3F61A

Crystal structure of m. tuberculosis pknb leu33asp/val222asp double mutant in complex with adp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
290
structure length
271
Chain Sequence
MTTPSHLSDRYELGEILGFGGMSEVHLARDLRDHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIAAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPDSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase pknB
publication title Auto-activation mechanism of the Mycobacterium tuberculosis PknB receptor Ser/Thr kinase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 81
structure length 271
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f61A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f61A01
3UJGA 4RJ3A 3TIZA 2C6DA 3PXQA 2QODA 4IEBA 4AOTA 5DHJA 3ZSIA 1K9AA 3CQEA 3RCJA 1UWJA 1JKSA 2XUUA 3TNQB 4ANMA 1J7LA 2X0GA 2X9EA 3D7ZA 4Y95A 2R3QA 3U55A 2YITA 2R3RA 2WKMA 3Q32A 2FYSA 5D11A 2CPKE 1Q3WA 5CSXA 1CKPA 3C5IA 1YVJA 4GV1A 2BTSA 3FY2A 4GIIA 4UV0A 3TL8A 2PK9A 5ETIA 4XHKB 4KBAA 2BKKA 4FTIA 1AD5A 1YOMA 3ZMMA 3KXNA 5AV4A 1U59A 5DR6A 2GNFA 2IW9A 3NAYA 5I3OA 3CXWA 3FLZA 3FDNA 2YLFA 3Q04A 3BGQA 4GMYA 4FV2A 4FYOA 3R9DA 4EOMA 2GS2A 5CAVA 1JSUA 2HW6A 1KE9A 3IS5A 5HX6A 3P9JA 3DKGA 4N57A 3PLAE 3H30A 1FBNA 2J0KA 4O84A 5LWNA 3LOKA 4D2VA 1VYZA 2EXMA 5IU2A 4G34A 5J8IA 5HU3A 4ZJJA 1J91A 1H1RA 4J52A 2V0DA 3UDBA 3ULZA 4O86A 5G1XA 2Y4IB 3HMOA 5AP2A 4RIWB 5AIRA 1OL7A 1ND4A 1BL6A 1A9UA 1XO2B 2B4SB 3LCSA 3R83A 5JQ8A 3PPZA 4BGQA 4IVBA 5M44A 2WMRA 2R3JA 5DEYA 3CJFA 1WAKA 3QD0A 1R3CA 1DAYA 4U6RA 4MBLA 1LEZA 5FEQA 3EQHA 1HCKA 3I79A 2UW3A 2BCJA 3R2BA 2ZV7A 2QR7A 3Q2JA 3NNWA 3EIDA 2WIPA 3ORMA 4WG5A 3RTPA 4RJ8A 2J6MA 5HZNA 5HO8A 4FV3A 3BU5A 2QD9A 1M17A 2BZIB 2ZV8A 4G3DA 1EH4A 4R8QA 2QVSE 4UB7A 5G6VA 1YOLA 3TACA 5KHWA 5KMJA 4ZTHA 2OJGA 3HKOA 1Y8GA 3NUSA 2GQRA 2XKCA 5TO8A 5K0KA 3DBEA 4FR4A 1PMEA 2YAKA 5CEKA 5JFVA 4ZSAA 5A54A 3FI8A 1P4FA 5BUIA 3E62A 4NM3A 3AMBA 4FL2A 3UO4A 5AUVA 4RIOA 5ANGA 3TTIA 3V6SA 4C59A 4ONAA 3LXLA 4IE9A 3R7VA 3WF6A 3R30A 2J0IA 3K3IA 3S4QA 2YLEA 1IAJA 3OS3A 5L2WA 4TTHB 2XYNA 3A2CA 2OIBA 3AOXA 4IAZA 4I22A 5TKDA 4U41A 4QMQA 2X39A 3HNGA 3MGYA 2C6TA 4FNXA 5JRSA 3GQLA 5TF9A 4DTBA 3QXOA 1OUKA 4MXYA 4NYEA 4NJ3A 4FI1A 3SXSA 5A6OA 4WNMA 5IH6A 5AFVA 1WBOA 2PMNX 3BU3A 3ET7A 5DEWA 3PXKA 3Q53A 2I0VA 5HG8A 4DEHA 3W33A 2ZMCA 5GJFA 5CEOA 5AM6A 3WI6A 5I9VA 2BDFA 4C61A 2PVHA 5IQHA 3QLFA 2V55A 4JQ8A 4FTCA 3F7WA 5IISA 3Q4CA 4X0MA 4FUXA 1DAWA 4ACGA 5BVEA 4ANSA 4O2PA 3V8SA 4NFNA 4U80A 1GZ8A 3RHKA 2WQMA 4AF3A 4BTKA 4FSZA 2F9GA 3BELA 4G3FA 5AP0A 3SW7A 4GYIA 3ZFMA 4U3YA 4JBVA 4BN1A 4CLJA 4FIHA 5KKRC 4R1YA 5HEZA 2VU3A 4AGWA 5IA4A 2WAJA 3AC3A 2G2FA 4X6QC 3VUDA 3R1QA 3LXKA 4YJOA 4GKHA 1OL6A 2BROA 3TUBA 1GIHA 2C3JA 2C6EA 5GNKA 4BDKA 3DLSA 3LMIA 3EHAA 1OPLA 4I94A 3WZUA 4IJPA 4UYNA 5E91A 1YXUA 2JGZA 2ZAZA 3ZSHA 2YM8A 4WT6A 2A2AA 2C30A 5EW3A 2Z8CA 4QMWA 3LFAA 4RVKA 4AQCA 3ORXA 2W5AA 4G3EA 4DA5A 4F64A 1SM2A 3KXMA 3QCYA 5CNNA 3CPBA 4GIHA 3QQKA 4JNWA 1GZKA 2C6KA 2CCIA 4CYJA 4QP7A 5C03A 2R3IA 4ACDA 4CKIA 2E9UA 3KULA 2J4ZA 4ZY4A 4LG4A 4NZWB 5K3YA 4RA5A 3V5QA 4FEXA 5TE0A 4XV9A 5KMIA 5EYCA 2YISA 3LJ2A 4A07A 3GCPA 3IOKA 3OEFX 4UWCA 3RPRA 3SV0A 4O7LA 4YZNA 1MQBA 3PE2A 4D28A 3BGPA 4RVTA 3PA4A 3WIGA 4OTIA 4MD9E 4BVUA 3ZO4A 1UU8A 3MH2A 4CMOA 2OWBA 4I3ZA 1YDRE 2WMWA 2YIQA 3EWHA 4BHZA 2B0QA 3NUPA 2PE2A 3IW7A 5HG9A 4AA4A 2CGUA 1IAHA 2A19B 2XK8A 2VTTA 2XCKA 4NTTA 1OECA 4JRVA 2SRCA 3DT1A 3DFCB 4YLLA 4DHFA 3CPCA 1H1SA 4FNZA 5HIDA 3D5WA 2O2UA 3BQCA 5HBHA 5DT0A 4N0SA 4P5ZA 4M68A 4C4GA 5L6PA 4HPTE 3F2NA 2UW5A 4S2ZA 5IUIA 4AOJA 4DH3A 1NVSA 3DPKA 2KTYA 3A7IA 2BHEA 3NNUA 1SVHA 3FSKA 2Y4PA 3EMGA 3LQ5A 3N51A 1CMKE 2EUFB 4MQ2A 2Q0BA 5FDPA 3NUAA 2A1AB 2IZRA 2WTIA 1PKDA 1PMVA 2B52A 3T9TA 2YM7A 4EZ5A 5C8KA 2ZB0A 4FNWA 1Q4LA 4FSQA 4QMPA 2HAKA 4IBMA 4ITJA 2X2KA 4DC2A 5CASA 1G8AA 1BYGA 3KVXA 4L9IA 1ZZ2A 3TN8A 4FEWA 2F7ZE 2ONLC 2OZAA 4XRLA 3PG3A 3FKNA 2W9FB 3HRFA 5HE3A 3NPCA 5AADA 1PXJA 2ITXA 4BKYA 2PUNA 2QOFA 2V62A 3NUNA 2DUVA 2YWPA 1SNUA 3TM0A 3F2AA 4O0RA 3KKVA 4BCQA 4ORKA 3RZFA 4QP3A 4DFUA 5DR9A 2WIHA 4J8MA 1JBPE 3EQRA 3GU6A 5CSHA 5M08A 3FHRA 3FL4A 3SVVA 5A3XA 3UQGA 4FEVA 2YDIA 4PNKA 1H0WA 3EN9A 2I7QA 1H28A 2QR8A 4M67A 4F0IA 2PE1A 4YTIA 2XNOA 4FKGA 3MPAA 4GK3A 3MVLA 2PVLA 5ACBC 4ZMEA 2BZKB 2VTOA 1FQ1B 3UZRA 1YOJA 4WNPA 4BF2A 3U4UA 4AN9A 4DCAA 1OKWA 1WBWA 5IA1A 5LMBA 4OBQA 3W55A 3UZPA 4R78A 2UVYA 3KXZA 3ZFXA 4Y8DA 2ESMA 2WO6A 2OI4X 1M2QA 3F3TA 5CQWA 5J95A 3ZLSA 1OIUA 2HENA 2PVKA 3GBZA 3QZFA 4C34A 4HVGA 3E8NA 4KD1A 4RVMA 2PE0A 2W4JA 3T9IA 3VC4A 1OKZA 2JFMA 3FV8A 5HGIA 4TYHA 3RPVA 3VO3A 4O83A 3PJ8A 4II5A 2O64A 4X3FB 2UZTA 3PVUA 5ANJA 3HAVA 3U8WA 3MH1A 3F82A 3OMVA 2OBJA 4WNKA 1PW2A 1GIJA 4EHZA 4GK2A 4AZSA 5KBQA 3G51A 3FI3A 4X7QA 2BHHA 1U5RA 2W1EA 5HQ0A 4XG9A 2W05A 3JVRA 2PVJA 3Q3BA 3UOKA 1Q41A 4DGGA 3PJCA 2HW7A 2YWVA 5H8GA 5H8BA 5J79A 1W82A 1I09A 3R63A 2XK7A 4ZSJA 4FODA 5GJDA 4Z7GA 4CFVA 4NIFB 2E2BA 4BDAA 2UZUE 3PSDA 3NYXA 4D1XA 3CD8A 4BZDA 3QD4A 4ZLYA 2X6EA 4IDTA 3A7GA 3Q9YA 4CCBA 4ZZNA 2F4JA 4I4EA 5M4IA 5CU4A 4P90A 5CEQA 3TNWA 4RC2A 2IVVA 2X81A 4X6RA 4LFIA 2FSTX 1NVRA 3D83A 3LCKA 2AYPA 4PY1A 3ZCLA 2X2LA 4EOSA 4F7NA 5CU2A 4ZSEA 4FVPA 4APPA 3D5UA 2NP8A 3TNIA 3VBYA 2C0TA 1PXPA 5AM7A 5DLSA 4GYGA 1GAGA 2GHGA 4PDOA 3SG9A 3MFTA 3LFQA 5FWKK 3QZHA 1VJYA 3IW8A 2CKPA 2YN8A 3GP0A 4CZUA 4F1MA 2C3LA 3UMWA 4DN5A 1ERKA 4K0YA 1W0XC 3Q6UA 4WRGA 4K1BA 5HOAA 1URWA 3FMEA 2HXQA 3QTUA 3I6WA 4YO6A 5K4JA 2RFNA 3NW5A 4FGRA 4XMOA 4O81A 5FDXA 2UZEA 3IPHA 4PDPA 3LJ0A 4U81A 4E6CA 3PLSA 4IB5A 2BZHB 3OT8A 5F4NA 4EOLA 1FVTA 3A8WA 4YZCA 5HE1A 3HMPA 2XIKA 3QAME 3RNIA 3LFSA 5LWMA 4ZZOA 5KBRA 2VGOA 5M4UA 2R3PA 2CNVA 2BTRA 3KL8A 5JRQA 3R02A 4R77A 3FPQA 4AACA 3BYOA 4L3LA 5EW9A 5FTQA 2QQ7A 3EQPA 4WA9A 3V51A 2BR1A 2WTWA 4IWQA 2JAMA 3UODA 2J2IB 3QQGA 4YZBA 3ZO2A 4KIQA 3OY3A 3P08A 5AX9A 2FUMA 3FMHA 1TQPA 4IC8A 5DG5A 3UPXA 4S32A 4J95A 3DKOA 4O96A 4QP6A 2OZOA 3N9XA 2R7BA 2HZNA 2R0UA 3SQQA 3DTCA 3LPBA 4D5HA 4I6QA 4QNAA 3WZEA 5ETFA 2VWVA 2XKEA 4F9AA 2C0IA 4EORA 4NM7A 1LPUA 5AX3A 2CSNA 2GNGA 5KZIA 3UG2A 4ZY5A 2YIWA 4IZYA 2JKQA 3KXHA 3W1FA 3TDVA 4O27B 1U46A 5HE2A 2HZ0A 5T3QA 2C1BA 4D55A 2WTKC 3CSVA 4ZMFA 3DK7A 2JDOA 3AMAA 3ROCA 1XJDA 4U45A 5AP6A 2JFLA 4G3GA 4O0WA 4F9YA 4YR8A 1OB3A 2OLCA 3RAKA 4B99A 4ZJIA 4AW5A 4P2KA 2QI8A 2EXCX 4BCHA 3ORPA 3BBWA 1JWHA 3P23A 1TKIA 3OCBA 3EN4A 2JKKA 5BVDA 2WMAA 2HY81 4TRLA 4D4RA 3R8MA 4FF8A 4C8BA 3K2LA 1AGWA 1YWRA 3KK8A 2H34A 4MCVA 3TNPC 4OTDA 2WMBA 4L8MA 4EQMA 1P5EA 4IZ5A 5CYIA 4KIOA 3U51A 2WU6A 4O1PA 4RQKA 4I20A 3ZSGA 4E26A 5GZ8A 5L6OA 2BPMA 1R1WA 3DJ7A 2J5FA 3NVKI 3QTRA 3VS7A 1FVVA 2XM9A 4QMXA 3U9NA 3AGLA 4CCUA 3TKUA 4WOVA 5EKOA 3D7TB 4EC8A 2GHLA 4CYIA 2CDZA 2QOCA 4U7ZA 5M56A 3TV4A 4B7TA 4EH7A 1LEWA 4FKVA 3L8XA 5HKMA 1WBVA 1YI6A 3ZTXA 5JGBA 4UX9A 4IHPA 3OXTA 5EM7A 4KSPA 5HTIA 4AE6A 3KC3A 3DTWA 1Q8ZA 2JIIA 2OH4A 3UGCA 3DXNA 2XKFA 5LVNA 4CFMA 4TNDA 4W9XA 3O0GA 4QP2A 5L8JA 4MNFA 4WD5A 5IA3A 3D0EA 4MVFA 2PY3A 4FVRA 4MHAA 2O3PA 4DT9A 4OTWA 2P33A 4WUAA 2R3GA 2ZV9A 4L45A 2J0JA 3DU8A 3RWPA 2GSFA 3QUPA 3REPA 3P1AA 4EUUA 3CQWA 2VTJA 3P4KA 4EQUA 4AT5A 3OOGA 4DGOA 3EOCA 5E7RA 5LCKA 4BZNA 3T3VA 5JN2A 5KO1A 5HO6A 2CMWA 5CAUA 5HTCA 4FKRA 3PXZA 2ZDTA 1R0PA 3ANQA 4CZYB 3FQSA 2FSOX 4AN2A 2BMCA 5JZJA 3ZC5A 4F0FA 4RFMA 4TY1A 5JH6A 3UVQA 2W1GA 3CC6A 3MPMA 2IWIA 3DDPA 1BI7A 4XV2A 5DIAA 2X6DA 3SOCA 3VUTA 4EUTA 4IW0A 3C4EA 4NUSA 3VUKA 4NFMA 2W4OA 5AR4A 5M51A 3F5GA 4QQ5A 3PY3A 3BLHA 3FPMA 5C8NA 1YHVA 2XNNA 1IR3A 3C0GA 4LGGA 3C4CA 4FKUA 2PL0A 5ANOA 5AUZA 3H9RA 3VS5A 4D0XA 3KXGA 4KBKA 2NO3A 2WMQA 5AR5A 5J87A 5JFWA 2G2IA 2ACXA 2J0LA 2VNWA 3GGFA 3UC3A 3DKCA 1W98A 2YFXA 4DEAA 4IAKA 4S33A 4DEIA 3DS6A 5EQPA 3KEXA 2UW4A 4BI0A 5A4LA 2PUIA 1KSWA 1H26A 2OJ9A 4BCKA 4A4LA 4MXAA 4D1SA 2WB8A 3PJ2A 3NWWA 1Y57A 2C5NA 1UKIA 4AZWA 3HZTA 2BIYA 4U43A 1JAMA 5CTPA 3TTJA 4NIFA 5CS6A 3NCZA 1GZOA 4XYFA 4DG3E 3CTHA 1WVWA 4FOBA 3QWJA 3VF9A 3ZM9A 4ID7A 3IKAA 3NYNA 1XH9A 3R8UA 3EQFA 2XH5A 4Z9LA 4CLIA 4CFFA 4FV4A 1A06A 3T8OA 3WYYA 4QQTA 2CKEA 4O7SA 5I9ZA 3G2FA 1XH5A 3PP1A 4H3PA 3VBVA 5GIPE 1KOBA 1YW2A 2XJ2A 1STCE 1IG1A 3CR0A 3OCGA 4FT9A 3F3WA 4R3CA 4FMQA 1KUTA 4TYEA 3LM0A 2AC3A 4NL0A 5IQEA 3HGKA 4BDDA 1CSNA 3DCVA 3DNEA 4JJRA 2UW8A 4KIPA 5AR8A 2WTCA 4FKWA 2VTMA 2CCHA 1WCCA 1F0QA 2ZM1A 3DY7A 5FTGA 2GPHA 1IASA 4RFZA 3R28A 3KMWA 3OWKA 3PXRA 3S00A 1Y8YA 2XZSA 3PVGA 4CZTA 3I4BA 3QZIA 4FX3A 2I0HA 4ACMA 4Z55A 4Y83A 4AWIA 4Q2AA 5FXSA 1PHKA 3RK5A 4XLVA 2UZDA 5HICA 2VO7A 1WFCA 2IVSA 2YCFA 3KRWA 4X2FA 4EH4A 5LVLA 4WUNA 2CLXA 5B0XA 4RIYB 5ICPA 2ITYA 5AV3A 4FTRA 3LLTA 4FYNA 5IQDA 3OZ6A 2ERZE 4MBIA 3TZ9A 5TOZA 4ZS4A 2R0IA 4FTQA 1OBDA 5H3QA 3AQVA 4MXZA 5KMOA 1UVRA 5C26A 5M07A 2P55A 4CKJA 1OM1A 1I44A 1ZLTA 3BI6A 2QOLA 3DLZA 3PRFA 4LL0A 2OK1A 4BYJA 5HIBA 3G0FA 3R1YA 5DGZA 3DJ6A 3O7LB 4KS8A 5H9BA 5A14A 3E8EA 5E8YA 5HHWA 2Y6OA 2QO2A 2YIXA 3F3ZA 4ASXA 2GMXA 4GCJA 3UO6A 4XUFA 1IEPA 4LUDA 3E8CA 4J97A 1NW1A 3SW4A 4V04A 2VWZA 2RF9A 2VO3A 2J0MB 3KQ7A 3ZZEA 3LFEA 4MNEB 2UZOA 4A9RA 3BWFA 5DN3A 4RX5A 5KMLA 4L44A 4TPTA 4JL9A 3ZBXA 4QTEA 2UZLA 3KCFA 4FG7A 5D10A 4CTBA 1DS5A 4EH5A 4UN0C 5AP5A 3FLYA 4RX9A 5J1VA 4JI9A 4H39A 4BDCA 5DBXA 1OL2A 4MXCA 4Y5HA 2VTPA 5FTOA 2QOKA 3DNDA 2VTNA 3HLLA 3TI1A 2G1TA 3DGKA 5M06A 2YCRA 4PMTA 4OR5A 3QLGA 3SLSA 2REIA 3LXNA 4AT3A 5F9EA 5H8EA 2CLQA 5M57A 3SD0A 3ZDIA 2B7AA 3QGYA 4FIIA 4NJDA 1GNGA 2I6LA 3RMFA 3FKOA 4FIFA 4FIJA 2YERA 4GK4A 1UA2A 3EQBA 5KCVA 4G2FA 4KKEA 4L42A 4GH2A 3DQWA 4MX9A 3GUBA 4HNIA 5AP7A 3JPVA 4QMNA 4O7RA 5EM8A 4UXLA 3ELJA 2B1PA 2CN8A 4TWCA 2BRMA 2E9OA 2ZM4A 2W96B 2Y8OA 3MJ1A 2H9VA 3BHYA 5AUXA 1YKRA 1BUHA 3UC4A 2GQSA 5FRIA 2HK5A 4IXPA 3UIMA 3AC4A 4HYHA 3DBDA 1XBAA 4YHJA 3VW8A 4BDFA 4C2VA 4M15A 1K3AA 3D7TA 2ZB1A 4PMMA 2J7TA 4YTCA 5E8WA 4G5JA 2A27A 3ATSA 2VTRA 1JPAA 4RX7A 2XRUA 3QZGA 4PPCA 2JEDA 4BCFA 1JSVA 2CNQA 4USEA 3IECA 2VO6A 5J9ZA 1FGKA 4JG7A 4KBCA 3HRCA 2PVNA 2H96A 1FOTA 2JKMA 4O7YA 2PSQA 5FG8A 3O71A 2W1DA 4BKZA 5E8SA 4HW7A 1Q97A 3R7UA 3S2PA 5J1WA 3SXFA 1M52A 2G2HA 2WELA 4QYFA 3SG8A 3F5UA 2A4LA 3QHWA 1UU3A 1V0PA 2Q0NA 4ALWA 5AAEA 4XOYA 1M14A 3OVVA 4KIKB 4YJVA 3W18A 3MIAA 4BZOA 1KOAA 2XP2A 1BI8A 3QUEA 3V01A 3C5UA 4FEQA 3ID6C 4PL3A 4YBJA 4ACHA 2UZWE 5D12A 4L46A 2I1MA 1PY5A 3ZEWA 3VS0A 2W1CA 2ITNA 4ZTRA 3C50A 4L68A 5A46A 4GJ3A 3TZ7A 4BTMA 3FXXA 3QCXA 1DM2A 3D94A 5E1EA 5HVKA 5LOHA 4FSRA 2GFCA 4FZFB 4W4XA 1PYXA 4D9TA 5L2SA 4AA5A 2R3LA 4D2SA 3HMIA 5CXZA 4UYAA 4DFLA 3UG1A 5GIOE 1Q3DA 3KB7A 3QTQA 4K9YA 4G6LA 1Q8UA 3BYSA 4ZXTA 3EL7A 3TKHA 5LVOA 1QPCA 3KCKA 3F7ZA 3NRMA 3LFFA 4JOAA 2YEXA 5D9HA 3TV7A 3ZUTA 4YU2A 3OOMA 4IB0A 3KRLA 3S1HA 5HBEA 3F69A 4IIRA 3QU0A 2J50A 3E3PA 1GOLA 1YWVA 2XK9A 2XNEA 1WVXA 4K77A 3MVHA 5L2QA 4U97A 1ZMWA 3WARA 5GINE 4R3RA 2IZSA 4ZJVA 3R8VA 4KAOA 4OTGA 2BDWA 2HYYA 4PPAA 2PZ5A 5B2KA 4H05A 2J5EA 4BDEA 4FG8A 2Y4IC 4DTKA 5F95A 3LQ3A 3EH9A 5CAOA 4HYSA 3UNJA 2OGVA 5IH4A 2ZV2A 2OICA 5EHLA 5EYMA 4BCJA 1ZY4A 5IA5A 4PPBA 4R7BA 2JBPA 4GRBA 4RPVA 5LVPA 1H01A 3R00A 2WMTA 3FHIA 5AP1A 4YZMA 3AD6A 2EVAA 5EOBA 3RHXA 4YURA 2VWBA 4F63A 1RDQE 2X8DA 2O0UA 1GY3A 2JITA 2LGCA 2WMUA 4JT3A 3OUNB 1ATPE 2JDSA 4FIGA 4FTMA 3DFAA 3P86A 5DE2A 1KV2A 3JY9A 3R1NA 3FQHA 4QPSA 2RFSA 3CS9A 4R1VA 3UVPA 4XG8A 2QCSA 4ZSLA 2PVRA 4F70A 1WBSA 4W8DA 5BYYA 4IX6A 2IN6A 2XRWA 4C3FA 4C36A 2F49A 3SX9A 4OBOA 5FXRA 5J7BA 4EYMA 1UKHA 4AFEA 4YC6A 2F2UA 3CJGA 3SHEA 4D4VA 1APME 3R9HA 2J90A 3E64A 3C4ZA 4UMUA 3CLYA 4YJUA 1PYEA 3F5XA 1TQIA 3U6JA 3R8ZA 2JDRA 2QOQA 3V3VA 3W32A 3H3CA 4HGTA 3TXOA 3E93A 4BCPA 3E5AA 4FUYA 2HCKA 1XHAA 4FKQA 3DK6A 2IW6A 3FKLA 4H3BA 3A7JA 4QTBA 4M69B 4EQCA 3PY1A 4DFXE 5C4LA 4J7BA 4O0TA 3MB6A 4U0IA 2V7AA 4W4VA 4ZEGA 2BIKB 4PRJA 4E5AX 3GCSA 4DGLC 3D15A 4B4LA 1BKXA 4C7TA 1V1KA 3MFSA 2PVMA 3R01A 3IW6A 1R0EA 4I1ZA 3BU6A 5CI6A 5IKWA 2VV9A 4FEUA 4JAJA 4JDIA 2FGIA 5BVFA 2GNJA 5HD4A 3RINA 5AAGA 4JX3A 5AR3A 5HI2A 3PIXA 3QQHA 2RG5A 3QRIA 3R8PA 3ZM4A 5B2MA 1R78A 5DI1A 5E8VA 2R3MA 4FE2A 4ERWA 3RPOA 3E3BX 4C4JA 4ZOGA 4E6AA 3ITZA 4XBRA 4ANNA 3B2TA 5LVMA 2ZYBA 3EZRA 1MP8A 3Q9XA 5AV1A 3TZ8A 1UNHA 2PZYA 2X9FA 4OUCA 5GJGA 4F99A 5AV2A 2PZPA 4XG2A 4YC8A 4M13A 1KV1A 4BTFA 1YHWA 1KWPA 2WQBA 3KFAA 5JZNA 5HIEA 1OIQA 4GT3A 4C3RA 5CF8A 3BGZA 3LXPA 3BYMA 3PRIA 3RP9A 3ENHA 2OFVA 4IX5A 5DT3A 3P7BA 4GS6A 4I6FA 3EN5A 5CWZA 1OPJA 1H1PA 3HV6A 4UMQA 4A06A 4EK5A 4QMZA 4YZDA 5L8LA 4JBQA 3FMMA 3LMHA 1QPDA 3QALE 3FJQE 2B55A 4BYIA 3VBWA 3PJ1A 5FLFA 4DH5A 4ASDA 3O96A 3KGAA 5CT7A 5AR2A 2WMSA 3C9WA 3UYTA 3FMDA 3PP0A 5FP6A 1H24A 3R9NA 4DLJA 5IMEA 5FUTA 2NNWB 3LJ1A 5HCZA 2QHMA 4OAUC 5HLPA 4EI4A 1OUYA 1UV5A 3C7QA 3MPTA 2UZBA 3RZBA 3KF4A 4GFMA 4JX7A 4YJRA 2YCQA 3P7AA 3VRZA 4BIDA 2F7EE 3SXRA 3KY2A 5BYLA 2C3IB 3ZLXA 3KK9A 4AP7A 2DWBA 1JKLA 3NNVA 1ZARA 3IK3A 4TKSA 3QRKA 5EH0A 4M12A 5E8UA 2E9PA 1XQZA 4YPDA 3UVRA 4HVHA 2JKOA 4LI5A 3SC1A 3MJ2A 3OWLA 5DH3A 4C58A 2EWAA 4F9CA 4BCNA 2JIVA 4C4EA 4ENXA 3UNKA 4WIHA 2VWYA 4UEUA 3PG1A 3VW6A 4AW0A 3C13A 5ETCA 4WBOA 4UY9A 3BKBA 5J9LA 4F0GA 2WTDA 4GUEA 4EZ7A 2XCHA 3FQEA 4F7SA 3R2YA 4FV9A 3AC5A 4O0UA 3W2RA 1GZNA 1YXTA 3DZOA 3GXLA 2GS6A 2WQNA 3MB7A 4RIWA 5D1JA 5GZ9A 4I0SA 4WBBB 2VTLA 3NNXA 4Y5QA 5TR6A 5EM5A 4S34A 3R9RA 2IZTA 3R21A 1REKA 2OU7A 1ZYSA 2QU6A 3BZ3A 4C57A 2FSLX 5IQGA 3CP9A 5DVRA 2X7OA 4EHVA 3Q4ZA 5LCJA 3CY2A 4D2WA 4BHNA 4Q9SA 3Q5ZA 2WQEA 3FI2A 4QPAA 4ZTSA 3I0OA 5M53A 3TDWA 1BL7A 4O6LA 5DWRA 3I7BA 5M55A 4AXAA 2NRUA 3MIYA 3R7YA 3EQDA 5JGAA 4FTUA 4Y72A 4DBXA 5D7VA 2Z2WA 1IA9A 1E9HA 3RGFA 3PIYA 5C27A 4C37A 3P5KA 4H58A 4G6OA 4IB3A 3TG1A 3NMUF 5IZFA 2E9VA 3PVWA 3NAXA 4RZWA 3DBFA 3DXPA 3QQLA 3DAEA 2R3HA 3JVSA 5IMXA 2BRNA 1ZOEA 1OVEA 3KMMA 4P5QA 3HX4A 4R3PA 5I4NA 2CKOA 4FKPA 2XNBA 4QT1A 4YHFA 5JQ5A 1KE6A 4IVAA 4YJNA 4BIEA 2UW0A 4CG9A 4FTAA 4F6UA 4XOZA 4YJTA 4R5SA 4FT3A 3F2RA 3FY0A 3C4WA 2YABA 3A60A 4XP3A 1LP4A 4S30A 1NY3A 4DEEA 1MRUA 2EB3A 3QYZA 3NYVA 1OZ1A 3BYVA 2BVAA 1Q8YA 1RJBA 1ZAOA 4BWKA 5HLNA 4BWPA 4X3FC 5EQYA 1YXVA 2BAJA 2Z60A 4BKJA 3BE9A 5EDRA 3UQCA 4F6SA 2PTKA 2W0JA 2VTSA 3TEIA 3FZRA 4D0WA 5D7AA 3LCDA 3P78A 3W16A 3UTOA 5IDNA 1JKTA 2PMOX 1IRKA 1F3MC 2OO8X 3BCEA 4KSQA 3VF8A 2PYWA 3F6XA 2B53A 1H1WA 2C0OA 4FT7A 3L8PA 2C4GA 4UWYA 4DINA 3U6IA 4I24A 1B6CB 4JRNA 2G9XA 4BDHA 1OKYA 2VWUA 3AT4A 3QA8A 4APCA 4LV5A 4O7VA 5JMSA 3GCQA 5CEMA 4AN3A 3G15A 1OMWA 2VWIA 5E8XA 5KUPA 3QTSA 2XEZA 4GG5A 5BUJA 3I0QA 4C3PA 4FTJA 3QXPA 4BDGA 3PE1A 1ZOHA 5DNRA 5LARA 2LAVA 4CVAA 2G15A 4QMOA 1MRVA 3NDMA 1Y6BA 1ZOGA 3DZQA 1O6KA 3LFDA 3FLNC 5DPVA 3BLRA 4QTCA 5CF5A 3QCSA 3O8PA 5IUGA 3KA0A 2QOHA 4IM3A 4RRVA 4HVSA 2PULA 2XM8A 1SMHA 2GDOA 3KXXA 3TZMA 3ORNA 3GENA 4QP8A 3QRUA 4I92A 4QNYA 4RC4A 1UU9A 5HVYA 4EONA 3IONA 3CE3A 3QBNA 4DGMA 3MS9A 2ETMA 1REJA 4DEBA 5LQFA 3QUDA 4CFXA 4JS8A 3A7FA 1BLXA 2VGPA 3A61A 5EI2A 2QKRA 1Q8TA 1ZMVA 4HVDA 3HRBA 2HWPA 3MFRA 2CGVA 2Y0AA 4FK3A 3QHRA 3PA5A 4O0VA 4CGAA 1CKIA 2PUUA 4IMYA 1VR2A 4QRCA 1Z57A 2XBAA 3VUGA 3KN5A 4GUBA 5AR7A 5HCYA 3I5ZA 4M69A 4TYGA 3FLSA 4C2WA 3OY1A 4R6VA 4PMPA 5KMNA 4JG6A 1YDTE 3RALA 3RPYA 4E5BA 4LRJA 2UW7A 2GHMA 1URCA 1E1XA 5JT2A 5L2IA 2QLQA 2XK6A 5C01A 3A62A 4HGSA 4MXXA 3F3UA 3BHTA 2W5HA 3G0EA 3PSBA 4BFMA 4O38A 5IQCA 4IAYA 1PXNA 4WHZA 3GFEA 1XBCA 3O23A 3DK3A 1Y91A 4AU8A 3TIYA 2ERKA 4DGNA 2WD1A 3HL7A 2JIUA 3ZRKA 4BDBA 3NS9A 5I9UA 3AC2A 2BKZA 5IQIA 1FGIA 3GC7A 1H27A 3VJOA 1AQ1A 5CVFA 4D9UA 2C5YA 3CY3A 4MQ1A 3PFQA 2QLUA 3BRBA 3RJCA 3OD6X 3H9FA 4F1OA 3DA6A 3GC8A 4FZ7A 3HV5A 5BUEA 3CGOA 2XIYA 4FV8A 4BGGA 1VEBA 3IG7A 4AGUA 4TWNA 4LGDA 4IVDA 4AW1A 4EWQA 5I9XA 3GU5A 3UPZA 4E4MA 3R8LA 1JVPP 4ZS0A 1F5QA 4A9UA 4AFJA 3FSFA 4BCMA 2OJJA 1Y6AA 4CG8A 2PMLX 4QYEA 3ZXTA 4PV0A 1YWNA 2Z7SA 4C38A 4C4IA 4V05A 1H00A 4ANBA 4XJ0A 2BFYA 4D2TA 4K11A 3BEAA 4O22A 5L3AA 5ANDA 3ZLWA 2GU8A 4HCUA 1NA7A 1GJOA 1OKVA 3KRRA 4HYIA 5CALA 5M4FA 3GB2A 5HD7A 1M7NA 4CMTA 5L8KA 4XLIA 3TV6A 5A4EA 5F1ZA 4XCUA 1MUOA 2VRXA 1J1BA 4FZDB 5KMMA 4X2JA 5DT4A 2W9ZB 4GW8A 3B8RA 3LIJA 1V0BA 5DR2A 2IVUA 3PJ3A 5FEEA 4CXAA 4EBVA 5J5TA 4Z3VA 3EYHA 4U42A 5AJQA 2WMVA 3TKIA 2ITTA 4BI1A 2C5OA 4E4NA 4X2KA 2BRGA 3HDMA 4O7NA 2OH0E 1PMNA 1PMUA 3IQ7A 4UWBA 2HOGA 3N4TA 2PMIA 3EZVA 3H4JA 5AIKA 2FA2A 2OIDA 2Y9QA 5ANIA 5E9EA 3BLQA 2IVTA 4CRLA 4ZY6A 1VZOA 3TUCA 3ZO1A 4JIKA 3LFNA 3TCPA 3GVUA 4QMYA 5IPJA 4OT5A 4F65A 3FE3A 2W7XA 2Z7RA 4AOIA 1FMOE 2R3KA 3QTZA 2YM5A 3MYGA 4X3FA 2J9MA 3ZS5A 4WSYA 4GJ2A 3LLAA 3H0ZA 5FM2A 4E6QA 3UOLA 5L2TA 4J98A 4I0TA 3MV5A 4JQ7A 1GIIA 4QP1A 4MTAA 4QYHA 5CU3A 3C4XA 2RGPA 2QU5A 3EQGA 4ANQA 3AD4A 3PZEA 5AMNA 2ITVA 3OTUA 5BVOA 4FA2A 3NX8A 5LJJA 4RWKA 2QHNA 3FUPA 4PTCA 4DT8A 2PZRA 2GQGA 4MKCA 4JBOA 3NUUA 4GVAA 1ZYJA 3UMXA 4E4LA 3BE2A 3TNHA 4RIXB 4EK4A 3DBCA 5IEYA 3OP5A 3Q2MA 3C4FA 3GC9A 4I93A 2BALA 3L1SA 3OG7A 4YSJA 4GVJA 3COKA 2RKUA 2UW6A 5GHVA 2VZ6A 5CVHA 4CTCA 2RFDA 1H4LA 2OW3A 3KREA 3SGCA 5HLWA 2JDVA 3VS1A 3FWQA 4MEDA 2BFXA 3T3UA 4EEVA 3O50A 3QTWA 2HZ4A 4BL1A 2OXXA 4AGDA 4FBXA 2R3OA 2P2IA 1ZXEA 4LOPA 3KN6A 1OIRA 4FKTA 4PF4A 4GT4A 3JXWA 4E93A 4LQMA 2UZVA 1Q62A 3C0HA 3UOJA 1XH6A 4TWPA 4BI2A 1IA8A 4EBWA 4F4PA 3G9NA 3QRJA 4F7LA 3MY5A 1Q61A 3DV3A 4PNIA 5LXMA 2YA9A 1OI9A 2PVFA 4IFGA 4PTEA 2XIZA 5JFSA 4XNEA 4BRXA 4BBMA 4KRCA 2FO0A 3WBLA 2PU8A 2GTMA 1J7UA 1U5QA 3MW1A 4E8AA 4YNEA 4KUJA 4RWJA 3ZU7A 5CVGA 3D5XA 5CANA 4JAIA 3R6XA 4WG4A 4FGBA 3VS6A 3HMNA 4Y85A 5FBNC 3BHUA 2IG7A 4NK9A 4CKRA 2R64A 3OUKA 3PA3A 2UZNA 4FV0A 4DG0E 4IM0A 5AV0A 4M8TA 3UIBA 5AP3A 5JKGA 2GS7A 3ALOA 2OFUA 3FZ1A 3QF9A 5C1QB 2C6OA 1XH7A 3HA8A 3FYKX 2CHLA 3I7CA 4FSYA 1X8BA 4LOOA 4NW5A 3GFWA 1ZYLA 3AC1A 2VTAA 2PHKA 4AZVA 2BILB 3L9LA 5CLPA 2C5VA 2CNUA 1BMKA 3L9PA 4XP0A 2OG8A 5CQUA 2QC6A 5I5ZA 2ETKA 3ACKA 4ZP5A 4BDIA 3WF8A 4O0YA 3DAJA 2ZDUA 4PL5A 3V5JA 1RW8A 2X1NA 3B2WA 3R7OA 3HEGA 4QPMA 4JG8A 2BZJA 4QOXA 4XEYA 2O8YA 2CKQA 2UV2A 3COMA 1WBNA 1Q8WA 4QP9A 4LRKA 4QP4A 4D4YA 2GTNA 3E88A 3FBVA 3FLQA 3FMKA 3QGWA 3BV3A 4FOCA 4AZFA 5KMKA 5CU6A 2XNPA 3S0OA 3JY0A 2FH9A 4WSQA 2I0EA 2YJSA 4XBUA 3BX5A 4LM5A 4RJ7A 3WYXA 3FAAA 3RAWA 3VVHA 2FB8A 4G6NA 4LMUA 4C4FA 3PPJA 3FZTA 4V0GB 1B38A 3QQUA 3Q9WA 1SYKA 3UOHA 4ZK5A 4EH9A 4HPUE 4LMNA 5CT0A 2VTIA 3EB0A 3G6HA 2I40A 1JOWB 4YJSA 4B9DA 4KWPA 5CF6A 2V7OA 3C51A 3ZH8A 5IEXA 5EYDA 1UU7A 1HOWA 3M42A 1Z5MA 3VJNA 4QYGA 2DYLA 3ZBFA 4JDJA 5D41A 2HIWA 3H9OA 5DRBA 3KVWA 2YJRA 2KULA 2OSCA 4N70A 3RNYA 3ZRMA 4ANLA 3KF7A 2OKRA 4YHTA 5IA0A 3K5UA 5C8MA 3F5PA 3DB8A 4JLCA 5DFPA 5I0BA 4DBNA 3D14A 3S95A 3NIEA 4JDKA 4EOPA 3WE4A 3Q60A 1J7IA 3LVPA 3MH3A 4OTQA 1OIYA 3LAUA 3PXYA 1W83A 4L43A 2CGXA 3GQIA 3W2QA 1PXIA 5HG5A 4M66A 1CM8A 4IFCA 5FXQA 3R7EA 1FPUA 3OC1A 5C4KA 2RG6A 3DQXA 2ITZA 2VUWA 3F66A 4PQNA 4PWNA 4TW9A 4E5WA 3P0MA 3AMYA 5E90A 4UZHA 4N6ZA 4WG3A 4RQVA 3VIDA 3BEGA 4B8LA 1T46A 4NTSA 5EG3A 4Z16A 1YXXA 3NUXA 2GNIA 4L3JA 3HMMA 4OGRA 4F9BA 4X2NA 4A9YA 2YDKA 3EFLA 4YPSA 4PDYA 1MQ4A 3HV7A 4TYHB 4O21A 5IG1A 1YXSA 5ANKA 3RVGA 3LCTA 3VHEA 1UWHA 3QTXA 4D2RA 5BVNA 3NVMB 2QOBA 5AAFA 4LYNA 3LQ8A 2P2HA 1RQQA 3NIZA 4GSBA 1FVRA 1XBBA 2ITPA 2HXLA 3QQJA 3ZZWA 2WTVA 2XJ1A 2VX3A 3QRTA 4KA3A 5KHXA 1H25A 2WPAA 4FSTA 4IQ6A 2J51A 4G9CA 4PDSA 4CNHA 5J7HA 3IDBA 4Q5HA 2YZAA 4IAAA 4UMTA 4JBPA 1H0VA 3FMJA 4Q9ZA 5KKRB 4PTGA 4O7TA 2X8IA 2EB2A 5E1SA 4NCTC 4ANOA 4F09A 5JGDA 2GFSA 3EJ1A 3MESA 3NLBA 3QC4A 4I5CA 5AA8A 4L7FA 3EN6A 3O8UA 4L67A 4ZAUA 1OBGA 1L3RE 4QMUA 2Z7QA 3NYOA 4ALVA 3NEWA 4GL9A 2EU9A 5JSMA 2ITQA 2ITWA 3I60A 3ZOSA 4AX8A 3FYJX 4AS0A 1WBPA 3UE4A 3MWUA 2QG5A 2W1FA 4NKSA 5CENA 3V5PA 3NSZA 2V5QA 4HNFA 4KKGA 4LV8A 5KE0A 3VWAA 3LFBA 2YIRA 4TZRA 1QCFA 1XH4A 1P2AA 3ZO3A 4OW8A 2BDJA 3LW0A 3RM7A 4B8MA 1PXKA 3FC2A 2GNLA 3OROA 4FV1A 5CNOA 4BCOA 1A48A 4LOQA 2A0CX 3FZSA 5EOLA 3ZRLA 3AG9A 5EFQA 5JEBA 3KRJA 4M3QA 4D1ZA 5BNJA 4C62A 2JAVA 4YTFA 4QTDA 5DA3A 5FQDC 3PYYA 4OTPA 4FSWA 4I6BA 4C02A 2X4ZA 4GU6A 4J1RA 3CKWA 4M0YA 1OGUA 2Q83A 2OF4A 3VULA 2WTJA 3G90X 3U54A 4N6YA 2F7XE 4RIXA 4EH8A 4I0RA 3WF9A 5HU9A 4NEUA 4DG2E 1XH8A 4RVLA 4OBPA 4EYJA 4I5MA 2DS1A 4OTRA 3HUBA 3D2IA 4U79A 3GEQA 2XKDA 1L8TA 4G5PA 2YAAA 5HNGA 4UMRA 1G5SA 2OXDA 3NGAA 3QKLA 3FMLA 4JDHA 4FKLA 4QMTA 4FVQA 1CDKA 1QPJA 2WEIA 4IANA 3A7HA 4ITHA 4DH8A 4G31A 5CF4A 4GKIA 5E4HA 4JVGA 5HG7A 3DDQA 3EKKA 1PF8A 3WF5A 1LR4A 2YM4A 3FLWA 4XG7A 2DQ7X 4EK3A 4HCVA 3E63A 2GNHA 1WMKA 3MVMA 3A8XA 3ZFYA 3DJ5A 4CFNA 2B9FA 3QYWA 1UNLA 1H1QA 2C3KA 2XVDA 3IO7A 3W8QA 3AXWA 3LKMA 1OL5A 5FBOA 2C1AA 4FG9A 5HO7A 4V01A 4QMSA 4RIYA 3MA6A 4CRSA 5HX8A 5HCXA 4D5KA 3K54A 1PXMA 2V22A 4AZEA 1LUFA 2VTHA 1DI9A 3IGOA 2IO6A 3ZDUA 3UQFA 4UMPA 4KKHA 1KE5A 4MBJA 3BIZA 3WF7A 3P79A 4ZIMA 4AUAA 1W8CA 4H3QA 5T6KA 3RKBA 3IGGA 3QL8A 4BICA 3POOA 4I41A 4EH3A 2IPXA 2XNMA 4IADA 2C6IA 4RJ5A 1NXKA 3FL5A 2YCSA 3H10A 3VN9A 4R7IA 4D2PA 1CTPE 3OTVA 3ORTA 3D2KA 3QD2B 3VS2A 1OL1A 3RK7A 4DFZE 5EKNA 3ACJA 3DB6A 3VBTA 2WXVA 2XYUA 4PUZA 2O63A 2QO9A 4M97A 5IUHA 3VNTA 4EOKA 4AT4A 4G16A 3V5TA 4MNEA 2VWWA 3THBA 3HECA 1B39A 4R5YA 3RPSA 4I5HA 3NW6A 3RCDA 4CSVA 3QC9A 4YSMA 4L3PA 4QMVA 4IJ9A 4NU1A 5IEVA 3MTLA 3KRXA 4FC0A 4AGCA 4CQEA 4K18A 4MXOA 3ULIA 4DFYA 1H07A 2RFEA 3GU4A 3HP2A 3OT3A 3UO5A 2OJFE 3V5WA 1QL6A 1W84A 4QO9A 5CY3A 3ZXZA 3AD5A 4E7WA 4FKSA 4O6EA 1ZYCA 5IDPA 4YBKA 3PY0A 4C33A 5EM6A 1T45A 4U40A 3QA0A 4E20A 4V0GA 3CD3A 3G9LX 5IQAA 4BDJA 2AUHA 3ODYX 2PWLA 5CEPA 3N4UA 3A99A 4NCTA 1FMKA 2YDJA 3OBGA 5DOSA 2C6MA 1R39A 3W2OA 4FT0A 3FXZA 3Q9ZA 3ORIA 4IWPA 3IW4A 1PKGA 3ENMA 4HGLA 4M7IA 3FEGA 2Y7JA 3HYHA 3MFUA 3KMUA 3SKCA 2Z02A 4EOJA 2YZLA 3RBWA 5IA2A 3FZOA 1SNXA 4TNBA 5BQ0A 3OWPA 1NVQA 4A7CA 4O82A 4MWHA 4ZTQA 1O6YA 3HAMA 3PWDA 4CT1A 3AT2A 4DAWA 2XJ0A 4L00A 3GC0A 4JR7A 4LUEA 2Y6MA 4EK8A 4HYUA 4F1TA 3R7IA 4YO4A 2ZM3A 1QPEA 3PTGA 3CEKA 4EH2A 1FINA 2HY0A 3D5VA 3MY0A 5AUTA 2XA4A 2G01A 4IX4A 3QFVA 4EH6A 5FM3A 4XH6A 1PXLA 4O0XA 3OW3A 2I0YA 5AUUA 4JIAA 4EOIA 1NT2A 2JC6A 3ALNA 4O1OA 4ZTNA 4YJPA 2AC5A 3LFCA 4KIKA 3VUIA 1JNKA 2HZIA 2P0CA 2R4BA 2WOTA 3AT3A 3DBQA 3EKNA 3MA3A 4IZ7A 5HBJA 4OTHA 5K4IA 4IWDA 1SVGA 3TJDA 4DF3A 4U9AA 4KINA 3V04A 1G8SA 3FI4A 4GT5A 4XP2A 4G3CA 4EKKA 4H36A 5I9WA 4N4SA 2WQOA 2YM3A 3ORKA 4FKIA 3I6UA 3NCGA 4FV7A 2VTQA 3PVBA 3O2MA 3F9NA 3P7CA 4G9RA 3O51A 4GG7A 5AUYA 3R22A 4CV9A 1YI4A 5F94A 3EFKA 2XS0A 5AUWA 2FSMX 4FT5A 3UP2A 3OCSA 5FD2A 3V8TA 3JR1A 5HNBA 4IB1A 1P14A 3D4QA 3ZUVA 3NW7A 3C1XA 1BX6A 3U6HA 4QD6A 4ZLOA 4U5JA 3IW5A 2BAQA 3RM6A 3VQUA 2CN5A 5K5NA 2F57A 4D4SA 3DAKA 1M7QA 3OEZA 3QD3A 5CZIA 3OFMA 5M4CA 1YHSA 2B9IA 3OXIA 4WKQA 5DRDA 4BBFA 3QKKA 4NW6A 3UP7A 2RL5A 2X4FA 4CQGA 4O2ZA 2F2CB 2XIRA 4YMJA 4L52A 5CZHA 2IZUA 3BBTB 4TT7A 5FP5A 4CT2A 3U87A 4G17A 4IACA 3AC8A 3HP5A 4Y73A 4M14A 3QWKA 5EW8A 4LRMA 5BMSA 2WTKB 2XK3A 5A4TA 2W1IA 3OXZA 2R7IA 5ANEA 3G5DA 3WZKA 4IDVA 4FKJA 1ZYDA 2E9NA 4YP8A 2XMYA 5BVKA 1Q5KA 3NUYA 4HCTA 3R9OA 4EC9A 2YACA 2ZOQA 3BYUA 2QURA 4MF1A 4A9TA 4L6QA 4ALUA 4DCEA 4E6DA 5AEPA 2ITUA 3CTJA 3R0TA 3SOAA 2R3FA 3V6RA 3VHKA 2R2PA 5CEIA 4QMMA 2VX0A 2H8HA 4RJ4A 4AW2A 4EL9A 3O17A 3C0IA 5E92A 3JYAA 2OJIA 3QQFA 1JQHA 4KB8A 3RAHA 4Y46A 1XWSA 1M2PA 4NM5A 4NSTA 4ZLZA 3FC1X 4QTAA 3GCVA 4GFOA 4HJOA 3M2WA 3ROYA 1OPKA 2RSVA 3D9VA 1YRPA 3ZC6A 4CFUA 3E92A 4RBLA 3RI1A 4DH1A 3CIKA 4DEGA 4QQJA 4YTHA 4EHGA 4YNOA 1S9JA 2IJMA 4WRSA 4K8AA 5FEDA 3N4VA 4ZZMA 1S9IA 2JLDA 2WOUA 4B0GA 3BHHA 3QX4A 3Q6WA 4DLIA 3UIUA 1Q99A 4EWHA 2PVYA 4RJ6A 2ZVAA 5KZ0A 4NM0A 4OLIA 4DH7A 4M0ZA 3RK9A 2PPQA 3SRVB 3OWJA 4M84A 2BRHA 3HUCA 3L8SA 3TT0A 3LHJA 3A4OX 3CKXA 4HZSA 3R04A 2UUEA 2X2MA 4U3ZA 5EI8A 4FTNA 5FGKA 5BMMA 3PDTA 4L7SA 2ITOA 1U54B 2ETRA 2VN9A 5EDPA 4RMZA 4FNYA 2VNYA 5J5SA 1RE8A 2XK4A 3PUPA 3UZTA 2VX1A 1H8FA 4JR3A 4RSSA 1J1CA 1QMZA 4S31A 4NH1A 4UALA 3CTQA 2ONLA 4RA4A 1G3NA 1O9UA 3CBLA 4KS7A 4EK6A 3R71A 5BVWA 4CFWA 4XG4A 5K5XA 4F7JA 3SAYA 2P3GX 2QNJA 1PJKA 2ZJWA 3H0YA 3TWJA 3GCUA 3I5NA 2VD5A 4HVIA 4CEGA 4R7HA 3BHVA 3VS4A 4TXCA 2IW8A 5CSWA 5HVJA 2CJMA 2HELA 4OT6A 3LZBA 4YJQA 3RAIA 4XG6A 5B7VA 4IAFA 4RWIA 4QYYA 2RIOA 3JS2A 4USFA 2W1ZA 1ZRZA 2NRYA 3II5A 3OCTA 4XV3A 5M09A 2XF0A 4U44A 5CSPA 2NPQA 2VAGA 3ZHPC 3EQIA 3GU7A 4C0TA 4ASEA 5LMKC 2WNTA 3DOGA 2WFYA 4OTFA 3VQHA 5ITAA 3GT8A 4MD8E 1OITA 3L8VA 5EDQA 2W4KA 2R3NA 3R7GA 4I6HA 5I9YA 1JSTA 4NT4A 4PP9A 4BR3A 3SDJA 4IAIA 3VRYA 2C68A 4X2GA 5ETAA 3TUDA 5IF1A 3VS3A 4F6WA 2X7FA 2X8EA 4J8NA 4HGEA 4EJNA 1SZMA 5F20A 3W2SA 3PXFA 1CKJA 2VO0A 2YIYA 4RC3A 4IWOA 3CCNA 4UBAA 3MSSA 5HESA 3BQRA 4PL4A 5C9CA 2OIQA 2CGWA 4QQCA 4ACCA 4O91A 5BYZA 4BBEA 4BC6A 4FKOA 1PXOA 3LE6A 4RLLA 3Q5IA 4MK0A 3W10A 3QTIA 3PWYA 4WO5A 4BB4A 3U9CA 1KE8A 4W9WA 1HCLA 2W06A 3WILA 1M2RA 3E7OA 4WNOA 5EI6A 4JXFA 3G6GA 2H6DA 3ORZA 4GU9A 5TT7A 2OXYA 4A4OA 4B6LA 4EZ3A 4EKLA 1YQJA 3LM5A 3NZ0A 2UVZA 2BUJA 3FZPA 4LL5A 4Q5EA 4TN6A 4DFNA 2XBJA 4FIEA 4TL0A 3HV4A 3R73A 2QONA 3IDPA 3PSCA 3WE8A 3V8WA 3EQCA 3UBDA 5EK7A 4E3CA 3W2PA 3Q4TA 4KRDA 3ATTA 4FZAB 3GOKA 4J99A 4ARKA 3EFJA 4J53A 1TQMA 5DMZA 4FTKA 3IDCA 2ZMDA 3MH0A 4RG0A 5CI7A 3IOPA 3EYGA 1XKKA 5CSVA 2HWOA 4L01A 4X3JA 4H1MA 4ERKA 1TVOA 5CU0A 5CX9A 3Q4UA 2UW9A 2YM6A 3DKFA 5HORA 2VWXA 5A6NA 4W4WA 3Q52A 3FMNA 4E4XA 1WVYA 3ZLYA 4K6ZA 1SVEA 3K5VA 4BY9E 4CD0A 3COHA 4QMLA 2R9SA 4MH7A 4FTTA 5JK3A 3MVJA 5E8TA 4RZVA 4FL3A 3ZEPA 4CV8A 3GOPA 1PRYA 3BV2A 2BRBA 3VAPA 5A9UA 5CAPA 3VUHA 1KE7A 4PX6A 2C47A 3O8TA 5T68A 2WU7A 3F61A 4FSMA 4AAAA 5A4QA 4RFYA 3V5LA 3MDYA 3RWQA 4O7ZA 4FTOA 2JDTA 2WMXA 2WEVA 2XIXA 4NKAA 4BIBA 2R5TA 4I5PA 4D58A 5IQFA 4YGAA 4P7EA 2O5KA 4FV5A 4G1WA 3PZHA 5E8ZA 3U4WA 4USDA 3I81A 3QCQA 4MYGA 4W4YA 1V0OA 3Q96A 3JUHA 3PIZA 2B9JA 4BGHA 3R1SA 3VBXA 1U4DA 4HOKA 3WZDA 3VBQA 1UNGA 1W7HA 4F08A 3L9MA 4DE4A 2W99B 2Z7LA 4ENYA 4J96A 3HVCA 3UYSA 2QO7A 5EHYA 4YC3A 4AZTA 2W5BA 5GZAA 4XRJA 3E87A 4C35A 1P4OA 2WHBA 5EHOA 3BPRA 4AA0A 2XEYA 4TYJA 3LMGA 5JFXA 3L9NA 4MWIA 5HE0A 3GU8A 4NWMA 4RGJA 2B54A 3PPKA 4IVCA 5KX8A 2W1HA 4ITIA 4RT7A 5K0XA 4W8EA 3EFWA 5DYJA 4RLKA 3NR9A 4FSUA 3ZUUA 4BTJA 5IH5A 5KNJA 2XNGA 4IM2A 1ZWSA 3WOWA 2GCDA 2OF2A 2QOOA 4I21A 3ETAA 5LMAA 4H1JA 3MTFA 4DITA 5L4QA 5IQBA 2YHVA 4O0SA 5HTBA 5I3RA 2X7GA 4DFBA 3OF0A 4AG8A 4GEOA 3FXWA 5BX0A 4RX8A 3ZONA 5EQEA 3F88A 1XR1A 2UVXA 4YZ9A 4TWOA 4YLKA 2PUPA 3CQUA 4U8ZA 3KULB 4UXQA 4DEDA 3QX2A 1O6LA 5HNIX 3HV3A 3MY1A 5K9IA 4HZRA 4EOQA 2C5XA 4O7WA 3BWJA 3COIA 2XB7A 4P4CA 3I1AA 3AGMA 4LGHA 2JBOA 4FICA 4FTLA 3W8LA 4IX3A 2EXEA 4ZSGA 4BCGA 4CMUA 4FZ6A 3ODZX 3TJCA 4K2RA 4E73A 3KU2A 1YI3A 1JKKA 2WZJA 3ANRA 4J71A 2C6LA 4I4FA 4JQEA 3W2CA 4IC7A 1ZZLA 5CXHA 3K3JA 3QKMA 4KNBA 4MF0A 3MI9A 4PMSA 3GNIB 4AE9A 2QKWB 3GI3A 5LMKA 3WZJA 1Z9XA 4DTAA 1MRYA 1H08A 3VUMA 3DXQA 3OBJA 4C4HA 4ZTLA 2QOIA 4K33A 4BCIA 5BPYA 4FV6A 3MBLA 3M1SA 4ASZA 2PZIA 5L6WL 2W17A 4A4XA 5CAQA 4L53A 3UIXA 4ZTMA 3SA0A 5AA9A 1JLUE 4BWXA 4TYIA 1ZMUA 2QG7A 3A4PA 3E8DA 5ACKA 3B8QA 4IH8A 3HDNA 4GFGA 3EL8A 4F9WA 4FK6A 5J9YA 3SRVA 4Z7HA 3G33A 4EHEA 3ZYAA 4MAOA 3MN3A 4I23A 4MD7E 2BAKA 3EN7A 5AWMA 4YUQA 5A4CA 3O7LD 1DI8A 1WZYA 4DYMA 3CGFA 2JD5A 4FSNA 3ERKA 4RWLA 3E7VA 1Q24A 1WBTA 3HA6A 2P4IA 1U54A 3F3VA 3ORLA 4YLJA 4A9SA 3UNZA 2WGJA 4PP7A 2OZAB 4KABA 2C69A 2FVDA 4XS2A 3WIKA 2O65A 1ZY5A 4EOOA 4IZAA 4OAVB 1VYWA 4EJ7A 2B9HA 5H2UA 1E1VA 3OW4A 1YDSE 1J3HA 4XG3A 4UZDA 3LCOA 3M11A 4E1ZA 4XV1A 5B2LA 5EYKA 1K2PA 3POZA 4X21A 4XX9A 3OHTA 5AP4A 3S3IA 4FL1A
chains in the Genus database with same CATH superfamily
3UJGA 4RJ3A 3TIZA 2C6DA 3PXQA 2QODA 4IEBA 5BV3A 4AOTA 5DHJA 3ZSIA 1K9AA 3CQEA 3RCJA 1UWJA 1JKSA 2XUUA 3TNQB 4ANMA 1J7LA 2X0GA 2X9EA 3D7ZA 4Y95A 2R3QA 3U55A 2YITA 2R3RA 2WKMA 3Q32A 2FYSA 5D11A 2CPKE 1Q3WA 5CSXA 1CKPA 3C5IA 1YVJA 4GV1A 2BTSA 3FY2A 4GIIA 4UV0A 3TL8A 2PK9A 5ETIA 4XHKB 4KBAA 2BKKA 4FTIA 1AD5A 1YOMA 3ZMMA 3KXNA 5AV4A 1U59A 5DR6A 2GNFA 2IW9A 3NAYA 5I3OA 3CXWA 3FLZA 3FDNA 2YLFA 3Q04A 3BGQA 4GMYA 4FV2A 4FYOA 3R9DA 4EOMA 2GS2A 5CAVA 1JSUA 2HW6A 1KE9A 3IS5A 5HX6A 3P9JA 3DKGA 4N57A 3PLAE 3H30A 1FBNA 2J0KA 4O84A 5LWNA 3LOKA 4D2VA 1VYZA 2EXMA 5IU2A 4G34A 5J8IA 5HU3A 4ZJJA 1J91A 1H1RA 4J52A 2V0DA 3UDBA 3ULZA 4O86A 5G1XA 2Y4IB 3HMOA 5AP2A 4RIWB 5AIRA 1OL7A 1ND4A 1BL6A 1A9UA 1XO2B 2B4SB 3LCSA 3R83A 5JQ8A 3PPZA 4BGQA 4IVBA 5M44A 2WMRA 2R3JA 5DEYA 3CJFA 1WAKA 3QD0A 1R3CA 1DAYA 4U6RA 4MBLA 1LEZA 5FEQA 3EQHA 1HCKA 3I79A 2UW3A 2BCJA 3R2BA 2ZV7A 2QR7A 3Q2JA 3NNWA 3EIDA 2WIPA 3ORMA 4WG5A 3RTPA 4RJ8A 2J6MA 5HZNA 5HO8A 4FV3A 3BU5A 2QD9A 1M17A 2BZIB 2ZV8A 4G3DA 1EH4A 4R8QA 2QVSE 4UB7A 5G6VA 1YOLA 3TACA 5KHWA 5KMJA 4ZTHA 2OJGA 3HKOA 1Y8GA 3NUSA 2GQRA 2XKCA 5TO8A 5K0KA 3DBEA 4FR4A 2YAKA 1PMEA 5CEKA 5JFVA 4ZSAA 5A54A 3FI8A 1P4FA 5BUIA 3E62A 4NM3A 3AMBA 4FL2A 3UO4A 5AUVA 4RIOA 5ANGA 3TTIA 3V6SA 4C59A 4ONAA 3LXLA 4IE9A 3R7VA 3WF6A 3R30A 2J0IA 3K3IA 3S4QA 2YLEA 1IAJA 3OS3A 5L2WA 4TTHB 2XYNA 3A2CA 2OIBA 3AOXA 4IAZA 4I22A 5TKDA 4U41A 4QMQA 2X39A 3HNGA 3MGYA 2C6TA 4FNXA 4O4CA 3GQLA 5JRSA 5TF9A 3QXOA 1OUKA 4DTBA 4MXYA 4NYEA 4NJ3A 4FI1A 3SXSA 5A6OA 4WNMA 5IH6A 5AFVA 1WBOA 2PMNX 3BU3A 3ET7A 5DEWA 3PXKA 3Q53A 2I0VA 5HG8A 4DEHA 4QDVA 3W33A 2ZMCA 5GJFA 5CEOA 5AM6A 3WI6A 5I9VA 2BDFA 4C61A 2PVHA 5IQHA 3QLFA 2V55A 4LV7A 4JQ8A 4FTCA 3F7WA 5IISA 3Q4CA 4X0MA 4FUXA 1DAWA 4ACGA 5BVEA 4ANSA 4O2PA 3V8SA 4NFNA 4U80A 1GZ8A 3RHKA 2WQMA 4AF3A 4BTKA 4FSZA 2F9GA 3BELA 4G3FA 5AP0A 3SW7A 4GYIA 3ZFMA 4U3YA 4JBVA 4BN1A 4CLJA 4FIHA 5KKRC 4R1YA 5HEZA 2VU3A 4AGWA 5IA4A 2WAJA 3AC3A 2G2FA 4X6QC 3VUDA 3R1QA 3LXKA 4YJOA 4GKHA 1OL6A 2BROA 3TUBA 1GIHA 2C3JA 2C6EA 5GNKA 4BDKA 3DLSA 3LMIA 3EHAA 1OPLA 4I94A 3WZUA 4IJPA 4UYNA 5E91A 1YXUA 2JGZA 2ZAZA 3ZSHA 2YM8A 4WT6A 2A2AA 2C30A 5EW3A 1ST0A 2Z8CA 4QMWA 3LFAA 4RVKA 4AQCA 3ORXA 2W5AA 4G3EA 4DA5A 4F64A 1SM2A 3KXMA 3QCYA 5CNNA 3CPBA 4GIHA 3QQKA 4JNWA 1GZKA 2C6KA 2CCIA 4CYJA 4QP7A 5C03A 2R3IA 4ACDA 4CKIA 2E9UA 3KULA 2J4ZA 4ZY4A 4LG4A 4NZWB 5K3YA 4RA5A 3V5QA 4FEXA 5TE0A 4XV9A 5KMIA 5EYCA 2YISA 3LJ2A 4A07A 3GCPA 3IOKA 3OEFX 4UWCA 3RPRA 3SV0A 4O7LA 4AXCA 4YZNA 1MQBA 3PE2A 4D28A 3BGPA 4RVTA 3PA4A 3WIGA 4OTIA 4MD9E 4BVUA 3ZO4A 1UU8A 3MH2A 4CMOA 2OWBA 4I3ZA 1YDRE 2WMWA 2YIQA 3EWHA 4BHZA 2B0QA 3NUPA 2PE2A 3IW7A 5HG9A 4AA4A 2CGUA 1IAHA 2A19B 2XK8A 2VTTA 2XCKA 4NTTA 1OECA 4JRVA 2SRCA 3DT1A 2X0PA 3DFCB 4YLLA 4DHFA 3CPCA 1H1SA 4FNZA 5HIDA 3D5WA 2O2UA 3BQCA 5HBHA 5DT0A 4N0SA 4P5ZA 4M68A 4C4GA 5L6PA 4HPTE 3F2NA 2UW5A 4S2ZA 5IUIA 4AOJA 4DH3A 1NVSA 3DPKA 2KTYA 3A7IA 2BHEA 3NNUA 1SVHA 3FSKA 2Y4PA 3EMGA 3LQ5A 3N51A 1CMKE 2EUFB 4MQ2A 2Q0BA 5FDPA 3NUAA 2A1AB 2IZRA 4BJJA 2WTIA 1PKDA 1PMVA 2B52A 3T9TA 2YM7A 4EZ5A 5C8KA 2ZB0A 4FNWA 1Q4LA 4FSQA 4QMPA 2HAKA 4IBMA 4ITJA 2X2KA 4DC2A 5CASA 1G8AA 1BYGA 3KVXA 4L9IA 1ZZ2A 3TN8A 4FEWA 2F7ZE 2ONLC 2OZAA 4XRLA 3PG3A 3FKNA 2W9FB 3HRFA 5HE3A 3NPCA 5AADA 1PXJA 2ITXA 4BKYA 2PUNA 2QOFA 2V62A 3NUNA 2DUVA 2YWPA 1SNUA 3TM0A 3F2AA 4O0RA 3KKVA 4BCQA 4ORKA 3RZFA 4QP3A 4DFUA 5DR9A 2WIHA 4J8MA 1JBPE 3EQRA 3GU6A 5CSHA 5M08A 3FHRA 3FL4A 3SVVA 5A3XA 3UQGA 4FEVA 2YDIA 4PNKA 1H0WA 3EN9A 2I7QA 1H28A 2QR8A 4M67A 4F0IA 2PE1A 4YTIA 2XNOA 4FKGA 3MPAA 4GK3A 3MVLA 2PVLA 5ACBC 4ZMEA 2BZKB 2VTOA 1FQ1B 3UZRA 1YOJA 4WNPA 4BF2A 3U4UA 4AN9A 4DCAA 1XMLA 1OKWA 1WBWA 5IA1A 5LMBA 4OBQA 3W55A 3UZPA 4R78A 2UVYA 3KXZA 3ZFXA 4Y8DA 2ESMA 2WO6A 2OI4X 1M2QA 3F3TA 5CQWA 5J95A 3ZLSA 1OIUA 2HENA 2PVKA 3GBZA 3QZFA 4C34A 4HVGA 3E8NA 4KD1A 4RVMA 2PE0A 3UDTA 2W4JA 3T9IA 3VC4A 1OKZA 2JFMA 3FV8A 5HGIA 4TYHA 3RPVA 3VO3A 4O83A 3PJ8A 4II5A 2O64A 4X3FB 2UZTA 3PVUA 5ANJA 3HAVA 3U8WA 3MH1A 3F82A 3OMVA 4QDEA 2OBJA 4WNKA 1PW2A 1GIJA 4EHZA 4GK2A 4AZSA 5KBQA 3G51A 3FI3A 4X7QA 2BHHA 1U5RA 2W1EA 5HQ0A 4XG9A 2W05A 3JVRA 2PVJA 3Q3BA 3UOKA 1Q41A 4DGGA 3PJCA 2HW7A 2YWVA 5H8GA 5H8BA 5J79A 1W82A 1I09A 3R63A 2XK7A 4ZSJA 4FODA 5GJDA 4Z7GA 4CFVA 4NIFB 2E2BA 4BDAA 4AXDA 2UZUE 3PSDA 3NYXA 4D1XA 3CD8A 4BZDA 3QD4A 4ZLYA 2X6EA 4IDTA 3A7GA 3Q9YA 4CCBA 2IF8A 4ZZNA 2F4JA 4I4EA 5M4IA 5CU4A 4P90A 5CEQA 3TNWA 4RC2A 2IVVA 2X81A 4X6RA 4LFIA 2FSTX 1NVRA 3D83A 3LCKA 2AYPA 4PY1A 3ZCLA 2X2LA 4EOSA 4F7NA 5CU2A 4ZSEA 4FVPA 4APPA 3D5UA 2NP8A 3TNIA 3VBYA 2C0TA 1PXPA 5AM7A 5DLSA 4GYGA 1GAGA 2GHGA 4PDOA 3SG9A 3MFTA 3LFQA 5FWKK 3QZHA 1VJYA 3IW8A 2CKPA 2YN8A 3GP0A 4CZUA 4F1MA 2C3LA 3UMWA 4DN5A 1ERKA 4K0YA 1W0XC 3Q6UA 4WRGA 4K1BA 5HOAA 1URWA 3FMEA 2HXQA 3QTUA 3I6WA 4YO6A 5K4JA 2RFNA 3NW5A 4FGRA 4XMOA 4O81A 5FDXA 2UZEA 3IPHA 4PDPA 3LJ0A 4U81A 4E6CA 3PLSA 4IB5A 2BZHB 3OT8A 5F4NA 4EOLA 1FVTA 3A8WA 4YZCA 5HE1A 3HMPA 2XIKA 3QAME 3RNIA 3LFSA 5LWMA 4ZZOA 5KBRA 2VGOA 5M4UA 2R3PA 2CNVA 2BTRA 3KL8A 5JRQA 3R02A 4R77A 3FPQA 4AACA 3BYOA 4L3LA 5EW9A 5FTQA 2QQ7A 3EQPA 4WA9A 3V51A 2BR1A 2WTWA 4IWQA 2JAMA 3UODA 2J2IB 3QQGA 4YZBA 3ZO2A 4KIQA 3OY3A 3P08A 5AX9A 2FUMA 3FMHA 1TQPA 4IC8A 5DG5A 3UPXA 4S32A 4J95A 3DKOA 4O96A 4QP6A 2OZOA 3N9XA 2R7BA 2HZNA 2R0UA 3SQQA 3DTCA 3LPBA 4D5HA 4I6QA 4QNAA 3WZEA 5ETFA 2VWVA 2XKEA 4F9AA 2C0IA 4EORA 4NM7A 1LPUA 5AX3A 2CSNA 2GNGA 5KZIA 3UG2A 4ZY5A 2YIWA 4IZYA 2JKQA 3KXHA 3W1FA 3TDVA 4O27B 1U46A 5HE2A 2HZ0A 5T3QA 2C1BA 4D55A 2WTKC 3CSVA 4ZMFA 3DK7A 2JDOA 3AMAA 3ROCA 1XJDA 4U45A 5AP6A 2JFLA 4G3GA 4O0WA 4F9YA 4YR8A 1OB3A 2OLCA 3RAKA 4B99A 4ZJIA 4AW5A 4P2KA 2QI8A 2EXCX 4BCHA 3ORPA 3BBWA 1JWHA 3P23A 1TKIA 3OCBA 3EN4A 2JKKA 5BVDA 2WMAA 2HY81 4TRLA 4D4RA 3R8MA 4FF8A 4C8BA 3K2LA 1AGWA 1YWRA 3KK8A 2H34A 4MCVA 3TNPC 4OTDA 2WMBA 4L8MA 4EQMA 4O4EA 1P5EA 4IZ5A 4DHIB 5CYIA 4KIOA 3U51A 2WU6A 4O1PA 4RQKA 4I20A 3ZSGA 4E26A 5GZ8A 5L6OA 2BPMA 1R1WA 3DJ7A 2J5FA 3NVKI 3QTRA 3VS7A 1FVVA 2XM9A 4QMXA 3U9NA 3AGLA 3TYKA 4CCUA 3TKUA 4WOVA 5EKOA 4O4DA 3D7TB 4EC8A 2GHLA 4CYIA 2CDZA 2QOCA 4U7ZA 5M56A 3TV4A 4B7TA 4EH7A 1LEWA 4FKVA 3L8XA 5HKMA 1WBVA 1YI6A 3ZTXA 5JGBA 4UX9A 4IHPA 3OXTA 5EM7A 3W0MA 4KSPA 5HTIA 4AE6A 3KC3A 3DTWA 1Q8ZA 2JIIA 2OH4A 3UGCA 3DXNA 2XKFA 5LVNA 4CFMA 4TNDA 4W9XA 3O0GA 4QP2A 5L8JA 4MNFA 4WD5A 5IA3A 3D0EA 4MVFA 2PY3A 4FVRA 4MHAA 2O3PA 4DT9A 4OTWA 2P33A 4WUAA 3AKJA 2R3GA 2ZV9A 4L45A 2J0JA 3DU8A 3RWPA 2GSFA 3QUPA 3REPA 3P1AA 4EUUA 3CQWA 2VTJA 3P4KA 4EQUA 4AT5A 3OOGA 4DGOA 3EOCA 5E7RA 5LCKA 4BZNA 3T3VA 5JN2A 5KO1A 5HO6A 2CMWA 5CAUA 5HTCA 4FKRA 3PXZA 2ZDTA 1R0PA 3ANQA 4CZYB 3FQSA 2FSOX 4AN2A 2BMCA 5JZJA 3W0SA 3ZC5A 4F0FA 4RFMA 4TY1A 5JH6A 3UVQA 2W1GA 3CC6A 3MPMA 2IWIA 3DDPA 1BI7A 4XV2A 5DIAA 2X6DA 3SOCA 3VUTA 4EUTA 4IW0A 3C4EA 4NUSA 3VUKA 4NFMA 2W4OA 5AR4A 5M51A 3F5GA 4QQ5A 3PY3A 3BLHA 3FPMA 5C8NA 1YHVA 2XNNA 1IR3A 3C0GA 4LGGA 4DDIA 3C4CA 4FKUA 2PL0A 5ANOA 5AUZA 3H9RA 3VS5A 4D0XA 4DHJA 3KXGA 4KBKA 2NO3A 2WMQA 5AR5A 5J87A 5JFWA 2G2IA 2ACXA 2J0LA 2VNWA 3GGFA 3UC3A 3AKLA 3DKCA 1W98A 2YFXA 4DEAA 4IAKA 4S33A 4DEIA 3DS6A 5EQPA 3KEXA 2UW4A 4BI0A 5A4LA 2PUIA 1KSWA 1H26A 2OJ9A 4BCKA 4A4LA 4MXAA 4D1SA 2WB8A 3PJ2A 3NWWA 1Y57A 2C5NA 1UKIA 4AZWA 3HZTA 2BIYA 4U43A 1JAMA 5CTPA 3TTJA 4NIFA 5CS6A 3NCZA 1GZOA 4XYFA 4DG3E 3CTHA 1WVWA 4FOBA 3QWJA 3VF9A 3ZM9A 4ID7A 3IKAA 3NYNA 1XH9A 3R8UA 3EQFA 2XH5A 4Z9LA 4CLIA 4CFFA 4FV4A 1A06A 3T8OA 3WYYA 4QQTA 2CKEA 4O7SA 5I9ZA 3G2FA 1XH5A 3PP1A 4H3PA 3VBVA 5GIPE 1KOBA 1YW2A 2XJ2A 1STCE 1IG1A 3CR0A 3OCGA 4FT9A 3F3WA 4R3CA 4FMQA 1KUTA 4TYEA 3LM0A 2AC3A 4NL0A 5IQEA 3HGKA 4BDDA 1CSNA 3DCVA 3DNEA 4JJRA 2UW8A 4KIPA 5AR8A 2WTCA 4FKWA 2VTMA 2CCHA 1WCCA 1F0QA 2ZM1A 3DY7A 5FTGA 2GPHA 1IASA 4RFZA 3R28A 3KMWA 3OWKA 3PXRA 3S00A 1Y8YA 2XZSA 3PVGA 4CZTA 3I4BA 3QZIA 4FX3A 2I0HA 4ACMA 4Z55A 4Y83A 4AWIA 4Q2AA 5FXSA 1PHKA 3RK5A 4XLVA 3ML1A 2UZDA 5HICA 2VO7A 1WFCA 2IVSA 2YCFA 3KRWA 4X2FA 4EH4A 5LVLA 4WUNA 2CLXA 5B0XA 4RIYB 5ICPA 2ITYA 5AV3A 4FTRA 3LLTA 4FYNA 5IQDA 3OZ6A 2ERZE 4MBIA 3TZ9A 5TOZA 4ZS4A 2R0IA 4FTQA 1OBDA 5H3QA 3AQVA 4MXZA 5KMOA 3P5JC 1UVRA 5C26A 5M07A 2P55A 4CKJA 1OM1A 1I44A 1ZLTA 3BI6A 2QOLA 3DLZA 3PRFA 4LL0A 2OK1A 4BYJA 5HIBA 3G0FA 3R1YA 5DGZA 3DJ6A 3O7LB 4KS8A 5H9BA 5A14A 3E8EA 3UDZA 5E8YA 5HHWA 2Y6OA 2QO2A 2YIXA 3F3ZA 4ASXA 2GMXA 4GCJA 3UO6A 4XUFA 1IEPA 4LUDA 3E8CA 4J97A 1NW1A 3SW4A 4V04A 2VWZA 2RF9A 2VO3A 2J0MB 3KQ7A 3ZZEA 3LFEA 4MNEB 2UZOA 4A9RA 3BWFA 5DN3A 4RX5A 5KMLA 4L44A 4AXFA 4TPTA 4JL9A 3ZBXA 4QTEA 2UZLA 3KCFA 4FG7A 5D10A 4CTBA 1DS5A 4EH5A 4UN0C 5AP5A 3FLYA 4RX9A 5J1VA 4JI9A 4H39A 4BDCA 5DBXA 1OL2A 4MXCA 4Y5HA 2VTPA 5FTOA 2QOKA 3DNDA 2VTNA 3HLLA 3TI1A 2G1TA 3DGKA 5M06A 2YCRA 4PMTA 4OR5A 3QLGA 3SLSA 2REIA 3LXNA 4AT3A 5F9EA 3BL9A 5H8EA 2CLQA 5M57A 3SD0A 3ZDIA 2B7AA 3QGYA 4FIIA 4NJDA 1GNGA 2I6LA 3RMFA 3FKOA 4FIFA 4FIJA 2YERA 4GK4A 1UA2A 3EQBA 5KCVA 4G2FA 4KKEA 4L42A 4GH2A 3DQWA 4MX9A 3GUBA 4HNIA 5AP7A 3JPVA 4QMNA 4O7RA 5EM8A 4UXLA 3ELJA 2B1PA 2CN8A 4TWCA 2BRMA 2E9OA 2ZM4A 2W96B 2Y8OA 3MJ1A 2H9VA 3BHYA 5AUXA 1YKRA 1BUHA 3UC4A 2GQSA 5FRIA 2HK5A 4IXPA 3UIMA 3AC4A 4HYHA 3UDSA 3DBDA 1XBAA 4YHJA 3VW8A 4BDFA 4C2VA 4M15A 1K3AA 3D7TA 2ZB1A 4PMMA 2J7TA 4YTCA 5E8WA 3W0QA 4G5JA 2A27A 3ATSA 2VTRA 1JPAA 4RX7A 2XRUA 3QZGA 4PPCA 2JEDA 4BCFA 1JSVA 2CNQA 4USEA 3IECA 2VO6A 5J9ZA 1FGKA 4JG7A 4KBCA 3HRCA 2PVNA 2H96A 1FOTA 2JKMA 4O7YA 2PSQA 5FG8A 3O71A 2W1DA 4BKZA 5E8SA 4HW7A 1Q97A 3R7UA 3S2PA 5J1WA 3SXFA 1M52A 2G2HA 2WELA 4QYFA 3SG8A 3F5UA 2A4LA 3QHWA 1UU3A 1V0PA 2Q0NA 4ALWA 5AAEA 4XOYA 1M14A 3OVVA 4KIKB 4YJVA 3W18A 3MIAA 4BZOA 1KOAA 2XP2A 1BI8A 3QUEA 3V01A 3C5UA 4FEQA 3ID6C 4PL3A 4YBJA 4ACHA 2UZWE 5D12A 4L46A 2I1MA 1PY5A 3ZEWA 3VS0A 2W1CA 2ITNA 4ZTRA 3C50A 4L68A 5A46A 4GJ3A 3TZ7A 1W2DA 4BTMA 3FXXA 3QCXA 1DM2A 3D94A 5E1EA 5HVKA 5LOHA 4FSRA 2GFCA 4FZFB 4W4XA 1PYXA 4D9TA 5L2SA 4AA5A 2R3LA 4D2SA 3HMIA 5CXZA 4UYAA 4DFLA 3UG1A 5GIOE 1Q3DA 3KB7A 3QTQA 4K9YA 4G6LA 1Q8UA 3BYSA 4ZXTA 3EL7A 3TKHA 5LVOA 1QPCA 3KCKA 3F7ZA 3NRMA 3LFFA 4JOAA 2YEXA 5D9HA 3TV7A 3ZUTA 4YU2A 3OOMA 4IB0A 3KRLA 3S1HA 5HBEA 3F69A 4IIRA 3QU0A 3PFYA 2J50A 3E3PA 1GOLA 4F78A 1YWVA 2XK9A 2XNEA 1WVXA 4K77A 3MVHA 5L2QA 4U97A 1ZMWA 3WARA 5GINE 4R3RA 2IZSA 4ZJVA 3R8VA 4FJVA 4KAOA 4OTGA 2BDWA 2HYYA 4PPAA 2PZ5A 5B2KA 4H05A 2J5EA 4BDEA 4FG8A 2Y4IC 4DTKA 5F95A 3LQ3A 3EH9A 5CAOA 4HYSA 3UNJA 2OGVA 5IH4A 2ZV2A 2OICA 5EHLA 5EYMA 4BCJA 1ZY4A 5IA5A 1W2FA 4PPBA 4R7BA 2JBPA 4GRBA 4RPVA 5LVPA 1H01A 3R00A 2WMTA 3FHIA 5AP1A 4YZMA 3AD6A 2EVAA 5EOBA 3RHXA 4YURA 2VWBA 4F63A 1RDQE 2X8DA 2O0UA 1GY3A 2JITA 2LGCA 2WMUA 4JT3A 3OUNB 1ATPE 2JDSA 4FIGA 4FTMA 3DFAA 3P86A 5DE2A 1KV2A 3JY9A 3R1NA 3FQHA 4QPSA 2RFSA 3CS9A 4R1VA 3UVPA 4XG8A 2QCSA 4ZSLA 2PVRA 4F70A 1WBSA 4W8DA 5BYYA 4IX6A 2IN6A 2XRWA 4C3FA 4C36A 2F49A 3SX9A 4OBOA 5FXRA 5J7BA 4EYMA 1UKHA 4AFEA 4YC6A 2F2UA 3CJGA 3SHEA 4D4VA 1APME 3R9HA 2J90A 3E64A 3C4ZA 4UMUA 3CLYA 4YJUA 1PYEA 3F5XA 1TQIA 3U6JA 3R8ZA 2JDRA 2QOQA 3V3VA 3W32A 3H3CA 4HGTA 3TXOA 3E93A 4BCPA 3E5AA 4FUYA 2HCKA 1XHAA 4FKQA 3DK6A 2IW6A 3FKLA 4H3BA 3A7JA 4QTBA 4M69B 4EQCA 3PY1A 4DFXE 5C4LA 4J7BA 4O0TA 3MB6A 4U0IA 2V7AA 4W4VA 4ZEGA 2BIKB 4PRJA 4E5AX 3GCSA 4DGLC 3D15A 4B4LA 1BKXA 4C7TA 1V1KA 3MFSA 2PVMA 3R01A 3IW6A 1R0EA 4I1ZA 3BU6A 5CI6A 5IKWA 2VV9A 4FEUA 4JAJA 4JDIA 2FGIA 5BVFA 2GNJA 5HD4A 3RINA 5AAGA 4JX3A 5AR3A 5HI2A 3PIXA 3QQHA 2RG5A 3QRIA 3R8PA 3ZM4A 5B2MA 1R78A 5DI1A 5E8VA 2R3MA 4FE2A 4ERWA 3RPOA 3E3BX 4C4JA 4ZOGA 4E6AA 3ITZA 4XBRA 4ANNA 3B2TA 5LVMA 2ZYBA 3EZRA 1MP8A 3Q9XA 5AV1A 3TZ8A 1UNHA 2PZYA 2X9FA 4OUCA 5GJGA 4F99A 4AQKA 5AV2A 2PZPA 4XG2A 4YC8A 4M13A 1KV1A 4BTFA 1YHWA 1KWPA 2WQBA 3KFAA 5JZNA 5HIEA 1OIQA 4GT3A 4C3RA 5CF8A 3BGZA 3LXPA 3BYMA 3PRIA 3RP9A 3ENHA 2OFVA 4IX5A 5DT3A 3P7BA 4GS6A 4I6FA 3EN5A 5CWZA 1OPJA 1H1PA 3HV6A 4UMQA 4A06A 4EK5A 4QMZA 4YZDA 5L8LA 3AKKA 4JBQA 3FMMA 2A98A 1QPDA 3QALE 3FJQE 2B55A 4BYIA 3LMHA 3VBWA 3PJ1A 5FLFA 3W0OA 4DH5A 4ASDA 3O96A 3KGAA 5CT7A 5AR2A 2WMSA 3C9WA 3UYTA 3FMDA 3PP0A 5FP6A 1H24A 3R9NA 2XAMA 4DLJA 5IMEA 5FUTA 2NNWB 3LJ1A 5HCZA 2QHMA 4OAUC 5HLPA 4EI4A 1OUYA 1UV5A 3C7QA 3MPTA 2UZBA 3RZBA 3KF4A 4GFMA 4JX7A 4YJRA 2YCQA 3P7AA 3VRZA 4BIDA 2F7EE 3SXRA 3KY2A 5BYLA 2C3IB 3ZLXA 3KK9A 4AP7A 2DWBA 1JKLA 3NNVA 1ZARA 3IK3A 4TKSA 3QRKA 5EH0A 4M12A 5E8UA 2E9PA 1XQZA 4YPDA 3UVRA 4HVHA 2JKOA 4LI5A 3SC1A 3MJ2A 3OWLA 5DH3A 4C58A 2EWAA 4F9CA 4BCNA 2JIVA 4C4EA 4ENXA 3UNKA 4WIHA 2VWYA 4UEUA 3PG1A 3VW6A 4AW0A 3C13A 5ETCA 4WBOA 4UY9A 3BKBA 5J9LA 4F0GA 2WTDA 4GUEA 4EZ7A 2XCHA 3FQEA 4F7SA 3R2YA 4FV9A 3AC5A 4O0UA 3W2RA 1GZNA 1YXTA 3DZOA 3GXLA 2GS6A 2WQNA 3MB7A 4RIWA 5D1JA 5GZ9A 4I0SA 4WBBB 2VTLA 3NNXA 4Y5QA 5TR6A 5EM5A 4S34A 3R9RA 2IZTA 3R21A 1REKA 2OU7A 1ZYSA 2QU6A 3BZ3A 4C57A 2FSLX 2XALA 3CP9A 5IQGA 5DVRA 2X7OA 4EHVA 3Q4ZA 5LCJA 3CY2A 4D2WA 4BHNA 4Q9SA 3Q5ZA 2WQEA 3FI2A 4QPAA 4ZTSA 3I0OA 5M53A 3TDWA 1BL7A 4O6LA 5DWRA 3I7BA 5M55A 4AXAA 2NRUA 3MIYA 3R7YA 3EQDA 5JGAA 4FTUA 4Y72A 4DBXA 5D7VA 2Z2WA 1IA9A 1E9HA 3RGFA 3PIYA 5C27A 4C37A 3P5KA 4H58A 4G6OA 4QEBA 4IB3A 2XARA 3TG1A 3NMUF 5IZFA 4AAYA 2E9VA 3PVWA 3NAXA 4RZWA 3DBFA 3DXPA 3QQLA 3DAEA 2R3HA 3JVSA 5IMXA 2BRNA 1ZOEA 1OVEA 3KMMA 4P5QA 3HX4A 4R3PA 5I4NA 2CKOA 4FKPA 2XNBA 4QT1A 4YHFA 5JQ5A 1KE6A 4IVAA 4YJNA 4BIEA 2UW0A 4CG9A 4FTAA 4F6UA 4XOZA 4YJTA 4R5SA 4FT3A 3F2RA 3FY0A 3C4WA 2YABA 3A60A 4XP3A 1LP4A 4S30A 1NY3A 4DEEA 1MRUA 2EB3A 3QYZA 3NYVA 1OZ1A 3BYVA 2BVAA 1Q8YA 1RJBA 1ZAOA 4BWKA 5HLNA 4BWPA 4X3FC 5EQYA 1YXVA 2BAJA 2Z60A 4BKJA 3BE9A 5EDRA 3UQCA 4F6SA 2PTKA 2W0JA 2AEGA 2VTSA 3TEIA 3FZRA 4D0WA 5D7AA 3LCDA 3P78A 3W16A 3UTOA 5IDNA 1JKTA 2PMOX 1IRKA 1F3MC 2OO8X 3BCEA 4KSQA 3VF8A 2PYWA 3F6XA