3E87A 3GGFA 2ZV9A 4H3BA 3BU3A 1S9JA 3VUGA 4YLKA 4MQ1A 4UZDA 3H10A 3FC2A 1DS5A 3VJNA 5AV2A 4K8AA 4QYYA 1JKKA 4XP2A 2NPQA 4FTCA 4HYIA 2RL5A 4O0YA 5CAPA 4Z7GA 4JBQA 4FKJA 3OWKA 2VWWA 3TG1A 3FBVA 1OECA 3MN3A 3OP5A 5A6NA 3MH2A 3C13A 3BHVA 1H8FA 1GNGA 4D5HA 4O7YA 2P2HA 4MCVA 3SOCA 4FKWA 1PYXA 2C6OA 3UQGA 5E8WA 3WZJA 4GKIA 4AGCA 4MX9A 4YZNA 2PE1A 2HZ4A 3FI3A 4GJ2A 4EOIA 3GBZA 5AV0A 5AAEA 2OJJA 3DZOA 1Q97A 3LCKA 4D0XA 4EOMA 3G33A 3QC4A 5EQEA 2BHHA 1XQZA 2F2UA 3NUUA 3I0OA 3M1SA 1ZOEA 2YN8A 3CY3A 4JG8A 1SVEA 3PG3A 5I9XA 2YDIA 3HV4A 4EH7A 4Y85A 1CKIA 2YIRA 4QQTA 5HBJA 3QFVA 5AP6A 4YUQA 3QCQA 1L8TA 2VWXA 4HZSA 4IM0A 4CFWA 4DLIA 3MPAA 4KBCA 5BYYA 3KVXA 4BKJA 4G5PA 4A4XA 3RK7A 3H0ZA 3SXRA 5C9CA 4CYIA 2RSVA 2RF9A 5BYZA 2BALA 3NDMA 5IDNA 3D7TB 2HW6A 3FE3A 5HU3A 4FTNA 2ITOA 2FSOX 4BGQA 1H1PA 3R8LA 4LYNA 1SZMA 4E4XA 4DITA 4FIFA 3FHIA 4YZBA 2SRCA 4L68A 1GZKA 3TZ9A 2VTTA 3EN4A 4GG7A 4QYHA 3OG7A 2BTRA 4JAJA 4XG7A 2HOGA 5FTOA 5TF9A 2R9SA 2QCSA 1X8BA 1XJDA 5CWZA 2IZTA 4TWPA 5HNGA 3DKCA 4IADA 3TZMA 3W8QA 4AN2A 4BBFA 4NKAA 4EBVA 4OTIA 4ACHA 4O2PA 4G3CA 2B1PA 4V0GB 3SVVA 4MK0A 1LEZA 4FYOA 3NW6A 4TWCA 5AR7A 3T3VA 5FG8A 5TOZA 4TYHB 3H9OA 4M69A 3ZSHA 3COMA 1F5QA 4RSSA 5FD2A 1OIRA 1OI9A 4S33A 4YHJA 4CMUA 3LQ3A 3N4VA 1T45A 4UV0A 3PSCA 4TWNA 4QQJA 3PXZA 4IC7A 5AIRA 5HI2A 4FTTA 4FTIA 3AG9A 2A4LA 4KIKB 2PYWA 1H01A 4E26A 5AR8A 1REJA 4NIFA 5AP3A 4K9YA 3JVSA 4C62A 4L00A 4PMPA 5J7BA 4TYGA 3A7GA 3FPQA 2UW3A 4QMSA 3TUBA 2ONLC 2WMTA 2VZ6A 4AGUA 4FZ6A 4FTLA 2FVDA 4G3FA 4CQGA 4YZDA 2BAQA 4YP8A 4E8AA 3MH0A 1ZYLA 4G9RA 4ACCA 4R7HA 5JSMA 2QG5A 4E6AA 2C3KA 2JDOA 3Q9WA 2WTCA 4GH2A 3PPKA 4OGRA 4A4LA 1J1CA 2ZB1A 3KB7A 4O2ZA 2PE2A 3R8VA 3ZU7A 2BAJA 4C35A 3HECA 3FI8A 4O7WA 1Q8TA 1CDKA 5IEVA 3ZYAA 4R78A 5KBQA 1PJKA 4GV1A 4IX3A 5T68A 4LRJA 3EN9A 4B9DA 2BZKB 3ITZA 5H8EA 2YACA 4XP0A 2QR8A 3TN8A 1XH8A 3NIEA 3PJ8A 4QD6A 4A9UA 3HUBA 4L45A 4EOQA 3N4UA 2O8YA 5AUUA 4BDFA 4Y73A 3UYTA 4X3JA 3GCUA 4QT1A 4Y72A 2YCQA 4I5HA 5F4NA 2CHLA 3BEAA 3TACA 3TNIA 3IOKA 4QMUA 5IA0A 3DK3A 3HRCA 2IVVA 4RJ3A 2PUNA 2ITUA 4FKLA 5C01A 1GZNA 4Q2AA 4D4YA 3ZUUA 5LMBA 3ZO4A 3VQUA 3NLBA 3R7EA 3RPOA 2V22A 3VNTA 3FLZA 4FV1A 4JRNA 1BI7A 5J5SA 3P7AA 5J1VA 1WBOA 2HZIA 1YRPA 3GT8A 3I0QA 5GINE 4KINA 3RHXA 4YBKA 3O17A 3E88A 4FC0A 3HGKA 3PE2A 3V6RA 2UW4A 3F61A 4UX9A 4X2GA 4QP8A 3EN6A 1BL6A 3ACJA 1ZMWA 3LCSA 3MH3A 4FG7A 4JQ8A 5HD7A 1KE7A 2B9FA 3QYZA 3JS2A 4MXOA 4XRLA 4OTDA 5CU0A 4C36A 3AT2A 4FNWA 4QTCA 4WD5A 4ERKA 3I7BA 3HRFA 2WMXA 3I5NA 3GQIA 5L3AA 3DNDA 3P7CA 4LRKA 3RM7A 2QO9A 4X6QC 3DDQA 4DBNA 3ENHA 5B2LA 4TT7A 2YIQA 4QMQA 3W2RA 2PVNA 3Q9ZA 2OH0E 3R9RA 4BGGA 3JY9A 3MVHA 4L53A 5AX3A 3WE4A 2HELA 4JXFA 1Y8YA 4L46A 4DGGA 1IAHA 3C1XA 5L4QA 2J0KA 4KRDA 3UP7A 2OIQA 5AV1A 4NFMA 4EH2A 5FXRA 4O86A 3FQSA 5DFPA 3SRVB 1FBNA 2R2PA 4B4LA 3GC9A 4B8MA 1OKVA 5LVMA 4EQMA 1KE9A 2QOIA 5FBOA 4O0VA 2HYYA 3COIA 2WZJA 3IS5A 2J7TA 3G90X 4JVGA 4AT4A 3EN5A 3DV3A 4LI5A 3QLGA 4J1RA 4ANBA 4FV9A 4OUCA 2WEIA 1XWSA 2C3IB 4CEGA 3KQ7A 3LHJA 5L2WA 3QWKA 4YTIA 4APPA 4U81A 2O3PA 1ZYJA 2OO8X 5IQGA 1Q8WA 3RINA 5BX0A 5JGBA 2JC6A 4B8LA 3O8UA 4M8TA 1U54B 3MI9A 1Q8ZA 4TKSA 3DXNA 4IVDA 2JEDA 4KKGA 3TM0A 4DGOA 3FSKA 4FF8A 4XH6A 2IW9A 2BMCA 3DK6A 3KXZA 3HL7A 1OPKA 2YCRA 4GVAA 5EDPA 5D41A 4XRJA 3W2CA 4C61A 3OC1A 2QOKA 3D9VA 3OCSA 4GT5A 4EC8A 3NAYA 3CBLA 4U40A 1UU3A 2GNJA 3EFLA 2PULA 3CKXA 1LEWA 3QRTA 4RLLA 4D2TA 3PXFA 3VIDA 1ZAOA 3VBTA 5I5ZA 3DBCA 3FMLA 4ZJVA 1SM2A 3CIKA 3F88A 5LQFA 4F64A 5AX9A 1M2PA 3Q6UA 2X2LA 3VRYA 3CTHA 4Q9SA 1BL7A 3UO5A 4FSMA 4BF2A 1IG1A 3O8TA 4E3CA 3R7IA 2OXDA 4M14A 3KL8A 4AXAA 2XMYA 4FV3A 4L7SA 3QGWA 5H2UA 1P5EA 1OM1A 3RNYA 3ORIA 3NYNA 3ZO3A 3GU5A 3FL5A 5A4QA 4GKHA 3EFWA 1YOJA 2E9NA 3WOWA 3C0HA 2WOTA 5L2QA 3ZSIA 1NW1A 3R7VA 1YDSE 2J5FA 3NR9A 1GIIA 4D28A 2R3KA 3NCGA 1R3CA 2F49A 4FOBA 2W1GA 4ZTRA 5JMSA 3HAMA 3NVKI 5CASA 1JKLA 3R9HA 1ZY4A 1B6CB 3UOJA 5F1ZA 5EQYA 5IEYA 2HIWA 4F9CA 3QALE 4DH7A 4ASZA 3HV7A 2UW6A 2YZAA 1H07A 4G17A 2RFDA 3VJOA 5E90A 5CSPA 4HNIA 4I41A 3UVQA 3LJ2A 4G6LA 2E9OA 1WFCA 2H34A 3D0EA 1UKIA 4AS0A 1YXTA 3U9CA 4U0IA 5CQWA 4ZSLA 5E8UA 3SXFA 1G3NA 3MY5A 3ZO2A 4DEBA 4KIOA 4FTAA 4BCIA 2ZYBA 3QAME 4F7NA 4M12A 3LXNA 4FZDB 3PFQA 3RAWA 2I7QA 3ZFYA 3FJQE 3F66A 5HTCA 4A9YA 3CEKA 4IVAA 4YJRA 1FPUA 3PPJA 4FEQA 3QUEA 5DR9A 2J4ZA 3MDYA 4IVBA 2ZDUA 4NH1A 2JDSA 4IWDA 5EQPA 2UZTA 3FYKX 4IBMA 1H4LA 4AW5A 2OZAA 4DFZE 1OKZA 4CVAA 4GS6A 2GQGA 4OBPA 2FO0A 4U43A 3VUTA 1Q8YA 5DRBA 4C3FA 2ETKA 1BX6A 3RBWA 4BWXA 4MBLA 5I9YA 4ANLA 4C37A 5AR5A 4RG0A 3W2OA 4BI1A 4JG6A 4BHZA 4E73A 4FKVA 4F9WA 5AP0A 4FT9A 5A4EA 4AOIA 4J95A 4DLJA 3PWYA 2VV9A 4CRSA 3ZRLA 2OJGA 4MHAA 4UWYA 3L9PA 5DT3A 3CPBA 3KULA 3SGCA 2AC5A 2CSNA 2ZM1A 2XH5A 1MQ4A 3WF9A 4AZSA 4H36A 2BDJA 4FX3A 3A2CA 3NYOA 4UBAA 5HE2A 3VBQA 3UOHA 2VTRA 3MWUA 4YZCA 1JVPP 2GHGA 2YLEA 3RPYA 2UZNA 2F7ZE 2G2HA 3PY3A 1CM8A 4I93A 1OVEA 4O96A 1UWJA 3IECA 4L67A 2YHVA 3TTJA 3JVRA 3U6HA 2F7EE 2HCKA 3UZRA 3RMFA 1VJYA 4X6RA 2VWYA 4YGAA 5IQHA 5CY3A 4IAYA 3JY0A 4YJPA 3RCDA 5IPJA 3CGFA 2Y9QA 1GIHA 3G51A 4OTGA 3VHEA 3R7OA 3D2IA 3DPKA 1SNUA 4PL3A 1YOMA 2WELA 3SHEA 2Z2WA 4CKIA 3VS6A 4L43A 5CU2A 2HY81 3DS6A 2Z7QA 3RPSA 4AA0A 1YWRA 3QA8A 2OICA 4QMOA 2UZOA 3DB6A 4R5SA 4UZHA 5DWRA 2XK3A 4KAOA 4G16A 4M13A 5J8IA 2CN5A 4KSQA 3AGMA 3CKWA 5HCYA 4A9SA 1ZZ2A 4ERWA 2CNQA 3LW0A 2I0VA 4MVFA 3BZ3A 2P0CA 4O22A 3DJ6A 3ZC5A 4W4WA 5LWNA 4FKSA 4M69B 4O0XA 4G2FA 1KE5A 3O50A 4M0ZA 4ONAA 4BTMA 3HYHA 4NM7A 5CYIA 4BIEA 4QTAA 4KABA 4QP2A 4I5CA 5K5NA 3ZFMA 4CMTA 4DGNA 2R3HA 2JFMA 3V5WA 5BMSA 3VVHA 3P5KA 3LMIA 4FEWA 4IQ6A 3MS9A 1DAWA 2VGPA 2R3OA 3BGPA 2WQEA 3HEGA 3R00A 2ETRA 4R1YA 3R8MA 3RGFA 3ZC6A 1QCFA 2A0CX 5GZ9A 4NIFB 3D2KA 4R5YA 2ITXA 4CTBA 3KXMA 2DQ7X 3DGKA 3G5DA 2W06A 3Q4ZA 2X1NA 4ID7A 4AW2A 1NT2A 2VX1A 5HIDA 5HLWA 4KBKA 4EBWA 4N0SA 4Q5EA 5EHOA 3QTUA 3SG9A 4PF4A 3DOGA 4WOVA 3ACKA 4FKQA 4G34A 3S4QA 3UYSA 3GUBA 2G01A 3GNIB 3QQKA 3FZTA 5CF5A 4J99A 4RIXA 2J51A 4ITHA 4M68A 4I20A 2J5EA 2R7IA 4MBJA 2YLFA 1V0PA 3G0EA 5FP6A 4EQUA 4A06A 4N6YA 3WF5A 4FSTA 3JR1A 3LKMA 1SNXA 5HCZA 5A4TA 3GVUA 3IPHA 5KX8A 2X2KA 1QPDA 2PVKA 1XH6A 5CVHA 4IMYA 2QR7A 2FH9A 5J95A 4KB8A 4ZTMA 4D0WA 2C6TA 1G8SA 5CQUA 3R8UA 3SDJA 4TRLA 4JX3A 4HCTA 2Q83A 1Y8GA 3CE3A 3DZQA 4IX6A 5M4IA 3PXRA 1CSNA 5GJDA 2XNEA 3NNWA 3D5UA 5AFVA 2B52A 4LL5A 3UVRA 1PKGA 5GIOE 3FUPA 3TUCA 3ULIA 3FSFA 1E9HA 4JR3A 5DN3A 3TKUA 3IOPA 4RQKA 4DEHA 2OFUA 2PY3A 3LIJA 5AM7A 3TIYA 4TNDA 5L8LA 3OWLA 4YBJA 2G15A 2VWBA 4M3QA 3HA6A 2ZMDA 4RIWB 5DEYA 4HVDA 3FI4A 3P0MA 4K6ZA 5IUHA 3PP1A 3Q6WA 4PPAA 3VS1A 1P4FA 4BDAA 2XNGA 1IAJA 3PA4A 5DI1A 1JLUE 2IN6A 3KK8A 3OCTA 4G1WA 4NTTA 5CEMA 4TW9A 4EHGA 4JBOA 3UC4A 3SD0A 1Q99A 5CZIA 3W2PA 3EKKA 3UG1A 2XBJA 3KRWA 4DEGA 2XJ0A 5BVNA 3PDTA 4J97A 1HCLA 4FT0A 4H1MA 2ITNA 1DAYA 3OCBA 5DEWA 3KGAA 4FVPA 3ALOA 3KXGA 1O6KA 4JDHA 5HEZA 1SVGA 2ZV8A 3FC1X 1V0OA 4XG3A 5G6VA 1MUOA 2JIVA 4II5A 4ASXA 3L1SA 4BZNA 3V5JA 3PTGA 3SRVA 4FIIA 1RJBA 4ENXA 4YO4A 2QO2A 3U6JA 4PP9A 4WBOA 4PRJA 3U8WA 4AE6A 3SQQA 2PL0A 2CGVA 2WD1A 3TDWA 1ZOHA 3OXIA 3R83A 2ONLA 4GMYA 2YFXA 2YISA 4P4CA 4G31A 5B2MA 2V55A 5EYKA 3R0TA 4MAOA 4MD9E 4IAKA 4GFGA 3K3JA 3ZSGA 1Y6AA 5DLSA 3ORKA 4CZYB 3S1HA 4IAFA 5FEQA 4GUEA 3TKIA 2CDZA 3A99A 5M09A 3RALA 1XR1A 2UZWE 5ACBC 4FICA 2ITWA 2Z7SA 3P23A 5E8SA 2W1DA 1TVOA 3O71A 4NJ3A 3V5QA 2QQ7A 3FXZA 4I4FA 1W98A 3MSSA 3Q4CA 4X2FA 4AT5A 4DN5A 2XYNA 1QMZA 5C26A 3QTSA 4L52A 4N6ZA 4ZTNA 1DI9A 3D14A 3MA3A 3NYXA 4D4RA 4QNAA 3QZHA 4FR4A 1ERKA 5F94A 1OIQA 4D1SA 4D2WA 3MGYA 4R6VA 4E7WA 2B0QA 1P14A 2C5OA 5IMEA 3PSDA 3UGCA 3PZEA 4ZSEA 2CPKE 3ENMA 5DHJA 5FEEA 1PRYA 4HGLA 1W8CA 3MTLA 4ZTHA 4KWPA 4LL0A 3VUIA 3PSBA 4AG8A 5A4CA 1PY5A 2G9XA 3CJGA 4NM5A 4QTEA 1ZWSA 5IQEA 2YABA 3UVPA 3GQLA 4QMNA 3R30A 4UMTA 3VBWA 2JKOA 1JWHA 3OTUA 2WPAA 3FLWA 4EKKA 2WMAA 3ZO1A 4PQNA 2JIUA 1URCA 3IW6A 3S0OA 2WFYA 1VEBA 2ITZA 2PVHA 2CGWA 2VO6A 2R3GA 3PYYA 4QMXA 5GJFA 3UO6A 4PTCA 3MV5A 4O27B 4E20A 2PZPA 3C0GA 5D1JA 4IZAA 2WMRA 3UIXA 4LOPA 1TQIA 3A8XA 4EC9A 3QX2A 4PDPA 1IRKA 3NW7A 4WRSA 4XEYA 5DIAA 4RIYB 4ANNA 5AM6A 2Z60A 3LFBA 4ZZMA 4HGSA 4PWNA 2WQBA 4TY1A 4A7CA 3NVMB 2EB2A 4CV8A 4MEDA 4EOLA 1WVXA 2QLUA 3SKCA 5KZ0A 4F63A 3LQ5A 3W2QA 2H96A 4O1OA 2PZIA 3HP2A 1M52A 1OUKA 2X8DA 3I1AA 3R22A 3TNQB 4EWQA 3LCOA 4EH3A 3UNZA 1OKYA 3KC3A 4OAUC 3GCPA 5CI7A 5IA3A 3EKNA 1YI3A 4BDCA 5AAFA 1XKKA 5KMKA 1YHVA 4LFIA 3E62A 3WZEA 3FYJX 2W1EA 4GSBA 2X6DA 4QQ5A 5AUYA 3OUKA 3RVGA 4ZXTA 2GS2A 3NIZA 4FNZA 3LCDA 2BHEA 3MYGA 4F9BA 4Z16A 5JFVA 5ACKA 1PMUA 2BRGA 4UYNA 3WZDA 1GZ8A 1UVRA 3D5VA 4PMMA 4NW5A 3FLSA 3PXKA 3CXWA 3FMEA 3F7WA 2XKFA 3GENA 4C02A 2C69A 3G6GA 4XYFA 5L2TA 5EFQA 2WB8A 5JZNA 3AOXA 1YOLA 2XEYA 3FPMA 3LXLA 2YJRA 2JBOA 4K0YA 4RQVA 4R3RA 4NL0A 4F7SA 3P79A 4D4SA 3BV2A 3W2SA 4FG9A 4AUAA 3OEZA 4BCMA 3TUDA 3MPMA 3BWFA 3R9OA 3CQUA 3LXKA 4CZTA 2VTJA 3KEXA 4E1ZA 4EOSA 2BZJA 2VWVA 3ODYX 1OZ1A 4DH8A 5FGKA 4FTJA 2W7XA 4YJUA 3QUDA 1Z9XA 2GNHA 3F5XA 3QRIA 2PWLA 4O91A 1H26A 3L9NA 4FL3A 3RI1A 4ZSAA 1UU7A 4I24A 2KTYA 4DC2A 1WBNA 2VU3A 4BCQA 3AGLA 3G9LX 5JZJA 4MXXA 4EHVA 2W4JA 3BU6A 2WTIA 5HG9A 5ITAA 1WCCA 3VS4A 1U5QA 4P5QA 4YJSA 4YJQA 2YZLA 3Q9YA 2EWAA 4ENYA 1R0EA 4JAIA 3KCFA 1SYKA 4MF1A 3E8NA 3ZRKA 4RVMA 2WEVA 1E1VA 3LXPA 5EG3A 4DF3A 4OR5A 3E8EA 4EH5A 1NA7A 1OIUA 1Q61A 2VTQA 4NKSA 4A4OA 3JUHA 4HYHA 4AZTA 1KSWA 4AGWA 5KMOA 3GU4A 5HX6A 5HX8A 4QRCA 5CAQA 4XNEA 2B55A 3HVCA 3DA6A 3UNJA 4DT8A 1B39A 2YDKA 3DQWA 3QUPA 2I0EA 4Q5HA 1Q4LA 2R5TA 3UODA 2ITTA 2R3JA 4FL2A 4AF3A 2J2IB 5CF6A 1WAKA 4X2KA 5J9LA 2GSFA 2PE0A 5E8XA 4LV5A 3DJ5A 3BCEA 3NUSA 4OTWA 2FSMX 3LFCA 5ANJA 4JOAA 3VUMA 4EHEA 3EQPA 1XBCA 3PJ2A 5LARA 4EZ3A 1JSUA 3GXLA 3OEFX 2OW3A 2HXLA 1HCKA 4KKHA 1H28A 3LJ0A 5HO8A 5J1WA 3DKFA 3HMOA 4NM3A 4YLLA 4PP7A 2FSLX 2OGVA 3POOA 5M53A 2VNYA 2XK9A 4XUFA 4BWPA 5E4HA 1H1RA 2QKWB 4AACA 3E7OA 3C4WA 5BUEA 2QI8A 4EEVA 3KA0A 5EDRA 3GB2A 2BFYA 3W32A 2R3FA 2OXYA 3QXPA 3ERKA 5CVGA 5FDPA 5EM5A 2C6DA 2QOQA 3KULB 3PJ1A 2UUEA 4BCOA 4EH9A 1M14A 3EFKA 3OFMA 3JPVA 2DWBA 4IHPA 2WAJA 5LVNA 4GK4A 4FMQA 5DNRA 5C4KA 4I21A 5BPYA 4JI9A 3LOKA 2I0HA 3BGQA 4EYJA 2OIBA 4AZEA 2JKQA 3EZRA 3PVWA 4IB0A 4JIAA 1JSVA 3KF7A 5FRIA 3HV5A 2V7OA 1Q3DA 2W17A 3QQUA 5IU2A 3RWPA 5I0BA 4JDJA 5CEIA 4RC3A 4E5WA 4JJRA 4PPCA 5M51A 4D55A 4K1BA 3U4UA 3QC9A 1YI4A 2RG6A 3CPCA 4AGDA 2XEZA 1OKWA 1A06A 2A27A 4EK4A 3BKBA 3R01A 4EZ7A 2VX3A 3EH9A 4BDDA 3Q3BA 4C34A 3EYHA 3H3CA 4P90A 3NUNA 4RA5A 4PX6A 4KIPA 4Y95A 5IH6A 4PDOA 4LGHA 2UW8A 2X4FA 3WE8A 3OROA 3QLFA 4I22A 1LR4A 1RE8A 3R7YA 4GEOA 4O38A 4BCFA 3U54A 4TPTA 5JH6A 3OF0A 2CKPA 3CR0A 1BUHA 1PMNA 3OWJA 5KZIA 3GC8A 3DFAA 4CFVA 3O23A 1UV5A 3MJ1A 2X8IA 1ZYSA 4KUJA 3EIDA 3F6XA 3MVLA 3V5LA 4CXAA 3G15A 2Z7LA 5AP5A 4AP7A 2WTWA 3FWQA 4ZZNA 2BUJA 3FZRA 5B0XA 2Y6OA 4I6FA 3Q4UA 4V04A 4IH8A 5HE3A 4DFXE 1KWPA 3LQ8A 3SA0A 3F9NA 5EK7A 5FTQA 4BIBA 3Q52A 3QL8A 5E8ZA 5JQ5A 2QU5A 4GT3A 3IW7A 3OZ6A 3V8TA 3A60A 4MNEA 2ITVA 3S95A 4O7TA 4USFA 4I0TA 3QZFA 3R6XA 2R3QA 1K2PA 1OPLA 3QRUA 4MNEB 5ETCA 5LCJA 2HWOA 4E6DA 5F20A 5H8BA 4Q9ZA 4TYJA 1Y57A 3WBLA 3MW1A 5EI2A 4CYJA 4R77A 3OHTA 5LMKA 2X9FA 4XV1A 1L3RE 2PZRA 2H8HA 4HVGA 1OL2A 1YXSA 3RM6A 2IZUA 5K4IA 2UW7A 4BFMA 1KV2A 4GFMA 1LP4A 4FSRA 4GU9A 1M7NA 4AT3A 4O84A 4B7TA 5IQCA 4BCNA 4FZ7A 3KREA 4OLIA 4O6EA 4IVCA 4JIKA 4C4JA 4EOPA 3W33A 4F08A 2Y0AA 1YHWA 4YTCA 5KHXA 2O63A 4ZMFA 2BILB 2IG7A 4W4YA 4K11A 3HNGA 3FAAA 2NRUA 3EHAA 4H3QA 3DB8A 3ZOSA 4I6BA 4FKRA 2W1FA 2XKDA 3EQGA 3QCXA 1WZYA 4DH3A 2VNWA 1TKIA 4NYEA 2HK5A 5KMNA 4FSNA 3EQFA 3FMHA 4TXCA 2R3RA 4QMMA 4K2RA 5HNBA 3TV6A 4AW1A 4RJ5A 5LVLA 4GT4A 4EK8A 1O9UA 1XBBA 2HZNA 4ZMEA 3K3IA 5F9EA 5CEOA 4HPTE 5HG5A 5M4CA 4QYEA 2IZSA 4BZOA 1QL6A 3CD3A 4HVHA 1M2RA 2XIYA 4ALVA 3GFWA 5AUXA 5HKMA 3QHRA 2CCHA 1OL7A 2PMNX 2Z02A 4FIHA 4F1OA 4BI0A 2ZVAA 3LAUA 1JOWB 5HLPA 2RGPA 2PUIA 1FVRA 2C5NA 4V01A 3UDBA 3UE4A 3ZRMA 2QODA 4KA3A 4FSWA 1G5SA 3GC0A 2C1BA 2PMIA 4LMNA 4AOJA 1OIYA 4BDGA 4DHFA 1WBWA 3CSVA 3QRKA 5IZFA 2BZHB 3TI1A 3WI6A 5DYJA 1WVYA 3KF4A 4BCPA 3QGYA 3MB6A 4I6QA 5ANOA 3VF8A 5B7VA 3IG7A 2WMSA 4RVKA 4DGMA 5DBXA 2UW9A 4J53A 5DH3A 2I1MA 1Q5KA 2V5QA 2YERA 2WTDA 2ZAZA 3DY7A 3EYGA 5AWMA 3DU8A 1Q24A 2NP8A 5BUIA 4NM0A 5L2SA 5HTBA 3FY2A 4O7ZA 3LPBA 4CV9A 1QPJA 4U97A 2C6EA 5KBRA 4ZLZA 4IEBA 2J0MB 3F69A 2YM7A 3DFCB 3OS3A 2X9EA 1VYZA 3EWHA 3QQHA 4M15A 4FV0A 5IF1A 3QCYA 1S9IA 4BHNA 2WQNA 4F9AA 5D11A 3GCSA 4ZTLA 4FKTA 4USDA 4E4LA 4IXPA 2BZIB 3C4XA 3KKVA 4EHZA 2W1CA 4WG4A 2UZDA 4HYUA 4HJOA 1XO2B 1OL1A 3ANQA 2R3PA 4GU6A 3AD5A 5LOHA 3P1AA 2BKZA 3PVUA 3DAEA 4JDIA 2R3IA 4Z3VA 3IDPA 2OJFE 3L8SA 4AA5A 3EZVA 4Z7HA 4J8MA 3QWJA 4F0FA 2J6MA 3R28A 4F65A 2PUPA 2BR1A 3EQDA 5CSHA 2GPHA 4JBVA 3EOCA 3FZ1A 1Q41A 3PVGA 4WHZA 2CLXA 5CF8A 5I4NA 4QYGA 3HUCA 2G2FA 3W55A 4DEEA 5BVEA 1R0PA 4RJ4A 5DPVA 4F6SA 3Q96A 2W1HA 4ZS0A 1OB3A 3HZTA 4MF0A 1M7QA 2WHBA 2KULA 1PKDA 3ORZA 3PE1A 4C38A 4PL5A 4ZSJA 4AWIA 2HENA 3R1YA 3UJGA 4AQCA 2A2AA 3FXWA 4C2VA 1JQHA 4HGTA 4B99A 5LXMA 4CSVA 3NW5A 5A4LA 2OJ9A 4KIQA 5J79A 2XM9A 1MQBA 5CLPA 5EM6A 3T9TA 3QCSA 4HVIA 2F4JA 5E1EA 3AMYA 4CFUA 3UNKA 4PDSA 2QC6A 2QOBA 4CRLA 1JKTA 4I4EA 3M11A 3EQHA 4S32A 3RKBA 2C0OA 4RA4A 3ZDUA 4W9XA 4BYIA 2PMLX 4CFNA 4ITIA 4DE4A 2VTAA 2NO3A 2Y8OA 3FLQA 3TIZA 4IFGA 4AOTA 4MYGA 2PZ5A 3DKGA 4L7FA 3I6UA 4AN3A 4UN0C 4MXCA 4MD7E 4FV7A 3G9NA 4QMPA 2QOHA 1YXXA 3BV3A 4EORA 3OY1A 2JITA 3IDBA 5EKOA 5IA5A 3SOAA 4CFMA 3OY3A 4RMZA 3PWDA 4L3PA 1PMVA 3ROYA 2X7OA 2V62A 3AXWA 3MJ2A 4X0MA 3F3UA 4EK3A 2ZM4A 3P4KA 3D7ZA 2CNUA 5HBEA 1RW8A 3DLSA 4XLIA 5HG7A 4EH4A 1BYGA 1F3MC 2BROA 2ETMA 3POZA 3RP9A 4NW6A 4BDKA 1J7LA 3VS7A 2YM5A 4P2KA 1WBPA 4RX9A 2CN8A 5CX9A 5CNOA 3ZUVA 2AUHA 1H1SA 3TZ7A 1UNHA 1PHKA 2XBAA 4UMUA 2QURA 3I81A 1PXNA 3ULZA 1V1KA 2ERKA 3K2LA 4DFLA 5BVKA 3FV8A 2CKQA 3BGZA 4U79A 2CKEA 4R3PA 4I5MA 4JRVA 3II5A 1VYWA 2ZOQA 3MIAA 3GCVA 4LGGA 4RIYA 4ASDA 4DEAA 4MXAA 4UXLA 3S00A 3DT1A 2R3LA 1ZY5A 2Y4IC 3JYAA 3WYYA 5HVKA 4F7JA 4MBIA 1ZYCA 4H1JA 3MH1A 2BDWA 3KN5A 3D5XA 4NSTA 4GG5A 5HVYA 4UMQA 4RJ8A 3I79A 2O2UA 5AAGA 2C3LA 5LJJA 4FOCA 4Y46A 2VO7A 3ZUTA 3DBDA 3V8SA 2EB3A 2BRHA 3CS9A 3IONA 2IPXA 1NVSA 2C30A 3R2BA 5CVFA 3W16A 5DT4A 4UY9A 3EFJA 1YWNA 1R78A 4QMYA 4IAAA 3RPVA 4BN1A 3UC3A 2YAAA 3EQCA 2FYSA 3ZTXA 3L8PA 4V0GA 3A62A 3FDNA 1VZOA 2YIXA 4BDBA 4JL9A 1U59A 3I7CA 3MBLA 5BVOA 3GU8A 4DAWA 3BLHA 2PUUA 4BC6A 1OBGA 3Q53A 2PVFA 5EI8A 2VTNA 3IKAA 2ZB0A 3Q32A 5AP7A 5HBHA 5L2IA 3G6HA 1O6LA 1UKHA 2JIIA 4UB7A 4ZY6A 1K9AA 3Q5IA 2IJMA 4BWKA 3PJ3A 4D4VA 4FTOA 1OL6A 3BYUA 3FKOA 4FSQA 4N70A 2W5HA 4YO6A 5KE0A 4R3CA 4YR8A 5AR2A 3EQRA 3NMUF 3VAPA 2OU7A 4YZMA 4RC2A 4EJNA 4ZLYA 4BTJA 5BVFA 4HZRA 4AW0A 2EXMA 3VUHA 3RCJA 4EONA 1Y91A 2RG5A 3FQEA 2GTMA 2P3GX 5FBNC 2GTNA 3BE9A 4MQ2A 4P7EA 3COKA 5CNNA 4QMLA 1XH9A 4XS2A 4QMVA 3EL8A 5FDXA 2E9PA 3H30A 4DA5A 1U46A 2W96B 4FTUA 4QPMA 3BI6A 4TYHA 2UZBA 3JXWA 4FZFB 3C7QA 4BRXA 5CEPA 2WKMA 5A6OA 1XH7A 3F3ZA 4C3PA 3AC4A 3VC4A 3ZONA 5AA9A 5D10A 1PXJA 1J7UA 1KOBA 4NTSA 5AEPA 3D83A 1Q3WA 2PSQA 3AD6A 5IQDA 3ET7A 4QQCA 5TO8A 3DDPA 4O0WA 2GNFA 4QPAA 4F6UA 2WTVA 5IH5A 1ND4A 3FEGA 3U6IA 3PLAE 1XHAA 4H39A 4ZJIA 5HQ0A 4APCA 5M08A 4RC4A 4GK2A 4CD0A 4DTKA 3UOLA 3VF9A 3THBA 3GI3A 2UW5A 2ITPA 3NNVA 4E5BA 3FLYA 3Q9XA 2HZ0A 2W99B 4ANQA 4PNKA 5CAUA 1H1QA 3BQRA 2PHKA 2RIOA 2OH4A 3IQ7A 4A07A 4WT6A 1SVHA 1IR3A 1JSTA 4GVJA 4J52A 2B4SB 4RX5A 5HCXA 3CQWA 2WXVA 4HCUA 4UWBA 4OT6A 2DYLA 3W18A 2XKCA 1AQ1A 4LQMA 3C5IA 5CSVA 2ESMA 1OPJA 2Z8CA 3PRIA 3HAVA 3F3TA 2W5AA 3OBGA 5DR2A 3QQLA 1I09A 2WU7A 3DKOA 3PLSA 4OTQA 4YTFA 4EWHA 4ALWA 1WBTA 3H0YA 3CP9A 4ZK5A 4RJ7A 3E92A 3AQVA 4FV8A 2QOFA 3RK9A 3ZCLA 1XH5A 5CT0A 3Q5ZA 4G5JA 4OT5A 3RHKA 5I9WA 2E2BA 4IZYA 4RWKA 2X81A 4A9RA 5K9IA 5GIPE 3NWWA 4E4NA 5A3XA 5LCKA 2WU6A 3DTCA 3PIZA 4IW0A 3HV6A 4L3JA 5JT2A 4PTEA 4WIHA 4EH6A 2ITYA 1BLXA 3ETAA 4FKPA 2VAGA 3RZBA 4FSUA 3QHWA 4ZP5A 1Z57A 5IA4A 3CTQA 4MNFA 4J7BA 5HD4A 1OMWA 2E9UA 2WMWA 4U8ZA 1Z5MA 1CTPE 2VGOA 3LFQA 5C8MA 4O7NA 2XIKA 4IZ7A 5CSWA 3UP2A 3V3VA 3RAHA 4FODA 3V8WA 5JFSA 3OMVA 2YWVA 5IQAA 4UEUA 2C47A 2IVTA 2OXXA 3TKHA 3EB0A 3O96A 3DBQA 3BHYA 4F4PA 4RJ6A 1KV1A 2X6EA 4PDYA 3BEGA 3L8XA 4FIEA 5CZHA 3NNXA 2OFVA 4B0GA 3B8QA 4NFNA 5A14A 5B2KA 3IW5A 3GC7A 3MFRA 4FYNA 3TTIA 5HU9A 2Y4PA 4M97A 4KNBA 4FSYA 3SLSA 3ZS5A 3PXYA 4XOZA 3TWJA 4FK6A 1V0BA 4DH5A 3Q2JA 3TL8A 1BI8A 2XIZA 4OTFA 3M2WA 4XG6A 4GUBA 2W1IA 5HESA 1U4DA 5HE1A 3DAJA 3NUYA 1O6YA 5A46A 3SAYA 2CKOA 4MH7A 2C6MA 4FSZA 3KMWA 2QOLA 2R3NA 4RFYA 5AUZA 4ZLOA 2GS7A 2XF0A 2JLDA 2F2CB 5A54A 3BQCA 4PTGA 3TV4A 4F1TA 3S3IA 3ATSA 2C6IA 5EW8A 5LVOA 4MXZA 2BFXA 3IW8A 2IO6A 4HPUE 2XM8A 4JQEA 3NUAA 5M07A 4IDVA 2WGJA 4EQCA 4AU8A 4EUTA 1YWVA 4BKYA 3ELJA 3NX8A 5ETAA 3AT3A 5IEXA 1YDRE 3C51A 4WNOA 4CLJA 2R4BA 3ROCA 2F9GA 3UPXA 5E9EA 4C4EA 3CGOA 2W5BA 4C3RA 5J7HA 5AP2A 3COHA 4N57A 3R1NA 4R8QA 2B53A 2GFCA 2OF2A 4LGDA 5D7AA 5C27A 2ZMCA 4YJOA 2VTHA 4QP3A 2VWUA 3LE6A 5HOAA 3KRRA 3UIUA 4EYMA 3NAXA 3ORMA 4U3ZA 4HW7A 3VHKA 2W9FB 2C5VA 4K18A 5CF4A 4ZSGA 4IJ9A 4KBAA 5K0KA 3LFAA 1PXOA 1BKXA 2GDOA 2XCHA 2X7FA 2NRYA 2XIRA 2GNLA 5JQ8A 3LFFA 4WBBB 4ANSA 4BI2A 5M56A 3I60A 4I23A 2VRXA 3P7BA 4XBRA 1TQPA 4S30A 4CGAA 2VTMA 3BYMA 2OZAB 3KMUA 2UZLA 3WYXA 4EK6A 4FBXA 4NT4A 5FM3A 4H58A 2P4IA 4GRBA 2I40A 4X21A 4GCJA 2PVLA 4D5KA 3F82A 2GU8A 3BHHA 1PYEA 5LMAA 3DJ7A 2B9HA 4FT5A 2HXQA 3A8WA 3B2WA 3P78A 3ZZWA 1QPCA 4DFYA 5J9ZA 1XBAA 4NJDA 2HY0A 4DG2E 1T46A 4YZ9A 1OGUA 1J3HA 1CMKE 1GY3A 3OW3A 4X3FC 4C57A 4QMZA 3UQCA 2XNOA 3ZFXA 4NEUA 5DE2A 2J50A 3KK9A 4CNHA 2CNVA 3DTWA 4X3FA 5K5XA 3PIYA 3KXNA 3ZEWA 2OSCA 3OBJA 5E8VA 3F2NA 3VS5A 2R3MA 1GIJA 1WVWA 2JDTA 4OTPA 4O7VA 3EN7A 2C6KA 3VUKA 2GFSA 3KCKA 5AIKA 4CFXA 4F0IA 5FQDC 4DYMA 4BDJA 3GU7A 3RAIA 2BDFA 2Y7JA 3PJCA 4GJ3A 5HORA 5DOSA 4O0RA 2CGUA 3FKLA 1YHSA 3HV3A 5IUIA 3C4ZA 3O2MA 4MXYA 5DA3A 5BVWA 2CCIA 5EYMA 2O65A 3QQJA 5CENA 5DRDA 3BYSA 3OT8A 1LPUA 2R0UA 4F70A 3C4CA 3CC6A 4RWLA 4PMSA 2EXCX 1ZLTA 2PK9A 3BBTB 4F9YA 5L8JA 4HNFA 2C1AA 2W0JA 3TZ8A 1YKRA 5EHYA 4FKOA 2VD5A 3E5AA 4WKQA 3C5UA 5HO6A 3KRLA 3UG2A 2PZYA 2OIDA 4AN9A 4W4XA 2FUMA 4D2SA 3PY1A 3FZOA 4M7IA 3KMMA 1H08A 3AC5A 4FV6A 5LMKC 3WARA 4K33A 4RFMA 2WMQA 5L6WL 3ATTA 4L3LA 4DTBA 4WSQA 3PG1A 1ZZLA 2Y4IB 4IIRA 3WILA 3NGAA 4FTQA 3PVBA 4XJ0A 4DEDA 5H9BA 2WQMA
chains in the Genus database with same CATH superfamily
3BHTA 3AC2A 5KKRC 4DCAA 1DM2A 2BCJA 5EI6A 2RFEA 5EM8A 3C4EA 4XG2A 3ZM4A 4YMJA 2XRWA 2AEGA 3KY2A 4JDKA 4LMUA 4EK5A 5E1SA 2YIYA 3Q2MA 5FXSA 1NY3A 2BIKB 3QU0A 4EZ5A 2GHMA 3AMAA 3HMPA 3DQXA 4BDIA 3OVVA 4EUUA 4BGHA 2QG7A 3D7TA 4H3PA 4QMTA 4E93A 4KKEA 4FUXA 1B38A 3ORXA 1UWHA 4WNPA 5CU6A 5F95A 3HLLA 3DBFA 1YXUA 3LMHA 3K5VA 3LFSA 4BDEA 3F5GA 5EOLA 5IQFA 1W2DA 1M17A 2JAMA 3FKNA 3P08A 5I9ZA 3UOKA 2IZRA 4WG5A 5KNJA 4PY1A 3ZBFA 2BKKA 2VWZA 1MRVA 3FMMA 3T9IA 4H05A 3IK3A 1H00A 3ZM9A 3S2PA 3F3VA 1G8JA 4UYAA 2ZJWA 3EL7A 1STCE 3V5TA 2X0QA 1YQJA 2E9VA 2F57A 3QTWA 5D12A 5AA8A 2A1AB 5K4JA 4I1ZA 4YSMA 1ZXEA 4F6WA 4FEUA 2YEXA 2XB7A 3OXZA 3QD4A 2W4KA 4FKUA 5IKWA 3ZDIA 1XMMA 1AGWA 2H9VA 3LMGA 2J0JA 3KRJA 4IDTA 4YHTA 3UIBA 2P33A 3QZIA 1MP8A 1P4OA 3L9LA 4W8DA 4FT3A 2DUVA 4M0YA 5EW3A 4J8NA 2Q0NA 3N9XA 4S31A 1NVRA 1PXMA 3PA5A 3T3UA 4E6CA 5M55A 4R7BA 5ANEA 3TNPC 2PU8A 5HIBA 5FP5A 4O0UA 4GYGA 5JN2A 2XP2A 3OT3A 3IGOA 4M66A 3ZLSA 2VTLA 5GZ8A 4NCTC 1W83A 2WIHA 4TN6A 3U55A 4X3FB 1FVTA 5GHVA 4AE9A 1GAGA 3GP0A 4MD8E 4FEXA 4F7LA 4PL4A 3V01A 2W1ZA 2A19B 3EJ1A 4PPBA 4X2JA 1GZOA 2WQOA 5A9UA 1ZARA 3AC1A 4I6HA 2IW8A 2PVJA 4WO5A 5TE0A 4IWPA 4YJVA 2XNNA 4NK9A 3ZLWA 3NRMA 5IMXA 2C5YA 2XNMA 3UZTA 4ZS4A 5AR3A 4BTFA 4IX4A 2V0DA 4DEIA 2W9ZB 1R39A 5AUVA 3UZPA 2PTKA 2CJMA 2Q0BA 2QNJA 2WMBA 4IB1A 4D2PA 3D5WA 3QTIA 4FG8A 3CD8A 4DG3E 3O7LD 2WMUA 3PPZA 2B54A 4L44A 3VULA 3EMGA 1FOTA 3QTXA 3BWJA 3T8OA 5EHLA 3TXOA 4FVQA 4L42A 3TT0A 4B6LA 5I9VA 3ANRA 5AUTA 2CLQA 5E8YA 4CFFA 3OWPA 5HNIX 3QF9A 1KE8A 4G3EA 5IISA 3LVPA 4IAZA 4QP4A 4FEVA 4QPSA 3U4WA 4I5PA 3MY0A 2X4ZA 3DCVA 4RBLA 5EKNA 1APME 1ZOGA 4WA9A 3F5PA 1F0QA 4M84A 3QBNA 1VR2A 3KRXA 2XCKA 5ICPA 4JBPA 2QVSE 2UV2A 4NCTA 4O1PA 5JFWA 3F2RA 3TJDA 3TV7A 3D4QA 3H9RA 4KD1A 4WSYA 2C0TA 3NPCA 2OI4X 2G1TA 3HDMA 4MWIA 4I92A 2Z7RA 4LUEA 4RIWA 5K3YA 3SW4A 3IW4A 3QQFA 4DG0E 2JKMA 3ZXZA 4FIJA 1KUTA 3SG8A 2W4OA 2UZEA 3BL9A 4W8EA 4FK3A 4TZRA 4CT2A 3RNIA 2ZM3A 1A9UA 2BTSA 2C0IA 4FT7A 3W1FA 4MUQA 4N4SA 2BRBA 3E93A 4J71A 3R9NA 1J91A 2QO7A 3UBDA 3VBYA 3WF6A 3WZUA 2X8EA 1SMHA 5D9HA 1PXPA 2HWPA 4LOQA 3A7FA 3QKMA 5ANDA 4CZUA 3VW8A 3AD4A 4TYIA 4MWHA 4DFBA 3F2AA 3HP5A 3NSZA 4GIHA 3W0RA 4EOOA 2GMXA 5AJQA 3TNWA 4YSJA 2IVSA 3KU2A 4O83A 3E3PA 4KIKA 3TCPA 3A7IA 4U7ZA 4C4IA 4RRVA 2O64A 2QU6A 2XJ2A 3IO7A 2OZOA 4QMWA 4O4EA 2FA2A 5CANA 3ALNA 3SC1A 2REIA 4ASEA 3W0QA 2PMOX 4UALA 4PV0A 2JDVA 3FHRA 2C6LA 3IGGA 4X7QA 5ETIA 3CLYA 3VONA 2WOUA 4U3YA 4RIXB 1H25A 1JPAA 1Q8UA 2JBPA 4ZOGA 4BBMA 5KMIA 4ZEGA 4L8MA 4OW8A 4UWCA 5CXHA 3WIKA 3LFEA 4O7SA 3FXXA 3E8CA 1Q62A 3RZFA 4EI4A 4BCGA 2XUUA 3LZBA 2NNWB 2GS6A 3VO3A 4BCKA 5AR4A 2GHLA 4KRCA 5CEQA 3MVMA 4QP9A 3QZGA 4AFEA 4O7LA 1YDTE 1K3AA 2R64A 3H4JA 3QA0A 2YAKA 2YM4A 3R2YA 2I6LA 3AT4A 3PZHA 2XA4A 3P9JA 4U44A 5ANGA 2LAVA 4FKIA 2VO0A 4F1MA 3SW7A 4UMRA 3MFTA 3QRJA 4YNOA 3RAKA 5K0XA 3LFDA 4XV3A 4K77A 2X0GA 5IQBA 4LM5A 3VW6A 4ANMA 4BL1A 3TYKA 1PXIA 4IACA 3UMXA 2HAKA 3QTZA 5E92A 2HW7A 2R7BA 2YA9A 2YITA 4IE9A 4BKZA 3VN9A 4RX8A 1A48A 5EYCA 1R1WA 2IVUA 2QONA 4TTHB 4ACGA 4BY9E 4HGEA 3R73A 5C8KA 1AD5A 3QKLA 4OAVB 3NEWA 2EVAA 4JT3A 4RZWA 3N51A 5T3QA 4ACMA 5AADA 2BIYA 4CG9A 1H1WA 4E6QA 3BBWA 2J90A 3BRBA 2OLCA 2XRUA 4JNWA 3AKLA 5M57A 2CMWA 4C0TA 4XOYA 5BUJA 4ACDA 2VTSA 4LRMA 4XG4A 3TMOA 4I94A 3WF7A 4BBEA 2JFLA 5J87A 2H6DA 3GCQA 1J1BA 3R02A 3R63A 4ZY5A 3HMNA 5CU4A 3OUNB 3MTFA 3VWAA 2W05A 1W84A 1ZRZA 1UNGA 3FLNC 2OJIA 5HG8A 3OTVA 5KMJA 2YCFA 4BR3A 3NZ0A 2OK1A 4PUZA 3ZLXA 4ZZOA 1E1XA 3PUPA 4YC6A 4IWOA 4MKCA 4D9TA 3F3WA 3TEIA 4C2WA 3TNHA 2J0LA 4YU2A 2DS1A 3A4PA 4JR7A 2R0IA 4ALUA 3ORPA 4D1ZA 2P55A 1JNKA 3BELA 3U9NA 3VS0A 1UU9A 5G1XA 4MTAA 3VUDA 3RWQA 3CY2A 4Z55A 3HX4A 2QLQA 4NZWB 4HVSA 5HIEA 2CGXA 1Y6BA 4X2NA 4YHFA 4UXQA 4I0RA 3U87A 5DG5A 4XG9A 3MB7A 4Y5QA 5M06A 1OL5A 3LJ1A 2RFNA 4CG8A 2EU9A 2G2IA 3V5PA 3D15A 4TYEA 3L9MA 3FI2A 1GJOA 3UMWA 1PMEA 5H8GA 3K5UA 3U51A 3HKOA 2QHMA 3EQBA 3OOGA 3QD2B 2FB8A 1PXKA 3LFNA 3SV0A 4R1VA 4BDHA 5FLFA 1XH4A 2UZVA 4G3DA 3ORLA 5EYDA 5AUWA 2XS0A 4DTAA 2GNIA 2QOCA 3H9FA 3G0FA 2BRMA 4DCEA 1FQ1B 4O0TA 2WTKC 3P86A 2VN9A 3EQIA 2QOOA 5GJGA 1ZYDA 1KE6A 4WRGA 4D9UA 2YDJA 3NCZA 3QKKA 1ATPE 3R1QA 4C7TA 1BMKA 5AV3A 3PY0A 5HE0A 4JMQA 3GOPA 3DLZA 3BPRA 4YLJA 4NUSA 3BLRA 2UVZA 4DGLC 2VUWA 5ANIA 3CQEA 4O81A 3NUXA 3R71A 4BTKA 2YWPA 4G6NA 2XNBA 5DT0A 3LCTA 3RK5A 4BIDA 3UIMA 2O5KA 4FNXA 2OBJA 5FEDA 1UU8A 1LUFA 4FI1A 4IB5A 4FA2A 4RVTA 2YM3A 5DGZA 4ZTSA 3C50A 1H0WA 1H0VA 3FZPA 4F0GA 3GEQA 3A7HA 3VBVA 4RPVA 1G8AA 1OBDA 4ITJA 4PMTA 4GK3A 3MA6A 3GU6A 2XYUA 4OBQA 3QXOA 3ZBXA 4EOJA 2WMVA 3NYVA 3FMKA 4C33A 4CTCA 2EXEA 4AFJA 2WTJA 4CT1A 5IUGA 5L6OA 3PXQA 4BYJA 2XVDA 2B9JA 5FTGA 4DBXA 4W4VA 5J5TA 5C4LA 1FGKA 3LM5A 4RLKA 4O21A 3OCGA 3QX4A 5FXQA 1UNLA 4YC8A 3LM0A 1URWA 4AX8A 5BNJA 5CTPA 2X7GA 4S2ZA 2J0IA 4AZVA 4DH1A 4NU1A 2BVAA 4QOXA 1PF8A 3KVWA 4QTBA 2XK6A 1H27A 4JG7A 4KS8A 4O82A 3TJCA 4AZWA 5HVJA 5GNKA 3SX9A 4ARKA 3F7ZA 2QKRA 2WTKB 4IZ5A 4O6LA 3NNUA 4UMPA 4ANOA 3OXTA 3VBXA 4FV2A 2PVRA 2XJ1A 1J7IA 5TKDA 2JAVA 1ZMUA 3FZSA 3FQHA 4XV9A 5IA2A 4DT9A 1NVQA 4FTRA 4FVRA 3DNEA 4JQ7A 3DBEA 3R04A 3A61A 4RIOA 5T6KA 4P5ZA 2BRNA 4Y83A 3MVJA 4AA4A 5ANKA 3QD3A 2QHNA 1IEPA 1UA2A 4G3GA 4L01A 3B8RA 1U54A 3MPTA 4EL9A 4TL0A 3GOKA 5M4FA 3A7JA 1PW2A 4FV4A 4EH8A 4YPSA 1MRYA 1REKA 3AC3A 4WNKA 2UZUE 3OD6X 3F5UA 4XHKB 4RVLA 3MFUA 4HYSA 2X2MA 5E7RA 5E91A 4D58A 2ITQA 4FZAB 5AP4A 3WF8A 4FV5A 5CAOA 3RPRA 2AYPA 2WIPA 3NUPA 3L8VA 4HOKA 5I3RA 3PP0A 4HCVA 4WG3A 4EKLA 3ZXTA 2GNGA 1M2QA 4C4FA 2PPQA 2WNTA 1OITA 2Y6MA 1W7HA 4FIGA 1IA8A 4Z9LA 4OTHA 4C59A 3KXXA 3BYVA 5D7VA 3ZZEA 4LV8A 3FMJA 1FMOE 3QTQA 2YM8A 4IX5A 1YXVA 4JLCA 5TT7A 3DAKA 4EJ7A 2FGIA 2F7XE 3QQGA 2VTIA 4FTKA 3R7GA 2OG8A 5C8NA 3CJFA 3I5ZA 4IAIA 4IANA 3I6WA 5EW9A 3ODZX 3O7LB 1I44A 4G6OA 3E63A 3HDNA 5I9UA 1RDQE 1YVJA 4J96A 4OBOA 2IW6A 3UPZA 4CMOA 2B9IA 3C0IA 4FKGA 3OW4A 4IM3A 4O7RA 2YIWA 4RX7A 5HLNA 3CCNA 3A4OX 1W82A 3UQFA 4JX7A 2JGZA 4IC8A 5BYLA 3Q4TA 3W10A 3MESA 4TNBA 5IDPA 3MFSA 2XK4A 2J9MA 4G9CA 5CU3A 5C03A 4E4MA 3R7UA 5HZNA 4IFCA 1CKPA 3AKJA 4RZVA 4XP3A 2LGCA 3RTPA 2JDRA 3O0GA 4CLIA 2P2IA 4CKRA 5KUPA 4WUNA 4GL9A 3LLTA 4D1XA 5TR6A 4F09A 3DXQA 4CCUA 4CKJA 4FTMA 3OOMA 3QD0A 2UVYA 5AV4A 4YC3A 1KOAA 4GW8A 4XBUA 2XZSA 3HMIA 4XX9A 4CQEA 5EOBA 4USEA 5JEBA 3WZKA 1H24A 5EDQA 4AZFA 3V04A 5CAVA 5FUTA 1U5RA 3TDVA 4BB4A 3QYWA 4RWJA 4V05A 1FVVA 3ZH8A 4R7IA 5HTIA 2OKRA 1IASA 4RT7A 4FUYA 4GYIA 4XMOA 3R8PA 4D2VA 3B2TA 4I0SA 2X39A 4OTRA 5E8TA 3ZHPC 5DR6A 2WO6A 3Q60A 2VWIA 4C58A 3KXHA 2RKUA 2YJSA 3IDCA 4O0SA 4RFZA 5CSXA 4KSPA 5GZAA 1OUYA 2XKEA 3HA8A 3DK7A 4GIIA 4S34A 4YJNA 3FMDA 1PXLA 5IG1A 3RJCA 3ORNA 4RWIA 2O0UA 3E8DA 3ZEPA 1JKSA 3ZMMA 2EUFB 3QTRA 4IM2A 3BHUA 2C5XA 2ERZE 5LWMA 5JK3A 5DVRA 2C4GA 3E3BX 4WUAA 3ZLYA 1MRUA 2PVMA 5M44A 3R1SA 3G2FA 3BIZA 3CTJA 1FGIA 3M42A 5KKRB 5L6PA 4LOOA 4DFNA 1FMKA 4QP1A 3WIGA 2RFSA 4QP6A 4FNYA 2GQSA 3O51A 5ETFA 4FL1A 3ID6C 4QTDA 3KFAA 4JS8A 4ZTQA 4U41A 3AMBA 4Y8DA 5JRSA 4F99A 4ZAUA 1JBPE 3N4TA 1WBVA 1ZMVA 1WBSA 3PA3A 2OF4A 3R21A 4U42A 4KS7A 4LG4A 1YW2A 4BZDA 4W9WA 3VS2A 3MY1A 5CT7A 4YTHA 5AMNA 3W0PA 2ZV7A 5HICA 3HRBA 4U5JA 5AP1A 5H3QA 5I3OA 5CXZA 1IA9A 3NFFB 4Y5HA 5HGIA 3KN6A 5M4UA 2VO3A 1JAMA 4M67A 2ACXA 4ZIMA 5BQ0A 4DFUA 3R9DA 2XK7A 4ZY4A 3V51A 2B7AA 4YURA 5IQIA 4CCBA 4L6QA 5CS6A 2UVXA 5KMMA 1HOWA 5KMLA 3VS3A 1P2AA 3BU5A 4RGJA 3VRZA 4IWQA 4O4DA 4BICA 4LUDA 4BVUA 3BYOA 4AAAA 2YCSA 3K54A 2C3JA 3C4FA 4XV2A 3NS9A 1CKJA 5L8KA 4J98A 3UO4A 2GQRA 1EH4A 1TQMA 4FGBA 2JKKA 4YJTA 2VTPA 3O8PA 5LVPA 3PRFA 3C9WA 3I4BA 2XIXA 2XNPA 4U6RA 3V6SA 5JKGA 2I0YA 5JGAA 4BCHA 3FL4A 5IH4A 5KHWA 4U80A 1FINA 2YM6A 4XG8A 3UTOA 5JGDA 3R8ZA 5JFXA 4U9AA 1GOLA 3BLQA 5CI6A 1NXKA 5HO7A 5HHWA 3LLAA 4FE2A 2JD5A 2ZV2A 4NWMA 3E64A 4XLVA 2VTOA 4E5AX 5KO1A 5DMZA 3FMNA 4FGRA 2XK8A 4PNIA 2IWIA 2UW0A 2ZDTA 4BCJA 2V7AA 4ZJJA 4ORKA 5EM7A 3AC8A 5CEKA 1WMKA 3GFEA 3VQHA 5FM2A 3FY0A 4QO9A 2FSTX 1QPEA 4U45A 1YI6A 2BAKA 4QNYA 3ORTA 4IJPA 4YPDA 1DI8A 3SXSA 5J9YA 3PIXA 4C4HA 5CALA 4QP7A 2AC3A 4YNEA 4EOKA 3HMMA 5KCVA 2BPMA 2PVYA 4XCUA 5FWKK 5C1QB 4WNMA 4TWOA 5BVDA 3REPA 4DINA 2VX0A 3BX5A 1RQQA 4L9IA 2OWBA 2QD9A 3BE2A 3Q04A 4GFOA 3D94A 1W0XC 4A9TA 4IB3A 4C4GA 4QYFA 4D2RA 3MIYA 5IA1A 3W8LA 2GCDA 3E7VA 3DXPA 5BMMA 4C8BA 5EH0A 4I3ZA 5JRQA 2C68A 3E87A 3GGFA 2ZV9A 4H3BA 3BU3A 1S9JA 4DHJA 3VUGA 4YLKA 4MQ1A 4UZDA 3H10A 3FC2A 1DS5A 3VJNA 5AV2A 4K8AA 4QYYA 1JKKA 4XP2A 2NPQA 4FTCA 4HYIA 2RL5A 4O0YA 5CAPA 4Z7GA 4JBQA 4FKJA 3OWKA 2VWWA 3TG1A 3FBVA 1OECA 3MN3A 3OP5A 5A6NA 3MH2A 3C13A 2XAOA 3BHVA 1H8FA 1GNGA 4D5HA 4O7YA 2P2HA 4MCVA 3SOCA 4FKWA 2XANA 1PYXA 2C6OA 3UQGA 5E8WA 3WZJA 4GKIA 4AGCA 4MX9A 4YZNA 2PE1A 2HZ4A 3FI3A 4GJ2A 4EOIA 3GBZA 5AV0A 5AAEA 2OJJA 3DZOA 1Q97A 3LCKA 4D0XA 4EOMA 3G33A 3QC4A 5EQEA 2BHHA 1XQZA 2F2UA 3NUUA 3I0OA 3M1SA 1ZOEA 2YN8A 3CY3A 4JG8A 4DHIB 1SVEA 3PG3A 5I9XA 2YDIA 3HV4A 4EH7A 4Y85A 1CKIA 2YIRA 4QQTA 5HBJA 3QFVA 5AP6A 4YUQA 3QCQA 1L8TA 2VWXA 4HZSA 4IM0A 4CFWA 4DLIA 3MPAA 4KBCA 5BYYA 3KVXA 4BKJA 4G5PA 4A4XA 3RK7A 3H0ZA 3SXRA 5C9CA 4CYIA 2RSVA 2RF9A 5BYZA 2BALA 3NDMA 5IDNA 3D7TB 2HW6A 3FE3A 5HU3A 4FTNA 2ITOA 2FSOX 4BGQA 1H1PA 3R8LA 4LYNA 1SZMA 4E4XA 4DITA 4FIFA 3FHIA 4YZBA 2SRCA 4L68A 1GZKA 3TZ9A 2VTTA 3EN4A 4GG7A 4QYHA 3OG7A 2BTRA 4JAJA 4XG7A 2HOGA 5FTOA 5TF9A 2R9SA 2QCSA 1X8BA 1XJDA 5CWZA 2IZTA 4TWPA 5HNGA 3DKCA 4IADA 3TZMA 3W8QA 4AN2A 4BBFA 4NKAA 4EBVA 2XARA 4OTIA 4ACHA 4O2PA 4G3CA 2B1PA 4V0GB 3SVVA 4MK0A 1LEZA 4FYOA 3NW6A 4TWCA 5AR7A 3T3VA 5FG8A 5TOZA 4TYHB 3H9OA 4M69A 3ZSHA 3COMA 1F5QA 4RSSA 5FD2A 1OIRA 1OI9A 4S33A 4YHJA 4CMUA 3LQ3A 3N4VA 1T45A 4UV0A 3PSCA 4TWNA 4QQJA 3PXZA 4IC7A 5AIRA 5HI2A 3UDTA 4FTTA 4FTIA 3AG9A 2A4LA 4KIKB 2PYWA 1H01A 4E26A 5AR8A 1REJA 4NIFA 5AP3A 4K9YA 3JVSA 4C62A 4L00A 4PMPA 5J7BA 4TYGA 3A7GA 3FPQA 2UW3A 4QMSA 3TUBA 2ONLC 2WMTA 2VZ6A 4AGUA 4FZ6A 4FTLA 2FVDA 2A98A 4G3FA 4CQGA 4YZDA 2BAQA 4YP8A 4E8AA 3MH0A 1ZYLA 4G9RA 4ACCA 4R7HA 5JSMA 2QG5A 4E6AA 2C3KA 2JDOA 3Q9WA 2WTCA 4GH2A 3PPKA 4OGRA 4A4LA 1J1CA 2ZB1A 3KB7A 4O2ZA 2PE2A 3R8VA 3ZU7A 2BAJA 4C35A 3HECA 3FI8A 4O7WA 1Q8TA 1CDKA 5IEVA 3ZYAA 4R78A 5KBQA 1PJKA 4GV1A 4IX3A 5T68A 4LRJA 3EN9A 4B9DA 2BZKB 3ITZA 5H8EA 2YACA 4QDEA 4XP0A 2QR8A 3TN8A 1XH8A 3NIEA 3PJ8A 4QD6A 4A9UA 3HUBA 4L45A 4EOQA 3N4UA 2O8YA 5AUUA 4BDFA 4Y73A 3UYTA 4X3JA 3GCUA 4QT1A 4Y72A 2YCQA 4I5HA 5F4NA 2CHLA 3BEAA 3TACA 3TNIA 3IOKA 4QMUA 5IA0A 3DK3A 3HRCA 2IVVA 4RJ3A 2PUNA 2ITUA 4FKLA 5C01A 1GZNA 4Q2AA 4D4YA 3ZUUA 5LMBA 3ZO4A 3VQUA 3NLBA 3R7EA 3RPOA 2V22A 3VNTA 3FLZA 4FV1A 4JRNA 1BI7A 5J5SA 3P7AA 5J1VA 1WBOA 2HZIA 1YRPA 3GT8A 3I0QA 5GINE 4KINA 3RHXA 4YBKA 3O17A 3E88A 4FC0A 3HGKA 3PE2A 3V6RA 4BJJA 2UW4A 3F61A 4UX9A 4X2GA 4QP8A 3EN6A 1BL6A 3ACJA 1ZMWA 3LCSA 3MH3A 4FG7A 4JQ8A 5HD7A 1KE7A 2B9FA 3QYZA 3JS2A 4MXOA 4XRLA 4OTDA 5CU0A 4C36A 3AT2A 4FNWA 4QTCA 4WD5A 4ERKA 3I7BA 3HRFA 2WMXA 3I5NA 3GQIA 5L3AA 3DNDA 3P7CA 4LRKA 3RM7A 2QO9A 4X6QC 3DDQA 4DBNA 3ENHA 5B2LA 4TT7A 2YIQA 4QMQA 3W2RA 2PVNA 3Q9ZA 2OH0E 3R9RA 4BGGA 3JY9A 3MVHA 4L53A 5AX3A 3WE4A 2HELA 4JXFA 1Y8YA 4L46A 4DGGA 1IAHA 3C1XA 5L4QA 2J0KA 4KRDA 3UP7A 2OIQA 5AV1A 4NFMA 4EH2A 5FXRA 4O86A 3FQSA 5DFPA 3SRVB 1FBNA 2R2PA 4B4LA 3GC9A 4B8MA 1OKVA 3UDZA 5LVMA 4EQMA 1KE9A 2QOIA 5FBOA 4O0VA 2HYYA 3COIA 2WZJA 3IS5A 2J7TA 3G90X 4JVGA 4AT4A 3EN5A 3DV3A 4LI5A 3QLGA 4J1RA 4ANBA 4FV9A 1XMLA 4OUCA 2WEIA 1XWSA 2C3IB 4CEGA 3KQ7A 3LHJA 5L2WA 3QWKA 4YTIA 4APPA 4U81A 2O3PA 1ZYJA 2OO8X 5IQGA 1Q8WA 3RINA 5BX0A 5JGBA 2JC6A 4B8LA 3O8UA 4M8TA 1U54B 3MI9A 1Q8ZA 4TKSA 3DXNA 4IVDA 2JEDA 4KKGA 3TM0A 4DGOA 3FSKA 4FF8A 4XH6A 2IW9A 2BMCA 3DK6A 3KXZA 3HL7A 1OPKA 2YCRA 4GVAA 5EDPA 5D41A 4XRJA 3W2CA 4C61A 3OC1A 2QOKA 3D9VA 3OCSA 4GT5A 4EC8A 3NAYA 3CBLA 2X0OA 4U40A 1UU3A 2GNJA 3EFLA 2PULA 3CKXA 1LEWA 3QRTA 4RLLA 4D2TA 3PXFA 3VIDA 1ZAOA 3VBTA 5I5ZA 3DBCA 3FMLA 4ZJVA 1SM2A 3CIKA 3F88A 5LQFA 4F64A 5AX9A 1M2PA 3Q6UA 2X2LA 3VRYA 3CTHA 4Q9SA 1BL7A 3UO5A 4FSMA 4BF2A 1IG1A 3O8TA 4E3CA 3R7IA 2OXDA 4M14A 3KL8A 4AXAA 2XMYA 4FV3A 4L7SA 3QGWA 5H2UA 1P5EA 1OM1A 3RNYA 3ORIA 3NYNA 4FRFA 3ZO3A 3GU5A 3FL5A 5A4QA 4GKHA 3EFWA 1YOJA 2E9NA 3WOWA 3BL7A 3C0HA 2WOTA 5L2QA 3ZSIA 1NW1A 3R7VA 1YDSE 2J5FA 3NR9A 1GIIA 4D28A 2R3KA 3NCGA 1R3CA 2F49A 4FOBA 2W1GA 4ZTRA 5JMSA 3HAMA 3NVKI 5CASA 1JKLA 3R9HA 1ZY4A 1B6CB 3UOJA 5F1ZA 5EQYA 5IEYA 2HIWA 4F9CA 3QALE 4DH7A 4ASZA 3HV7A 2UW6A 2YZAA 1H07A 4G17A 2RFDA 3VJOA 5E90A 5CSPA 4HNIA 4I41A 3UVQA 3LJ2A 4G6LA 2E9OA 1WFCA 2H34A 3D0EA 1UKIA 4AS0A 1YXTA 3U9CA 4U0IA 5CQWA 4ZSLA 5E8UA 3SXFA 1G3NA 3MY5A 3ZO2A 4DEBA 4KIOA 4FTAA 4BCIA 2ZYBA 3QAME 4F7NA 4M12A 3LXNA 4FZDB 3PFQA 3RAWA 2I7QA 3ZFYA 4I6LA 3FJQE 3F66A 5HTCA 4A9YA 3CEKA 4IVAA 4YJRA 3NFGB 1FPUA 3PPJA 4FEQA 3QUEA 5DR9A 2J4ZA 3MDYA 4IVBA 2ZDUA 4NH1A 2JDSA 4IWDA 5EQPA 2UZTA 3FYKX 4IBMA 1H4LA 4AW5A 2OZAA 4DFZE 1OKZA 4CVAA 4GS6A 2GQGA 2NYAA 4OBPA 2FO0A 4U43A 3VUTA 1Q8YA 5DRBA 4C3FA 2ETKA 1BX6A 3RBWA 4BWXA 4MBLA 5I9YA 4ANLA 4C37A 5AR5A 4RG0A 3W2OA 4BI1A 4JG6A 4BHZA 4E73A 4FKVA 4F9WA 5AP0A 4FT9A 5A4EA 4AOIA 4J95A 4DLJA 3PWYA 2VV9A 4CRSA 3ZRLA 2OJGA 4MHAA 4UWYA 3L9PA 5DT3A 3CPBA 3KULA 3SGCA 2AC5A 2CSNA 2ZM1A 2XH5A 1MQ4A 3WF9A 4AZSA 4H36A 2BDJA 4FX3A 3A2CA 3NYOA 4UBAA 5HE2A 3VBQA 3UOHA 2VTRA 3MWUA 4YZCA 1JVPP 2GHGA 2YLEA 3RPYA 2UZNA 2F7ZE 2G2HA 2IF8A 3PY3A 1CM8A 4I93A 1OVEA 4O96A 1UWJA 3IECA 4L67A 2YHVA 3TTJA 3JVRA 3U6HA 2F7EE 2HCKA 3UZRA 3RMFA 1VJYA 4X6RA 2VWYA 4YGAA 5IQHA 5CY3A 4IAYA 3JY0A 4YJPA 3RCDA 5IPJA 3CGFA 2Y9QA 1GIHA 3G51A 4OTGA 3VHEA 3R7OA 3D2IA 3DPKA 1SNUA 4PL3A 1YOMA 2WELA 3SHEA 2Z2WA 3UDSA 4CKIA 3VS6A 4L43A 5CU2A 2HY81 3DS6A 2Z7QA 3RPSA 4AA0A 4O4BB 1YWRA 3QA8A 2OICA 4QMOA 2UZOA 3DB6A 4R5SA 4UZHA 5DWRA 1ST4A 2XK3A 4KAOA 4G16A 4M13A 5J8IA 2CN5A