3VQHA

Bromine sad partially resolves multiple binding modes for pka inhibitor h-89
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
347
structure length
344
Chain Sequence
AAAKKGEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Anomalous dispersion analysis of inhibitor flexibility: a case study of the kinase inhibitor H-89
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 344
sequence length 347
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vqhA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vqhA02
2O0UA 3BZ3A 3RK7A 3GU8A 1NT2A 3IOKA 3OCTA 4BICA 1H1QA 2VWIA 4FTLA 4A9TA 4NCTA 4YPSA 2BIYA 5E8TA 3V51A 2BILB 2XEYA 4FSYA 3MFUA 4E73A 4QMMA 3HMPA 3LFSA 4YJUA 3R73A 1XBBA 2DS1A 5DNRA 1XR1A 4FL2A 4AN3A 5HU3A 2YZAA 2X8IA 3AGMA 3R7EA 3F2RA 1M52A 4Z7HA 3FAAA 4DG2E 4ARKA 4EK5A 4YBJA 5BYZA 4IIRA 3FYKX 2VX0A 2UZBA 4A9SA 1PKDA 3Q4UA 4BCJA 4MBLA 4L6QA 4CKJA 4DEIA 4F6UA 3S0OA 4FL1A 3EQGA 2R3RA 3A60A 4MHAA 2YN8A 3BU3A 4EOPA 3JUHA 3PJ8A 5CI7A 3FZPA 3VBWA 3MBLA 2HZIA 2YIWA 5CQUA 5IEXA 3UQFA 5KZIA 2JKKA 2C3JA 4G34A 3GI3A 4TKSA 4C7TA 3HDMA 4IMYA 5AV0A 4ZP5A 4DAWA 4IZAA 5A6NA 3NAYA 4JAJA 4L43A 1IEPA 4LRKA 4EOSA 3WZJA 4DC2A 3DDPA 5J9ZA 3EKKA 4GEOA 4EH8A 1VYZA 5A4CA 5AUTA 4K0YA 3VBXA 3DK7A 4D9TA 2X8DA 4PRJA 2P33A 5EYKA 2F49A 3OCGA 3FMNA 2PMLX 1YDTE 4CV9A 4XUFA 2GQRA 2GHGA 2XCHA 4KUJA 5FUTA 3SQQA 3AT2A 2CKPA 3C5IA 3NUNA 4JAIA 2F7EE 2RFEA 1ERKA 3G6GA 3QLFA 4APPA 4YNOA 2O8YA 3ZLYA 1YDSE 3KRJA 4ZZMA 4K6ZA 4RMZA 2GSFA 3CKXA 3PA5A 4BHZA 3C9WA 3BWFA 4D28A 3CPBA 2VTQA 3KA0A 4XG7A 4G5JA 4DF3A 3TEIA 3VF9A 5HQ0A 2J7TA 5EM6A 2R5TA 3FZOA 1IA9A 3PA3A 4X3FC 4I1ZA 3R71A 4J1RA 2IVUA 1FVTA 2X81A 2YM7A 4MWHA 3GCVA 4FE2A 2BALA 2IN6A 5DT0A 3F5XA 4FTCA 3CCNA 3FMDA 5KUPA 2J0LA 4JL9A 4U40A 2AUHA 4IEBA 4L3LA 5DOSA 2R3OA 5AP7A 4AZTA 3TKUA 2H34A 4TNDA 3LQ3A 2YITA 4A9RA 2BCJA 4CG9A 3ZYAA 5GIOE 3JVRA 2ITPA 4AUAA 3A7HA 4BTMA 4QMXA 4AFJA 3QYWA 5E8ZA 5DR6A 4G3EA 4UYNA 4J53A 2XCKA 4FIGA 2UZTA 4UZHA 4F09A 2ONLC 4ACDA 3NW6A 1QPDA 4KINA 4OUCA 4DBNA 2CJMA 2VO7A 2X1NA 5EYMA 2XK4A 3CQEA 3F7WA 2HXLA 4O91A 4Y8DA 2FA2A 4FMQA 3THBA 3BLQA 2R2PA 2ERZE 2XBAA 2Y8OA 1UU9A 2EU9A 2XEZA 4QD6A 3IQ7A 4LMNA 4F6WA 4HW7A 4EOKA 1L8TA 4DA5A 3NUUA 1UWJA 3SV0A 5LQFA 1JKSA 3PDTA 3LFAA 1Y91A 3QGYA 1JSUA 1PXKA 4RLKA 3CSVA 4XBRA 2BPMA 3O7LB 5CVGA 3ZRLA 4PPBA 5TR6A 2O3PA 4LFIA 2B55A 1UU8A 2KULA 3R9HA 5J1VA 3FY0A 2GS7A 4DITA 3QD4A 3R1NA 4PF4A 1G3NA 2JIVA 4YURA 2XKDA 2XJ2A 4FT9A 1SVHA 1Q8TA 4QYEA 4W4WA 4DGNA 4H36A 3L8VA 3QQUA 5IEVA 2XZSA 2C6KA 3FZ1A 3WZEA 3L8XA 1KOBA 3C4ZA 3V5TA 3I5ZA 2R3KA 4DINA 5E9EA 1W83A 1CKPA 1T45A 3R28A 4TN6A 3SC1A 4EH4A 1MRVA 2IZRA 3OWKA 3R8MA 4EHZA 4JDJA 1OKVA 4BDAA 3DJ5A 4DTKA 3F82A 4EH9A 2V62A 2Y4IB 4NFNA 5IEYA 3LW0A 1A48A 2JKOA 3A7FA 4NIFB 5EDQA 2W1IA 4ZTHA 5I3OA 3UQGA 1P14A 4PTCA 2OXYA 2YEXA 4JVGA 4NSTA 5DVRA 1I44A 4KBAA 4ZJVA 3PE2A 2QLQA 4P2KA 5AEPA 4ZZNA 3BKBA 3QX2A 1KUTA 1KE8A 2ZMDA 4MNEB 1PXIA 1Z5MA 3V04A 3R83A 4D2WA 2UZWE 4X0MA 4AOTA 3GNIB 3DBDA 3CJGA 3UJGA 3ODYX 2R3HA 4XLVA 4BI1A 1U46A 1XH9A 5AM6A 5JGDA 3ORXA 1IASA 2Z8CA 3VW6A 4P90A 2VZ6A 4O7RA 4N70A 5GIPE 3WARA 5M56A 1QMZA 3ZO4A 3KC3A 5A3XA 2F2UA 5TKDA 5FTGA 4EBVA 3NW7A 1YOJA 2JAVA 3L1SA 3JVSA 2C5VA 1SVEA 3OY3A 3PY1A 4I3ZA 4IVBA 1MRYA 2CCIA 4RIYB 3DCVA 2X4FA 3TT0A 3W32A 4AW5A 5K5XA 4DT9A 4BY9E 3OUNB 2WTKB 1GNGA 3G9LX 4YJNA 1G8AA 3I81A 3OWJA 3QD0A 4IANA 4FEWA 2PZIA 2ZYBA 2VTAA 4NU1A 3TKIA 3W18A 4EBWA 4EQMA 2EB3A 4AZFA 2X0GA 4XV2A 4AGUA 3TNHA 3TI1A 2VWZA 3PWYA 5CF5A 3UOLA 2JFLA 5A4TA 1WBNA 2FO0A 4ZIMA 2FSMX 2UW5A 4FSZA 1QCFA 3BU5A 4JDHA 4RFZA 5LVLA 4DLIA 5GNKA 1PXMA 4C33A 4ZSJA 2JDSA 2JKQA 3PXFA 2R3LA 3NNXA 4ZSEA 3KREA 1NVQA 1OPLA 4MF1A 3R8ZA 3V8SA 3MVJA 4ASEA 4KIPA 4CG8A 1JBPE 4H1JA 4G3FA 5CNNA 3QQGA 1OIYA 4I5MA 4NM3A 3AGLA 4FSRA 4CLJA 5DWRA 4CMTA 5GJFA 3UNJA 2C6EA 3NZ0A 5CAUA 4FV7A 2XKCA 5AR4A 1REKA 2QOHA 4XG9A 5K4IA 4FV3A 2VUWA 2J51A 4BC6A 3MTLA 3LFDA 2CHLA 1JOWB 3EN9A 3FXXA 5EK7A 2OJ9A 2XNBA 4AA0A 1OL7A 4RJ6A 4UEUA 3VQUA 3R0TA 1OPKA 3RAHA 3PJCA 3TL8A 3UVPA 1GIJA 2XM8A 3PSDA 2B7AA 2C6TA 3EYHA 4CKRA 5HE0A 3L8SA 3MA6A 4RVKA 2OKRA 4EUUA 5HI2A 3E63A 5CAOA 4YPDA 1XWSA 1CMKE 2ZDTA 2VO6A 1OL2A 4U9AA 4BCHA 4V04A 3ZH8A 3AC1A 4EHGA 2GHLA 2A27A 3I6UA 5BVNA 4UZDA 4TL0A 2B1PA 3L8PA 2X4ZA 1E9HA 1OL1A 2XIXA 3LOKA 5CSHA 2WXVA 3ORIA 3QQJA 5ANDA 4IX5A 3RHXA 4EQCA 3OT8A 1ZZLA 5LOHA 4C34A 4PL5A 3D83A 1B39A 2HY81 2XBJA 5A9UA 3QL8A 4GK2A 4BBEA 3F3VA 4IX3A 5J1WA 4J95A 2E9OA 4EWQA 5M4IA 4QMQA 4OTPA 3IW6A 2WTKC 3LVPA 4RQVA 2EXEA 4TNBA 3RAIA 3VHKA 2JBOA 3PTGA 4I5HA 5M55A 3I60A 3U8WA 4FGRA 2QOCA 1XO2B 4AF3A 5IH4A 4DFUA 3T9IA 2W4KA 5AP6A 4DFYA 2XIKA 1MRUA 4IZ5A 5AR5A 3OXTA 3UZTA 4EWHA 4CTCA 4FTIA 2UZEA 2V5QA 4RIWB 2BFYA 1Q8WA 3SRVB 4C2VA 3O71A 3Q4CA 2YFXA 3HX4A 4HOKA 3R63A 4E20A 3DXQA 4K18A 5BVKA 4EI4A 5M08A 3PXYA 4F70A 3U55A 1V0BA 1PKGA 2A0CX 2Y6OA 2GNFA 2QC6A 2C3LA 4CNHA 4O7NA 3PPJA 3DY7A 4FKUA 5FTOA 3D5VA 3UO5A 3DFAA 3RPYA 3V6RA 4K1BA 5J9LA 3PVGA 4JG8A 4GU6A 4O7SA 2B0QA 4OTDA 4P4CA 2XS0A 3HECA 2OF2A 3Q3BA 3VQHA 3W55A 2HK5A 4C37A 2JGZA 3F5PA 4Q9ZA 2WU7A 4AA5A 3DAJA 3KXXA 2WIPA 4NH1A 1XBAA 2IJMA 3LKMA 4FKWA 2IZTA 2PVJA 3C51A 3EQCA 4YJQA 5FBNC 3PY3A 4RWKA 5JK3A 2QONA 3ODZX 4RIXA 4KS7A 2WMBA 4I0SA 5K5NA 3LE6A 3F2NA 5LMAA 4D0WA 3C7QA 1PMUA 5BUEA 5DI1A 5DH3A 3LCKA 4GW8A 4IB1A 3MVMA 2IVSA 4FX3A 1URWA 4L9IA 4PX6A 3PZEA 4LRJA 4Y85A 3RK9A 4CFXA 3SW4A 1UNHA 5HTIA 2B9FA 5E8VA 3W16A 2ZM3A 5BX0A 3U6HA 3I7BA 2X7OA 3RJCA 4I4EA 5IQDA 5LXMA 2XMYA 1URCA 2YJSA 5HBJA 5E1SA 2X9FA 3OTUA 4IACA 3TNQB 3UIBA 2QOKA 4ITIA 3GC9A 4IM3A 4JT3A 4JJRA 5IA5A 3BI6A 4JR7A 5IUIA 5IH6A 1OGUA 2C6LA 3N9XA 1KWPA 3QRIA 5HG7A 3P0MA 2J0JA 3B2WA 4MQ1A 3RPOA 3ZSGA 4GKIA 5F9EA 1UV5A 2P0CA 4JBOA 3B8RA 5EDPA 5IQGA 4UWCA 3FMJA 5HO7A 5L3AA 5G1XA 2VTHA 5M06A 1UU3A 2B9IA 5DG5A 1JLUE 3UC4A 3DNEA 2OJFE 3GB2A 5TO8A 4KBKA 2W06A 4RZWA 1KE9A 3M1SA 3QQHA 3ELJA 2HXQA 2ZJWA 5EKOA 4ASDA 4O83A 3I5NA 3KXMA 4O82A 3F7ZA 4KRCA 3KF7A 2CDZA 4H39A 1M2QA 4DYMA 2B9HA 4EC8A 5CNOA 4EOQA 2PUPA 3C13A 4O0XA 4EQUA 1R1WA 3S4QA 3VUMA 4KIKB 2GNLA 3SOCA 2O2UA 4RG0A 2UW3A 3TM0A 5AV3A 4PL4A 4D5HA 3LFCA 5C4LA 4FVPA 2V22A 4MNFA 2QURA 4QP9A 5HX6A 3CQUA 3NYOA 4BF2A 4PP9A 4MD9E 3VVHA 1R39A 4WSYA 4BCOA 3WF5A 3QZFA 3SA0A 4BCKA 1XQZA 4XV9A 5A14A 1YWVA 2PTKA 2QO9A 3BCEA 4GSBA 3QZIA 2PUIA 1GZOA 2P3GX 5CXHA 5L8JA 3V5JA 4H1MA 3QTQA 5AP0A 2XIYA 1UKHA 3DXNA 5IQHA 4X6QC 4DGOA 5L2IA 2J5EA 2LAVA 1S9JA 1JKLA 2PL0A 3ENHA 3NLBA 3RI1A 4RWLA 2C1BA 1ZYJA 4AP7A 4WO5A 3OCBA 1M17A 4IHPA 3O17A 4FV4A 2UW6A 2V7AA 4FTJA 2QOLA 4LGDA 1OI9A 4O38A 3AMAA 4P7EA 3RPSA 4B4LA 2X8EA 5KKRB 2GTMA 5FXSA 5HVJA 3FMHA 2BROA 4ALUA 3A4PA 2BAKA 1Q3DA 4YJTA 2QODA 2UW4A 4IADA 3SKCA 1BI7A 4YLJA 4RRVA 3ORKA 4FIHA 4WRSA 4C4FA 2CLXA 4O27B 3WF7A 2W1FA 5A6OA 3R9DA 4ID7A 4NKAA 2C5YA 2KTYA 4O0RA 1ZWSA 5CAQA 4QP2A 5AUWA 5L6OA 5F94A 4IDVA 2WIHA 4E4MA 4Z9LA 4FA2A 4MXYA 3BIZA 4JDKA 3QCXA 1CKIA 5FM3A 4BI0A 2YIRA 1MUOA 2Z7RA 3O51A 3OEFX 3TDVA 4AAAA 1LEZA 4KSPA 3ZEPA 4ANLA 5EOBA 4Y83A 3QBNA 3AQVA 2YDJA 3EQPA 3PIYA 3GC0A 4RJ7A 3HV6A 5TT7A 3SXSA 2Y7JA 4KKEA 3ID6C 3M11A 5FRIA 5L4QA 3MVLA 4L7SA 4B9DA 2HCKA 4RFMA 4EZ5A 3PVBA 5H8BA 4C02A 2OXDA 1OUYA 4P5QA 2WNTA 4ZTLA 4V0GB 3ERKA 4PMPA 3B2TA 3SAYA 3TDWA 3D7ZA 2GU8A 3FMLA 2WGJA 2HIWA 3R04A 3EFLA 5ETAA 2XK8A 3PY0A 4XG4A 3DU8A 5BVOA 3V5QA 4LL5A 2YA9A 1G5SA 3WZDA 5H3QA 1JSTA 4DH5A 5FG8A 3ZU7A 4F99A 1YVJA 2A19B 5IA2A 4RA5A 2ETRA 4ACGA 3QC4A 2JDRA 4DEGA 3GCSA 3MGYA 5DLSA 3H9RA 4LOQA 1FINA 4GU9A 4YP8A 1JQHA 2BRNA 3EFWA 3MJ2A 5K0KA 5L2QA 3RKBA 5J7HA 3BYMA 5AADA 4XG3A 4CFUA 2JD5A 3H30A 5CYIA 2W99B 3WOWA 1TKIA 4GK4A 3RNYA 3RZBA 4NCTC 2UW9A 1M2RA 3GQLA 3II5A 4UWBA 5HNBA 3P7AA 4M8TA 5KKRC 4MWIA 3U6IA 4O6EA 3CQWA 2C3KA 1TVOA 2WTCA 3E8NA 4O0WA 4KIOA 4HCTA 3NUSA 2PVKA 5KMMA 4ZXTA 5BVDA 4ZMFA 2QOFA 3VAPA 3Q5ZA 3HDNA 2QVSE 4U6RA 4XLIA 3BHYA 4DEHA 4NJDA 1H8FA 3G2FA 4K2RA 3TUBA 2R7IA 1K2PA 2VGPA 4YJRA 4Q2AA 3G15A 3DKCA 4QPSA 3FHIA 4MH7A 1I09A 4FSUA 2BFXA 2ETKA 3CGFA 4AWIA 4FT7A 2NRYA 4ANNA 3EZRA 2GNJA 3ZCLA 5HTCA 5EHYA 4HGEA 1YXXA 2C68A 2ITTA 2G01A 2WQMA 3KK9A 2YABA 4D2SA 3S95A 4C59A 4V05A 5FBOA 2WTWA 4D1XA 4K9YA 4C4IA 2ITXA 5D1JA 4D1SA 5ETFA 4FTQA 5AR2A 3HRCA 2YHVA 3GFEA 4S30A 1FQ1B 2W05A 3SGCA 2WEVA 2E9PA 4XOYA 3SG9A 2GFSA 3PP0A 3KK8A 3Q2MA 3CTHA 4FSNA 4O84A 5IQAA 3Q5IA 3QALE 3QTSA 4QP1A 2C4GA 4C0TA 3TN8A 2WPAA 5LVPA 2JKMA 4NM5A 5KMOA 5CENA 1W0XC 2A2AA 3RVGA 5KBRA 3BYSA 4FNZA 2AC3A 4S31A 5ANIA 1TQMA 2X9EA 4YTFA 2ZV7A 2JDTA 4ZLYA 3ZZEA 3F61A 2QCSA 4I5CA 5CSVA 1FGIA 3TNWA 2UVZA 3DK3A 5CY3A 3MN3A 1YI6A 2BTRA 2VTMA 4M69A 4QQJA 4ZEGA 5HICA 4IJPA 4AFEA 3VRZA 1KE5A 3HUCA 3QTUA 4AT5A 3W10A 5JGAA 4WA9A 4OTHA 4D4SA 4ZY6A 1IA8A 1W7HA 3FWQA 4B0GA 3IS5A 4AZSA 2ERKA 3V8TA 4ALWA 2QLUA 3KMUA 2W9FB 3NNWA 5HCXA 3UZRA 1QL6A 1ZRZA 2BZKB 3MY5A 5AR7A 4BGHA 3LMIA 2WOTA 2QO2A 5HLNA 3NYXA 3E3PA 4QTBA 4OAUC 1Q99A 4GVAA 2XNGA 4YJPA 4ASXA 4U42A 3UZPA 3PPKA 5E92A 5CU6A 1OL5A 4BCNA 4GYIA 5A46A 1OL6A 4QP8A 4ZSAA 1XH5A 4USFA 4QMWA 3U9NA 2Z02A 1YRPA 4FTMA 3F3UA 3P79A 3PXKA 1E1XA 3Q4ZA 4GH2A 4F9BA 4IFGA 3KRLA 3QWKA 4X3JA 4MXOA 3ZRKA 2YIYA 4AGDA 5DR2A 3FKNA 5HNIX 3IDCA 5L2TA 4E26A 4TWNA 2XF0A 3DAEA 2OZAB 1W98A 3A7JA 3P86A 4HYIA 2QOIA 3KN5A 3O8PA 4IAFA 5C01A 4ZJJA 4X3FB 3TKHA 1S9IA 4FNXA 1MQ4A 2BDJA 2Z7QA 3F88A 4EH5A 5L2WA 1HCLA 3D2IA 3FPMA 3EWHA 1LUFA 1V1KA 3KY2A 2ITYA 3VS4A 4C38A 3UE4A 5ETIA 4FKPA 4OBOA 5ETCA 3A4OX 4WSQA 3FQEA 4JLCA 3VUDA 2YLEA 4FOCA 2WMWA 3HA6A 1M7QA 3OY1A 4BIDA 3CD8A 5HZNA 3FI2A 3SX9A 2G9XA 4OR5A 4KRDA 2BAQA 3PJ2A 5GJDA 5FD2A 3RWPA 3Q60A 3LQ5A 4J98A 5HIBA 5KMNA 1JPAA 2VAGA 4PMSA 3IECA 2JEDA 4CZYB 5FP5A 3CBLA 1H26A 4NFMA 4FYNA 4RVTA 2XK6A 3BPRA 4FZAB 5IUHA 3DKOA 3PJ1A 4KA3A 4KB8A 2IPXA 2AYPA 2OG8A 4RLLA 4JIKA 3VS1A 3ACJA 3RHKA 3O50A 2E2BA 2R64A 4I22A 2J50A 1R0PA 2GS2A 2VNWA 1FOTA 3EQIA 2W1GA 4M15A 4BDJA 4BTJA 4D4YA 3DQXA 3FI8A 3KULA 2XRUA 4TRLA 2RSVA 2G15A 2P2HA 3EMGA 3NGAA 4NEUA 4YZ9A 4C57A 2XNNA 1OITA 3VHEA 1IRKA 2H96A 5KNJA 5DT4A 1AD5A 1KE7A 2CGUA 1WBVA 3ZM9A 5GINE 5EFQA 4QRCA 4R3CA 3H0ZA 3ATSA 2Z7LA 2PVNA 3FLNC 3NPCA 5FP6A 4DG3E 1VR2A 2VWBA 4WRGA 2WTDA 4GCJA 2X2LA 4PDSA 4J97A 4TTHB 4XV3A 4C36A 2P55A 4AOJA 3NCZA 5H8GA 2VWYA 3FC1X 4KSQA 4YJOA 4BDDA 5IQEA 1NVRA 1T46A 4O2ZA 1JAMA 4RBLA 4J8MA 5DPVA 1U54A 2VX3A 4RGJA 2FSOX 5CEIA 3G0EA 4XG2A 4XYFA 2RIOA 3P9JA 4FZFB 2CCHA 4NTTA 4LUDA 3DDQA 4TY1A 3V5LA 2UUEA 3ZS5A 4D9UA 3ATTA 4JG7A 4O7WA 3UGCA 4FTKA 3IK3A 3R9OA 1Q61A 4C3PA 3PIXA 4HPUE 5ANKA 3ZUUA 4IAIA 4QP4A 4ZAUA 3RPVA 5DRBA 3I0QA 4C62A 4BTFA 4EOMA 4R77A 2XYNA 4DBXA 2YM8A 5I9XA 1GZ8A 5C27A 5LWMA 3HZTA 4FVQA 3EKNA 4IDTA 2GMXA 3SD0A 3QTIA 1ZOGA 3NWWA 3Q9WA 3G9NA 5IQCA 2VTIA 4W8DA 3LAUA 3SXRA 2J9MA 4ZSLA 4F1MA 3IW7A 3B8QA 2QU6A 4L3JA 4FTRA 2H8HA 3RBWA 4L67A 2BRHA 2PZPA 4FEUA 1G8SA 3IGOA 4AQCA 3NMUF 4H3PA 3QZGA 4OTRA 5EQYA 2XB7A 1JKTA 2VTOA 4ZTSA 4F7NA 1J7UA 1PJKA 2JDOA 5CVHA 4L7FA 4U3ZA 4M84A 4DFLA 3DKGA 2X7GA 2R0IA 4PDOA 2VRXA 3MH1A 3NUAA 2PK9A 3LFNA 2HENA 2QD9A 1H0WA 3COHA 1OECA 3F3TA 3ALNA 4CCUA 4G17A 4PPCA 4CFWA 3CPCA 2DQ7X 3FL4A 3KRXA 3R7YA 4RIOA 3QAME 2WEIA 4C2WA 5M09A 3KFAA 5BUIA 2UVYA 5JRSA 4PMMA 2NO3A 2F9GA 1PMEA 2HW6A 4RX5A 3DB6A 4I6HA 3ZRMA 3HL7A 3K2LA 3QKMA 3CY3A 1ZAOA 3COKA 3V6SA 4N6YA 3FBVA 2W5AA 5C26A 4FIJA 4IZYA 4XV1A 3O96A 5EW3A 4C4HA 3FDNA 1PXLA 3QTWA 5JZNA 3DZQA 4KABA 3DZOA 4AX8A 5DRDA 2PMIA 3UO4A 3FJQE 4ZY5A 4XJ0A 1XHAA 2QOQA 4LOPA 5FM2A 3A8XA 3A2CA 2HWPA 3CJFA 4Y72A 1H1PA 1Z57A 5IA3A 1NXKA 4JQEA 3LFQA 3CY2A 4MD7E 4BCMA 4U80A 2CKQA 2R3FA 2F2CB 2F7ZE 3FV8A 4YHTA 3R1YA 2C47A 4FNWA 4WIHA 5CU2A 5E8WA 3U87A 3ULIA 3UODA 3VIDA 1B38A 3BLHA 4QYYA 2BHHA 4PY1A 4OTGA 4BZDA 2ZAZA 5CU4A 4FEQA 4MBJA 5BUJA 4YC8A 4NW5A 2IW8A 4TYHA 5M57A 3ZC6A 1RJBA 2W1HA 4U5JA 5B2LA 1ZMUA 3Q9ZA 4FKQA 5JZJA 4DT8A 5J5SA 4F1TA 4DH3A 3ZO3A 5KHXA 4G16A 4MXCA 4O0SA 5FGKA 2XM9A 2QHNA 4U7ZA 5D10A 5DN3A 3QCQA 3F5GA 4MVFA 1UKIA 3F69A 5KO1A 2XNMA 4LM5A 4D1ZA 4AU8A 2YM3A 5CAVA 5DFPA 2ZDUA 4UALA 1CKJA 5I9YA 5HIEA 2QKRA 4ACCA 4QT1A 5DT3A 3LM0A 5LJJA 3NNUA 3LXPA 3R8VA 2PULA 5IISA 2VWXA 3AXWA 1Y6AA 4G6LA 4ITJA 3VBVA 3WZKA 1IAJA 2O63A 1RDQE 3CLYA 4PTGA 4CYJA 3N4TA 4F08A 1H1WA 2PVYA 5J95A 5J79A 3UOKA 4OT6A 5C1QB 4F7JA 2FH9A 3OUKA 4TT7A 4W9WA 4UMTA 4KKHA 4KBCA 2XRWA 5IUGA 2EXCX 3D14A 3NDMA 3EJ1A 4CKIA 3FXWA 1OIRA 5FTQA 3BYUA 5BNJA 3OBGA 3SLSA 4B8MA 4ANBA 4XMOA 3PSCA 4CZTA 2PE1A 5JQ8A 2VGOA 3DK6A 3CTQA 5CWZA 2YCSA 5FLFA 4M66A 4QTCA 4RZVA 2VN9A 4HYHA 4DEBA 2OF4A 3WYXA 1B6CB 5IMEA 1ATPE 1IR3A 2YDIA 3W8QA 2PY3A 3FY2A 4EK4A 5GJGA 4P5ZA 4FT5A 4M68A 3LLAA 2OGVA 1UA2A 3PUPA 3QA8A 4LG4A 3FYJX 5CF4A 1PXPA 2RFNA 2UZLA 2Y0AA 3GOKA 4HZSA 5EG3A 5FXQA 2IWIA 3UQCA 2IVTA 2P2IA 2YM4A 2YAKA 4RT7A 2WMQA 3IW8A 4AOIA 1ZYSA 4N57A 4FVRA 2NNWB 3ITZA 4LOOA 3AC8A 2DYLA 4R3RA 5KMJA 4PL3A 3VS7A 3BQRA 2C6DA 3VUKA 5AAGA 5L6PA 3VS0A 1BUHA 4XP0A 4EC9A 4KD1A 3QQFA 5ANJA 1OKYA 5C03A 3VNTA 3PIZA 1DAWA 4RQKA 3BX5A 5CANA 3LXLA 4FIFA 5B2KA 4UMPA 3FZRA 2XJ0A 4YZMA 1PYEA 3TTIA 5I9WA 3O8TA 3MIAA 3DKFA 4BIBA 1O6LA 4C4GA 1UWHA 2WKMA 4QOXA 1ND4A 5M4CA 3GCPA 2XK3A 2BAJA 5IPJA 4M0YA 3LJ2A 3NAXA 3ZFXA 3RNIA 4WNMA 4AS0A 4D58A 1OB3A 1U59A 4BGGA 1VZOA 4YUQA 1ZOEA 3ORNA 4XRLA 4L00A 4FV1A 4GL9A 4RJ4A 2JAMA 3OS3A 4M12A 3DB8A 3Q9XA 4I41A 3FLWA 4OBQA 4ZTRA 4BCGA 3KXNA 2ZM4A 3LXKA 4NTSA 4S33A 5JQ5A 4L44A 4O0VA 5K4JA 4D4RA 4DTAA 1CM8A 1H28A 4IC8A 4J71A 1KSWA 4G1WA 4DH1A 3F66A 3VBTA 1YHSA 4OT5A 3BELA 3K3JA 4II5A 5CQWA 4YZNA 4TPTA 3E92A 3OD6X 1WBSA 5KX8A 4TW9A 3E62A 3PJ3A 2YJRA 3H9FA 4FKSA 4QMNA 4RX9A 4MTAA 1OIQA 4V01A 4IBMA 3R02A 4IAKA 4YLLA 3MH0A 5AAEA 3ALOA 1WBPA 4NZWB 2CKEA 4TWCA 2CNVA 4LUEA 5GZAA 2IVVA 2OH0E 4CMOA 2CMWA 3EN6A 5FXRA 3OXIA 2NPQA 1YXTA 2WTIA 3HMMA 3WYYA 5HG5A 1Q4LA 3RGFA 1PHKA 4TYIA 3IPHA 1XH8A 4IWQA 5D12A 5CEQA 3QXOA 3ACKA 4Y95A 5DBXA 3EFJA 1XH6A 5J7BA 2WHBA 1RQQA 2WB8A 4GFOA 3PYYA 2BZIB 4KAOA 5HE1A 4K33A 5EYCA 1R3CA 3DA6A 4HPTE 5G6VA 4QP3A 4EONA 3NCGA 5EYDA 4MXAA 2CSNA 4QQ5A 3FI4A 4CRSA 4FIEA 1UNGA 3OC1A 4X2NA 2PPQA 4M7IA 4UBAA 3IONA 4ZY4A 2GNIA 2OJGA 4BKJA 4BRXA 4BDCA 4ANSA 5IA0A 3VS3A 3BGPA 4H3BA 3V8WA 1SNUA 2XUUA 5CEKA 3DFCB 1H1RA 3LCOA 4QMYA 3D5UA 5H8EA 4GRBA 2UV2A 4I6QA 3IO7A 3RTPA 3W2RA 4Z7GA 2WQOA 5LWNA 5AIRA 3UO6A 3H3CA 5DGZA 2H9VA 1Y6BA 3RK5A 5C9CA 4CFNA 3FLYA 5KMLA 3PE1A 4D0XA 3BGQA 2O64A 2GNHA 4JX3A 5HE2A 1AQ1A 2XNEA 3RAKA 4EHVA 5HIDA 5AJQA 2ITOA 2R3NA 3A8WA 3FLSA 4IB0A 4FT3A 2REIA 3HV7A 4IWDA 4U81A 4YJVA 2XKEA 4GT3A 3UG2A 3M2WA 4QPAA 4XRJA 1KOAA 1XJDA 2RG6A 4BCQA 4PNKA 5TOZA 4HVIA 4JQ7A 4O1PA 3GCUA 4U8ZA 5I9ZA 4LMUA 2I0EA 3D5XA 3RP9A 2J2IB 4R7BA 4NIFA 2QO7A 4PNIA 3W2SA 5ICPA 3TUDA 4O7YA 3EN7A 3MPMA 3R8PA 4F1OA 3FZTA 4WT6A 4X2JA 3T3VA 3U9CA 4YMJA 4HVGA 5IDNA 4IQ6A 2OBJA 3LMHA 3S3IA 2BRBA 4OAVB 3NS9A 1Q24A 3A7IA 4MNEA 4DFNA 3P08A 4Z16A 2PVHA 2OZOA 3HLLA 4UB7A 4E6DA 2CN5A 4MKCA 5FWKK 5BVFA 1H00A 5JT2A 1YI4A 4ANOA 2QR8A 4YBKA 3I7CA 5H9BA 2ITZA 2XIZA 4R1YA 3MS9A 1O6YA 4M97A 3R22A 3RCDA 2FSLX 2G2FA 3DPKA 4U44A 4AE9A 4S32A 2BKZA 2OFVA 2R3JA 3GGFA 1XH4A 3LJ1A 3F5UA 4I92A 4Y73A 3TIYA 4E6QA 2G2HA 3MYGA 4GT4A 4RA4A 2VWUA 3TV4A 4LV5A 3DT1A 2PUUA 2XH5A 3LLTA 4ITHA 4NJ3A 4RIYA 3W2PA 5CI6A 2HWOA 3A61A 3ET7A 4EK3A 5DMZA 2HELA 5CSWA 1H24A 3ZFMA 5LCJA 3W1FA 4X7QA 5KMKA 1ZARA 3NIZA 2ZOQA 2OIQA 2OICA 1XKKA 3HEGA 4M3QA 4XBUA 3CKWA 4BWXA 4E6CA 4FZ7A 5IQIA 1Q41A 4F9WA 5DIAA 1V0OA 3QCYA 1ZXEA 2VWWA 1LR4A 3OEZA 4FKVA 4WD5A 1PRYA 5IMXA 5EM5A 4IVDA 5AMNA 2C3IB 3GFWA 4QMTA 1J1BA 2VTPA 3AC3A 2PE0A 3G51A 3OW4A 4AT4A 3ZLSA 2AC5A 3UPZA 4FR4A 4M67A 4QMVA 2CLQA 3C4XA 3QF9A 4CCBA 2E9VA 3OBJA 3DQWA 3JS2A 3O2MA 3ZLXA 4E6AA 1DM2A 4O22A 2PU8A 1R0EA 3Q53A 1V0PA 2WELA 2X2KA 5DYJA 2EB2A 4U79A 2BVAA 3DBCA 4FTUA 3MSSA 4FODA 4LL0A 3UDBA 3VJOA 3ZUTA 4FEXA 4FT0A 3H10A 1FVRA 3AC4A 1L3RE 3OVVA 2F7XE 3ANRA 4CMUA 4G3CA 4AT3A 4PDYA 2HZNA 4OW8A 3Q6WA 4IWOA 4DGLC 4FZ6A 4OGRA 4R3PA 4M0ZA 5EM7A 4W4YA 3C4WA 3DLSA 4JG6A 4CQEA 2BUJA 5EKNA 2PUNA 5AV2A 1CDKA 3N4UA 1BLXA 5ACBC 1WZYA 1SMHA 3W2QA 3OF0A 5LVOA 2VV9A 3BHVA 4FTNA 4GJ3A 1Q5KA 4G5PA 3SDJA 3N51A 4Q5EA 3VW8A 4BN1A 3VS6A 5HVKA 2VTSA 1OBDA 3EFKA 3KKVA 1WBOA 4GIIA 1PYXA 2BTSA 4FG8A 2WU6A 5AP4A 4U41A 3TZ7A 1FBNA 5CU3A 3MY0A 4DH7A 4I5PA 2ETMA 3GU6A 3U54A 4QTEA 4F4PA 4YTHA 5K0XA 3SOAA 3WE8A 3I6WA 2BRGA 5HOAA 4RJ5A 5J8IA 2ZV8A 3QXPA 4FGBA 5J87A 2VTTA 3HMNA 2YZLA 3FL5A 2FB8A 1J1CA 1WVXA 4XCUA 5JN2A 1WMKA 4ACMA 1O6KA 4I0TA 2F4JA 5IZFA 3CS9A 4O2PA 1JSVA 3E3BX 4F0IA 4L8MA 1HOWA 2XP2A 4XEYA 2OJIA 3PRIA 3MW1A 3SRVA 4WKQA 3NYNA 1J91A 5L8LA 2X39A 1UVRA 4WNPA 4FG9A 3KEXA 3GQIA 4RVMA 2WMTA 1H01A 5AR3A 5T68A 1VEBA 2CGWA 3UYTA 4AGCA 3KQ7A 3E8CA 2WZJA 1WVWA 3U6JA 2CGXA 5KBQA 3OW3A 3P5KA 3U51A 2A1AB 1P4OA 5FEQA 5CXZA 3E5AA 2WAJA 3JXWA 1REJA 3C0HA 3D94A 2JIIA 3ZLWA 5BQ0A 4BYIA 5M53A 4FUYA 2PZ5A 3G33A 2WMVA 5A4QA 1YXUA 5CLPA 3OG7A 3R21A 1VJYA 1U5QA 4HNFA 2YERA 4AG8A 2ZB1A 1BI8A 3Q04A 4FNYA 4DN5A 3QRTA 3D4QA 2R0UA 3H9OA 2OH4A 2O5KA 3FC2A 3KN6A 5H2UA 4S34A 2W17A 1YOLA 3GUBA 4JX7A 3MTFA 2DUVA 3F6XA 3LPBA 3MY1A 3EQDA 4W4XA 3RAWA 1JVPP 2SRCA 3IG7A 4D5KA 2R3GA 3ROCA 5JFVA 3FEGA 3AD4A 5HE3A 4MYGA 4IZ7A 3UMXA 4FTAA 1FPUA 1SVGA 4L52A 4AW0A 3MVHA 3SW7A 1PMNA 4HJOA 4WNKA 4F64A 4YU2A 1J7IA 4O7TA 1X8BA 5HHWA 3VUHA 3E93A 1O9UA 5JRQA 3WIKA 4DFBA 3VN9A 3R7UA 5EQEA 4PV0A 3BEGA 4ENXA 4PDPA 2G2IA 2WD1A 2B9JA 2I0VA 2VO3A 3Q6UA 1YOMA 3UG1A 4FV9A 1XBCA 3PFQA 4APCA 1E1VA 3QLGA 2NRUA 4IAYA 4FV2A 4F7LA 4EH3A 5HD7A 4YSJA 5I3RA 5BMSA 3MFTA 5L2SA 3KXHA 5HCZA 2HYYA 2IO6A 3KXZA 3OZ6A 3ZSIA 1F0QA 2QKWB 4QMUA 3S00A 3HRBA 3VBYA 2ITUA 4ZLOA 3ZUVA 5AA8A 3KF4A 3UTOA 3ZTXA 5F1ZA 3K5UA 2R3IA 4XOZA 3PXQA 4IE9A 3UIXA 1DAYA 3V5PA 4GVJA 3ZOSA 4UMRA 4ACHA 4ZZOA 2XJ1A 5CT7A 3WE4A 4CT2A 2I7QA 3R1QA 4FV5A 3PPZA 4NUSA 2W1CA 4DCEA 5I4NA 4M13A 3EZVA 3HMOA 5KHWA 3Q32A 2HW7A 3C0GA 3FMKA 4HGLA 4MXZA 5AUUA 5C4KA 4BCPA 5BVEA 5ACKA 3RMFA 3UIUA 4YZCA 2H6DA 4AW1A 4C3RA 1GY3A 2XYUA 1BKXA 2CKOA 2QG5A 2W5HA 2X6DA 3E7OA 2J0KA 3KRRA 3MJ1A 4FI1A 4GG5A 4LI5A 4QQTA 1APME 2RKUA 3LZBA 4FG7A 2JITA 4L53A 5BMMA 4CZUA 3UOJA 3UC3A 2ITVA 2QHMA 5AX3A 2UZNA 3R00A 2I0HA 3EQFA 2NP8A 4O0YA 3GU5A 5F20A 4I6FA 4IM0A 4R7HA 4O6LA 2DWBA 2HZ0A 3ZDUA 2UZUE 3QD3A 2HY0A 4YZDA 1M14A 4CSVA 5KMIA 3OT3A 4U43A 1ZMVA 3NX8A 3D2KA 5FDPA 4CFVA 3L9NA 5AUZA 1ZYCA 1WBTA 3S2PA 3ROYA 1SM2A 5HG8A 3DXPA 4EZ3A 3HV3A 3P7CA 1WCCA 3F9NA 4QNYA 3S1HA 3HNGA 4KKGA 5JEBA 5HU9A 2RF9A 2XKFA 3UVQA 2WQNA 3PXZA 3PLAE 4FBXA 3RM7A 3R7OA 4U0IA 4IM2A 4J52A 3IW5A 4UV0A 4IXPA 2BDWA 4DG0E 1OKWA 2X2MA 1WVYA 3R9NA 3TXOA 2WMXA 5E8SA 3R30A 3W33A 4XH6A 4CFFA 4X6RA 3QZHA 4RSSA 3TWJA 3D9VA 1IG1A 4ERKA 3C4FA 1ZY5A 2X6EA 3CEKA 3A7GA 3TV7A 3TZMA 2XA4A 4A4LA 5DEYA 3UBDA 1Y57A 1YKRA 2WMSA 3E8DA 3HMIA 2W1DA 1OMWA 4G3DA 4JR3A 4E7WA 1BL7A 2VNYA 3FQSA 4ZJIA 4ASZA 3I1AA 4E4NA 3GBZA 3C1XA 3P23A 4I4FA 3VULA 2A4LA 3O0GA 4YTIA 4E1ZA 3E88A 5HTBA 3QD2B 4HNIA 4OLIA 3I4BA 2E9UA 4HGSA 4W4VA 5CF6A 3COMA 2WO6A 5E8YA 4G31A 4F9YA 5HD4A 1H4LA 3BEAA 3PA4A 4G9RA 3HV5A 5F4NA 1OM1A 3LJ0A 4DLJA 3ZBFA 5IH5A 4LGGA 4ZK5A 4PTEA 2WMUA 1OPJA 2C0OA 2C5NA 5JFWA 3BWJA 4E93A 2QOOA 2ITWA 3G5DA 4IAAA 4LQMA 4NW6A 1P5EA 4RX8A 4V0GA 4QYFA 2W1ZA 5DHJA 5E8XA 4B7TA 3CXWA 3NIEA 1XH7A 4H58A 3FPQA 2J5FA 3Q4TA 5EH0A 2WTVA 2W5BA 4ERWA 4Z55A 2G1TA 2CGVA 3LFFA 5AWMA 3FLZA 1Y8YA 1YWRA 2YM6A 3D7TA 3DGKA 2ZMCA 3L9LA 5AUVA 4CXAA 3WF8A 3VS5A 2LGCA 3FHRA 4L46A 3UPXA 4CFMA 3QTXA 4FV0A 4RC2A 5ANGA 2QNJA 2RFSA 3UP7A 5BVWA 1F3MC 3ZEWA 2B52A 2PVMA 4Z3VA 4UN0C 3L9PA 3R01A 5AUYA 3ZMMA 3JPVA 1OZ1A 4A9UA 4AXAA 4E5BA 5ITAA 4IFCA 4XNEA 1FMKA 4D2PA 4RIXB 3EHAA 3R1SA 3GC7A 2YISA 3OWLA 5TF9A 5JFXA 1GIIA 3RALA 1BYGA 4OBPA 5HLWA 3NVMB 3VBQA 4BDGA 2WFYA 1Z9XA 3NRMA 4ZLZA 5KCVA 4JXFA 3V01A 4LGHA 3A99A 3I0OA 4JRNA 2YCRA 3UOHA 3OCSA 1BL6A 3P78A 4ENYA 3C50A 4J96A 4YZBA 5HKMA 1QPCA 3SXFA 4C8BA 2JFMA 4Q9SA 3KVWA 5FEDA 4AACA 3F3WA 3TV6A 4QMPA 4LYNA 4MXXA 2J4ZA 4D2TA 5AP2A 1GJOA 4RWIA 3NUPA 5CVFA 3QGWA 3CP9A 3VF8A 4FL3A 4WNOA 3VS2A 3DBFA 5LMKA 2PE2A 4FZDB 4WUAA 2WMRA 5BYLA 4AE6A 3EQRA 5AP1A 3T9TA 4TWOA 3H0YA 3QTRA 4NT4A 4H05A 3WI6A 4GMYA 4HGTA 3TJCA 1IAHA 4BDIA 2W4OA 3OOMA 4UXLA 2I1MA 4QNAA 2VTJA 4G6NA 4YO6A 4MBIA 5CTPA 3W2CA 3R7GA 3P1AA 1HCKA 4JDIA 2OXXA 3HVCA 2HZ4A 3FMEA 4BFMA 1OVEA 1OIUA 4IB5A 1JKKA 5IKWA 4MCVA 4CYIA 3C0IA 4BVUA 5CZHA 3VRYA 4FSQA 2R4BA 2R7BA 1H0VA 2Y4PA 1YQJA 2WQBA 4A9YA 1GIHA 3FSKA 3R6XA 4OTQA 4C61A 5CX9A 2QOBA 5E91A 5EW8A 4S2ZA 5FEEA 3ORPA 2Q0NA 4DEDA 2O65A 3ORLA 1CSNA 3C4CA 4HCUA 3EQBA 4LV8A 2OSCA 2YAAA 1A9UA 4MEDA 5ANOA 5CF8A 1YXVA 2FYSA 4GIHA 4I23A 4L68A 4BGQA 1CTPE 2OIBA 4O1OA 3UP2A 2JC6A 2OI4X 1P2AA 4MF0A 5D7VA 3ZONA 3NUXA 4C4JA 2C6MA 4YHJA 3N4VA 3ZXZA 4QMZA 2VO0A 5AUXA 3VUGA 2YLFA 1QPEA 4ANQA 2W7XA 3CE3A 4ANMA 3TUCA 4NWMA 3DJ6A 1GZKA 4JBPA 4QP7A 3RINA 3WZUA 2IW9A 4EH7A 4M14A 2VTRA 3PVWA 2PVLA 5M07A 3QQKA 5HVYA 4C4EA 3PXRA 4GS6A 4F9CA 4EORA 3PG3A 4F9AA 1ZOHA 2PMOX 3OWPA 3QRUA 2Y9QA 4D55A 3IGGA 4UYAA 3G6HA 2JDVA 2BDFA 4EKLA 4TYJA 3FI3A 1KE6A 4EOJA 3ZDIA 4FKRA 5EDRA 4AZEA 4NL0A 4ORKA 4ZTQA 4WBOA 3UMWA 3VWAA 5GZ9A 4FV8A 3JY0A 3BBTB 3TG1A 3PVUA 4QO9A 3TZ8A 4CQGA 3MH3A 4EYJA 3V3VA 3PSBA 2YDKA 3GCQA 2EXMA 5IF1A 2ACXA 3UVRA 3QWJA 3AMBA 4BWKA 2X7FA 4ZMEA 2GS6A 2CN8A 2J0MB 4BDHA 2OZAA 3M42A 4R1VA 5IU2A 3R7VA 4X3FA 2C5XA 2EWAA 4DEAA 2YCQA 2VU3A 3OMVA 2JLDA 4RJ8A 5AV1A 5EI2A 5L6WL 4I6BA 3MH2A 4QMSA 3POOA 5HNGA 3BV3A 3LCSA 2Q0BA 3MA3A 4BDEA 1DI8A 5BYYA 5JSMA 1RE8A 5GZ8A 2B54A 3KCKA 1PMVA 2ITQA 4QQCA 4K8AA 4IVCA 2YIXA 4R6VA 1DI9A 5JKGA 3FXZA 4DFZE 3QQLA 4GJ2A 4NM0A 4H3QA 3ZZWA 5EHOA 3LFEA 4E4LA 5LARA 5B7VA 5JMSA 3I79A 4MAOA 4O7ZA 3SVVA 2ONLA 3ETAA 3CTJA 4HYUA 2J90A 3LHJA 4L42A 4RC4A 5AAFA 4BBMA 3ULZA 4BHNA 3CC6A 4TWPA 3FUPA 5EQPA 2Y4IC 3FZSA 3W8LA 5CEMA 4DE4A 5C8MA 5HG9A 3R2BA 4MX9A 4YC3A 4BDFA 4X21A 3NNVA 2Q83A 4D2RA 5K9IA 5JFSA 4DCAA 3DOGA 4FKIA 3WILA 3TTJA 4JBVA 3QCSA 3QRJA 3ZM4A 4B99A 3SG8A 1ZMWA 3RPRA 3BLRA 3GENA 5DA3A 4HZRA 1ZZ2A 4EOOA 2QG7A 5HO8A 5EI6A 3EL7A 3W2OA 1PW2A 4CGAA 3QHRA 1H07A 4XHKB 5FQDC 3QUDA 3NR9A 5CT0A 2HAKA 3QKLA 5HBHA 4HYSA 4O21A 4WG5A 2QI8A 2YM5A 3NUYA 2IZUA 3HUBA 4AZVA 2QU5A 1Q62A 4JNWA 3G90X 2PYWA 4ZSGA 5AFVA 2BZJA 4NM7A 1BX6A 4KWPA 3AD5A 4RWJA 4DHFA 4F0FA 3MESA 4QMLA 3EL8A 3MI9A 3AC2A 3DTCA 3RWQA 2ZV2A 2WTJA 2RGPA 4U3YA 3U4UA 5BPYA 2R3QA 1GOLA 3IOPA 4KIQA 4FK6A 4YJSA 3UYSA 3WF6A 3V5WA 3MV5A 5CAPA 4JIAA 3KB7A 1STCE 4A4OA 2C0TA 3KVXA 4U45A 2R3PA 3ZC5A 5IDPA 5I5ZA 4R5YA 1AGWA 4C3FA 3IDPA 3ENMA 3EQHA 4GV1A 3EH9A 4OTFA 4FYOA 4RJ3A 2ZVAA 3HRFA 1ZLTA 4GUEA 4CRLA 4G3GA 3GOPA 4BIEA 4CTBA 4E5AX 5A4EA 4U97A 3DJ7A 3K5VA 3FE3A 3QYZA 3WF9A 2OK1A 1YXSA 3REPA 4FKOA 4BKZA 2XNPA 4QYGA 4J7BA 2XVDA 4ONAA 4XP3A 2IG7A 4YO4A 2P4IA 4O86A 1OKZA 1OBGA 3MFRA 4WHZA 3PLSA 5CASA 5IA1A 2BR1A 4FK3A 2F57A 4JS8A 4X2GA 5K3YA 3R7IA 4IC7A 4C58A 3BRBA 3O7LD 1NY3A 4A06A 4WG4A 4HVSA 2BKKA 3ZBXA 4B6LA 3HP2A 2B53A 1Q8YA 3MFSA 5E90A 1FMOE 3AT3A 1U4DA 3NYVA 4FTOA 1J3HA 4K77A 5IA4A 5T6KA 2UZVA 5IQFA 4FIIA 4A07A 3BV2A 3DLZA 4Y5HA 2CPKE 2GCDA 2BHEA 4G2FA 5HBEA 4UMQA 2OO8X 3HGKA 4D2VA 5M44A 3KRWA 5IQBA 4E8AA 5LMBA 4Q5HA 4BBFA 5E8UA 5CSXA 2PSQA 4R5SA 1P4FA 3P4KA 4XX9A 2V0DA 4BKYA 4G6OA 4RX7A 4BL1A 4CLIA 4DTBA 1TQIA 2ZV9A 2YIQA 3PP1A 4B8LA 4ZS4A 1LEWA 4N4SA 4N0SA 1H27A 4M69B 2OU7A 3TIZA 3DAKA 4UY9A 3TZ9A 3ORTA 3UNZA 5CEOA 3DV3A 5T3QA 3R8LA 2FSTX 4DGMA 1DS5A 2ESMA 4YNEA 3GXLA 4YTCA 4XP2A 3JR1A 4GK3A 4I93A 4ZOGA 2BIKB 2IZSA 5HLPA 3O23A 3WBLA 3AT4A 2UZOA 4JRVA 2PVFA 5I9VA 5IG1A 4EK6A 4I0RA 4UXQA 4DH8A 4CT1A 5E7RA 3KMMA 2PZRA 4RVLA 3LM5A 4EUTA 3QFVA 3MB6A 4BZNA 5DE2A 5B2MA 1SYKA 1MQBA 2C30A 3MPTA 4J99A 4CD0A 4IX6A 4BR3A 4L45A 2C0IA 3KGAA 3MB7A 5HORA 5DR9A 3QUPA 4TZRA 3FSFA 1M7NA 4JBQA 3CD3A 4AA4A 4D4VA 1BMKA 4MD8E 4W8EA 4JOAA 3QTZA 3KMWA 3PZHA 3Q52A 2BMCA 3QUEA 3HP5A 3TNIA 1H25A 2XNOA 1NVSA 1ZY4A 1K3AA 2W96B 3OP5A 4L01A 4USDA 2GHMA 3T3UA 3VUTA 4R78A 4LRMA 3HA8A 3GU7A 4QTAA 4TYGA 4Y46A 1PXNA 1Q8ZA 1W84A 3KL8A 4O7LA 5EI8A 3GVUA 3BQCA 2VWVA 3BBWA 1Q8UA 3VUIA 3ZO1A 1LP4A 3DTWA 1OUKA 3AD6A 3K54A 4PPAA 2C69A 2Y6MA 5HGIA 3R8UA 1YDRE 3U4WA 4A4XA 4EH2A 4JI9A 2C6IA 3E87A 2YCFA 3IW4A 5CALA 2EUFB 4EHEA 3O8UA 4R7IA 4RC3A 2R9SA 3LCDA 2C1AA 5F95A 4IVAA 3RCJA 4A7CA 4ZTNA 4FTTA 1A06A 2JBPA 5M4UA 1NA7A 3TCPA 4F6SA 3DNDA 3LFBA 4C35A 2ZM1A 3F2AA 4DFXE 3E7VA 4GKHA 2UZDA 3GC8A 1LPUA 4JQ8A 2OLCA 2UW8A 4WBBB 3BHUA 2QQ7A 1Q3WA 3ORZA 4O7VA 1MP8A 3EN4A 3ORMA 3QX4A 2RG5A 3EOCA 4J8NA 4DGGA 3UIMA 3BHTA 3ZFYA 3QKKA 1ZYDA 5AP5A 3Q2JA 2I6LA 3OROA 4NKSA 5AP3A 5I9UA 4BWPA 3Q9YA 3LMGA 3GEQA 2JIUA 5J9YA 3KULB 5C8NA 3OXZA 5HEZA 3EN5A 3AMYA 4G9CA 3PWDA 4PP7A 4XG6A 3VC4A 3AG9A 1H08A 1PF8A 1YI3A 4F65A 2Z7SA 2PWLA 2XK9A 4EH6A 2J0IA 5M51A 5D11A 4YR8A 1WBWA 1F5QA 3VO3A 4E4XA 2Z2WA 4YC6A 3R9RA 5D41A 3G0FA 2EVAA 3KCFA 4F7SA 1H1SA 3NSZA 5L8KA 3POZA 4AZWA 3MDYA 4BZOA 5C8KA 1U54B 2W1EA 4FKLA 5CU0A 4O81A 3JYAA 3TJDA 4HVDA 4FEVA 4AN9A 2YWVA 4GT5A 3H4JA 1RW8A 3NVKI 2GNGA 4O96A 5LVNA 2CNUA 3R2YA 1R78A 3GU4A 5EW9A 4BB4A 4O0UA 2YACA 5AIKA 5EM8A 3SHEA 4OTIA 4EZ7A 2UW0A 2VX1A 2W4JA 1KV1A 4PWNA 4WG3A 4X2FA 4XS2A 4FSMA 4EJNA 5AM7A 4GUBA 5EHLA 4BCIA 1PXJA 4EJ7A 3FMMA 1Y8GA 3D5WA 4PQNA 4QPMA 5D7AA 3AC5A 4BDBA 4IJ9A 3D7TB 4AN2A 3BYVA 4FC0A 2WQEA 3A62A 3QA0A 4FV6A 4UWYA 4BI2A 4UX9A 3ZSHA 3LXNA 4IW0A 4EEVA 4ZTMA 4MQ2A 2UVXA 2V55A 3FLQA 4FKJA 3HKOA 4EYMA 3ANQA 5CSPA 5I0BA 2ZB0A 2XK7A 1YHWA 3F3ZA 4BCFA 4GFMA 5KZ0A 4RIWA 4PMTA 3HAVA 2UW7A 4EL9A 4FUXA 4FSTA 2W0JA 3EB0A 1GZNA 5D9HA 4EKKA 3K3IA 3MWUA 5HO6A 3FKLA 5JH6A 5CZIA 5DEWA 4QTDA 3GP0A 2BRMA 2BZHB 2OJJA 3HV4A 5E1EA 5HESA 1Q97A 4UMUA 4BYJA 2VTNA 4QP6A 4I24A 4E5WA 5ANEA 4RFYA 4QYHA 4FKTA 4F0GA 4I94A 4PUZA 2W9ZB 4BTKA 4CV8A 1UU7A 3OHTA 1WFCA 2GQGA 3DS6A 4FKGA 1U5RA 2WMAA 2CNQA 5EOLA 2GFCA 4ALVA 4HCVA 4EK8A 1YHVA 3QC9A 2VD5A 3IDBA 5LCKA 4AGWA 2FGIA 3LIJA 4IX4A 3MPAA 2GQSA 1FGKA 3PRFA 3MIYA 3D15A 4YLKA 3JY9A 3HYHA 3T8OA 4AW2A 1VYWA 3BHHA 1ZYLA 2GDOA 3CIKA 4USEA 3GT8A 1NW1A 1M2PA 4QMOA 4FF8A 3TNPC 1GAGA 2XIRA 4RPVA 2GPHA 3AOXA 3WIGA 5LVMA 1W82A 4MK0A 2OWBA 5A54A 5AA9A 2J6MA 2PHKA 3PG1A 4YSMA 3KU2A 1PY5A 4GYGA 4TYEA 3DBQA 4WUNA 5GHVA 1YWNA 4CEGA 4BDKA 3L9MA 3QU0A 4I20A 4F63A 1EH4A 4OTWA 5KE0A 4XG8A 3BE9A 4YGAA 1YW2A 3ZO2A 3IKAA 2WOUA 4IWPA 4NYEA 2GTNA 5FDXA 1JWHA 3DBEA 1JNKA 3RZFA 3BE2A 3FQHA 3LCTA 1QPJA 4TYHB 4IAZA 1WAKA 5CS6A 3FKOA 3COIA 5HCYA 4HVHA 2Z60A 2QR7A 3ZHPC 5JGBA 3D0EA 2C6OA 3QRKA 4IB3A 5TE0A 4KNBA 5J5TA 3E64A 4KS8A 4R8QA 2C5OA 3CR0A 3NEWA 4EOLA 3P7BA 2YWPA 3EYGA 1KV2A 3RM6A 2HOGA 1FVVA 2PZYA 2PVRA 4E3CA 3CGOA 3Q96A 4O0TA 3HAMA 4X2KA 2ITNA 3EIDA 4Y5QA 2OFUA 3VJNA 3E8EA 5M4FA 1TQPA 4GG7A 4KIKA 2PMNX 4N6ZA 4TXCA 2FUMA 2IW6A 2OIDA 5AX9A 5AR8A 3TACA 2B4SB 3NW5A 4WOVA 3ZXTA 4FSWA 1SNXA 2VTLA 4EOIA 4IH8A 4FOBA 4K11A 3BGZA 3QHWA 1W8CA 3C5UA 4L3PA 3OOGA 2I40A 3UNKA 2OW3A 1K9AA 1J7LA 2RFDA 3OTVA 4NK9A 3BU6A 3KXGA 3OFMA 5B0XA 5A4LA 1PXOA 5AV4A 3C4EA 5CEPA 5E4HA 4YHFA 4FICA 4DEEA 2V7OA 1UNLA 2I0YA 4CVAA 2FVDA 1SZMA 5LMKC 3LQ8A 2R3MA 4I21A 5HX8A 2E9NA 4GFGA 4ZS0A 3BYOA 4W9XA 2RL5A
chains in the Genus database with same CATH superfamily
2O0UA 3BZ3A 3RK7A 3GU8A 1NT2A 3IOKA 3OCTA 4BICA 1H1QA 2VWIA 4FTLA 4A9TA 4NCTA 4YPSA 2BIYA 5E8TA 3V51A 2BILB 2XEYA 4FSYA 3MFUA 4E73A 4QMMA 3HMPA 3LFSA 4YJUA 3R73A 1XBBA 2DS1A 5DNRA 1XR1A 4FL2A 4AN3A 5HU3A 2YZAA 2X8IA 3AGMA 3R7EA 3F2RA 1M52A 4Z7HA 3FAAA 4DG2E 4ARKA 4EK5A 4YBJA 5BYZA 4IIRA 3FYKX 2VX0A 2UZBA 4A9SA 1PKDA 3Q4UA 4BCJA 4MBLA 4L6QA 4CKJA 4DEIA 4F6UA 3S0OA 4FL1A 3EQGA 2R3RA 3A60A 4MHAA 2YN8A 3BU3A 4EOPA 3JUHA 3PJ8A 5CI7A 3FZPA 3VBWA 3MBLA 2HZIA 2YIWA 5CQUA 5IEXA 3UQFA 5KZIA 3BL7A 2JKKA 2C3JA 4G34A 3GI3A 4TKSA 4C7TA 3HDMA 4IMYA 5AV0A 4ZP5A 4DAWA 4IZAA 5A6NA 3NAYA 4JAJA 4L43A 1IEPA 4LRKA 4EOSA 3WZJA 4DC2A 3DDPA 5J9ZA 3EKKA 4GEOA 4EH8A 1VYZA 5A4CA 5AUTA 4K0YA 3VBXA 3DK7A 4D9TA 2X8DA 4PRJA 2P33A 5EYKA 2F49A 3OCGA 3FMNA 2PMLX 1YDTE 4CV9A 4XUFA 2GQRA 2GHGA 2XCHA 4KUJA 5FUTA 3SQQA 3AT2A 2CKPA 3C5IA 3NUNA 4JAIA 2F7EE 2RFEA 3ML1A 1ERKA 3G6GA 3QLFA 4APPA 4YNOA 2O8YA 3ZLYA 1YDSE 3KRJA 4ZZMA 4K6ZA 4RMZA 2GSFA 3CKXA 3PA5A 4BHZA 3C9WA 3BWFA 4D28A 3CPBA 2VTQA 3KA0A 4XG7A 4G5JA 4DF3A 3TEIA 3VF9A 5HQ0A 2J7TA 5EM6A 2R5TA 3FZOA 1IA9A 3PA3A 4X3FC 4I1ZA 3R71A 4J1RA 2IVUA 1FVTA 2X81A 2YM7A 4MWHA 2X0OA 3GCVA 4FE2A 2BALA 2IN6A 5DT0A 3F5XA 4FTCA 3CCNA 3FMDA 5KUPA 2J0LA 4JL9A 4U40A 2AUHA 4IEBA 4L3LA 5DOSA 2R3OA 5AP7A 4AZTA 3TKUA 2H34A 4TNDA 3LQ3A 2YITA 4A9RA 2BCJA 4CG9A 3ZYAA 5GIOE 3JVRA 2ITPA 4AUAA 3A7HA 4BTMA 4QMXA 4AFJA 3QYWA 5E8ZA 5DR6A 4G3EA 4UYNA 4J53A 2XCKA 4FIGA 5BV3A 2UZTA 4UZHA 4F09A 2ONLC 4ACDA 3NW6A 1QPDA 4KINA 4OUCA 4DBNA 2CJMA 2VO7A 2X1NA 5EYMA 2XK4A 3CQEA 3F7WA 2HXLA 4O91A 4Y8DA 2FA2A 4FMQA 3THBA 3BLQA 2R2PA 2ERZE 2XBAA 2Y8OA 1UU9A 2EU9A 2XEZA 4QD6A 3IQ7A 4LMNA 4F6WA 4HW7A 4EOKA 1L8TA 4DA5A 3NUUA 1UWJA 3SV0A 5LQFA 1JKSA 3PDTA 3LFAA 1Y91A 3QGYA 1JSUA 1PXKA 4RLKA 3CSVA 4XBRA 2BPMA 3O7LB 5CVGA 3ZRLA 4PPBA 2XALA 5TR6A 2O3PA 4LFIA 2B55A 1UU8A 2KULA 3R9HA 5J1VA 3FY0A 2GS7A 4DITA 3QD4A 3R1NA 4PF4A 1G3NA 2JIVA 4YURA 2XKDA 2XJ2A 4FT9A 1SVHA 1Q8TA 4QYEA 4W4WA 4DGNA 4H36A 3L8VA 3QQUA 5IEVA 2XZSA 2C6KA 3FZ1A 3WZEA 3L8XA 1KOBA 3C4ZA 3V5TA 3I5ZA 2R3KA 4DINA 5E9EA 1W83A 1CKPA 1T45A 3R28A 4TN6A 3SC1A 4EH4A 1MRVA 2IZRA 3OWKA 3R8MA 4EHZA 4JDJA 1OKVA 4BDAA 3DJ5A 4DTKA 3F82A 4EH9A 2V62A 2Y4IB 4NFNA 5IEYA 3LW0A 1A48A 2JKOA 3A7FA 4NIFB 5EDQA 2W1IA 4ZTHA 5I3OA 3UQGA 1P14A 4PTCA 2OXYA 2YEXA 4JVGA 4NSTA 5DVRA 1I44A 4KBAA 4ZJVA 3PE2A 2QLQA 4P2KA 5AEPA 4ZZNA 3BKBA 3QX2A 1KUTA 1KE8A 2ZMDA 4MNEB 1PXIA 1Z5MA 3V04A 3R83A 4D2WA 2UZWE 4X0MA 4AOTA 3GNIB 3DBDA 3CJGA 3UJGA 3ODYX 4FRFA 2R3HA 4XLVA 4BI1A 1U46A 1XH9A 5AM6A 5JGDA 3ORXA 1IASA 2Z8CA 3VW6A 4P90A 2VZ6A 4O7RA 4N70A 5GIPE 3WARA 5M56A 1QMZA 3ZO4A 3KC3A 5A3XA 2F2UA 5TKDA 5FTGA 4EBVA 3NW7A 1YOJA 2JAVA 3L1SA 3JVSA 2C5VA 1SVEA 3AKJA 3OY3A 3PY1A 4I3ZA 4IVBA 1MRYA 2CCIA 4RIYB 3DCVA 2X4FA 3TT0A 3W32A 4AW5A 5K5XA 4DT9A 4BY9E 3OUNB 2WTKB 1GNGA 3G9LX 4YJNA 1G8AA 3I81A 3OWJA 3QD0A 4IANA 4FEWA 2PZIA 2ZYBA 2VTAA 4NU1A 3TKIA 3W18A 4EBWA 4EQMA 2EB3A 4AZFA 2X0GA 4XV2A 4AGUA 3TNHA 3TI1A 2VWZA 3PWYA 5CF5A 3UOLA 2JFLA 5A4TA 1WBNA 2FO0A 4ZIMA 2FSMX 2UW5A 4FSZA 1QCFA 3BU5A 4JDHA 4RFZA 5LVLA 4DLIA 5GNKA 1PXMA 4C33A 4ZSJA 2JDSA 2JKQA 3PXFA 2R3LA 3NNXA 4ZSEA 3KREA 1NVQA 1OPLA 4MF1A 3R8ZA 3V8SA 3MVJA 4ASEA 3AKKA 4KIPA 4CG8A 1JBPE 4H1JA 4G3FA 5CNNA 3QQGA 1OIYA 4I5MA 4NM3A 3AGLA 4FSRA 4CLJA 5DWRA 4CMTA 5GJFA 3UNJA 2C6EA 3NZ0A 5CAUA 4FV7A 2XKCA 5AR4A 1REKA 2QOHA 4XG9A 5K4IA 4FV3A 2VUWA 2J51A 4BC6A 3MTLA 3LFDA 2CHLA 1JOWB 3EN9A 3FXXA 5EK7A 2OJ9A 2XNBA 4AA0A 1OL7A 4RJ6A 4UEUA 3VQUA 3R0TA 1OPKA 3RAHA 3PJCA 3TL8A 3UVPA 1GIJA 2XM8A 3PSDA 2B7AA 2C6TA 3EYHA 4CKRA 5HE0A 3L8SA 3MA6A 4RVKA 2OKRA 4EUUA 5HI2A 3E63A 5CAOA 4YPDA 1XWSA 1CMKE 2ZDTA 2VO6A 1OL2A 4U9AA 4BCHA 4V04A 3ZH8A 3AC1A 4EHGA 2GHLA 2A27A 3I6UA 5BVNA 4UZDA 4TL0A 2B1PA 3L8PA 2X4ZA 1E9HA 1OL1A 2IF8A 2XIXA 3LOKA 5CSHA 2WXVA 3ORIA 3QQJA 5ANDA 4IX5A 3RHXA 4EQCA 3OT8A 1ZZLA 5LOHA 4C34A 4PL5A 3D83A 1B39A 2HY81 2XBJA 5A9UA 3QL8A 4GK2A 4BBEA 3F3VA 4IX3A 5J1WA 4J95A 2E9OA 4EWQA 5M4IA 4QMQA 4OTPA 3IW6A 2WTKC 3LVPA 4RQVA 2EXEA 4TNBA 3RAIA 3VHKA 2JBOA 3PTGA 4I5HA 5M55A 3I60A 3U8WA 4FGRA 2QOCA 1XO2B 4AF3A 5IH4A 1ST0A 3T9IA 4DFUA 2W4KA 5AP6A 4DFYA 2XIKA 1MRUA 4IZ5A 5AR5A 3OXTA 3UZTA 4EWHA 4CTCA 4FTIA 2UZEA 2V5QA 4RIWB 2BFYA 1Q8WA 3SRVB 4C2VA 3O71A 3Q4CA 2YFXA 3HX4A 4HOKA 3R63A 4O4BB 4E20A 4K18A 5BVKA 4EI4A 3DXQA 3PXYA 5M08A 4F70A 3U55A 1V0BA 1PKGA 2A0CX 2Y6OA 2GNFA 2QC6A 2C3LA 4CNHA 4O7NA 3PPJA 3DY7A 4FKUA 5FTOA 3D5VA 3UO5A 3DFAA 3RPYA 1TZDA 3V6RA 4K1BA 5J9LA 3PVGA 4JG8A 4GU6A 4O7SA 2B0QA 4OTDA 4P4CA 2XS0A 3HECA 2OF2A 3Q3BA 3VQHA 3W55A 2HK5A 4C37A 2JGZA 3F5PA 4Q9ZA 2WU7A 4AA5A 3DAJA 3KXXA 2WIPA 4NH1A 1XBAA 2IJMA 3LKMA 4FKWA 2IZTA 2PVJA 3C51A 3EQCA 4YJQA 5FBNC 3PY3A 4RWKA 5JK3A 2QONA 3UDTA 3ODZX 4RIXA 4KS7A 2WMBA 4I0SA 5K5NA 3LE6A 3F2NA 5LMAA 4D0WA 3C7QA 1PMUA 5BUEA 5DI1A 5DH3A 3LCKA 3FI8A 4GW8A 4IB1A 3MVMA 2IVSA 4FX3A 1URWA 4L9IA 4PX6A 3PZEA 4LRJA 4Y85A 3RK9A 4CFXA 3SW4A 3W0PA 1UNHA 5HTIA 2B9FA 3W0SA 5E8VA 3W16A 2ZM3A 5BX0A 3U6HA 3I7BA 2X7OA 3RJCA 4I4EA 1OGYA 5IQDA 5LXMA 2XMYA 1URCA 2YJSA 5HBJA 5E1SA 2X9FA 3OTUA 4IACA 3TNQB 3UIBA 2QOKA 4ITIA 3GC9A 4IM3A 4JT3A 4JJRA 5IA5A 3BI6A 4JR7A 5IUIA 5IH6A 1OGUA 2C6LA 3N9XA 1KWPA 3QRIA 5HG7A 3P0MA 2J0JA 3B2WA 4MQ1A 3RPOA 3ZSGA 4GKIA 5F9EA 1UV5A 2P0CA 4JBOA 3B8RA 5EDPA 5IQGA 4UWCA 3FMJA 5HO7A 5L3AA 5G1XA 2VTHA 4DHJA 1UU3A 2B9IA 5DG5A 1JLUE 3UC4A 3DNEA 5M06A 2OJFE 3GB2A 4O4EA 5TO8A 4KBKA 2W06A 4RZWA 1KE9A 3M1SA 3QQHA 3ELJA 2HXQA 2ZJWA 5EKOA 4ASDA 4O83A 3I5NA 3KXMA 4O82A 3F7ZA 4KRCA 3KF7A 2CDZA 4H39A 1M2QA 4DYMA 2B9HA 4EC8A 5CNOA 2AQXA 4EOQA 2PUPA 3C13A 4O0XA 4EQUA 1R1WA 3S4QA 3VUMA 4KIKB 2GNLA 3SOCA 2O2UA 4RG0A 2UW3A 3TM0A 5AV3A 4PL4A 4D5HA 3LFCA 5C4LA 4FVPA 2V22A 4MNFA 2QURA 4QP9A 5HX6A 3CQUA 3NYOA 4BF2A 4PP9A 4MD9E 3VVHA 1R39A 4WSYA 4BCOA 3WF5A 3QZFA 3SA0A 4BCKA 1XQZA 4XV9A 5A14A 1YWVA 2PTKA 2QO9A 3BCEA 4GSBA 3QZIA 2PUIA 1GZOA 2P3GX 5CXHA 5L8JA 3V5JA 4H1MA 3QTQA 5AP0A 2XIYA 1UKHA 3DXNA 5IQHA 4X6QC 4DGOA 5L2IA 2J5EA 2LAVA 1S9JA 1JKLA 2PL0A 3ENHA 3NLBA 3RI1A 4RWLA 2C1BA 1ZYJA 4AP7A 4WO5A 3OCBA 1M17A 4IHPA 3O17A 4FV4A 2UW6A 2V7AA 4FTJA 2QOLA 4LGDA 1OI9A 4O38A 3AMAA 4P7EA 3RPSA 4B4LA 2X8EA 5KKRB 3W0NA 2GTMA 5FXSA 5HVJA 3FMHA 2BROA 4ALUA 3A4PA 2BAKA 1Q3DA 4YJTA 2QODA 2UW4A 4IADA 3SKCA 1BI7A 4YLJA 4RRVA 3ORKA 4FIHA 4WRSA 4C4FA 2CLXA 4O27B 3WF7A 2W1FA 5A6OA 3R9DA 4ID7A 4NKAA 2C5YA 2KTYA 4O0RA 1ZWSA 5CAQA 4QP2A 5AUWA 5L6OA 5F94A 4IDVA 2WIHA 4E4MA 4Z9LA 4FA2A 4MXYA 3BIZA 2X0PA 4JDKA 3QCXA 1CKIA 5FM3A 4BI0A 2YIRA 1MUOA 2Z7RA 3O51A 3OEFX 3TDVA 4AAAA 1LEZA 4KSPA 3ZEPA 4ANLA 5EOBA 4Y83A 3QBNA 3AQVA 2YDJA 3EQPA 3PIYA 3GC0A 4RJ7A 3HV6A 5TT7A 2XANA 3SXSA 2Y7JA 4KKEA 3ID6C 3M11A 5FRIA 5L4QA 3MVLA 4L7SA 4B9DA 2HCKA 4RFMA 4EZ5A 3PVBA 5H8BA 4C02A 2OXDA 1OUYA 4P5QA 2WNTA 4ZTLA 3W0RA 4V0GB 3ERKA 4PMPA 3B2TA 3SAYA 3TDWA 4AXEA 3D7ZA 2GU8A 3FMLA 2WGJA 2HIWA 3R04A 3EFLA 5ETAA 2XK8A 3PY0A 4XG4A 3DU8A 5BVOA 3V5QA 4LL5A 2YA9A 1G5SA 3WZDA 5H3QA 1JSTA 4DH5A 5FG8A 3ZU7A 4F99A 1YVJA 2A19B 5IA2A 4RA5A 2ETRA 4ACGA 3QC4A 2JDRA 4DEGA 3GCSA 3MGYA 5DLSA 3H9RA 4LOQA 1FINA 4GU9A 4YP8A 1JQHA 2BRNA 3EFWA 3MJ2A 5K0KA 5L2QA 3RKBA 5J7HA 3BYMA 5AADA 4XG3A 4CFUA 2JD5A 3H30A 5CYIA 2W99B 3WOWA 1TKIA 4GK4A 3RNYA 3RZBA 4NCTC 2UW9A 1M2RA 3GQLA 3II5A 4UWBA 5HNBA 3P7AA 4M8TA 5KKRC 4MWIA 3U6IA 4O6EA 3CQWA 2C3KA 1TVOA 2WTCA 3E8NA 4O0WA 4KIOA 4HCTA 3NUSA 2PVKA 5KMMA 4ZXTA 5BVDA 4ZMFA 2QOFA 3VAPA 3Q5ZA 3HDNA 2QVSE 4U6RA 4XLIA 3BHYA 4DEHA 4NJDA 1H8FA 3G2FA 4K2RA 4FJVA 3TUBA 2R7IA 1K2PA 2VGPA 4YJRA 4Q2AA 3G15A 3DKCA 4QPSA 3FHIA 4MH7A 1I09A 4FSUA 2BFXA 2XAOA 2ETKA 3CGFA 4AWIA 4FT7A 2NRYA 4ANNA 3EZRA 4LDTA 2GNJA 3ZCLA 5HTCA 5EHYA 4HGEA 1YXXA 2C68A 2ITTA 2G01A 2WQMA 3KK9A 2YABA 4D2SA 3S95A 4C59A 4V05A 5FBOA 2WTWA 4D1XA 4K9YA 4C4IA 2ITXA 5D1JA 4D1SA 5ETFA 4FTQA 5AR2A 3HRCA 2YHVA 3GFEA 4S30A 1FQ1B 2W05A 3SGCA 2WEVA 2E9PA 4XOYA 3SG9A 2GFSA 3PP0A 3KK8A 3Q2MA 3CTHA 4FSNA 4O84A 5IQAA 3Q5IA 3QALE 3QTSA 4QP1A 1TFFA 2C4GA 4C0TA 3TN8A 2WPAA 5LVPA 1W2DA 2JKMA 4NM5A 5KMOA 5CENA 1W0XC 2A2AA 3RVGA 5KBRA 3BYSA 4FNZA 2AC3A 4S31A 5ANIA 1TQMA 2X9EA 4YTFA 2ZV7A 2JDTA 4ZLYA 3ZZEA 3F61A 2QCSA 4I5CA 5CSVA 1FGIA 3TNWA 2UVZA 3DK3A 5CY3A 3MN3A 1YI6A 2BTRA 2ZFYA 2VTMA 4M69A 4QQJA 4ZEGA 5HICA 4IJPA 4AFEA 3VRZA 1KE5A 3HUCA 3QTUA 4AT5A 3W10A 5JGAA 4WA9A 4OTHA 4D4SA 4ZY6A 1IA8A 1W7HA 3FWQA 4B0GA 3IS5A 4AZSA 2ERKA 3V8TA 4ALWA 2QLUA 3KMUA 2W9FB 3NNWA 5HCXA 3UZRA 1QL6A 1ZRZA 2BZKB 3MY5A 5AR7A 4BGHA 3LMIA 2WOTA 2QO2A 5HLNA 3NYXA 4DHIB 3E3PA 4QTBA 4OAUC 1Q99A 4GVAA 2XNGA 4YJPA 4ASXA 4U42A 3UZPA 3PPKA 5E92A 5CU6A 1OL5A 4BCNA 4GYIA 5A46A 1OL6A 4QP8A 4ZSAA 1XH5A 4USFA 4QMWA 3U9NA 3NFGB 2Z02A 1YRPA 4FTMA 3F3UA 3P79A 3PXKA 1E1XA 3Q4ZA 4GH2A 4F9BA 4IFGA 3KRLA 3QWKA 4X3JA 4MXOA 3ZRKA 2YIYA 4AGDA 5DR2A 3FKNA 5HNIX 3IDCA 5L2TA 4E26A 4TWNA 2XF0A 3DAEA 2OZAB 1W98A 3A7JA 3P86A 4HYIA 2QOIA 3KN5A 3O8PA 4IAFA 5C01A 4ZJJA 4X3FB 3TKHA 1S9IA 4FNXA 1MQ4A 2BDJA 2Z7QA 3F88A 4EH5A 5L2WA 1HCLA 3D2IA 3FPMA 3EWHA 1LUFA 1V1KA 1G8KA 3KY2A 2ITYA 3VS4A 4C38A 3UE4A 5ETIA 4FKPA 4OBOA 5ETCA 3A4OX 4WSQA 3FQEA 4JLCA 3VUDA 2YLEA 4FOCA 3P5JC 2WMWA 3HA6A 1M7QA 3OY1A 4BIDA 3CD8A 5HZNA 3FI2A 3SX9A 3W0MA 2G9XA 4OR5A 4KRDA 2BAQA 3PJ2A 5GJDA 5FD2A 3RWPA 3Q60A 3LQ5A 4J98A 5HIBA 5KMNA 1JPAA 2VAGA 4PMSA 3IECA 2JEDA 4CZYB 5FP5A 3CBLA 1H26A 4NFMA 4FYNA 4RVTA 2XK6A 3BPRA 4FZAB 5IUHA 3DKOA 3PJ1A 4KA3A 4KB8A 2IPXA 2AYPA 2OG8A 4RLLA 4JIKA 3VS1A 3ACJA 3RHKA 3O50A 2E2BA 2R64A 4I22A 2J50A 1R0PA 2GS2A 2VNWA 1FOTA 3EQIA 2W1GA 4M15A 4O4FA 4BDJA 4BTJA 3DQXA 4D4YA 3KULA 3BL9A 2XRUA 4TRLA 2RSVA 2G15A 2P2HA 3EMGA 3NGAA 4NEUA 4YZ9A 4C57A 2XNNA 1OITA 3VHEA 1IRKA 2H96A 5KNJA 5DT4A 1AD5A 1KE7A 2CGUA 1WBVA 3ZM9A 5GINE 5EFQA 4QRCA 4R3CA 3H0ZA 3ATSA 2Z7LA 2PVNA 3FLNC 3NPCA 5FP6A 4DG3E 1VR2A 2VWBA 4WRGA 2WTDA 4GCJA 2X2LA 4PDSA 4J97A 4TTHB 4XV3A 4C36A 2P55A 4AOJA 3NCZA 5H8GA 2VWYA 3FC1X 4KSQA 4YJOA 4BDDA 5IQEA 1NVRA 1T46A 4O2ZA 1JAMA 4RBLA 4J8MA 5DPVA 1U54A 2VX3A 4RGJA 2FSOX 4O4DA 3G0EA 5CEIA 4XG2A 4XYFA 2RIOA 3P9JA 4FZFB 2CCHA 4NTTA 4LUDA 3DDQA 4TY1A 3V5LA 2UUEA 3ZS5A 4D9UA 3ATTA 4JG7A 4O7WA 3UGCA 4FTKA 3IK3A 3R9OA 1Q61A 4C3PA 3PIXA 4HPUE 5ANKA 3ZUUA 4IAIA 4QP4A 4ZAUA 3RPVA 5DRBA 3I0QA 4C62A 4BTFA 4EOMA 4R77A 2XYNA 4DBXA 2YM8A 5I9XA 1GZ8A 5C27A 5LWMA 3HZTA 4FVQA 3EKNA 4IDTA 2GMXA 3SD0A 3QTIA 1ZOGA 3NWWA 3NFFB 3Q9WA 3G9NA 5IQCA 4I6LA 2VTIA 4W8DA 3LAUA 3SXRA 2J9MA 4ZSLA 4F1MA 3IW7A 3B8QA 2QU6A 4L3JA 4FTRA 2H8HA 3RBWA 4L67A 2BRHA 2PZPA 4FEUA 1G8SA 3IGOA 4AQCA 3NMUF 4H3PA 3QZGA 4OTRA 5EQYA 2XB7A 1JKTA 2VTOA 4ZTSA 4F7NA 1J7UA 1G8JA 1PJKA 2JDOA 5CVHA 4L7FA 4U3ZA 4M84A 4DFLA 3DKGA 2X7GA 2R0IA 4PDOA 2VRXA 3MH1A 3NUAA 2PK9A 3LFNA 2HENA 2QD9A 1H0WA 3COHA 1OECA 3F3TA 3ALNA 4CCUA 4G17A 4PPCA 4CFWA 3CPCA 2DQ7X 3FL4A 3KRXA 3R7YA 4RIOA 3QAME 2WEIA 4C2WA 5M09A 3KFAA 5BUIA 2UVYA 5JRSA 4PMMA 2NO3A 2F9GA 1PMEA 2HW6A 4RX5A 3DB6A 4I6HA 3ZRMA 3HL7A 3K2LA 3QKMA 3CY3A 1ZAOA 3COKA 3V6SA 4N6YA 3FBVA 2W5AA 5C26A 4FIJA 4IZYA 4XV1A 3O96A 5EW3A 4C4HA 3FDNA 1PXLA 3QTWA 5JZNA 3DZQA 4KABA 3DZOA 4AX8A 5DRDA 2PMIA 3TYKA 3UO4A 3FJQE 4ZY5A 4XJ0A 1XHAA 2QOQA 4LOPA 5FM2A 3A8XA 3A2CA 2HWPA 3CJFA 4Y72A 1H1PA 1Z57A 5IA3A 1NXKA 4JQEA 3LFQA 3CY2A 4MD7E 4BCMA 4U80A 2CKQA 2R3FA 2F2CB 2F7ZE 3FV8A 4YHTA 3R1YA 2C47A 4FNWA 4WIHA 5CU2A 5E8WA 3U87A 3ULIA 3UODA 3VIDA 1B38A 3BLHA 4QYYA 2BHHA 4PY1A 4OTGA 4BZDA 2ZAZA 5CU4A 4FEQA 4MBJA 5BUJA 4YC8A 4NW5A 2IW8A 4TYHA 5M57A 3ZC6A 1RJBA 2W1HA 4U5JA 5B2LA 1ZMUA 3Q9ZA 4FKQA 5JZJA 4DT8A 5J5SA 4F1TA 4DH3A 3ZO3A 5KHXA 4G16A 4MXCA 4O0SA 5FGKA 2XM9A 2QHNA 4U7ZA 5D10A 5DN3A 3QCQA 3F5GA 4MVFA 1UKIA 3F69A 5KO1A 2XNMA 4LM5A 4D1ZA 4AU8A 2YM3A 5CAVA 5DFPA 2ZDUA 4UALA 1CKJA 5I9YA 5HIEA 2QKRA 4ACCA 4QT1A 5DT3A 3LM0A 5LJJA 3NNUA 3LXPA 3R8VA 2PULA 5IISA 2VWXA 3AXWA 1Y6AA 4G6LA 4ITJA 3VBVA 3WZKA 1IAJA 2O63A 1RDQE 3CLYA 4PTGA 4CYJA 3N4TA 4F08A 1H1WA 2PVYA 5J95A 5J79A 3UOKA 4OT6A 5C1QB 4F7JA 2FH9A 3OUKA 4TT7A 3TMOA 4W9WA 4UMTA 4KKHA 4KBCA 2XRWA 5IUGA 2EXCX 3D14A 3NDMA 3EJ1A 4CKIA 3FXWA 1OIRA 5FTQA 3BYUA 5BNJA 3OBGA 3SLSA 4B8MA 4ANBA 4XMOA 4AXCA 3PSCA 4CZTA 2PE1A 5JQ8A 2VGOA 1XMLA 3DK6A 3CTQA 5CWZA 2YCSA 5FLFA 4M66A 4QTCA 4RZVA 2VN9A 4HYHA 4DEBA 2OF4A 3WYXA 1B6CB 5IMEA 1ATPE 1IR3A 2YDIA 3W8QA 2PY3A 3FY2A 4EK4A 5GJGA 4P5ZA 4FT5A 4M68A 3LLAA 2OGVA 1UA2A 3PUPA 3QA8A 4LG4A 3FYJX 5CF4A 1PXPA 2RFNA 2UZLA 2Y0AA 3GOKA 4HZSA 5EG3A 5FXQA 2IWIA 3UQCA 2IVTA 2P2IA 2YM4A 2YAKA 4RT7A 2WMQA 3IW8A 4AOIA 1ZYSA 4N57A 4FVRA 2NNWB 3ITZA 4LOOA 3AC8A 2DYLA 4R3RA 5KMJA 4PL3A 3VS7A 3BQRA 2C6DA 3VUKA 5AAGA 5L6PA 3VS0A 1BUHA 4XP0A 4EC9A 4KD1A 3QQFA 5ANJA 1OKYA 5C03A 3VNTA 3PIZA 1DAWA 4RQKA 3BX5A 5CANA 3LXLA 4FIFA 5B2KA 4UMPA 3FZRA 2XJ0A 4YZMA 1PYEA 3TTIA 5I9WA 3O8TA 3MIAA 3DKFA 4BIBA 1O6LA 4C4GA 1UWHA 2WKMA 4QOXA 1ND4A 5M4CA 3GCPA 2XK3A 2BAJA 5IPJA 4M0YA 3LJ2A 3NAXA 3ZFXA 3RNIA 4WNMA 4AS0A 4D58A 1OB3A 1U59A 4BGGA 1VZOA 4YUQA 1ZOEA 3ORNA 4XRLA 4L00A 4FV1A 4GL9A 4RJ4A 2JAMA 3OS3A 4M12A 3DB8A 3Q9XA 4I41A 3FLWA 4OBQA 4ZTRA 4BCGA 3KXNA 2ZM4A 3LXKA 4NTSA 4S33A 5JQ5A 4L44A 4O0VA 5K4JA 4D4RA 4DTAA 1CM8A 1H28A 4IC8A 4J71A 1KSWA 4G1WA 4DH1A 3F66A 3VBTA 1YHSA 4OT5A 3BELA 3K3JA 4II5A 5CQWA 4YZNA 4TPTA 3E92A 3OD6X 1WBSA 5KX8A 4TW9A 3E62A 3PJ3A 2YJRA 3H9FA 4FKSA 4QMNA 4RX9A 4MTAA 1OIQA 4V01A 4IBMA 3R02A 4IAKA 4YLLA 3MH0A 5AAEA 3ALOA 1WBPA 4NZWB 2CKEA 4AXDA 4TWCA 2CNVA 4LUEA 5GZAA 2IVVA 2OH0E 4CMOA 2CMWA 3EN6A 5FXRA 3OXIA 2NPQA 1YXTA 2WTIA 3HMMA 3WYYA 5HG5A 1Q4LA 3RGFA 1PHKA 4TYIA 3IPHA 1XH8A 4IWQA 5D12A 5CEQA 3QXOA 3ACKA 4Y95A 5DBXA 3EFJA 1XH6A 5J7BA 2WHBA 1RQQA 2WB8A 4GFOA 2AEGA 3PYYA 2BZIB 4KAOA 5HE1A 4K33A 5EYCA 1R3CA 3DA6A 4HPTE 5G6VA 4QP3A 4EONA 3NCGA 5EYDA 4MXAA 2CSNA