3EB0A

Crystal structure of cgd4_240 from cryptosporidium parvum in complex with indirubin e804
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
370
structure length
311
Chain Sequence
SKKYSLGKTLGTGFGIVCEVFDIESGKRFALKKVLQDPRYKNRELDIMKVLDHVNIIKLVDYFYTTNKYLNVIMEYVPDTLHKVLKSFIRSGRSIPMNLISIYIYQLFRAVGFIHSLGICHRDIKPQNLLVNSKDNTLKLCDFGSAKKLIPSEPSVAICSRFYRAPELMLGATEYTPSIDLWSIGCVFGELILGKPLFSGETSIDQLVRIIQIMGTPTKEQMIRMNPHYVRFPTLKAKDWRKILPEGTPSLAIDLLEQILRYEPDLRINPYEAMAHPFFDHLRNSIPQLFNFSPYELSIIPGNVLNRILPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal Structure of cgd4_240 from cryptosporidium Parvum in complex with indirubin E804
rcsb
source organism Cryptosporidium parvum iowa ii
molecule tags Transferase
total genus 97
structure length 311
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eb0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eb0A01
4FV4A 2RSVA 3NIZA 1Q3DA 3BV2A 3W8LA 2XJ1A 2F7ZE 3RM7A 3KRRA 4O0UA 3A7GA 3EZVA 2F2UA 3TACA 2IVUA 4MTAA 5EYKA 3AMYA 3QCQA 3TTJA 5CSPA 4DTAA 3M42A 2XIZA 3FWQA 2QU5A 1J1CA 2WEIA 3OG7A 1P14A 4FNZA 1GIHA 4PV0A 3GXLA 4RC2A 2GNFA 3ZH8A 2XK6A 1OZ1A 4RIYA 3CTHA 4IDVA 4A4LA 3EOCA 1WFCA 4L8MA 4FTMA 2WQNA 4G9RA 4TXCA 2P2HA 4YC3A 5EW8A 3VVHA 3E8EA 5L8KA 1BKXA 2R0IA 3UQFA 3BYUA 2YM7A 4KS7A 1W84A 3QZFA 4LOPA 4NZWB 2YIQA 5FEDA 3VJOA 3HV3A 5KHWA 2P33A 4HGEA 2R3KA 3KULA 4QTAA 1DS5A 4TKSA 4DH1A 1ERKA 5AUUA 4JXFA 4KNBA 4OW8A 4YC6A 4X2NA 4E1ZA 5E8ZA 3DFAA 2R4BA 1APME 1H07A 4GIIA 3CP9A 2OIQA 4FKLA 4PDSA 3RK7A 3QU0A 4EHEA 3MESA 1FPUA 3Q2JA 5FUTA 2ZV8A 3RBWA 2OIDA 4GEOA 3OOGA 4YO4A 4KKHA 4O84A 4WUNA 3L9NA 3PZHA 1J7IA 1YOLA 2OWBA 4QPMA 4QNYA 2ITOA 4NW6A 3G5DA 3FV8A 4QQTA 4MNEB 4II5A 2PTKA 4RVTA 3TL8A 3O0GA 2BDFA 2KULA 4C37A 4DFNA 2QKRA 4Q5EA 2W7XA 5EKOA 3TCPA 1YWNA 3FPMA 4F7LA 3OVVA 5CAPA 4M84A 4USEA 2JIUA 1R39A 4WNPA 4HNFA 4ANNA 1GZNA 2WTCA 2NRUA 3EYGA 5ANKA 4TN6A 4XOYA 1OUYA 3EFLA 4CGAA 2R7BA 5EI6A 1WMKA 2EXCX 5LMAA 3UDBA 3QXOA 5L2IA 3PXKA 4RIWB 5FG8A 4YHJA 4ZJIA 3FC1X 2W5BA 3EH9A 2F4JA 5GJGA 2BZIB 2JFMA 3GC0A 5EFQA 4B8MA 3ZMMA 5IQIA 1M7NA 1V0OA 4OBPA 3ROYA 5EQYA 1JNKA 3I7CA 3KRLA 2YIWA 1MRVA 2IZRA 4WG5A 3VS3A 2GQGA 2PVYA 3FLZA 5HEZA 1K2PA 4DEIA 1OL1A 3DAJA 4EH6A 3EN4A 3U8WA 4OAUC 4F9CA 2YM8A 4MD9E 4X2FA 2CN5A 4ZXTA 3R7YA 4A9YA 4P4CA 3RKBA 3L8VA 5LVPA 2WOTA 3MPAA 3NAXA 4DEDA 1H01A 1GZOA 5IQGA 4ACMA 4FNWA 4MXZA 3V04A 3QRIA 4RFZA 5M09A 4QYHA 3CGOA 3MA6A 5BVWA 4FKGA 4CV9A 4YZBA 4CZTA 4NM0A 3U4UA 5KHXA 2CKOA 1Q99A 3IKAA 1TQIA 1W8CA 2CDZA 1KE5A 3NUUA 3KXHA 3R8VA 2BUJA 3VUTA 5JK3A 3UZRA 5LARA 3PJ3A 4D4YA 2OJFE 3W1FA 1Q24A 3FMMA 2RGPA 3UYTA 2YDJA 2YM3A 5HD7A 2CCHA 2C3IB 1Q8YA 3OW3A 4GRBA 4CFVA 5F9EA 3WF5A 3LFSA 2PUUA 2V7OA 3POZA 3OBGA 4BCPA 5JGDA 1OMWA 3D94A 3AXWA 4W9XA 2B9FA 3I60A 4BDGA 4EOQA 3PA5A 4E5WA 4EK8A 2WOUA 4G6NA 5DT0A 1FGIA 3QTUA 4ZSAA 4L6QA 4ASXA 5CSXA 4Z7GA 3A7FA 4FMQA 1XJDA 1U59A 3TNIA 2CJMA 3Q04A 2VTMA 4UY9A 2OLCA 3OC1A 4QOXA 1ZXEA 3OCTA 4I20A 4XS2A 1PKGA 3ZHPC 4DFZE 5CASA 2BALA 2WFYA 3QQFA 3B2TA 5E92A 4BYJA 2J0LA 4CEGA 3S0OA 1UU3A 5FTGA 3UVQA 5I9VA 2ITQA 3R7OA 2GS7A 3RCDA 4WG4A 3B8RA 3MY0A 4BHZA 4BCGA 1WVXA 2J50A 4YLLA 5AV1A 4GG5A 4KWPA 2QR8A 1REKA 3V5TA 3QC9A 4EH9A 3OCSA 5HCXA 2BKZA 2BZHB 2QVSE 3MVJA 2VWZA 4I94A 4PDPA 5AR3A 4EEVA 4XV1A 3QRUA 4J98A 1ZMUA 4KSQA 5EYCA 3QQKA 3FZ1A 1LEZA 2JDTA 3OMVA 4G9CA 4E26A 2OXXA 3A7HA 3AOXA 1UNHA 2PZIA 3Q6UA 4UYNA 3RHKA 3SHEA 2OICA 2C30A 1FVRA 4HYSA 2R9SA 3W2OA 2ZMCA 5KZIA 4DLJA 3UP2A 4Z9LA 3O8TA 3NNXA 4F65A 3PPKA 4M67A 5E8VA 3KVWA 4RQVA 4CFNA 1IRKA 2PZPA 5C9CA 4F7JA 5ANOA 4D2RA 4FEXA 2XS0A 4DEGA 5CAQA 3NUSA 3ZSIA 2YZAA 4XG8A 3QGYA 4YZCA 1XH7A 3ZC5A 1NXKA 2FYSA 2CGVA 1STCE 2QOIA 3IW6A 3DB6A 4FKSA 2UW4A 2XJ2A 3U6JA 2J2IB 1IAHA 3BGPA 3ENMA 2WQMA 4IB0A 3SXSA 4CTCA 4M0ZA 3FMDA 3QAME 1VR2A 4RX8A 5IU2A 4F7NA 1BI7A 1IEPA 4RWKA 5ETAA 4DITA 3KRXA 2QOHA 3GFEA 4UN0C 4ZTHA 3TEIA 5HU9A 5IQHA 2QD9A 3ZEWA 4EWQA 5K5NA 5CU6A 5HHWA 5TR6A 4O83A 2VAGA 3DLZA 4BWPA 2WHBA 3PXZA 2W1IA 3W55A 4E4NA 3CGFA 3CXWA 4IAIA 3DOGA 4QYYA 2W4OA 4CTBA 3PJ8A 2I40A 5DE2A 3IOPA 4FX3A 4IX6A 3K3IA 3KXMA 3LJ0A 4QMWA 4ZSGA 4D0XA 3DXPA 3QTIA 4CMOA 3R1QA 3PFQA 4FV0A 4TY1A 4YPDA 4R1VA 4EKKA 3DNDA 2HXQA 4M0YA 2C47A 2XM8A 3FKLA 1AQ1A 3LVPA 3PJCA 3NW7A 5ACKA 4A9UA 2RKUA 5EK7A 1OIYA 3F3WA 3FSKA 4FT0A 3CY2A 5LWMA 4EH2A 2B7AA 2OJJA 4X3JA 3DJ7A 3Q9WA 5BMSA 5HG5A 4XG4A 2BHHA 4NK9A 4PDOA 2JAVA 3BX5A 3W18A 4ARKA 5TKDA 2R3GA 3II5A 3P4KA 5CLPA 4G16A 4Q5HA 5CEOA 2C6MA 3HA6A 3H10A 3R71A 3O8PA 3ZS5A 5LJJA 5ANGA 4O96A 4FVQA 1UVRA 1H4LA 1H27A 2DS1A 3AC3A 2OZOA 4U80A 5DT4A 5CTPA 5IQAA 2FSOX 4FTNA 3BLRA 4EORA 4O81A 3GCUA 4RIXB 1QPEA 4TWPA 4O2ZA 3Q2MA 4YJOA 3DTCA 5K4IA 3LFDA 2ITYA 1DI8A 3M2WA 3PSCA 4RZWA 4DGNA 4EK5A 1GAGA 4RFYA 4OGRA 4AF3A 3R1NA 3DFCB 3MSSA 4CFXA 4DHFA 2EXEA 4XCUA 4MK0A 3DDPA 3MV5A 2GTMA 3EFWA 2EB3A 3GGFA 3UIMA 4K77A 4APPA 3LCDA 3S95A 1JKLA 2X4ZA 4FSUA 4UMQA 3ZU7A 4BTKA 4FIFA 5CSWA 4KINA 4WT6A 3PJ1A 3RPYA 2Z7QA 4YJUA 5CEKA 2Y4IC 5M08A 3NUXA 3F5XA 3RALA 2AYPA 3QTSA 4HOKA 5AP3A 3TZ9A 3D2KA 3FYJX 4S31A 3W2QA 5BUIA 3PVGA 2XA4A 5IH4A 1VZOA 3C4WA 2G2IA 4TYEA 5KMOA 3MIAA 3ORMA 4TT7A 5E8SA 4AN9A 3DA6A 1PXNA 2X6DA 2XNOA 4A07A 4EL9A 2Z02A 4YU2A 3DDQA 4YJPA 3ZO1A 4A9TA 3P79A 4CZYB 5AP7A 3TZ7A 5G1XA 5AV4A 4N70A 4ZZOA 4ZLZA 2XNGA 5JFXA 5EDRA 2HK5A 2QG7A 3CS9A 4QP7A 5D41A 1Q4LA 2ZAZA 3QALE 5M57A 3UIXA 3QUDA 2OGVA 4IWQA 5JQ5A 3COHA 5HLPA 4APCA 5DVRA 3DXQA 3SG8A 5BVKA 2B0QA 1WBNA 2E9VA 3BHUA 5J1WA 4NJ3A 1T45A 5G6VA 2CPKE 4E5AX 4BI1A 3BLHA 5GZ8A 3VUHA 4ALVA 1A9UA 1IA8A 5JT2A 3BRBA 4UB7A 5IISA 3FMKA 2PMOX 5DR6A 5D12A 4B4LA 2WD1A 2VD5A 2V62A 4P5ZA 5FBOA 5BVNA 1PJKA 1EH4A 1LEWA 3BIZA 4K33A 3VS4A 3I79A 4I4FA 4TYJA 2DWBA 2HAKA 3E7VA 4GFMA 5CU4A 3S4QA 4QMLA 2VX0A 3ACKA 2JBOA 2XNPA 2WTKC 3D0EA 4QD6A 3R8PA 5AA8A 4UXQA 3CSVA 2A4LA 3HVCA 5CU0A 5M06A 2VTIA 4QP3A 1W83A 3H0YA 5CANA 5E7RA 1Y8YA 3V01A 5EHOA 4YJQA 5CNOA 4BVUA 4S30A 1DM2A 3WF8A 2QO9A 1YW2A 2FA2A 3G9NA 3DBFA 4LM5A 4TRLA 4C3FA 5HIBA 3Q4ZA 3C1XA 3R2BA 3GCPA 3MFSA 1FINA 4V0GB 4HVGA 3C0HA 3OWKA 1H8FA 5FGKA 5CNNA 4JDHA 3NR9A 3PJ2A 2QLQA 2W1HA 1GY3A 2UZNA 3BKBA 5HBJA 3WZDA 3EYHA 3W33A 4Q2AA 2Z7LA 4MWIA 5K0KA 4NWMA 2W1GA 4WA9A 1M2RA 2XEZA 5DT3A 3D5UA 1RQQA 1PXJA 1ATPE 5GHVA 4D55A 3D4QA 4ZLYA 2OBJA 4GK4A 4FG7A 4HGSA 4C7TA 5EHYA 4IAAA 4J97A 4D9TA 4EUTA 2UW9A 5CF5A 3PLAE 3C4FA 4YC8A 3JVSA 3F3ZA 4FIIA 2BHEA 5AP5A 5C03A 4ERKA 2EU9A 3EHAA 2FB8A 4QQJA 3REPA 4K9YA 3GFWA 3TNPC 4DH5A 5J5SA 2XYNA 4MYGA 5ICPA 3RK9A 2JKOA 3GU5A 2WMQA 2CGWA 4YURA 4UALA 3FJQE 2J5EA 2OZAA 4LQMA 5ANJA 4K1BA 4L52A 3NZ0A 3RZFA 3A4PA 3UOKA 4DG2E 1A48A 3NNUA 2BZKB 4FIEA 3ZZWA 4JL9A 2XKFA 1PXIA 4BHNA 4PP9A 4PMPA 3RCJA 3PRIA 2O63A 5K9IA 4YPSA 4YR8A 4FV2A 2XP2A 4GK2A 4RJ4A 3UQCA 1S9IA 4JIAA 5TT7A 4D5KA 4PUZA 4YSMA 2QOOA 2X39A 2C6DA 2OJIA 4FKRA 1OKVA 3ZRMA 4AGDA 3N4TA 2XK3A 2ZDUA 4HZSA 4XYFA 3DAEA 3W10A 5HLWA 5CI7A 5IQBA 2FSLX 3C4CA 1ZWSA 4LV5A 5KKRC 5IQCA 4KIPA 4XUFA 2CNUA 5EM7A 4XV3A 3O17A 2QHMA 4GFGA 1W7HA 3TDVA 2RIOA 1L3RE 4G31A 4ZY6A 4ALWA 5IQEA 3LZBA 4U45A 4AT3A 3FQSA 4KABA 4HYIA 4FZDB 2QOLA 4ZJVA 4IVAA 3GBZA 4JG8A 3JR1A 3GNIB 5FTQA 3TZMA 5AP1A 2ITVA 4Y5HA 4JAJA 1OKWA 2XK4A 4J95A 4HCTA 1IA9A 3BI6A 1UNLA 5KCVA 4ASEA 2OFUA 4RT7A 5HG9A 4BC6A 2VU3A 3ZO4A 4ZMEA 3H30A 5EYDA 4JDIA 1W0XC 4AOJA 4XEYA 5K4JA 2JFLA 1SNXA 2VTOA 2WTDA 3AMAA 4V05A 4ZTLA 3OXIA 4WIHA 5GINE 3JYAA 2UV2A 4QTDA 5T3QA 3ZONA 5J9LA 3PA3A 3UNJA 3ODZX 3JY9A 4YTCA 4AXAA 3WOWA 3KK9A 5EI8A 5ETFA 2RF9A 4AZSA 4BI2A 3ANQA 3AT2A 5HTBA 4RLLA 4ZY5A 5HG7A 3U87A 2OXYA 3F5PA 1TKIA 2WTIA 4BL1A 3H9RA 4F9WA 5LWNA 2KTYA 2XK9A 5E91A 4CFFA 3O7LB 1OUKA 3LCSA 2W1FA 4I3ZA 1ZLTA 4LV8A 3F82A 4O0SA 3WZUA 5GIPE 4BDFA 2JLDA 4PY1A 2H34A 2W96B 4EWHA 2BAQA 4TYIA 4WNKA 4ALUA 4LL5A 4KD1A 4OTQA 1RDQE 3L8XA 3MH2A 2ZM1A 2ESMA 3C5UA 3HV4A 2JKKA 2QQ7A 4HYHA 4IC8A 3RAHA 4GMYA 3W2SA 4KIQA 4ZMFA 1NVRA 4RX7A 2JDVA 3ZRKA 5I9XA 2CSNA 3TV6A 3EQRA 4K8AA 2QLUA 4BDHA 4GKHA 5AAEA 1WVYA 2Z8CA 3ZFXA 5A46A 3NIEA 3DU8A 4IVCA 5AP2A 3ULZA 5A6OA 4G3CA 1CDKA 4MQ1A 5DLSA 4Q9SA 2XBJA 5AWMA 4G3FA 2QOBA 3EZRA 3LXLA 4G1WA 4ZIMA 5DOSA 3D5WA 5HLNA 2HZIA 4WSQA 5F95A 5BPYA 3DCVA 1JSVA 4U79A 5FWKK 3EKNA 3R8UA 3BELA 4FR4A 3E5AA 4MBLA 4DH7A 4EOIA 2YN8A 4GIHA 4R3CA 4QPSA 3UO5A 3HL7A 4BR3A 3QQUA 3T9TA 5JGAA 2WU7A 4PTGA 5HD4A 3SGCA 4FTOA 2HENA 3C4ZA 4DT8A 4BBEA 4DLIA 1ZYLA 3ITZA 5JZJA 4IAZA 3KXNA 3I0OA 4RIOA 5HE2A 3NCZA 5L6WL 4C4FA 4BCIA 3VS0A 3BQRA 4NM5A 4EHGA 4EJ7A 3DZOA 1OL7A 4NTSA 4W9WA 3SRVA 3QRTA 4ANBA 2PVKA 5JEBA 4TYGA 1PMVA 3VBQA 5AIRA 3SVVA 5IA5A 2AC5A 5EQEA 3OW4A 3ZDIA 2R3IA 4S2ZA 4CQGA 3KMWA 1PYEA 4A9SA 3ZLXA 2DYLA 4QQCA 3I5NA 4OT5A 3KGAA 3ZYAA 3EN7A 2BRBA 4B0GA 1P4FA 4E5BA 2BDJA 3KVXA 3OWJA 4EQMA 2Y4PA 2V22A 2YFXA 2CN8A 3V8TA 3ETAA 4I23A 3KMUA 3DK7A 3LFAA 2XBAA 4BWKA 2YZLA 4C2WA 1PYXA 4BRXA 2ERKA 3GC8A 4OR5A 5CWZA 5TO8A 4FKVA 2QG5A 3TZ8A 3V6SA 3R9OA 3R02A 4FEUA 3CCNA 3KY2A 5DR2A 2GNIA 5E8YA 4ASDA 4FUXA 4BN1A 3R63A 1BL6A 2PWLA 3R21A 4J1RA 5E8XA 3TDWA 5GZAA 3VS1A 2WGJA 5E9EA 4WRGA 3UVPA 3TNQB 1G5SA 4C3RA 4YLKA 4PF4A 4U43A 5I9ZA 1WBOA 4D5HA 3NAYA 2OF2A 3UMWA 5I0BA 3PSDA 4R5SA 4ZSJA 3KK8A 4O82A 2X9FA 5ACBC 4UZHA 4H3PA 5H2UA 1OGUA 3L8SA 3SXFA 3F5UA 1R78A 2O65A 4YTHA 4DC2A 5F4NA 5DN3A 2C6KA 3KF7A 3HUBA 4BCNA 4FSNA 4D1SA 4FI1A 5L2WA 2ZV2A 4DFLA 1QPCA 4WKQA 5AUYA 3D7TB 3MWUA 3PPZA 5AX3A 4WO5A 3SDJA 2REIA 4LI5A 4E6CA 4JG6A 2XRUA 3G33A 2WTJA 5C8MA 3AGLA 2C6OA 3TJDA 5AEPA 1H28A 1QL6A 2GU8A 4WD5A 2WMTA 5H9BA 5BVEA 4RC4A 5B2MA 3GOPA 4USFA 5L8LA 4NCTC 2R64A 2OH0E 3UIBA 2E9PA 4X6QC 3TUCA 4O1PA 4XX9A 4FA2A 4CVAA 2ONLC 4BKYA 1H0WA 2CNQA 4X6RA 4R3PA 3TKIA 4CFUA 2IVVA 1XHAA 3ZDUA 3CEKA 4IB1A 2EVAA 2JDRA 4JQ8A 2W5AA 4H36A 3BU6A 4QP9A 4C35A 4E7WA 5B2KA 2IPXA 3TI1A 3I7BA 3VIDA 4ZP5A 2CKEA 4RJ6A 2R3QA 1XH6A 5HE3A 3WZJA 4EK3A 3R9RA 4BDAA 4IHPA 5EW3A 3DT1A 2Z7RA 3OEFX 3FZSA 4WRSA 2F9GA 2VUWA 4MKCA 4XOZA 3JXWA 3MVHA 5D10A 2SRCA 2C6EA 3GEQA 1WBPA 4NSTA 4BDBA 5CEPA 4LRMA 4I6FA 4R1YA 1XKKA 4L44A 2ZV7A 2BZJA 4D58A 4DBNA 3C7QA 5JFVA 2XK8A 4ACGA 2ZM3A 4PMTA 5CX9A 4NUSA 3V3VA 4O0WA 3S3IA 5AA9A 4AZEA 4I22A 5AP4A 2HW7A 5IKWA 3V5PA 3BCEA 4CFMA 2CGUA 4K0YA 3QD2B 3HMPA 3FQHA 3VN9A 2W1EA 4D0WA 2XRWA 2C5NA 3KC3A 4MXCA 2YABA 4EKLA 2C3JA 1DAYA 4HYUA 4AT5A 4C34A 5IG1A 2ITXA 2LGCA 2UZLA 5C26A 1JWHA 4X0MA 3KL8A 2WB8A 1JKTA 2GS2A 4NM3A 1KUTA 3KEXA 4O0YA 4Q9ZA 2BKKA 3LFCA 3OROA 1Y91A 1XH4A 4JQEA 3AGMA 4FL3A 2GNJA 4M3QA 3G6HA 4UMTA 4E73A 5HI2A 2JKQA 3PIZA 3WYXA 1XO2B 4BBMA 2HZ4A 5HNGA 5K0XA 5L2TA 4FV9A 5J9YA 4EOLA 5J79A 5JH6A 2YWPA 1SVHA 3ALOA 3TWJA 3WF6A 1YXTA 3GQLA 4MX9A 4MAOA 4E8AA 2GQRA 2PZ5A 1XH5A 1E9HA 5LVLA 3NNWA 3V51A 2YLFA 4A7CA 2C3KA 4UMUA 4U44A 3OWLA 3RZBA 1F0QA 1P4OA 5A6NA 4PQNA 5EQPA 4OTPA 4R8QA 4O0XA 2YCRA 4O0RA 4IVDA 2YM4A 2J90A 3R7UA 3NS9A 4XP3A 4JOAA 1YQJA 4AFJA 3NVKI 5IH6A 4FUYA 4XHKB 2IW9A 4TYHB 4EYMA 2FSTX 3NW5A 1R0PA 2YCFA 4JJRA 1SZMA 2XB7A 3Q4CA 4X7QA 3THBA 4L68A 4PL4A 3P7BA 4RVMA 5FTOA 5H8BA 5B0XA 1R1WA 1V0PA 4GSBA 4ACCA 2J4ZA 2YAAA 2PVHA 3FZPA 3ORLA 4Y73A 5AR5A 1U54A 3RGFA 3F66A 2XMYA 3OUKA 3R28A 4IC7A 3PVBA 5HE0A 4FV6A 2QOKA 4WBOA 3RP9A 1MRUA 1YRPA 5L2SA 5J95A 1BI8A 3IDBA 3AG9A 2W9FB 2WZJA 3VW6A 2ZJWA 4FT7A 4E93A 3MI9A 2JIIA 4J71A 3VS6A 4EYJA 5BYZA 4XLVA 3IW7A 2VWIA 2YJRA 2GMXA 3LJ2A 3I1AA 1H08A 4WG3A 3DBQA 3K54A 3OBJA 4JBVA 4U8ZA 5IQFA 4ENXA 4FICA 3SW4A 1KOBA 5JN2A 4QRCA 5J8IA 3VS7A 2W9ZB 4YJTA 4C4IA 3ACJA 4HGTA 2C5OA 1WCCA 3EQFA 3HLLA 3PTGA 4QYFA 3BWFA 1QCFA 4PMSA 4JLCA 4H1MA 2XNBA 4F70A 5FXRA 3BGQA 4F99A 4JDJA 4KIKB 4MD7E 4NW5A 4O86A 4QP4A 3CKWA 2ZB0A 1OECA 2VNYA 3DTWA 4NFMA 3G51A 2PMLX 3HDMA 3SLSA 1BL7A 3FI3A 4IB5A 4BZDA 3PA4A 2B52A 5I5ZA 4ANLA 3OT3A 3BGZA 4L3LA 5EM8A 3V5JA 3LOKA 2OSCA 3BWJA 5L2QA 4I24A 2PVRA 4FKIA 3SQQA 3VBXA 3V5WA 3I6UA 3VUMA 4NIFA 3ZO3A 3DKOA 4RJ8A 3HAMA 4G5JA 1QPJA 3EQCA 4NT4A 1KE8A 5KBRA 1XR1A 3L8PA 3MB7A 4QMXA 5TOZA 1XBBA 4O6EA 2F57A 4UBAA 3O71A 3QYWA 2UVZA 4GK3A 4EC8A 4M66A 4LL0A 5DNRA 3A61A 4YLJA 1HCKA 3ZO2A 5KNJA 3R04A 3HDNA 2GHGA 3V8SA 3QHWA 3ZEPA 4ZLOA 5AUWA 3EN6A 4XH6A 4U3YA 5HO8A 3QA8A 4YNEA 2WMBA 2OW3A 4GV1A 3BYMA 5F1ZA 1U46A 4AZVA 5IA0A 4CSVA 2G2FA 4M69A 2VGPA 3PE2A 4RLKA 4JRNA 3VAPA 4D2WA 2YM5A 5CF6A 5M51A 4I41A 4NKAA 4B6LA 4YZ9A 3ORTA 3DV3A 3T3UA 4BTJA 3QX4A 4F9BA 3QA0A 1JVPP 4KS8A 4N0SA 2G2HA 3ID6C 5ETIA 3OXTA 3R30A 4E4XA 4OBQA 3TIZA 5C1QB 4RX9A 2BFYA 3BBTB 1NW1A 3TNHA 3D5VA 4OTDA 4K18A 1ZYDA 5LMBA 1WBVA 1WBTA 4N4SA 4O22A 4L9IA 1URCA 3KB7A 4F1MA 3LHJA 3V6RA 3IDCA 4BYIA 1UWJA 3H9FA 3MY5A 4AN2A 1T46A 4R7HA 3BEGA 4U7ZA 1ZOEA 5M55A 5BUEA 3HMMA 3KXZA 3EN5A 1PXLA 2C4GA 2G01A 3CBLA 2IZSA 2YLEA 3Q52A 4QPAA 2VWUA 3FXWA 5CS6A 3R7EA 3LJ1A 3COIA 2RFDA 5LMKC 2OG8A 1CKIA 2CGXA 2R0UA 4FOCA 1BX6A 4ZSEA 4O0VA 2O64A 4C33A 3WBLA 2R7IA 3ZBFA 3TKUA 5IQDA 2QHNA 4NEUA 4X3FB 4YHTA 1KV2A 3POOA 4IVBA 1SNUA 4MF1A 4YO6A 2RFSA 3BLQA 3PP0A 4RA5A 4JVGA 3P1AA 4K11A 4BIDA 3QD4A 4UV0A 3NNVA 4YJRA 1FVTA 3VO3A 5DI1A 3SAYA 4DEBA 2VN9A 2WQBA 3L1SA 4FG8A 3E7OA 4Y72A 5IMEA 5AM7A 5EW9A 3SOCA 2VTPA 3HAVA 4H05A 2UUEA 4P5QA 5DBXA 4PRJA 2VTAA 2VX3A 1AD5A 2XVDA 4JBQA 3NUYA 4GJ2A 3BZ3A 1PXPA 3KN6A 2VWWA 3HV7A 3KU2A 5D7VA 3CQEA 4HCVA 1UV5A 2UW6A 4AAAA 1B39A 2C1AA 2NPQA 3NYXA 1KWPA 5E8UA 1GJOA 3QGWA 3ODYX 2B53A 3VW8A 2E9NA 3PUPA 3RAWA 2YDIA 4CKRA 1K3AA 5L3AA 4FE2A 1YDRE 5JGBA 4PNKA 4O7VA 4FTJA 5CT0A 4DYMA 2X8DA 2J0JA 2UZDA 4FSWA 4LUEA 4RSSA 1ZZLA 2WMAA 3VJNA 4F9AA 4GG7A 4KBCA 5HTIA 4IAYA 4XRJA 5M4UA 4GL9A 4MF0A 1WBWA 3H0ZA 4AW5A 5IPJA 2C0TA 3FAAA 4FK3A 3A60A 3MBLA 4DTKA 3KREA 3NW6A 5B2LA 1LUFA 4IWPA 1YOMA 4O7RA 1MQ4A 1PXOA 3EFJA 3O23A 4MCVA 5A4TA 4YJSA 3IDPA 4G6LA 4ZS4A 3LQ3A 3RM6A 4XJ0A 4XBRA 4LFIA 2VGOA 4FGBA 3NYNA 4KBKA 5AAFA 3SC1A 4A4OA 2OI4X 4ID7A 4UXLA 4W4XA 2YACA 2GCDA 4QQ5A 5FDXA 4HW7A 4I5PA 1ZYJA 4Y5QA 3LXKA 2WIHA 5A3XA 1I09A 3JVRA 5AR7A 3W2PA 4ZTNA 1SYKA 3RPSA 3QFVA 3FMNA 2ZVAA 4ANSA 3IECA 1UU7A 3T9IA 2BILB 3LFQA 4NH1A 3Q60A 4RFMA 1ZARA 1Q41A 3ZLYA 4ACDA 3G90X 5CQUA 4BDJA 3CLYA 2ITUA 4O1OA 4YNOA 2XKEA 4ZJJA 2ZB1A 1O9UA 4FTLA 4XG9A 3ORKA 2UW8A 3KCFA 3LFEA 2PE2A 4YJVA 4BTFA 2IVTA 5M44A 5CEQA 3CPBA 4LOQA 3VUKA 3QCSA 5AX9A 2EXMA 4AG8A 4IXPA 1Y6AA 2QKWB 4M14A 4RVKA 4CLIA 4IZAA 2O8YA 5IZFA 3EQIA 5FBNC 1Q62A 1YKRA 4FL1A 3GCQA 3TTIA 4U81A 4AW0A 4JBPA 4ORKA 2X7GA 4AE6A 4AUAA 3NYVA 4E3CA 5EH0A 4DFXE 3FL4A 3FL5A 4HPTE 4MNEA 4AWIA 4DGGA 3D15A 3PE1A 2PMNX 3SV0A 4IJ9A 4M15A 3CQWA 5JKGA 2ETMA 1IG1A 4M8TA 5FDPA 3MW1A 3G9LX 1PXMA 4HVHA 3VHEA 3R22A 2CCIA 2W4JA 4TW9A 4O7SA 5BMMA 3T8OA 3C4EA 4EOJA 3U54A 3VRYA 1OIRA 4EK6A 3CIKA 3WIGA 2R3HA 3BU3A 4QYEA 4W4WA 4EQUA 4RIWA 4FT5A 5DPVA 3UQGA 4X2GA 4FEVA 5FM3A 3F3UA 5A54A 4NTTA 4C36A 3GCSA 3CPCA 1H26A 3KRWA 4FYNA 2P3GX 3ALNA 4ZSLA 1RJBA 3R8ZA 2WAJA 2WPAA 3OF0A 1MQBA 5EKNA 2PPQA 3NLBA 5D7AA 4DH8A 4TL0A 3G2FA 3MTLA 3LLAA 4GT4A 5B7VA 3NWWA 3OZ6A 4KUJA 4FNYA 3SOAA 2PZYA 2WTWA 1KE9A 4L3PA 4YTIA 5D11A 3JY0A 3PYYA 3FLSA 4JX7A 4X3FC 2UW0A 4FIGA 4FT3A 4P90A 5AR8A 3QCXA 4U5JA 1J91A 3TIYA 3FI4A 1BMKA 4ZOGA 3F7ZA 3WI6A 3OCBA 2FGIA 1JPAA 5KZ0A 4OTGA 4NKSA 4EQCA 3IW4A 3WYYA 5M53A 3P9JA 4FVRA 4R6VA 2BROA 3ZBXA 5IMXA 4RIYB 3BE9A 4DE4A 5H8GA 4A06A 1PMNA 3QLFA 4ENYA 3P7CA 3QTQA 4FTQA 4DFYA 4OBOA 3AMBA 4QMYA 2OJ9A 3LQ8A 2F49A 3Q4UA 4BDCA 5ANIA 4TNDA 1DAWA 2V5QA 3KRJA 2IO6A 2HWPA 3MPMA 4I5CA 4FC0A 3ZSGA 4FKJA 1TVOA 2PY3A 2J0KA 3KULB 3OP5A 4FIJA 5JSMA 2G15A 4B7TA 4IBMA 5BVOA 1K9AA 3NVMB 3M11A 3Q4TA 5AUVA 5FM2A 2YITA 5M4IA 2VTJA 3DS6A 1ZMVA 3DBEA 3MB6A 3UJGA 1Y57A 3D14A 2J0IA 1NY3A 2YIYA 2JGZA 4BCKA 2B9HA 5CXZA 4ERWA 3GOKA 5FEEA 2C1BA 3UOHA 2I0VA 3R6XA 3WF9A 3GP0A 5DRDA 4A9RA 1GIIA 4KBAA 3DKFA 3KXXA 4RG0A 4AA5A 4BICA 3NMUF 4BI0A 1YHWA 4X2JA 4Z55A 5BYYA 5CVGA 4FSRA 2IW6A 2H6DA 2CLXA 4XP0A 4PL3A 3ZFYA 4JG7A 4O2PA 5FXSA 3FBVA 1L8TA 3TV4A 2FO0A 4CKJA 5AP6A 3AC2A 3ROCA 5HO7A 4U3ZA 5KX8A 3K5UA 2NNWB 2HXLA 5HICA 2VO7A 4GYGA 4G17A 3UNZA 5BYLA 3HX4A 3HKOA 3GT8A 1PRYA 2H96A 2I6LA 2QO2A 3HV6A 1LR4A 5DHJA 1JKSA 3RHXA 3QKLA 1OB3A 3A2CA 3UNKA 3QX2A 4UZDA 2HWOA 5IA2A 5JFWA 4KKEA 4AU8A 4BF2A 2W5HA 2PUNA 5KMMA 4F6SA 5EOBA 1OL2A 2YIRA 4M7IA 3FE3A 3QRJA 4FSZA 1XBCA 3FXXA 5EDPA 3UOJA 1FBNA 3W16A 3ZM4A 4QTEA 3CJFA 3IW5A 3GU4A 1OITA 2F7XE 4YTFA 4QMMA 5I9YA 5BQ0A 2V7AA 1KE6A 3PRFA 3QZHA 1WBSA 3OTUA 4Y8DA 5GJDA 4F0GA 3A4OX 4MWHA 4CZUA 3ORXA 2VV9A 1OPLA 3EQHA 3DBDA 4YSJA 4IMYA 2P0CA 2XNEA 5EOLA 4WNOA 1UA2A 1Q3WA 5GNKA 2BRGA 2E2BA 2UVXA 3UODA 5BNJA 3TUDA 1VYZA 2UW3A 4GS6A 3CJGA 4FKTA 2HELA 5CQWA 5M07A 1SMHA 3ENHA 4PPCA 3BHVA 2WNTA 3P7AA 3SG9A 5BUJA 4MBIA 3BYSA 3EMGA 4C4EA 3QQHA 4DCEA 3WE4A 1PW2A 4V01A 3PLSA 3EQPA 4DINA 2VTTA 3R9DA 1IR3A 3A99A 4YMJA 3FMEA 5JZNA 3C0IA 5HG8A 4AOIA 4ZZMA 3VWAA 1M7QA 3OWPA 2J0MB 3FZOA 3LAUA 4BBFA 4EOKA 3ATSA 4MHAA 4N57A 2QI8A 3E93A 4DA5A 3E87A 4B8LA 2JBPA 4HPUE 5AV3A 3FLQA 3DY7A 4BFMA 1G3NA 2HYYA 2YA9A 1KV1A 4R7IA 1SVEA 3E63A 1SVGA 2BPMA 3NYOA 4WOVA 5E90A 4E6AA 3OXZA 4TNBA 5AV0A 1H0VA 1R0EA 3UC4A 2A27A 3MFUA 4ZK5A 4QTBA 4BCHA 2BRNA 2XYUA 2UZVA 5CXHA 5DRBA 4I6BA 3NGAA 2O2UA 3LM0A 2R3RA 3MVMA 4IFCA 1GZ8A 3PDTA 1Q8UA 2IJMA 3QD3A 2VWBA 2X8EA 3GU7A 2GTNA 2XJ0A 3E64A 4OUCA 4U0IA 3FEGA 4DTBA 3ELJA 4S32A 3L9PA 5IA4A 2J6MA 4U42A 4AZWA 2JDSA 1LP4A 4GJ3A 4FVPA 1ZYCA 4QP2A 4RA4A 4ANQA 4LGHA 5HESA 3I4BA 1U5RA 1SM2A 2IVSA 4IX4A 4GW8A 3RTPA 2C68A 1CKJA 1XQZA 3PVUA 2Y8OA 4PPBA 4HVDA 1YDSE 2OU7A 3FPQA 3IG7A 3VBWA 3AT4A 2UZWE 3UP7A 2WMRA 3PWYA 3P0MA 4DGOA 4AZTA 4PNIA 5GZ9A 3WIKA 4CRLA 5ANEA 2UZOA 2QODA 2XM9A 3ORIA 4QP8A 2G9XA 3E62A 3AQVA 3BYVA 3OFMA 5J9ZA 3R73A 3ZLWA 2W1ZA 5DFPA 1JSTA 3VS2A 4FSQA 2ZV9A 1IASA 3KKVA 3SX9A 1Q61A 4GYIA 4QMUA 4C3PA 5LCJA 1RW8A 2XIRA 5AUXA 5HX6A 2W1DA 3OEZA 1QPDA 1U5QA 3BHYA 4L3JA 3EQBA 4O7NA 4O21A 3G15A 3F6XA 4G34A 3EJ1A 2O5KA 4O7WA 3C51A 1YWRA 2BDWA 5J5TA 1FOTA 3FMLA 5IEXA 2FUMA 2QR7A 2IZTA 4DFUA 4EI4A 1Q5KA 1CMKE 2PVLA 3BQCA 3EIDA 4J96A 3LMGA 1YI4A 2BMCA 3GQIA 4AW1A 2R5TA 2FH9A 2R3OA 1B6CB 2PK9A 3C0GA 1KSWA 2BAKA 3PG1A 3MH1A 5FLFA 5DMZA 2GDOA 2YEXA 3DGKA 2X2LA 5EHLA 3VNTA 4KB8A 3WZEA 4I0SA 3QXPA 2R3PA 3RI1A 1HOWA 4DT9A 3Q3BA 4I6QA 3VQHA 1OL6A 2ITZA 5CZHA 3P5KA 5CSVA 3QKKA 4FV7A 4IWOA 5J1VA 2X4FA 2PE0A 4GU6A 4IH8A 2UZBA 3EWHA 4BCJA 4UX9A 4FSTA 2AUHA 3LMHA 4RWIA 4AS0A 2PYWA 4I1ZA 4KKGA 3LLTA 3O51A 1REJA 2LAVA 3LFFA 2H9VA 3RNYA 5CZIA 3DNEA 4FKPA 2UW7A 2VTLA 4G3GA 4LRJA 4TPTA 5ETCA 1QMZA 4OTIA 3VUIA 3ZLSA 4V0GA 4C62A 5CF8A 1G8AA 2BVAA 1CSNA 5CAOA 3F5GA 4F6UA 4PP7A 5M4CA 1Z57A 3HRCA 1Z9XA 3MFTA 3QTZA 1H24A 4JNWA 4LGDA 5CEMA 4YZDA 3E8CA 1NVSA 1S9JA 4O7TA 1M14A 4OTWA 4W8DA 2B9JA 2ZOQA 5F94A 4BDDA 3F2RA 4Z3VA 1V0BA 4EZ5A 2IN6A 3R83A 3NCGA 3F61A 3OY1A 3EL8A 4QMSA 4RGJA 3PIXA 3NSZA 5AIKA 3PSBA 1OBGA 3VC4A 2QOQA 4DG0E 1OIQA 2OKRA 3FHIA 4GT5A 4H3BA 4ITHA 4M12A 1YXUA 2YDKA 4J52A 4M68A 4UWBA 3HNGA 4QMVA 4AE9A 5EYMA 4EUUA 4S34A 1M17A 1FMOE 4F1TA 5HNBA 4N6YA 1Y8GA 3IGGA 4NFNA 2Q0BA 3QZIA 3NRMA 1W98A 5H3QA 3GENA 4C58A 3LIJA 4L67A 3HV5A 4ITIA 2WXVA 3ZXTA 5DYJA 5AUTA 1ND4A 5KMLA 1ZMWA 4J99A 3VBVA 3QC4A 3I5ZA 3HUCA 4FNXA 5HTCA 3ET7A 3QLGA 2F7EE 3D7ZA 3BHTA 4IANA 1NVQA 4FV3A 3MIYA 4JDKA 4LUDA 4RVLA 5JRQA 4W4YA 3DJ6A 4UWYA 2VNWA 2JKMA 3NEWA 1YI3A 4QT1A 3QQGA 4CRSA 3TG1A 3LKMA 1Q8WA 5DA3A 4FTKA 3WILA 2WKMA 3MGYA 4U97A 1UKIA 3IW8A 1G8SA 2QURA 2J7TA 3GB2A 5KMJA 2BTRA 3NDMA 2R2PA 5FXQA 1H1PA 4O7YA 4IM3A 1P5EA 3FUPA 4JR7A 5CVFA 4MXXA 3W8QA 5IUGA 5DIAA 2WTVA 2WIPA 2X1NA 1OPJA 3O8UA 4E20A 2EB2A 5IDNA 4PMMA 1BLXA 5CYIA 3KA0A 2R3NA 1LPUA 3A7IA 5IEVA 3FLNC 3EN9A 4E4LA 4C02A 3U6HA 3GC9A 3MVLA 3PXRA 4F08A 2RL5A 1ZAOA 4NCTA 3CTJA 3RAIA 4KAOA 3TJCA 4USDA 2C5VA 2I0YA 1M2PA 4J53A 5HO6A 2IW8A 2ONLA 1YXXA 3TT0A 4MH7A 4AGWA 4J8MA 3MFRA 3FDNA 1CKPA 1I44A 3DK3A 2B4SB 2X9EA 4FBXA 4GU9A 1O6LA 4A4XA 3RPRA 4DAWA 1PMUA 3H4JA 4BIBA 4GUBA 4DG3E 4EC9A 2OH4A 3KXGA 2F2CB 2OIBA 3P23A 4DEHA 2YIXA 2JEDA 3GUBA 2Z2WA 3QF9A 3R8LA 5J7BA 3K5VA 5J7HA 4FTAA 3ZCLA 3Q96A 2Q0NA 5IA3A 3QTXA 3RK5A 1Q8ZA 3ZOSA 1YDTE 1VYWA 5AUZA 2Z7SA 4GFOA 2YM6A 3I6WA 4F64A 4DGMA 5HGIA 4XG3A 2X81A 3IOKA 2ITNA 3IO7A 4V04A 3MJ1A 2XIYA 5LVNA 4AFEA 4DN5A 3QZGA 2R3FA 5EM5A 4GVAA 5KUPA 4H39A 3AC8A 5M4FA 4FV5A 3P08A 2YISA 5CI6A 3DKCA 1F3MC 2YCQA 3R0TA 4I21A 4YJNA 3DJ5A 2BRMA 3TUBA 2NRYA 4NL0A 5JQ8A 4QMTA 5I3OA 1CTPE 2HCKA 3BHHA 4G2FA 2EWAA 3RAKA 1J7UA 2C5YA 4K2RA 3QBNA 3GU8A 1YHVA 3MTFA 4L45A 2RG5A 3AC4A 4M13A 3FLYA 2OZAB 2VWYA 3DPKA 4BCOA 5IDPA 4EBVA 4QYGA 3N9XA 2UVYA 2R3LA 3OCGA 3Q9YA 5HX8A 3A8XA 1R3CA 5AP0A 1OKYA 2QU6A 5IEYA 1ZY5A 5I9WA 2ITWA 4IEBA 5H8EA 2VZ6A 2X6EA 1BYGA 4FT9A 2R3MA 3CD8A 4HZRA 1ZYSA 5FEQA 3W2CA 5LXMA 2Y4IB 4JAIA 5EG3A 1XH9A 3QRKA 4I0TA 4O38A 4U41A 4ZTSA 4H3QA 3N51A 3NPCA 4ASZA 3ULIA 4JI9A 3V5QA 4EHVA 4D4SA 4LMUA 3GCVA 3RWQA 4LMNA 4RMZA 3QKMA 4ZTQA 3PPJA 4EJNA 5EM6A 2WMVA 3E3BX 3LFNA 5L6OA 4FK6A 4R5YA 3MN3A 4L7SA 5M56A 1Z5MA 3VRZA 1P2AA 2WO6A 1VJYA 3IQ7A 3ZUVA 3WF7A 5T68A 4W8EA 3EKKA 4O0TA 4P2KA 5HVKA 5A4EA 5HQ0A 3F3VA 2VTNA 3LCKA 3UE4A 3BE2A 2OXDA 5KE0A 4BGQA 1H25A 1FQ1B 2ETRA 2IZUA 4R78A 3QCYA 4FZ6A 2FVDA 4BGHA 4CMTA 4RJ5A 4FODA 3ZXZA 3HP5A 4CQEA 4DH3A 1GNGA 4XMOA 3HRBA 3IPHA 3UTOA 3HEGA 2BAJA 5BVDA 5I4NA 2QONA 4FTRA 4OAVB 3CY3A 4YZNA 5IUHA 3Q9ZA 5KO1A 5FD2A 5DR9A 3F2AA 3LCTA 1FVVA 2VTRA 4L46A 4CD0A 4FKQA 2W99B 4QMPA 5A4CA 3QL8A 2XIKA 4Y46A 5E4HA 4IZYA 3JS2A 3TXOA 5HCYA 2WTKB 5HBHA 3OHTA 2Y9QA 3LW0A 4FTTA 2J9MA 3VS5A 5HKMA 4DF3A 2GHMA 2HIWA 3CR0A 2VTHA 4YUQA 1Y6BA 5A4LA 2I0EA 4DBXA 1H00A 1ZRZA 4LOOA 3PXQA 5TE0A 4NJDA 2WMUA 4D1XA 2XCHA 3U9CA 1A06A 3AD4A 2ITTA 3IGOA 2Y7JA 2DUVA 1B38A 1JOWB 3U55A 4EH3A 4BGGA 4B99A 2EUFB 3N4VA 4ZAUA 4XNEA 2C6TA 3D7TA 3LM5A 3NUNA 4FZFB 4XV2A 1O6YA 4I4EA 5HU3A 3NUAA 5HZNA 4LRKA 3UG1A 2C5XA 3SA0A 4MQ2A 4L42A 1Q8TA 2HZ0A 2NO3A 3RMFA 3F9NA 4C4GA 4X2KA 5L4QA 2C0IA 4R77A 3TNWA 3AD6A 2PE1A 4CLJA 4IDTA 2UW5A 4G3DA 4L01A 2BR1A 3N4UA 3TM0A 4DFBA 3D9VA 3RINA 1RE8A 4GT3A 3TN8A 5CALA 2ETKA 3CC6A 3O96A 4ZTRA 4CV8A 1TQPA 4FF8A 3UIUA 4UMPA 2GFSA 3BV3A 3OD6X 3BPRA 3OOMA 3KCKA 4CYIA 3F88A 5CEIA 4BTMA 4HGLA 1H1RA 4QNAA 2HY0A 4JQ7A 3UG2A 3Q6WA 3HP2A 2A1AB 3KMMA 4UWCA 4EOPA 1NT2A 3COKA 1XWSA 3EL7A 2OJGA 5KMIA 3FC2A 4PX6A 3UOLA 4RPVA 2E9OA 2JAMA 5LVMA 3D83A 3K2LA 3E8DA 2ACXA 5C01A 4IFGA 3F69A 2J51A 2GPHA 4RC3A 4W4VA 4TTHB 3PY3A 1JAMA 1YWVA 1PMEA 3LCOA 2A19B 3BU5A 3SRVB 3ZM9A 4BY9E 4QMOA 3H9OA 4IB3A 4EBWA 4F63A 3RPOA 4OTFA 5AM6A 5HVJA 3OS3A 2HW6A 3BBWA 4U40A 2IWIA 2P55A 3IONA 5E1EA 2BIYA 1W82A 2X2MA 1NA7A 1GIJA 2VX1A 2WQOA 4IADA 2Z60A 3UGCA 4BDIA 2GQSA 3R00A 2GNLA 1JLUE 4IZ7A 5I9UA 5CENA 5HBEA 2P2IA 2O0UA 4WUAA 2W06A 4JRVA 2OK1A 4I5MA 3EFKA 5KKRB 1Q97A 2B9IA 1OVEA 3LE6A 4GUEA 4KRDA 4C59A 3FLWA 3PXFA 4JS8A 1VEBA 4XG2A 2HOGA 1PY5A 2QOFA 4FG9A 2UZEA 3CE3A 4JR3A 4BZOA 3E88A 3A7JA 2QO7A 2FSMX 2B55A 5DWRA 3GVUA 4FTCA 2G1TA 3FZRA 3KFAA 4FZAB 3FKOA 3RJCA 4F1OA 1KOAA 3O2MA 4RWLA 3UZTA 1JBPE 2ITPA 3W2RA 2C3LA 4ITJA 4PPAA 5DEYA 4MEDA 4FIHA 4TZRA 3BEAA 2WQEA 3WZKA 4D2VA 4FEWA 4L00A 2IG7A 3QTWA 2B1PA 2PHKA 4RBLA 2O3PA 3G0FA 3ORNA 1ZZ2A 4CMUA 4D4RA 4F0FA 4OLIA 3UPZA 5CAVA 3VUDA 5LMKA 2DQ7X 3DQXA 4YBKA 2XKDA 2CKQA 3AC1A 2OFVA 5CSHA 4F7SA 5FP6A 2XH5A 2YAKA 3RPVA 2X7FA 4WNMA 4FL2A 4YGAA 4YP8A 4E6DA 2A0CX 1URWA 2W0JA 4IAKA 1JQHA 4XG6A 4F6WA 3AD5A 4TYHA 4EH8A 5LOHA 2VTQA 5HIDA 2CMWA 3ZFMA 4F4PA 3UYSA 3IK3A 3AT3A 3V8WA 4HVSA 4D2PA 3R01A 3FHRA 3LXNA 3PG3A 5CVHA 3RNIA 4NM7A 3K3JA 1XH8A 1DI9A 4X21A 5T6KA 5C4LA 3OY3A 1UWHA 4AGCA 4I0RA 2YJSA 4UEUA 3T3VA 4FOBA 3R1SA 4RZVA 5HNIX 1U4DA 4CCBA 3ZRLA 3FI2A 2WEVA 3DAKA 4ZZNA 3MDYA 5L6PA 4JBOA 3L9LA 3SD0A 4IQ6A 4F9YA 1E1XA 3LPBA 4J7BA 2E9UA 4GCJA 4BIEA 4BDEA 1YOJA 3UC3A 2WELA 5A9UA 2PVJA 1H1WA 3B8QA 3HMIA 3CD3A 4GVJA 2XZSA 4KA3A 5L8JA 2C0OA 3PP1A 4AN3A 4NU1A 3TV7A 4PTCA 4FEQA 2W05A 4D4VA 4IM0A 5J87A 1YVJA 4C4HA 1HCLA 2WU6A 3C4XA 3F2NA 4XV9A 4QMZA 5AR2A 3VQUA 5A4QA 4NYEA 4BZNA 1UU8A 4JT3A 4O91A 3G6GA 3MPTA 3QWKA 5GIOE 4KIKA 4FSYA 3FY0A 4FKWA 2ERZE 4AGUA 4MXAA 3KN5A 4KRCA 3R7VA 3D5XA 4C4JA 5AV2A 3ORPA 1JSUA 5AJQA 4N6ZA 2YCSA 4I92A 2JDOA 4E4MA 4CNHA 2WMSA 1MP8A 3LMIA 5HOAA 2P4IA 4G6OA 5K5XA 2Y0AA 4D2SA 4IWDA 3PXYA 4YZMA 5KBQA 1WVWA 2VO6A 5I3RA 5E8WA 3QUEA 5D1JA 1FGKA 4RX5A 5BVFA 1YHSA 5HIEA 5CU2A 4WSYA 3UBDA 1J1BA 2C6LA 1ZOGA 2C69A 3QQLA 4IX3A 3EB0A 4OTHA 3SW7A 4D28A 4H1JA 3WARA 4OT6A 1UNGA 5TF9A 5KMKA 4XBUA 3I81A 1H1QA 5DEWA 5LVOA 2XUUA 2ZM4A 4TWCA 4H58A 2ZMDA 1CM8A 2GHLA 3U51A 3HRFA 3ZSHA 2VWXA 4EH7A 2H8HA 3FKNA 3MH0A 2VWVA 3HMNA 3LFBA 4AACA 2V55A 4Z16A 3GU6A 1FMKA 5HE1A 3NUPA 3FMJA 4QO9A 4XG7A 5CU3A 3U6IA 4IIRA 3EQDA 4Y95A 2PVNA 4IM2A 4EOOA 4RJ7A 4AOTA 2WMWA 3QTRA 5DH3A 4WBBB 2X7OA 4FV8A 5CT7A 1M2QA 5DG5A 3O7LD 3U4WA 4XRLA 3B2WA 4U9AA 2X8IA 4MXYA 4RJ3A 5C8NA 2V0DA 1IAJA 1M52A 1ZY4A 3P86A 3PY0A 4C0TA 5IF1A 5BX0A 1V1KA 2GNGA 2OO8X 1BUHA 1U54B 3HYHA 1OM1A 3Q5ZA 2Y6OA 3ATTA 4ZS0A 3C5IA 2QNJA 3MA3A 2BCJA 2XKCA 5AAGA 4I6HA 3FYKX 3M1SA 4JX3A 3UMXA 4IX5A 3UO6A 3DBCA 4FZ7A 4D2TA 3AC5A 5EDQA 4Y85A 3R8MA 4HCUA 4QP1A 4R3RA 2JIVA 5HCZA 2JITA 5JMSA 3MY1A 4FKOA 4EOSA 4CT1A 4K6ZA 4L43A 3FY2A 4RRVA 5IH5A 2I0HA 3KQ7A 4O7ZA 2Y6MA 4FTIA 4QTCA 3HZTA 5JRSA 4CFWA 2YWVA 1XBAA 3MS9A 1PKDA 2Q83A 3C9WA 2PVFA 4X3FA 1TQMA 3GC7A 2PVMA 4LG4A 3R7IA 4HVIA 2I7QA 2GFCA 4EZ3A 5FP5A 4FYOA 3RWPA 3OUNB 5ANDA 1YXVA 3TKHA 2UZUE 3MH3A 5DGZA 3HMOA 4AW2A 3BYOA 4IJPA 5LQFA 2AC3A 3FSFA 4R7BA 1OI9A 2W1CA 3QYZA 1F5QA 1OPKA 1KE7A 3VF8A 1WZYA 3L9MA 4TWOA 5D9HA 3F3TA 4IE9A 3DQWA 3SXRA 1GZKA 4C57A 4AT4A 4CYJA 2PUPA 3LXPA 4BDKA 1WAKA 3Q32A 3VBTA 2XNNA 4MVFA 2VRXA 1GOLA 3PZEA 2CLQA 3ZZEA 4CT2A 4QP6A 2CKPA 4ONAA 1E1VA 3ZC6A 5HVYA 3A62A 4D1ZA 4GH2A 2PULA 4NIFB 4ZY4A 3UPXA 2X0GA 3O50A 5CF4A 4LYNA 5E1SA 3E8NA 3ZTXA 4F09A 3CKXA 5IUIA 2QCSA 3P78A 4HNIA 4AZFA 4CKIA 5FRIA 2VO0A 5A14A 3PVWA 4PDYA 4G5PA 4HJOA 1OBDA 3Q5IA 2CNVA 4ZTMA 4DCAA 3F7WA 2GNHA 2BFXA 2W17A 3LQ5A 4IZ5A 4RWJA 4RIXA 2XCKA 5AADA 1MRYA 2PZRA 2XNMA 3ZUUA 5CY3A 2VO3A 4ANMA 3R1YA 4MBJA 3VUGA 4EZ7A 3DXNA 4F0IA 4FKUA 3W32A 1PF8A 1PHKA 3QD0A 4MD8E 5C27A 3FZTA 4PTEA 1X8BA 2CHLA 2RFNA 3MJ2A 4M69B 3OT8A 3E92A 3WE8A 1UKHA 2C6IA 3R9HA 4FSMA 4Y83A 3ZUTA 4QMNA 3D2IA 4C38A 4YHFA 5KMNA 4EOMA 3HA8A 3R7GA 4FTUA 4I5HA 2BRHA 4O7LA 3S1HA 4DGLC 4EHZA 4MNFA 3DZQA 3VBYA 3QUPA 2OF4A 3VHKA 1OKZA 2W4KA 3GI3A 3UO4A 4EH4A 3UZPA 1PXKA 2XEYA 4C61A 3RVGA 3H3CA 4AA4A 2GS6A 3Q53A 4U6RA 3QHRA 2JD5A 4AA0A 2JC6A 1J7LA 2GSFA 3DKGA 2XF0A 2XIXA 3HECA 2PU8A 3PY1A 4BB4A 3VULA 3COMA 3PIYA 4EONA 3ERKA 3FI8A 5E8TA 4EK4A 4AQCA 4DEAA 5ITAA 2HY81 4ACHA 2X2KA 4XLIA 1YI6A 4CXAA 5JFSA 2YERA 4M97A 2RFEA 2YHVA 4MXOA 4AP7A 4KIOA 4CCUA 5F20A 1MUOA 3E3PA 4EH5A 4Z7HA 2J5FA 2I1MA 3ANRA 3OTVA 3R2YA 4RQKA 1O6KA 4TWNA 1UU9A 4CG8A 2BIKB 3A8WA 3HGKA 4J8NA 4UYAA 2B54A 2XK7A 5K3YA 2PUIA 3DLSA 3KF4A 4IAFA 3C13A 4OTRA 5AMNA 1YXSA 5FQDC 4ANOA 5EI2A 3JUHA 3DK6A 3DB8A 3IS5A 3ORZA 3FQEA 4C8BA 5LCKA 3C50A 4DEEA 1J3HA 3QWJA 2ZDTA 3I0QA 3V5LA 5CAUA 4IW0A 5C4KA 4FV1A 3S2PA 1H1SA 3S00A 4AX8A 3UVRA 3FXZA 4YBJA 4O27B 2A2AA 4I93A 4O6LA 4P7EA 4BCFA 4PL5A 4D9UA 4GKIA 2NP8A 4BCQA 5HORA 1OL5A 4L53A 4FGRA 4CG9A 4BKZA 4LGGA 2HZNA 4ZEGA 3CQUA 3Q9XA 5AR4A 2QOCA 2RG6A 4JIKA 4BWXA 1JKKA 2BTSA 2UZTA 4G3EA 4WHZA 3G0EA 5IA1A 2VTSA 4C2VA 4IACA 2PSQA 4KSPA 2WMXA 4BCMA 3R9NA 4E6QA 3QQJA 3EQGA 4B9DA 5GJFA 5AFVA 3SKCA 4QMQA 3FMHA 1AGWA 1OIUA 2QC6A 2ZYBA 3MYGA 3PWDA 4L7FA 4S33A 4XP2A 4UMRA 1ZOHA 3CTQA 3NX8A 3U9NA 2R3JA 2PL0A 4PWNA 4BKJA 3VF9A 2PMIA 3JPVA 5C8KA
chains in the Genus database with same CATH superfamily
4FV4A 2RSVA 3NIZA 1Q3DA 3BV2A 3W8LA 2XJ1A 2F7ZE 3RM7A 3KRRA 4O0UA 3A7GA 3EZVA 2F2UA 3TACA 2IVUA 4MTAA 5EYKA 3AMYA 3QCQA 3TTJA 5CSPA 4DTAA 3M42A 2XIZA 3FWQA 2QU5A 1J1CA 2WEIA 3OG7A 1P14A 4FNZA 1GIHA 4PV0A 3GXLA 4RC2A 2GNFA 3ZH8A 2XK6A 1OZ1A 4RIYA 3CTHA 4IDVA 4A4LA 3EOCA 1WFCA 4L8MA 4FTMA 2WQNA 4G9RA 4TXCA 2P2HA 4YC3A 5EW8A 3VVHA 3E8EA 5L8KA 1BKXA 2R0IA 3UQFA 3BYUA 2YM7A 4KS7A 1W84A 3QZFA 4LOPA 4NZWB 2YIQA 5FEDA 3VJOA 3HV3A 5KHWA 2P33A 4HGEA 2R3KA 3KULA 4QTAA 1DS5A 4TKSA 4DH1A 1ERKA 5AUUA 4JXFA 4KNBA 4OW8A 4YC6A 4X2NA 4E1ZA 5E8ZA 3DFAA 2R4BA 1APME 1H07A 4GIIA 3CP9A 2OIQA 4FKLA 4PDSA 3RK7A 3QU0A 4EHEA 3MESA 1FPUA 3Q2JA 5FUTA 2ZV8A 3RBWA 2OIDA 4GEOA 3OOGA 4YO4A 4KKHA 4O84A 4WUNA 3L9NA 3PZHA 1J7IA 1YOLA 2OWBA 4QPMA 4QNYA 2ITOA 4NW6A 3G5DA 3FV8A 4QQTA 4MNEB 4II5A 2PTKA 4RVTA 3TL8A 3O0GA 2BDFA 2KULA 4C37A 4DFNA 2QKRA 4Q5EA 2W7XA 5EKOA 4O4EA 1YWNA 3FPMA 3TCPA 3OVVA 4F7LA 4M84A 5CAPA 4USEA 2JIUA 1R39A 4WNPA 4HNFA 4ANNA 1GZNA 2WTCA 2NRUA 3EYGA 5ANKA 4TN6A 4XOYA 1OUYA 3EFLA 4CGAA 2R7BA 5EI6A 1WMKA 2EXCX 5LMAA 3UDBA 1W2DA 3QXOA 5L2IA 3PXKA 4RIWB 5FG8A 4YHJA 4ZJIA 3FC1X 2W5BA 3EH9A 2F4JA 5GJGA 2BZIB 2JFMA 3GC0A 5EFQA 4B8MA 3ZMMA 5IQIA 1M7NA 1V0OA 4OBPA 3ROYA 5EQYA 1JNKA 3I7CA 3KRLA 2YIWA 1MRVA 2IZRA 4WG5A 3VS3A 2GQGA 2PVYA 3FLZA 5HEZA 1K2PA 4DEIA 1OL1A 3DAJA 4EH6A 4DHZA 3EN4A 3U8WA 4OAUC 4F9CA 2YM8A 4MD9E 4X2FA 2CN5A 4ZXTA 3R7YA 4A9YA 4P4CA 3RKBA 3L8VA 5LVPA 2WOTA 3MPAA 3NAXA 4DEDA 1H01A 1GZOA 5IQGA 4ACMA 4FNWA 4MXZA 3V04A 3QRIA 4RFZA 5M09A 4QYHA 3CGOA 3MA6A 5BVWA 4FKGA 4CV9A 4YZBA 4CZTA 4NM0A 3U4UA 5KHXA 2CKOA 1Q99A 3IKAA 1TQIA 1W8CA 2CDZA 1KE5A 3NUUA 3KXHA 3R8VA 2BUJA 3VUTA 5JK3A 3UZRA 2XARA 5LARA 3PJ3A 4D4YA 2OJFE 3W1FA 1Q24A 3FMMA 2RGPA 3UYTA 2YDJA 2YM3A 5HD7A 2CCHA 2C3IB 1Q8YA 3OW3A 4GRBA 4CFVA 5F9EA 3WF5A 3LFSA 2PUUA 2V7OA 3POZA 3OBGA 4BCPA 5JGDA 1OMWA 3D94A 3AXWA 4W9XA 2B9FA 3I60A 4BDGA 4EOQA 3PA5A 4E5WA 4EK8A 2WOUA 4G6NA 5DT0A 1FGIA 3QTUA 4ZSAA 4L6QA 4ASXA 5CSXA 4Z7GA 3A7FA 4FMQA 1XJDA 1U59A 3TNIA 2CJMA 3Q04A 2VTMA 4UY9A 2OLCA 3OC1A 4QOXA 1ZXEA 3OCTA 4I20A 4XS2A 1PKGA 3ZHPC 4DFZE 5CASA 2BALA 2WFYA 3QQFA 3B2TA 5E92A 4BYJA 2J0LA 4CEGA 3S0OA 1UU3A 5FTGA 3UVQA 5I9VA 2ITQA 3R7OA 2GS7A 3RCDA 4WG4A 3B8RA 3MY0A 4BHZA 4BCGA 1WVXA 2J50A 4YLLA 5AV1A 4GG5A 4KWPA 2QR8A 1REKA 3V5TA 3QC9A 4EH9A 3OCSA 5HCXA 2BKZA 2BZHB 2QVSE 3MVJA 2VWZA 4I94A 4PDPA 5AR3A 4EEVA 4XV1A 3QRUA 4J98A 1ZMUA 4KSQA 5EYCA 3QQKA 3FZ1A 1LEZA 2JDTA 3OMVA 4G9CA 4E26A 2OXXA 3A7HA 3AOXA 1UNHA 2PZIA 3Q6UA 4UYNA 3RHKA 3SHEA 2OICA 2C30A 1FVRA 4HYSA 2R9SA 3W2OA 2ZMCA 5KZIA 4DLJA 3UP2A 4Z9LA 3O8TA 3NNXA 4F65A 3PPKA 4M67A 5E8VA 3KVWA 4RQVA 4CFNA 1IRKA 2PZPA 5C9CA 4F7JA 5ANOA 4D2RA 4FEXA 2XS0A 4DEGA 4BJJA 5CAQA 3NUSA 3ZSIA 2YZAA 4XG8A 3QGYA 4YZCA 1XH7A 3ZC5A 1NXKA 2FYSA 2CGVA 1STCE 2QOIA 3IW6A 1TFFA 3DB6A 4FKSA 2UW4A 2XJ2A 3U6JA 2J2IB 1IAHA 3BGPA 3ENMA 2WQMA 4IB0A 3SXSA 4CTCA 4M0ZA 3FMDA 3BL7A 3QAME 1VR2A 4RX8A 5IU2A 4F7NA 1BI7A 1IEPA 4RWKA 5ETAA 4DITA 3KRXA 2QOHA 3GFEA 4UN0C 4ZTHA 3TEIA 5HU9A 5IQHA 2QD9A 3ZEWA 4EWQA 5K5NA 5CU6A 5HHWA 5TR6A 4O83A 2VAGA 3DLZA 4BWPA 2WHBA 3PXZA 2W1IA 3W55A 4E4NA 3CGFA 3CXWA 4IAIA 3DOGA 4QYYA 2W4OA 4CTBA 3PJ8A 2I40A 5DE2A 3IOPA 4FX3A 4IX6A 3K3IA 3KXMA 3LJ0A 4QMWA 4ZSGA 4D0XA 3DXPA 3QTIA 4CMOA 3R1QA 3PFQA 4FV0A 4TY1A 4YPDA 4R1VA 4EKKA 4DHIB 3DNDA 2HXQA 4M0YA 2C47A 2XM8A 1OGYA 3FKLA 1AQ1A 3LVPA 3PJCA 3NW7A 5ACKA 4A9UA 2RKUA 5EK7A 1OIYA 3F3WA 3FSKA 4FT0A 3CY2A 5LWMA 4EH2A 2B7AA 2OJJA 4X3JA 3DJ7A 3Q9WA 5BMSA 5HG5A 4XG4A 2BHHA 4NK9A 4PDOA 2JAVA 3BX5A 3W18A 4ARKA 5TKDA 2R3GA 3II5A 3P4KA 5CLPA 4G16A 4Q5HA 5CEOA 2C6MA 3HA6A 3H10A 3R71A 3O8PA 3ZS5A 5LJJA 5ANGA 4O96A 4FVQA 1UVRA 1H4LA 1H27A 2DS1A 3AC3A 2OZOA 4U80A 5DT4A 5CTPA 5IQAA 2FSOX 4FTNA 3BLRA 4EORA 4O81A 3GCUA 4RIXB 1QPEA 4TWPA 4O2ZA 3Q2MA 4YJOA 3DTCA 5K4IA 3LFDA 2ITYA 1DI8A 3M2WA 3PSCA 4RZWA 4DGNA 4EK5A 1GAGA 4RFYA 4OGRA 4AF3A 3R1NA 3DFCB 3MSSA 4CFXA 4DHFA 2EXEA 4XCUA 4MK0A 3DDPA 3MV5A 2GTMA 2AEGA 3EFWA 2EB3A 3GGFA 3UIMA 4K77A 4APPA 3LCDA 3S95A 1JKLA 2X4ZA 4FSUA 4UMQA 3ZU7A 4BTKA 4FIFA 5CSWA 4KINA 4WT6A 3PJ1A 3RPYA 2Z7QA 4YJUA 5CEKA 2Y4IC 3AKLA 3NUXA 3F5XA 3RALA 2AYPA 3QTSA 4HOKA 5AP3A 3TZ9A 3D2KA 3FYJX 4S31A 3W2QA 5BUIA 3PVGA 2XA4A 5IH4A 1VZOA 3C4WA 2G2IA 4TYEA 5KMOA 3MIAA 3ORMA 4TT7A 5E8SA 4AN9A 3DA6A 1PXNA 2X6DA 2XNOA 4A07A 4EL9A 2Z02A 3BL9A 4YU2A 3DDQA 4YJPA 3ZO1A 4A9TA 3P79A 4CZYB 5AP7A 3TZ7A 5G1XA 5AV4A 4N70A 4ZZOA 4ZLZA 2XNGA 5JFXA 5EDRA 2HK5A 2QG7A 3CS9A 4QP7A 5D41A 1Q4LA 2ZAZA 3QALE 5M57A 3UIXA 3QUDA 2OGVA 4IWQA 5JQ5A 3COHA 5HLPA 4APCA 5DVRA 3DXQA 3SG8A 5BVKA 2B0QA 1WBNA 2E9VA 3BHUA 5J1WA 4NJ3A 1T45A 5G6VA 2CPKE 4E5AX 4BI1A 3BLHA 5GZ8A 3VUHA 4ALVA 1A9UA 1IA8A 5JT2A 3BRBA 4UB7A 5IISA 3FMKA 2PMOX 5DR6A 5D12A 4B4LA 2WD1A 2VD5A 2V62A 4P5ZA 5FBOA 5BVNA 1PJKA 1EH4A 1LEWA 3BIZA 4K33A 3VS4A 3I79A 4I4FA 4TYJA 2DWBA 2HAKA 3E7VA 4GFMA 5CU4A 3S4QA 4QMLA 2VX0A 3ACKA 2JBOA 2XNPA 2WTKC 3D0EA 4QD6A 3R8PA 5AA8A 4UXQA 3CSVA 2A4LA 3HVCA 5CU0A 5M06A 2VTIA 4QP3A 1W83A 3H0YA 5CANA 5E7RA 1Y8YA 3V01A 5EHOA 4YJQA 5CNOA 4BVUA 4S30A 1DM2A 3WF8A 2QO9A 1YW2A 2FA2A 3G9NA 3DBFA 4LM5A 4TRLA 4C3FA 5HIBA 3Q4ZA 3C1XA 3R2BA 3GCPA 3MFSA 1FINA 4V0GB 4HVGA 3C0HA 3OWKA 1H8FA 5FGKA 5CNNA 4JDHA 3NR9A 3PJ2A 2QLQA 2W1HA 1GY3A 2UZNA 3BKBA 5HBJA 3WZDA 3EYHA 3W33A 4Q2AA 2Z7LA 4MWIA 5K0KA 4NWMA 2W1GA 4WA9A 1M2RA 2XEZA 5DT3A 3D5UA 1RQQA 1PXJA 1ATPE 5GHVA 4D55A 3D4QA 4ZLYA 2OBJA 4GK4A 4FG7A 4HGSA 4C7TA 5EHYA 4IAAA 4J97A 4D9TA 4EUTA 2UW9A 5CF5A 3PLAE 3C4FA 4YC8A 3JVSA 3F3ZA 4FIIA 3UDTA 2BHEA 5AP5A 5C03A 4ERKA 2EU9A 3EHAA 2FB8A 4QQJA 3REPA 4K9YA 3GFWA 3TNPC 4DH5A 5J5SA 2XYNA 4MYGA 5ICPA 3RK9A 2JKOA 3GU5A 2WMQA 2CGWA 4YURA 4UALA 3FJQE 2J5EA 2OZAA 4LQMA 5ANJA 4K1BA 4L52A 3NZ0A 3RZFA 3A4PA 3UOKA 4DG2E 1A48A 3NNUA 2BZKB 4FIEA 3ZZWA 4JL9A 2XKFA 1PXIA 4BHNA 4PP9A 4PMPA 3RCJA 3PRIA 2O63A 5K9IA 4YPSA 4YR8A 4FV2A 2XP2A 4GK2A 4RJ4A 3UQCA 1S9IA 4JIAA 5TT7A 4D5KA 4PUZA 4YSMA 2QOOA 2X39A 2C6DA 2OJIA 4FKRA 1OKVA 3ZRMA 4AGDA 3N4TA 2XK3A 2ZDUA 4HZSA 4XYFA 3DAEA 3W10A 5HLWA 5CI7A 5IQBA 2FSLX 3C4CA 1ZWSA 4LV5A 5KKRC 5IQCA 4KIPA 4XUFA 2CNUA 5EM7A 4XV3A 3O17A 2QHMA 4GFGA 1W7HA 3TDVA 2RIOA 1L3RE 4G31A 4ZY6A 4ALWA 5IQEA 3LZBA 4U45A 4AT3A 3FQSA 4KABA 4HYIA 4FZDB 2QOLA 4ZJVA 4IVAA 3GBZA 4JG8A 3JR1A 3GNIB 5FTQA 3TZMA 5AP1A 2ITVA 4Y5HA 4JAJA 1OKWA 2XK4A 4J95A 4HCTA 1IA9A 3BI6A 4AXFA 1UNLA 1VLRA 5KCVA 4ASEA 2OFUA 4RT7A 5HG9A 4BC6A 2VU3A 3ZO4A 4ZMEA 3H30A 5EYDA 4JDIA 1W0XC 4AOJA 4XEYA 5K4JA 2JFLA 1SNXA 2VTOA 2WTDA 3AMAA 4V05A 4ZTLA 3OXIA 4WIHA 5GINE 3JYAA 2UV2A 4QTDA 5T3QA 3ZONA 5J9LA 3PA3A 3UNJA 3ODZX 3JY9A 4YTCA 4AXAA 3WOWA 3KK9A 5EI8A 5ETFA 2RF9A 4AZSA 4BI2A 3ANQA 3AT2A 5HTBA 4RLLA 4ZY5A 5HG7A 3U87A 2OXYA 3F5PA 1TKIA 2WTIA 4BL1A 3H9RA 4F9WA 5LWNA 2KTYA 2XK9A 4O4DA 5E91A 4CFFA 3O7LB 1OUKA 3LCSA 2W1FA 4I3ZA 1ZLTA 4LV8A 3F82A 4O0SA 3WZUA 5GIPE 4BDFA 2JLDA 4PY1A 4MUQA 2H34A 2W96B 4EWHA 2BAQA 4O4BB 4TYIA 4WNKA 4ALUA 4LL5A 4KD1A 4OTQA 1RDQE 3L8XA 3MH2A 2ZM1A 2ESMA 3C5UA 3HV4A 2JKKA 2QQ7A 4HYHA 4IC8A 3RAHA 4GMYA 3W2SA 4KIQA 4ZMFA 1NVRA 4RX7A 2JDVA 3ZRKA 5I9XA 2CSNA 3TV6A 3EQRA 4K8AA 2QLUA 4BDHA 4GKHA 5AAEA 1WVYA 2Z8CA 3ZFXA 5A46A 3NIEA 3DU8A 4IVCA 5AP2A 3ULZA 5M08A 5A6OA 4G3CA 1CDKA 4MQ1A 5DLSA 4Q9SA 2XBJA 5AWMA 4G3FA 2QOBA 3EZRA 3LXLA 4G1WA 4ZIMA 5DOSA 3D5WA 5HLNA 2HZIA 4WSQA 5F95A 5BPYA 3DCVA 1JSVA 4U79A 5FWKK 3EKNA 3R8UA 3BELA 4FR4A 3E5AA 4MBLA 4DH7A 4EOIA 2YN8A 4GIHA 4R3CA 4QPSA 3UO5A 3HL7A 4BR3A 3QQUA 3T9TA 5JGAA 2WU7A 4PTGA 5HD4A 3SGCA 4FTOA 2HENA 3C4ZA 4DT8A 4BBEA 4DLIA 1ZYLA 3ITZA 5JZJA 4IAZA 3KXNA 3I0OA 4RIOA 5HE2A 3NCZA 5L6WL 4C4FA 4BCIA 3VS0A 3BQRA 4NM5A 4EHGA 4EJ7A 3DZOA 1OL7A 4NTSA 4W9WA 3SRVA 3QRTA 4ANBA 2PVKA 5JEBA 4TYGA 1PMVA 3VBQA 5AIRA 3SVVA 5IA5A 2AC5A 5EQEA 3OW4A 3TMOA 3ZDIA 2R3IA 4S2ZA 4CQGA 3KMWA 1PYEA 4A9SA 3ZLXA 2DYLA 4QQCA 3I5NA 4OT5A 3KGAA 3ZYAA 3EN7A 2BRBA 4B0GA 1P4FA 4E5BA 2BDJA 3KVXA 3OWJA 4EQMA 2Y4PA 2V22A 2YFXA 2CN8A 3V8TA 3ETAA 4I23A 3KMUA 3DK7A 3LFAA 2XBAA 4BWKA 2YZLA 4C2WA 1PYXA 4BRXA 2ERKA 3GC8A 4OR5A 5CWZA 5TO8A 4FKVA 2QG5A 3TZ8A 3V6SA 3R9OA 3R02A 4FEUA 3CCNA 3KY2A 5DR2A 2GNIA 5E8YA 4ASDA 4FUXA 4BN1A 3R63A 1BL6A 2PWLA 3R21A 4J1RA 5E8XA 3TDWA 5GZAA 3VS1A 2WGJA 5E9EA 4WRGA 3UVPA 3TNQB 1G5SA 4C3RA 4YLKA 4PF4A 4U43A 5I9ZA 4BJJB 1WBOA 4D5HA 3NAYA 2OF2A 3UMWA 5I0BA 3PSDA 4R5SA 4ZSJA 3KK8A 4O82A 2X9FA 5ACBC 4UZHA 4H3PA 5H2UA 1OGUA 3L8SA 3SXFA 3F5UA 1R78A 2O65A 4YTHA 4DC2A 5F4NA 5DN3A 2C6KA 3KF7A 3HUBA 4BCNA 4FSNA 4D1SA 4FI1A 5L2WA 2ZV2A 4DFLA 1QPCA 4O4CA 4WKQA 3D7TB 3MWUA 5AUYA 3PPZA 5AX3A 4FJVA 4WO5A 3SDJA 2REIA 4LI5A 4E6CA 4JG6A 2XRUA 3G33A 2WTJA 5C8MA 4AAYA 3AGLA 2C6OA 3TJDA 5AEPA 1H28A 1QL6A 2GU8A 4WD5A 2WMTA 5H9BA 5BVEA 4RC4A 5B2MA 3GOPA 4USFA 5L8LA 4NCTC 2R64A 2OH0E 3UIBA 4AXCA 2E9PA 4X6QC 3TUCA 4O1PA 4XX9A 4FA2A 4CVAA 2ONLC 4BKYA 1H0WA 2CNQA 4X6RA 4R3PA 3TKIA 4CFUA 4QDEA 2IVVA 1XHAA 3ZDUA 3CEKA 4IB1A 2EVAA 2JDRA 4JQ8A 2W5AA 4H36A 3BU6A 4QP9A 4C35A 4E7WA 5B2KA 2IPXA 3TI1A 3I7BA 3VIDA 4ZP5A 2CKEA 4RJ6A 2R3QA 1XH6A 5HE3A 3WZJA 4EK3A 3R9RA 4BDAA 4IHPA 5EW3A 3DT1A 1TZDA 2Z7RA 3OEFX 3FZSA 4WRSA 2F9GA 2VUWA 4MKCA 4XOZA 3JXWA 3MVHA 5D10A 2SRCA 2C6EA 3GEQA 1WBPA 4NSTA 4BDBA 5CEPA 4LRMA 3PUFC 4I6FA 4R1YA 1XKKA 4L44A 2ZV7A 2BZJA 4D58A 4DBNA 3C7QA 5JFVA 2XK8A 4ACGA 2ZM3A 4PMTA 5CX9A 4NUSA 3V3VA 4O0WA 3S3IA 5AA9A 4AZEA 4I22A 5AP4A 2HW7A 5IKWA 3V5PA 3BCEA 4CFMA 2CGUA 4K0YA 3QD2B 3HMPA 3FQHA 3VN9A 2W1EA 4D0WA 2XRWA 2C5NA 3KC3A 4MXCA 2YABA 4EKLA 2C3JA 1DAYA 4HYUA 4AT5A 4C34A 5IG1A 2ITXA 2LGCA 2UZLA 5C26A 1JWHA 4X0MA 3KL8A 2WB8A 1JKTA 2GS2A 4NM3A 1KUTA 3KEXA 4O0YA 4Q9ZA 2BKKA 3LFCA 3OROA 1Y91A 1XH4A 4JQEA 3AGMA 4FL3A 2GNJA 4M3QA 3G6HA 4UMTA 4E73A 5HI2A 2JKQA 3PIZA 3WYXA 1XO2B 4BBMA 2HZ4A 5HNGA 5K0XA 5L2TA 4FV9A 5J9YA 4EOLA 5J79A 5JH6A 2YWPA 1SVHA 3ALOA 3TWJA 3WF6A 1YXTA 3GQLA 4MX9A 4MAOA 4E8AA 2GQRA 2PZ5A 1XH5A 1E9HA 5LVLA 3NNWA 3V51A 2YLFA 4A7CA 2C3KA 4UMUA 4U44A 3OWLA 3RZBA 1F0QA 1P4OA 5A6NA 4PQNA 1G8KA 5EQPA 4OTPA 4R8QA 4O0XA 2YCRA 3P5JC 4O0RA 4IVDA 2YM4A 2J90A 3R7UA 3NS9A 4XP3A 4JOAA 1YQJA 4AFJA 3NVKI 5IH6A 4FUYA 2X0OA 4XHKB 2IW9A 4TYHB 4EYMA 2FSTX 3NW5A 1R0PA 2YCFA 4JJRA 2XANA 1SZMA 2XB7A 3Q4CA 4X7QA 3THBA 4L68A 4PL4A 3P7BA 4RVMA 5FTOA 5H8BA 5B0XA 1R1WA 1V0PA 4GSBA 4ACCA 2J4ZA 2YAAA 2PVHA 3FZPA 3ORLA 4Y73A 5AR5A 1U54A 3RGFA 3F66A 2XMYA 3OUKA 3R28A 4IC7A 3PVBA 5HE0A 4FV6A 2QOKA 4WBOA 3RP9A 3W0OA 1MRUA 1YRPA 5L2SA 5J95A 1BI8A 3IDBA 3AG9A 2W9FB 2WZJA 3VW6A 2ZJWA 4FT7A 4E93A 3MI9A 2JIIA 4J71A 3VS6A 4EYJA 5BYZA 2ZFYA 4XLVA 3IW7A 2VWIA 2YJRA 2GMXA 3LJ2A 3I1AA 1H08A 4WG3A 3DBQA 3K54A 3OBJA 4JBVA 4U8ZA 5IQFA 4ENXA 4FICA 3SW4A 1KOBA 5JN2A 4QRCA 5J8IA 3VS7A 2W9ZB 4YJTA 4C4IA 3ACJA 4HGTA 2C5OA 1WCCA 3EQFA 3HLLA 3PTGA 4QYFA 3BWFA 1QCFA 4PMSA 4JLCA 4H1MA 2XNBA 4F70A 5FXRA 3BGQA 4F99A 4JDJA 4KIKB 4MD7E 4NW5A 4O86A 4QP4A 3CKWA 2ZB0A 1OECA 2VNYA 3DTWA 4NFMA 3G51A 2PMLX 3HDMA 3SLSA 1BL7A 3FI3A 4IB5A 4BZDA 3PA4A 2B52A 5I5ZA 4ANLA 3OT3A 3BGZA 4L3LA 5EM8A 3V5JA 3LOKA 2OSCA 3BWJA 5L2QA 4I24A 2PVRA 4FKIA 3SQQA 3VBXA 3V5WA 3I6UA 3VUMA 4NIFA 3ZO3A 3DKOA 4RJ8A 3HAMA 4G5JA 1QPJA 3EQCA 4NT4A 1KE8A 5KBRA 1XR1A 3L8PA 3MB7A 4QMXA 5TOZA 1XBBA 3UDSA 4O6EA 2F57A 4UBAA 3O71A 3QYWA 2UVZA 4GK3A 4EC8A 4M66A 4LL0A 5DNRA 2XAMA 3A61A 4YLJA 1HCKA 3ZO2A 5KNJA 3R04A 3HDNA 2GHGA 3V8SA 3QHWA 3ZEPA 4ZLOA 5AUWA 3EN6A 4XH6A 4U3YA 5HO8A 3QA8A 4YNEA 2WMBA 2OW3A 4GV1A 3BYMA 5F1ZA 1U46A 4AZVA 5IA0A 4CSVA 2G2FA 4M69A 2VGPA 3PE2A 4RLKA 4JRNA 3VAPA 4D2WA 2YM5A 5CF6A 5M51A 4I41A 4NKAA 4B6LA 4YZ9A 3ORTA 3DV3A 3T3UA 4BTJA 3QX4A 4F9BA 3QA0A 1JVPP 4KS8A 4N0SA 2G2HA 3ID6C 5ETIA 3OXTA 3R30A 4E4XA 4OBQA 3TIZA 5C1QB 4RX9A 2BFYA 3BBTB 1NW1A 4DDIA 3TNHA 3D5VA 4OTDA 4K18A 1ZYDA 5LMBA 1WBVA 1WBTA 4N4SA 4O22A 4L9IA 1URCA 3KB7A 4F1MA 3LHJA 3V6RA 3IDCA 4BYIA 1UWJA 3H9FA 3MY5A 4AN2A 1T46A 4R7HA 3BEGA 4U7ZA 1ZOEA 5M55A 5BUEA 3HMMA 3KXZA 3EN5A 1PXLA 2C4GA 2G01A 3CBLA 2IZSA 2YLEA 3Q52A 4QPAA 2VWUA 3FXWA 5CS6A 3R7EA 3LJ1A 3COIA 2RFDA 5LMKC 2OG8A 1CKIA 2CGXA 2R0UA 4FOCA 1BX6A 4ZSEA 4O0VA 2O64A 4C33A 3WBLA 2R7IA 3ZBFA 3TKUA 5IQDA 2QHNA 4NEUA 4X3FB 4YHTA 1KV2A 3POOA 4IVBA 1SNUA 4MF1A 4YO6A 2RFSA 3BLQA 3PP0A 4RA5A 4JVGA 3P1AA 4K11A 4BIDA 3QD4A 4UV0A 3NNVA 4YJRA 1FVTA 3VO3A 5DI1A 3SAYA 4DEBA 2VN9A 2WQBA 3L1SA 4FG8A 3E7OA 4Y72A 5IMEA 5AM7A 5EW9A 3SOCA 2VTPA 3HAVA 4H05A 2UUEA 4P5QA 5DBXA 4PRJA 2VTAA 2VX3A 1AD5A 2XVDA 4JBQA 3NUYA 4GJ2A 3BZ3A 1PXPA 3KN6A 2VWWA 3HV7A 3KU2A 5D7VA 3CQEA 1W2FA 4HCVA 1UV5A 2UW6A 4AAAA 1B39A 2C1AA 2NPQA 3NYXA 1KWPA 5E8UA 1GJOA 3QGWA 3ODYX 2B53A 3VW8A 2E9NA 3PUPA 3RAWA 2YDIA 4CKRA 1K3AA 5L3AA 4FE2A 1YDRE 5JGBA 4PNKA 4O7VA 4FTJA 5CT0A 4DYMA 2X8DA 2J0JA 2UZDA 4FSWA 4LUEA 4RSSA 1ZZLA 2WMAA 3VJNA 4F9AA 4GG7A 4KBCA 5HTIA 4IAYA 4XRJA 5M4UA 4GL9A 4MF0A 1WBWA 3H0ZA 4AW5A 5IPJA 2C0TA 3FAAA 4FK3A 3A60A 3MBLA 4DTKA 3KIOC 3KREA 3NW6A 5B2LA 1LUFA 4IWPA 1YOMA 4O7RA 1MQ4A 1PXOA 3EFJA 3O23A 4MCVA 5A4TA 4YJSA 3IDPA 4G6LA 4ZS4A 3LQ3A 3RM6A 4XJ0A 4XBRA 4LFIA 2VGOA 4FGBA 3NYNA 4KBKA 5AAFA 3SC1A 4A4OA 2OI4X 4ID7A 4UXLA 4W4XA 2YACA 2GCDA 4QQ5A 5FDXA 4HW7A 4I5PA 1ZYJA 4Y5QA 3LXKA 2WIHA 5A3XA 1I09A 3JVRA 5AR7A 3W2PA 4ZTNA 1SYKA 3RPSA 3QFVA 3FMNA 2ZVAA 4ANSA 3IECA 1UU7A 3T9IA 2BILB 3LFQA 4NH1A 3Q60A 4RFMA 1ZARA 1Q41A 3ZLYA 4ACDA 3G90X 5CQUA 4BDJA 3CLYA 2ITUA 4O1OA 4YNOA 2XKEA 4O4FA 4ZJJA 2ZB1A 1O9UA 4FTLA 4XG9A 3ORKA 2UW8A 3KCFA 3LFEA 2PE2A 4YJVA 4BTFA 2IVTA 5M44A 5CEQA 3CPBA 4LOQA 3VUKA 3QCSA 5AX9A 2EXMA 4AG8A 4IXPA 1Y6AA 2QKWB 4M14A 4RVKA 4CLIA 4IZAA 2O8YA 5IZFA 3EQIA 5FBNC 1Q62A 1YKRA 4FL1A 3GCQA 3TTIA 4U81A 4AW0A 4JBPA 4ORKA 2X7GA 4AE6A 4AUAA 3NYVA 4E3CA 5EH0A 4DFXE 3FL4A 3FL5A 4HPTE 4MNEA 4AWIA 4DGGA 3D15A 3PE1A 2PMNX 3SV0A