3LXPA

Structural and thermodynamic characterization of the tyk2 and jak3 kinase domains in complex with cp-690550 and cmp-6
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
291
structure length
285
Chain Sequence
DPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYRVGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Structural and thermodynamic characterization of the TYK2 and JAK3 kinase domains in complex with CP-690550 and CMP-6.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 285
sequence length 291
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lxpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lxpA01
2PZIA 4GG5A 4XEYA 1Q24A 3EZVA 4OW8A 3OBGA 4PDSA 2YM3A 5C27A 3G90X 3R8UA 4W8EA 2BRGA 2O8YA 5DN3A 2GTMA 2XP2A 3B8RA 1ZLTA 4ANBA 5LMKA 1W8CA 3HRCA 3O23A 4ZTQA 3R8LA 4RX5A 3IO7A 4IAYA 4QMSA 3LFEA 3VUIA 3SC1A 3W33A 3GBZA 4BIBA 2JDOA 5AR5A 3HUBA 2ETKA 4FKRA 3EQBA 3U4WA 4IWDA 4KINA 2VTOA 5FDPA 3TTJA 4H39A 1Y91A 3SXSA 2QI8A 4FODA 2BZJA 2NRYA 4A4LA 4RT7A 4KA3A 3ZM9A 4H36A 5E8UA 3JY9A 5ACBC 1KV2A 4YTFA 2E9OA 4LOPA 3ZLYA 5FEEA 3KB7A 5FXQA 1ZZ2A 3TIYA 5CNNA 4I23A 5EHYA 2DWBA 3PY0A 1OL5A 3MH3A 2WMQA 2XNGA 4OUCA 4UMQA 4LQMA 3VS2A 3L8VA 4XOZA 2YHVA 3ZCLA 5IUGA 3CIKA 4F63A 4KIPA 2YDIA 3PFQA 5J7BA 4D9TA 4NT4A 2WOUA 4TZRA 2QHNA 3FEGA 2WTVA 5DR6A 3R8PA 4NH1A 3ENHA 3MH1A 3PXYA 4BTKA 1ZOEA 3ZO1A 1PF8A 4MD7E 5FDXA 3QKKA 4AP7A 4XG4A 4XYFA 2FSMX 2X9EA 3DOGA 3GOKA 5CSHA 3UIBA 4PQNA 2XM8A 2YZAA 4B0GA 2ZAZA 1IAHA 5TT7A 3EN6A 3QCSA 2I1MA 3DLSA 3Q9WA 3SAYA 1PYXA 3QYWA 4MQ2A 4R77A 5IQDA 2B9HA 3UDBA 5HTBA 3LXPA 3DQWA 3PJ8A 5KMNA 3WILA 4GCJA 1YDSE 3DBFA 5CQUA 4OBPA 3S1HA 3DAKA 4KIQA 4EHZA 3C7QA 1OIRA 2WFYA 5DE2A 4YO4A 3EKKA 5AP5A 4M66A 5CEKA 1H25A 3SD0A 3Q5ZA 2XCHA 4FIEA 1R78A 2HZNA 2BPMA 4F99A 4JRVA 2W1HA 4FNXA 2PE2A 5CXHA 5EDRA 3TZ9A 4F7SA 2ITTA 2GNHA 3UTOA 2WD1A 4XUFA 4GH2A 2BAQA 4NM5A 4BBMA 5AUZA 3HV4A 2KULA 2CCIA 2VO0A 1RJBA 2JDVA 3EB0A 3D0EA 3T3VA 2ZM3A 4J8MA 5TE0A 1ZYCA 4CZUA 4IZ5A 3NEWA 4IXPA 3P79A 5HLPA 1W98A 3HV6A 3QD0A 3ZU7A 2ITPA 4NZWB 3U6HA 3QF9A 4AGUA 3LFSA 3LFDA 3FI3A 4RRVA 1DI8A 4YO6A 4L9IA 3AG9A 5L8JA 3R1YA 5IA0A 1LPUA 4W8DA 4TXCA 5L8LA 3HLLA 4ERWA 2X8IA 5LXMA 2GDOA 4NJ3A 3VC4A 4Z7HA 5FM3A 5HU9A 4ZS4A 5IZFA 4AGDA 4N0SA 3DKGA 4UMPA 4G9CA 3ZLSA 3FWQA 5H8BA 5K9IA 4PTGA 4WO5A 4GFOA 4FEUA 4MNEA 2WMBA 1AD5A 5IA3A 4EK3A 1OZ1A 2HK5A 2R3RA 3AD5A 4DT8A 3FSKA 1JKSA 3MPAA 2V22A 2YM5A 3QD2B 4I24A 1GZNA 3IW7A 2BDWA 5LJJA 3ORPA 3NUNA 1UA2A 5KKRC 5LMBA 5TF9A 3ANQA 1NVSA 1Q41A 1NA7A 2ZVAA 5EYDA 3V5WA 2C3KA 4J53A 4XJ0A 4FV5A 1X8BA 4Y73A 4DG3E 4O7LA 1GIJA 2W17A 4C02A 2F2CB 2JITA 4QTBA 5M08A 4FTJA 4EKKA 1I44A 2WMSA 2ZV7A 3E64A 4R5SA 4LOQA 4X3FB 4BGGA 2YLFA 3QQLA 3QTRA 4FT5A 4X3FC 3SHEA 5EI2A 4X2FA 5DGZA 1QPCA 3KXMA 4O0VA 3E7VA 5AR4A 3RPSA 2VWZA 2BAKA 5DVRA 1YWVA 4XNEA 1Y57A 4YC6A 3KMWA 3ALOA 4O0UA 3R0TA 3FLWA 3R02A 4IAZA 1BL6A 2R3FA 3EN4A 3DNDA 4PMTA 2O5KA 3UOHA 2OXXA 3Q9ZA 3QALE 5AP7A 4X3JA 1XH7A 2PHKA 4O2ZA 3H30A 2GMXA 5D41A 3OWPA 4KNBA 3VIDA 4BDDA 2IZRA 2R3IA 4G17A 4TNBA 3KXNA 4JAIA 2UZTA 4AOTA 5JGBA 1Q5KA 4EHGA 3EIDA 1E1VA 2XMYA 2OFVA 2Y4PA 4LMNA 5EYCA 4OTFA 4HVIA 1XBCA 2R3NA 3C50A 3UIXA 2V5QA 3O2MA 2BDJA 5ANKA 3SOAA 3ORLA 4G6OA 2QR7A 2UZDA 3QTWA 3M1SA 3ZS5A 2BHEA 5E8ZA 4AXAA 2OKRA 3ORKA 4JOAA 4BZDA 2X4FA 4P5ZA 4CG9A 1YXUA 2O0UA 1O6LA 2OIBA 4C4HA 4H3PA 4E4XA 3ET7A 5IUHA 4XV9A 5J9LA 2RG6A 2UVXA 3ORXA 3R28A 3ZLWA 3DQXA 4LGDA 2WTDA 3O17A 1PMVA 3QXPA 4OTRA 5FUTA 4BB4A 4YZDA 4FZ6A 4EOKA 3EKNA 4BHZA 4PMSA 2VD5A 1IG1A 5JQ5A 2AC3A 4RA5A 2G01A 3R63A 2W5AA 4IAAA 3ORNA 4CKJA 5LVPA 4D4RA 4G34A 3AMBA 4IE9A 4CSVA 1NT2A 5A54A 5D7AA 4PL4A 4P4CA 4UWCA 2C69A 3TNHA 1RW8A 3AC1A 3NUYA 1WBNA 3D4QA 3EQIA 3PG1A 4P5QA 5E8TA 3PVGA 4OTPA 4WIHA 5EM8A 5AR3A 4JR3A 4C35A 4OGRA 3FL5A 3ZSGA 4XLIA 3RI1A 4CMUA 5EQYA 3THBA 4EYMA 4OBOA 2YWVA 5HBJA 1YHSA 3ZO3A 3BRBA 3EFKA 3KCFA 3HMIA 5HO6A 4YJVA 3AC2A 3UP2A 3BHVA 3R30A 3KN5A 4KIKA 2QOBA 3DB8A 5H2UA 2PVYA 3ALNA 3VQHA 2XRWA 4C3FA 4F09A 4IVAA 1ZOHA 5AMNA 4DEEA 4J97A 5IQBA 1YQJA 4OTHA 4EZ5A 3PSCA 4DCAA 4YLKA 4RBLA 4IH8A 4EOSA 3GOPA 3LXNA 2NP8A 5HD7A 3IDCA 3ID6C 5CVGA 1VJYA 5CSXA 1DS5A 3PA4A 4AOIA 5HX6A 1H08A 1Y6AA 5F1ZA 3FQEA 3QTSA 4FG7A 4TYGA 4F9AA 3W32A 3ZFXA 4IX5A 3L9NA 5EOLA 3C0HA 4M84A 3DCVA 4QYGA 3UG1A 2XH5A 4CFMA 4DFUA 5CVHA 5LCKA 1H00A 4UZHA 3SRVB 5A9UA 3IKAA 3KXXA 1WCCA 4B8MA 1OPLA 3AXWA 3RHKA 2EB2A 5BMMA 5EOBA 4HW7A 3DZOA 3E8DA 1VR2A 4D1XA 2GQGA 5EFQA 5HVYA 3C9WA 3VHEA 4ZMEA 4E6QA 5HIBA 3CSVA 2QO2A 4BKZA 2XS0A 2WB8A 2DYLA 3CBLA 4MK0A 4TPTA 4C3PA 2QC6A 2XNMA 3AMAA 4EH4A 3C5IA 3NUSA 5K3YA 3N9XA 2FH9A 2CNVA 3ZRMA 5AX3A 3JYAA 4BZOA 3OWKA 3POOA 4BDBA 2B54A 4BDAA 5A4LA 5ITAA 4C2VA 4X6RA 3G9NA 1FVTA 3KQ7A 4XX9A 3GQLA 4LRKA 3TNIA 3BI6A 4EK8A 4Z16A 3DBEA 1TQIA 4L3LA 2IVVA 2VTQA 2CKPA 2OFUA 1B6CB 4O7ZA 3MYGA 4BI1A 3OWLA 3BQCA 3K3IA 3NNVA 3R8VA 5KMKA 1BKXA 3CEKA 3NYOA 3FXXA 4U7ZA 2CJMA 3HA6A 4R78A 4K33A 1EH4A 3KVXA 4MKCA 4DFXE 4QQTA 3ODYX 1G8SA 1PKGA 4AZWA 3VRZA 3GB2A 4YNOA 2GS6A 2UZUE 5BVKA 1XKKA 4D2RA 3GP0A 5AAEA 4GYIA 3E7OA 3VWAA 3QA0A 4I5MA 3D7TA 1GJOA 3BEGA 2JIUA 3TXOA 1OKYA 3V6RA 5IA5A 3UBDA 1WZYA 2X0GA 1IA8A 2JBOA 3BE9A 4FV7A 4FKPA 3MB6A 2WU7A 5H8GA 4RX7A 4ZY6A 3VBWA 5IUIA 1PRYA 1T45A 2YCRA 3BBWA 4DC2A 4EI4A 3DXQA 3CJGA 3AOXA 3ENMA 4E4MA 4OR5A 3PJ1A 2C6KA 2WMTA 5AP4A 4V01A 4I6HA 4DGMA 3C4XA 5DI1A 4AT4A 4DFYA 4V0GA 2EXMA 4A9RA 4GS6A 3C13A 4AA4A 2GQSA 3F69A 3OUNB 4IX6A 3NX8A 4LOOA 1Q8ZA 3A60A 3EYGA 4QTAA 3RGFA 1SMHA 4ZEGA 2BRMA 3VUMA 4K8AA 4ALVA 2C3IB 5CZHA 4I6BA 4A9TA 2E9VA 3QHRA 2GFCA 1V0OA 4BTMA 3ZSIA 3R9DA 4NM0A 4M0YA 3TZ7A 3MN3A 2PVKA 4FC0A 4MXAA 2IW8A 1K3AA 3BCEA 3FLYA 4DBXA 2YM7A 4GMYA 3MPMA 4BL1A 3HZTA 3FBVA 5D12A 1IASA 3BYSA 3FE3A 2V7AA 2X7OA 4OT5A 3W2SA 1KWPA 4PNIA 5DMZA 3L8XA 4FT0A 4I4FA 4UB7A 5G6VA 5IQAA 2V55A 3EFLA 4FSQA 3LJ2A 5ETFA 3FXZA 3LLAA 4I6FA 5L6PA 5LARA 5LVOA 3OY1A 4U41A 4EEVA 5F95A 4K2RA 5CALA 3ZDIA 3DV3A 1GZOA 3SKCA 2YISA 4ITIA 3PIXA 1U46A 3BGZA 2OXDA 4ZLZA 4MBIA 3I7CA 4JG8A 3ZFYA 5FP5A 4X2GA 2XNOA 4GG7A 4NYEA 3CC6A 2JAVA 4RLLA 4CTCA 3DFAA 3KRRA 2R3LA 5C01A 2BILB 4FTRA 5FM2A 3ZUVA 4BWXA 5E90A 3NIZA 4GJ3A 3VF9A 4DH1A 4WOVA 4IVDA 3VQUA 5AR2A 2HY81 4F6WA 5AJQA 1PHKA 4KRCA 5K4IA 3TDWA 5DEWA 2E9NA 1OECA 1XH8A 4MCVA 1M17A 1P5EA 4C4GA 5HCZA 3UO6A 2XIZA 2Y6OA 5E8SA 5AUTA 2WEVA 2E2BA 2Z7QA 1QPJA 3GGFA 4MVFA 5FBNC 2OXYA 3SOCA 4RLKA 3P23A 4GEOA 1KUTA 3PLSA 4IQ6A 2X81A 1YDTE 3FI8A 1JSVA 5TOZA 1UV5A 1XO2B 3EZRA 3Q4UA 3Q04A 3ATTA 4GU6A 2CDZA 4FNYA 2C0OA 4O86A 3O96A 3QXOA 4QD6A 3VJNA 5J95A 5GIOE 4CCBA 4DAWA 3QTUA 3UQCA 3IK3A 4XCUA 3TKUA 4D9UA 2R0IA 5CEOA 5EKOA 4FKUA 3ZSHA 3TACA 4BDHA 4XG8A 4EJNA 3BU6A 2JEDA 1W7HA 3RHXA 4MTAA 3PUPA 3QKLA 4FG8A 5M4FA 5J9YA 2UW8A 3ZHPC 2A0CX 2XKCA 3CQEA 3UNJA 2WELA 3IDBA 4FI1A 4YSMA 1OL1A 2C3JA 5GJDA 4FNWA 2OO8X 2PTKA 5CU4A 5ANGA 2IW6A 4GRBA 3F7WA 3WF8A 3ZXZA 1QPEA 1Z57A 4Y5QA 2CNUA 2EB3A 1M2PA 1UU3A 3EL8A 2GS7A 4EK6A 1OUKA 4G31A 4CGAA 2XIKA 4QMPA 4QYFA 3LFBA 5CASA 5LQFA 2R3KA 2W7XA 3QAME 5JFSA 5CSVA 3D5UA 3E3BX 4FF8A 4X2NA 5BNJA 5KBQA 2PVRA 4B7TA 4EQCA 3G5DA 2VX1A 3MGYA 3BLQA 4HYHA 2RFSA 5AR8A 5AUWA 2WMWA 4HVHA 5L4QA 5DBXA 4G3CA 3R7UA 5LVMA 1JBPE 4DH8A 2PVMA 1R39A 3AMYA 3Q53A 1ZY5A 3HKOA 5CAVA 2XB7A 2C1BA 1BI7A 3PXZA 5ANJA 4ZXTA 3W2QA 4UN0C 4BCKA 5HX8A 1LR4A 2JIVA 4V04A 4KKGA 1OKVA 4CEGA 4DGLC 3IPHA 5AP2A 4ZLYA 4FKTA 3ORZA 4BHNA 2OF4A 2XK4A 3QLGA 2BKKA 5HG7A 5ANIA 5B0XA 2CN5A 2P0CA 1O9UA 5H8EA 4JI9A 4CD0A 3PP0A 1XWSA 1H1PA 2VTJA 3C4EA 4NTTA 2IWIA 1BYGA 3KF7A 4C4EA 3EMGA 4G3FA 3S95A 4DH3A 5HLWA 1W82A 2XKEA 3MA3A 2JDRA 4KS8A 2BHHA 3MY5A 4NIFA 3TG1A 2W06A 4D4YA 4L44A 5D9HA 3NUPA 5FXRA 3RCDA 1OL2A 5IEXA 3F3UA 3PVWA 4F9CA 2C30A 4A9SA 3OTUA 2RFEA 1KE8A 2J50A 3R21A 4O0WA 4O7RA 3NCGA 5I9XA 2DS1A 4O7WA 3UP7A 2LGCA 2HOGA 5FXSA 1M7NA 4EWQA 5KMJA 4FT3A 5ANDA 1DAWA 3HEGA 2PVLA 4V05A 4FX3A 1RQQA 2QLQA 3R9OA 5M44A 3W16A 2WO6A 2YITA 2QOCA 5HNIX 3DAJA 5M53A 3D14A 4BN1A 4JRNA 3W2CA 2CGVA 3O50A 4HCTA 1YI3A 3S0OA 3NZ0A 3RJCA 4FTQA 4EJ7A 2PMIA 4OTWA 4EHVA 4YUQA 4OT6A 3R7EA 2ITUA 3RAIA 4ZZOA 4ZS0A 3FJQE 4WRGA 3OXZA 4MNEB 4AZEA 3RVGA 3F5GA 4EQMA 4EH2A 2Z7SA 3FZPA 5GNKA 3Q96A 4RIWA 4G5PA 2XCKA 4N57A 3I5ZA 4RGJA 3DY7A 3RAWA 5HG8A 2XK3A 3LPBA 5EDQA 4ZAUA 2PUIA 3F82A 2HWOA 5HKMA 3DDPA 2GNFA 3R9NA 4BCGA 4FOBA 2XUUA 3UODA 4HCVA 2UZWE 2W1CA 4YHFA 3PSBA 4RVLA 2VWIA 5AUVA 3HUCA 4ANLA 2CKQA 4FV2A 3F2RA 4S32A 4R3RA 3P5KA 2J90A 3A8WA 4FBXA 4BBFA 4ZTMA 3DNEA 4QP1A 4QP7A 2VWVA 3NUUA 3U51A 4M14A 1JPAA 2QVSE 4FZAB 4AN3A 3TM0A 1PXKA 3PVUA 4H1MA 3CPCA 3HNGA 4FVPA 3LVPA 4BZNA 3UJGA 4PDYA 3NR9A 3KGAA 4QMYA 4YJTA 3IG7A 5KNJA 1DI9A 1LEWA 2J5FA 3UVQA 4XG9A 3RK9A 3D94A 3E8NA 3JVRA 2NO3A 3FY2A 3F2AA 4KWPA 3TEIA 2A4LA 3D5WA 3ANRA 5AA9A 1ERKA 3VVHA 4QP2A 3MVLA 4J98A 5DRBA 3C0IA 1XH5A 4QPAA 5AAGA 4FZDB 2ZV8A 3G2FA 4FKJA 5AEPA 1OBDA 3FZSA 4K6ZA 3KN6A 4APPA 4YMJA 5IA1A 4FEXA 2VO6A 4QMZA 2R7IA 3DKCA 3JS2A 3TV6A 4XLVA 4Q9ZA 3PZHA 2XIRA 2ZDUA 3MFTA 3PPZA 1XBAA 4O96A 2B7AA 1OM1A 5K0KA 4DBNA 3V5QA 4DITA 3UOJA 5FRIA 4ENXA 4QMLA 1OKWA 4RZVA 3EN5A 3TNPC 4NTSA 4D2VA 4UALA 3U87A 4EH7A 3FMJA 3EHAA 2I40A 4U8ZA 5FGKA 1JWHA 2O63A 5CY3A 5IQCA 3NSZA 1NVQA 4NSTA 2ETMA 3W55A 3W10A 1SYKA 1ZZLA 5L6OA 3RKBA 3V01A 5EM7A 2NPQA 4RVTA 3UZTA 2WTWA 5CSWA 5CENA 4QYEA 1KE9A 3I1AA 5CX9A 3R8MA 3R7IA 3TNQB 5HTIA 4YJPA 1ZAOA 2YCQA 4GKIA 3OG7A 5TO8A 2RF9A 4FVRA 3KC3A 4BDEA 3LM5A 1TVOA 2VTHA 5LWNA 3FLQA 3HV5A 3FC1X 1V0PA 1MUOA 4TYIA 5HVJA 2UZLA 2UUEA 1QPDA 4IAIA 4L43A 3KULA 4EOJA 3UYSA 2QG7A 1M7QA 2QOIA 2YA9A 2YM6A 3E92A 4BBEA 4D5KA 3D2KA 2W4KA 3BYVA 4NFNA 3JUHA 5J87A 1TQMA 4XHKB 3V5TA 2X39A 3PZEA 4JQ8A 5KBRA 3W2PA 5AV4A 3WF5A 4F1TA 3OS3A 1REKA 5EHOA 4ZZNA 1PXLA 3PTGA 2HZ4A 3F88A 2WMUA 4M67A 2QKRA 3AQVA 3MBLA 4DA5A 3FMNA 1VYZA 4CFXA 3CTHA 1WMKA 4PTCA 3CGFA 3DKFA 4L52A 5CVFA 3UOLA 2RSVA 3AD4A 2JKKA 3E87A 4ASXA 4BC6A 3WZJA 4EZ3A 4CG8A 3AC8A 2OWBA 3BGQA 5EH0A 4N6ZA 4DLJA 3NS9A 5IISA 3OCSA 1WVXA 3NYNA 4FE2A 4H58A 4M12A 1UKHA 4XV3A 3LCKA 4KIKB 4UV0A 4MEDA 4OTGA 4MWHA 1OKZA 5A4TA 1J3HA 3BYUA 2ACXA 2Z7LA 5IEYA 2FSTX 4UY9A 1VZOA 2BVAA 3H10A 2X8EA 5HOAA 3P7CA 4FTOA 5CYIA 1UU8A 5I9WA 2Y6MA 4P2KA 5M57A 4XBUA 4TT7A 4QP6A 3VN9A 1SVHA 4C62A 4N6YA 2VTSA 4O38A 3CPBA 3KMUA 4F9YA 4BDJA 2PSQA 3D9VA 4S34A 3VUDA 3SA0A 4EWHA 5I3RA 3DTCA 4X6QC 4IB5A 4UMRA 5JN2A 4LRJA 5CNOA 5JZNA 4ANMA 1A9UA 3LFFA 3RALA 3UZPA 4HNFA 3OT3A 4I3ZA 4TTHB 5T6KA 1FPUA 4ASZA 2Q0BA 4G5JA 3ZM4A 4USEA 4MWIA 3HGKA 3BKBA 4QMMA 3RM6A 2C47A 4OTIA 4Y46A 4C7TA 4FSMA 4W4VA 3FDNA 4YHJA 3VO3A 1BLXA 2R3QA 5C9CA 2X4ZA 4I5CA 4C0TA 3RINA 3FMLA 4FV3A 4DEDA 4BCPA 1CTPE 3MB7A 2Z02A 1ZMWA 4IM3A 4J95A 5EM5A 2ITZA 3UNKA 3PP1A 4GL9A 2PZ5A 3VS5A 3GU7A 1FQ1B 1XBBA 5HEZA 3WZUA 4O7YA 1PXPA 2JD5A 2OZAA 4G3GA 4PTEA 2WIPA 2C5YA 3TZ8A 3DU8A 3GU8A 4D4VA 4M3QA 5JRQA 3SXFA 4NWMA 4FV9A 2WEIA 4U81A 4LYNA 4O6EA 2QD9A 4QNYA 3R22A 3E93A 3KRLA 3MESA 2WMXA 3F6XA 3A8XA 5CI7A 3R73A 1YKRA 2FSOX 2FYSA 4Y83A 5EHLA 2HZ0A 3I7BA 3NCZA 5EW9A 1YOJA 4D55A 5KKRB 2B9JA 3G0FA 1YDRE 3NAYA 4AW5A 4CRLA 4C59A 4F0GA 1WBSA 2ZYBA 4PPBA 3SV0A 3SGCA 2VTRA 2PZPA 4WBOA 2UV2A 4X2KA 1YWNA 2OIDA 2Z60A 3QBNA 4FUXA 4NUSA 4JDIA 4QMTA 3G15A 4IEBA 3PJCA 4ZTNA 1UNLA 3B8QA 2WXVA 4DG2E 3QHWA 3VUKA 4FEVA 4QRCA 5C4KA 4OAVB 2X7FA 1XQZA 3MWUA 2VTMA 3DBCA 2EWAA 3QTIA 3DB6A 3R71A 4O27B 4ACDA 1ZOGA 4RIOA 4C2WA 3MW1A 3Q6WA 3ZONA 3JVSA 1PXIA 2XEYA 5ANOA 3EQDA 3VUTA 3O8PA 5B2MA 3U54A 3F3TA 3ZDUA 3D7TB 4MF0A 4KSQA 4BGQA 4CFVA 2OLCA 3IW8A 4Y85A 4C37A 4TKSA 3WYXA 4W9WA 3IW6A 4GFGA 4M8TA 4U9AA 5EYKA 3FKNA 5CQWA 5KX8A 4AZTA 4TY1A 2SRCA 2VU3A 2NNWB 2G2IA 4AWIA 1P14A 2F7ZE 3WE8A 3PLAE 4FMQA 2CGUA 4GJ2A 5B2LA 3HV3A 3HMOA 2R2PA 1BUHA 2YJSA 3TUCA 4LL0A 5CAQA 4X7QA 2IVTA 3BX5A 3CTJA 3FMKA 3OC1A 4V0GB 3QLFA 4LM5A 2C6EA 3R7YA 3EQGA 4JBPA 4NFMA 4F1MA 4PDOA 2QO7A 3D5XA 3HMNA 3OVVA 4UBAA 3WF6A 2J0LA 2BDFA 4QP3A 4TWCA 5TR6A 4WUAA 2C6IA 2YM8A 3UZRA 3LFQA 3FL4A 1OITA 3SG9A 3DFCB 3W8QA 3FZTA 4A06A 5LWMA 1U59A 3QZHA 4I5HA 1ZMVA 2GHGA 2PYWA 2YCSA 2QOFA 3IW4A 1PY5A 3D2IA 4IZ7A 4BIDA 4DINA 4YU2A 4O7NA 4BIEA 3O7LB 1OPJA 4IWOA 2EVAA 3LW0A 3ZOSA 4C58A 2WTJA 3QQGA 3PXKA 4QMQA 3HRFA 4ZIMA 3WYYA 4RMZA 3AT4A 3MI9A 2UZOA 1Q3WA 3KF4A 4HPUE 4LGHA 3RMFA 4AT3A 1STCE 4E8AA 2YZLA 5DR9A 5C03A 1YXSA 3SQQA 2HWPA 2OG8A 5GHVA 5CU0A 3QQHA 1Q99A 3CGOA 4EH3A 5LVNA 2E9PA 5BVOA 4JIKA 3MDYA 4DLIA 5KCVA 2YIRA 4CMOA 4R6VA 3WIKA 4M7IA 3HRBA 3UC4A 2YEXA 2A27A 4AACA 3WZKA 3NW6A 2XJ0A 4F08A 5IMXA 1YXTA 3LJ0A 4K0YA 5EYMA 4RVMA 3GCPA 3IS5A 5CU6A 2OJGA 2W1IA 2CKOA 1WVYA 3F3ZA 4I4EA 4FTLA 4TYHA 5FP6A 4U45A 2XK8A 3BYMA 2VTAA 4JX7A 2JKOA 3LFNA 3SW7A 3GEQA 3QC9A 2UW7A 2QLUA 4ANNA 4BVUA 4EC8A 2R3HA 2QR8A 3ZEWA 4RQKA 4ACHA 4PRJA 1MQBA 4IWQA 2W1EA 4RFMA 3CQUA 3ORIA 4CKIA 4D5HA 1SNXA 4IC8A 2UZNA 4UXLA 2WGJA 1SVEA 3L9LA 4CRSA 4AW1A 2XA4A 4AW2A 3F3WA 5IH4A 3MH0A 4MXYA 3OCBA 5E91A 3V6SA 4WKQA 2DUVA 4ZJIA 4R8QA 4TYEA 4QOXA 3KXGA 3RAHA 3TN8A 4YJOA 2X2MA 3QCQA 2C68A 3ZUTA 3FPMA 3Q52A 2GS2A 3GCVA 3W2OA 4BRXA 3E8CA 5JEBA 5E92A 3IOKA 4G3EA 3D83A 1W83A 4FK3A 2Q0NA 1YVJA 3Q60A 1FMOE 2X2LA 3PY3A 3KRJA 3R7GA 3SLSA 2J51A 2RL5A 3QL8A 4BKJA 3PE1A 4DGOA 2EU9A 1KE6A 1ZYDA 4WG5A 3GCUA 5K4JA 2F49A 5TKDA 1XH6A 4ASDA 4BCHA 4G6LA 3QGWA 3S3IA 2HELA 2ZDTA 3RK5A 4X21A 4AQCA 4FZ7A 4I0SA 2C6TA 1UWHA 4R7HA 1IRKA 2C6MA 1DAYA 3VBQA 3CD3A 2QU5A 3BE2A 4K77A 3CQWA 5IDNA 4O6LA 5AM7A 1Q97A 4U40A 1UU9A 3O51A 3ELJA 1UKIA 3KXHA 2QOLA 4W4XA 4BI2A 3NUAA 2X7GA 3FMEA 3CP9A 3TZMA 3DLZA 4TWOA 3FKOA 4L01A 4PP7A 4IADA 3TUBA 5GJGA 3OROA 2XZSA 3A7IA 3MY1A 2PVJA 3WARA 2HYYA 4ZMFA 5J8IA 3HV7A 3COIA 4ZZMA 3PXRA 1JSUA 2BZKB 5CEQA 3CS9A 3F9NA 1YRPA 4RWJA 4QP4A 2V62A 5A6NA 3MA6A 3G0EA 4JVGA 4PP9A 4A7CA 5GINE 4E6DA 2XK7A 3R6XA 4AG8A 1KOBA 3GQIA 1NY3A 3ZUUA 4AA5A 3G33A 1OIYA 3TL8A 2JLDA 4HJOA 3U9CA 4FV0A 2RFNA 4PV0A 4D2TA 2X6EA 3VHKA 3PPKA 4I94A 4U80A 3MTFA 3OY3A 3RCJA 4ORKA 3GC0A 3P1AA 2YCFA 4M15A 3Q4ZA 5AX9A 5HI2A 5HG9A 3ORMA 4BDCA 4FKGA 4KBCA 3QZFA 3GC9A 2FUMA 4IFCA 5IQIA 3QGYA 3LKMA 5CS6A 4Z9LA 5L2QA 3MIYA 3O0GA 4XP2A 4O21A 1S9JA 3HL7A 4RJ5A 5BYZA 5CU2A 3VBXA 3LLTA 2VTLA 1ZY4A 3K3JA 4NIFB 4QTCA 4RJ7A 2FSLX 2J9MA 4XMOA 5JFVA 3D5VA 5M07A 3QC4A 4G16A 1CDKA 4WSQA 4TNDA 3NPCA 3R1QA 4I1ZA 3U6JA 2BUJA 2J2IB 3O8TA 4IIRA 2VWXA 3TTIA 2VWBA 2YIXA 4JT3A 3FQSA 4C4JA 3ZZWA 2IPXA 3UVRA 4D0WA 5CT7A 4A9UA 4U5JA 2W5BA 2REIA 2WQOA 3CE3A 5FTOA 3WI6A 1FBNA 1APME 1KSWA 5M09A 3FY0A 3A2CA 3W1FA 3WOWA 4OTDA 4YJUA 5L3AA 1QMZA 2R4BA 2XYUA 3ZC5A 4BFMA 2B1PA 2CGWA 2VGOA 3QWJA 1KE5A 5DOSA 1J1BA 4I5PA 3TCPA 2GCDA 3MS9A 2XK6A 3I0OA 4C61A 4DEGA 3VUHA 4R7BA 3TKIA 2R5TA 4Y5HA 4DEBA 2Y4IB 3PIZA 2Y4IC 3FUPA 3L9PA 4M68A 4IM2A 4AN9A 2PMOX 2IVSA 3FYJX 4JLCA 2O65A 4C33A 4CFFA 2VN9A 5I9ZA 5IA4A 3K2LA 3CKXA 4ZLOA 5JRSA 5E1EA 4RIWB 3NNUA 1FMKA 2B9IA 2HXQA 3ORTA 4GIIA 2GSFA 4MXZA 1Z5MA 2I0VA 2VWUA 1Q62A 3DDQA 4EH5A 1OVEA 3PVBA 2J6MA 4IWPA 5E1SA 4U42A 5E4HA 5DT0A 3VF8A 4IBMA 1ATPE 4O0TA 3AT3A 4HYSA 5DFPA 2WMAA 4BCOA 5JGDA 5J5TA 4DFBA 4C57A 2XNEA 3HDMA 3LM0A 3OMVA 4UX9A 3DJ7A 2YIWA 5L8KA 5A14A 4S31A 3LXLA 2OSCA 3QQKA 5LCJA 1FVRA 2PUNA 2PZYA 3EN9A 4QPMA 5CF5A 4NL0A 1URWA 4AN2A 5AADA 5GZAA 2IN6A 4GW8A 3EQRA 1M14A 3P08A 3PXFA 4J8NA 4L6QA 4YZBA 3L1SA 5EQPA 4HVGA 2F7XE 2J0IA 4YJSA 3UE4A 4KKHA 3LE6A 3RNYA 3VW6A 4E5BA 5E8XA 4B4LA 5JK3A 2P2IA 5L2WA 4IANA 4LV8A 4PMPA 2EUFB 4IAFA 4G2FA 4BYJA 3GU6A 4XP3A 3VS4A 4F6UA 2XBJA 4JBVA 5IDPA 3R2BA 5DIAA 2OF2A 4ZJVA 2A2AA 3II5A 3OXIA 2FA2A 2IVUA 2UZBA 3C1XA 4RJ8A 3MSSA 2WQMA 4GIHA 4W4WA 2EXCX 4L7SA 2UZEA 4FIIA 3JXWA 3LFCA 5C8KA 4YC3A 5AV1A 3KCKA 2ZV2A 4F1OA 4A9YA 3RNIA 3GU5A 3HX4A 4DFNA 3RZFA 5BUEA 2H96A 3E8EA 3NIEA 4ALUA 4ALWA 4YR8A 2W4JA 5HG5A 2NRUA 2ITOA 3MIAA 2JBPA 5BQ0A 4JR7A 2GPHA 5DT3A 1ZMUA 4FKQA 4WD5A 5D11A 4BR3A 1AQ1A 3GCSA 3ZH8A 3WZDA 5M4IA 1A06A 4PUZA 3HP2A 3PXQA 2PE1A 2VTTA 3KY2A 3QA8A 4FT7A 3WF9A 2WU6A 5IMEA 2QOQA 4NU1A 5A6OA 4HZSA 4FNZA 4NM7A 4G6NA 2W96B 3KRWA 3MVJA 3C0GA 2YLEA 4JAJA 3UPXA 1P4FA 3FMMA 3GU4A 1B39A 3DAEA 4RC3A 2WAJA 2WNTA 4RSSA 3KULB 4U6RA 3BHHA 4FKOA 4FVQA 3ZC6A 4AZVA 3EOCA 3WIGA 4RC2A 3E62A 3V8TA 4G9RA 4B8LA 4E6AA 4PL3A 4JL9A 4Y95A 2WQEA 4WNMA 4E5AX 3QQUA 5HNBA 2C6DA 2C5XA 2R3MA 3R7OA 4EH6A 3DK7A 4X2JA 3BU5A 4DF3A 4DCEA 2OICA 1CM8A 1OMWA 4USDA 2PWLA 5F20A 3TKHA 2AYPA 1ND4A 4FUYA 1J1CA 2PE0A 5G1XA 3A7FA 3OP5A 2VWYA 1G3NA 4AF3A 3LZBA 4L53A 3QRKA 2IW9A 3LMIA 4E20A 3NNXA 3QTXA 1YW2A 2ITVA 1XH4A 2HY0A 3QYZA 4B9DA 2AUHA 4CMTA 4DEIA 4EH9A 3PWYA 2CPKE 5L2IA 4ZSJA 4J7BA 2W0JA 4DEHA 3QKMA 4IJ9A 4JQ7A 3VS1A 1VYWA 3NYXA 4FKWA 2QCSA 3RWQA 2BTSA 2B9FA 4BF2A 4O0SA 4LUDA 3QZGA 2XIYA 4NM3A 2BKZA 2WTKC 5J1WA 3TT0A 2V7OA 3I6UA 5M4UA 4FL3A 3FC2A 2F7EE 2CMWA 4CYJA 1NXKA 5BMSA 2P55A 3BHYA 5HIEA 5IQFA 2UW9A 3DXPA 3LMHA 4H1JA 5CEPA 4P7EA 4ZY4A 2FO0A 3H3CA 4ZOGA 3SX9A 4F4PA 3FV8A 1PKDA 4EH8A 4MF1A 3OW4A 1UVRA 2BRBA 3DS6A 4GYGA 4QT1A 4W9XA 3BHTA 5FG8A 4Y8DA 3EYHA 4IDVA 2LAVA 1BL7A 4EK4A 4UZDA 2XF0A 2XKFA 1GZ8A 3UNZA 4E26A 3CY2A 5CAOA 3OZ6A 2OZAB 4XRJA 3ZBXA 3PSDA 4GU9A 4N4SA 4YC8A 5AR7A 5A3XA 4CZTA 4E1ZA 3O8UA 4BY9E 2WMRA 3VS7A 1YHVA 3R83A 2C5NA 3COMA 4U79A 4FTAA 3QWKA 4I6QA 4DH5A 1W84A 2IZTA 1JQHA 3Q5IA 3ZLXA 1OBGA 2UW4A 2I0YA 3BYOA 3LIJA 2YDJA 3AGLA 4FIFA 2PU8A 3IGGA 2QOKA 3FLZA 4FA2A 2ZOQA 3UC3A 3P0MA 3POZA 2JFMA 4A07A 3DTWA 4K11A 1K2PA 3ODZX 4ZTSA 5T68A 4ACGA 5CU3A 1JKLA 4QMNA 1LP4A 5E8WA 3D15A 2OBJA 4KBKA 4ZTLA 5JFXA 4LI5A 2BMCA 1JAMA 4FSUA 5JGAA 2PL0A 2GTNA 3OF0A 4Y72A 3MFSA 4CFNA 3V5LA 4IVCA 5CZIA 4JQEA 4KRDA 4AU8A 4C3RA 3TV7A 2IZUA 3C4FA 4I0TA 4EORA 3A7GA 2JKMA 3E3PA 5AFVA 5CWZA 4RX9A 2QURA 4RA4A 3M11A 4PMMA 3ZTXA 4IZAA 5CEIA 4C8BA 3ERKA 5IQGA 3AGMA 2PK9A 3ITZA 4KABA 4RVKA 4S33A 2GNLA 3Q6UA 4RWLA 4JDHA 2BCJA 4QTDA 3WF7A 5HHWA 2XYNA 4CNHA 5C26A 5ICPA 3R04A 4O2PA 3G6HA 2XNPA 2VTNA 2H6DA 5L6WL 5BYLA 3VNTA 3A61A 4TWPA 5I4NA 3OHTA 1U5QA 5CTPA 3BZ3A 3GUBA 5E8VA 5JSMA 2BAJA 3UPZA 3I79A 2BZIB 5AIRA 2W4OA 5HE3A 5F9EA 5KMIA 1YI6A 4AS0A 3MJ1A 4E4NA 3NAXA 1SM2A 4M97A 4WT6A 2QU6A 4CQEA 5CEMA 1OUYA 4FSWA 4BKYA 4O83A 2C0TA 5CF8A 2WTIA 4FIGA 4FSYA 4YBKA 2XBAA 3K5UA 3R9HA 3ZZEA 1WBOA 2CLQA 3KK8A 1Y6BA 5E7RA 5CSPA 3GC8A 1LUFA 4HGTA 3MY0A 1YI4A 3IDPA 5ETCA 4YTIA 5BUJA 4YHTA 5AV3A 1P2AA 1JSTA 5DG5A 5A46A 3UOKA 4UYAA 4MX9A 4LGGA 4HYUA 3PDTA 4HCUA 1IR3A 4EZ7A 4QYHA 4O82A 5DEYA 4J99A 5FD2A 2WMVA 1NW1A 4CT2A 3COHA 4ZSEA 1YOMA 1JKTA 4RZWA 2WQBA 4QMOA 2JC6A 5IQHA 2PULA 4LFIA 3ZBFA 4A4XA 1U54A 2PPQA 3LMGA 4GT3A 5C4LA 4JS8A 1PXJA 2W99B 4CYIA 2GFSA 2C5VA 4U44A 5HESA 2ITXA 3TDVA 4NW6A 1OL6A 2VX0A 4JNWA 1OPKA 4EOLA 4GKHA 2UZVA 4R5YA 5JMSA 5AP6A 3FYKX 3FLNC 5KZIA 3BQRA 3O71A 4CV8A 1H4LA 4KAOA 4P90A 4TYHB 4CKRA 3KXZA 3I6WA 1H01A 2W1FA 3OOGA 2QQ7A 1P4OA 1ZYJA 2BFXA 5H3QA 2ITYA 5BVEA 1JNKA 2OU7A 2B53A 1YHWA 5M55A 4RIYA 2WQNA 3QD3A 4FL2A 1UNGA 3KKVA 4XG7A 5HCXA 5HVKA 4Q5EA 4KIOA 4EQUA 3R9RA 3UGCA 2HW7A 4LUEA 3WE4A 3PRFA 1OIUA 3OBJA 3P4KA 3H9OA 5FBOA 3QZIA 5IA2A 1DM2A 4EOPA 3A7JA 5DWRA 4AZFA 4QPSA 1OL7A 4UMTA 4XV1A 3K54A 2XEZA 5J9ZA 2PUPA 4FKLA 3FLSA 4C4IA 4YSJA 5CF4A 1IA9A 5LMAA 4EOMA 1PMEA 5AUXA 4OLIA 3PJ2A 5KMLA 5EDPA 3FXWA 2HZIA 1BMKA 3GT8A 2O2UA 4G1WA 4MBLA 4A4OA 1M2RA 1RDQE 1TKIA 5IQEA 3DKOA 4IB3A 4CTBA 3V5JA 5K0XA 2RIOA 5CAPA 3RPVA 4S30A 3BV2A 2ZB1A 3UG2A 3HP5A 3TWJA 2VTPA 5AAFA 2GHMA 4WHZA 3TI1A 2UVYA 3FZRA 1TQPA 2O3PA 4BDGA 4FTIA 5CF6A 5AP0A 3OXTA 3IONA 1JKKA 2ZM1A 4DEAA 3QCYA 1QCFA 3Q2MA 3Q4CA 3ZRLA 3C51A 3VS3A 3UIMA 3GFWA 5BX0A 5HTCA 2J0JA 3B2TA 3WZEA 3I4BA 4BCNA 3JR1A 2JFLA 3MJ2A 2VGPA 1U5RA 4L45A 1GIHA 2YN8A 4GK2A 4PX6A 5DR2A 3A4OX 2ONLC 2ERZE 3ZXTA 4L8MA 3QX2A 2ZJWA 3GCQA 4EC9A 3ZFMA 3QU0A 3VS0A 4PPAA 4QMWA 5J79A 1CMKE 4DE4A 1L8TA 1ZARA 4GVJA 3D7ZA 3Q9XA 5ETIA 1J7IA 4IFGA 3H0YA 2P33A 2OK1A 3AC3A 3V04A 4NW5A 2GHLA 3QTZA 4FTNA 1LEZA 1RE8A 2I6LA 3VBVA 1HCKA 4FKSA 4MD8E 1G8AA 3OEZA 3EL7A 1CKJA 3RPOA 3C4WA 2A19B 1WBPA 3DJ6A 2I0HA 2J4ZA 4GT5A 3SW4A 5E9EA 3FHRA 2ETRA 4BGHA 4FIJA 5HZNA 4O0XA 4YJQA 5JKGA 1Q4LA 5DT4A 4RIXA 3KVWA 3QUPA 4LV5A 5HO8A 1VEBA 4LG4A 5C8MA 2ITWA 4AZSA 1OI9A 5EW3A 3H4JA 3KK9A 4CXAA 4FEQA 4IC7A 2XM9A 4EL9A 1J7UA 2VAGA 5D10A 3KEXA 4FSZA 4RC4A 2IJMA 2R3GA 3V51A 4ZTHA 4ANOA 4EOOA 2V0DA 5DYJA 3B2WA 4HPTE 5AIKA 3T9TA 4GVAA 1U4DA 3VW8A 5M56A 3C4ZA 1FGIA 1JOWB 3C4CA 3KMMA 4IHPA 4TN6A 4YNEA 2B4SB 4FV6A 2WZJA 2OH0E 3FMDA 3FZOA 2GNGA 4GK4A 4RG0A 3R2YA 1HCLA 1ZWSA 3ATSA 4IMYA 4XRLA 5T3QA 4OBQA 3UQGA 2YDKA 4M69A 1R0EA 4XOYA 4FV4A 4L68A 3AC5A 4ACCA 4HYIA 1IEPA 4XG2A 5AV2A 4FGRA 4MYGA 4RFYA 5F4NA 3NYVA 5ETAA 4WSYA 4YURA 4W4YA 3ULZA 4BDFA 3VJOA 5HE2A 2DQ7X 2C0IA 4L00A 4RJ4A 4HGEA 1G5SA 3NWWA 3BGPA 4YTHA 4DN5A 1H8FA 4IDTA 2ESMA 3U55A 3SVVA 2FGIA 3CD8A 3LCDA 3Q3BA 3HECA 5HLNA 1PXMA 5EK7A 2XVDA 3E63A 3RPYA 5GZ9A 5BYYA 5BVDA 4O7TA 2RKUA 4FIHA 4BYIA 5ANEA 4PDPA 4WNKA 3SXRA 2BIKB 2CSNA 3MH2A 5FTQA 3QUEA 2G9XA 4YJNA 3SDJA 3CXWA 2GNJA 3TIZA 4CFUA 4YPDA 1MRYA 4AOJA 3FHIA 4L3JA 1MRUA 4F70A 3U8WA 3RWPA 4E5WA 2VNYA 2G1TA 3ZRKA 2CN8A 3P86A 5KMOA 1CKIA 4J96A 1Q8UA 3RK7A 5L2SA 3A62A 5M51A 2QO9A 4E4LA 2JGZA 2P2HA 2VNWA 3A7HA 2W5HA 2J5EA 4AAAA 3N4TA 4QTEA 1ZYSA 2CCHA 3NVMB 1O6YA 2XIXA 5AWMA 3FKLA 3QRJA 4ARKA 5DRDA 3LOKA 5IPJA 4UWYA 5AA8A 2X2KA 4BCMA 3EFJA 2CNQA 3ZMMA 4O22A 5HICA 1E9HA 4HZRA 4IW0A 4L3PA 1H0WA 4QQJA 4XBRA 4C38A 3O7LD 3KL8A 3IW5A 2Z7RA 4YZMA 5AM6A 3MV5A 2UW5A 4QO9A 4AT5A 4TL0A 3CTQA 3S4QA 3PG3A 1V1KA 3DT1A 1GZKA 4I93A 4ACMA 4DYMA 5HBHA 4DHFA 4HVSA 5AUYA 3LQ3A 1PMNA 2J0KA 2YIYA 4JIAA 4CFWA 4IJPA 4QNAA 3E88A 5K5NA 5KMMA 4F6SA 3PYYA 5FEDA 3TUDA 3FAAA 5EI8A 4MHAA 4XG3A 3I5NA 2OW3A 2AC5A 3C5UA 3PPJA 4ENYA 4USFA 2ZMCA 2VRXA 1T46A 2OZOA 3LCTA 5DNRA 3PA3A 5IKWA 5EI6A 3HA8A 3HVCA 2HAKA 3BBTB 4E7WA 1FGKA 2W1ZA 3OW3A 1PYEA 3ETAA 5KE0A 3T3UA 3R8ZA 4QYYA 3GENA 4FSNA 4XV2A 2BTRA 2OJ9A 3BEAA 5HBEA 2Y7JA 4ZTRA 4BCFA 4FSRA 4MQ1A 4OTQA 5DH3A 2F4JA 3FMHA 4O81A 3NMUF 3E5AA 4LMUA 4GUEA 4HGLA 3PE2A 4IM0A 1GAGA 3COKA 4PNKA 5FQDC 1FOTA 4RPVA 2QHMA 4FV8A 4UXQA 1SNUA 2E9UA 2QODA 3F61A 2ERKA 2YM4A 3EFWA 3OTVA 3UYTA 2ONLA 4BWPA 3L8SA 4D2PA 4MXCA 3I81A 2B52A 3BIZA 5F94A 4Q9SA 3EJ1A 4F9WA 5B2KA 3TNWA 4RX8A 1WVWA 3OFMA 3QUDA 5KO1A 4F0FA 4BICA 4O0RA 4YPSA 2YJRA 3EN7A 5BPYA 4LL5A 4EUTA 4UMUA 5IH6A 1PXOA 3U9NA 2X1NA 4AE6A 4MBJA 1BX6A 3QX4A 3T9IA 3K5VA 3QQFA 3ROCA 4FK6A 3JPVA 5JZJA 3KRXA 3LAUA 4YP8A 3ZYAA 2FVDA 3HYHA 1AGWA 3EQFA 2XJ1A 4J71A 4RJ3A 4EOIA 5HORA 4R3PA 5HE1A 3NVKI 4II5A 5JT2A 1Z9XA 1BI8A 2J7TA 4GV1A 4E73A 5I9YA 1YXVA 2OJJA 2B0QA 2Z8CA 3NNWA 3QCXA 4TRLA 4RFZA 4F7LA 4FYNA 1QL6A 3BELA 3CJFA 2XJ2A 4WUNA 3QRUA 4AFJA 4DH7A 2G2FA 3UO4A 3UMWA 4EBVA 2R3PA 2Q83A 1GOLA 2R64A 4C34A 2A1AB 2RFDA 4FZFB 4Q5HA 3ZO4A 4QQCA 1HOWA 4DGNA 4ZP5A 4LRMA 3IQ7A 3CLYA 2R7BA 3F5XA 4M13A 3F66A 2X6DA 3LQ5A 4F9BA 1GNGA 1V0BA 4EOQA 3NW7A 3VAPA 3UVPA 4X0MA 3PJ3A 4ZK5A 2YACA 3VS6A 4CLJA 3M42A 1R1WA 3EH9A 3GFEA 4X3FA 5DPVA 4EHEA 4D28A 1H26A 4NCTC 2VZ6A 3ACKA 4MD9E 4R3CA 3FQHA 2QNJA 3H0ZA 4DG0E 1YOLA 4KKEA 1Q8TA 4ZSAA 5A4QA 3RP9A 3Q4TA 3QRIA 4FTUA 2ZM4A 4QQ5A 5D1JA 4ITJA 3RAKA 4DTAA 1WAKA 1H1RA 1B38A 2ITNA 3HMPA 4G3DA 3QRTA 4EK5A 5FLFA 4F64A 4M0ZA 4XP0A 3TJDA 4BTFA 2P4IA 4PPCA 4D4SA 3AC4A 4CZYB 2BRHA 4JG6A 4ANSA 3R00A 2BR1A 4R1YA 4NKAA 5GIPE 4EBWA 3DJ5A 1R0PA 4KSPA 1URCA 4U43A 5CT0A 4WNPA 4IB1A 1I09A 2WHBA 3R1NA 4WNOA 5I9VA 2C5OA 3R1SA 4HOKA 4YGAA 4DGGA 4BWKA 3RZBA 3BV3A 5EKNA 1SZMA 2O64A 4GSBA 3W18A 4H05A 1SVGA 3GVUA 3HAVA 3FSFA 3U4UA 3OEFX 4E3CA 4N70A 2QOHA 4JX3A 1Q8YA 3P7BA 3L9MA 2B55A 1H1QA 2VWWA 3QD4A 4RQVA 4FL1A 2EXEA 3MPTA 4DT9A 3DZQA 1JLUE 1Y8YA 3KU2A 4EKLA 4QMUA 4J1RA 1Q61A 2F9GA 4U3ZA 2HXLA 3S2PA 3F2NA 3RTPA 4WG3A 3OUKA 4K18A 4WBBB 3W2RA 3MTLA 1F5QA 3FI4A 4FG9A 4O7SA 1L3RE 3BWFA 5BVNA 2PMNX 4DFLA 2UW6A 3AT2A 3F5UA 3RPRA 1M2QA 4I92A 5J1VA 3H9RA 3I60A 5HCYA 4BTJA 2BFYA 3FI2A 2UW3A 1FVVA 2YFXA 3DK3A 3RBWA 4RJ6A 4F0IA 4AA0A 1A48A 4KUJA 5M06A 2XRUA 3P78A 3DBQA 4Z3VA 2R3JA 3T8OA 3CKWA 4FT9A 5EG3A 5GJFA 4BCQA 4EYJA 5AUUA 4MXOA 2VUWA 3GC7A 1E1XA 3VBTA 3IGOA 4FEWA 4D1ZA 4KS7A 2PVHA 2W9FB 5AP3A 1PJKA 4TWNA 4FTCA 4YJRA 5C1QB 2QOOA 3PWDA 3DGKA 4QMVA 4I41A 1MRVA 3W8LA 3TJCA 3VRYA 4AFEA 1UU7A 4FKVA 4PY1A 5J5SA 4YLLA 2YABA 3PIYA 4FV1A 4NEUA 4ONAA 4QP8A 4XH6A 2PUUA 4ZJJA 1ZRZA 4C4FA 5BVWA 3EWHA 3IECA 4AX8A 3FZ1A 4Z7GA 5IF1A 5CANA 4O1OA 4HVDA 2F57A 4I21A 4AGWA 3VBYA 4E6CA 2XNBA 3PY1A 1CSNA 5J7HA 2WKMA 4MAOA 3RM7A 1XR1A 2W9ZB 4PWNA 4BDKA 2CLXA 2G15A 3CY3A 3OT8A 2X8DA 4UYNA 4C36A 2C1AA 4JBOA 4NK9A 2OJFE 3HDNA 4L7FA 2JKQA 4R7IA 3DA6A 5HE0A 4IACA 5EW8A 3LQ8A 2GQRA 4UEUA 2OIQA 2BIYA 5IH5A 3KA0A 2XNNA 2IO6A 5CI6A 4CT1A 5CXZA 3OD6X 4O7VA 3TV4A 3F5PA 1M52A 3BLRA 4U3YA 4F7NA 3ULIA 5LMKC 2C3LA 3WBLA 2GNIA 2ZMDA 3P7AA 3BLHA 1W0XC 2Y8OA 3DK6A 3Q9YA 4PL5A 2OI4X 4UWBA 3SRVA 1J7LA 4BI0A 3GNIB 3EQPA 3H9FA 1H28A 2CHLA 4OAUC 1ZYLA 5D7VA 1U54B 4EUUA 1S9IA 3DPKA 4ERKA 1XHAA 1XJDA 4I20A 2BZHB 4IX4A 3UMXA 5JQ8A 4R1VA 3CCNA 4O0YA 3MFUA 4WG4A 5CAUA 4H3QA 3BU3A 2JAMA 2WTCA 3UQFA 3R7VA 4ASEA 4CLIA 3NUXA 2RG5A 5FWKK 4GFMA 4FGBA 4FKIA 3BHUA 4IAKA 3SG8A 3IOPA 4CVAA 5HNGA 3VULA 2Z2WA 5AP1A 4TYJA 4AW0A 2RGPA 4K9YA 4XS2A 3OWJA 4PF4A 5DHJA 3LFAA 5AV0A 3REPA 4JDJA 4RIYB 3MVHA 1GIIA 4RWKA 5JFWA 1O6KA 2Y0AA 4AGCA 3AD6A 4FTKA 2F2UA 4NJDA 3KFAA 1REJA 5B7VA 2UW0A 4S2ZA 2JDTA 3LXKA 2I7QA 3LCSA 4ITHA 4O91A 4FICA 4L42A 5A4CA 2VX3A 5GZ8A 1Y8GA 4JBQA 2R0UA 3GI3A 4DTKA 1KE7A 2CGXA 1WFCA 4F65A 2VTIA 3I0QA 4U0IA 3NW5A 2HW6A 2OGVA 2Y9QA 5I5ZA 4GUBA 4JJRA 1IAJA 3F7ZA 2WTKB 1H1WA 1H27A 1H1SA 2H34A 2PMLX 2PVFA 4NCTA 3ROYA 2FB8A 2C4GA 4FOCA 5ACKA 3V8SA 1YWRA 1Q8WA 2IG7A 5K5XA 2PVNA 3U6IA 2XKDA 2OH4A 2YERA 3N4VA 5KHWA 3DXNA 2IZSA 3ZO2A 2G2HA 2R3OA 4MH7A 4FTTA 1PXNA 4TW9A 4QMXA 3KREA 3UO5A 3HMMA 2BRNA 4GK3A 3FPQA 3G9LX 1F3MC 3JY0A 3OCGA 5DA3A 4BDIA 4FR4A 4CQGA 3PA5A 5JH6A 4YZ9A 2W1GA 5M4CA 4ID7A 4RWIA 4YBJA 4BCJA 4I22A 5HU3A 3QQJA 2CKEA 4J52A 4L46A 1ZXEA 5E8YA 1NVRA 4DFZE 2C6OA 2W05A 3EQHA 3NGAA 5FEQA 5H9BA 3S00A 4FSTA 5HIDA 3CR0A 2WIHA 3GXLA 5A4EA 4BCIA 1Q3DA 1YXXA 3ACJA 2KTYA 2C6LA 3LJ1A 4FYOA 4CCUA 3BWJA 3QFVA 3OCTA 1PMUA 1OB3A 3L8PA 3V8WA 2YWPA 4JXFA 3N51A 1JVPP 4YTCA 4O84A 1R3CA 1MP8A 5DLSA 4KD1A 1OIQA 4GT4A 4QP9A 5IU2A 3HAMA 4U97A 4YZNA 2H8HA 5CLPA 2BALA 2HCKA 3LHJA 4Z55A 1FINA 3QTQA 4H3BA 4D2WA 4EONA 2VO3A 4D1SA 5L2TA 3G6GA 3V5PA 3NDMA 2J0MB 3A99A 4RIXB 3P9JA 2VV9A 2HENA 4FTMA 4JDKA 4APCA 1H0VA 3PRIA 3M2WA 2W1DA 4HGSA 2I0EA 1MQ4A 3A4PA 4NKSA 4YLJA 4I0RA 3VUGA 1KOAA 4B6LA 5KHXA 2ZB0A 3DBDA 4MNFA 5I0BA 5LVLA 4F7JA 4E93A 4D58A 2YIQA 5C8NA 2ITQA 4IZYA 3Q32A 2QONA 3EQCA 4B99A 4IX3A 5EM6A 2XK9A 2QG5A 4HNIA 5I3OA 3N4UA 3ZEPA 4O1PA 5FTGA 2WOTA 4AE9A 4AUAA 5I9UA 5IG1A 5LOHA 1GY3A 1UNHA 1WBTA 4JG7A 1K9AA 4Q2AA 4MXXA 4D0XA 4ZSLA 1J91A 1XH9A 2H9VA 4CV9A 4IB0A 4KB8A 1F0QA 4M69B 5HGIA 3MFRA 2YAAA 4KBAA 4ZSGA 3MVMA 5IEVA 1CKPA 1H24A 2R9SA 3NRMA 5HO7A 1WBWA 1KV1A 2YAKA 3BPRA 3F3VA 5KZ0A 1OGUA 1UWJA 2PY3A 3NLBA 4WRSA 4XG6A 4YZCA 4D2SA 3LCOA 5HQ0A 4IVBA 4ANQA 3G51A 5BVFA 5EQEA 3OOMA 1WBVA 2UVZA 1H07A 2JIIA 2PZRA 2HIWA 2WPAA 4WA9A 2BROA 4ZY5A 5BUIA 2VO7A 1PW2A 2X9FA 2QKWB 4K1BA 2P3GX 3V3VA 2ZV9A 2JDSA 5KUPA 4DTBA 5HD4A 2GU8A 3R01A 4L67A 3Q2JA 2OJIA 3UIUA
chains in the Genus database with same CATH superfamily
2PZIA 4GG5A 4XEYA 1Q24A 3EZVA 4OW8A 3OBGA 4PDSA 2YM3A 5C27A 3G90X 3R8UA 4W8EA 2BRGA 2O8YA 5DN3A 2GTMA 2XP2A 3B8RA 1ZLTA 4ANBA 5LMKA 1W8CA 3HRCA 3O23A 4ZTQA 3R8LA 4RX5A 3IO7A 4IAYA 4QMSA 3LFEA 3VUIA 3SC1A 3W33A 3GBZA 4BIBA 2JDOA 5AR5A 3HUBA 2ETKA 4FKRA 3EQBA 3U4WA 4IWDA 4KINA 2VTOA 5FDPA 3TTJA 4H39A 1Y91A 3SXSA 2QI8A 4FODA 2BZJA 2NRYA 4A4LA 4RT7A 4KA3A 3ZM9A 4H36A 5E8UA 3JY9A 5ACBC 1KV2A 4YTFA 2E9OA 4LOPA 3ZLYA 5FEEA 4I6LA 3KB7A 5FXQA 1ZZ2A 3TIYA 5CNNA 4I23A 5EHYA 2DWBA 3PY0A 1OL5A 3MH3A 2WMQA 2XNGA 4OUCA 4UMQA 4LQMA 3VS2A 3L8VA 4XOZA 2YHVA 3ZCLA 5IUGA 3CIKA 4F63A 4KIPA 2YDIA 3PFQA 5J7BA 4D9TA 4NT4A 2WOUA 4TZRA 2QHNA 3FEGA 2WTVA 5DR6A 3R8PA 4NH1A 3ENHA 3MH1A 3PXYA 4BTKA 1ZOEA 3ZO1A 1PF8A 4MD7E 5FDXA 3UDSA 3QKKA 4AP7A 4XG4A 4XYFA 2FSMX 2X9EA 3DOGA 3GOKA 5CSHA 3UIBA 4PQNA 2XM8A 2YZAA 4B0GA 2ZAZA 1IAHA 5TT7A 3EN6A 3QCSA 2I1MA 3DLSA 3Q9WA 3SAYA 1PYXA 3QYWA 4MQ2A 4R77A 5IQDA 2B9HA 3UDBA 5HTBA 3LXPA 3DQWA 3PJ8A 5KMNA 3WILA 4GCJA 1YDSE 3DBFA 5CQUA 4OBPA 3S1HA 3DAKA 4KIQA 4EHZA 3C7QA 1OIRA 2WFYA 4O4FA 5DE2A 3EKKA 5AP5A 4YO4A 4M66A 5CEKA 1H25A 3SD0A 3Q5ZA 2XCHA 4FIEA 1R78A 2HZNA 2BPMA 4F99A 4JRVA 2W1HA 4FNXA 2PE2A 5CXHA 5EDRA 3TZ9A 4F7SA 2ITTA 2GNHA 3UTOA 2WD1A 4XUFA 4GH2A 2BAQA 4NM5A 4BBMA 5AUZA 3HV4A 2KULA 2CCIA 2VO0A 1RJBA 2JDVA 3EB0A 3D0EA 3T3VA 2ZM3A 4J8MA 5TE0A 1ZYCA 4CZUA 4IZ5A 3NEWA 4QDVA 4IXPA 3P79A 5HLPA 1W98A 3HV6A 3QD0A 3ZU7A 2ITPA 4NZWB 3U6HA 3QF9A 4AGUA 3LFSA 3LFDA 3FI3A 4RRVA 1DI8A 4YO6A 4L9IA 3AG9A 5L8JA 3R1YA 5IA0A 1LPUA 4W8DA 4TXCA 5L8LA 3HLLA 4ERWA 2X8IA 5LXMA 2GDOA 4NJ3A 3VC4A 4Z7HA 5FM3A 5HU9A 4AXFA 4BJJB 5IZFA 4ZS4A 4AGDA 4N0SA 3DKGA 4UMPA 4G9CA 3ZLSA 3FWQA 5H8BA 5K9IA 4PTGA 4WO5A 4GFOA 4FEUA 4MNEA 2WMBA 1AD5A 5IA3A 4EK3A 1OZ1A 2HK5A 2R3RA 3AD5A 4DT8A 3FSKA 1JKSA 3MPAA 2V22A 2YM5A 3QD2B 4I24A 1GZNA 3IW7A 2BDWA 5LJJA 3ORPA 3NUNA 1UA2A 5KKRC 5LMBA 5TF9A 3ANQA 1NVSA 1Q41A 1NA7A 2ZVAA 5EYDA 3V5WA 2C3KA 4J53A 4XJ0A 4FV5A 1X8BA 4Y73A 4DG3E 4O7LA 1GIJA 2W17A 4C02A 2F2CB 2JITA 4QTBA 5M08A 4FTJA 4EKKA 2X0QA 1I44A 2WMSA 2ZV7A 3E64A 4R5SA 4LOQA 4X3FB 4BGGA 2YLFA 3QQLA 3QTRA 4FT5A 4X3FC 3SHEA 5EI2A 4X2FA 5DGZA 1QPCA 3KXMA 4O0VA 3E7VA 5AR4A 3RPSA 2VWZA 2BAKA 5DVRA 1YWVA 4XNEA 1Y57A 4YC6A 3KMWA 3ALOA 4O0UA 3R0TA 3FLWA 3R02A 4IAZA 1BL6A 2R3FA 3EN4A 3DNDA 4PMTA 4AAYA 2O5KA 3UOHA 2OXXA 3Q9ZA 3QALE 5AP7A 4X3JA 1XH7A 2PHKA 4O2ZA 3H30A 2GMXA 5D41A 3OWPA 4KNBA 3VIDA 4BDDA 2IZRA 2R3IA 4G17A 4TNBA 3KXNA 4JAIA 2UZTA 4AOTA 5JGBA 1Q5KA 4EHGA 3EIDA 1E1VA 2XMYA 2OFVA 2Y4PA 4LMNA 5EYCA 4OTFA 4HVIA 1XBCA 2R3NA 3C50A 3UIXA 2V5QA 3O2MA 2BDJA 5ANKA 3SOAA 3ORLA 4G6OA 2QR7A 2UZDA 3QTWA 3M1SA 3ZS5A 2BHEA 5E8ZA 4AXAA 2OKRA 3ORKA 4JOAA 4BZDA 2X4FA 4P5ZA 3W0PA 4CG9A 1YXUA 2O0UA 1O6LA 2OIBA 4C4HA 4H3PA 4E4XA 3ET7A 5IUHA 4XV9A 5J9LA 2RG6A 2UVXA 3ORXA 3R28A 1XMLA 3ZLWA 3DQXA 4LGDA 2WTDA 3O17A 1PMVA 3QXPA 4OTRA 5FUTA 4BB4A 4YZDA 4FZ6A 4EOKA 3EKNA 4BHZA 4PMSA 2VD5A 1IG1A 5JQ5A 2AC3A 4RA5A 2G01A 3R63A 2W5AA 4IAAA 3ORNA 4CKJA 5LVPA 4D4RA 4G34A 3AMBA 4IE9A 4CSVA 1NT2A 5A54A 5D7AA 4PL4A 4P4CA 4UWCA 2C69A 3TNHA 1RW8A 3AC1A 3NUYA 1WBNA 3D4QA 3EQIA 3PG1A 4P5QA 5E8TA 3PVGA 4OTPA 4WIHA 5EM8A 5AR3A 4JR3A 4C35A 4OGRA 3FL5A 3ZSGA 4XLIA 3RI1A 4CMUA 5EQYA 3THBA 4EYMA 4OBOA 2YWVA 1TFFA 5HBJA 3W0OA 1YHSA 3ZO3A 3BRBA 3EFKA 3KCFA 3HMIA 5HO6A 4FRFA 4YJVA 3AC2A 3UP2A 3BHVA 3R30A 3KN5A 4KIKA 2QOBA 3DB8A 5H2UA 2PVYA 3ALNA 3VQHA 2XRWA 4C3FA 4F09A 4IVAA 1ZOHA 5AMNA 4DEEA 4J97A 5IQBA 1YQJA 4OTHA 4EZ5A 3PSCA 4DCAA 4YLKA 4RBLA 4IH8A 4EOSA 3GOPA 3LXNA 2NP8A 5HD7A 3IDCA 3ID6C 5CVGA 1VJYA 5CSXA 1DS5A 3PA4A 4AOIA 5HX6A 1H08A 1Y6AA 5F1ZA 3FQEA 3QTSA 4FG7A 4TYGA 4F9AA 3W32A 3ZFXA 4IX5A 3L9NA 5EOLA 3C0HA 4M84A 3DCVA 4QYGA 3UG1A 2XH5A 4CFMA 4DFUA 5CVHA 5LCKA 1H00A 4UZHA 3SRVB 5A9UA 3IKAA 3KXXA 1WCCA 4B8MA 1OPLA 3AXWA 3RHKA 2EB2A 5BMMA 5EOBA 4HW7A 3DZOA 3E8DA 1VR2A 4D1XA 2GQGA 5EFQA 5HVYA 3C9WA 3VHEA 4ZMEA 4E6QA 5HIBA 3CSVA 2QO2A 4BKZA 2XS0A 2WB8A 2DYLA 3CBLA 4MK0A 4TPTA 4C3PA 1XMMA 2QC6A 2XNMA 3AMAA 4EH4A 3C5IA 3NUSA 5K3YA 3N9XA 2FH9A 2CNVA 3ZRMA 5AX3A 3JYAA 4BZOA 3OWKA 3POOA 4BDBA 2B54A 4BDAA 5A4LA 5ITAA 4C2VA 4X6RA 3G9NA 1FVTA 3KQ7A 4XX9A 3GQLA 4LRKA 3TNIA 3BI6A 4EK8A 4Z16A 3DBEA 1TQIA 4L3LA 3AKKA 2IVVA 2VTQA 2CKPA 2OFUA 1B6CB 4O7ZA 3MYGA 4BI1A 3OWLA 3BQCA 3K3IA 3NNVA 3R8VA 5KMKA 4AQKA 1BKXA 3CEKA 3NYOA 3FXXA 4U7ZA 2CJMA 3HA6A 4R78A 4K33A 1EH4A 3KVXA 4MKCA 4DFXE 4QQTA 3ODYX 1G8SA 1PKGA 4AZWA 3VRZA 3GB2A 4YNOA 2GS6A 2UZUE 5BVKA 1XKKA 4D2RA 3GP0A 5AAEA 4GYIA 3E7OA 3VWAA 3QA0A 4I5MA 3D7TA 1GJOA 3BEGA 2JIUA 3TXOA 1OKYA 3V6RA 5IA5A 3UBDA 3NFGB 1WZYA 2X0GA 1IA8A 2JBOA 3BE9A 4FV7A 4FKPA 3MB6A 2WU7A 5H8GA 4RX7A 4ZY6A 3VBWA 5IUIA 1PRYA 1T45A 2YCRA 3BBWA 4DC2A 4EI4A 3DXQA 3CJGA 3AOXA 3ENMA 4E4MA 4OR5A 3PJ1A 2C6KA 2WMTA 5AP4A 4V01A 4I6HA 4DGMA 3C4XA 5DI1A 4AT4A 4DFYA 4V0GA 2EXMA 4A9RA 4GS6A 3C13A 4AA4A 2GQSA 3F69A 3OUNB 4IX6A 3NX8A 4LOOA 1Q8ZA 3A60A 3EYGA 4QTAA 3RGFA 1SMHA 4ZEGA 2BRMA 3VUMA 4K8AA 4ALVA 2C3IB 5CZHA 4I6BA 4A9TA 2E9VA 3QHRA 2GFCA 1V0OA 4BTMA 3ZSIA 3R9DA 4NM0A 4M0YA 3TZ7A 1G8JA 3MN3A 2PVKA 4FC0A 4MXAA 2IW8A 1K3AA 3BCEA 3FLYA 4DBXA 2YM7A 4GMYA 3MPMA 4BL1A 3HZTA 3FBVA 5D12A 1IASA 3BYSA 3FE3A 2V7AA 2X7OA 4OT5A 3W2SA 1KWPA 4PNIA 5DMZA 3L8XA 4FT0A 4I4FA 4UB7A 5G6VA 5IQAA 2V55A 3EFLA 4FSQA 3LJ2A 5ETFA 3FXZA 3AKLA 3LLAA 4I6FA 5L6PA 5LARA 5LVOA 3OY1A 4U41A 4EEVA 5F95A 4K2RA 5CALA 3ZDIA 3DV3A 1GZOA 3SKCA 2YISA 4ITIA 3PIXA 1U46A 3BGZA 4F78A 2OXDA 4ZLZA 4MBIA 3I7CA 4JG8A 3ZFYA 5FP5A 4X2GA 2XNOA 4GG7A 4NYEA 3CC6A 2JAVA 4RLLA 4CTCA 3DFAA 3KRRA 2R3LA 5C01A 2BILB 4FTRA 5FM2A 3ZUVA 4BWXA 4FJVA 5E90A 3NIZA 4GJ3A 3VF9A 4DH1A 4WOVA 4IVDA 3VQUA 5AR2A 2HY81 4F6WA 5AJQA 1PHKA 4KRCA 5K4IA 3TDWA 5DEWA 2E9NA 1OECA 1XH8A 4MCVA 1M17A 1P5EA 4C4GA 5HCZA 3UO6A 2XIZA 2Y6OA 5E8SA 5AUTA 2WEVA 2E2BA 2Z7QA 1QPJA 3GGFA 4MVFA 5FBNC 2OXYA 3SOCA 4RLKA 3P23A 4GEOA 2X0PA 1KUTA 3PLSA 4IQ6A 2X81A 1YDTE 3FI8A 1JSVA 5TOZA 1UV5A 1XO2B 3EZRA 3Q4UA 3Q04A 3ATTA 4GU6A 2CDZA 4FNYA 2C0OA 4O86A 3O96A 3QXOA 4QD6A 3VJNA 5J95A 5GIOE 4CCBA 4DAWA 3QTUA 3UQCA 3IK3A 4XCUA 3TKUA 4D9UA 2R0IA 5CEOA 5EKOA 4FKUA 3ZSHA 3TACA 4BDHA 4XG8A 4EJNA 3BU6A 2JEDA 1W7HA 3RHXA 4MTAA 3PUPA 3QKLA 4FG8A 5M4FA 5J9YA 2UW8A 3ZHPC 2A0CX 2XKCA 3CQEA 3UNJA 2WELA 3IDBA 4FI1A 4YSMA 1OL1A 2C3JA 5GJDA 4FNWA 2OO8X 2PTKA 5CU4A 5ANGA 2IW6A 4GRBA 3F7WA 3WF8A 3ZXZA 1QPEA 1Z57A 4Y5QA 2CNUA 2EB3A 1M2PA 1UU3A 3EL8A 2GS7A 4EK6A 1OUKA 4G31A 4CGAA 2XIKA 4QMPA 4QYFA 3LFBA 5CASA 5LQFA 2R3KA 2W7XA 3QAME 5JFSA 5CSVA 3D5UA 3E3BX 4FF8A 4X2NA 5BNJA 5KBQA 2PVRA 4B7TA 4EQCA 3G5DA 2VX1A 3MGYA 3BLQA 4HYHA 2RFSA 5AR8A 5AUWA 2WMWA 4HVHA 5L4QA 5DBXA 4G3CA 3R7UA 5LVMA 1JBPE 4DH8A 2PVMA 1R39A 3AMYA 3Q53A 1ZY5A 3HKOA 5CAVA 2XB7A 2C1BA 1BI7A 3PXZA 5ANJA 4ZXTA 3W2QA 4UN0C 4BCKA 5HX8A 1LR4A 2JIVA 2NYAA 4V04A 4KKGA 1OKVA 4CEGA 4DGLC 3IPHA 5AP2A 4ZLYA 4FKTA 3ORZA 4BHNA 2OF4A 2XK4A 3QLGA 2BKKA 5HG7A 5ANIA 5B0XA 2CN5A 2P0CA 1O9UA 5H8EA 4JI9A 4CD0A 3PP0A 1XWSA 1H1PA 2VTJA 3C4EA 4NTTA 2IWIA 1BYGA 3KF7A 4C4EA 3EMGA 4G3FA 3S95A 4DH3A 5HLWA 1W82A 2XKEA 3MA3A 2JDRA 4KS8A 2BHHA 3MY5A 4NIFA 3TG1A 2W06A 4D4YA 4L44A 5D9HA 3NUPA 5FXRA 3RCDA 1OL2A 5IEXA 3F3UA 3PVWA 4F9CA 2C30A 4A9SA 3OTUA 2RFEA 1KE8A 2J50A 3R21A 4O0WA 4O7RA 3NCGA 5I9XA 2DS1A 4O7WA 3UP7A 2LGCA 2HOGA 5FXSA 1M7NA 4EWQA 5KMJA 4FT3A 5ANDA 1DAWA 3HEGA 2PVLA 4V05A 4FX3A 1RQQA 2QLQA 3R9OA 5M44A 3W16A 2WO6A 2YITA 2QOCA 5HNIX 3DAJA 5M53A 3D14A 4BN1A 4JRNA 3W2CA 2CGVA 3O50A 4HCTA 1YI3A 3S0OA 3NZ0A 3RJCA 4FTQA 4EJ7A 2PMIA 4OTWA 4EHVA 4YUQA 4OT6A 3R7EA 2ITUA 3RAIA 4ZZOA 4ZS0A 3FJQE 4WRGA 3OXZA 4MNEB 4AZEA 3RVGA 3F5GA 4EQMA 4EH2A 2Z7SA 3FZPA 5GNKA 3Q96A 4RIWA 4G5PA 2XCKA 4N57A 3I5ZA 4RGJA 3DY7A 3RAWA 5HG8A 2XK3A 3LPBA 5EDQA 4ZAUA 2PUIA 3F82A 2HWOA 5HKMA 3DDPA 2GNFA 3R9NA 4BCGA 4FOBA 2XUUA 3UODA 4HCVA 5BV3A 2UZWE 2W1CA 4YHFA 3PSBA 4RVLA 2VWIA 5AUVA 3HUCA 4ANLA 2CKQA 4FV2A 3F2RA 3O5AA 3P5JC 4S32A 4R3RA 3P5KA 2J90A 3A8WA 4FBXA 4BBFA 4ZTMA 3DNEA 4QP1A 1OGYA 4QP7A 2VWVA 3NUUA 3U51A 4M14A 1JPAA 2QVSE 4FZAB 4AN3A 3TM0A 1PXKA 3PVUA 4H1MA 3CPCA 3HNGA 4FVPA 3LVPA 4BZNA 3UJGA 4PDYA 3NR9A 3KGAA 4QMYA 4YJTA 3IG7A 5KNJA 1DI9A 1LEWA 2J5FA 3UVQA 4XG9A 3RK9A 3D94A 3E8NA 3JVRA 2NO3A 3FY2A 3F2AA 4KWPA 3TEIA 2A4LA 3D5WA 3ANRA 5AA9A 1ERKA 3VVHA 4QP2A 3MVLA 4J98A 5DRBA 3C0IA 1XH5A 4QPAA 5AAGA 4FZDB 2ZV8A 3G2FA 4FKJA 5AEPA 1OBDA 3FZSA 4K6ZA 3KN6A 4APPA 4YMJA 5IA1A 4FEXA 2VO6A 4QMZA 2R7IA 3DKCA 3JS2A 3TV6A 4XLVA 4Q9ZA 3PZHA 2XIRA 2ZDUA 3MFTA 3PPZA 1XBAA 4O96A 2B7AA 1OM1A 5K0KA 4DBNA 3V5QA 4DITA 3UOJA 5FRIA 4ENXA 4QMLA 1OKWA 4RZVA 3EN5A 3TNPC 4NTSA 4D2VA 4UALA 3U87A 4EH7A 3FMJA 3EHAA 2I40A 4U8ZA 5FGKA 1JWHA 2O63A 5CY3A 5IQCA 3NSZA 1NVQA 4NSTA 2ETMA 2XARA 3W55A 3W10A 1SYKA 1ZZLA 5L6OA 2XANA 3RKBA 3V01A 5EM7A 2NPQA 4RVTA 3UZTA 2WTWA 5CSWA 5CENA 4QYEA 1KE9A 3I1AA 5CX9A 3R8MA 3R7IA 3TNQB 5HTIA 4YJPA 1ZAOA 2YCQA 4GKIA 3OG7A 5TO8A 2RF9A 4FVRA 3KC3A 4BDEA 3LM5A 1TVOA 2VTHA 5LWNA 3FLQA 3HV5A 3FC1X 1V0PA 1MUOA 4TYIA 5HVJA 2UZLA 2UUEA 1QPDA 4IAIA 4L43A 3KULA 4EOJA 3UYSA 2QG7A 1M7QA 2QOIA 2YA9A 2YM6A 3E92A 4BBEA 4D5KA 3D2KA 2W4KA 3BYVA 4NFNA 3JUHA 5J87A 1TQMA 4XHKB 3V5TA 2X39A 3PZEA 4JQ8A 5KBRA 3W2PA 5AV4A 3WF5A 4F1TA 3OS3A 4QEBA 1REKA 5EHOA 4ZZNA 1PXLA 3PTGA 2HZ4A 3F88A 2WMUA 4M67A 2QKRA 3AQVA 3MBLA 4DA5A 3FMNA 1VYZA 4CFXA 3CTHA 1WMKA 4PTCA 3CGFA 3DKFA 4L52A 5CVFA 3UOLA 2RSVA 3AD4A 2JKKA 3E87A 4ASXA 4BC6A 3WZJA 4EZ3A 4QDEA 4CG8A 3AC8A 2OWBA 3BGQA 5EH0A 4N6ZA 4DLJA 3NS9A 5IISA 3OCSA 1WVXA 3NYNA 4FE2A 4H58A 4M12A 1UKHA 4XV3A 3LCKA 4KIKB 4UV0A 4MEDA 4OTGA 4MWHA 1OKZA 5A4TA 1J3HA 3BYUA 2ACXA 2Z7LA 5IEYA 2FSTX 4UY9A 1VZOA 2BVAA 3H10A 2X8EA 5HOAA 3P7CA 4FTOA 5CYIA 1UU8A 5I9WA 2Y6MA 4P2KA 5M57A 4XBUA 4TT7A 4QP6A 3VN9A 1SVHA 4C62A 4DDIA 4N6YA 2VTSA 4O38A 3CPBA 3KMUA 4F9YA 4BDJA 2PSQA 3D9VA 4S34A 3VUDA 3SA0A 4EWHA 5I3RA 3DTCA 4X6QC 4IB5A 4UMRA 5JN2A 4LRJA 5CNOA 5JZNA 4ANMA 4LDTA 1A9UA 3LFFA 3RALA 3UZPA 4HNFA 3OT3A 4I3ZA 4TTHB 5T6KA 1FPUA 4ASZA 2Q0BA 4G5JA 3ZM4A 4USEA 4MWIA 3HGKA 3BKBA 4QMMA 3RM6A 2C47A 4OTIA 4Y46A 4C7TA 4FSMA 4W4VA 3FDNA 4YHJA 3VO3A 1BLXA 2R3QA 5C9CA 2X4ZA 4I5CA 4C0TA 3RINA 3FMLA 4FV3A 4DEDA 4BCPA 1CTPE 3MB7A 2Z02A 1ZMWA 4IM3A 4J95A 5EM5A 2ITZA 3UNKA 3PP1A 4GL9A 2PZ5A 3VS5A 3GU7A 1FQ1B 1XBBA 5HEZA 3WZUA 4O7YA 1PXPA 2JD5A 2OZAA 4G3GA 4PTEA 2WIPA 2C5YA 3TZ8A 3DU8A 3GU8A 4D4VA 4M3QA 5JRQA 3SXFA 4MUQA 4NWMA 4FV9A 2WEIA 4U81A 3UDZA 4LYNA 4O6EA 2QD9A 4QNYA 3R22A 3E93A 3KRLA 3MESA 2WMXA 3F6XA 3A8XA 5CI7A 3R73A 1YKRA 2FSOX 2FYSA 4Y83A 5EHLA 2HZ0A 3I7BA 3NCZA 5EW9A 1YOJA 4D55A 5KKRB 2B9JA 3G0FA 1YDRE 3NAYA 4AW5A 4CRLA 4C59A 4F0GA 1WBSA 2ZYBA 4PPBA 3SV0A 3SGCA 2VTRA 2PZPA 4WBOA 2UV2A 4X2KA 1YWNA 2OIDA 2Z60A 3QBNA 4FUXA 4NUSA 4JDIA 4QMTA 3G15A 4IEBA 3PJCA 4ZTNA 1UNLA 3B8QA 3PFYA 2WXVA 4DG2E 3QHWA 3VUKA 4FEVA 4QRCA 5C4KA 4OAVB 2X7FA 1XQZA 3MWUA 2VTMA 3DBCA 2EWAA 3QTIA 3DB6A 3R71A 4O27B 4ACDA 1ZOGA 4RIOA 4C2WA 3MW1A 3Q6WA 3ZONA 3JVSA 1PXIA 2XEYA 5ANOA 3EQDA 3VUTA 3O8PA 5B2MA 3U54A 3F3TA 3ZDUA 3D7TB 4MF0A 4KSQA 4BGQA 4CFVA 2OLCA 3IW8A 4Y85A 4C37A 4TKSA 3WYXA 4W9WA 3IW6A 4GFGA 4M8TA 4U9AA 5EYKA 3FKNA 5CQWA 5KX8A 4AZTA 4TY1A 2SRCA 2VU3A 2NNWB 2G2IA 4AWIA 3TMOA 1P14A 2F7ZE 3WE8A 3PLAE 4FMQA 2CGUA 4GJ2A 5B2LA 3HV3A 3HMOA 2R2PA 1BUHA 2YJSA 3TUCA 4LL0A 5CAQA 4X7QA 2IVTA 3BX5A 3CTJA 3FMKA 3OC1A 4V0GB 3QLFA 4LM5A 3NFFB 2C6EA 3R7YA 3EQGA 4JBPA 4NFMA 4F1MA 4PDOA 2QO7A 3D5XA 3HMNA 3OVVA 4UBAA 3WF6A 2J0LA 2BDFA 4QP3A 4TWCA 5TR6A 4WUAA 2C6IA 2YM8A 3UZRA 3LFQA 3FL4A 1OITA 3SG9A 3DFCB 3W8QA 3FZTA 4A06A 5LWMA 1U59A 3QZHA 4I5HA 1ZMVA 2GHGA 2PYWA 2YCSA 2QOFA 3IW4A 1PY5A 3D2IA 4IZ7A 4BIDA 4DINA 4YU2A 4O7NA 4BIEA 3O7LB 1OPJA 4IWOA 2EVAA 3LW0A 3ZOSA 4C58A 2WTJA 3QQGA 3PXKA 4QMQA 3HRFA 4ZIMA 3WYYA 4RMZA 3AT4A 3MI9A 2UZOA 1Q3WA 3KF4A 4HPUE 4LGHA 3RMFA 4AT3A 1STCE 4E8AA 2YZLA 5DR9A 5C03A 1YXSA 3SQQA 2HWPA 2OG8A 5GHVA 5CU0A 3QQHA 1Q99A 3CGOA 4EH3A 5LVNA 2E9PA 5BVOA 4JIKA 3MDYA 4DLIA 5KCVA 2YIRA 4CMOA 4R6VA 3WIKA 4M7IA 3HRBA 3UC4A 2YEXA 2A27A 4AACA 3WZKA 3NW6A 2XJ0A 4F08A 5IMXA 1YXTA 3LJ0A 4K0YA 5EYMA 4RVMA 3GCPA 3IS5A 5CU6A 2OJGA 2W1IA 2CKOA 1WVYA 3F3ZA 4I4EA 4FTLA 4TYHA 5FP6A 4U45A 2XK8A 3BYMA 2VTAA 4JX7A 2JKOA 3LFNA 3SW7A 3GEQA 3QC9A 2UW7A 2QLUA 4ANNA 4BVUA 4EC8A 2R3HA 2QR8A 3ZEWA 4RQKA 4ACHA 4PRJA 1MQBA 4IWQA 2W1EA 4RFMA 3CQUA 3ORIA 4CKIA 4D5HA 1SNXA 4IC8A 2UZNA 4UXLA 2WGJA 1SVEA 3L9LA 4CRSA 4AW1A 2XA4A 4AW2A 3F3WA 5IH4A 3MH0A 4MXYA 3OCBA 5E91A 3V6SA 4WKQA 2DUVA 4ZJIA 4R8QA 2XAOA 4TYEA 4QOXA 3KXGA 3RAHA 3TN8A 4YJOA 2XAMA 2X2MA 3QCQA 2C68A 3ZUTA 3FPMA 3Q52A 2GS2A 3GCVA 3W2OA 4BRXA 3E8CA 5JEBA 5E92A 3IOKA 4G3EA 3D83A 1W83A 4FK3A 2Q0NA 1YVJA 3Q60A 1FMOE 2X2LA 3PY3A 3KRJA 3R7GA 3SLSA 2J51A 2RL5A 3QL8A 4BKJA 3PE1A 4DGOA 3BL7A 2EU9A 1KE6A 4DDGA 1ZYDA 4WG5A 3GCUA 5K4JA 2F49A 5TKDA 1XH6A 4ASDA 4BCHA 4G6LA 3QGWA 3S3IA 2HELA 2ZDTA 3RK5A 4X21A 4AQCA 4FZ7A 4I0SA 2C6TA 1UWHA 4R7HA 1IRKA 2C6MA 1DAYA 3VBQA 3CD3A 2QU5A 3BE2A 4K77A 3CQWA 5IDNA 4O6LA 5AM7A 1Q97A 4U40A 1UU9A 3O51A 3W0NA 3ELJA 1UKIA 3KXHA 2QOLA 4W4XA 4BI2A 3NUAA 2X7GA 3FMEA 3CP9A 3TZMA 3DLZA 4TWOA 3FKOA 4L01A 4PP7A 4IADA 3TUBA 5GJGA 3OROA 2XZSA 3A7IA 3MY1A 2PVJA 3WARA 2HYYA 4ZMFA 5J8IA 3HV7A 3COIA 4ZZMA 3PXRA 1JSUA 2BZKB 5CEQA 3CS9A 3F9NA 1YRPA 4RWJA 4QP4A 1W2FA 2V62A 5A6NA 3MA6A 3G0EA 4JVGA 4PP9A 4A7CA 5GINE 3UDTA 4E6DA 2XK7A 3R6XA 4AG8A 1KOBA 3GQIA 1NY3A 3ZUUA 4AA5A 3G33A 1OIYA 3TL8A 2JLDA 4HJOA 3U9CA 4FV0A 2RFNA 4PV0A 4D2TA 2X6EA 3VHKA 3PPKA 4I94A 4U80A 4AXCA 3MTFA 3OY3A 3RCJA 4ORKA 3GC0A 3P1AA 2YCFA 4M15A 3Q4ZA 5AX9A 5HI2A 5HG9A 3ORMA 4BDCA 4FKGA 4KBCA 3QZFA 3GC9A 2FUMA 4IFCA 5IQIA 3QGYA 4O4CA 5CS6A 4Z9LA 5L2QA 3MIYA 3LKMA 3O0GA 3PUFC 4XP2A 4O21A 1S9JA 3HL7A 4RJ5A 5BYZA 5CU2A 3VBXA 3LLTA 2VTLA 1ZY4A 3K3JA 4NIFB 4QTCA 4RJ7A 2FSLX 2J9MA