3LXPA

Structural and thermodynamic characterization of the tyk2 and jak3 kinase domains in complex with cp-690550 and cmp-6
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
291
structure length
285
Chain Sequence
DPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYRVGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Structural and thermodynamic characterization of the TYK2 and JAK3 kinase domains in complex with CP-690550 and CMP-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 285
sequence length 291
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lxpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lxpA01
4EWHA 1ZWSA 4O6EA 4BDBA 2XIZA 3UP7A 1A48A 1R78A 2C6MA 3CPCA 5C8KA 4FKJA 2GMXA 4JL9A 3Q3BA 3ALOA 2ITPA 3IDPA 5AR4A 5CSPA 3AD4A 2YISA 2BIKB 3D94A 3R7UA 1M2QA 4DH5A 1MRVA 5AA9A 2PMIA 2VAGA 1ZOHA 4R77A 2LGCA 4E4LA 4EBWA 4Q9ZA 3G6GA 4FTAA 1H00A 4BL1A 4JRNA 4IB5A 2Z7RA 3FMNA 3U9NA 3QCXA 2NPQA 4FNWA 1L3RE 5M07A 3C5UA 3BE9A 2E9UA 2YAKA 3WZDA 4X3FB 3HMIA 3E8CA 2C6IA 2ONLC 3FY0A 2W5BA 4RC2A 2VU3A 3P7AA 3CTQA 5C27A 1KE9A 4Z9LA 2J6MA 4IVAA 5D41A 5A6OA 4TYHB 3MYGA 2J0LA 4D1ZA 4D5HA 2ERZE 2YCFA 3KXHA 2BCJA 3V6SA 4CFUA 3MA3A 2A2AA 3IO7A 5BVKA 5M44A 5EOLA 1J1CA 1KSWA 2IZTA 3D4QA 3OCTA 4J8MA 3HAVA 1H1QA 3M11A 4IX6A 3V5TA 3WE4A 5CF6A 4FV9A 3ZLYA 4TNBA 4BWKA 4RLLA 1IRKA 2YDJA 4GW8A 4I5PA 5A54A 2PL0A 3MFRA 1KWPA 5DHJA 3ZC5A 5IU2A 3C4XA 3MN3A 4MXCA 4OT6A 4QO9A 2VGOA 1PXIA 2PE2A 3TCPA 1BUHA 4AOTA 1GJOA 4UMRA 4MH7A 5DN3A 2YLEA 3RHXA 3U55A 4KRCA 1P5EA 3E87A 4MXXA 5HTCA 1XH5A 3VO3A 4AZVA 3FZ1A 2VWYA 1J3HA 2WTJA 2GQRA 1JVPP 2UZTA 4MK0A 4L68A 3NGAA 4W9WA 4J53A 1OL6A 1W8CA 5FBNC 4PTGA 4HGTA 4O7TA 3OT3A 2FA2A 4C57A 4EQCA 1B38A 3QCYA 4ZY6A 3VBXA 2C3LA 4EOPA 4DN5A 3VBWA 5JGBA 4R3CA 3OT8A 4TYIA 3GGFA 4BCGA 1G8SA 4E6DA 2HOGA 4HZRA 4YTHA 4EHEA 4PL3A 4KBCA 1GIJA 1SMHA 1YI6A 3IPHA 1JKKA 4G3DA 4MQ2A 3LKMA 1L8TA 4PQNA 4PP9A 2YJRA 4RC4A 4AGCA 3MV5A 4H3QA 5I9YA 4H3PA 2RGPA 3EN9A 4F70A 3V5WA 4CT2A 2J50A 5DIAA 2WQBA 2B4SB 3WZEA 1Q3WA 3FSKA 2KULA 4DT8A 1M2PA 5KKRC 4L43A 2Y8OA 5FQDC 3QU0A 3QWJA 2I0HA 3LQ8A 4X2NA 2QOCA 5HESA 4ZLYA 1ZMVA 1Q99A 4NM0A 4X3JA 1OUKA 4J1RA 3MTFA 1M17A 2YIXA 5AUZA 2IVUA 3RAHA 3LFBA 3KMMA 4FIGA 5HG9A 2IW8A 1FVTA 2RG5A 2VWWA 1ZOEA 4YJPA 4E6AA 2PMOX 2XYUA 3KXXA 2W96B 4NW6A 2QC6A 1QL6A 1UKHA 5EQPA 1S9JA 3A7GA 3LCDA 5M06A 3GU5A 3FHRA 3DTCA 2B9HA 3COIA 3EFJA 4O2ZA 4WD5A 4YSMA 3RNYA 3V51A 4CXAA 4AWIA 4IW0A 4OTIA 3VUIA 3RVGA 3TZ9A 3AC5A 3QUPA 3FC1X 2OZOA 2B0QA 2BHHA 2ITTA 4HW7A 2R5TA 1Y57A 1YXUA 2CCHA 3SRVB 2YZAA 2BFYA 1ZXEA 3UG1A 4O81A 4FTQA 1G3NA 4L46A 2R4BA 3G5DA 4I41A 5EW8A 4FV7A 4M3QA 4FICA 5AAGA 2PWLA 5JSMA 3COKA 3QKMA 3UP2A 4YJRA 2BTRA 5FEEA 3UZPA 4GJ3A 2VZ6A 3FKNA 4GEOA 3F2NA 4NFNA 2Q0BA 3S2PA 4ERWA 2O8YA 4CNHA 1M2RA 5LCJA 4O21A 3Q60A 4IB3A 4L45A 5ETIA 1MUOA 5KKRB 2VWVA 3VC4A 3E64A 1JOWB 4KS8A 5AR3A 4ZS4A 1Q8UA 4FG8A 4X7QA 4PNKA 3N4UA 4MXOA 1IA8A 4RX9A 1WCCA 4DGLC 4IAAA 5CENA 3TJCA 3FMKA 3QTZA 3EQHA 2XK7A 4Q5EA 2CNVA 3CTJA 3V5JA 4RJ4A 3NUPA 2F7ZE 3EN5A 2ETKA 5KNJA 3FYJX 4IZ5A 1DM2A 3HUCA 4CRSA 3DA6A 4X6QC 3COMA 2ZJWA 3SD0A 4XJ0A 2R3HA 1V0BA 3NUUA 3ODYX 3R8MA 3ZC6A 1UNLA 3MB7A 4GH2A 3QQJA 4LMNA 4WIHA 2W4KA 2ZYBA 2IZRA 3BEGA 5DLSA 5DH3A 1W84A 1AGWA 3F2AA 3R9OA 3KREA 4X6RA 3TNPC 4QP1A 2QO9A 5HIEA 3NVKI 4FODA 3CGOA 1URCA 2A1AB 4J8NA 3FE3A 4U80A 1PXLA 4DEHA 4I3ZA 5AAEA 5KCVA 3K3IA 5FEDA 3ZU7A 4JR3A 4Y73A 3R8VA 2VN9A 4IACA 3O7LB 5M4FA 3FMJA 5B0XA 4Q5HA 2QQ7A 1XHAA 4OT5A 3OCSA 4DCEA 3Q04A 4YTCA 2F2CB 1TKIA 4X21A 2UW4A 4KSPA 4EYJA 3EQGA 1W7HA 4ARKA 4CTCA 2ZDUA 4RIWA 4RG0A 3QRIA 4ZZNA 3RM6A 3R2BA 3BYUA 4L53A 4N6YA 3VS3A 5BMMA 2ITWA 3PE1A 4FVPA 2WQMA 4AT3A 2P2IA 2Q0NA 5HO6A 5I9WA 4HPTE 2REIA 3A62A 4O0TA 2YM5A 2PULA 4K8AA 3O8UA 3DDQA 4DE4A 2GNFA 2O65A 5E90A 3BQRA 4BBEA 1WAKA 4K9YA 3IQ7A 4UMTA 4F1TA 3RPSA 1VJYA 3E8DA 2BDFA 4WT6A 3CQUA 1UU9A 4IJ9A 2QHMA 3THBA 4FBXA 4I4EA 3FLYA 4IB0A 3TZMA 4UEUA 4BWPA 4C4GA 4XLVA 3UQFA 3LXPA 3DB8A 3UODA 4GT5A 4YZ9A 3PXRA 4I20A 2UUEA 3Q5IA 4BI1A 4IDVA 4HVIA 3FXWA 5HCXA 2LAVA 3ZEWA 5E8TA 2X4FA 2P2HA 3NAXA 2BZHB 2Z7QA 4HCVA 3R7GA 4A9TA 2NNWB 2ZM1A 4JAIA 1H01A 2QONA 4JX7A 3DK3A 5EDRA 3NAYA 2WTKC 3E8EA 3UMWA 2XNBA 3DPKA 4MNEA 4UY9A 4ASEA 1H27A 5AUTA 4P4CA 4M69A 2ITUA 2Y9QA 5TO8A 4B7TA 4DFZE 3PJ3A 4XYFA 2WXVA 4RFMA 4FNXA 3HV5A 4R6VA 4V04A 3I6UA 1J1BA 1RW8A 3KK9A 4BDAA 4EOQA 5IDNA 5HE2A 5IQDA 2J9MA 2RSVA 4GFMA 1JKLA 2B7AA 4DEEA 4ITJA 2HELA 2EB2A 4U0IA 4F63A 3C1XA 3FMMA 3DZQA 4RIYB 2YM4A 4E93A 2GQGA 4MD7E 2Z60A 2R3RA 3AXWA 3DAEA 4FV3A 4IADA 5CT7A 4OBOA 4ZEGA 5KE0A 3PRFA 3PZHA 4FEVA 3GFEA 5AM6A 4NZWB 1XBCA 4FT3A 4ZJIA 2R3OA 3T3VA 4H36A 3KXZA 4FKPA 1JSTA 1YDSE 2HZNA 4YZBA 5HKMA 2PTKA 4MKCA 2EXMA 5BUJA 1RDQE 3TNIA 3PSCA 1LP4A 5JZJA 4D1XA 3E8NA 3WZJA 1H8FA 1FOTA 2BUJA 4YJNA 1KE8A 4JLCA 5K3YA 4XBRA 5KHXA 1ZRZA 2P55A 2W1DA 4LUEA 4QMZA 4JJRA 2CGUA 2JAVA 4EK5A 5K4JA 2XNEA 4IHPA 5FXRA 2HW7A 2WTKB 4S31A 4DH1A 4EK4A 4YO6A 5AAFA 2YABA 4WRGA 3F5XA 1H08A 3EQRA 2YJSA 3GCVA 4FV4A 4IB1A 4I4FA 4L3LA 4RWJA 3R7YA 3UC3A 4BCOA 4BF2A 3TUCA 4BI0A 3NDMA 4K18A 5A4TA 4IIRA 1VYWA 3C50A 2XM9A 3OBJA 1QPJA 5C8MA 3LCKA 3TKUA 4UWYA 5G6VA 4ONAA 3GT8A 4PPBA 3D7ZA 1CKIA 3F7WA 3Q4ZA 4GJ2A 4V01A 4ZTRA 3VS2A 4ZMFA 3W2RA 4ANMA 4CEGA 3GU4A 4JG7A 2OW3A 4CKJA 5LJJA 4G5PA 4YBJA 4YZCA 3A8WA 5IQCA 3I7BA 4BTMA 3QXPA 4Y72A 4JOAA 3QCSA 4AZWA 4IZYA 2V22A 5CU4A 3V6RA 1YWNA 2WEIA 4AXAA 2UW5A 3R1QA 1YXVA 3WYXA 4W4WA 2NO3A 2QO2A 4GL9A 4LRJA 4QD6A 3UOJA 4NCTA 1UNHA 4I94A 4FKSA 2JC6A 4IQ6A 5CALA 2C5OA 4ZZOA 2B9FA 2R3IA 5CSWA 2YFXA 5HG8A 4EUTA 3C4EA 3ETAA 3FL4A 3I0OA 4PDSA 3E92A 3UIBA 3JUHA 4FSYA 4M8TA 5CSVA 3UOHA 4MWHA 2VNYA 4JQ7A 4EH4A 3ALNA 4BDDA 3HAMA 4WOVA 4J71A 2BALA 3AC2A 4O7ZA 2J2IB 5DT0A 4CMUA 4XRLA 3TXOA 4JRVA 4NJ3A 4B9DA 3DS6A 3TT0A 4FIEA 3P7BA 5LOHA 3LE6A 3AD5A 1ZZLA 3NYXA 2H96A 4R78A 3TIYA 5BMSA 2QR8A 3RINA 3OZ6A 3OTVA 5CAQA 2QOIA 4IVDA 3S95A 3R63A 3PIYA 3BYVA 5L8KA 3EKNA 3RK5A 4E1ZA 2PVLA 3L8SA 4EBVA 2O64A 3U87A 2WOTA 3R21A 3T8OA 5HICA 4PL5A 5IA0A 5AV0A 4C02A 1GIIA 4XV2A 3BWJA 2E9NA 5L6PA 2V5QA 2YLFA 5HIBA 5DE2A 2XIXA 1HCKA 2EUFB 2F4JA 2XS0A 3QLFA 2R0UA 4NSTA 3T9TA 3PZEA 4F1MA 1SVHA 4FTRA 3MFTA 4FNYA 2UZWE 5FDXA 3NSZA 4B8MA 5IG1A 3LAUA 4QNYA 4XG4A 4FK6A 1WBTA 4XBUA 2JGZA 4ERKA 4L7SA 4TN6A 4KSQA 4M0YA 4O83A 4GUBA 1K3AA 4YO4A 3ZRMA 1P14A 2GCDA 2HWPA 2WD1A 5HCYA 3RPVA 4IWQA 3P4KA 4FSMA 2H8HA 3R8PA 4CFVA 3CY2A 4IJPA 3A61A 1OIRA 1GZ8A 3SV0A 3KRJA 4HPUE 4LOPA 4IFGA 4U7ZA 2R2PA 4QMSA 3F2RA 4XP0A 4BHZA 3T9IA 3MPAA 3MW1A 3QRJA 1PXOA 3OXTA 5DBXA 2AC5A 3CKWA 3HNGA 4QRCA 2CDZA 2VTSA 3ZXTA 2OI4X 4RIXB 5FEQA 2XNNA 2F57A 3K54A 4KWPA 4FNZA 4PL4A 5EHYA 4AGUA 4FTOA 4JG8A 3TIZA 2YAAA 2XBJA 2PVKA 3R71A 4UMQA 4XV3A 4RX5A 2ZV9A 5J5SA 2ZM4A 4R5SA 2VWIA 4I24A 2UW0A 3EQCA 3PXZA 5L2TA 1BX6A 3ZSGA 3TKIA 3NIEA 4II5A 3V04A 4I5MA 5CAUA 5JMSA 3AC4A 2WZJA 3ENMA 3MIAA 4OAUC 3HMOA 3UG2A 3GI3A 3MH0A 4D2VA 3NVMB 2VUWA 3R8UA 2QD9A 5HU3A 3BCEA 2GNGA 3DOGA 1SZMA 2JIIA 2OJJA 3LFDA 1OMWA 5C01A 1KE5A 4MYGA 5FRIA 3ROYA 2YN8A 3R7IA 4TWCA 5AUWA 2YDKA 4FVRA 1UKIA 3HV7A 3NW6A 2P3GX 1OKZA 4GU6A 4IM0A 4WBBB 2CNQA 2WMUA 2R9SA 3HUBA 2GNLA 1DAWA 3ORTA 4PUZA 3DTWA 3PY0A 3FMDA 3MA6A 4WNMA 5E9EA 5FTOA 3V3VA 3OS3A 2WEVA 4QP6A 2C6KA 3PPZA 4ZTHA 2PUIA 5HO7A 2PK9A 2E9VA 3DBEA 3V8SA 5LVMA 3UZRA 4F08A 2JAMA 4A9RA 4YPSA 2CCIA 3C0IA 2I1MA 3F3TA 2ZB1A 3R7VA 3UPZA 4F6SA 1Q61A 3OEFX 4O7VA 3KU2A 4M12A 5EQYA 3ZDIA 4YU2A 4RQVA 3ZYAA 4DH8A 1RQQA 4QP2A 3BU3A 4JX3A 5CQUA 4MVFA 2GU8A 2PZIA 5DYJA 2VTJA 4FKUA 2RL5A 2C6TA 5GIOE 1OITA 4X2GA 4QMLA 4ZSLA 2YITA 4EH2A 3B8RA 5LCKA 3UDBA 4EH7A 2RKUA 5TKDA 3ZBXA 1FBNA 4W9XA 4GKIA 5IQGA 3DNDA 4ALVA 3U54A 2CN5A 5KBRA 2WO6A 3F7ZA 4JQ8A 4OTHA 4CCBA 5A4LA 5A6NA 4UV0A 4FKQA 4XH6A 1OB3A 3OW4A 3P7CA 3UIXA 3VS5A 4U6RA 4NM5A 4B99A 4FTIA 4ALWA 3T3UA 3I5NA 3QD4A 4AA4A 4R7HA 3C51A 3L9NA 3U9CA 3HMPA 4MBLA 3LPBA 1NA7A 3EZRA 2XIYA 1YW2A 2EXCX 3Q53A 3GC0A 5DR6A 3VF9A 4AN3A 4BZOA 2QCSA 4M14A 5IUGA 3KCKA 2HZ4A 3R8ZA 5I4NA 3EB0A 3WF6A 2WMWA 3R9NA 4EKKA 2JIUA 3HV3A 3DLSA 4BGHA 1B6CB 3ANRA 3I6WA 3TV4A 3MH2A 4C2WA 2YDIA 3IW4A 4EL9A 2BZKB 4HOKA 3DDPA 4M67A 2IPXA 2NRYA 3O2MA 1GIHA 4MBJA 3HRFA 3UYSA 3TEIA 4C4IA 4EK3A 2CKOA 2RFEA 3R22A 4FGRA 3KC3A 4BBFA 3OFMA 2PE0A 4ZSJA 4CQEA 3GEQA 2OO8X 1SYKA 2C3IB 3AMYA 4KIKA 3N51A 5E1EA 4EOJA 2ZV7A 2GFSA 2OIDA 3PY1A 4MXZA 2OJFE 5D9HA 5M09A 3WF7A 4XRJA 4U9AA 1KE7A 1CKJA 2VX3A 3FLWA 5HGIA 5DG5A 2XNPA 2VTTA 2C68A 2OLCA 3RPRA 5HNIX 1UU7A 3COHA 2VTNA 3DKOA 3C4FA 3TWJA 4S2ZA 5M55A 4MX9A 3VUDA 3NUSA 2IW9A 4C35A 3NPCA 4RMZA 4CKIA 1RJBA 4YR8A 5CU3A 3Q4CA 5BYZA 2Z7LA 2WQNA 3EQIA 4ITIA 2CN8A 3U6IA 4U79A 4BBMA 2PY3A 3OY3A 5GIPE 3EOCA 4QTAA 4CFMA 4A06A 5HIDA 3NS9A 5ANDA 1YOLA 2EXEA 4BIBA 3S0OA 3E7OA 3OROA 4YPDA 4FI1A 5IPJA 4BVUA 1FMOE 3EN4A 2PPQA 4PDYA 1O6YA 2XEZA 3MJ1A 5LMAA 2QOLA 3JS2A 4KINA 4O38A 1WBSA 4BTFA 5DGZA 3HV4A 4AA0A 2Y4IC 2YZLA 3F3WA 3G15A 3KRWA 1WBNA 4WBOA 4Y5QA 3SDJA 4HVSA 4DEDA 5HBJA 3UIUA 5IUIA 1PXJA 4NKSA 1GZOA 4U42A 5ETFA 4ACDA 3E7VA 5HI2A 3OW3A 4FE2A 2DYLA 2WPAA 4TT7A 5AADA 4G3FA 4TXCA 3OUKA 3DU8A 4K1BA 4BDEA 2O3PA 4UALA 4I21A 4RPVA 3AT3A 3D5WA 3NYNA 3UO5A 3SQQA 2OFVA 3DKCA 1QMZA 3LCOA 3QQKA 1XH8A 5I9VA 4WUAA 3FUPA 2ZDTA 4LUDA 2W9ZB 5AM7A 4HGSA 3NUXA 4X2FA 4XOZA 1APME 3D7TA 3VS7A 4C4JA 3SA0A 4MF0A 4USDA 2FSLX 2PVHA 3QWKA 3MVJA 4IAFA 3TV7A 3LFQA 1E1VA 4BKYA 2WTVA 5AX9A 4UMPA 5AP0A 5KZ0A 3A7FA 2WMQA 5C8NA 4PMMA 4YJTA 4QQTA 2ZV2A 4CLJA 5HVJA 2X8EA 3UOLA 5D11A 5L8LA 4DH3A 3EIDA 3Q2MA 4R7IA 5EDQA 5F94A 4K0YA 3OTUA 4DC2A 3PYYA 4FKGA 2HY0A 2XB7A 3VUTA 2HW6A 3H0ZA 1XQZA 2R3MA 4XCUA 3UBDA 3MSSA 1XH7A 2A19B 5E8YA 4UZDA 2G2FA 5TF9A 3UMXA 3KFAA 3MPMA 1BKXA 2V7AA 2I0VA 1Y6BA 1I09A 3PXQA 1YVJA 4QP8A 5CSXA 3LFEA 3M1SA 2C69A 4O0RA 3I1AA 3LFFA 4DTAA 2UZEA 2X7OA 2C5VA 2Y4IB 5E8SA 3WIKA 3OXIA 4EI4A 5M4CA 3PLSA 1TQMA 2QNJA 3A4OX 4GG7A 1STCE 1OUYA 3NX8A 4RJ8A 3RAWA 2VWZA 5E91A 3QTXA 4FT7A 1QCFA 2C4GA 3R04A 4J99A 4FT9A 4AW0A 5I9XA 3L8XA 2PE1A 4KB8A 4RGJA 1E9HA 3Q4UA 3IS5A 1OKYA 2HK5A 3EL7A 2HXQA 3EQDA 4Z3VA 3GFWA 3SXSA 3KKVA 3ZOSA 1J7IA 4EZ3A 2W17A 4D58A 5J5TA 3FZPA 3P23A 4ZTLA 2R7BA 4NTTA 3BLRA 4XMOA 4WUNA 5IH6A 3PUPA 4QYGA 2BZJA 3NEWA 4JNWA 2YERA 3TZ7A 4Y85A 2XP2A 5L6OA 4LGHA 1GNGA 4JDHA 5A4EA 3H4JA 2BVAA 4Z7GA 4FMQA 3VBYA 5IZFA 1OI9A 1JNKA 1UNGA 2IVVA 4UXQA 5C03A 3WE8A 5KMKA 4O7NA 4FTJA 2RFDA 5AV2A 3REPA 4NTSA 4IAKA 4QPSA 3GU8A 3KA0A 1LUFA 1GZNA 3A99A 2XCHA 3GU6A 5H3QA 2RIOA 2Z02A 3QTRA 1IASA 3D14A 2BFXA 3MY0A 3CQEA 3RPOA 2QI8A 4OTQA 4QYYA 5BYYA 4IFCA 5A14A 3U51A 3TL8A 2UZOA 3BIZA 4R7BA 2UVXA 3ELJA 3QQLA 3TDWA 3WF5A 4PRJA 4OAVB 5E8ZA 3A4PA 3VIDA 1W83A 4LL0A 3FLNC 2VV9A 4TNDA 4MF1A 3U6HA 2J7TA 4F1OA 4GK4A 4USFA 4U3YA 4S34A 4I1ZA 5AP5A 2OWBA 4U8ZA 5DA3A 4NWMA 3B2TA 2OXDA 4Y5HA 3R02A 3DQXA 5FM3A 4GFOA 3ZS5A 2I40A 5G1XA 4AT4A 1OECA 2WIHA 2VTQA 3DKFA 3QTSA 3EMGA 4AGDA 3N4VA 3E88A 3V8TA 5JH6A 2AYPA 4F99A 1G8AA 3ZEPA 2YHVA 4R3RA 3R83A 3V01A 2JBPA 3ATTA 1ZMWA 1Q8ZA 3CS9A 2FSMX 4ORKA 2BTSA 4N0SA 4AS0A 5EOBA 4L3JA 1H26A 1GOLA 3UQGA 2WMAA 3S4QA 3ZMMA 5AA8A 3TDVA 3F3ZA 2J5EA 2YM7A 5D1JA 5I9ZA 2CHLA 5IQBA 3MY1A 3TM0A 3BGPA 4EH9A 3W8LA 3BHYA 3ZUTA 4FT5A 3H9FA 4P2KA 4FTTA 2W4OA 3IGGA 4NM7A 1QPCA 5ETCA 4PMSA 5A9UA 3FEGA 3L1SA 4FZAB 4GVAA 2QG7A 3P1AA 2OZAB 1PKGA 5K4IA 3D5XA 3BGQA 2Y4PA 1MP8A 4RJ5A 3WI6A 3I79A 3QQUA 3MVMA 4FTMA 5CEKA 2G9XA 3G0EA 4FL3A 4UZHA 4C38A 4J98A 4JR7A 4LGGA 3JY9A 3SXRA 2C6OA 4FYNA 4PF4A 3QYWA 5CVGA 1HOWA 4I92A 4DTKA 3JY0A 5CU6A 3DGKA 4GS6A 5TOZA 3F3VA 1H0WA 1WFCA 3UIMA 3V5PA 1E1XA 2OU7A 3GXLA 3OEZA 5JK3A 5FUTA 4NU1A 2GTMA 3ORLA 3DCVA 3D5UA 5ANKA 4A9SA 3AC1A 5AUXA 3CEKA 4DFBA 4FSNA 4IVCA 5EQEA 1WBPA 3V5QA 2XJ0A 4FOBA 1WBWA 3CJGA 2BROA 3OF0A 4Z55A 2PHKA 4YHTA 3F3UA 4KD1A 3GQIA 5LXMA 2VTOA 3MTLA 2VO6A 4B0GA 3H0YA 3VS4A 4DLJA 3PWDA 1PRYA 2WAJA 5DI1A 2ZOQA 2ERKA 2J90A 3FHIA 5AP2A 4F7JA 5HX6A 4PTCA 4FV8A 2XRUA 3R8LA 3KVWA 4HNIA 4BDFA 4YLKA 2G15A 4BZDA 4BWXA 5FDPA 4L01A 1URWA 3SW4A 2YCRA 5C1QB 3G9NA 1OIYA 3JR1A 1QPDA 5HEZA 3FQSA 5GINE 1WVYA 1Z57A 5FP6A 4IC7A 4C8BA 4E4NA 2GNHA 2XJ2A 1FGKA 2G1TA 3MIYA 3C4CA 3AT2A 3CP9A 3Q52A 4QMUA 1SVGA 4CRLA 4RZWA 3K3JA 2XK6A 2VD5A 4AAAA 4DGNA 2W5HA 1MRUA 4U41A 5IDPA 4QQCA 2QLQA 1H0VA 3AT4A 4PV0A 4UN0C 2UZUE 3UE4A 4PDPA 5D10A 4G31A 5EW9A 5J9ZA 1A06A 4BYIA 5IMEA 4EOIA 1U4DA 4N70A 4QMYA 2Y6OA 5B2KA 5JFSA 3MFSA 5EM8A 4PY1A 1BI8A 4F9WA 2J0MB 2J0JA 3Q2JA 1P4OA 2G2IA 2WELA 3B2WA 4YP8A 4FIHA 3RJCA 5HLNA 2QU6A 5JFVA 3FQEA 4OTGA 1ZYCA 2J5FA 4IMYA 3O17A 3R01A 3RM7A 2R64A 2JDTA 4HGEA 5B2MA 1H1SA 4C33A 3KMWA 4Z7HA 5C9CA 2ETMA 2BRNA 3PJ8A 3NW5A 4NCTC 4OTPA 5DR9A 5GZAA 3BPRA 4AOIA 3FAAA 3DJ6A 2BAKA 3ZSIA 4C4FA 5KMNA 2PU8A 2C1AA 4EC9A 3VUGA 3RK7A 3NIZA 4OLIA 3PA4A 1JQHA 3PJCA 5IQEA 3VS0A 3S1HA 5A3XA 3UNJA 3SGCA 4O86A 3LMIA 1H24A 4V0GA 1BL7A 1KOBA 4XS2A 2EVAA 3QCQA 4WO5A 3I60A 4F0GA 4LG4A 1J91A 3QD0A 5J9LA 4WNKA 1PW2A 4EH8A 3GCQA 3OVVA 3RNIA 4CVAA 1XR1A 3R30A 4F4PA 3U6JA 1KV2A 1V0PA 2IZUA 5IA3A 5A4QA 2W1CA 1OIQA 4H1MA 5M4UA 2GS6A 5J7BA 3IK3A 4ENYA 3H9OA 3C13A 4CG8A 2HAKA 4IANA 2Y0AA 4FKIA 4C59A 4PX6A 3VULA 2JDVA 4CFFA 4UXLA 3F88A 2IVSA 2YM3A 3QZIA 3QZHA 3UYTA 3VWAA 4D2PA 5TR6A 3HP5A 4QMNA 3LHJA 1JWHA 2VRXA 3KXGA 3IW6A 3MI9A 5E1SA 4FEUA 4TWPA 5CEQA 3W10A 4O84A 3O8TA 4RJ7A 5IA5A 3LJ2A 3E3PA 3VN9A 4D4VA 4M15A 2OJ9A 3DAJA 4NFMA 2GNJA 2HZIA 3GU7A 2R3NA 4YBKA 4KBKA 5DOSA 5DT4A 4BGGA 3SOAA 5KMLA 5A46A 4FTKA 5L6WL 3CSVA 3DBCA 5CU0A 3EWHA 4BIDA 3JXWA 5EM6A 5HE0A 4I23A 3VNTA 3IDBA 3VBVA 4AG8A 3R9HA 1J7UA 1UU8A 5AV1A 1JLUE 4L42A 3IECA 3QTIA 4C58A 4USEA 4I93A 3BV2A 4J96A 4P5QA 5AJQA 4R5YA 2R3PA 4QMPA 3QGWA 1JAMA 4D2WA 2WQOA 4TWNA 4E5BA 5CF5A 3K5VA 5AIRA 3HA8A 3EQBA 3OD6X 2A0CX 1WZYA 2GHGA 2UZDA 1ZY5A 5I3RA 3UVRA 4I0TA 3SG9A 4IX5A 3RAKA 3EKKA 4YSJA 4G17A 2YIRA 2ESMA 2CNUA 1ZAOA 4OW8A 4G1WA 5AR8A 4WKQA 2FO0A 1CDKA 4MBIA 4GV1A 4YJSA 3HEGA 4LMUA 4XP2A 5AP7A 1U54A 5EI2A 3FZRA 3OP5A 2XMYA 4NIFA 5IEYA 3ZO2A 4TYEA 5HVYA 3M42A 2PYWA 4Y46A 4O0VA 2UW8A 4OTFA 1P2AA 2VO7A 2JIVA 3GCPA 2W1ZA 4XG3A 2Z8CA 1DI9A 2UZBA 1UA2A 4XG8A 4XLIA 4I0RA 4PMPA 2RG6A 3HECA 4G2FA 4U43A 1H1WA 4RQKA 4DFLA 4NT4A 3MVHA 2WOUA 4BDJA 3FPMA 4FKWA 3ZHPC 4IAYA 3UVQA 4QMQA 4DF3A 4ZZMA 5CS6A 4QMWA 4H1JA 3F5PA 4BRXA 1OZ1A 3GVUA 3OWLA 2QG5A 4QOXA 3TNQB 2JKKA 4G5JA 3BU6A 5IQFA 1YXXA 4WRSA 3SX9A 4FEXA 3CIKA 4FV5A 3RAIA 5AUVA 3WIGA 5LVOA 1PMEA 3H10A 5LMKA 4EHZA 4HCTA 1R0EA 4QPMA 2C47A 3H9RA 2CGXA 5JQ8A 4C4EA 4J7BA 4L52A 3HMMA 4L6QA 3QZGA 3WILA 2F7XE 3ANQA 3MWUA 2QVSE 2IVTA 4CGAA 3G9LX 3WZKA 5AP4A 1KE6A 4Y8DA 5T6KA 3G0FA 3P0MA 5BYLA 5LMBA 3DT1A 3R1NA 3FXZA 3R9DA 3ID6C 2O2UA 4RIYA 4BHNA 2HXLA 5CZHA 5FTGA 1FGIA 3KL8A 3LW0A 4QP4A 5AFVA 4TYJA 3TZ8A 4BTKA 1F0QA 2CKQA 4O0WA 4WG3A 3ZCLA 4JQEA 4WA9A 2OBJA 4V05A 2FSTX 5JKGA 1XH6A 3FXXA 4I6HA 1H07A 3FLQA 3KY2A 4BCQA 3ZO1A 3ZH8A 5CLPA 3VRYA 4G3GA 3FJQE 3FV8A 4KABA 4RVKA 4O7WA 3E93A 5DRBA 5FBOA 3UO4A 5EG3A 5ITAA 4U45A 3ZRKA 4RSSA 3CD3A 1O6KA 3EYGA 3RHKA 1IEPA 1CSNA 4MD9E 3AGMA 4GFGA 4RX7A 3QX2A 4DFYA 3OMVA 3NRMA 4W8EA 3O50A 5E8UA 4BICA 2QOOA 5EM7A 4D28A 4X3FA 2HWOA 4HVGA 3PY3A 4BCJA 4AACA 2JKQA 2UW9A 3ZZWA 3AC8A 3ZLXA 3ZLWA 3QBNA 5HZNA 2BHEA 4XG2A 5ACBC 3UOKA 3QC9A 3MPTA 2IO6A 3A7JA 3UVPA 3EFLA 2C5XA 2I6LA 4GG5A 5AP1A 1YWRA 2FUMA 3PA5A 3PVWA 1WBVA 3MJ2A 5AUUA 2PVNA 2W06A 3W55A 4CZYB 4O96A 1YI4A 1YHSA 4F9YA 3KB7A 5AIKA 3PSDA 2PUUA 3QLGA 4IE9A 3VBTA 5BVEA 3NNUA 1GY3A 1OVEA 4XV9A 4RZVA 2JITA 4FX3A 4ZSEA 3E5AA 4E7WA 2XIKA 3OBGA 2B53A 3PWYA 2XNOA 3DBQA 3MS9A 3P86A 4W4YA 3U4WA 4PP7A 5GHVA 5CXZA 4QPAA 3LVPA 1DS5A 3U4UA 3ACKA 3C7QA 3OY1A 5CTPA 5AX3A 3NNXA 5DRDA 2XBAA 4ID7A 4TY1A 4U40A 3BHTA 3DJ5A 3VAPA 3RI1A 5K0XA 4QMXA 3BKBA 5KX8A 2BILB 1M52A 1ZY4A 2HYYA 4DBXA 3W18A 1OM1A 2UW7A 3MESA 3RCDA 4TZRA 3G90X 3HDMA 4DFUA 4QNAA 2J0IA 2XNGA 2VO0A 4IEBA 3Q9WA 5CWZA 5H8BA 3RZBA 1PXMA 2GHLA 4DHFA 3LMHA 1BYGA 4QP9A 2E9PA 2FSOX 2P33A 4DINA 4WHZA 2X9EA 3E3BX 4LOOA 5CEIA 4ZP5A 2X2LA 5JRQA 4GT4A 4S30A 4ZAUA 4C3PA 4G6NA 2V0DA 2UVYA 3QZFA 2WTCA 1P4FA 1XBAA 4C37A 4M84A 3OWKA 4ACCA 5LVNA 1MQ4A 2B55A 2YIYA 1JBPE 3L8VA 1PF8A 3KULB 4I5CA 3ORKA 3CY3A 2C0IA 3CXWA 1FPUA 2A4LA 1VR2A 3FWQA 3W1FA 4D2TA 1DAYA 3TUBA 3ITZA 5CAPA 3ULZA 3GQLA 3BYSA 3PVUA 3QAME 4C62A 4BYJA 3NZ0A 3Q9XA 4EHGA 5HX8A 2C5YA 2OG8A 4KIKB 4KAOA 3W2QA 4FUYA 4UWCA 2GFCA 4FVQA 2X6DA 4OBQA 3RTPA 4F9CA 2R3JA 4WG4A 4AE6A 2VWBA 1S9IA 4N6ZA 5CSHA 4BDIA 2OXYA 3RBWA 1AQ1A 1YDRE 2I0EA 4JBQA 2OJIA 3IGOA 3LIJA 5ACKA 3DXQA 3FLSA 3GNIB 4UB7A 2GS7A 3IOKA 2XKDA 5DWRA 5GJGA 3TI1A 4AT5A 5I5ZA 4ZK5A 5BPYA 4BCHA 4YZNA 1YRPA 4XP3A 2IN6A 3EH9A 1Q41A 1YWVA 1XWSA 2W4JA 2WTIA 4WNOA 5F9EA 5L2WA 5ANEA 1H25A 3GCSA 4O1PA 3IG7A 3ZTXA 4DEAA 2GDOA 4FKOA 4XX9A 5FWKK 3WF8A 3RGFA 2QR7A 2IW6A 4DTBA 3QD3A 1CM8A 2YCQA 3ZSHA 2WNTA 3VHEA 5DNRA 3NNVA 2BDWA 4I5HA 5D7AA 2W1IA 4GT3A 5B2LA 1OGUA 3Q4TA 2Q83A 2YWPA 2ZB0A 4HNFA 2O0UA 3FZOA 3B8QA 1GZKA 1PMUA 2NP8A 3CGFA 4DG3E 4DFXE 5H8GA 5BVOA 4DGOA 2RF9A 5IISA 2J0KA 4DYMA 4O82A 4F09A 3BV3A 2R3GA 4RJ6A 3NUAA 1AD5A 5EM5A 5KZIA 4ASDA 2A27A 2WB8A 3SW7A 5LWNA 4KKGA 3R6XA 4DT9A 4YZDA 5DEWA 2QKWB 4QYEA 4C2VA 4XNEA 4FG9A 3GC9A 4AZTA 4DCAA 3O8PA 4RBLA 4C34A 1ZYLA 4ZMEA 3DK7A 4TYGA 4IM2A 4EZ7A 3VQHA 3ODZX 5CQWA 2XUUA 1F5QA 3LCSA 4QYFA 4ANQA 3DY7A 3G2FA 4ZY5A 4AU8A 4NM3A 3OHTA 4KKHA 2V7OA 5IH5A 1YHVA 4A4LA 4TTHB 4MNFA 2B52A 1CMKE 4R1YA 5DR2A 4M66A 3ATSA 2XRWA 3WOWA 1IR3A 3KGAA 5EFQA 3GBZA 5GJDA 4FKLA 3D5VA 5LWMA 2CGVA 4LGDA 3S3IA 2XNMA 1ZARA 4CLIA 5FM2A 4WG5A 1SM2A 3LFNA 4P90A 3Q6UA 3UC4A 4BIEA 4L3PA 5C4KA 3JVSA 4FIJA 5HG5A 5JQ5A 2QURA 4D1SA 2W1EA 4R3PA 4YGAA 3ZXZA 2QOKA 4G16A 3PVBA 5C4LA 2R3QA 3EQPA 4ALUA 5EI6A 5K0KA 4QTDA 2XK8A 4MXYA 3KN6A 4XG6A 3GOKA 2BAQA 1O6LA 3D0EA 3PXFA 3C5IA 5H9BA 3R7EA 1LEZA 4A4XA 3IW8A 4PMTA 4E6CA 2X2KA 2X39A 3QUDA 4GYGA 3HLLA 4F65A 1OIUA 4GUEA 1Y8GA 4U81A 4B8LA 4N4SA 5KMIA 2GHMA 3TTIA 3BBTB 4RWKA 4FV0A 3P9JA 1ZYDA 4GK2A 2ZAZA 4GCJA 1ZYJA 3IW5A 4YLLA 4L7FA 3R0TA 3FY2A 3LOKA 4IM3A 3TG1A 4AW1A 4PWNA 4EHVA 5IKWA 4AOJA 5K5XA 4FZ7A 2IWIA 4IAZA 1OL7A 4IH8A 3VBQA 2YM6A 3DZOA 4U5JA 3C0HA 4IZAA 1H4LA 2G2HA 3FI2A 5EW3A 2VTPA 1H1PA 3BE2A 3O51A 3C9WA 4ZSGA 5L2SA 4MXAA 3KXNA 4E3CA 4IXPA 4RFYA 3QRUA 2YCSA 3LXKA 5HBHA 4KBAA 3UGCA 4AW5A 3FDNA 3PJ2A 1U59A 2GS2A 4DBNA 4KUJA 3OOGA 3PRIA 4O0UA 5EH0A 3ZBFA 2Y6MA 3GENA 3FQHA 2OF2A 2WTDA 3ORMA 1JKSA 3CQWA 5HNBA 5L8JA 2W1HA 4PPCA 1GAGA 4RVMA 3BEAA 2OH0E 5JN2A 1PHKA 2RFNA 3UJGA 3D83A 4JDIA 1PYEA 3EL8A 3W16A 3UQCA 3F5GA 3Q9ZA 3QX4A 1XJDA 4FR4A 4JXFA 3WARA 3C4WA 3QL8A 4YJVA 4ANNA 1Y8YA 5HD4A 4AZSA 3HGKA 2IJMA 3ZUUA 2O63A 4Y95A 5BVWA 3UNKA 3PPKA 3UZTA 5LQFA 3VHKA 4TW9A 4F9BA 4QMTA 4CSVA 3QD2B 4EOOA 5AMNA 4LRMA 3HVCA 3BYOA 1R1WA 2OK1A 3SG8A 5B7VA 1TVOA 4ZTNA 4JDKA 1WBOA 3EZVA 4LFIA 3BGZA 3A7HA 1Y91A 5CXHA 3NCGA 3UNZA 2UZLA 4F0FA 4NYEA 1PXPA 4DG0E 5AWMA 5J8IA 3DNEA 3LJ1A 4HYSA 5CI6A 3KF4A 2HIWA 4EH6A 2HENA 1UU3A 1JKTA 5JEBA 4FEWA 2VTRA 3CKXA 4R8QA 3WYYA 4MAOA 4CV8A 3ZFMA 5IA1A 4RLKA 2XA4A 1NVSA 1PJKA 2OKRA 3N9XA 3VVHA 4FTUA 4A9UA 2J51A 4AUAA 5J87A 2XCKA 3FC2A 3G51A 5CVHA 4RWIA 1H28A 3K2LA 1NXKA 2W99B 2ITVA 4IBMA 4XV1A 3NLBA 3DB6A 5J1WA 3ORNA 5HORA 5IUHA 4RC3A 1Y6AA 3QRTA 4KIPA 4E4MA 1R0PA 2WMTA 2VWXA 4XG7A 5CEOA 5CAVA 2PVJA 4O91A 4I6QA 3ZLSA 3BWFA 3ACJA 2PMNX 4F0IA 3TNWA 1OKVA 1LEWA 1ZMUA 2V62A 4JI9A 5FGKA 3OG7A 1Q97A 4EQUA 5AV4A 2ETRA 1R39A 3Q9YA 3JVRA 4FKRA 5CU2A 2VX0A 1Z9XA 5HQ0A 3HDNA 3PSBA 3D15A 2DQ7X 3NMUF 4E5AX 5KUPA 3GUBA 3VUHA 3TJDA 2UV2A 2PUPA 4G9RA 3RKBA 3EFWA 4OR5A 5HOAA 4YTFA 4QT1A 2QLUA 4NJDA 4TYHA 4QMMA 5HE3A 4YURA 3R9RA 2C6LA 4CFXA 3BELA 2PVFA 4YTIA 2IG7A 2XKCA 4EOLA 4ZXTA 2XZSA 5J1VA 4U97A 2WHBA 4FEQA 2WGJA 4QMOA 4GRBA 1U46A 2OIQA 4FTLA 2Y7JA 3JYAA 3L8PA 4FG7A 3PXYA 1FMKA 4H05A 4ZSAA 3EFKA 3ZONA 1IAHA 3DQWA 3NYOA 3BLQA 2XKFA 1ZLTA 2VWUA 2XEYA 3R2YA 2HCKA 3D2IA 2OGVA 2PZPA 3FBVA 2OICA 3F69A 4HYIA 5EYCA 4AGWA 4M68A 4RIWB 2VTIA 5CY3A 5JRSA 1XH9A 4H3BA 4P5ZA 4K77A 5HD7A 5LVLA 3PVGA 3C0GA 2C0OA 5HVKA 4FSZA 4KKEA 3RWQA 3RZFA 2Z2WA 4E8AA 3LFSA 3IONA 1OL2A 1NY3A 3DXPA 1NVRA 3BU5A 1ERKA 1ATPE 2C3KA 2BRHA 3TV6A 5HLWA 2ITZA 4IVBA 1Q3DA 1OBGA 4G3EA 3ENHA 5EKOA 5H8EA 3F6XA 4FK3A 3RP9A 5JGAA 3QF9A 4XEYA 1R3CA 3I5ZA 4TRLA 5CT0A 4W8DA 4ANBA 4V0GB 1WMKA 3P78A 4ZIMA 4D4SA 2PZ5A 2C0TA 3QC4A 3FLZA 3G33A 2VTMA 4RA5A 4C7TA 2ONLA 3AMAA 5HTBA 1FVRA 4RJ3A 4FZ6A 4LM5A 4F6WA 4ASXA 2AC3A 3FZSA 2UZVA 2XK4A 3QA0A 4S33A 3KN5A 3BRBA 3O96A 4BCNA 4EH5A 4O0XA 1LR4A 2UZNA 3PJ1A 1VYZA 2X4ZA 4XUFA 2BIYA 4BC6A 4EOKA 4MHAA 2I0YA 5KHWA 2ITXA 4CQGA 4DEGA 4HGLA 3ZDUA 4MNEB 4D4RA 1SNXA 4E73A 4QP3A 3RALA 4O7RA 4M69B 3R00A 5LVPA 4DAWA 4GYIA 5BVFA 4O1OA 3LZBA 3PTGA 2CLQA 2CMWA 3QA8A 3UO6A 1MRYA 2JBOA 5GZ8A 4W4XA 4IX4A 1EH4A 1W0XC 1DI8A 1XO2B 2HZ0A 3MFUA 2CKEA 2YM8A 4YHJA 4LQMA 3WZUA 3F66A 1O9UA 4G9CA 4FKTA 2BRGA 2DWBA 4RFZA 5EDPA 3TN8A 4L8MA 4CTBA 5KO1A 4E26A 4OTDA 1OL1A 4O27B 5HO8A 4D4YA 2QOBA 5F95A 4E4XA 4LYNA 5ANGA 4ZY4A 4QTEA 5EYDA 5GNKA 3W2CA 2WU7A 5JGDA 2NRUA 2X7FA 3LCTA 4IZ7A 1ZZ2A 2Z7SA 1F3MC 3FL5A 4GVJA 4UWBA 5LMKC 3EYHA 1YKRA 2OZAA 4O6LA 3ZFYA 5M53A 3D9VA 2WMVA 5AV3A 3PG1A 4G3CA 2FB8A 1KV1A 4A9YA 3G6HA 5HCZA 5C26A 4YJOA 4O7YA 2BPMA 4YHFA 3CE3A 1PYXA 3QTQA 3SRVA 3DAKA 3KRRA 4L44A 2CJMA 3II5A 3QKLA 4KNBA 3ORZA 3DBFA 1W82A 3UPXA 2JDSA 2I7QA 2QU5A 2ZMDA 2W5AA 4C61A 4LRKA 3LLAA 4K33A 3VUMA 4NH1A 4YNOA 1U54B 1PKDA 2C5NA 4FIFA 3HV6A 2P0CA 1T45A 2WMSA 3L9MA 4O2PA 4RRVA 4NIFB 3GB2A 3V5LA 2UW3A 4JVGA 4EQMA 2QOHA 4FTNA 2BMCA 2XK3A 4DFNA 3PP1A 5ETAA 3MGYA 4E20A 2PMLX 2WTWA 3QALE 2P4IA 3F82A 4KIQA 4QMVA 5HE1A 4JDJA 2FVDA 3SLSA 1UWJA 2X2MA 3EJ1A 3IOPA 5F1ZA 3ROCA 5EYKA 5JFXA 5ANIA 5HHWA 1ZYSA 4EZ5A 3KXMA 4ANOA 2WQEA 4BCFA 3QTUA 3PA3A 5AR7A 4X3FC 2B54A 4FZDB 1YXSA 3FMEA 4NEUA 2YIQA 4QTCA 5AP3A 2ACXA 5CEMA 1Q8YA 4ANSA 3EN7A 4CD0A 4UBAA 2J4ZA 4X0MA 4EONA 5FLFA 1PY5A 5E8VA 4A4OA 4YUQA 2CLXA 3HA6A 4CV9A 4BCKA 4JAJA 5FXSA 2JKOA 5CASA 4UYAA 2WIPA 4GU9A 3QQGA 3HRBA 5BQ0A 4A7CA 2JD5A 4Q2AA 1QPEA 2IZSA 3IDCA 4AFJA 1IAJA 4YC8A 5EHLA 2OXXA 4JIAA 4B4LA 4FUXA 3Q96A 4D0WA 4CYIA 5DPVA 4ZLZA 4F7SA 3NWWA 2W05A 5D12A 5DT3A 3GP0A 2PVRA 4FYOA 5EKNA 4LV8A 2JLDA 4J95A 4DLIA 1Q8TA 1OKWA 4ZJVA 4RIOA 2XJ1A 1OPKA 3CCNA 2BAJA 4EK6A 3DKGA 2RFSA 2YEXA 4MQ1A 4X2JA 4AZEA 5K5NA 2BKZA 5FTQA 4Z16A 3CD8A 4JBVA 1OPJA 1SNUA 4IC8A 4ZOGA 2VTLA 5BUEA 2F2UA 3W2SA 3PLAE 2W0JA 4BY9E 4IX3A 4C3FA 3MY5A 2H6DA 3BBWA 2CPKE 2H34A 1YDTE 1YI3A 1REKA 2OIBA 1XKKA 3LQ5A 4JG6A 2F9GA 3FI3A 4RVLA 3SOCA 4CKRA 4IWDA 4O0YA 2XKEA 2X6EA 2JEDA 3DV3A 1K2PA 2WU6A 3KF7A 4BDHA 4E5WA 1OBDA 1W98A 4MTAA 5E7RA 5ICPA 3W2OA 3RPYA 2VGPA 4YC6A 3PIXA 4MD8E 5I9UA 4CT1A 3W8QA 4BZNA 3RMFA 3ORIA 4K6ZA 2CSNA 3VRZA 5H2UA 3KQ7A 5ANJA 4C36A 4KRDA 2R3KA 3D2KA 3NW7A 5DMZA 4ZTMA 4NW5A 3KRLA 3I0QA 3MBLA 4BDCA 4JBOA 4HZSA 3CTHA 2B1PA 3FZTA 2R7IA 3RK9A 3VS1A 4AX8A 3VQUA 2BKKA 1X8BA 2BDJA 2V55A 4B6LA 1I44A 1YXTA 2GTNA 3TACA 4C4HA 5AR5A 4FL1A 2GQSA 4ACHA 3DFAA 3FI4A 4GIHA 3O71A 4YNEA 2YIWA 3TKHA 3ZFXA 1U5RA 5EYMA 2C1BA 3R7OA 4DGGA 1M7QA 4HVHA 3F9NA 4AN9A 4GKHA 2ITYA 2ZVAA 5JZNA 3ORPA 5HG7A 4M13A 4CFNA 3O0GA 4H39A 4BN1A 5J7HA 5CF4A 3O7LD 2W7XA 5J95A 3AOXA 4FSWA 4IWPA 5FD2A 1IA9A 5E92A 1FQ1B 2JDRA 4M97A 1VEBA 2QHNA 4PNIA 3LFCA 5M51A 1Q5KA 4YJUA 2VTAA 3DXNA 2XVDA 3LM5A 3BLHA 4HJOA 5CEPA 4MWIA 4BGQA 4DEIA 2EB3A 3TUDA 2EU9A 3A7IA 3LXLA 2XYNA 4MCVA 4ZTQA 3I7CA 1TQIA 4DH7A 1NW1A 4L67A 3GCUA 3DBDA 4U44A 3SXFA 1A9UA 1PXKA 4EUUA 4YMJA 3A8XA 5M57A 2R0IA 3PE2A 3RWPA 4FC0A 5F4NA 4KA3A 2F7EE 3FSFA 4ZTSA 4BCMA 3QXOA 3E62A 4JIKA 4U3ZA 4BKZA 3JPVA 2KTYA 3OXZA 3POOA 1FVVA 2VO3A 5L4QA 1CTPE 3NYVA 1UV5A 2H9VA 2R3LA 5CF8A 3OWPA 3LQ3A 4AN2A 2SRCA 3F61A 4M0ZA 4EYMA 5E4HA 5TT7A 3HP2A 3WBLA 3SAYA 2XH5A 3P5KA 5A4CA 5BUIA 4K11A 2YA9A 3AD6A 3W2PA 4ZLOA 4FIIA 4Y83A 3AQVA 5IA2A 3S00A 5CI7A 4E6QA 3K5UA 4OTRA 5BX0A 1LPUA 2X8DA 2C6EA 1U5QA 3DK6A 2OH4A 2FGIA 3FKOA 4FL2A 4JT3A 4K2RA 3BQCA 4MEDA 5AR2A 3SKCA 4OUCA 2B9JA 2ITQA 2X8IA 3BYMA 1B39A 5I3OA 3TNHA 3LMGA 4BKJA 3PP0A 4UMUA 4D2SA 4H58A 4ANLA 3M2WA 4FV2A 3HX4A 5L2QA 4FSQA 4UYNA 4EK8A 5CVFA 3Q32A 2GPHA 2QOQA 3CR0A 4AQCA 3FMLA 4BDGA 2YWVA 5HU9A 1K9AA 1UVRA 4BCPA 4XG9A 1OL5A 4G34A 3I4BA 4I22A 3MVLA 3ORXA 5HBEA 2XIRA 5JFWA 2PZYA 1T46A 3SHEA 2F49A 5HNGA 3H3CA 4FOCA 4BI2A 3GC7A 1XBBA 2FYSA 3P79A 4CZUA 3FI8A 2QOFA 5IF1A 3VW6A 4QQ5A 3W32A 5IMXA 3HL7A 4X2KA 5HLPA 5EI8A 3MDYA 4O7SA 4QQJA 3FMHA 1V0OA 3OCGA 3PFQA 4PDOA 2XM8A 3BZ3A 4L00A 4WNPA 5DVRA 5ANOA 3ULIA 5BVNA 2WMRA 5IQHA 3BHUA 4EWQA 3KEXA 3OCBA 3N4TA 4RT7A 3PXKA 3R28A 3QYZA 4I0SA 4EORA 4EJ7A 4WSYA 1YOMA 2QO7A 3NUYA 4KS7A 3H30A 4RA4A 4YJQA 5T3QA 4AW2A 2ZM3A 4BCIA 4F9AA 3W33A 4AA5A 3CPBA 4ENXA 4P7EA 4S32A 3HYHA 2GSFA 3QQHA 3ZUVA 3HKOA 2XK9A 4TL0A 2X0GA 5F20A 2PVYA 5BNJA 1YQJA 3IW7A 1JPAA 4G6OA 3VW8A 2BRBA 4Q9SA 4F7LA 3UTOA 4NUSA 4O0SA 4NK9A 4IWOA 1XH4A 2VX1A 4LL5A 4I6BA 3CLYA 3ZO4A 4N57A 3VJNA 3FYKX 5FG8A 2EWAA 3KRXA 4FTCA 2DUVA 4JBPA 2E2BA 4LOQA 4DGMA 4EOMA 4TWOA 3F5UA 3HRCA 1BI7A 4HCUA 4NL0A 4AP7A 4FSUA 5BVDA 1HCLA 4PPAA 4EOSA 5IQIA 2JFLA 2QODA 5AUYA 2OFUA 3ZM4A 4LI5A 5K9IA 5IQAA 1NT2A 3MH1A 4EC8A 4RVTA 5E8WA 4O7LA 3LXNA 4O22A 3LFAA 4YC3A 3MH3A 1PMVA 4D0XA 4FT0A 5M4IA 4ZS0A 2ZMCA 4R1VA 4OBPA 4QP7A 4HYHA 4F6UA 4BB4A 2B9IA 2WMBA 2UVZA 3QKKA 4PTEA 2BR1A 3CC6A 3DJ7A 4F64A 5JT2A 4EJNA 3OC1A 3VUKA 2JDOA 4A07A 4CCUA 1RE8A 4J97A 4RWLA 4DG2E 1MQBA 4OTWA 1TQPA 4D9TA 5D7VA 3ERKA 2WMXA 3ZZEA 3LM0A 1Q8WA 3V8WA 5J9YA 4FZFB 3CBLA 3QGYA 1WVXA 3O23A 4CYJA 5AEPA 2W1FA 3PIZA 5IEXA 3VJOA 5DFPA 3PG3A 3AGLA 3GOPA 4FV1A 5I0BA 5EK7A 5M08A 2CKPA 2AUHA 1ND4A 3DLZA 1PXNA 2O5KA 4IAIA 4ZJJA 3WF9A 4XHKB 2PSQA 1H1RA 4RIXA 2W9FB 5FP5A 4M7IA 3AMBA 4FSRA 2HY81 1M7NA 4XOYA 4GSBA 5T68A 3QFVA 2XF0A 3R73A 4GK3A 4J52A 2W1GA 3R1YA 3ZO3A 3VF8A 4ACMA 1J7LA 3NCZA 3AC3A 3ZRLA 4G6LA 4JS8A 4AFEA 3P08A 3R1SA 4CMOA 3PPJA 2BZIB 1M14A 3ET7A 3EQFA 4LV5A 3BX5A 5CNOA 1JSUA 4C3RA 5IA4A 4ACGA 3NNWA 4AZFA 1G5SA 2G01A 5L3AA 3D7TB 2ZV8A 5KMMA 5CYIA 1YHWA 4CFWA 1CKPA 2PUNA 3L9LA 3AG9A 1V1KA 5HTIA 4C0TA 3QUEA 3QQFA 5TE0A 3LJ0A 2PVMA 2X9FA 3L9PA 3MB6A 3KULA 4D5KA 2OF4A 4HYUA 1JSVA 3GC8A 4IDTA 3DFCB 3BI6A 4EKLA 4AF3A 4FGBA 4AE9A 3EN6A 1UWHA 4ITHA 3SC1A 2C6DA 3OWJA 3NR9A 4FSTA 5M56A 2PZRA 2VNWA 3BHVA 4DITA 5KMJA 2ITNA 5IEVA 3HZTA 3KMUA 2GNIA 3OUNB 4GIIA 4L9IA 4UX9A 3IKAA 4WSQA 4YLJA 4BDKA 2OJGA 3Q6WA 4DEBA 1NVQA 3CJFA 3I81A 5DEYA 4BTJA 2ITOA 2E9OA 5GZ9A 4D2RA 3EHAA 1Q4LA 1IG1A 4BR3A 1KOAA 3A60A 4D9UA 2BRMA 3PDTA 4TKSA 4FF8A 1Z5MA 4EEVA 3E63A 3POZA 5GJFA 1OPLA 2X1NA 4QYHA 4CMTA 3C4ZA 4FKVA 4W4VA 3U8WA 5CX9A 3BHHA 4FA2A 4EH3A 1REJA 4OGRA 5CANA 2X7GA 1ZOGA 2UW6A 2X81A 3FPQA 2C30A 3KK8A 2DS1A 2QKRA 3KCFA 5CAOA 5E8XA 5EHOA 4GMYA 5KBQA 3FKLA 2CGWA 2R3FA 3QTWA 4CZTA 2VTHA 5CNNA 1SVEA 4RX8A 1FINA 2C3JA 2WKMA 3OOMA 4FV6A 5CZIA 2JFMA 4F7NA 5L2IA 3TTJA 4YZMA 3LLTA 3QRKA 2OSCA 4APPA 2YACA 5FXQA 5LARA 3RCJA 3VS6A 4CG9A 3A2CA 5AP6A 2JKMA 1VZOA 3ZM9A 1Q24A 4NKAA 3NUNA 4TPTA 4KIOA 4HVDA 4APCA 1BLXA 3HMNA 1Q62A 1YOJA 4D55A 3Q5ZA 1BL6A 5KMOA 4I6FA 4QTBA 1BMKA 1WVWA 4BFMA 5IH4A 3QHWA 1KUTA 2WFYA 5J79A 3QHRA 4ASZA 2FH9A 3SVVA 3KVXA 1PMNA 4DA5A
chains in the Genus database with same CATH superfamily
4EWHA 1ZWSA 4O6EA 4BDBA 2XIZA 3UP7A 1A48A 1R78A 2C6MA 3CPCA 1W2DA 5C8KA 4FKJA 2GMXA 4JL9A 3Q3BA 3ALOA 2ITPA 3IDPA 5AR4A 5CSPA 3AD4A 2YISA 2BIKB 3D94A 3R7UA 1M2QA 4DH5A 1MRVA 5AA9A 2PMIA 2VAGA 1ZOHA 4R77A 2LGCA 4E4LA 4EBWA 4Q9ZA 3G6GA 4FTAA 1H00A 4BL1A 4JRNA 4IB5A 2Z7RA 3FMNA 3U9NA 3QCXA 2NPQA 4FNWA 1L3RE 5M07A 3C5UA 3BE9A 2E9UA 2YAKA 4MUQA 3WZDA 4X3FB 3HMIA 3E8CA 2C6IA 2ONLC 3FY0A 2W5BA 4RC2A 2VU3A 3P7AA 3CTQA 5C27A 1KE9A 4Z9LA 2J6MA 4IVAA 5D41A 5A6OA 4TYHB 3MYGA 2J0LA 4D1ZA 4D5HA 2ERZE 2YCFA 3KXHA 2BCJA 3V6SA 4CFUA 3MA3A 2A2AA 3IO7A 3P5JC 5BVKA 5M44A 5EOLA 1J1CA 1KSWA 2IZTA 3D4QA 3OCTA 4J8MA 3HAVA 1H1QA 3M11A 4IX6A 3V5TA 3WE4A 5CF6A 4FV9A 3ZLYA 4TNBA 4BWKA 4RLLA 1IRKA 2YDJA 4GW8A 4I5PA 5A54A 2PL0A 3MFRA 1KWPA 5DHJA 3ZC5A 5IU2A 3C4XA 3MN3A 4MXCA 4OT6A 3W0NA 4QO9A 2VGOA 1PXIA 2PE2A 3TCPA 1BUHA 4AOTA 1GJOA 4UMRA 4MH7A 5DN3A 3W0PA 2YLEA 3RHXA 3U55A 4KRCA 1P5EA 3E87A 4MXXA 5HTCA 1XH5A 3VO3A 4AZVA 3FZ1A 2VWYA 1J3HA 2WTJA 4JMQA 2GQRA 1JVPP 2UZTA 4MK0A 4L68A 3NGAA 4W9WA 4J53A 1OL6A 1W8CA 5FBNC 4PTGA 4HGTA 4O7TA 3OT3A 2FA2A 4C57A 4EQCA 1B38A 3QCYA 4ZY6A 3VBXA 2C3LA 4EOPA 4DN5A 3VBWA 5JGBA 4R3CA 3OT8A 4TYIA 3GGFA 4BCGA 1G8SA 4E6DA 2HOGA 4HZRA 4YTHA 4EHEA 4PL3A 4KBCA 1GIJA 1SMHA 1YI6A 3IPHA 1JKKA 4G3DA 4MQ2A 3LKMA 1L8TA 4PQNA 4PP9A 2YJRA 4RC4A 4AGCA 3MV5A 4H3QA 5I9YA 4H3PA 2RGPA 3EN9A 4F70A 3V5WA 4CT2A 2J50A 5DIAA 2WQBA 2B4SB 3WZEA 1Q3WA 3FSKA 2KULA 4DT8A 1M2PA 5KKRC 4L43A 2Y8OA 5FQDC 3QU0A 3QWJA 2I0HA 3LQ8A 4X2NA 2QOCA 5HESA 4ZLYA 1ZMVA 1Q99A 4NM0A 4X3JA 1OUKA 4J1RA 3MTFA 1M17A 2YIXA 5AUZA 2IVUA 3RAHA 3LFBA 3KMMA 4FIGA 5HG9A 2IW8A 1FVTA 2RG5A 2VWWA 1ZOEA 4YJPA 4E6AA 2PMOX 2XYUA 3KXXA 2W96B 4NW6A 2QC6A 1QL6A 1UKHA 5EQPA 1S9JA 3A7GA 3LCDA 5M06A 3GU5A 3FHRA 3DTCA 2B9HA 3COIA 3EFJA 4O2ZA 4WD5A 4YSMA 3RNYA 3V51A 4CXAA 4AWIA 4IW0A 4AQKA 4OTIA 3VUIA 3RVGA 3TZ9A 3AC5A 3QUPA 3FC1X 2OZOA 2B0QA 2BHHA 2ITTA 4HW7A 2R5TA 1Y57A 1YXUA 2CCHA 3SRVB 2YZAA 2BFYA 1ZXEA 3UG1A 4O81A 4FTQA 1G3NA 4L46A 2R4BA 3G5DA 4I41A 5EW8A 4FV7A 4M3QA 4FICA 5AAGA 2PWLA 5JSMA 3COKA 3QKMA 3UP2A 4YJRA 2BTRA 5FEEA 3UZPA 4GJ3A 2VZ6A 3FKNA 4GEOA 3F2NA 4NFNA 2Q0BA 3S2PA 4ERWA 2O8YA 4CNHA 1M2RA 5LCJA 1OGYA 4O21A 3Q60A 4IB3A 4L45A 5ETIA 1MUOA 5KKRB 2VWVA 3VC4A 3E64A 1JOWB 4KS8A 5AR3A 4ZS4A 1Q8UA 4FG8A 4X7QA 4PNKA 3N4UA 4MXOA 1IA8A 4RX9A 1WCCA 4DGLC 4IAAA 5CENA 3TJCA 3FMKA 3QTZA 3EQHA 2XK7A 4Q5EA 2CNVA 3CTJA 3V5JA 4RJ4A 3NUPA 2F7ZE 3EN5A 2ETKA 5KNJA 3FYJX 4IZ5A 1DM2A 3HUCA 4CRSA 3DA6A 4X6QC 3COMA 2ZJWA 3SD0A 4XJ0A 2R3HA 1V0BA 3NUUA 3ODYX 3R8MA 3ZC6A 1UNLA 3MB7A 4GH2A 3QQJA 4LMNA 4WIHA 2W4KA 2ZYBA 2IZRA 3BEGA 5DLSA 5DH3A 1W84A 1AGWA 3F2AA 3R9OA 3KREA 4X6RA 3TNPC 4QP1A 2QO9A 5HIEA 3NVKI 4FODA 3CGOA 1URCA 2A1AB 4J8NA 3FE3A 4U80A 1PXLA 4DEHA 4I3ZA 5AAEA 5KCVA 3K3IA 5FEDA 3ZU7A 4JR3A 4Y73A 3R8VA 2VN9A 4IACA 3O7LB 5M4FA 3FMJA 5B0XA 4Q5HA 2QQ7A 1XHAA 1ST0A 3TYKA 4OT5A 3OCSA 4DCEA 3Q04A 4YTCA 2F2CB 1TKIA 4X21A 2UW4A 4KSPA 4EYJA 3EQGA 1W7HA 4ARKA 4CTCA 2ZDUA 4RIWA 4RG0A 3QRIA 4ZZNA 3RM6A 3R2BA 3BYUA 4L53A 4N6YA 3VS3A 5BMMA 2ITWA 3PE1A 4FVPA 2WQMA 4AT3A 2P2IA 2Q0NA 5HO6A 5I9WA 4HPTE 2REIA 3A62A 4O0TA 2YM5A 2PULA 4K8AA 3O8UA 3DDQA 4DE4A 2GNFA 2O65A 5E90A 3BQRA 4BBEA 1WAKA 4K9YA 3IQ7A 4DHIB 4UMTA 4F1TA 3RPSA 1VJYA 3E8DA 2BDFA 4WT6A 3CQUA 1UU9A 4IJ9A 2QHMA 3THBA 4FBXA 4I4EA 3FLYA 4IB0A 3TZMA 4UEUA 4BWPA 4C4GA 4XLVA 3UQFA 3LXPA 3DB8A 3UODA 4GT5A 4YZ9A 3PXRA 4I20A 2UUEA 3Q5IA 4BI1A 4IDVA 4HVIA 3FXWA 5HCXA 2LAVA 3ZEWA 4BJJB 5E8TA 2X4FA 2P2HA 3NAXA 2BZHB 2Z7QA 4HCVA 3R7GA 3O5AA 4A9TA 2NNWB 2ZM1A 4JAIA 1H01A 2QONA 4JX7A 3DK3A 5EDRA 3NAYA 2WTKC 3E8EA 3UMWA 2XNBA 3DPKA 4MNEA 4UY9A 4ASEA 1H27A 5AUTA 4P4CA 4M69A 2ITUA 2Y9QA 5TO8A 4B7TA 4DFZE 3PJ3A 4XYFA 2WXVA 4RFMA 4FNXA 3HV5A 4R6VA 4V04A 3I6UA 1J1BA 1RW8A 3KK9A 4BDAA 4EOQA 5IDNA 5HE2A 5IQDA 2J9MA 2RSVA 4GFMA 1JKLA 2B7AA 4DEEA 4ITJA 2HELA 2EB2A 4U0IA 4F63A 3C1XA 3FMMA 3DZQA 4RIYB 2YM4A 4E93A 2GQGA 4MD7E 2Z60A 2R3RA 3AXWA 3DAEA 4FV3A 4IADA 5CT7A 4OBOA 4ZEGA 5KE0A 3PRFA 3PZHA 4FEVA 3GFEA 5AM6A 4NZWB 1XBCA 4FT3A 4ZJIA 2R3OA 3T3VA 4H36A 3KXZA 4FKPA 1JSTA 1YDSE 2HZNA 4YZBA 5HKMA 2PTKA 4MKCA 2EXMA 5BUJA 1RDQE 3TNIA 3PSCA 1LP4A 5JZJA 4D1XA 3UDTA 3E8NA 3WZJA 1H8FA 1FOTA 2BUJA 4YJNA 1KE8A 4JLCA 5K3YA 4XBRA 5KHXA 1ZRZA 2P55A 2W1DA 4LUEA 4QMZA 3KIOC 4JJRA 2CGUA 2JAVA 4EK5A 5K4JA 2XNEA 4IHPA 5FXRA 2HW7A 2WTKB 4S31A 4DH1A 4EK4A 4YO6A 5AAFA 2YABA 4WRGA 3F5XA 1H08A 3EQRA 2YJSA 3GCVA 4FV4A 4IB1A 4I4FA 4L3LA 4RWJA 3R7YA 3UC3A 4BCOA 4BF2A 3TUCA 4BI0A 3NDMA 4K18A 5A4TA 4IIRA 1VYWA 3C50A 2XM9A 3OBJA 1QPJA 5C8MA 3LCKA 3TKUA 4UWYA 5G6VA 4ONAA 3GT8A 4PPBA 3D7ZA 1CKIA 3F7WA 3Q4ZA 4GJ2A 4V01A 4ZTRA 3VS2A 4ZMFA 3W2RA 4FRFA 4ANMA 4CEGA 3GU4A 4JG7A 2OW3A 4CKJA 4QDVA 5LJJA 4G5PA 4YBJA 4YZCA 3A8WA 5IQCA 3I7BA 4BTMA 3QXPA 4Y72A 4JOAA 3QCSA 4AZWA 4IZYA 2V22A 5CU4A 3V6RA 1YWNA 2WEIA 4AXAA 2UW5A 3R1QA 1YXVA 3WYXA 4W4WA 2NO3A 2QO2A 4GL9A 4LRJA 4QD6A 3UOJA 4NCTA 1UNHA 4I94A 4FKSA 2JC6A 4IQ6A 5CALA 2C5OA 4ZZOA 2B9FA 3AKKA 2R3IA 5CSWA 2YFXA 5HG8A 4EUTA 3C4EA 3ETAA 3FL4A 3I0OA 4PDSA 3E92A 3UIBA 3JUHA 2XARA 4FSYA 4M8TA 5CSVA 3UOHA 4MWHA 2VNYA 4JQ7A 4EH4A 3ALNA 4BDDA 3HAMA 4WOVA 4J71A 2BALA 3AC2A 4O7ZA 2J2IB 5DT0A 4CMUA 4XRLA 3TXOA 4JRVA 4NJ3A 4B9DA 3DS6A 3TT0A 4FIEA 3P7BA 5LOHA 3LE6A 3AD5A 1ZZLA 3NYXA 2H96A 4R78A 3TIYA 5BMSA 2QR8A 3RINA 3OZ6A 3OTVA 5CAQA 2QOIA 4IVDA 3S95A 3R63A 3PIYA 3BYVA 5L8KA 3EKNA 3RK5A 4E1ZA 2PVLA 3L8SA 4EBVA 2O64A 3U87A 2WOTA 3R21A 3T8OA 5HICA 4PL5A 5IA0A 5AV0A 4C02A 1GIIA 4XV2A 3BWJA 2E9NA 5L6PA 2V5QA 2YLFA 5HIBA 5DE2A 2XIXA 1HCKA 2EUFB 2F4JA 2XS0A 3QLFA 2R0UA 4NSTA 3T9TA 3PZEA 4F1MA 1SVHA 4FTRA 3MFTA 4FNYA 2UZWE 5FDXA 3NSZA 4B8MA 4QDEA 5IG1A 3LAUA 4QNYA 4XG4A 4FK6A 1WBTA 4XBUA 2JGZA 4ERKA 4L7SA 4TN6A 4KSQA 4M0YA 4O83A 4GUBA 1K3AA 4YO4A 3ZRMA 1P14A 2GCDA 2HWPA 2WD1A 5HCYA 3RPVA 4IWQA 3P4KA 4FSMA 2H8HA 3R8PA 4CFVA 3CY2A 4IJPA 3A61A 1OIRA 1GZ8A 3SV0A 3KRJA 4HPUE 4LOPA 4IFGA 4U7ZA 2R2PA 4QMSA 3F2RA 4XP0A 4BHZA 3T9IA 3MPAA 3MW1A 3QRJA 1PXOA 3OXTA 5DBXA 2AC5A 3CKWA 3HNGA 4QRCA 2CDZA 2VTSA 3ZXTA 2OI4X 4RIXB 5FEQA 2XNNA 2F57A 3K54A 4KWPA 4FNZA 4PL4A 5EHYA 4AGUA 4FTOA 4JG8A 3TIZA 2YAAA 2XBJA 2PVKA 3R71A 4LDTA 4UMQA 4XV3A 4RX5A 2ZV9A 5J5SA 2ZM4A 4R5SA 2VWIA 4I24A 2UW0A 3EQCA 3PXZA 5L2TA 2X0OA 1BX6A 3ZSGA 3TKIA 3NIEA 4II5A 3V04A 4I5MA 1XMLA 5BV3A 5CAUA 5JMSA 3AC4A 2WZJA 3ENMA 3MIAA 4OAUC 3HMOA 3UG2A 3GI3A 3MH0A 4D2VA 3NVMB 2VUWA 3R8UA 2QD9A 5HU3A 3BCEA 2GNGA 3DOGA 1SZMA 2JIIA 2OJJA 3LFDA 1OMWA 5C01A 1KE5A 4MYGA 5FRIA 3ROYA 2YN8A 3R7IA 4TWCA 5AUWA 2YDKA 4FVRA 1UKIA 3HV7A 3NW6A 2P3GX 1OKZA 4GU6A 4IM0A 4WBBB 2CNQA 2WMUA 2R9SA 3HUBA 2GNLA 1DAWA 3ORTA 4PUZA 3DTWA 3PY0A 3FMDA 3MA6A 4WNMA 5E9EA 5FTOA 3V3VA 3OS3A 2WEVA 4QP6A 2C6KA 3PPZA 4ZTHA 2PUIA 5HO7A 2PK9A 2E9VA 3DBEA 3V8SA 5LVMA 3UZRA 4F08A 2JAMA 4A9RA 4YPSA 2CCIA 3C0IA 2I1MA 3F3TA 2ZB1A 3R7VA 3UPZA 4F6SA 1Q61A 3OEFX 4O7VA 3KU2A 4M12A 5EQYA 3ZDIA 4YU2A 4RQVA 3ZYAA 4DH8A 1RQQA 4QP2A 3BU3A 4JX3A 5CQUA 4MVFA 2GU8A 2PZIA 5DYJA 2VTJA 4FKUA 2RL5A 2C6TA 5GIOE 1OITA 4X2GA 4QMLA 4ZSLA 2YITA 4EH2A 3B8RA 5LCKA 3UDBA 4EH7A 2RKUA 5TKDA 3ZBXA 1FBNA 4W9XA 4GKIA 5IQGA 3DNDA 4ALVA 3U54A 2CN5A 5KBRA 2WO6A 3F7ZA 4JQ8A 4OTHA 4CCBA 5A4LA 5A6NA 4UV0A 4FKQA 4XH6A 1OB3A 3OW4A 3P7CA 3UIXA 3VS5A 4U6RA 4NM5A 4B99A 4FTIA 4ALWA 3T3UA 3I5NA 3QD4A 4AA4A 4R7HA 3C51A 3L9NA 3U9CA 3HMPA 4MBLA 3LPBA 1NA7A 3EZRA 2XIYA 1YW2A 2EXCX 3Q53A 3GC0A 5DR6A 3VF9A 4AN3A 4BZOA 2QCSA 4M14A 5IUGA 4DDGA 3KCKA 2HZ4A 3R8ZA 5I4NA 3EB0A 3WF6A 2WMWA 3R9NA 4EKKA 2JIUA 3HV3A 1W2CA 3DLSA 4BGHA 1B6CB 3ANRA 3I6WA 3TV4A 3MH2A 4C2WA 2YDIA 3IW4A 4EL9A 2BZKB 4HOKA 3DDPA 4M67A 2IPXA 2NRYA 3O2MA 1GIHA 4MBJA 3HRFA 3UYSA 3TEIA 4C4IA 4EK3A 2CKOA 2RFEA 3R22A 4FGRA 3KC3A 4BBFA 3OFMA 2PE0A 4ZSJA 4CQEA 3GEQA 2OO8X 1SYKA 2C3IB 3AMYA 4KIKA 3N51A 5E1EA 4EOJA 2ZV7A 2GFSA 2OIDA 3PY1A 4MXZA 2OJFE 5D9HA 5M09A 3WF7A 4XRJA 4U9AA 1KE7A 1CKJA 2VX3A 3FLWA 4O4BB 5HGIA 5DG5A 2XNPA 2VTTA 2C68A 3W0SA 2OLCA 3RPRA 5HNIX 1UU7A 3COHA 2VTNA 3DKOA 3C4FA 3TWJA 4S2ZA 5M55A 4MX9A 3VUDA 3NUSA 2IW9A 4C35A 3NPCA 4RMZA 4CKIA 1RJBA 4YR8A 5CU3A 3Q4CA 5BYZA 2Z7LA 2WQNA 3EQIA 4ITIA 2CN8A 3U6IA 4U79A 4BBMA 2PY3A 3OY3A 5GIPE 3EOCA 4QTAA 4CFMA 4A06A 5HIDA 3NS9A 5ANDA 1YOLA 2EXEA 4BIBA 3S0OA 3E7OA 3OROA 4YPDA 4FI1A 5IPJA 4BVUA 1FMOE 3EN4A 2PPQA 4PDYA 1O6YA 2XEZA 3MJ1A 5LMAA 2QOLA 3JS2A 4KINA 4O38A 1WBSA 4BTFA 5DGZA 3HV4A 4AA0A 2Y4IC 2YZLA 3F3WA 3G15A 3KRWA 1WBNA 4WBOA 4Y5QA 3SDJA 4HVSA 4DEDA 5HBJA 3UIUA 5IUIA 1PXJA 4NKSA 1GZOA 4U42A 5ETFA 4ACDA 3E7VA 5HI2A 3OW3A 4FE2A 2DYLA 2WPAA 4TT7A 5AADA 4G3FA 4TXCA 3OUKA 3DU8A 4K1BA 4BDEA 2O3PA 4UALA 4I21A 4RPVA 3AT3A 3D5WA 3NYNA 3UO5A 3SQQA 2OFVA 3DKCA 1QMZA 3LCOA 3QQKA 1XH8A 5I9VA 2XAMA 4WUAA 3FUPA 2ZDTA 4LUDA 2W9ZB 5AM7A 4HGSA 3NUXA 4X2FA 4XOZA 1APME 3D7TA 3VS7A 4C4JA 3SA0A 4MF0A 4USDA 2FSLX 2PVHA 3QWKA 3MVJA 4IAFA 3TV7A 3LFQA 1E1VA 4BKYA 2WTVA 5AX9A 4UMPA 5AP0A 5KZ0A 3A7FA 2WMQA 5C8NA 4PMMA 4YJTA 4QQTA 2ZV2A 4CLJA 5HVJA 2X8EA 3UOLA 5D11A 5L8LA 4DH3A 3EIDA 3Q2MA 4R7IA 5EDQA 5F94A 2AQXA 4K0YA 3OTUA 4DC2A 3PYYA 4FKGA 2HY0A 2XB7A 3VUTA 2HW6A 3H0ZA 1XQZA 2R3MA 4XCUA 3UBDA 3MSSA 1XH7A 2A19B 5E8YA 4UZDA 2G2FA 5TF9A 3UMXA 3KFAA 3MPMA 1BKXA 2V7AA 2I0VA 1Y6BA 1I09A 3PXQA 1YVJA 4QP8A 5CSXA 3LFEA 3M1SA 2C69A 4O0RA 3I1AA 3LFFA 4DTAA 2UZEA 2X7OA 2C5VA 2Y4IB 5E8SA 3WIKA 3OXIA 4EI4A 5M4CA 3PLSA 1TQMA 2QNJA 3A4OX 4GG7A 1STCE 1OUYA 3NX8A 4RJ8A 3RAWA 2VWZA 5E91A 3QTXA 4FT7A 1QCFA 2C4GA 3R04A 2X0PA 4J99A 4FT9A 4AW0A 5I9XA 3L8XA 2PE1A 4KB8A 4RGJA 1E9HA 3Q4UA 3IS5A 1OKYA 2HK5A 3EL7A 2HXQA 3EQDA 4Z3VA 3GFWA 3SXSA 3KKVA 3ZOSA 1J7IA 4EZ3A 2W17A 4D58A 5J5TA 3FZPA 3P23A 4ZTLA 2R7BA 4NTTA 3BLRA 4XMOA 4WUNA 5IH6A 3PUPA 4QYGA 2BZJA 3NEWA 4JNWA 2YERA 3TZ7A 4Y85A 2XP2A 5L6OA 4LGHA 1GNGA 4JDHA 5A4EA 3H4JA 2BVAA 4Z7GA 4FMQA 3VBYA 5IZFA 1OI9A 1JNKA 1UNGA 2IVVA 4UXQA 5C03A 3WE8A 5KMKA 4O7NA 4FTJA 2RFDA 5AV2A 3REPA 4NTSA 4IAKA 4QPSA 3GU8A 3KA0A 1LUFA 1GZNA 3A99A 2XCHA 3GU6A 5H3QA 2RIOA 2Z02A 3QTRA 1IASA 3D14A 2BFXA 3MY0A 3CQEA 3RPOA 2QI8A 4OTQA 4QYYA 5BYYA 4IFCA 5A14A 3U51A 3TL8A 2UZOA 3BIZA 4R7BA 2UVXA 3ELJA 3QQLA 3TDWA 3WF5A 4PRJA 4OAVB 5E8ZA 3A4PA 3VIDA 1W83A 4LL0A 3FLNC 2VV9A 4TNDA 4MF1A 3U6HA 2J7TA 4F1OA 4GK4A 4USFA 4U3YA 4S34A 4I1ZA 5AP5A 2OWBA 4U8ZA 5DA3A 4NWMA 3B2TA 2OXDA 4Y5HA 3R02A 3DQXA 5FM3A 4GFOA 3ZS5A 2I40A 5G1XA 4AT4A 1OECA 2WIHA 2VTQA 3DKFA 3QTSA 3EMGA 4AGDA 3N4VA 3E88A 3V8TA 5JH6A 2AYPA 4F99A 1G8AA 3ZEPA 2YHVA 4R3RA 3R83A 3V01A 2JBPA 3ATTA 1ZMWA 1Q8ZA 3CS9A 2FSMX 4ORKA 2BTSA 4N0SA 4AS0A 5EOBA 4L3JA 1H26A 1GOLA 3UQGA 2WMAA 3S4QA 3ZMMA 5AA8A 3TDVA 4AXCA 3F3ZA 2J5EA 2YM7A 5D1JA 5I9ZA 2CHLA 5IQBA 3MY1A 3TM0A 3BGPA 4EH9A 3W8LA 3BHYA 3ZUTA 4FT5A 3H9FA 4P2KA 4FTTA 2W4OA 3IGGA 4NM7A 1QPCA 5ETCA 4PMSA 5A9UA 3FEGA 3L1SA 4FZAB 4GVAA 2QG7A 3P1AA 2OZAB 1PKGA 5K4IA 3D5XA 3BGQA 2Y4PA 3AKLA 1MP8A 4RJ5A 3WI6A 3I79A 3QQUA 3MVMA 4FTMA 5CEKA 2G9XA 3G0EA 4FL3A 4UZHA 4C38A 4J98A 4JR7A 4LGGA 3JY9A 3SXRA 2C6OA 4FYNA 4PF4A 3QYWA 5CVGA 1HOWA 4I92A 4DTKA 3JY0A 5CU6A 3DGKA 4GS6A 5TOZA 3F3VA 1H0WA 1WFCA 3UIMA 3V5PA 1E1XA 2OU7A 3GXLA 3OEZA 5JK3A 5FUTA 4NU1A 2GTMA 3ORLA 3DCVA 3D5UA 5ANKA 4A9SA 3AC1A 5AUXA 3CEKA 4DFBA 4FSNA 4IVCA 5EQEA 1WBPA 3V5QA 2XJ0A 4FOBA 1WBWA 3CJGA 2BROA 3OF0A 4Z55A 4AAYA 2PHKA 4YHTA 3F3UA 4KD1A 3GQIA 5LXMA 2VTOA 3MTLA 2VO6A 4B0GA 3H0YA 3VS4A 4DLJA 3PWDA 1PRYA 2WAJA 5DI1A 2ZOQA 2ERKA 2J90A 3FHIA 5AP2A 4F7JA 5HX6A 4PTCA 4FV8A 2XRUA 3R8LA 3KVWA 4HNIA 4BDFA 4YLKA 2G15A 4BZDA 4BWXA 5FDPA 4L01A 1URWA 3SW4A 2YCRA 5C1QB 4AXEA 3G9NA 1OIYA 3JR1A 1QPDA 5HEZA 3FQSA 5GINE 1WVYA 1Z57A 5FP6A 4IC7A 4C8BA 4E4NA 2GNHA 2XJ2A 1FGKA 2G1TA 3MIYA 3C4CA 4O4CA 3AT2A 3CP9A 3Q52A 4QMUA 1SVGA 4CRLA 4RZWA 3K3JA 2XK6A 2VD5A 4AAAA 4DGNA 2W5HA 1MRUA 4U41A 5IDPA 4QQCA 2QLQA 1H0VA 3AT4A 4PV0A 4UN0C 2UZUE 3UE4A 4PDPA 5D10A 4G31A 5EW9A 5J9ZA 1A06A 4BYIA 5IMEA 4EOIA 1U4DA 4N70A 4QMYA 2Y6OA 2IEWA 5B2KA 5JFSA 3MFSA 5EM8A 4PY1A 1BI8A 4F9WA 2J0MB 2J0JA 3Q2JA 1P4OA 2G2IA 2WELA 3B2WA 4YP8A 4FIHA 3RJCA 5HLNA 2QU6A 5JFVA 3FQEA 4OTGA 1ZYCA 2J5FA 4IMYA 3O17A 3R01A 3RM7A 2R64A 2JDTA 4HGEA 5B2MA 1H1SA 4C33A 3KMWA 4Z7HA 5C9CA 2ETMA 2BRNA 3PJ8A 3NW5A 4NCTC 4OTPA 5DR9A 5GZAA 3BPRA 4AOIA 3FAAA 3DJ6A 2BAKA 3ZSIA 4C4FA 5KMNA 2PU8A 2C1AA 4EC9A 3VUGA 3RK7A 3NIZA 4OLIA 3PA4A 1JQHA 3PJCA 5IQEA 3VS0A 1G8KA 3S1HA 5A3XA 3UNJA 3SGCA 4O86A 3LMIA 1H24A 4V0GA 1BL7A 1KOBA 4XS2A 2EVAA 3QCQA 4WO5A 3I60A 4F0GA 4LG4A 1J91A 3QD0A 5J9LA 4WNKA 1PW2A 4EH8A 3GCQA 3OVVA 3RNIA 4CVAA 1XR1A 3R30A 4F4PA 3U6JA 1KV2A 1V0PA 2IZUA 5IA3A 5A4QA 2W1CA 1OIQA 4H1MA 5M4UA 2GS6A 5J7BA 3IK3A 4ENYA 3NFGB 3H9OA 3C13A 4CG8A 2HAKA 4IANA 2Y0AA 4FKIA 4C59A 4PX6A 3VULA 2JDVA 4CFFA 4UXLA 3F88A 2IVSA 1G8JA 2YM3A 3QZIA 3QZHA 3UYTA 3VWAA 4D2PA 5TR6A 3HP5A 4QMNA 3LHJA 1JWHA 2VRXA 3KXGA 3IW6A 3MI9A 5E1SA 4FEUA 4TWPA 5CEQA 3W10A 4O84A 3O8TA 4RJ7A 5IA5A 3LJ2A 3E3PA 3VN9A 4D4VA 4M15A 2OJ9A 3DAJA 4NFMA 2GNJA 2HZIA 3GU7A 2R3NA 4YBKA 4KBKA 5DOSA 5DT4A 4BGGA 3SOAA 5KMLA 5A46A 4FTKA 5L6WL 3CSVA 3DBCA 5CU0A 3EWHA 4BIDA 3JXWA 5EM6A 5HE0A 4I23A 3VNTA 3IDBA 3VBVA 4AG8A 3R9HA 1J7UA 2ZFYA 1UU8A 5AV1A 1JLUE 4L42A 3VONA 3IECA 3QTIA 4C58A 4USEA 4I93A 3BV2A 4J96A 4P5QA 5AJQA 4AXDA 4R5YA 2R3PA 4QMPA 3QGWA 1JAMA 4D2WA 2WQOA 4TWNA 4E5BA 5CF5A 3K5VA 5AIRA 3HA8A 3EQBA 3OD6X 2A0CX 1WZYA 2GHGA 2UZDA 1ZY5A 5I3RA 3UVRA 4I0TA 3SG9A 4IX5A 3RAKA 3EKKA 4YSJA 4G17A 2YIRA 2ESMA 2CNUA 1ZAOA 4OW8A 4G1WA 5AR8A 4WKQA 2FO0A 1CDKA 4MBIA 4GV1A 4YJSA 3HEGA 4LMUA 4XP2A 5AP7A 1U54A 5EI2A 3FZRA 3OP5A 2XMYA 4NIFA 5IEYA 3ZO2A 4TYEA 5HVYA 3M42A 2PYWA 4Y46A 4O0VA 2UW8A 4OTFA 1P2AA 2VO7A 2JIVA 3GCPA 2W1ZA 4XG3A 2Z8CA 1DI9A 2UZBA 1UA2A 2XANA 4XG8A 4XLIA 4I0RA 4PMPA 2RG6A 3HECA 4G2FA 4U43A 1H1WA 4RQKA 4DFLA 4NT4A 3MVHA 2WOUA 4BDJA 3FPMA 4FKW