3F61A

Crystal structure of m. tuberculosis pknb leu33asp/val222asp double mutant in complex with adp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
290
structure length
271
Chain Sequence
MTTPSHLSDRYELGEILGFGGMSEVHLARDLRDHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIAAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPDSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase pknB
publication title Auto-activation mechanism of the Mycobacterium tuberculosis PknB receptor Ser/Thr kinase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 81
structure length 271
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f61A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f61A01
4B4LA 3R8UA 3TZ9A 3I0OA 3MY5A 4FIFA 4AN3A 4F9AA 3PZEA 2Y6MA 4J99A 3VJOA 1UNLA 3OHTA 5L3AA 5KBQA 4RX5A 3QHRA 3R22A 3BLQA 3NUUA 4FV0A 3UP2A 4HGTA 1GAGA 3SD0A 2R5TA 3HGKA 5AUWA 3B8QA 2PVLA 4Q9ZA 2FSLX 1OUYA 3R0TA 2VX0A 3E8DA 4QPMA 2WMUA 5TR6A 4X3FB 2C5NA 2H9VA 1XH9A 4X2JA 2ITTA 4CG8A 3MFSA 4XOZA 3IGGA 3ROCA 3MN3A 1Q8ZA 5FD2A 3QXOA 3HKOA 4R7BA 5L6OA 2OG8A 3V5LA 2ZM3A 3QWKA 3H9OA 1M14A 3ORXA 3PIZA 4E93A 5CAQA 4YJPA 4AOIA 5A14A 3R6XA 4ONAA 4QP6A 3WF6A 4FOCA 4RVTA 1ZMUA 4AA5A 2KTYA 1GZKA 1PXLA 4EK3A 4C4EA 3PLSA 4USFA 1APME 2NPQA 4RX9A 5AAFA 4C2VA 3N4UA 4CV9A 4RA5A 4AA0A 2C6KA 3MPTA 2WU6A 2HW6A 1A48A 4ZS4A 2OIDA 4FKVA 4GKIA 2WZJA 4DEDA 5GZAA 5EW8A 5HG7A 2YJRA 1J1BA 1OMWA 4F1OA 4DAWA 3ORIA 5HG8A 2HZIA 3DJ5A 4ANMA 1RDQE 3GB2A 2VTMA 4C34A 3F6XA 5A9UA 2PMNX 2UV2A 2R2PA 1G5SA 3RAIA 4CKRA 2QKRA 2WMXA 3DY7A 2XCKA 3A7HA 3T9IA 4ZEGA 3UODA 4CSVA 5A54A 3CGFA 3AXWA 3MS9A 3UC3A 5IUHA 2IZUA 3DK6A 3LAUA 3N51A 5AIKA 3TG1A 2W1FA 3CTQA 1YWVA 4FTTA 3VBWA 4V04A 3PIXA 4ZS0A 5CT7A 4Q9SA 3B2TA 5E7RA 1H24A 3WARA 4PL3A 3HX4A 3E93A 2RF9A 3OY1A 2GQRA 3FBVA 4FZDB 3UQCA 2XBJA 3NR9A 4W8DA 2QURA 4KSQA 3C13A 2X9FA 4ZSEA 2AYPA 3JYAA 3MTFA 2QOFA 3VUTA 4C4IA 3QQUA 4IQ6A 2C6TA 5K9IA 5E8XA 3AC2A 4WRGA 3FL4A 2ESMA 4M12A 3IONA 2CCHA 3W8LA 3DBQA 2R3QA 4ZMFA 1QPCA 1H0VA 2X6DA 5I9XA 2WB8A 2ITVA 1P5EA 2ZB0A 3LCKA 5M08A 4H3QA 1UWHA 4D1ZA 5HTCA 4B8LA 1WVXA 3E3BX 1REKA 4EHGA 2XVDA 2V5QA 3VQUA 4YNEA 1OL7A 3MH0A 4FK6A 2OXYA 2ETRA 3AG9A 2XK4A 1JNKA 4EOIA 2VTTA 3BI6A 4JQ7A 3FMNA 3EKNA 4HOKA 4LUDA 2BVAA 4OTPA 3MY1A 5CNNA 3RTPA 4ACHA 2HZNA 3L9NA 2XA4A 4TNDA 4K2RA 1XQZA 3RI1A 3BYVA 2I0YA 4DLIA 4UZHA 4XNEA 3BYSA 3F9NA 3P0MA 3QRUA 2FGIA 4JDHA 4TKSA 3UPZA 3I5ZA 2CLXA 4GT4A 4PF4A 4R3CA 1NVSA 4G3GA 3LLAA 1NVRA 2ZV7A 1AD5A 4IZAA 4UV0A 3Q4ZA 2X8IA 4AZEA 4Z55A 5IUGA 3EIDA 1J1CA 5M55A 2WOUA 3R21A 5AP1A 4OTQA 4BDIA 3KL8A 5CQUA 4MD9E 5JMSA 3OT8A 4CT1A 3OROA 5A46A 2GNIA 3GP0A 3DBDA 5EW9A 2UW3A 3TI1A 2GS7A 5DPVA 1YXUA 5M4CA 5FTGA 4CTCA 5HLNA 3EZRA 2WEIA 2EUFB 2X4ZA 2HY81 4QMOA 2WMVA 4U81A 5FG8A 3H0YA 5L2WA 4UXQA 3AOXA 5ITAA 3G33A 2X2KA 4RVMA 1Q4LA 3O17A 3PSBA 2JDSA 4JRNA 2WELA 4MK0A 3QGYA 2UUEA 3G9NA 3BGQA 3I7CA 3FI3A 2X39A 3ERKA 1OVEA 1VYWA 2AC3A 3GUBA 5C01A 4D5HA 4RJ3A 4RC2A 4BCNA 3ZO1A 4ANNA 1ERKA 3QQHA 2XEZA 3W10A 2BDFA 2QI8A 4IC8A 3BELA 2JAMA 5D9HA 3IGOA 1URWA 2W17A 3BYUA 3HP5A 3I6UA 3PXYA 4FKTA 1U5QA 4I22A 4U44A 3QQGA 5DGZA 4BICA 5B2MA 2FYSA 4I92A 2WIPA 4O22A 2OXXA 4NW5A 4K6ZA 5GZ8A 3RPRA 2EXEA 3NUAA 4IVDA 4ZSGA 3FLZA 4PUZA 5LVPA 1U5RA 4CYIA 3TL8A 3OBGA 5KHXA 2UW8A 4DFZE 2YLEA 3L9PA 4EHVA 2J0LA 2ZVAA 1ZZ2A 3AT2A 4JX7A 4KRDA 4IFCA 2PVFA 3BV3A 4PY1A 4CFMA 2R9SA 2OXDA 3C5UA 1MQ4A 2C6DA 3IG7A 3OFMA 4IIRA 3UP7A 3ZONA 4O96A 4NJDA 3NUYA 3QTWA 2BRBA 4MVFA 4AGWA 5DR2A 4XRLA 3FPMA 3QYWA 1PXMA 2WQEA 4I93A 4TYJA 3ATTA 3Q4CA 5GINE 4YLLA 3S0OA 2YJSA 3K54A 2XKEA 1R1WA 3N9XA 1G8AA 2I1MA 4LRKA 4FMQA 5AMNA 1H1RA 3CD3A 5AUUA 1H01A 1W8CA 2CKQA 3DJ6A 4C33A 4FNZA 2IPXA 2QR7A 3R1NA 3KRLA 1SMHA 2RIOA 4E6AA 3TNIA 5EYKA 3PA3A 5F4NA 1PXNA 2R3OA 2R3IA 2CSNA 4M84A 1FPUA 4G5PA 5E90A 5H8EA 4AN2A 3ZZEA 4DH8A 5E4HA 4M13A 2OJFE 4AA4A 2VTIA 4AFJA 4FX3A 3B8RA 2BAKA 3PTGA 4QMWA 5I3OA 4DEIA 4EYMA 3V8TA 4QMTA 3E88A 3E5AA 4HCUA 3WYYA 5A4CA 2XRWA 3GXLA 3JPVA 3AD6A 4QMYA 3UZPA 4FV9A 4FL3A 4I4EA 2GHLA 5FWKK 5BX0A 5H8BA 2W0JA 3D5WA 3PWYA 3QBNA 5J1VA 4PDYA 4RG0A 4Y5QA 4BDHA 2YLFA 3DOGA 4ITIA 4ZTQA 3SW7A 5HVJA 4EOMA 3FZRA 3PFQA 1VJYA 4J97A 4ZIMA 1X8BA 4II5A 2IWIA 4F7JA 4XP3A 2RG6A 1XH6A 5IQHA 4Y72A 4F64A 5ETAA 3LFCA 1KE5A 2WQBA 4YHJA 3IK3A 4O83A 2NRUA 3PY0A 3NYNA 4XLVA 2VUWA 5H2UA 3QCXA 5BVNA 4KD1A 1H8FA 4RIWA 4IFGA 2ITNA 1IASA 3OY3A 2GFCA 5FTOA 4U79A 4UWBA 3PXRA 4FKRA 4FKPA 4WD5A 4DF3A 2XIZA 1U4DA 1WBWA 4IB0A 2WKMA 2PULA 2XJ1A 5CXZA 2HELA 4C7TA 3BHVA 3Q5IA 3TIYA 3ELJA 3KFAA 3UOHA 1LEZA 5HESA 3WZJA 4ZSAA 3VBQA 4HGEA 5JZJA 4IWPA 4RA4A 2QLQA 2QU5A 3DB6A 3JXWA 4QQ5A 3UIBA 3JVSA 4WIHA 2WPAA 3V04A 1KSWA 4FODA 1DI8A 4FTCA 1WBPA 2XK6A 4NZWB 3KXXA 5HIEA 5IA3A 5BPYA 5IKWA 3M42A 3QZHA 4FG7A 3PY3A 4ZY4A 2XIYA 1PMUA 3R71A 3TWJA 5A4QA 5L8LA 4O6LA 4AWIA 5C4LA 4KKEA 4O2PA 3NYXA 3QKMA 4O1OA 2IW6A 4S2ZA 3ROYA 3DNEA 4JR7A 4BZOA 5AV4A 5CEQA 5I9YA 3T3UA 4DE4A 4XCUA 4Q2AA 3Q6UA 3V6RA 2IW8A 1BYGA 2C3KA 2J6MA 4BL1A 4IHPA 2ITUA 4GRBA 4WKQA 4O84A 4O0TA 3OD6X 3E8CA 4IAZA 1AQ1A 3VHKA 5CU0A 3IKAA 3BLRA 3OS3A 5HNIX 4PP7A 2W1EA 2JD5A 5CSVA 5CZHA 4L46A 4O7LA 1PMVA 5AUYA 2XNMA 4RPVA 5T3QA 3DLSA 2VTAA 2VN9A 4G6LA 5CAUA 3EB0A 5AEPA 3ORZA 4DGOA 2Y4IC 3NW6A 4G1WA 1LEWA 4GMYA 4KKHA 5FXRA 4ZSJA 3MVJA 3C9WA 3FMEA 4U43A 2X7FA 5IQCA 3BQCA 5AWMA 5L2QA 4FT9A 4FTMA 4MKCA 5B0XA 3FHRA 2ITPA 3DBCA 2OZOA 3A99A 4QRCA 3WF8A 4X2KA 4RZWA 3WE8A 4O81A 3NYVA 3LFNA 4C02A 4E4LA 4FTOA 4HCVA 2P2IA 4GH2A 1P14A 2BUJA 3KF7A 2JAVA 5CF5A 3R30A 5TOZA 4BBMA 4D1SA 5KO1A 4BYJA 4D2SA 3LMHA 3LCDA 2YM7A 4O0UA 1XBBA 4ZJJA 2QOBA 1S9IA 3JS2A 2XH5A 3QQFA 4FVRA 4E4MA 1OBGA 4L6QA 4AE9A 2W9ZB 4YR8A 5L4QA 5TF9A 1CKPA 1YDTE 5BQ0A 3K2LA 5LOHA 3ZUTA 3FMMA 2BRGA 1XH5A 5JFVA 4YO6A 4IAIA 4CFWA 4L3LA 4XRJA 4L3JA 5AP3A 3LFDA 3U55A 4CKIA 4QMUA 3C4EA 3HDNA 4HZRA 5IA2A 3MA3A 2C3LA 3R63A 3NCZA 3SX9A 4IAAA 4BCJA 3KVWA 1FINA 4AU8A 3D83A 5B7VA 5EI2A 3SOAA 1UA2A 2UZDA 4O2ZA 5AM6A 2F2CB 2OICA 3JVRA 1M2PA 2Y4IB 3WI6A 4EH4A 2CGVA 5FEDA 3LFEA 2GNHA 2A27A 3OOMA 3R7IA 3HP2A 2Y4PA 4CEGA 4X6QC 3UZTA 5A6NA 3BBWA 1STCE 3UE4A 1YOLA 2W5BA 3O0GA 1P2AA 2WMAA 2J0KA 3PPJA 4FTQA 4QPAA 4DEAA 5LMBA 4XG2A 3NUNA 1ATPE 3BX5A 2YDIA 4X6RA 4Q5HA 4D9UA 4RC4A 2VGPA 2JIVA 3ZO3A 3A60A 3LXLA 2PZ5A 1H08A 2FSMX 2BALA 2FB8A 2VWUA 3IW4A 3VIDA 4FV8A 2XMYA 1KE7A 3QZIA 2WTIA 3GC0A 4NU1A 5J1WA 1OUKA 4JL9A 5BUJA 4LGHA 1ZWSA 1JKTA 3VN9A 4OAUC 4C4JA 3UO6A 5JGBA 3BHTA 3U87A 3NEWA 5I9WA 4BGQA 1NA7A 4WO5A 2RKUA 4X2GA 3F5XA 3NW7A 3C4WA 3IW5A 4WUNA 3TNHA 3VS1A 4TTHB 3PPZA 3QRIA 3LXPA 3EFWA 3VBTA 3F3TA 4BCMA 3SW4A 5EQPA 3A62A 4MXYA 4ASZA 3GI3A 4XYFA 3DCVA 3GU6A 3W18A 4XUFA 5TT7A 4FNYA 2UW9A 1L8TA 3A8WA 5DT3A 2VX1A 4F1TA 3R00A 4HCTA 5DT4A 3DS6A 2GQGA 3OXZA 4CMUA 4QTEA 3DTCA 1QMZA 4C59A 4ZAUA 2C69A 5JKGA 5HX8A 5BVOA 2HZ4A 1OPKA 3DXNA 2BIKB 3RAKA 4AAAA 3IOKA 1ND4A 2PVJA 4GUEA 3UQGA 2W96B 4BKZA 5L8KA 4E4XA 2VX3A 4OTFA 3VF9A 3MA6A 3BGZA 4W8EA 5C8KA 2G15A 2YN8A 2OBJA 3NRMA 4U5JA 4YC8A 4YGAA 2GQSA 5ICPA 3ZEWA 5GNKA 3L1SA 4BGHA 3GCQA 3VS0A 2KULA 3MIAA 4TYEA 5JT2A 5LWMA 1R78A 3FV8A 2UZUE 2CGWA 2BTRA 3R7UA 3ETAA 4G3DA 5CANA 3SHEA 3L8PA 5FEEA 4M3QA 4P5ZA 3UYTA 4CT2A 4W4VA 4PMMA 3UPXA 5IQDA 4XBUA 3NNVA 3ORTA 4NW6A 4U9AA 3SA0A 4PPAA 3RKBA 5I9VA 4C3PA 3EN5A 4GVAA 4R6VA 3O8PA 4B6LA 4IWDA 3CP9A 5DEYA 5DWRA 1UU9A 3KK9A 3PG3A 4ANLA 2W5AA 1JQHA 3F5UA 4FV6A 3RGFA 2WQNA 4LMNA 3KXGA 4YU2A 4MWIA 3R9DA 3F5GA 4O7NA 2RFNA 5EK7A 1WBOA 3HV3A 3TV6A 4L7FA 4ORKA 5J5TA 5G1XA 4QOXA 2QD9A 1B38A 2CPKE 3UNKA 1H1WA 3DKCA 3HUBA 3MW1A 3EYHA 4G5JA 4TT7A 3L9MA 5CI6A 3VULA 3QA8A 4FTRA 2XRUA 3DBFA 1XBCA 4XS2A 5L8JA 2ERKA 4TN6A 3RAWA 2WTKC 3QCYA 5KMNA 5M53A 2YZAA 5BYLA 5IH5A 4AFEA 1OI9A 3QZFA 2P33A 1UU8A 2UW6A 3D5XA 4EHZA 1O6KA 2ZM4A 1XJDA 3PXKA 3EQFA 1OIYA 4EHEA 4FE2A 2XYNA 4AQCA 5JK3A 4CRSA 1NXKA 4RIWB 2CNQA 4F65A 3GU4A 1E9HA 2B54A 3E8NA 4IX5A 2CNVA 3MESA 3A7GA 3ZFMA 5CVHA 4KBKA 4J8NA 4QD6A 2QOIA 1O9UA 4EC8A 1K3AA 4UALA 5M57A 2DQ7X 4IZYA 3QC9A 4LOQA 5FXSA 4BKYA 4L53A 4LQMA 4FL2A 2ITQA 2GHGA 4O21A 1WBTA 4EBWA 1JKLA 4FIEA 3GC7A 3OMVA 4JQEA 4NJ3A 1DAYA 4J8MA 2X0GA 3FC1X 3RBWA 2W4JA 4GK4A 3RP9A 3I6WA 2VTRA 3VAPA 1LPUA 4HNFA 2V7AA 1H25A 2PVRA 1YI4A 2OZAA 4Y73A 3U9CA 4EOSA 4XV2A 3SVVA 4TWPA 4MF0A 4X21A 4EJNA 4ZJVA 5HVKA 2H96A 5HHWA 4A7CA 1PHKA 3OZ6A 4EOQA 3FPQA 2PU8A 5L2SA 4JG8A 3NCGA 4WG4A 2RG5A 4DITA 5CALA 3KKVA 1HCKA 3OW3A 3KVXA 3R8LA 3DPKA 3D0EA 3P4KA 3PVBA 4LGDA 3O2MA 5FQDC 1YRPA 3JR1A 1CTPE 1R39A 5LVOA 2Y7JA 4APPA 2XNOA 1Q8YA 2HOGA 5L6PA 1YHVA 3LFQA 3UMWA 1ZAOA 3DAKA 4GEOA 4IX3A 4O7ZA 2WTKB 4C62A 3VS3A 5EQEA 5F94A 3UOKA 2X8EA 4KBCA 3QRJA 3DK7A 3QUEA 1WVYA 4HGSA 4J52A 2C5XA 4OR5A 5CLPA 4IW0A 3JY0A 2OH0E 1FQ1B 3AD4A 3P9JA 4N4SA 5CF4A 2XYUA 1ZMWA 5FTQA 2RFDA 1Y91A 2CLQA 3Q32A 3F3ZA 4H39A 2Z7LA 4F9CA 3F7WA 4DH7A 1H27A 2QOOA 4KKGA 3QALE 1J91A 4I5HA 5DMZA 1UV5A 2C1BA 2FA2A 1OIUA 1YKRA 2ZDTA 3HRBA 4JS8A 4GG7A 4L44A 3M1SA 4AG8A 4OW8A 4C35A 1M17A 1TQPA 2C6OA 4OTHA 3SG8A 2YM4A 4ERKA 3KEXA 2I0HA 3P79A 1FVRA 2X6EA 3QFVA 4BCHA 3CPCA 3DJ7A 3FUPA 4V01A 5DT0A 4LL5A 1BLXA 3LIJA 3OXTA 5HLPA 4EH8A 4BC6A 5E8ZA 5HBHA 3RALA 2QNJA 3FZSA 3PIYA 3W2RA 1Q62A 3V5TA 3VUIA 2H6DA 3ZXZA 3MYGA 2XK3A 2IW9A 4IAKA 3EYGA 4D2VA 1TVOA 4EQUA 4EL9A 4YTCA 3R8MA 1GY3A 3OWLA 4UYNA 4Y46A 3PZHA 5D41A 5HICA 4X0MA 3DU8A 4A4OA 3U6IA 1GIHA 3F61A 1YOMA 2R3FA 3MB6A 1OECA 2UW7A 3EN9A 3PJCA 4E6CA 4F08A 3LPBA 4YZ9A 2VD5A 2WTCA 3QYZA 4KWPA 4BDAA 2ZOQA 3DA6A 4D1XA 4JBQA 2F4JA 4XP2A 5BVKA 3FY2A 3ACKA 3ITZA 1PJKA 3TV4A 2UW0A 2XIRA 1JOWB 4PL4A 1DS5A 4HW7A 5FBNC 1M52A 2JIUA 4M0ZA 4ZZMA 5HE3A 3SV0A 5M06A 3PVWA 5DEWA 3ZEPA 3VS6A 3O8TA 2W1HA 3O8UA 3VS2A 3VS7A 1AGWA 4R78A 3C50A 3GC9A 4CFXA 2W4OA 1ZXEA 4DA5A 4TWNA 4YJRA 1QL6A 1XHAA 5KE0A 5IQAA 4M8TA 4GU9A 4DGGA 1YWNA 3AMAA 4RMZA 3ET7A 3ZS5A 3Q9WA 2H34A 4YJUA 3TZ8A 3PE1A 2QCSA 2BR1A 2O8YA 4ZY6A 5J7HA 3PWDA 3F3WA 3VWAA 4EH7A 5M4IA 3KULA 2VV9A 2WFYA 5EW3A 5DR6A 4DC2A 4PTGA 2OJ9A 2CN8A 2JFMA 4QMVA 5FUTA 3KY2A 5EDRA 4IC7A 4B99A 2YERA 5KZ0A 4RVLA 3TUBA 1Z5MA 3MIYA 1FGIA 3UTOA 1W98A 4RJ7A 4DEGA 4H3PA 3BRBA 4YZNA 3ZSIA 2VO7A 4F7LA 5BNJA 2JLDA 3HA6A 5DRDA 4HGLA 3EL8A 4LUEA 4FSZA 4MXXA 3H30A 4W4YA 4YZDA 1W84A 5ANJA 5FDPA 2F49A 4F7NA 1CSNA 3ZM9A 1U54B 1PW2A 2PE2A 4FIIA 5IQBA 4DFBA 4UB7A 5CVGA 4E8AA 1ZLTA 5IH6A 2YM6A 2NNWB 2HAKA 2GHMA 5LMKA 3MGYA 4X2FA 2WMTA 1KUTA 2OK1A 4D9TA 3VUGA 3UVRA 4EJ7A 2WQOA 2C68A 3HECA 4IEBA 4I5MA 1JSVA 4OT5A 4BHNA 2X2LA 4JBPA 1SNXA 4YPDA 4R77A 2VTLA 2QG5A 2WO6A 3LCSA 3T3VA 3DT1A 1VYZA 3R8VA 2B9HA 3PSCA 2XF0A 4L52A 2YITA 3K3IA 4PP9A 4O7WA 3UZRA 2XM8A 4EONA 4GS6A 3A7IA 4IVAA 4MAOA 3MVHA 2WXVA 3REPA 4RJ6A 4AXAA 3HMPA 3IQ7A 2I6LA 1Z9XA 4L01A 2ZYBA 3PA5A 4FT5A 4ZJIA 2HY0A 5DVRA 4IM0A 4UXLA 1ZYLA 4JI9A 4PPCA 4JAIA 4U6RA 1GZNA 4BIBA 5AP5A 5D12A 2CMWA 3QCQA 1ZARA 2R3RA 3IDPA 4EK8A 1Q61A 4QMNA 3V51A 4U45A 3VS4A 1CM8A 1OIRA 2YABA 2PMOX 5KZIA 3EQCA 1JLUE 3WYXA 1H26A 3RCDA 3UDBA 2J4ZA 2XBAA 5KX8A 4IB5A 2BZKB 2JDRA 5IQFA 4L42A 1SVEA 4IMYA 4MEDA 4UMQA 3MH1A 3FZOA 2RL5A 1P4FA 2VWBA 4M68A 4GYIA 3RHXA 3S95A 2ITWA 3UIXA 3R9RA 2J5FA 4FI1A 3Q6WA 4O0XA 5HTBA 3KXHA 3C4XA 2OW3A 3V8SA 4BBFA 1KE8A 5AUTA 2W1ZA 4DTAA 5ANGA 3IECA 4EKLA 4L45A 4AZWA 3TV7A 4DEHA 1VR2A 4QNYA 5CU4A 4IZ5A 4O0RA 4XMOA 5AX3A 5KMOA 4ITJA 4TWCA 3EZVA 2C0TA 3VS5A 4D55A 3EFJA 2CCIA 4FEXA 4GSBA 1DM2A 4GFMA 3HMOA 2R3PA 2Z7SA 3COIA 5CSPA 1O6LA 4WT6A 4JDIA 4ZLYA 4OBQA 2X2MA 1GZOA 3QUDA 4N70A 4ZP5A 1OKZA 3AC3A 2WTWA 5H3QA 5EFQA 1XKKA 2HIWA 2VTHA 2IVVA 4FV3A 2WMWA 4O6EA 5D10A 2XKFA 4P5QA 1OB3A 4IAFA 1H0WA 4XP0A 2QONA 3Q60A 3M11A 4KIKA 1QPJA 2PVMA 4K9YA 4IX4A 5EM7A 2IVUA 2YAKA 4H36A 3C51A 3FC2A 3MVMA 4BDFA 4A07A 4FEVA 1NY3A 1GIIA 5A4TA 4IB3A 1BL6A 2X81A 1UVRA 4O1PA 2Y6OA 3POZA 3SQQA 4ZSLA 4LYNA 3NWWA 3PXFA 4YSMA 2IG7A 2Z7QA 4UBAA 3FI2A 3ODZX 2YDJA 3IS5A 5DI1A 3FYKX 2YIWA 2OZAB 3IDCA 3G0FA 5LARA 3VUDA 4JXFA 3HEGA 4FZAB 4U7ZA 2YCRA 3LM5A 3H10A 3R2YA 4TRLA 4AOTA 4CRLA 3FXZA 3PP0A 1OL2A 5JN2A 4E7WA 5I9UA 4IZ7A 2XK9A 5IH4A 4TZRA 3ZO4A 3LMIA 2J50A 1M2QA 1PYXA 4QYGA 1SM2A 5AM7A 3SRVA 4C38A 3CD8A 1ZOGA 5CZIA 3UOLA 3LQ5A 2CDZA 4KIOA 4RBLA 4BIEA 2IJMA 4RSSA 3KF4A 4FGRA 3HDMA 4F63A 4H58A 3Q52A 3KU2A 1FVTA 4JRVA 3TNPC 3E3PA 4FGBA 5CAVA 3MSSA 5HBJA 1YI3A 2C5VA 2HW7A 4G2FA 4EZ7A 5BUEA 2YWVA 1I44A 3O50A 4ALVA 4XV1A 2G2IA 4B8MA 2XS0A 3RPSA 3FJQE 3V3VA 3LMGA 5J9YA 5M4UA 1ZZLA 4S32A 1SYKA 4CCUA 5E8UA 2GNGA 2W1GA 2F7EE 3LHJA 3NGAA 3EKKA 4WNKA 5CNOA 5CASA 4FA2A 2BZHB 4FIGA 5IQGA 2J51A 3H3CA 3KK8A 3OW4A 1FVVA 2W1IA 3MH3A 3Q5ZA 4XEYA 5EYMA 3WBLA 2X7OA 1V0PA 3EN6A 1IAHA 3BE9A 2WIHA 2P3GX 4AX8A 2OFVA 2VAGA 2ITOA 3LQ3A 4AACA 4FG9A 2WGJA 4FTLA 4RWJA 2PL0A 3GT8A 2WHBA 2UW5A 3CXWA 2Z60A 3PG1A 4G6OA 2H8HA 5IA5A 4XV9A 1Y8GA 2QOKA 4FV5A 4ZMEA 3EQBA 3IO7A 1PMNA 4MX9A 4S34A 3ZC6A 3NIZA 2C4GA 3EWHA 5CU3A 5LVNA 4BTKA 3PVGA 4H1JA 2A19B 1U46A 3P7CA 5HTIA 4E4NA 2E9VA 3HL7A 2VTPA 5E8VA 2OWBA 5M09A 3CCNA 2IZSA 3R83A 4MXCA 3QAME 1ZYJA 2QC6A 2YHVA 4QP9A 1P4OA 3GQIA 3L8VA 3QC4A 2GTNA 4DGNA 3HUCA 1W0XC 5A3XA 4N0SA 1BUHA 5BMSA 5AUZA 4U40A 2BKKA 4C36A 5LMKC 4G6NA 3KMWA 2E9NA 2UVYA 4PRJA 3EQRA 3ZOSA 4O7RA 5E8TA 3CR0A 4BIDA 5CQWA 4FTKA 4GFOA 4MNEA 4D28A 3DFAA 3BGPA 3TDVA 5AR7A 2XKCA 4C3RA 4J71A 4BGGA 4GK2A 2OKRA 3IOPA 4FKQA 4QP3A 5CY3A 2F2UA 3OT3A 4NH1A 4D2PA 5IQIA 2R0UA 4CG9A 2LGCA 2O2UA 2W1DA 4QP4A 4HPUE 5M07A 1CMKE 2J5EA 4G16A 4TNBA 3ZLWA 5FM2A 4I0RA 3ALNA 4MYGA 2GNJA 3U51A 4AS0A 3ODYX 1R0EA 1UNHA 3NLBA 5C8NA 3KULB 5IMEA 3LOKA 3FSFA 3R01A 3DQXA 3R9HA 5JH6A 2C3JA 4EH5A 4EH3A 4JVGA 4DBXA 2R3LA 3MJ1A 4UEUA 4AE6A 4QTCA 5GJGA 2Z2WA 4IANA 3UBDA 4JBOA 4RQVA 3S00A 3VQHA 2BHHA 2W99B 2XKDA 3HV4A 4XG4A 2FSOX 3LQ8A 4EZ3A 4OTRA 1B39A 3FL5A 2HXLA 3OXIA 3R9NA 4YUQA 3LW0A 2UVZA 2Z02A 3D9VA 3C5IA 2PZIA 1Q3WA 3O7LB 4CNHA 3WF9A 3ZO2A 2BFXA 2I0EA 4YLJA 4C37A 1NT2A 3FY0A 5E1SA 1JPAA 3JY9A 3NIEA 4D4RA 3KA0A 4RFZA 3RPOA 3BHUA 4OBOA 4YJOA 5H9BA 3VUHA 4FK3A 3W1FA 4O7SA 2FVDA 3NUSA 2R3HA 3FZPA 3TT0A 4BI1A 3NS9A 3OC1A 3QUPA 4FV4A 2WAJA 2YM8A 2C47A 4H3BA 4OT6A 4V05A 4UY9A 3POOA 5CU2A 4HVDA 4Z16A 5HLWA 3H9FA 3KB7A 5G6VA 4MQ2A 5FBOA 5H8GA 2EXMA 1TQIA 1DI9A 3R02A 4AZTA 2IN6A 3OEZA 3D7ZA 4AGDA 2QVSE 4QTDA 4MD8E 2IVSA 4IACA 4Y83A 2IZRA 5J5SA 2XIKA 2XCHA 4BKJA 4Z3VA 4ZK5A 1U59A 1WZYA 5CU6A 5AP7A 1NW1A 5J95A 1ZY4A 2C0IA 3RK7A 4NT4A 4FEUA 5CT0A 5HORA 2V55A 3CQUA 3LJ2A 4IVCA 4WNMA 5HCYA 4AGUA 3NPCA 4ACGA 4GT3A 2YAAA 3WF7A 2YIQA 4O0SA 4U0IA 4YO4A 3FLWA 4G34A 2ERZE 3F2AA 4AW2A 4ZLOA 4RLKA 4A9UA 4C4HA 1E1XA 2OGVA 3HA8A 2HCKA 4M67A 5D7VA 5BVEA 3LFSA 4C4GA 2BILB 1YI6A 4HVHA 4Z9LA 5CSXA 4F6SA 4UMRA 3DDPA 3QLGA 4KIPA 4LV5A 1CKJA 1H1SA 4R8QA 1Q97A 4FUYA 4IJ9A 3ZH8A 4ZTNA 4PDSA 4WG5A 1GNGA 4E5BA 4NTTA 3MB7A 3KGAA 4D0XA 3CC6A 3CLYA 2CKEA 2W4KA 2CJMA 4PPBA 4UMTA 3BEGA 4GFGA 3DK3A 4UWCA 4M0YA 4I6HA 5HE2A 4RJ4A 1SZMA 2UZWE 5JQ5A 5KNJA 3NNXA 3PE2A 4CQEA 4QMZA 4NM5A 3TZMA 2SRCA 2G9XA 5CEOA 3RVGA 1XH4A 5AR2A 5K3YA 4KUJA 5IEYA 4IXPA 2V7OA 5JQ8A 5C26A 1Q8WA 2QOHA 3KN5A 3RAHA 3CEKA 3TKIA 2WMRA 3Q4TA 3AQVA 2A4LA 3GU8A 4JNWA 2V62A 3U9NA 3F66A 5HE0A 3ZFYA 3N4TA 5HZNA 4IWQA 3G5DA 5AA9A 3M2WA 4ENYA 4KA3A 5EOLA 5E8WA 4ANSA 3KMMA 4FSWA 3TN8A 4L68A 3ZU7A 5AX9A 1JKKA 4XX9A 2ZAZA 5BYYA 1XO2B 4F70A 3R7GA 3Q96A 4QT1A 3C0HA 4L9IA 3W2PA 4CFUA 5FM3A 5GJDA 3FDNA 4ZXTA 4KIKB 5KMKA 5L2IA 3E8EA 4XG7A 4NYEA 5I0BA 3BWFA 4BHZA 3FKLA 3G0EA 4ZTRA 1Q8TA 4FG8A 3HMMA 2PYWA 3G6GA 4XG3A 5CENA 5JFXA 3A7FA 4CV8A 2YA9A 4N6ZA 4JLCA 3KQ7A 2VWVA 4LI5A 3PSDA 2O64A 2C5YA 2E9OA 3I81A 3QX4A 1E1VA 1WCCA 2EXCX 4BDJA 3D15A 1H00A 3R7YA 4LMUA 3FKOA 5LVLA 3ZDUA 1U54A 4BCIA 5D1JA 5HG9A 3AC8A 4FSQA 4FTJA 3WZDA 2GNLA 3OG7A 1Q3DA 2QU6A 3G51A 2WOTA 3U4WA 5HD4A 4M7IA 5EDPA 2R64A 5L2TA 2ETMA 3MH2A 3QTXA 3SDJA 1K2PA 1W7HA 2WTVA 5LCKA 5KBRA 4OAVB 4GUBA 4PNIA 4G3CA 4J96A 2QHMA 4F4PA 4CKJA 4AZFA 4S30A 5HD7A 3AGLA 4EC9A 5ANKA 3SRVB 1S9JA 5HI2A 3LFAA 1PXJA 5C1QB 4RWKA 4NSTA 3MPAA 4NFNA 2PMIA 3RCJA 3BLHA 2G2HA 4EUTA 5J9LA 1EH4A 2FO0A 4ITHA 3QKLA 4HYUA 3F88A 1XH8A 4WRSA 1VZOA 3MV5A 2PVYA 4M69A 4NKAA 3ZM4A 1V0OA 3GEQA 3HNGA 4EH2A 5GIPE 3BU5A 3F69A 4YJVA 2JDOA 4BWKA 4FT0A 3QWJA 3FXWA 4FSMA 4CD0A 2OH4A 2EB2A 4RJ8A 3ENHA 2UZLA 3OEFX 2PVKA 4DTKA 3N4VA 5IEXA 5D7AA 1YXXA 3HMNA 2QO2A 4KSPA 4KBAA 2PSQA 3LXNA 3R1QA 5DN3A 2OU7A 1ZOHA 4KB8A 3TCPA 3PYYA 2Q0NA 5F95A 5CAOA 4QP7A 3TXOA 4R5SA 2VO0A 4R3RA 3VBXA 3O23A 2B55A 2R7IA 1ZYSA 3TNWA 3AMYA 3D94A 4P2KA 1YDRE 3GCSA 2VWZA 4U42A 3BZ3A 4U8ZA 3D7TA 4G17A 4QYFA 3VW6A 5F20A 4QMXA 5KUPA 2UZVA 3HZTA 3MWUA 4BDKA 1K9AA 4R1YA 3GENA 4B0GA 5M56A 4C3FA 2PUPA 4LRJA 3CKXA 3QZGA 4L43A 4NTSA 2OIBA 4EK5A 3CBLA 4F6WA 5ANEA 3EFLA 5M44A 3P7BA 2YIXA 3W32A 5CEMA 3FZ1A 2B7AA 4IADA 3G6HA 3UG1A 3ULZA 2O63A 1HOWA 4O7VA 3UNJA 4IX6A 4AZVA 5F1ZA 4M66A 1XWSA 3QCSA 3GOPA 4NCTA 4QO9A 3ZRLA 3MTLA 2J9MA 4QNAA 4M14A 5BVDA 4O38A 3CKWA 4G3EA 3RNYA 1V1KA 2PHKA 4XV3A 2X8DA 5DIAA 4BDGA 4IDVA 4RVKA 1Z57A 4DLJA 3BHYA 4PMPA 4WSYA 5LVMA 4JX3A 5J87A 2BAQA 4MNEB 4IVBA 4QMQA 3CJGA 3CS9A 3V6SA 1PMEA 4MBJA 4K0YA 3CY3A 4ID7A 4RX8A 1QPDA 4ALUA 4DGLC 3F2RA 2C30A 4WA9A 1OBDA 3GFEA 3MDYA 4L8MA 4RJ5A 4UMPA 4UMUA 3HV6A 3OVVA 4B7TA 3TNQB 4JIKA 5JRSA 4I5CA 3OCGA 1R3CA 2R3NA 1YHWA 2YZLA 1Y6AA 2G1TA 2R3JA 2ZV2A 3GCPA 3I7BA 4I4FA 1OL1A 3BV2A 4L67A 3BHHA 5AV2A 1OGUA 5HKMA 4E5AX 4F9BA 4DFUA 4G9RA 2I0VA 2WMBA 5BVWA 2QO9A 3W55A 1SVHA 4FIJA 1KV1A 4QMSA 3QQKA 4FV7A 1OKVA 2WMSA 2YEXA 4U80A 3W8QA 4FSTA 2UZBA 4HZSA 4P7EA 4D2TA 4TYIA 1WMKA 5EDQA 2XB7A 5J8IA 3C0GA 3E64A 4XHKB 5IA4A 4BWXA 2E2BA 5E91A 4NL0A 4Y95A 1YWRA 2B9FA 3Q04A 3S3IA 2OJGA 2HZ0A 4FKWA 4XH6A 4D4SA 4P4CA 2BRNA 3LJ0A 4A9SA 3HAMA 4W9WA 4ACDA 4XG9A 4GG5A 3NVKI 1UWJA 3V5JA 5AAGA 2IVTA 4HVSA 4HVGA 1FBNA 1JWHA 3GGFA 3O96A 1JSUA 4AUAA 5A6OA 1KE9A 4WBOA 4BVUA 3IW6A 3ACJA 4JJRA 5IISA 3OWJA 3OWKA 3Q2JA 4I20A 3QTQA 4J95A 2YIRA 3UVQA 4C61A 3VJNA 3MFTA 4LOPA 3O51A 3EOCA 4O7YA 3NAYA 2C6MA 5ANDA 2C3IB 1G3NA 3A7JA 1JVPP 4XOYA 3RM6A 2EB3A 2G2FA 2XK7A 3F3VA 3PJ8A 3Q4UA 5F9EA 4KS8A 2ZJWA 1T46A 3QQJA 4FZ7A 5CSHA 1Y6BA 3BIZA 4JQ8A 3EH9A 5HU3A 2XIXA 3F7ZA 3S1HA 2C6IA 3QGWA 5TKDA 4FV2A 4X3FC 2PTKA 3D2IA 3WZUA 4E20A 2OSCA 3SG9A 2J0MB 4H1MA 4EI4A 5EKNA 2HXQA 2YDKA 4ASEA 1BI7A 3NSZA 4E1ZA 5EH0A 1B6CB 3LCOA 4ZOGA 2J2IB 4BF2A 5K4IA 3LZBA 1GOLA 2ZV8A 3P23A 2GDOA 4E6QA 4F9WA 1OZ1A 2JEDA 2OF2A 3HV5A 4TYGA 3ID6C 4LL0A 1IA9A 4H05A 2PMLX 4B9DA 1OITA 2VWWA 2XUUA 4BDBA 4EOLA 4YC3A 1RE8A 4RGJA 3FI8A 1Q99A 3UG2A 4AP7A 4BTJA 4KS7A 2W06A 3QTSA 2PE0A 4EH9A 4K77A 4FV1A 4HNIA 3BKBA 3FLNC 4GIHA 3CIKA 3CY2A 5DRBA 5AV3A 4ACMA 3DB8A 3UNZA 2Z7RA 4NFMA 4RWIA 4D5KA 3D5VA 2O3PA 1Q24A 3OP5A 4DH3A 5HNGA 1H4LA 3LE6A 4IJPA 4M97A 4RT7A 4UWYA 2WTDA 4DFXE 4R3PA 4LRMA 3MY0A 4O27B 3EQHA 3V01A 5IDNA 2YCQA 4ANQA 2AC5A 2NRYA 3TJCA 2BTSA 4LOOA 2XP2A 3I0QA 4O0WA 3VC4A 4EKKA 5KKRC 3KMUA 3DBEA 2BCJA 5DNRA 4O0YA 2YIYA 2C5OA 3KXZA 3NUXA 5DFPA 3UIMA 3WILA 4E3CA 2VTJA 3EMGA 3BU6A 3JUHA 3NX8A 3KXMA 2P55A 3QD2B 3MI9A 2BROA 3PJ2A 5J79A 3RZFA 4WNOA 2VTQA 2R0IA 2GTMA 1CKIA 3MPMA 1PXIA 2UZEA 3C7QA 3OCSA 2OJIA 4RIXA 4CCBA 3R04A 1OKWA 3CQEA 1IAJA 5AUXA 3U54A 3NUPA 1F3MC 2QOLA 5KMJA 4CLJA 2A1AB 3HLLA 4BI2A 3SXRA 4BCFA 4EORA 1IA8A 3C1XA 1TKIA 4DN5A 4FTNA 4G3FA 4YSJA 4TYHA 3NW5A 3D14A 1GZ8A 3W2OA 4GL9A 4AT3A 2E9UA 3KRJA 4YBKA 3R1YA 1VEBA 1PXOA 3RM7A 4R5YA 3QHWA 3R1SA 1WBSA 4FVQA 4ZTSA 5C4KA 4C4FA 4NCTC 4F1MA 3VVHA 5AAEA 4YMJA 4IM3A 4MXOA 1DAWA 4M69B 4TY1A 5KKRB 1KV2A 2GU8A 3FLYA 4P90A 3QF9A 3DQWA 3U6JA 2REIA 1OKYA 3BU3A 3DDQA 4YNOA 5DHJA 2R3KA 2ONLC 1WBNA 2ITXA 4V0GB 2BDJA 5IU2A 3RHKA 3QQLA 2WU7A 4GJ3A 3QTRA 2PZRA 4TXCA 3TKHA 5ETIA 2PZPA 3E87A 3TZ7A 4BDCA 5D11A 2DWBA 3ZMMA 2C1AA 4MQ1A 4DG2E 3FLSA 4MBLA 2PE1A 3GU7A 5ANIA 2GPHA 4ERWA 5BUIA 4YTIA 1H1QA 3ZLYA 3PRFA 4UZDA 4CMOA 3COKA 3TUDA 5IA1A 3GBZA 2LAVA 3UO4A 4DH5A 4Z7HA 1FMOE 3ORLA 4NIFA 3ZLXA 5FP6A 2Y9QA 3D7TB 4S33A 4WHZA 4YBJA 3DXQA 4A4XA 3CQWA 4DGMA 4FKLA 3A61A 5EI6A 3A4OX 3OUKA 2YCFA 3P86A 5CEKA 5M51A 5IA0A 3UJGA 5KMIA 4HYIA 3ZCLA 4CTBA 2YM5A 2BAJA 2JDTA 4AOJA 1FMKA 2JBPA 2XJ0A 4QQTA 1Q41A 3COMA 4OBPA 3DNDA 4JT3A 4UYAA 3R8ZA 4PTEA 4DT9A 2BMCA 5C03A 4CFVA 4EH6A 4JR3A 2B4SB 3S2PA 3QTIA 3W2QA 2J0IA 4I6FA 3ZFXA 5JFSA 3R2BA 3EQDA 3LFBA 5HEZA 2DYLA 3AT3A 4ZY5A 1A06A 4HJOA 1H28A 3GCUA 2OLCA 1UNGA 4QYHA 2XZSA 4OTDA 2XJ2A 3FYJX 4PV0A 3ZLSA 4UX9A 3GFWA 1M7QA 3HYHA 1OL5A 4FKJA 3PP1A 1BI8A 5DLSA 4YURA 3HV7A 3PXZA 5KHWA 5GHVA 5CSWA 1JBPE 2OFUA 2O0UA 2XNBA 2BIYA 4XG6A 3VRYA 4EK4A 1KOAA 5HG5A 5LQFA 4BWPA 3HVCA 2P0CA 4WBBB 3Q53A 5B2KA 4R7IA 5IUIA 4RIOA 4DBNA 2RFSA 3FQSA 3GVUA 2GMXA 4LGGA 4ANBA 2B9JA 4BZNA 5HVYA 1BL7A 5L6WL 3P78A 4PTCA 3LM0A 4BBEA 5HQ0A 3VUMA 2FH9A 1J3HA 2JDVA 2JKQA 3FQHA 4MTAA 3PDTA 3EQIA 3G15A 3DZQA 4I0TA 3DKOA 4FSRA 4W4XA 4RIYA 5CTPA 5EM5A 5IZFA 3FMHA 5EG3A 4C2WA 4JDKA 1ZRZA 5FXQA 3ZUVA 4Y85A 3R8PA 3VRZA 1RJBA 3R7OA 3LKMA 4A9TA 2F7XE 2W1CA 5JZNA 1YXSA 2Y8OA 2XNGA 2I7QA 5CYIA 4K33A 5GIOE 5JEBA 2PVHA 4YTFA 3T9TA 4FEQA 4FZFB 4U97A 5M4FA 4MD7E 2QODA 4M15A 3CGOA 2HWPA 3CSVA 3ALOA 2RSVA 3E7OA 3H4JA 2VO3A 1BMKA 4JBVA 2UZNA 1QPEA 4U3YA 4BCGA 4BZDA 4FIHA 4D2RA 2RFEA 4YZMA 3TTIA 1ZMVA 5DBXA 4DINA 4J98A 3UVPA 4NM0A 4AT4A 3PVUA 4I0SA 3ZDIA 4PMSA 2VWXA 3C4CA 3DAEA 5EI8A 2QR8A 3SXFA 5DOSA 4OLIA 3BEAA 5AIRA 2DUVA 3DTWA 3VHEA 3G2FA 4BCOA 2IZTA 1URCA 2QQ7A 4R1VA 5ETCA 3WZKA 3ZHPC 4FKGA 4D4VA 5CI7A 3L9LA 4NK9A 4EBVA 1YVJA 4O86A 1ZY5A 5LMAA 4LG4A 3PLAE 1MRYA 2EWAA 1L3RE 3EFKA 3EHAA 4DTBA 4PMTA 5DH3A 4TL0A 4USDA 5HCXA 1JSTA 3SKCA 4CQGA 4D58A 4L00A 2C6LA 2IO6A 4JIAA 3RK9A 3SLSA 3RMFA 4RQKA 3Q9XA 3IW8A 5GZ9A 4DG0E 4EWHA 3VBVA 3QTZA 3P7AA 4YJTA 4O82A 2VTOA 4WOVA 1YDSE 2GNFA 4FSYA 5AP6A 4F0FA 4BTFA 3Q2MA 1PKGA 2O5KA 3EN7A 3V5QA 5HO7A 4A9RA 4BTMA 4J53A 2CKPA 4IE9A 3Q3BA 4JG7A 3BBTB 4MBIA 5IG1A 4I21A 3FZTA 1IRKA 1PKDA 4DEBA 3I60A 5J7BA 3NAXA 4FSNA 5KMMA 2FSTX 3E63A 1M2RA 4FF8A 4YHFA 4YTHA 4PWNA 4LM5A 3CJFA 3SC1A 3K5UA 1PRYA 2BHEA 2BZJA 3E92A 4YZBA 3TKUA 3D2KA 2RGPA 3O71A 1PY5A 1KWPA 5FP5A 2PUIA 4IBMA 5IMXA 3QLFA 2BRHA 3NYOA 2ITYA 3QA0A 5CWZA 3ENMA 5HBEA 4CFNA 2J7TA 5AV1A 3ZBXA 4FT7A 3FHIA 4OTGA 3WIGA 4BI0A 1YXVA 2WTJA 2XK8A 2PPQA 4EUUA 4RZVA 1IG1A 4FKSA 3AGMA 4WNPA 3WOWA 4BDDA 3W2SA 4BCQA 5HX6A 3EQPA 2CGUA 2B1PA 2YACA 4FTUA 5CAPA 4EOPA 2B52A 3NNWA 3V8WA 3I1AA 4I6BA 5HCZA 3SGCA 1W83A 4E6DA 3WZEA 3A4PA 3AC1A 4GKHA 4EYJA 5EHYA 3FQEA 5HO6A 3OBJA 4DCAA 3T8OA 2WD1A 2V0DA 4I3ZA 4PDPA 1XR1A 3UC4A 4X7QA 3QKKA 3HMIA 2JBOA 3KREA 4CXAA 4RIXB 4O91A 3OTUA 3IPHA 2VU3A 5DE2A 3TM0A 3LFFA 3DKGA 3F2NA 3ORMA 2A2AA 2JKKA 4ZTMA 3W33A 4CZTA 4AN9A 2WNTA 4K18A 3DLZA 5EHLA 3C4FA 5FRIA 1OM1A 4QTAA 1RW8A 1WAKA 2E9PA 2ETKA 4IB1A 4ZTHA 5IDPA 3QL8A 4TYHB 4OTWA 3R7EA 3ZRKA 3UGCA 2YCSA 3Q9YA 4U41A 3RINA 4EOJA 4G9CA 3R7VA 4IAYA 4KRCA 5DR9A 3TUCA 4DG3E 3NNUA 4G31A 3A8XA 3VW8A 5CEPA 1A9UA 1PXKA 3PPKA 3NMUF 4C8BA 3F3UA 4QMMA 3KN6A 3D4QA 2FUMA 3OOGA 2QKWB 5AR4A 2HYYA 3ZSHA 2R3GA 4BCKA 3ORKA 1YHSA 1LP4A 2BZIB 4U3ZA 3ZTXA 3DV3A 4I1ZA 5I9ZA 4FZ6A 4WUAA 5GJFA 3ZSGA 5TE0A 2WQMA 4I5PA 4RX7A 4AW1A 4NEUA 4QMLA 2VRXA 4CZUA 5HO8A 5C27A 5DYJA 4GCJA 3ANQA 4KIQA 4ARKA 2QO7A 3FE3A 4XJ0A 1KOBA 2XM9A 3UO5A 2VWIA 3AT4A 3E7VA 2F9GA 3G9LX 2VWYA 5K0KA 4XLIA 4YHTA 4O0VA 5LCJA 1YOJA 5A4EA 4KINA 2VGOA 1Q5KA 4C0TA 4OGRA 4CZYB 5LXMA 3BYMA 3IW7A 4Y5HA 3CTJA 3MVLA 4RWLA 4CMTA 1PF8A 1J7LA 5KCVA 2WEVA 2PUNA 1Y57A 4YC6A 4FBXA 3DKFA 4PL5A 5FLFA 4GVJA 4BCPA 4NIFB 3RPVA 4I41A 4F9YA 4GW8A 3P08A 5AR8A 2CKOA 4PDOA 2JGZA 4FL1A 5JFWA 5E9EA 4FC0A 1JKSA 4FICA 2GSFA 4YP8A 1H1PA 4FUXA 2XEYA 4LV8A 4I6QA 5JGDA 1QCFA 4FKUA 3ORPA 5JSMA 1LR4A 3II5A 3SXSA 3ANRA 4NUSA 4D2WA 3RZBA 3U4UA 5A4LA 4BFMA 1M7NA 4E26A 4DH1A 3PXQA 4CLIA 5I3RA 2OIQA 2HENA 2R4BA 2BDWA 2JKOA 3S4QA 4DFLA 4ZLZA 1IR3A 3AMBA 2V22A 3VO3A 4MF1A 2WMQA 3FMDA 5EYDA 1KE6A 2ZM1A 3ZUUA 3K5VA 3P1AA 4ALWA 3PJ3A 1PYEA 1LUFA 5C9CA 5CEIA 4RRVA 2PZYA 2CHLA 3U8WA 4F0GA 1ZOEA 1I09A 3R28A 4Z7GA 2DS1A 4MH7A 4X3FA 3COHA 4LFIA 5AUVA 4ANOA 4DCEA 3KCKA 2UW4A 3AC4A 4MXAA 5EM8A 5BMMA 3V5WA 1YXTA 4EOKA 4TWOA 3I4BA 1NVQA 4HYSA 4I24A 5AV0A 5HGIA 3NDMA 4APCA 2A0CX 2P2HA 1J7IA 2PVNA 3W2CA 3MFRA 3FEGA 5CX9A 2W7XA 5EKOA 2OF4A 3RK5A 4BDEA 4XG8A 1ZYCA 4KNBA 4ZZNA 3QD3A 3THBA 2R7BA 3OCTA 4QMPA 4AZSA 2PWLA 2O65A 5T68A 2I40A 4MWHA 2XNPA 2W9FB 5IEVA 3O7LD 1UKHA 3C0IA 2XNEA 2Q0BA 4BRXA 1BX6A 3LCTA 4CYJA 4K8AA 1SNUA 2GFSA 1MRUA 5CF6A 4ASDA 1JAMA 4QP2A 2BKZA 2VZ6A 3QXPA 4GV1A 4XBRA 2YISA 4RIYB 4IWOA 5E1EA 3UOJA 2JC6A 3HAVA 2YM3A 3OUNB 2OJJA 5IPJA 3ORNA 4JG6A 5HOAA 3PA4A 4GU6A 2OI4X 5DG5A 4FR4A 4ASXA 4IM2A 2B53A 4D0WA 3RPYA 3C4ZA 4QP8A 5AP0A 4AT5A 2EVAA 4A06A 5AA8A 2YWPA 3V5PA 3GU5A 3FWQA 3MFUA 2Q83A 2CGXA 4NM3A 4FTAA 4FYNA 3QX2A 4F0IA 2R3MA 3QRKA 4AF3A 3H9RA 4V0GA 3RWPA 4F09A 1ZYDA 5AP4A 5JRQA 4L3PA 3QD4A 2GS6A 3P5KA 4FVPA 3F5PA 4GIIA 4NKSA 1WVWA 3H0ZA 5LJJA 4F99A 3UIUA 3BCEA 5K4JA 2VNWA 4F7SA 5FGKA 2W05A 3R9OA 4JDJA 2PUUA 4I23A 4AGCA 5AADA 1GJOA 5CF8A 2ZV9A 3OTVA 4I94A 4FTIA 4NWMA 1YQJA 5FEQA 2QG7A 3WF5A 3SOCA 4E73A 3G90X 4RFYA 3EN4A 2W5HA 3KCFA 3K3JA 1RQQA 1O6YA 4CGAA 1CDKA 4QP1A 2EU9A 2ACXA 2F57A 3ZBFA 3MJ2A 2G01A 3AD5A 3PRIA 4K11A 3D5UA 5EOBA 4FNWA 3EQGA 3ULIA 4A4LA 2PY3A 5JGAA 3VF8A 4AW5A 2VNYA 4S31A 1OPLA 2QLUA 2CN5A 2YFXA 3LXKA 4ZTLA 4F6UA 4DHFA 5ACBC 4DEEA 4JAJA 4WSQA 1MRVA 5HIBA 1XH7A 4EWQA 4W9XA 1REJA 4GYGA 3FMJA 3GCVA 4BB4A 4PNKA 4YLKA 3OF0A 4BN1A 3FI4A 1H07A 4GK3A 3ZZWA 3BPRA 3QTUA 4MCVA 5LWNA 4N57A 2UVXA 3DAJA 3KRXA 2ONLA 5E92A 4UN0C 2JFLA 3FXXA 3L8XA 3MBLA 3VUKA 5AFVA 5K5NA 2JIIA 4YJNA 1BKXA 4X3JA 2BRMA 4C58A 3R73A 2BFYA 2ZB1A 3VNTA 2OO8X 3WE4A 5K5XA 3OCBA 5E8SA 3LJ1A 2HK5A 2X9EA 3W16A 5E8YA 4FYOA 2J0JA 4D4YA 2F7ZE 4TPTA 3A2CA 1UU3A 2GS2A 4KABA 3SAYA 2NO3A 4USEA 3TEIA 2C0OA 1PXPA 1WFCA 4WG3A 4CVAA 1T45A 3ZRMA 3GOKA 5T6KA 1F0QA 5AP2A 1GIJA 3QD0A 3FKNA 4O7TA 4FT3A 4NM7A 4N6YA 1FGKA 4DFYA 5EQYA 4J7BA 3DGKA 4HYHA 5CS6A 3VBYA 3GC8A 5K0XA 2ZMCA 3DXPA 3KRWA 1YW2A 1UKIA 5HIDA 4Y8DA 4EZ5A 4BYIA 4HPTE 2PK9A 4FKOA 3AC5A 3LLTA 4X2NA 3PY1A 5EHOA 2AUHA 1MP8A 4IDTA 5AJQA 1MUOA 3KRRA 1IEPA 4GJ2A 4RFMA 2XNNA 2B0QA 4ACCA 2CNUA 4W4WA 3TACA 3PJ1A 3FAAA 4TW9A 4K1BA 2UZOA 3DFCB 3RJCA 1R0PA 1HCLA 3L8SA 2UZTA 4FNXA 3HRFA 5TO8A 5I5ZA 4QTBA 3CPBA 3UQFA 1Q8UA 3CTHA 3I79A 5KMLA 5HNBA 4BR3A 5J9ZA 2C6EA 3BQRA 4A9YA 3I5NA 1SVGA 4IH8A 3TIZA 4AW0A 4DYMA 1F5QA 2X7GA 2GCDA 3ZC5A 5CXHA 3EL7A 3CE3A 4YZCA 4R7HA 2HWOA 4ENXA 4CFFA 3FMLA 3TTJA 4L7SA 4EQCA 2X4FA 3FSKA 3HRCA 4HVIA 3U6HA 3IDBA 4E5WA 2P4IA 3ZYAA 2NP8A 3QU0A 5EM6A 4EK6A 5ACKA 3QRTA 3FLQA 2ITZA 2VTSA 3PUPA 5BYZA 4YJSA 4RC3A 2B9IA 3KXNA 4MNFA 5ANOA 4EEVA 5AR5A 5IF1A 1V0BA 3GQLA 1XBAA 1OIQA 3TDWA 4FOBA 5HE1A 4EOOA 4YPSA 4FKIA 3Q9ZA 4ZZOA 2ZDUA 2ZMDA 3OWPA 3NZ0A 1UU7A 4RLLA 2QOQA 4PQNA 3DZOA 4OUCA 4Q5EA 4QQJA 5FDXA 5AR3A 1J7UA 1FOTA 4DFNA 3BE2A 5DA3A 2JKMA 3KC3A 4QYYA 1MQBA 2QHNA 3BWJA 3GNIB 1Y8YA 3ATSA 4BY9E 5EYCA 4QYEA 2VO6A 4MXZA 4OTIA 4EQMA 1WBVA 4C57A 2BPMA 3EJ1A 3TJDA 1OPJA 3RNIA 4DT8A 4GT5A 4PX6A 4KAOA 5CVFA 3RWQA 1TQMA 4MHAA 1OL6A 2Z8CA 1G8SA 5HU9A 4QPSA 5C8MA 3WIKA 3ZXTA 2J90A 4JOAA 2Y0AA 3UYSA 3LVPA 2VTNA 3B2WA 1W82A 5B2LA 4FEWA 3F82A 4FSUA 3FMKA 2JITA 5ETFA 5IQEA 3UMXA 3BYOA 3E62A 4J1RA 3NVMB 4YJQA 2X1NA 4QQCA 5I4NA 2QOCA 5BVFA
chains in the Genus database with same CATH superfamily
4B4LA 3R8UA 3TZ9A 3I0OA 3MY5A 4FIFA 4AN3A 4F9AA 3PZEA 2Y6MA 4J99A 3VJOA 1UNLA 3OHTA 5L3AA 5KBQA 4RX5A 3QHRA 3R22A 3BLQA 3NUUA 4FV0A 3UP2A 4HGTA 1GAGA 3SD0A 2R5TA 3HGKA 5AUWA 3B8QA 2PVLA 4Q9ZA 2FSLX 1OUYA 3R0TA 2VX0A 3E8DA 4QPMA 2WMUA 5TR6A 4X3FB 2C5NA 2H9VA 1XH9A 4X2JA 2ITTA 4CG8A 3MFSA 4XOZA 3IGGA 3ROCA 3MN3A 1Q8ZA 5FD2A 3QXOA 3HKOA 4R7BA 5L6OA 2OG8A 3V5LA 2ZM3A 3QWKA 3H9OA 1M14A 3ORXA 3PIZA 4E93A 5CAQA 4YJPA 4AOIA 5A14A 3R6XA 4ONAA 4QP6A 3WF6A 4FOCA 4RVTA 1ZMUA 4AA5A 2KTYA 1GZKA 1PXLA 4EK3A 4C4EA 3PLSA 4USFA 4MUQA 1APME 2NPQA 4RX9A 5AAFA 4C2VA 3N4UA 4CV9A 4RA5A 4AA0A 2C6KA 3MPTA 2WU6A 2HW6A 1A48A 4ZS4A 2OIDA 4FKVA 4GKIA 2WZJA 4DEDA 5GZAA 5EW8A 5HG7A 2YJRA 1J1BA 1OMWA 4F1OA 4DAWA 3ORIA 4AXFA 5HG8A 2HZIA 3DJ5A 4ANMA 1RDQE 3GB2A 2VTMA 4C34A 3F6XA 5A9UA 2PMNX 2UV2A 2R2PA 1G5SA 3RAIA 4CKRA 2QKRA 2WMXA 3DY7A 2XCKA 3A7HA 3T9IA 4ZEGA 3UODA 4CSVA 5A54A 3CGFA 3AXWA 3MS9A 3UC3A 5IUHA 2IZUA 3DK6A 3LAUA 3N51A 5AIKA 3TG1A 2W1FA 3CTQA 1YWVA 4FTTA 3VBWA 4V04A 3PIXA 4ZS0A 5CT7A 4Q9SA 3B2TA 5E7RA 1H24A 3WARA 4PL3A 3HX4A 3E93A 1TFFA 2RF9A 3OY1A 2GQRA 3FBVA 4FZDB 3UQCA 2XBJA 3NR9A 4W8DA 2QURA 4KSQA 3C13A 4AQKA 2X9FA 4ZSEA 2AYPA 3JYAA 3MTFA 2QOFA 3VUTA 4C4IA 3QQUA 2X0OA 4IQ6A 2C6TA 5K9IA 5E8XA 3AC2A 4WRGA 3FL4A 2ESMA 4M12A 3IONA 2CCHA 3W8LA 3DBQA 2R3QA 4ZMFA 1QPCA 1H0VA 2X6DA 5I9XA 2WB8A 2ITVA 1P5EA 2ZB0A 3LCKA 5M08A 4H3QA 1UWHA 4D1ZA 5HTCA 4B8LA 1WVXA 3E3BX 1REKA 4EHGA 2X0QA 2XVDA 2V5QA 3VQUA 4YNEA 1OL7A 3MH0A 4FK6A 2OXYA 2ETRA 3AG9A 2XK4A 1JNKA 4EOIA 2VTTA 3BI6A 4JQ7A 3FMNA 3EKNA 4HOKA 4LUDA 2BVAA 4OTPA 3MY1A 5CNNA 3RTPA 4ACHA 2HZNA 3L9NA 2XA4A 4TNDA 4K2RA 1XQZA 3RI1A 3BYVA 2I0YA 4DLIA 4UZHA 4XNEA 3BYSA 3F9NA 3P0MA 3QRUA 2FGIA 4JDHA 4TKSA 3UPZA 3I5ZA 2CLXA 4GT4A 4PF4A 4R3CA 1NVSA 4G3GA 3LLAA 1NVRA 2ZV7A 1AD5A 4IZAA 4UV0A 3Q4ZA 2X8IA 4AZEA 4Z55A 5IUGA 3EIDA 1J1CA 5M55A 2WOUA 3R21A 5AP1A 4OTQA 4BDIA 3KL8A 5CQUA 4MD9E 5JMSA 3OT8A 4CT1A 3PUFC 3OROA 5A46A 2GNIA 3GP0A 3DBDA 5EW9A 2UW3A 3TI1A 2GS7A 5DPVA 1YXUA 5M4CA 5FTGA 4CTCA 5HLNA 3EZRA 2WEIA 2EUFB 2X4ZA 2HY81 4QMOA 2WMVA 4U81A 5FG8A 3H0YA 5L2WA 4UXQA 3AOXA 5ITAA 3G33A 2X2KA 4RVMA 1Q4LA 3O17A 3PSBA 2JDSA 4JRNA 2WELA 4MK0A 3QGYA 2UUEA 3G9NA 3BGQA 3I7CA 3FI3A 2X39A 3ERKA 1OVEA 1VYWA 2AC3A 3GUBA 5C01A 4D5HA 4RJ3A 4RC2A 4BCNA 3ZO1A 4ANNA 1ERKA 3QQHA 2XEZA 3W10A 2BDFA 2QI8A 4IC8A 3BELA 2JAMA 5D9HA 3IGOA 1URWA 2W17A 3BYUA 3HP5A 3I6UA 3PXYA 4FKTA 1U5QA 4I22A 4U44A 3QQGA 5DGZA 4BICA 5B2MA 2FYSA 4I92A 2WIPA 4O22A 2OXXA 4NW5A 4K6ZA 5GZ8A 3RPRA 2EXEA 3NUAA 4IVDA 4ZSGA 3FLZA 4PUZA 5LVPA 1U5RA 4CYIA 3TL8A 3OBGA 5KHXA 2UW8A 4O4BB 4DFZE 2YLEA 3L9PA 4EHVA 2J0LA 2ZVAA 1ZZ2A 3AT2A 4JX7A 4KRDA 4IFCA 2PVFA 3BV3A 4PY1A 4CFMA 2R9SA 2OXDA 3C5UA 1MQ4A 2C6DA 3IG7A 3OFMA 4IIRA 3UP7A 3ZONA 4O96A 4NJDA 3NUYA 3QTWA 2BRBA 4MVFA 4AGWA 5DR2A 4XRLA 3FPMA 3QYWA 1PXMA 2WQEA 4I93A 4TYJA 3ATTA 3Q4CA 5GINE 4YLLA 3S0OA 2YJSA 3K54A 2XKEA 1R1WA 3N9XA 1G8AA 2I1MA 4LRKA 4FMQA 5AMNA 1H1RA 3CD3A 5AUUA 1H01A 1W8CA 2CKQA 3DJ6A 4C33A 4FNZA 2IPXA 2QR7A 3R1NA 3KRLA 1SMHA 2RIOA 4E6AA 3TNIA 5EYKA 3PA3A 5F4NA 1PXNA 2R3OA 2R3IA 2CSNA 4M84A 1FPUA 4G5PA 5E90A 5H8EA 4AN2A 3ZZEA 4DH8A 5E4HA 4M13A 2OJFE 4AA4A 2VTIA 4AFJA 4FX3A 3B8RA 2BAKA 3PTGA 4QMWA 5I3OA 4DEIA 4EYMA 3V8TA 4QMTA 3E88A 3E5AA 4HCUA 3WYYA 5A4CA 2XRWA 3GXLA 3JPVA 3AD6A 4QMYA 3UZPA 4FV9A 4FL3A 4I4EA 2GHLA 5FWKK 5BX0A 5H8BA 2W0JA 3D5WA 3PWYA 3QBNA 5J1VA 4PDYA 4RG0A 4Y5QA 4BDHA 2YLFA 3DOGA 4ITIA 4ZTQA 3SW7A 5HVJA 4EOMA 3FZRA 3PFQA 1VJYA 4J97A 4ZIMA 1X8BA 4II5A 2IWIA 4F7JA 4XP3A 2RG6A 1XMLA 1XH6A 5IQHA 4Y72A 4F64A 5ETAA 3LFCA 1KE5A 2WQBA 4YHJA 3IK3A 4O83A 2NRUA 3PY0A 3NYNA 4XLVA 2VUWA 5H2UA 3QCXA 5BVNA 4KD1A 1H8FA 4RIWA 4IFGA 2ITNA 1IASA 3OY3A 2GFCA 5FTOA 4U79A 4UWBA 3PXRA 4FKRA 4FKPA 4WD5A 4O4DA 4DF3A 2XIZA 1U4DA 1WBWA 4IB0A 2WKMA 2PULA 2XJ1A 5CXZA 2HELA 4C7TA 3BHVA 3Q5IA 3TIYA 3ELJA 3KFAA 3UOHA 1LEZA 5HESA 3WZJA 4ZSAA 3VBQA 4HGEA 5JZJA 4IWPA 4RA4A 2QLQA 2QU5A 3DB6A 3JXWA 4QQ5A 3UIBA 3JVSA 4WIHA 2WPAA 3V04A 1KSWA 4FODA 1DI8A 4FTCA 1WBPA 2XK6A 4NZWB 3KXXA 5HIEA 5IA3A 5BPYA 5IKWA 3M42A 3QZHA 4FG7A 3PY3A 4ZY4A 2XIYA 1PMUA 3R71A 3TWJA 5A4QA 5L8LA 4O6LA 4AWIA 5C4LA 4KKEA 4O2PA 3NYXA 3QKMA 4O1OA 2IW6A 4S2ZA 3ROYA 3DNEA 4JR7A 4BZOA 5AV4A 5CEQA 5I9YA 3T3UA 4DE4A 4XCUA 4Q2AA 3Q6UA 3V6RA 2IW8A 1BYGA 2C3KA 2J6MA 4BL1A 4IHPA 2ITUA 4GRBA 4WKQA 4O84A 4O0TA 3OD6X 3E8CA 4IAZA 1AQ1A 3VHKA 5CU0A 3IKAA 3BLRA 3OS3A 5HNIX 4PP7A 2W1EA 2JD5A 5CSVA 5CZHA 4L46A 4O7LA 1PMVA 5AUYA 2XNMA 4RPVA 5T3QA 3DLSA 2VTAA 2VN9A 4G6LA 5CAUA 3EB0A 5AEPA 3ORZA 4DGOA 2Y4IC 3NW6A 4G1WA 1LEWA 4GMYA 4KKHA 5FXRA 4ZSJA 3MVJA 3C9WA 3FMEA 4U43A 2X7FA 5IQCA 3BQCA 5AWMA 5L2QA 4FT9A 4FTMA 4MKCA 5B0XA 3FHRA 2ITPA 3DBCA 2OZOA 3A99A 4QRCA 3WF8A 4X2KA 4RZWA 3WE8A 4O81A 3NYVA 3LFNA 4C02A 4E4LA 4FTOA 4HCVA 2P2IA 4GH2A 1P14A 2BUJA 3KF7A 2JAVA 5CF5A 3ML1A 3R30A 5TOZA 4BBMA 4D1SA 5KO1A 4BYJA 4D2SA 3LMHA 3LCDA 2YM7A 4O0UA 1XBBA 4ZJJA 2QOBA 1S9IA 3JS2A 2XH5A 3QQFA 4FVRA 4E4MA 1OBGA 4L6QA 4AE9A 2W9ZB 4YR8A 5L4QA 5TF9A 1CKPA 1YDTE 5BQ0A 3K2LA 5LOHA 3ZUTA 3FMMA 2BRGA 1XH5A 5JFVA 4YO6A 4IAIA 1G8KA 4AAYA 4CFWA 4L3LA 4XRJA 4L3JA 5AP3A 3LFDA 3U55A 4CKIA 3BL9A 4QMUA 3C4EA 3HDNA 4HZRA 5IA2A 3MA3A 3NFFB 2C3LA 3R63A 3NCZA 3SX9A 4IAAA 4BCJA 3KVWA 1FINA 4AU8A 3D83A 5B7VA 5EI2A 3SOAA 1UA2A 2UZDA 4O2ZA 5AM6A 2F2CB 2OICA 3JVRA 1M2PA 2Y4IB 3WI6A 4EH4A 2CGVA 5FEDA 3LFEA 3NFGB 2GNHA 2A27A 3OOMA 3R7IA 3HP2A 2Y4PA 4CEGA 4X6QC 3UZTA 5A6NA 3BBWA 1STCE 3UE4A 1YOLA 2W5BA 3O0GA 1P2AA 2WMAA 2J0KA 3PPJA 4FTQA 4QPAA 4DEAA 5LMBA 4XG2A 3NUNA 1ATPE 3BX5A 2YDIA 4X6RA 4Q5HA 4D9UA 4RC4A 2VGPA 2JIVA 3ZO3A 3A60A 3LXLA 2XAOA 2PZ5A 1H08A 2FSMX 2BALA 2FB8A 2VWUA 3IW4A 3VIDA 4FV8A 2XMYA 1KE7A 3QZIA 2WTIA 3GC0A 4NU1A 1W2CA 5J1WA 1OUKA 4JL9A 5BUJA 4LGHA 1ZWSA 1JKTA 3VN9A 4OAUC 4C4JA 3UO6A 5JGBA 3BHTA 3U87A 3NEWA 5I9WA 4BGQA 1NA7A 4WO5A 2RKUA 4X2GA 3F5XA 3NW7A 2XAMA 3C4WA 3IW5A 4WUNA 3TNHA 3VS1A 4TTHB 3PPZA 3QRIA 3LXPA 3EFWA 3VBTA 3F3TA 4BCMA 3SW4A 5EQPA 3A62A 4MXYA 4ASZA 3GI3A 4XYFA 3DCVA 3GU6A 3W18A 4XUFA 5TT7A 4FNYA 2UW9A 1L8TA 3A8WA 5DT3A 2VX1A 4F1TA 3R00A 4HCTA 5DT4A 3DS6A 2GQGA 3OXZA 4CMUA 4QTEA 3TYKA 3DTCA 1QMZA 4C59A 4ZAUA 2C69A 5JKGA 5HX8A 5BVOA 2HZ4A 1OPKA 3DXNA 2BIKB 3RAKA 4AAAA 4BJJB 3IOKA 1ND4A 2PVJA 4GUEA 3UQGA 2W96B 4BKZA 5L8KA 4E4XA 2VX3A 4OTFA 3VF9A 3MA6A 3BGZA 4W8EA 5C8KA 2G15A 2YN8A 2OBJA 3NRMA 4U5JA 4YC8A 4YGAA 2GQSA 5ICPA 3ZEWA 5GNKA 3L1SA 4BGHA 3GCQA 3VS0A 2KULA 3MIAA 4TYEA 5JT2A 5LWMA 1R78A 3FV8A 2UZUE 2CGWA 2A98A 2BTRA 3R7UA 3ETAA 4G3DA 5CANA 3SHEA 3L8PA 5FEEA 4M3QA 4P5ZA 3UYTA 4CT2A 4W4VA 4PMMA 3UPXA 5IQDA 4XBUA 3NNVA 3ORTA 4NW6A 4U9AA 3SA0A 4PPAA 3RKBA 5I9VA 4C3PA 3EN5A 4GVAA 4R6VA 3O8PA 4B6LA 4IWDA 3CP9A 5DEYA 5DWRA 1UU9A 3KK9A 3PG3A 4ANLA 2W5AA 1JQHA 3F5UA 4FV6A 3RGFA 2WQNA 4LMNA 3KXGA 4YU2A 4MWIA 3R9DA 3F5GA 4O7NA 2RFNA 5EK7A 1WBOA 3HV3A 3TV6A 4L7FA 4ORKA 5J5TA 5G1XA 4QOXA 2QD9A 1B38A 2CPKE 3UNKA 1H1WA 3DKCA 3HUBA 3MW1A 3EYHA 4G5JA 4TT7A 3L9MA 5CI6A 3VULA 3QA8A 4FTRA 2XRUA 3DBFA 1XBCA 4XS2A 5L8JA 2ERKA 4TN6A 3RAWA 2WTKC 3QCYA 5KMNA 5M53A 2YZAA 5BYLA 5IH5A 4AFEA 1OI9A 3QZFA 2P33A 1UU8A 2UW6A 3D5XA 4EHZA 1O6KA 2ZM4A 1XJDA 3PXKA 3EQFA 1OIYA 4EHEA 4FE2A 2XYNA 4AQCA 5JK3A 4CRSA 1NXKA 4RIWB 2CNQA 4F65A 3GU4A 1E9HA 2B54A 3E8NA 4IX5A 2CNVA 3MESA 3A7GA 3ZFMA 5CVHA 4KBKA 4J8NA 4QD6A 2QOIA 1O9UA 4EC8A 1K3AA 4UALA 5M57A 2DQ7X 4IZYA 3QC9A 4LOQA 5FXSA 4BKYA 4L53A 4LQMA 4FL2A 3PFYA 2ITQA 2GHGA 4O21A 1WBTA 4EBWA 1JKLA 4FIEA 3GC7A 3OMVA 4JQEA 4NJ3A 1DAYA 4J8MA 2X0GA 3FC1X 3RBWA 2W4JA 4GK4A 3RP9A 3I6WA 2VTRA 3VAPA 1LPUA 4HNFA 2V7AA 1H25A 2PVRA 1YI4A 2OZAA 4Y73A 3U9CA 4EOSA 4XV2A 3SVVA 4TWPA 4MF0A 4X21A 4EJNA 4ZJVA 5HVKA 5BV3A 2H96A 5HHWA 4A7CA 2AEGA 1PHKA 3OZ6A 4EOQA 3FPQA 2PU8A 5L2SA 4JG8A 3NCGA 4WG4A 2RG5A 4DITA 5CALA 3KKVA 1HCKA 3OW3A 3KVXA 3R8LA 3DPKA 3D0EA 3P4KA 3PVBA 4LGDA 3O2MA 5FQDC 1YRPA 3JR1A 1CTPE 1R39A 5LVOA 2Y7JA 4APPA 2XNOA 1Q8YA 2HOGA 5L6PA 1YHVA 3LFQA 3UMWA 1ZAOA 3DAKA 4GEOA 4IX3A 4O7ZA 2WTKB 4C62A 3VS3A 5EQEA 5F94A 3UOKA 2X8EA 4KBCA 3QRJA 3DK7A 3QUEA 1WVYA 4HGSA 4J52A 2C5XA 4OR5A 5CLPA 4IW0A 3JY0A 2OH0E 1FQ1B 3AD4A 3P9JA 4N4SA 5CF4A 2XYUA 1ZMWA 5FTQA 2RFDA 1Y91A 2CLQA 3Q32A 3F3ZA 4H39A 2Z7LA 4F9CA 3F7WA 4DH7A 1H27A 2QOOA 4KKGA 3QALE 1J91A 4I5HA 5DMZA 1UV5A 2C1BA 2FA2A 1OIUA 1YKRA 2ZDTA 3HRBA 4JS8A 4GG7A 4L44A 3M1SA 4AG8A 4OW8A 4C35A 1M17A 1TQPA 2C6OA 4OTHA 4DHZA 3SG8A 2YM4A 4ERKA 3KEXA 2I0HA 3P79A 1FVRA 2X6EA 3QFVA 4BCHA 3CPCA 3DJ7A 3FUPA 4V01A 5DT0A 4LL5A 1BLXA 3LIJA 3OXTA 5HLPA 4EH8A 4BC6A 5E8ZA 5HBHA 3RALA 2QNJA 3FZSA 3PIYA 3W2RA 1Q62A 3V5TA 3VUIA 2H6DA 3ZXZA 3MYGA 2NYAA 2XK3A 2IW9A 4IAKA 3EYGA 4D2VA 1TVOA 4EQUA 4EL9A 4YTCA 3R8MA 1GY3A 3OWLA 4UYNA 4Y46A 3PZHA 5D41A 5HICA 4X0MA 3DU8A 4A4OA 3U6IA 1GIHA 3F61A 1YOMA 2R3FA 3MB6A 1OECA 2UW7A 3EN9A 3PJCA 4E6CA 4F08A 3LPBA 4YZ9A 2VD5A 2WTCA 3QYZA 4KWPA 4BDAA 2ZOQA 3DA6A 4D1XA 4JBQA 2F4JA 4XP2A 5BVKA 3FY2A 3ACKA 3ITZA 1PJKA 3TV4A 2UW0A 2XIRA 1JOWB 4PL4A 1DS5A 4HW7A 5FBNC 1M52A 2JIUA 4M0ZA 4ZZMA 5HE3A 3SV0A 5M06A 3PVWA 5DEWA 3ZEPA 3VS6A 3O8TA 2W1HA 3O8UA 3VS2A 3VS7A 1AGWA 4R78A 3C50A 3GC9A 4CFXA 2W4OA 1ZXEA 4DA5A 4TWNA 4YJRA 1QL6A 1XHAA 5KE0A 5IQAA 4M8TA 4GU9A 1W2DA 1YWNA 3AMAA 4DGGA 4RMZA 3ET7A 3ZS5A 3Q9WA 2H34A 4YJUA 3TZ8A 3PE1A 2QCSA 2BR1A 2O8YA 4ZY6A 5J7HA 3PWDA 3F3WA 3VWAA 4EH7A 5M4IA 3KULA 2VV9A 2WFYA 5EW3A 5DR6A 4DC2A 4PTGA 2OJ9A 2CN8A 2JFMA 4QMVA 5FUTA 3KY2A 5EDRA 4IC7A 4B99A 2YERA 5KZ0A 4RVLA 3TUBA 1Z5MA 3MIYA 1FGIA 3UTOA 1W98A 4RJ7A 4DEGA 4H3PA 3BRBA 4YZNA 3ZSIA 2VO7A 4F7LA 5BNJA 2JLDA 3HA6A 5DRDA 4HGLA 3EL8A 4LUEA 4FSZA 4MXXA 3H30A 4W4YA 4YZDA 1W84A 5ANJA 5FDPA 2F49A 4F7NA 1CSNA 3ZM9A 1U54B 1PW2A 2PE2A 4FIIA 5IQBA 4DFBA 4UB7A 5CVGA 4E8AA 1ZLTA 5IH6A 2YM6A 2NNWB 2HAKA 2GHMA 5LMKA 3MGYA 4X2FA 2WMTA 1KUTA 2OK1A 4D9TA 3VUGA 3UVRA 4EJ7A 2WQOA 2C68A 3HECA 4IEBA 4I5MA 1JSVA 4OT5A 4BHNA 2X2LA 4JBPA 1SNXA 4YPDA 4R77A 2VTLA 2QG5A 2WO6A 3LCSA 3T3VA 3DT1A 1VYZA 3R8VA 2B9HA 3PSCA 2XF0A 4L52A 2YITA 3K3IA 4PP9A 4O7WA 3UZRA 2XM8A 4EONA 4GS6A 3A7IA 4IVAA 4MAOA 3MVHA 2WXVA 3REPA 4RJ6A 4AXAA 3HMPA 3IQ7A 3AKLA 2I6LA 1Z9XA 4L01A 2ZYBA 3PA5A 4FT5A 4ZJIA 2HY0A 5DVRA 4IM0A 4UXLA 1ZYLA 4JI9A 4PPCA 4JAIA 4U6RA 1GZNA 4BIBA 5AP5A 5D12A 2CMWA 3QCQA 1ZARA 2R3RA 3IDPA 4EK8A 1Q61A 4QMNA 3V51A 4U45A 3VS4A 1CM8A 1OIRA 2YABA 2PMOX 5KZIA 3EQCA 1JLUE 3WYXA 1H26A 3RCDA 3UDBA 2J4ZA 2XBAA 5KX8A 4IB5A 2BZKB 2JDRA 3BLAA 4L42A 1SVEA 4IMYA 4MEDA 4UMQA 5IQFA 3MH1A 3FZOA 2RL5A 1P4FA 2VWBA 4M68A 4GYIA 3RHXA 3S95A 2ITWA 3UIXA 2XANA 3R9RA 2J5FA 4FI1A 3Q6WA 4O0XA 5HTBA 3KXHA 3C4XA 2OW3A 3V8SA 4BBFA 1KE8A 5AUTA 2W1ZA 4DTAA 5ANGA 3IECA 4EKLA 4L45A 4AZWA 3TV7A 4DEHA 1VR2A 4QNYA 5CU4A 4IZ5A 4O0RA 4XMOA 5AX3A 5KMOA 4ITJA 4TWCA 3EZVA 2C0TA 4AXDA 3VS5A 4D55A 3EFJA 2CCIA 4FEXA 4GSBA 1DM2A 4GFMA 3HMOA 2R3PA 2Z7SA 3COIA 5CSPA 1O6LA 4WT6A 4JDIA 4ZLYA 4OBQA 2X2MA 1GZOA 3QUDA 4N70A 4ZP5A 1OKZA 3AC3A 2WTWA 5H3QA 5EFQA 1XKKA 2HIWA 2VTHA 2IVVA 4FV3A 2WMWA 4DDGA 4O6EA 5D10A 2XKFA 4P5QA 1OB3A 4IAFA 1H0WA 4XP0A 2QONA 3Q60A 3M11A 4KIKA 1QPJA 2PVMA 4K9YA 4IX4A 5EM7A 2IVUA 2YAKA 4H36A 3C51A 3FC2A 3MVMA 4BDFA 4A07A 4FEVA 1NY3A 1GIIA 5A4TA 4IB3A 1BL6A 2X81A 1UVRA 4O1PA 2Y6OA 3POZA 3SQQA 4ZSLA 4LYNA 3NWWA 3PXFA 4YSMA 2IG7A 2Z7QA 4UBAA 3FI2A 3ODZX 2YDJA 3IS5A 5DI1A 3FYKX 2YIWA 2OZAB 3IDCA 3G0FA 5LARA 3VUDA 4JXFA 3HEGA 4FZAB 4U7ZA 2YCRA 3LM5A 3H10A 3R2YA 4TRLA 4AOTA 4CRLA 3FXZA 3PP0A 1OL2A 5JN2A 4E7WA 5I9UA 4IZ7A 2XK9A 5IH4A 4TZRA 3ZO4A 3LMIA 2J50A 1M2QA 1PYXA 4QYGA 1SM2A 5AM7A 3SRVA 4C38A 3CD8A 1ZOGA 5CZIA 3UOLA 3LQ5A 2CDZA 4KIOA 4RBLA 4BIEA 2IJMA 4RSSA 3KF4A 4BJJA 4FGRA 3HDMA 2IEWA 4H58A 4F63A 3TMOA 3Q52A 3KU2A 1FVTA 4JRVA 3TNPC 3E3PA 4FGBA 5CAVA 3MSSA 5HBJA 1YI3A 2C5VA 2HW7A 4G2FA 4EZ7A 5BUEA 2YWVA 1I44A 3O50A 4ALVA 4XV1A 2G2IA 4B8MA 2XS0A 3RPSA 3FJQE 3V3VA 3LMGA 5J9YA 5M4UA 1ZZLA 4S32A 1SYKA 4CCUA 5E8UA 2GNGA 2W1GA 2F7EE 3LHJA 3NGAA 3EKKA 4WNKA 5CNOA 5CASA 4FA2A 2BZHB 4FIGA 5IQGA 2J51A 3H3CA 3KK8A 3OW4A 1FVVA 2W1IA 3MH3A 3Q5ZA 4XEYA 5EYMA 3WBLA 2X7OA 1V0PA 3EN6A 1IAHA 3BE9A 2WIHA 2P3GX 4AX8A 2OFVA 2VAGA 2ITOA 3LQ3A 4AACA 4FG9A 2WGJA 4FTLA 4RWJA 2PL0A 3GT8A 2WHBA 2UW5A 3CXWA 2Z60A 3PG1A 4G6OA 2H8HA 5IA5A 4XV9A 1Y8GA 2QOKA 4FV5A 4ZMEA 3EQBA 3IO7A 1PMNA 4MX9A 4S34A 3ZC6A 3NIZA 2C4GA 3EWHA 5CU3A 5LVNA 4BTKA 3PVGA 4H1JA 2A19B 3AKJA 1U46A 3P7CA 5HTIA 4E4NA 2E9VA 3HL7A 2VTPA 5E8VA 2OWBA 5M09A 3CCNA 2IZSA 3R83A 4MXCA 3QAME 1ZYJA 2QC6A 2YHVA 4QP9A 1P4OA 3GQIA 3L8VA 3QC4A 2GTNA 4DGNA 3HUCA 1W0XC 5A3XA 4N0SA 1BUHA 5BMSA 5AUZA 4U40A 2BKKA 4C36A 5LMKC 4G6NA 3KMWA 2E9NA 2UVYA 4PRJA 3EQRA 3ZOSA 4O7RA 5E8TA 3CR0A 4BIDA 5CQWA 4FTKA 4GFOA 4MNEA 4D28A 3DFAA 3BGPA 3TDVA 5AR7A 2XKCA 4C3RA 4J71A 4BGGA 4GK2A 2OKRA 3IOPA 4FKQA 4QP3A 5CY3A 2F2UA 3OT3A 4NH1A 4D2PA 5IQIA 2R0UA 4CG9A 2LGCA 2O2UA 2W1DA 4QP4A 4HPUE 5M07A 1CMKE 2J5EA 4G16A 4TNBA 3ZLWA 5FM2A 4QEBA 4I0RA 3ALNA 4MYGA 2GNJA 3U51A 4AS0A 3ODYX 1R0EA 1UNHA 3NLBA 5C8NA 3KULB 5IMEA 3LOKA 3FSFA 2XARA 3R01A 3DQXA 3R9HA 5JH6A 2C3JA 4EH5A 4EH3A 4JVGA 4DBXA 2R3LA 3MJ1A 4UEUA 4AE6A 4QTCA 5GJGA 2Z2WA 4IANA 3UBDA 4JBOA 4RQVA 3S00A 3VQHA 2BHHA 2W99B 2XKDA 3HV4A 4XG4A 2FSOX 3LQ8A 4EZ3A 4OTRA 1B39A 3FL5A 2HXLA 3OXIA 3R9NA 4YUQA 3LW0A 2UVZA 2Z02A 3D9VA 3C5IA 2PZIA 1Q3WA 3O7LB 4FRFA 4CNHA 3WF9A 3ZO2A 2BFXA 2I0EA 4YLJA 4C37A 1NT2A 3FY0A 5E1SA 1JPAA 3JY9A 3NIEA 4D4RA 3KA0A 4RFZA 3RPOA 3BHUA 4OBOA 4YJOA 5H9BA 3VUHA 4FK3A 3W1FA 4O7SA 2FVDA 3NUSA 2R3HA 3FZPA 3TT0A 4BI1A 4DHIB 3NS9A 3OC1A 3QUPA 4FV4A 2WAJA 2YM8A 2C47A 4H3BA 4OT6A 4V05A 4UY9A 3POOA 5CU2A 4HVDA 4Z16A 5HLWA 3H9FA 3KB7A 5G6VA 4MQ2A 5FBOA 5H8GA 2EXMA 1TQIA 1DI9A 3R02A 4AZTA 2IN6A 3OEZA 3D7ZA 4AGDA 2QVS