3VQHA

Bromine sad partially resolves multiple binding modes for pka inhibitor h-89
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
347
structure length
344
Chain Sequence
AAAKKGEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Anomalous dispersion analysis of inhibitor flexibility: a case study of the kinase inhibitor H-89
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 113
structure length 344
sequence length 347
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vqhA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vqhA02
2YM4A 2VO3A 5KZIA 1J3HA 4DT9A 3ZRMA 4M12A 3BELA 4QMVA 3FLQA 5AM6A 4RFYA 3DNEA 4U3ZA 3HAMA 2JDRA 4O7YA 4B0GA 4J8MA 1QPJA 3F2AA 2W1ZA 5AIRA 3NNWA 2YABA 3OTVA 4QYGA 3WF8A 3LMGA 1RW8A 2I0YA 3GT8A 3CPBA 2WTDA 2GS6A 3EZVA 4HNIA 1AQ1A 2E9PA 4X6QC 1JSUA 1P2AA 3QKMA 4QP4A 2HYYA 2Y4IB 3SKCA 4F0IA 3VIDA 1ZYSA 3SW4A 3F5UA 1M14A 3ZLXA 4UEUA 3CD3A 3ZFXA 3G6GA 3OUKA 2W5AA 4N6ZA 4J1RA 4X3FB 5IA5A 4TWNA 4I93A 4FKQA 4LI5A 4ZTLA 5EK7A 2ETRA 3IDBA 2JKOA 3C0HA 4IJPA 5JGBA 4D1SA 2OFUA 5I0BA 4M84A 2OF4A 3V5TA 5J5TA 3HL7A 3KULB 5JZJA 3C5IA 2B9HA 1ZARA 3AC3A 4M67A 4QP1A 4G6OA 2C6KA 4S30A 5EKNA 2HCKA 3DXNA 2WPAA 3AMAA 1BI7A 2ITZA 4PPCA 5F95A 4XG9A 1FMOE 5AX9A 1M2RA 2XJ0A 3I79A 2XM8A 4EL9A 4I0SA 4MNEA 4BF2A 2V22A 5DR2A 4QMOA 1H00A 1W98A 4JRVA 4C57A 1XBCA 3T3UA 3VS4A 3W32A 3UOHA 3G9NA 3BLRA 2CKEA 5L8KA 3DKGA 4FT9A 4F4PA 1EH4A 3BIZA 4L8MA 4ZS4A 4EI4A 4CRLA 3FYKX 1I44A 3MTFA 3TACA 3RJCA 4IVBA 4LOOA 5CNOA 3F66A 4FV2A 4K8AA 1WBVA 4C2WA 4TWPA 4CFVA 1OVEA 3CKWA 5HO6A 1Q99A 4O7LA 2E9OA 4YJNA 4ZJIA 1ZAOA 2P3GX 3OOMA 5AWMA 2EXEA 3R9HA 3S1HA 2WOTA 1YXTA 3BWJA 4IVDA 3NUSA 4GFOA 1PMUA 4IM0A 4M66A 1H1QA 5BUEA 4QMYA 1CKPA 3EQBA 2W4KA 4NWMA 1NVSA 5FXRA 2JD5A 2QO9A 4DT8A 5GZ9A 2YM6A 3V5WA 3CLYA 4IAKA 3BBWA 1K3AA 4Q9SA 4RFZA 3TUDA 3L1SA 4FIJA 1UKHA 3FZSA 3EH9A 4TT7A 2CNVA 1HOWA 4OW8A 3PVUA 5AFVA 5CVGA 2EVAA 3P1AA 2WELA 2J5EA 4FC0A 3H9OA 4D1XA 4XOYA 4RLKA 4F9WA 2RIOA 1H0VA 4QPMA 1FQ1B 3GXLA 1CSNA 2XIKA 2PTKA 4ITJA 4UV0A 4F7JA 1H28A 3HP2A 4IZAA 4CTBA 2A19B 4D4YA 2G01A 5IEVA 1H4LA 5AP2A 4UMUA 5CF4A 3UOJA 2XNMA 3O8UA 2SRCA 4IJ9A 4L52A 3RK9A 2B54A 4CD0A 5AA8A 5EM6A 5JFXA 2R4BA 2VWZA 4MH7A 3G5DA 3ZO1A 4BDAA 1FOTA 4J8NA 4ASZA 4I4FA 2RSVA 4G9CA 4IB1A 3SA0A 4KS7A 3E88A 3D7TA 4GYGA 3VS3A 4EOJA 4PQNA 5DPVA 5FP5A 3CP9A 2BZHB 3E3BX 1WBWA 4N0SA 3RPRA 3COHA 2EB2A 4CCUA 3ERKA 4E4XA 5FEEA 4O7RA 4IIRA 4QT1A 2DS1A 2CNQA 2F49A 5CU4A 3BE2A 4ZZOA 2CSNA 3VC4A 4BI0A 1GIIA 4MWHA 4QTEA 2O65A 4ALVA 3PY1A 2NNWB 3Q04A 4A4LA 3QZHA 3P0MA 2C47A 2VTSA 2ZB0A 1FPUA 4TRLA 3WF9A 3ZFYA 2CKOA 5M55A 3CGFA 3ULIA 3RPOA 3BHVA 3FZOA 3OF0A 2QHMA 5L2QA 4CYJA 4ANBA 3MESA 3BPRA 1ZXEA 3I0OA 2FB8A 4QP7A 4WOVA 3W1FA 2DQ7X 2BHHA 5ITAA 3OWPA 1BMKA 3QF9A 3EL7A 3HRFA 4GUEA 5JN2A 5CAQA 4E5WA 5L2SA 1W83A 4GS6A 4BBFA 3QTWA 3DY7A 1M17A 4O0YA 4QMNA 5HEZA 4YHFA 1URCA 3MY0A 2YJRA 2UZVA 4G6LA 4IZ7A 3R7OA 4XHKB 4E7WA 5EHLA 4XLVA 2PE2A 3RZFA 2GS7A 3VO3A 4X21A 3WZEA 2FA2A 4BTMA 4BWKA 4L00A 4GV1A 3UO6A 3VUKA 5L8JA 3BGQA 4RIYB 3FMJA 4CFUA 3QD2B 2X6EA 3ITZA 3GCSA 4J7BA 3QHWA 3TN8A 3FC2A 5EOLA 4DA5A 5M08A 1JKKA 1PHKA 1UNLA 1WMKA 2CGWA 3EN6A 4KNBA 3IGOA 4KS8A 4E6CA 3A99A 3FWQA 4TYHB 3DK6A 5KBRA 3TDVA 4TYIA 3UNZA 4BCGA 4NZWB 4C4GA 4MQ2A 3COMA 5ANIA 3RM7A 2WMUA 3OROA 4AX8A 3MSSA 4IB3A 2JAMA 3ALOA 1A06A 3T3VA 2IVTA 3TUBA 3ANRA 2YJSA 5LVNA 5I9XA 4V01A 3I60A 2IW8A 4F6SA 3U55A 4RIXA 3IOPA 4J53A 5CT7A 5AP0A 3P08A 3CCNA 1B39A 3GCUA 5CI6A 3UDBA 2Z02A 4JR3A 4FL3A 2ZMCA 2GCDA 3C4FA 3OEZA 3GEQA 5GJFA 1Y6BA 2CCHA 2WD1A 3TG1A 3GQLA 5AP4A 1PW2A 2P4IA 2YIXA 3PJ2A 2V55A 3QUPA 4CFXA 1OKYA 5B2LA 5AX3A 2YWPA 4S33A 4U41A 3TNHA 4CZTA 4QMMA 4C58A 1YI3A 4I6QA 5E92A 3PJ3A 4RC3A 4ENXA 2GDOA 2YACA 3CQEA 4F9BA 2WQMA 3JS2A 3DZOA 3RHXA 3F7ZA 5HNGA 1KUTA 3C4ZA 2QOIA 3R00A 4IAFA 3F3VA 3NUXA 5L6WL 2C6LA 3MI9A 4HYSA 4ENYA 5BYYA 2VU3A 3FMNA 5HO7A 1FGKA 3MPMA 4E5BA 4NKAA 5L2TA 2XJ1A 3Q2JA 4K9YA 4S34A 2PUUA 4EWQA 3HGKA 4BGHA 2O0UA 1XWSA 3H0ZA 5TT7A 2RFEA 3SD0A 4LV5A 4ZXTA 3V8WA 4XV9A 4HYHA 3VBYA 3ZO3A 3UMXA 2VGOA 4G9RA 3QLFA 4FSYA 4IQ6A 4IMYA 2R3GA 2VTLA 4ZJVA 1PXJA 1Q3WA 3NRMA 4XP0A 3NS9A 5EW8A 3Q4UA 3WZKA 4PDOA 4AE9A 4EOMA 1ZZLA 4CFFA 4G5JA 3EKNA 3TIYA 3S00A 4XG4A 5TR6A 4CLJA 2QQ7A 4PDSA 4CKRA 4D5KA 1IA8A 2ITTA 4UMRA 4AZSA 3MY5A 5EFQA 5M4FA 3QTSA 1MP8A 4GU6A 4MHAA 4O2ZA 4QMUA 3U9NA 2PSQA 4PTGA 5AP7A 3H4JA 4DN5A 4BKYA 2ONLC 2V7AA 5F9EA 5K4JA 1Q61A 1PRYA 2VTJA 5CVFA 3OWLA 5L3AA 2WMQA 1BLXA 4C61A 2PUNA 2QOKA 5HTBA 4TYJA 2VTRA 4FIGA 2IO6A 1R3CA 3EQDA 3VVHA 1OB3A 1PXKA 4GIHA 2Y6OA 4YZDA 5AV3A 3CPCA 4D28A 4GG5A 3AT2A 3LFDA 5FQDC 4ACMA 4BDKA 4DEHA 5J7HA 3ZBXA 4IH8A 1GZKA 5KKRC 4OTGA 1MRVA 3FL5A 3BE9A 3BYMA 4HVGA 2OZAA 4W8EA 2CPKE 3EQPA 1ZY4A 3UO4A 4M0YA 3F7WA 2XNOA 3FY2A 4ZMEA 3RZBA 3LLAA 4O6EA 4H36A 4PL4A 2R3IA 4QD6A 3LCTA 3P7CA 3C4WA 5D1JA 3KXGA 4CZUA 2YN8A 4DINA 4FG8A 4O22A 1H01A 3MPAA 4GU9A 3TV7A 4DG2E 4FEUA 4XUFA 5HZNA 1CDKA 2R0IA 4JRNA 4LUEA 4Y73A 5H9BA 2WHBA 4EOQA 3EYHA 2XCHA 4BYJA 2VD5A 2YERA 4G3FA 5IKWA 1YDSE 4JT3A 1GJOA 3BU5A 4LQMA 5A14A 3UPZA 3D9VA 2BTSA 2C1BA 5LXMA 3E93A 1Q41A 3BV2A 5FWKK 3LFFA 4XP2A 2BZJA 2WOUA 2ZJWA 5J1VA 1QL6A 5LWMA 3L9MA 4ERKA 1M2QA 5CEOA 2VX1A 4YGAA 5E1SA 1YWVA 4YZBA 1E1XA 5IA1A 3VS7A 4UWCA 2W5HA 4ZZNA 4FT5A 5M4UA 4R77A 3RNIA 5DI1A 3PXRA 4JAIA 2VTHA 5CF5A 4ZTRA 2W99B 4EBWA 4USFA 5M07A 1QPDA 2X4ZA 4FOBA 2BRMA 3P7AA 4PDPA 2WQEA 3NSZA 4PNIA 2C5YA 2X1NA 5CU0A 3QRUA 3ULZA 4O1PA 3HMPA 4H05A 4O7TA 4FV0A 5A46A 1ZYLA 1OL7A 2QO7A 2VWBA 3F61A 2PPQA 2B4SB 3R7GA 3C4EA 3NNUA 4U79A 2HXQA 5DGZA 3COKA 5K9IA 4U8ZA 5EQYA 3A62A 4QO9A 4JG6A 4XG7A 4E6AA 5CEMA 2BROA 1J7LA 5D41A 2ZDUA 1ZOHA 2OK1A 2VRXA 4WNPA 3DFCB 1UU8A 1GNGA 4YJOA 4DTKA 1UKIA 1HCLA 3QKKA 1PXNA 3BLQA 3IW4A 1P4FA 3JXWA 3OCGA 3NYVA 4J71A 2W4JA 3OCBA 4RT7A 2BRGA 2JDTA 4S2ZA 2IZTA 4O0WA 2IVVA 4BCQA 3PYYA 3TTIA 2UZUE 5T68A 4O0SA 1XH9A 1Y91A 4FTLA 3TM0A 3WILA 3LQ5A 3TUCA 5HCZA 4PL5A 3DU8A 2JIVA 5DR9A 5GHVA 5EQPA 2I0EA 2VO6A 3GOPA 4S31A 4R5YA 3Q5ZA 4BI1A 4XYFA 4B8LA 5A6OA 5IH6A 4IX5A 4FT7A 4EC9A 2OFVA 3QCSA 3ORLA 2W1GA 3PLAE 4RJ4A 3IO7A 3WE8A 4G31A 2W9FB 4JDKA 4FTQA 4PV0A 3FSKA 4V0GA 5EM8A 4BWXA 1H24A 5KKRB 2X9EA 3CC6A 5IUGA 2PU8A 3DBDA 4IX3A 1LEZA 2QU5A 2V62A 5DHJA 5EYMA 3GGFA 4GFGA 4KD1A 5IMEA 5AP3A 3RGFA 3EKKA 2IVSA 3HYHA 4M97A 2WMAA 3DNDA 5FG8A 3Q4TA 2J0MB 4DE4A 3F88A 3PRIA 4TWOA 4E93A 1T46A 3EQCA 2VTMA 3DOGA 5EI2A 4B9DA 5FGKA 3DXQA 4U40A 4JIKA 4GL9A 3V6SA 2JKKA 4MF0A 4E3CA 3BZ3A 2J2IB 3DZQA 3KRJA 2P2IA 5FBNC 4NM7A 4Y5HA 1XH5A 3UE4A 3ZC6A 4WO5A 4S32A 2C69A 3A7JA 3KFAA 4C0TA 5LQFA 1J7UA 5CU6A 4P2KA 5ANDA 1OECA 3C7QA 3TEIA 4G3GA 4RWLA 3WI6A 3ZONA 4BR3A 1ZMVA 2ITOA 3ZBFA 3CGOA 4G1WA 1A48A 3U4UA 3SG9A 3HMOA 4DEGA 4EK8A 3PJ1A 4HVHA 2R3JA 3N4TA 3BEAA 2P0CA 5EQEA 3KXZA 3ANQA 1K2PA 2PVKA 4JX7A 4PUZA 4APCA 2JEDA 1ZY5A 3QRJA 3DKOA 5CSVA 3R9OA 2X39A 4L7FA 3WYXA 4EZ7A 2OI4X 2Y9QA 3OCSA 2W1CA 2PMLX 2BAJA 3PXQA 4IAYA 5HLPA 2PYWA 5FEDA 4CFMA 5E7RA 4QMPA 3LFSA 1RQQA 4EOLA 1XBAA 1G5SA 2JBPA 3R83A 4P7EA 2C6MA 2PY3A 1MUOA 5K0XA 4BHZA 4FKUA 4C3FA 2VTNA 3K2LA 4F0FA 1YOLA 4FSNA 1OUYA 1J7IA 3CY3A 4YZNA 4FTTA 3E8CA 4EQMA 3RCJA 4OTHA 4AFEA 5AAEA 4ZY5A 4JQEA 2W7XA 1SZMA 4QNYA 5J8IA 3RTPA 3VHEA 4XG8A 1WBPA 1KE6A 2RG5A 4BTKA 1M2PA 3NW7A 3NW6A 4YU2A 2QHNA 4KUJA 4FKGA 4IW0A 3VUHA 5JKGA 5GZAA 1SMHA 3LCKA 4HCVA 3A8WA 1PMNA 5IEYA 2X6DA 2BR1A 4ZTQA 4QMTA 2F7XE 5AR2A 4ZAUA 3H30A 5F94A 2W1EA 3A4PA 4OBQA 2PVMA 3FKNA 4FYNA 3KULA 4W4XA 4DEDA 2R3FA 2PL0A 3NVKI 3TTJA 2YIRA 3FMLA 4G16A 1SYKA 2VTPA 5FBOA 3F3TA 1U54B 4KKHA 2OO8X 5DRBA 4IWQA 4RZVA 4DGOA 3FZTA 5KZ0A 4E8AA 4EH9A 3WIGA 5CAUA 3CQUA 4BDDA 4DEBA 5I5ZA 3SV0A 3CJGA 1UVRA 3PP1A 3MBLA 3OCTA 4FMQA 3RK7A 4F1MA 4UY9A 5CNNA 2PZYA 3RBWA 5EYKA 3HMMA 1IASA 3TKIA 3FQHA 3U6IA 2F9GA 5IQBA 4GT4A 3DJ6A 3DCVA 5LARA 4R8QA 2XJ2A 3ID6C 2HOGA 4HJOA 4I23A 3UPXA 4ANNA 2C5XA 4OTFA 3ZYAA 3W8QA 2GNHA 4Q9ZA 2W1IA 4Y83A 3TL8A 3NUPA 4QP2A 3PJCA 5BVDA 3OWKA 2Y4IC 3HX4A 1KE9A 4FG7A 3FV8A 1IEPA 3F3UA 4XX9A 4C4IA 4DFUA 4K77A 5IDPA 4GT3A 4I0TA 4RFMA 4F7SA 4PNKA 4HGLA 3C13A 2R64A 3MVMA 3SRVA 4ASDA 2QD9A 3GP0A 4RC2A 4C3RA 2WTCA 3QC4A 4MTAA 4D2SA 3DTCA 1Q8YA 3IK3A 4YC3A 1FINA 1M7QA 5M4IA 4FSWA 3B8QA 4QTAA 1RJBA 4GJ3A 1JVPP 2JKQA 1JKLA 5LJJA 4O0TA 4F64A 4UMPA 3UO5A 3GU6A 3O8TA 3T9TA 3TV4A 4F70A 5E8WA 1PYXA 4J52A 3UP2A 5FTQA 2KULA 3P86A 3PSCA 4BIBA 4AOJA 5CQWA 2CN5A 4FSMA 5IH4A 3GU7A 5LMBA 2BRBA 4UMQA 4I1ZA 5T6KA 4D2WA 3F5GA 3L8XA 3AD5A 2VWUA 3Q9ZA 5BVOA 4HVIA 1FVRA 1BUHA 1ZOGA 2WEIA 3U54A 4IBMA 3UNKA 2QOLA 1XJDA 2PMNX 4FSUA 4NK9A 2QONA 4TWCA 4YTHA 3SXSA 5HX8A 4HPTE 2Z7LA 3ZUUA 4F9CA 3E8EA 1HCKA 3LXLA 4WSQA 4NYEA 4L3PA 3F2NA 4YC8A 4GKHA 3ENHA 5J79A 1UA2A 3OVVA 4IHPA 1CTPE 4G2FA 4NCTC 4BZDA 3OEFX 5BYZA 3W16A 4BCJA 3Q2MA 5CVHA 5AA9A 5I9YA 4AA5A 3BCEA 5TKDA 1YI4A 4E1ZA 1OL2A 3BV3A 2X7OA 3HMNA 4RIWA 2OLCA 2XK3A 4I3ZA 3EFLA 2QODA 5DR6A 2JITA 5GIOE 5IA4A 4I24A 5BVKA 3ZO2A 1WVXA 3TV6A 2C3KA 2YDIA 5CASA 3FHRA 3II5A 3NYOA 4I92A 3MIAA 5H8GA 2OJIA 3LCOA 3TNIA 2WXVA 4XLIA 2E9VA 1H26A 4UZDA 5CY3A 5CAOA 3IKAA 2VWWA 1Y6AA 3EYGA 2QKWB 4FV6A 3H0YA 3Q4ZA 1PXMA 5ETFA 3TZMA 3ZM4A 4EJNA 5IUHA 4DC2A 3IGGA 3GU8A 3CSVA 3RKBA 4ANQA 2X8IA 3MIYA 3MW1A 1PXIA 3LIJA 4AP7A 1X8BA 3CE3A 5EOBA 1K9AA 4LOPA 4MQ1A 5BQ0A 3QGYA 3DT1A 3EN4A 3I1AA 5T3QA 4DLJA 4FKSA 4X2NA 5HTIA 2Z60A 3F9NA 3OOGA 5AUYA 3MTLA 3B2WA 3QQLA 1DM2A 2A4LA 2F4JA 4EHVA 4F7LA 4F0GA 5IPJA 4FTKA 4EUUA 4OUCA 4BCFA 2WGJA 3ZMMA 4AS0A 4QPAA 2I0HA 2ITQA 2FVDA 1UU7A 5HIEA 1BL7A 2C3LA 4QTDA 4KKEA 2PE0A 2ERZE 5I9UA 3ZZEA 2HY0A 2B9IA 4RA5A 2YDKA 3VUGA 5DWRA 3ZUVA 5LVPA 1LP4A 3OT3A 2XK6A 3E87A 3BHUA 5B0XA 1WFCA 2BKKA 3VBTA 4RWJA 4L53A 4I5CA 3A2CA 3FI2A 5DT3A 2XA4A 4ZTMA 3V8SA 5D10A 3PXYA 4L46A 4PPBA 1IAHA 4QOXA 5C8MA 4W4YA 5HVKA 4XOZA 5IH5A 4ZY4A 3F6XA 2YCRA 3COIA 3W2PA 2CHLA 3NX8A 2I0VA 1ZRZA 2ITPA 4JDJA 4ZY6A 5ACBC 4AA0A 3T8OA 1OKVA 3R04A 1J1BA 2HW7A 3RK5A 2QCSA 3RCDA 4YJQA 3BU6A 3PP0A 1AGWA 1MQBA 4MD7E 4I6FA 5DVRA 3EFKA 1UNHA 3K3IA 4M69B 4WRSA 5HIDA 4FGBA 4HCUA 3RWPA 3QCQA 4CQGA 4MXOA 2IG7A 1GY3A 3ZCLA 2OXXA 5FTOA 1G8SA 2BIYA 4YUQA 3UOLA 2VNYA 5JRSA 3QX4A 2UW4A 4FNXA 3KL8A 4E73A 2O5KA 3S3IA 3E7VA 1WBTA 4U7ZA 3UJGA 4YJVA 2GNFA 2G2IA 3QHRA 5LMKA 4FKOA 4LM5A 4MXXA 4F9AA 4FTUA 3MYGA 2W06A 1JSVA 5HG5A 1JKTA 3RHKA 4AFJA 5A54A 3O71A 4FBXA 3W2SA 3SGCA 3PA4A 4WUAA 5E8UA 5D9HA 3FE3A 3C0GA 3FXWA 3PSDA 4WG4A 4BGQA 3SOAA 3KK8A 3OY1A 3TZ8A 3ZUTA 4AW2A 2PMOX 3IDCA 4MBLA 4FUXA 4H1JA 2A27A 1WVWA 3ACKA 4CT2A 5JH6A 3AT3A 1DS5A 4JI9A 3A61A 4BCOA 4RMZA 3K5VA 3FJQE 4MXAA 3DBFA 3R7EA 2QOCA 2R7BA 1YOJA 2YIYA 4NM3A 4O91A 3ZS5A 5I3RA 4AW5A 2C0TA 4A9RA 2EXMA 5AAFA 5M4CA 2X2MA 2Y7JA 3FSFA 3LPBA 4X2KA 4M0ZA 2EUFB 3F3WA 1PMEA 4NIFA 4BCKA 2XIZA 4R1YA 1BL6A 3HEGA 3TNQB 4ANSA 4BCPA 3TDWA 3E7OA 3IECA 3UOKA 2C6IA 1JNKA 5M53A 4EHZA 3Q4CA 3ZLYA 2OF2A 2QURA 4F7NA 3I5ZA 2BFXA 4I6BA 4XG3A 3V5PA 1SVHA 4NUSA 4DFLA 3ET7A 3C1XA 1OL1A 3DAKA 4CV9A 4OR5A 2OICA 4EUTA 3HA8A 3M11A 1VYWA 4P5QA 1BI8A 5KHXA 2VV9A 4LL5A 3FI8A 4HCTA 3PFQA 1H1WA 2ZAZA 4MK0A 4PWNA 4XCUA 2YHVA 4RX8A 4DG3E 5EW9A 2OW3A 2XCKA 4J96A 4HW7A 4WKQA 2VZ6A 4EK6A 2C0IA 3QRTA 4XEYA 1Q8TA 3HVCA 3LFNA 4AWIA 4O7NA 2XYUA 2FYSA 3DV3A 4GMYA 3CD8A 2X81A 4J97A 5HVYA 1CMKE 4DF3A 5KMLA 3FZ1A 3O7LB 4APPA 4M13A 3GCQA 4AZVA 4ID7A 3FMDA 2LGCA 1U59A 2BHEA 4CSVA 3GFEA 3SW7A 1PYEA 3I7BA 5CWZA 2W4OA 5CXHA 3RMFA 4NW6A 2PVYA 5FDXA 3F82A 4YURA 3EQHA 3MVJA 4L68A 5EHYA 4ANOA 2HAKA 3R1NA 3VHKA 3DTWA 4C33A 3ZOSA 4GCJA 3NNXA 4AGUA 3QALE 4OTQA 3B8RA 3O17A 2PZIA 3W8LA 4MKCA 4G3EA 2W96B 4MWIA 4ACCA 4YLJA 3UVPA 4F1OA 4LV8A 4GVJA 5IMXA 4UMTA 2PVLA 3L8SA 5LOHA 3LE6A 1R0EA 5C9CA 3DB6A 4YP8A 4B6LA 2EXCX 3UC4A 4CMUA 4PPAA 1M7NA 2JAVA 4D1ZA 4EH4A 3PZHA 4BDFA 3KB7A 4L44A 3F69A 2ZV2A 1R0PA 3C4XA 4TNDA 2GNIA 4EBVA 3LVPA 2I7QA 3I6UA 5KE0A 4CNHA 2WB8A 4DGGA 3D7ZA 2B0QA 2XEZA 3QTUA 4HZRA 4CFWA 5CENA 2J0LA 4B7TA 2WTVA 2QOOA 4QP6A 4JIAA 4MAOA 4YPDA 2C6DA 3R73A 4BFMA 3BX5A 1PKGA 2P2HA 3OXIA 5ANOA 4CT1A 4U6RA 3TI1A 4BIEA 2FH9A 1LUFA 3V3VA 1YOMA 4O84A 2YITA 4QPSA 4FTNA 1LPUA 4TPTA 5EYCA 3VW6A 2RFDA 3IW8A 4KAOA 2UZEA 4O0VA 3D2KA 3NGAA 4UZHA 2XUUA 4M8TA 3A7IA 5ANEA 3D5XA 3QLGA 3LOKA 3TNWA 4H3BA 2ONLA 4JS8A 2WO6A 4MXZA 4O2PA 4MD8E 4PMTA 2YCFA 3IPHA 5IQFA 4MNEB 1JQHA 5FUTA 4DH1A 4UN0C 1KE8A 2XNBA 3FMEA 5TOZA 3K54A 1H1SA 5AV4A 1IA9A 2VWXA 5IQAA 1P5EA 3OHTA 5DT4A 4RVKA 3TKUA 4YMJA 2H34A 3I4BA 3PVBA 2Y8OA 5DEYA 4YTIA 3NPCA 3OY3A 3R8PA 2PZPA 3BWFA 3SVVA 1OBGA 4CG8A 2WU7A 5L8LA 2B1PA 4TN6A 2OU7A 3U4WA 1TQPA 2EB3A 3BQCA 2G15A 4UWYA 4IVCA 3ZEWA 5D7VA 4XNEA 3LM0A 3AOXA 4ALUA 4AGWA 5JFVA 4QMXA 2QG7A 2OIBA 4CYIA 3Q60A 1YQJA 3OXTA 5KNJA 3NDMA 1IR3A 1TQIA 4K11A 4KWPA 5H2UA 5JGAA 2CKQA 1VZOA 2R3QA 4D0WA 2OKRA 3OD6X 5HG8A 4WG3A 3EN7A 3A4OX 3L9NA 2XVDA 4XH6A 3ZLSA 1JBPE 5HIBA 2YLFA 1KE5A 3PXKA 2RFNA 4MF1A 4DFNA 5CAPA 5AR8A 2UZBA 3ROCA 3VS1A 2ITWA 4CKJA 4YJPA 4O21A 4BI2A 2OWBA 4BYIA 2JFMA 2W05A 1YWRA 3CKXA 3OC1A 4YO6A 5DMZA 5C4LA 3EQGA 3FLWA 5CF6A 5IZFA 5IDNA 5HE3A 4DCEA 4FKTA 5KMIA 1JLUE 4E6QA 3WE4A 5CEIA 4U0IA 1L3RE 1XH6A 5E8XA 1YDTE 4R7BA 3MFUA 3ZDUA 2WMVA 3JPVA 2R0UA 3CY2A 1W7HA 3ZRKA 2DUVA 2J0IA 2OSCA 3O23A 3PSBA 2RGPA 4LUDA 3H3CA 3MH1A 4FTMA 4J99A 3ATTA 3EOCA 5AP5A 1R1WA 3G2FA 4A4XA 4KB8A 4HZSA 5JGDA 3W18A 1CKJA 2IW9A 1G8AA 3FLYA 3AC4A 3V6RA 5HLWA 5IF1A 5GIPE 4RVMA 4FV3A 2XBAA 4W9WA 3SAYA 2CLQA 4AZFA 4EOIA 3G9LX 3QWJA 4BIDA 5AM7A 5I4NA 2HW6A 1V0PA 4L3LA 5BPYA 4EQCA 3Q3BA 3LAUA 4YC6A 2ZV8A 4FSZA 3QC9A 5CX9A 2GPHA 1JOWB 1WCCA 4FTRA 4M15A 3VQUA 5IEXA 3GCVA 5EHOA 2OGVA 4R3RA 3UVRA 2ETMA 5JK3A 3D7TB 4CQEA 3GQIA 4BBEA 4JBQA 5DOSA 4TZRA 5ETIA 5IA2A 4GK2A 2CCIA 3BBTB 4AW0A 5LCJA 4X2FA 4BKZA 1UV5A 4XRJA 2XRWA 4FTAA 4K0YA 2YLEA 5DFPA 4CKIA 4EKKA 3W2QA 4QMSA 1YI6A 3VS6A 2RF9A 4C59A 1FVVA 1XQZA 4LOQA 3ODYX 4GT5A 5HD7A 3QUEA 4UX9A 1OGUA 4OBPA 3KF4A 4RX5A 3ZLWA 1PXLA 3QQKA 5D12A 2OIQA 5J5SA 4BDEA 3OW3A 3Q9WA 4F6WA 4IC7A 3DDPA 3P79A 3UG1A 1J91A 4MVFA 4W4WA 3RINA 4EYJA 4B4LA 4FIHA 5F4NA 4GSBA 5GINE 4D2PA 3V51A 3GC0A 1U54A 2BMCA 4FKJA 3D15A 2J51A 4NU1A 2GSFA 5HE2A 1SVGA 4PTCA 1RE8A 4JBPA 3VJOA 3RWQA 3ZRLA 2BDWA 4X0MA 4YZ9A 4L42A 1XH7A 5GNKA 4O38A 2YAKA 3NUAA 2OJGA 4QYHA 1OIRA 2R3PA 3OUNB 1DI8A 3L8VA 2RL5A 1V0OA 2C5NA 4FKPA 4OGRA 3AC1A 3VUTA 3EZRA 2WQOA 3A7HA 4O6LA 4OT6A 2O3PA 3CQWA 3GNIB 4DFYA 4DEEA 4YSMA 3BEGA 3SQQA 4D55A 4FX3A 4KIKA 2I1MA 3VWAA 3MA3A 5CAVA 4C7TA 1WVYA 5J87A 2WTWA 4ALWA 2J0KA 3C4CA 2B9JA 1G3NA 4RC4A 4KBCA 2XKEA 3VUMA 3W55A 4GG7A 3HECA 4TKSA 2C30A 4TTHB 5C1QB 2J50A 2UV2A 4GVAA 2X0GA 2BAQA 5HU3A 2ZM3A 4NTSA 5AR4A 3TCPA 4FF8A 3PIYA 4FEWA 3BU3A 1REJA 4FTIA 4RLLA 2X2LA 3PIZA 4L7SA 3ZO4A 2PUPA 4LMNA 5D7AA 1U46A 3ORPA 3R63A 4RIXB 3VBQA 3R02A 3FC1X 4DAWA 4FODA 4AT5A 3KN6A 3LM5A 4RA4A 3HV3A 2NPQA 3EN9A 4K2RA 4YHTA 4NM5A 4RJ8A 4U3YA 3UZPA 2PVFA 4C35A 2YM3A 2BUJA 2AUHA 3R1SA 3R7UA 2C3IB 5F20A 3V01A 3VJNA 3DKCA 4OTWA 4N70A 3HUBA 3PTGA 2HWOA 2VO7A 3UMWA 4FK6A 4JG7A 2ZM4A 1F0QA 3IW5A 4U97A 2NO3A 4BKJA 3NMUF 3MY1A 1RDQE 4JLCA 3P23A 3SHEA 3UODA 3JVSA 3VF9A 1UU9A 1VR2A 3ELJA 4FT3A 3V8TA 3KRXA 2GQSA 4EZ3A 1OL6A 3PVGA 3BHTA 1Z5MA 4FVQA 5ACKA 3IW7A 3R30A 5HORA 4PMPA 3NW5A 3Q6UA 2XP2A 4AA4A 2XZSA 1SVEA 5AUWA 5KMMA 3KK9A 3OP5A 4KA3A 3E8NA 1TQMA 4IFGA 3FQSA 4YJTA 5IG1A 5KBQA 3QD3A 4YPSA 2A0CX 2OH4A 4V04A 5KCVA 1O6YA 2CKPA 2WTKC 3FBVA 4O82A 2YCSA 5AAGA 4KIPA 3KU2A 2DWBA 1PY5A 3GB2A 3KY2A 4JQ7A 3ZSGA 4R7IA 1F5QA 4GYIA 2CLXA 4QNAA 5CS6A 4EH8A 4F63A 4FIFA 5AMNA 5C8KA 4HVDA 4J98A 1PKDA 3QQHA 4FVRA 3PRFA 4DH3A 5LVLA 3KMUA 3G15A 2IWIA 2R3HA 5E8ZA 5BVFA 5JRQA 4ZTNA 2WMWA 3QU0A 1OKZA 4BZOA 2BILB 2GQRA 2XIYA 2W1HA 2GFCA 2YCQA 4FR4A 4MNFA 4FZ6A 4WG5A 5HBHA 3W10A 4TYGA 4EHEA 3NEWA 2Y4PA 3IW6A 5CSHA 3R8LA 1H08A 3DAJA 4EH6A 4IB0A 4AF3A 4ZLYA 4R3PA 1H0WA 3DGKA 1IRKA 4LGGA 1B6CB 3EMGA 2P33A 3R8ZA 3V5QA 3AG9A 3T9IA 2XEYA 4PRJA 4KRCA 4C3PA 1ZWSA 3K5UA 4OLIA 5AADA 3ACJA 3MWUA 4RQKA 5HE0A 2VWIA 4K18A 3D2IA 2QOBA 3VS5A 3TKHA 1H1PA 3Q52A 5JMSA 4A7CA 3LJ1A 3WZUA 4IM3A 2OZAB 2PE1A 2WMRA 4X3FA 4ZTHA 4DH5A 2VTAA 3ATSA 3DJ7A 5HVJA 4Q5EA 5DEWA 3QCXA 4FSQA 4ITIA 3ALNA 2GQGA 3QTQA 2YIQA 4ONAA 4AE6A 4X2JA 5LCKA 5FM3A 2H9VA 3G0FA 2HY81 4KSPA 4IX4A 2UVZA 5J95A 3R7YA 4ACGA 1MRYA 1YKRA 3G0EA 2AC3A 3MH2A 3R71A 3KMWA 1I09A 2F2CB 5H8BA 3S4QA 3VNTA 5L2WA 2CJMA 1J1CA 3LFEA 3LMHA 3PPZA 3GBZA 3MH3A 4IEBA 5LWNA 2CMWA 2B52A 4OBOA 2FSTX 2PMIA 4D2TA 4RSSA 5FM2A 3G51A 5L6PA 2RG6A 3LFQA 3PG3A 5CT0A 3W2OA 5HNIX 4DTBA 1OIQA 4GRBA 4PP7A 3NIZA 3KXMA 2Z8CA 3PY3A 3SC1A 5FDPA 5ICPA 2YM8A 5C03A 3V5LA 2B7AA 2H96A 1OPLA 2JFLA 4IB5A 1W82A 3RAHA 2P55A 2XMYA 2Y6MA 3N51A 2V7OA 4HYIA 2BCJA 2H6DA 4JNWA 5AUZA 5ETAA 5DRDA 5CALA 1H8FA 4EZ5A 4M69A 1XBBA 3FKLA 1FVTA 1Y8GA 3EHAA 3GU5A 3GC7A 2XKFA 4PL3A 2G2FA 2V0DA 3CTQA 3R21A 4QQCA 3WYYA 4DHFA 4BDHA 3QCYA 4IXPA 2JDOA 4WBBB 3BI6A 5DNRA 4JBOA 1Y57A 4O27B 4FZFB 4I21A 3JYAA 3FUPA 3R0TA 4I20A 4ZZMA 2PVHA 2UW9A 3EJ1A 2WU6A 3H9FA 5IA3A 4FKVA 4O0XA 3VBWA 4WRGA 4OAVB 2LAVA 5E91A 4NKSA 4AOTA 4IWOA 5DT0A 2X4FA 2WIHA 2WTKB 4DCAA 3R01A 4FTJA 4IE9A 3R9NA 2RFSA 2XNPA 3LJ2A 3CBLA 2FSMX 4I22A 3PXZA 4I0RA 4G17A 5AUXA 2NRYA 3DKFA 2E9NA 2UVXA 2YZLA 4WNMA 2HIWA 3DBCA 3QTRA 2BZKB 1DI9A 4BCNA 3OXZA 4FKWA 2FO0A 3LJ0A 4F65A 3FAAA 4E5AX 2PHKA 5K4IA 1XR1A 3MPTA 4RGJA 3D5VA 2FSOX 3RALA 4RQVA 2ESMA 4O7VA 1NVQA 1U5QA 4RIOA 2ITNA 1NA7A 2JDVA 5TF9A 5EI6A 2XH5A 3R8VA 3VBVA 4II5A 4JAJA 2W1FA 2VN9A 4OT5A 2QI8A 4QYEA 4U5JA 3PWDA 1L8TA 4CFNA 3R2YA 5HLNA 1YXVA 3OBGA 4KABA 4IACA 4D0XA 4C4FA 2R5TA 1XH8A 4GK3A 4BVUA 5FEQA 3DJ5A 4ANLA 3VW8A 4FEXA 1P4OA 1NT2A 4AQCA 4NJDA 4AUAA 2BDJA 4AW1A 4XG2A 5AEPA 3OG7A 3GU4A 2UW8A 3E62A 5FLFA 1V1KA 3ORMA 4O0RA 3TIZA 4H3QA 3RPSA 3DPKA 1W84A 4CMTA 3LCSA 5A4EA 4MX9A 2G2HA 4NEUA 3RNYA 1W8CA 2VUWA 3OZ6A 4WUNA 4RJ5A 4HPUE 3P5KA 4RJ7A 4Y8DA 2R3RA 4W9XA 4E20A 2PUIA 2GU8A 4X6RA 4ASXA 1XH4A 4C8BA 3MV5A 2ETKA 4EQUA 4FK3A 4QMWA 4GIIA 4PTEA 5CZHA 2XNEA 1NXKA 4P5ZA 5ETCA 1QPCA 2OBJA 3FYJX 3HV4A 2ACXA 1S9JA 3QKLA 3VS2A 2X9FA 3O2MA 4JVGA 3GVUA 4D4RA 3L9LA 3MFTA 3EB0A 3RAIA 2BAKA 2IZUA 4L6QA 4YLKA 4WD5A 4EK5A 1Q5KA 5M09A 2C4GA 2O63A 4FZAB 4PMMA 3ZSIA 4A07A 4C37A 5K5XA 3HRCA 5AV0A 2G1TA 3QZIA 2CGXA 4C2VA 2WNTA 5M44A 1YVJA 1WBNA 1BKXA 3AGLA 3QUDA 1Y8YA 3G33A 4R5SA 4RPVA 3HDMA 4LMUA 4BBMA 1JKSA 3O0GA 4RVTA 3NCZA 3AXWA 5CI7A 4BDGA 3GCPA 3MB6A 4AXAA 1U5RA 5C27A 3RI1A 2J6MA 3VUIA 5TE0A 4ZLOA 3K3JA 3QTIA 3KKVA 3Q6WA 3MJ1A 3QD4A 4RIYA 5IQIA 3C9WA 5ANKA 2PVRA 2Z7SA 3NUUA 4HNFA 3FQEA 4ZS0A 2OIDA 5GZ8A 4M68A 2QOHA 4JG8A 4FOCA 3QRIA 2ZV9A 4ORKA 1KV2A 2BALA 4L67A 5I3OA 1UWHA 4FT0A 4H1MA 5IQEA 3VUDA 2XKCA 4U81A 5HOAA 3UQFA 4IM2A 4TYHA 4BC6A 5M06A 1URWA 4D4SA 4IWDA 4Z3VA 5CZIA 3IONA 4FZ7A 4IDTA 1QPEA 3UTOA 5J9ZA 4KKGA 5A9UA 3QTZA 3MDYA 4QP9A 5B2KA 2HZ0A 5AIKA 5EKOA 1OITA 4V05A 3KRWA 4Q5HA 4WT6A 4EEVA 3KA0A 4ZSAA 4MCVA 4ITHA 3P7BA 3PPKA 5JFSA 5EDQA 3WZDA 1ZYCA 5H3QA 5A4CA 5C01A 3NAYA 3FMKA 5AJQA 4I4EA 3ZH8A 3BHYA 3NYXA 1TVOA 1H1RA 1Q8ZA 3D0EA 4F1TA 3QTXA 3A7GA 5LMAA 4RRVA 3SXFA 3TJDA 3I7CA 2UUEA 4NFMA 4A9UA 5HX6A 4EJ7A 3LLTA 4PDYA 4JQ8A 4L9IA 5CLPA 3S2PA 3C0IA 3NIEA 3ORTA 3TNPC 3CEKA 4QQTA 1O9UA 2VTQA 1ZYDA 2ZDTA 2IZSA 2WMBA 3LFAA 3QQGA 3ETAA 3AC2A 5CXZA 1MQ4A 3KRLA 3MGYA 1JWHA 4CTCA 5ANJA 4LL0A 5I9WA 5IA0A 5M57A 1T45A 5CTPA 3C51A 4D58A 3KCKA 2YAAA 4AN3A 1PXOA 3NLBA 4U42A 4NSTA 4AN9A 4IVAA 5HBJA 5K0KA 5CEQA 3V5JA 3ZZWA 2BRNA 3BYOA 2YISA 5L6OA 3CTJA 3KMMA 3O51A 2BTRA 2GNJA 1Q8WA 4D4VA 2WQBA 3FLNC 3OWJA 2HZNA 3U87A 4BCHA 2OJFE 4EH5A 4FG9A 2I6LA 2YDJA 3E63A 2VX3A 5EW3A 1OM1A 3PZEA 4A06A 4FZDB 2OJ9A 4UYNA 5GJDA 5IQHA 1Q24A 2E9UA 2JDSA 5BVWA 3F2RA 3SRVB 4ZMFA 4FV9A 5B7VA 5E1EA 3HNGA 4FSRA 2Z7QA 2HZ4A 4NT4A 4A9TA 5E90A 2WMTA 3UIXA 2DYLA 1FGIA 2VO0A 1XO2B 4FUYA 4EC8A 2KTYA 1H27A 4WA9A 2CDZA 4QYFA 3MVLA 5DYJA 3GFWA 5A6NA 3KGAA 2F7EE 5DE2A 2CGUA 3IDPA 4BWPA 3Q9XA 4FVPA 3S0OA 5IQGA 1UNGA 5HESA 2CGVA 1OMWA 2PVNA 4XS2A 5G6VA 3QQJA 4EH2A 3PE1A 4IFCA 4EKLA 3DAEA 3CIKA 4FTOA 3QFVA 2Q83A 1R39A 3HA6A 3M1SA 5ANGA 4N6YA 1DAYA 2ITXA 2QG5A 3ZDIA 5JSMA 1OKWA 2WEVA 3QZFA 3TZ9A 2QC6A 5K5NA 3HDNA 4DTAA 2VGPA 3PIXA 5HCXA 4IAAA 3WZJA 4TW9A 2R2PA 4ZSLA 5GJGA 4ACDA 4RG0A 4D9UA 3FXZA 5LVOA 4MBJA 2FGIA 4FNYA 5DBXA 2VX0A 3I6WA 3JR1A 5EM7A 4YBJA 1NY3A 1PXPA 4UWBA 3UIMA 4YJUA 1U4DA 4D2RA 5M56A 3WIKA 2AYPA 3DFAA 4FA2A 5LMKC 3LFBA 3UZRA 3LMIA 3IG7A 1FMKA 4LGHA 3TWJA 4LRJA 5DG5A 2YIWA 5FP6A 3UIBA 2RKUA 4JDHA 3UIUA 3PXFA 2J5FA 4R7HA 4EOOA 1MRUA 5BYLA 4RIWB 3UNJA 5DIAA 4FKRA 3BYVA 1GIJA 2C6OA 3UC3A 3PLSA 2OXYA 3R1YA 4UB7A 3HAVA 4X2GA 1DAWA 2VAGA 2UZDA 3FI3A 5DH3A 4O86A 4IDVA 2Q0NA 4MXCA 4MBIA 4GJ2A 3CTHA 4Y72A 5CU3A 4ARKA 2EWAA 4R1VA 2X2KA 2UZLA 4L3JA 4ERWA 5KMJA 4G6NA 4YTCA 4RX7A 3RAWA 2HWPA 3KEXA 4AZTA 4PF4A 4BL1A 4EORA 4YSJA 4FEVA 2XIXA 5AR7A 4DFBA 5BVNA 4YNOA 3UQCA 3QBNA 4U43A 4KIOA 2YWVA 1OIYA 3M2WA 2XF0A 2XM9A 3IQ7A 3JUHA 4RBLA 2Y0AA 2R9SA 3DBEA 2HK5A 3I5NA 3KREA 4L43A 1QCFA 5E8SA 3R9RA 4LG4A 2PVJA 3HV7A 3GOKA 4E4LA 3BQRA 3EWHA 3BHHA 2W1DA 1IG1A 4BICA 4WNOA 3OS3A 4W8DA 3HP5A 4QTBA 4IC8A 3ZFMA 1YW2A 3GENA 3P4KA 4YO4A 3MFSA 4XV2A 5K3YA 4RX9A 1BYGA 3EQFA 3MH0A 2QKRA 5HKMA 1W0XC 1OZ1A 1ERKA 3KF7A 4ZLZA 3UZTA 5KUPA 4OTPA 4Z16A 3QRKA 2PZRA 3SG8A 4Y46A 3DK7A 4BCMA 3SDJA 2H8HA 3HZTA 2J4ZA 3LW0A 4AT3A 4MYGA 3JVRA 3ORKA 3R8MA 3TJCA 3UYSA 4A9YA 2GTMA 2XRUA 4QRCA 1YWNA 4AZEA 3G6HA 4BY9E 3AQVA 2HELA 4JJRA 3N4VA 2HXLA 3R2BA 3NR9A 4JBVA 5IISA 5HO8A 5CEKA 1JPAA 1IAJA 4BDJA 5EI8A 3DS6A 3FPMA 1KWPA 1R78A 4EHGA 4DFXE 1YHVA 4HOKA 2XYNA 3WF7A 2WAJA 3MFRA 4TYEA 2VWYA 4G3DA 4NL0A 3A8XA 4C62A 5IU2A 5HCYA 4GH2A 3R7IA 4YZMA 3UVQA 2QLQA 4TXCA 4DH8A 3UBDA 1GIHA 5A4QA 2W0JA 5J9LA 3FKOA 3QXPA 5JFWA 5CQUA 4ZIMA 2WZJA 5AV1A 1SM2A 4IANA 4F08A 2WQNA 3AD4A 3REPA 4EOPA 4KIQA 5HD4A 3VQHA 4OAUC 5FXQA 3RPYA 1GOLA 2OXDA 2JIIA 2OZOA 3BGZA 2J9MA 1ZZ2A 2J90A 2UZWE 5E8TA 3E8DA 1NVRA 3VF8A 3ORIA 2UZOA 3GC9A 3L8PA 2XK8A 3OT8A 3OW4A 4A9SA 2WMXA 2ITVA 4JDIA 1SNUA 2PWLA 5DLSA 3TT0A 1E1VA 1GZ8A 2CN8A 3NUYA 2W9ZB 1PJKA 4PP9A 5AUVA 5FD2A 3E64A 4K6ZA 5BX0A 5C8NA 4DYMA 3GI3A 2C3JA 2OG8A 5JT2A 5BVEA 1YHWA 5BNJA 2FUMA 1JAMA 3HLLA 4F99A 4XMOA 4FL2A 4PX6A 2UW5A 4JX3A 3KXNA 3UYTA 4CV8A 2YEXA 2YM5A 3D94A 4DBNA 2B53A 4O0UA 1VYZA 3LZBA 4NIFB 4B99A 2C68A 1TKIA 5FRIA 3R22A 3CXWA 4FIIA 4MD9E 4GKIA 5C4KA 2B9FA 4EK4A 5F1ZA 3VS0A 1ND4A 1GZNA 5KMOA 3ZC5A 4FV1A 2Z2WA 4DGNA 2C6EA 2VTIA 3PDTA 3W33A 4MXYA 4BHNA 4C34A 2VTTA 2XKDA 4Y85A 5CF8A 4EK3A 3P78A 2ZOQA 4ANMA 2R3LA 2PK9A 2R3MA 2GMXA 3AT4A 3RPVA 2XNGA 3EN5A 3KRRA 3PVWA 4R6VA 4AZWA 4ZSEA 5CANA 1H25A 3AGMA 2QO2A 4Z9LA 2UW7A 1OPJA 3A7FA 3BRBA 4GW8A 3D83A 4I5PA 1PF8A 3WOWA 5BMSA 2PZ5A 3D5WA 1Q8UA 4QQ5A 3BYUA 3TZ7A 4RVLA 2V5QA 5I9ZA 4XP3A 3U8WA 2C1AA 2F57A 5J7BA 4D5HA 4E26A 4O83A 2IVUA 1KE7A 1WBOA 2EU9A 2O8YA 2ZVAA 3ODZX 3O50A 4LGDA 2FSLX 4GFMA 2X7FA 2R3KA 2C5VA 3FXXA 2QVSE 4FTCA 4UBAA 4ZP5A 3WF5A 4EOKA 1H07A 2JLDA 3PJ8A 5HHWA 5AR3A 4K33A 4U44A 2OJJA 1STCE 4AGDA 3RAKA 1LR4A 3B2TA 5A4TA 3PG1A 4KBKA 4RWIA 4E4MA 4J95A 3GUBA 3BLHA 5HE1A 3ZXTA 4TY1A 5KX8A 3POZA 3QL8A 4M7IA 3VBXA 1ZMUA 3R7VA 5CU2A 4JR7A 1Z57A 3F3ZA 3DBQA 5HNBA 2Z7RA 2BFYA 1GAGA 3U9CA 4DG0E 2UW3A 4NFNA 3ZU7A 4BTJA 4I6HA 2UVYA 3POOA 3GC8A 3EIDA 3MS9A 4EH3A 1VJYA 3MA6A 2QU6A 4EWHA 1KOAA 4DBXA 1CM8A 2JC6A 3NNVA 4LRMA 1B38A 5LVMA 4HGEA 5EG3A 4FYOA 1ZLTA 4USDA 2HZIA 4WIHA 3R6XA 4LRKA 4O1OA 3O7LD 4YBKA 2F7ZE 3AC8A 1AD5A 4RWKA 4BDCA 1F3MC 3N4UA 3EQRA 2GNLA 3DB8A 4EH7A 4WHZA 2IN6A 4QQJA 3PPJA 4YNEA 3UG2A 5AP6A 2WKMA 4IZ5A 4UYAA 1SNXA 2UW0A 2Q0BA 1O6KA 3LXPA 5BMMA 3BYSA 2XK7A 4C38A 4E6DA 5FXSA 1CKIA 3LHJA 5E8VA 1Q3DA 4G34A 5CYIA 2X8DA 3UGCA 4CGAA 3U6HA 4ZOGA 1YRPA 3BGPA 4UALA 4U45A 5HI2A 4C02A 3M42A 3Q53A 4FSTA 4DEIA 4DGMA 4FGRA 5HBEA 3Q96A 4N57A 4WNKA 4IWPA 4EYMA 3VN9A 2HENA 1V0BA 2GHLA 3O96A 4U9AA 5JZNA 2JBOA 4YHJA 1XKKA 4YLLA 2W5BA 3AMYA 4BDIA 4L01A 4DEAA 1NW1A 3RVGA 3THBA 2GNGA 4WBOA 4YTFA 3QQFA 4KSQA 4YJRA 1KV1A 4WSYA 2ITYA 3I0QA 2ERKA 3HV6A 3H9RA 1S9IA 5HG9A 3WBLA 3QXOA 4RZWA 3QWKA 4R3CA 5HG7A 2QNJA 3FZPA 3KC3A 2E2BA 5BUIA 4O7ZA 3NYNA 4X3JA 3RM6A 2XBJA 2J0JA 5DN3A 4IADA 4CG9A 4RJ6A 4QYYA 4HGSA 5KO1A 4LYNA 4BN1A 4M3QA 1WBSA 4O7SA 3FZRA 3CJFA 1P14A 4NH1A 2IW6A 4AU8A 4HGTA 4OTDA 5G1XA 4GEOA 4XJ0A 4ZK5A 2XNNA 2NRUA 2XK9A 3KCFA 3Q9YA 3HMIA 1XHAA 4KINA 4DH7A 5AUTA 4K1BA 5JQ8A 4FL1A 1QMZA 1ZOEA 3V04A 5E4HA 4BDBA 2GTNA 2VWVA 4FNWA 4W4VA 2C6TA 4AGCA 3S95A 5AUUA 5EDRA 3QX2A 2F2UA 4NM0A 2BRHA 4ZSJA 3KXHA 2IJMA 3F5XA 4C36A 2A2AA 3QA0A 4XRLA 2AC5A 4ZTSA 2WTIA 3C50A 3LQ8A 5EH0A 3H10A 2CNUA 3WF6A 5L4QA 2X8EA 5HGIA 2GFSA 5IUIA 1APME 2JIUA 4P90A 2BPMA 5AR5A 4F6UA 3Q5IA 4I5MA 3OBJA 1OIUA 5KMKA 3CS9A 2XB7A 5M51A 3PE2A 4PMSA 1YHSA 3EQIA 3IOKA 1UU3A 4CZYB 1KSWA 3AC5A 4F09A 3DDQA 1ZMWA 3FMHA 3PUPA 2R3OA 5KHWA 2A1AB 4FIEA 4I94A 3R1QA 4BTFA 4USEA 1OPKA 4NJ3A 3FHIA 4Y95A 3DQWA 1FBNA 1OBDA 3KVWA 3PA5A 2VTOA 3QQUA 4EOSA 4M14A 2VNWA 4D2VA 1ZYJA 2QOFA 5CSPA 3ZHPC 2WTJA 3UP7A 4IAIA 3NUNA 3O8PA 1PMVA 4XG6A 3JY9A 4YJSA 3ORZA 3W2RA 4BRXA 3R8UA 3OMVA 4XBRA 1REKA 3A60A 1YXXA 4O7WA 3AD6A 3FI4A 4GUBA 1JSTA 4G5PA 4DLIA 3PY0A 3DLZA 4QP8A 4FKLA 5A4LA 4Z7GA 2QR7A 3D5UA 5AP1A 5HU9A 2QR8A 3UQGA 2WIPA 3OFMA 3MVHA 1YXSA 3ZXZA 3FDNA 1Z9XA 4O96A 4AG8A 4YR8A 2BIKB 3W2CA 2I40A 2PULA 3IS5A 1OL5A 2YM7A 3QGWA 4RJ3A 3HV5A 3NWWA 2C0OA 2JKMA 2ITUA 5BUJA 3FL4A 3DQXA 4AAAA 3LCDA 3QZGA 4OTIA 4XBUA 5KMNA 3FMMA 3OTUA 1VEBA 2BKZA 2QLUA 5E9EA 3VAPA 4FKIA 3LQ3A 3TXOA 4CEGA 3JY0A 3SOCA 5J1WA 4H58A 2REIA 4NCTA 1LEWA 3DK3A 3SX9A 4TNBA 3P9JA 3WARA 5A3XA 5IQDA 2IZRA 3ORNA 4Q2AA 1ATPE 2GHGA 3VRZA 4C4JA 4C4EA 2R7IA 4FV5A 1WZYA 3FY0A 3KVXA 4BCIA 5D11A 3KXXA 4O81A 2C5OA 3U51A 4FV7A 5CEPA 4CVAA 4FI1A 4KIKB 2G9XA 1KOBA 5L2IA 4NW5A 4CLIA 1UWJA 4QTCA 1YDRE 3R9DA 2BZIB 5EYDA 5HQ0A 4IZYA 4CMOA 4UXQA 4CCBA 3ZEPA 1Q97A 4R78A 4QMZA 4CXAA 2X7GA 2ZV7A 3NCGA 2GHMA 3AMBA 4FEQA 3R28A 4FV4A 4U80A 4XV3A 1Q62A 3PA3A 3QAME 5C26A 3LXNA 4UXLA 3MJ2A 5HICA 3MB7A 3KQ7A 4BZNA 4G3CA 3E92A 1GZOA 4DGLC 4X3FC 4ZSGA 3RP9A 4AOIA 5E8YA 4I5HA 1Q4LA 2QOQA 3KN5A 2UZTA 2BVAA 3NAXA 3QD0A 2J7TA 4MEDA 4EONA 4Z7HA 3EFWA 3NZ0A 5EM5A 4IX6A 3ZM9A 2XK4A 3QYWA 4C4HA 4H3PA 3L9PA 3HUCA 3U6JA 2W17A 4Y5QA 4P4CA 3FPQA 3ZTXA 4FV8A 1A9UA 3G90X 3HKOA 2R3NA 3N9XA 4JL9A 3EL8A 3DA6A 1E9HA 5JEBA 3QYZA 3MN3A 5CSXA 2O64A 5I9VA 5IQCA 3I81A 2YA9A 5AV2A 4QMLA 4V0GB 5DA3A 3D4QA 4QP3A 3DXPA 4BB4A 2ZYBA 4FICA 3ROYA 3LXKA 4AACA 5FTGA 4PY1A 2UZNA 2XIRA 4E4NA 4L45A 4HVSA 4A4OA 5CSWA 3EFJA 3BKBA 3E3PA 3Q32A 3VRYA 2YZAA 4AN2A 3FEGA 3FLSA 2ZMDA 1M52A 2B55A 1OI9A 2NP8A 2WMSA 3LKMA 1BX6A 4XV1A 4DFZE 4DITA 3DLSA 3SLSA 4Z55A 3SXRA 2IPXA 5JQ5A 5TO8A 1YXUA 2JGZA 4B8MA 4X7QA 3PWYA 4BGGA 4AT4A 4GK4A 3ORXA 1WAKA 4OTRA 1OUKA 5EDPA 3CR0A 2GS2A 5B2MA 4KBAA 2BDFA 1O6LA 4KRDA 4IAZA 5H8EA 4NTTA 2WFYA 4D9TA 4ZEGA 3ZSHA 4JXFA 3LFCA 3ENMA 2O2UA 4I41A 3F5PA 5J9YA 4F9YA 4H39A 4FNZA 4ZJJA 4TL0A 4N4SA 5HTCA 3C5UA 4YZCA 4HYUA 2XS0A 3QA8A 3VULA 4FE2A 4JOAA 4ACHA 2YFXA 4LFIA 4ASEA 3NVMB 2OH0E 3D14A 3HRBA 4CRSA 2ZM1A 3E5AA 2ZB1A 3FLZA 2UW6A 4QMQA
chains in the Genus database with same CATH superfamily
2YM4A 2VO3A 5KZIA 1J3HA 4DT9A 3ZRMA 4M12A 3BELA 4QMVA 3FLQA 5AM6A 4RFYA 3DNEA 4U3ZA 3HAMA 2JDRA 4O7YA 4B0GA 4J8MA 1QPJA 3F2AA 2W1ZA 5AIRA 3NNWA 2YABA 1W2FA 3OTVA 4QYGA 3LMGA 3WF8A 1RW8A 2I0YA 3GT8A 3CPBA 2WTDA 2GS6A 3EZVA 4HNIA 1AQ1A 2E9PA 4X6QC 1JSUA 1P2AA 3QKMA 4QP4A 2HYYA 2Y4IB 3SKCA 4F0IA 3VIDA 1ZYSA 3SW4A 3F5UA 1M14A 3ZLXA 4UEUA 3CD3A 3ZFXA 3G6GA 3OUKA 2W5AA 4N6ZA 4J1RA 4X3FB 5IA5A 4TWNA 4I93A 4FKQA 4LI5A 4ZTLA 5EK7A 2ETRA 3IDBA 2JKOA 3C0HA 4IJPA 5JGBA 4D1SA 2OFUA 5I0BA 4M84A 2OF4A 3V5TA 5J5TA 3HL7A 3KULB 5JZJA 3C5IA 2B9HA 1ZARA 3AC3A 4M67A 4QP1A 4G6OA 2C6KA 4S30A 5EKNA 2HCKA 3DXNA 2WPAA 3AMAA 1BI7A 2ITZA 4PPCA 5F95A 4XG9A 1FMOE 5AX9A 1M2RA 2XJ0A 3I79A 2XM8A 4EL9A 4I0SA 4MNEA 4BF2A 2V22A 5DR2A 4QMOA 1H00A 1W98A 4JRVA 4C57A 1XBCA 3T3UA 3VS4A 3W32A 3UOHA 3G9NA 3BLRA 2CKEA 4BJJB 5L8KA 3DKGA 4FT9A 4F4PA 1EH4A 3BIZA 4L8MA 4ZS4A 4EI4A 4CRLA 3FYKX 1I44A 3MTFA 3TACA 3RJCA 4IVBA 4LOOA 5CNOA 3F66A 4FV2A 4K8AA 1WBVA 4C2WA 4TWPA 4CFVA 1OVEA 3CKWA 5HO6A 1Q99A 4O7LA 2E9OA 4YJNA 4ZJIA 1ZAOA 2P3GX 3OOMA 5AWMA 2EXEA 3R9HA 3S1HA 2WOTA 1YXTA 3BWJA 4IVDA 3NUSA 4GFOA 1PMUA 4IM0A 4M66A 1H1QA 5BUEA 4QMYA 1CKPA 3EQBA 2W4KA 4NWMA 1NVSA 5FXRA 2JD5A 2QO9A 4DT8A 5GZ9A 2YM6A 3V5WA 3CLYA 4IAKA 3BBWA 1K3AA 4Q9SA 4RFZA 3TUDA 3L1SA 4FIJA 1UKHA 3FZSA 3EH9A 4TT7A 2CNVA 1HOWA 4OW8A 3PVUA 5AFVA 5CVGA 2EVAA 3P1AA 2WELA 2J5EA 4FC0A 3H9OA 4D1XA 4XOYA 4RLKA 4F9WA 2RIOA 3BL9A 1H0VA 4QPMA 1FQ1B 3GXLA 1CSNA 2XIKA 2PTKA 4ITJA 4UV0A 4F7JA 1H28A 3HP2A 4IZAA 4CTBA 2A19B 4D4YA 2G01A 5IEVA 3UDZA 1H4LA 5AP2A 4UMUA 5CF4A 3UOJA 2XNMA 3O8UA 2SRCA 4IJ9A 4L52A 3RK9A 2B54A 4CD0A 5AA8A 5EM6A 5JFXA 2R4BA 2XALA 2VWZA 4MH7A 3G5DA 3ZO1A 4BDAA 1FOTA 4J8NA 4ASZA 4I4FA 2RSVA 4G9CA 4IB1A 3SA0A 4KS7A 3E88A 3D7TA 4GYGA 3VS3A 4EOJA 4PQNA 5DPVA 5FP5A 3CP9A 2BZHB 3E3BX 1WBWA 4N0SA 3RPRA 3COHA 2EB2A 4CCUA 3ERKA 4E4XA 5FEEA 4O7RA 4IIRA 4QT1A 2DS1A 2CNQA 2F49A 5CU4A 3BE2A 4ZZOA 2CSNA 3VC4A 4BI0A 1GIIA 4MWHA 4QTEA 2O65A 4ALVA 3PY1A 2NNWB 3Q04A 4A4LA 3QZHA 3P0MA 2C47A 2VTSA 2ZB0A 1FPUA 4TRLA 3WF9A 3ZFYA 2CKOA 5M55A 3CGFA 3ULIA 3RPOA 3BHVA 3FZOA 3OF0A 2QHMA 5L2QA 4CYJA 4ANBA 3MESA 3BPRA 1ZXEA 3I0OA 2FB8A 4QP7A 4WOVA 3W1FA 2DQ7X 2BHHA 5ITAA 3OWPA 1BMKA 3QF9A 3EL7A 3HRFA 4GUEA 5JN2A 5CAQA 4E5WA 5L2SA 1W83A 4GS6A 4BBFA 3QTWA 3DY7A 1M17A 4O0YA 4QMNA 5HEZA 4YHFA 1URCA 3MY0A 2YJRA 2UZVA 4G6LA 4IZ7A 3R7OA 4XHKB 4E7WA 5EHLA 4XLVA 4F78A 2PE2A 3RZFA 2GS7A 3VO3A 4X21A 3WZEA 2FA2A 4BTMA 4BWKA 4L00A 4GV1A 3UO6A 3VUKA 5L8JA 3BGQA 4RIYB 1TFFA 3FMJA 4CFUA 3QD2B 2X6EA 3NFFB 3ITZA 3GCSA 4J7BA 3QHWA 3TN8A 3FC2A 5EOLA 4DA5A 5M08A 1JKKA 1PHKA 1UNLA 1WMKA 2CGWA 3EN6A 4KNBA 3IGOA 4KS8A 4E6CA 3A99A 3FWQA 4TYHB 3DK6A 5KBRA 3TDVA 4TYIA 3UNZA 4BCGA 4NZWB 4C4GA 4MQ2A 5BV3A 3COMA 5ANIA 3RM7A 2WMUA 3OROA 4AX8A 3MSSA 4IB3A 2JAMA 3ALOA 1A06A 3T3VA 2IVTA 3TUBA 3ANRA 2YJSA 5LVNA 5I9XA 4V01A 3I60A 2IW8A 4F6SA 3U55A 4RIXA 3IOPA 4J53A 5CT7A 5AP0A 3P08A 3CCNA 1B39A 3GCUA 5CI6A 3UDBA 4DHJA 2Z02A 4JR3A 4FL3A 2ZMCA 2GCDA 3C4FA 3OEZA 3GEQA 5GJFA 1Y6BA 2CCHA 2WD1A 3TG1A 3GQLA 5AP4A 1PW2A 2P4IA 2YIXA 3PJ2A 2V55A 3QUPA 4CFXA 4O4BB 1OKYA 5B2LA 5AX3A 2YWPA 4S33A 4U41A 3TNHA 4CZTA 4QMMA 4C58A 1YI3A 4I6QA 5E92A 3PJ3A 4RC3A 4ENXA 2GDOA 2YACA 3CQEA 4F9BA 2WQMA 3JS2A 3DZOA 3RHXA 3F7ZA 5HNGA 1KUTA 3C4ZA 2QOIA 3R00A 4IAFA 3F3VA 3NUXA 5L6WL 2C6LA 3MI9A 4HYSA 4ENYA 5BYYA 2VU3A 3FMNA 5HO7A 1FGKA 3MPMA 4E5BA 4NKAA 5L2TA 2XJ1A 3Q2JA 4K9YA 4S34A 2PUUA 4EWQA 3HGKA 4BGHA 2O0UA 1XWSA 3H0ZA 5TT7A 2RFEA 3SD0A 4LV5A 4ZXTA 3V8WA 4XV9A 4HYHA 3VBYA 3ZO3A 3UMXA 2VGOA 4G9RA 3QLFA 4FSYA 4IQ6A 4IMYA 2R3GA 2VTLA 4ZJVA 1PXJA 1Q3WA 3NRMA 4XP0A 3NS9A 5EW8A 3Q4UA 3WZKA 4PDOA 4AE9A 4EOMA 1ZZLA 4CFFA 4G5JA 3EKNA 3TIYA 3KIOC 3S00A 3W0PA 4XG4A 5TR6A 4CLJA 2QQ7A 4PDSA 4CKRA 4D5KA 1IA8A 2ITTA 4UMRA 4AZSA 3MY5A 5EFQA 5M4FA 3QTSA 1MP8A 4GU6A 4MHAA 4O2ZA 4QMUA 3U9NA 2PSQA 4PTGA 5AP7A 3H4JA 4DN5A 4BKYA 2ONLC 2V7AA 5F9EA 5K4JA 1Q61A 1PRYA 2VTJA 5CVFA 3OWLA 5L3AA 2WMQA 1BLXA 4C61A 2PUNA 2QOKA 5HTBA 4TYJA 2VTRA 4FIGA 2IO6A 1R3CA 3EQDA 3VVHA 1OB3A 1PXKA 4GIHA 2Y6OA 4YZDA 5AV3A 3CPCA 4D28A 4GG5A 3AT2A 3LFDA 5FQDC 4ACMA 4BDKA 4DEHA 5J7HA 3ZBXA 4IH8A 1GZKA 5KKRC 4OTGA 1MRVA 3FL5A 3BE9A 3BYMA 4HVGA 2OZAA 4W8EA 2CPKE 3EQPA 1ZY4A 3UO4A 4M0YA 3F7WA 2XNOA 3FY2A 4ZMEA 3RZBA 3LLAA 4O6EA 3UDTA 4H36A 4PL4A 2R3IA 4QD6A 3LCTA 3P7CA 3C4WA 5D1JA 3KXGA 4CZUA 2YN8A 4DINA 4FG8A 4O22A 1H01A 3MPAA 4GU9A 3TV7A 4DG2E 4FEUA 4XUFA 5HZNA 1CDKA 2R0IA 4JRNA 4LUEA 4Y73A 1OGYA 5H9BA 2WHBA 4EOQA 3EYHA 2XCHA 4BYJA 2VD5A 2YERA 4G3FA 5IKWA 1YDSE 4JT3A 1GJOA 3BU5A 4LQMA 5A14A 3UPZA 3D9VA 2BTSA 2C1BA 5LXMA 3E93A 1Q41A 3BV2A 5FWKK 3LFFA 4XP2A 2BZJA 2WOUA 2ZJWA 5J1VA 1QL6A 3W0SA 5LWMA 3L9MA 4ERKA 1M2QA 5CEOA 4DHIB 2VX1A 4YGAA 5E1SA 1YWVA 4YZBA 1E1XA 5IA1A 3VS7A 4UWCA 2W5HA 4ZZNA 4FT5A 5M4UA 4R77A 3RNIA 5DI1A 3PXRA 4JAIA 2VTHA 5CF5A 4ZTRA 2W99B 4EBWA 4USFA 5M07A 1QPDA 2X4ZA 4FOBA 2BRMA 3P7AA 4PDPA 2WQEA 3NSZA 4PNIA 2C5YA 2X1NA 5CU0A 3QRUA 3ULZA 4O1PA 3HMPA 4H05A 4O7TA 4FV0A 5A46A 1ZYLA 1OL7A 2QO7A 2VWBA 3F61A 2PPQA 2B4SB 3R7GA 3C4EA 3NNUA 4U79A 2HXQA 5DGZA 3COKA 5K9IA 4U8ZA 5EQYA 3A62A 4QO9A 4JG6A 4XG7A 4E6AA 5CEMA 2BROA 1J7LA 5D41A 2ZDUA 1ZOHA 2OK1A 2VRXA 4WNPA 3DFCB 1UU8A 1GNGA 4YJOA 4DTKA 1UKIA 1HCLA 3QKKA 1PXNA 3BLQA 3IW4A 1P4FA 3JXWA 3OCGA 3NYVA 4J71A 2W4JA 3OCBA 4RT7A 2BRGA 2JDTA 4S2ZA 2IZTA 4O0WA 2IVVA 4QDVA 4BCQA 3PYYA 3TTIA 2UZUE 5T68A 4O0SA 1XH9A 1Y91A 4FTLA 3TM0A 3WILA 3LQ5A 3TUCA 5HCZA 4PL5A 3DU8A 2JIVA 5DR9A 5GHVA 5EQPA 2I0EA 2VO6A 3GOPA 4S31A 4R5YA 3Q5ZA 4BI1A 4XYFA 4B8LA 5A6OA 5IH6A 4IX5A 4FT7A 4EC9A 2OFVA 3QCSA 3ORLA 2W1GA 3PLAE 4RJ4A 3IO7A 3WE8A 4G31A 2W9FB 4JDKA 4FTQA 4PV0A 3FSKA 4V0GA 5EM8A 4BWXA 1H24A 5KKRB 2X9EA 3CC6A 5IUGA 2PU8A 3DBDA 4IX3A 1LEZA 2QU5A 2V62A 5DHJA 5EYMA 3GGFA 4GFGA 4KD1A 5IMEA 5AP3A 3RGFA 3EKKA 2IVSA 3HYHA 4M97A 2WMAA 3DNDA 5FG8A 3Q4TA 2J0MB 4DE4A 3F88A 3PRIA 4TWOA 4E93A 1T46A 3EQCA 2VTMA 3DOGA 5EI2A 4B9DA 5FGKA 3DXQA 4U40A 4JIKA 4GL9A 3V6SA 2JKKA 4MF0A 4E3CA 3BZ3A 2J2IB 3DZQA 3KRJA 2P2IA 5FBNC 4NM7A 4Y5HA 1XH5A 3UE4A 3ZC6A 4WO5A 4S32A 2C69A 3A7JA 3KFAA 4C0TA 5LQFA 1J7UA 5CU6A 4P2KA 5ANDA 1VLRA 1OECA 3C7QA 3TEIA 4G3GA 4RWLA 3WI6A 3ZONA 4BR3A 1ZMVA 2ITOA 3ZBFA 3CGOA 4G1WA 1A48A 3U4UA 3SG9A 3HMOA 4DEGA 4EK8A 3PJ1A 4HVHA 2R3JA 3N4TA 3BEAA 2P0CA 5EQEA 3KXZA 3ANQA 1K2PA 2PVKA 4JX7A 4PUZA 4APCA 2JEDA 1ZY5A 3QRJA 3DKOA 5CSVA 3R9OA 2X39A 4L7FA 3WYXA 4EZ7A 2OI4X 2Y9QA 3OCSA 2W1CA 2PMLX 2BAJA 3PXQA 4IAYA 5HLPA 2PYWA 5FEDA 4CFMA 5E7RA 4QMPA 3LFSA 1RQQA 4EOLA 1XBAA 1G5SA 2JBPA 3R83A 4P7EA 2C6MA 2PY3A 1MUOA 5K0XA 4BHZA 4FKUA 4C3FA 2VTNA 3K2LA 4F0FA 1YOLA 4FSNA 1OUYA 1J7IA 3CY3A 4YZNA 4FTTA 3E8CA 4EQMA 3RCJA 4OTHA 4AFEA 5AAEA 4ZY5A 4JQEA 2W7XA 1SZMA 4QNYA 5J8IA 3RTPA 3VHEA 4XG8A 1WBPA 1KE6A 2RG5A 4BTKA 1M2PA 3NW7A 3NW6A 4YU2A 2QHNA 3BL7A 4KUJA 4FKGA 4IW0A 3VUHA 5JKGA 4AXCA 5GZAA 1SMHA 3LCKA 4HCVA 3A8WA 1PMNA 5IEYA 2X6DA 2BR1A 4ZTQA 4QMTA 2F7XE 5AR2A 4ZAUA 3H30A 5F94A 2W1EA 3A4PA 4OBQA 2PVMA 3FKNA 4FYNA 3KULA 4W4XA 4DEDA 2R3FA 2PL0A 3NVKI 3TTJA 2YIRA 3FMLA 4G16A 1SYKA 2VTPA 5FBOA 3F3TA 1U54B 4KKHA 2OO8X 5DRBA 4IWQA 4RZVA 4DGOA 3FZTA 5KZ0A 4E8AA 4EH9A 3WIGA 5CAUA 3CQUA 4BDDA 4DEBA 5I5ZA 3SV0A 3CJGA 1UVRA 3PP1A 3MBLA 3OCTA 4FMQA 3RK7A 4F1MA 4UY9A 5CNNA 2PZYA 3RBWA 5EYKA 3HMMA 1IASA 3TKIA 3FQHA 3U6IA 2F9GA 5IQBA 4GT4A 3DJ6A 4DHZA 3DCVA 5LARA 4R8QA 2XJ2A 3ID6C 2HOGA 4HJOA 4I23A 3UPXA 4ANNA 2C5XA 4OTFA 3ZYAA 3W8QA 2GNHA 4Q9ZA 2W1IA 4Y83A 3TL8A 3NUPA 4QP2A 3PJCA 5BVDA 3OWKA 2Y4IC 3HX4A 1KE9A 4FG7A 3FV8A 1IEPA 3F3UA 4XX9A 4C4IA 4DFUA 4K77A 5IDPA 4GT3A 4I0TA 4RFMA 4F7SA 4PNKA 4HGLA 3C13A 2R64A 3MVMA 3SRVA 4ASDA 2QD9A 3GP0A 4RC2A 4C3RA 2WTCA 4QEBA 3QC4A 4MTAA 4D2SA 3DTCA 1Q8YA 3IK3A 4YC3A 1FINA 1M7QA 5M4IA 4FSWA 3B8QA 4QTAA 1RJBA 4GJ3A 1JVPP 2JKQA 1JKLA 5LJJA 4O0TA 4F64A 4UMPA 3UO5A 3GU6A 3O8TA 3T9TA 3TV4A 4F70A 5E8WA 1PYXA 4J52A 3PUFC 3UP2A 5FTQA 2KULA 3P86A 3PSCA 4BIBA 2X0QA 4AOJA 5CQWA 2CN5A 4FSMA 3AKKA 5IH4A 3GU7A 5LMBA 2BRBA 4UMQA 4I1ZA 5T6KA 4D2WA 3F5GA 3L8XA 3AD5A 2VWUA 3Q9ZA 5BVOA 4HVIA 1FVRA 1BUHA 1ZOGA 2WEIA 3U54A 4IBMA 3UNKA 2QOLA 1XJDA 2PMNX 4FSUA 4NK9A 2QONA 4TWCA 4YTHA 3SXSA 5HX8A 4HPTE 2Z7LA 3ZUUA 4F9CA 3E8EA 1HCKA 3LXLA 4WSQA 4NYEA 4L3PA 3F2NA 4YC8A 4GKHA 3ENHA 5J79A 1UA2A 3OVVA 4IHPA 1CTPE 4G2FA 4NCTC 4BZDA 3OEFX 5BYZA 3W16A 1TZDA 4BCJA 3Q2MA 5CVHA 5AA9A 5I9YA 4AA5A 3BCEA 5TKDA 1YI4A 4E1ZA 1OL2A 3BV3A 2X7OA 3HMNA 4RIWA 2OLCA 2XK3A 4I3ZA 3EFLA 2QODA 5DR6A 2JITA 5GIOE 5IA4A 4I24A 5BVKA 3ZO2A 1WVXA 3TV6A 2C3KA 2YDIA 5CASA 3FHRA 3II5A 3NYOA 4I92A 3MIAA 5H8GA 2OJIA 3LCOA 3TNIA 2WXVA 4XLIA 2E9VA 1H26A 4UZDA 5CY3A 5CAOA 3IKAA 2VWWA 1Y6AA 3EYGA 2QKWB 4FV6A 3H0YA 3Q4ZA 1PXMA 5ETFA 3TZMA 3ZM4A 4EJNA 5IUHA 4DC2A 3IGGA 4AXDA 3GU8A 3CSVA 3RKBA 4ANQA 2X8IA 3MIYA 3MW1A 1PXIA 3LIJA 4AP7A 1X8BA 3CE3A 5EOBA 1K9AA 4LOPA 4MQ1A 5BQ0A 3QGYA 3DT1A 3EN4A 3I1AA 5T3QA 4DLJA 4FKSA 4X2NA 5HTIA 2Z60A 3F9NA 3OOGA 5AUYA 3MTLA 3B2WA 3QQLA 1DM2A 2A4LA 2F4JA 4EHVA 4F7LA 4F0GA 5IPJA 4FTKA 4EUUA 4OUCA 4BCFA 2WGJA 3ZMMA 4AS0A 4QPAA 2I0HA 2ITQA 2FVDA 1UU7A 5HIEA 1BL7A 2C3LA 4QTDA 4KKEA 2PE0A 2ERZE 5I9UA 3ZZEA 2HY0A 2B9IA 4RA5A 2YDKA 3VUGA 5DWRA 3ZUVA 5LVPA 1LP4A 3OT3A 2XK6A 3E87A 3BHUA 5B0XA 1WFCA 2BKKA 3VBTA 4RWJA 4L53A 4I5CA 3A2CA 3FI2A 5DT3A 2XA4A 4ZTMA 3V8SA 5D10A 3PXYA 4L46A 3O5AA 4PPBA 1IAHA 4QOXA 5C8MA 4W4YA 5HVKA 4XOZA 5IH5A 4ZY4A 3F6XA 2YCRA 3COIA 3W2PA 2CHLA 3NX8A 2I0VA 1ZRZA 2ITPA 4JDJA 4ZY6A 5ACBC 4AA0A 3T8OA 1OKVA 3R04A 1J1BA 2HW7A 3RK5A 2QCSA 3RCDA 4YJQA 3BU6A 3PP0A 1AGWA 1MQBA 4MD7E 4I6FA 5DVRA 3EFKA 1UNHA 3K3IA 4M69B 4WRSA 5HIDA 4FGBA 4HCUA 3RWPA 3QCQA 4CQGA 4MXOA 2IG7A 1GY3A 3ZCLA 4AXEA 3NFGB 2OXXA 5FTOA 1G8SA 2BIYA 4YUQA 3UOLA 2VNYA 5JRSA 3QX4A 2UW4A 4FNXA 3KL8A 4E73A 2O5KA 3S3IA 3E7VA 1WBTA 4U7ZA 3UJGA 4YJVA 2GNFA 2G2IA 3QHRA 5LMKA 4FKOA 4LM5A 4MXXA 4F9AA 4FTUA 3MYGA 2W06A 1JSVA 5HG5A 1JKTA 3RHKA 4AFJA 5A54A 3O71A 4FBXA 3W2SA 3SGCA 3PA4A 4WUAA 5E8UA 5D9HA 3FE3A 3C0GA 3FXWA 3PSDA 4WG4A 4BGQA 3SOAA 3KK8A 3OY1A 3TZ8A 3ZUTA 4AW2A 2PMOX 3IDCA 4MBLA 4FUXA 4H1JA 2A27A 1WVWA 3ACKA 4CT2A 5JH6A 3AT3A 1DS5A 4JI9A 3A61A 4BCOA 4RMZA 3K5VA 3FJQE 4MXAA 3DBFA 3R7EA 2QOCA 2R7BA 1YOJA 2YIYA 4NM3A 4O91A 3ZS5A 5I3RA 3BLAA 4AW5A 2C0TA 4A9RA 2EXMA 5AAFA 5M4CA 2X2MA 2Y7JA 3FSFA 3LPBA 4X2KA 4M0ZA 2EUFB 3F3WA 1PMEA 4NIFA 4BCKA 2XIZA 4R1YA 1BL6A 3HEGA 3TNQB 4ANSA 4BCPA 3TDWA 3E7OA 3IECA 3UOKA 2C6IA 1JNKA 4JMQA 5M53A 4EHZA 3Q4CA 3ZLYA 2OF2A 2QURA 4F7NA 3I5ZA 2BFXA 4I6BA 4XG3A 3V5PA 1SVHA 4NUSA 4DFLA 3ET7A 3C1XA 1OL1A 3DAKA 4CV9A 4OR5A 2OICA 4EUTA 3HA8A 3M11A 1VYWA 1G8KA 4P5QA 1BI8A 5KHXA 2VV9A 4LL5A 3FI8A 4I6LA 4HCTA 3PFQA 1H1WA 2ZAZA 4MK0A 4PWNA 4XCUA 2YHVA 4RX8A 3TMOA 4DG3E 5EW9A 2OW3A 2XCKA 4J96A 4HW7A 4WKQA 2VZ6A 4EK6A 2C0IA 3QRTA 4XEYA 1Q8TA 3HVCA 3LFNA 4AWIA 4FRFA 2XYUA 4O7NA 2FYSA 3DV3A 4GMYA 3CD8A 2X81A 4LDTA 4J97A 5HVYA 1CMKE 4DF3A 5KMLA 3FZ1A 3P5JC 3O7LB 4APPA 4M13A 3GCQA 4AZVA 4ID7A 3FMDA 2LGCA 1U59A 2BHEA 4CSVA 3GFEA 3SW7A 1PYEA 3I7BA 5CWZA 2W4OA 5CXHA 3RMFA 4NW6A 2PVYA 5FDXA 3F82A 4YURA 3EQHA 3MVJA 4L68A 5EHYA 4ANOA 2HAKA 3R1NA 3VHKA 3DTWA 4C33A 3ZOSA 4GCJA 3NNXA 4AGUA 3QALE 4OTQA 3B8RA 3O17A 2PZIA 3W8LA 4MKCA 4G3EA 2W96B 4MWIA 4ACCA 4YLJA 3UVPA 3W0OA 4F1OA 4LV8A 4GVJA 5IMXA 4UMTA 2PVLA 3L8SA 5LOHA 3LE6A 1R0EA 5C9CA 3DB6A 4YP8A 4B6LA 2EXCX 3UC4A 4CMUA 4PPAA 1M7NA 2JAVA 4D1ZA 4EH4A 3PZHA 4BDFA 3KB7A 4L44A 3F69A 2ZV2A 1R0PA 3C4XA 4TNDA 2GNIA 4EBVA 3LVPA 2I7QA 3I6UA 5KE0A 4CNHA 2WB8A 4DGGA 3D7ZA 2B0QA 2XEZA 3QTUA 4HZRA 4CFWA 5CENA 2J0LA 4B7TA 2WTVA 2QOOA 4QP6A 4JIAA 4MAOA 4YPDA 2C6DA 3R73A 4BFMA 3BX5A 1PKGA 2P2HA 3OXIA 5ANOA 4CT1A 4U6RA 3TI1A 4BIEA 2FH9A 1LUFA 3V3VA 1YOMA 4O84A 2YITA 2X0PA 4QPSA 4FTNA 1LPUA 4TPTA 5EYCA 3VW6A 2RFDA 3IW8A 4KAOA 2UZEA 4O0VA 3D2KA 3NGAA 4UZHA 2XUUA 4M8TA 3A7IA 5ANEA 3D5XA 3QLGA 3LOKA 3TNWA 4H3BA 2ONLA 4JS8A 2WO6A 4MXZA 4O2PA 4MD8E 4PMTA 2YCFA 3IPHA 5IQFA 4MNEB 1JQHA 5FUTA 4DH1A 4UN0C 1KE8A 2XNBA 3FMEA 5TOZA 3K54A 1H1SA 5AV4A 1IA9A 2VWXA 5IQAA 1P5EA 3OHTA 5DT4A 4RVKA 3TKUA 4YMJA 2H34A 3I4BA 3PVBA 2Y8OA 5DEYA 4YTIA 3NPCA 3OY3A 3R8PA 2PZPA 3BWFA 3SVVA 1OBGA 2XARA 2WU7A 5L8LA 4CG8A 2B1PA 4TN6A 2OU7A 3U4WA 1TQPA 2EB3A 3BQCA 2G15A 4UWYA 4IVCA 3ZEWA 5D7VA 4XNEA 3LM0A 3AOXA 4ALUA 4AGWA 5JFVA 4QMXA 2QG7A 2OIBA 4CYIA 3Q60A 1YQJA 3OXTA 5KNJA 3NDMA 1IR3A 1TQIA 4K11A 4KWPA 5H2UA 5JGAA 2CKQA 1VZOA 2R3QA 4D0WA 2OKRA 3OD6X 5HG8A 4WG3A 3EN7A 3A4OX 3L9NA 2XVDA 4XH6A 3ZLSA 1JBPE 5HIBA 2YLFA 1KE5A 3PXKA 2RFNA 4MF1A 4DFNA 5CAPA 5AR8A 2UZBA 3ROCA 3VS1A 2ITWA 4CKJA 4YJPA 4O21A 4BI2A 2OWBA 4BYIA 2JFMA 2W05A 1YWRA 3CKXA 3OC1A 4YO6A 5DMZA 5C4LA 3EQGA 3FLWA 5CF6A 5IZFA 5IDNA 5HE3A 4DCEA 4FKTA 5KMIA 1JLUE 4E6QA 3WE4A 5CEIA 4U0IA 1L3RE 1XH6A 5E8XA 1YDTE 4R7BA 3MFUA 3ZDUA 2WMVA 3JPVA 2R0UA 3CY2A 1W7HA 3ZRKA 2DUVA 2J0IA 2OSCA 3O23A 3PSBA 2RGPA 4LUDA 3H3CA 3MH1A 4FTMA 4J99A 3ATTA 3EOCA 5AP5A 1R1WA 3G2FA 4A4XA 4KB8A 4HZSA 5JGDA 3W18A 1CKJA 2IW9A 1G8AA 3FLYA 3AC4A 3V6RA 5HLWA 5IF1A 5GIPE 4RVMA 4FV3A 2XBAA 4W9WA 3SAYA 2CLQA 4AZFA 4EOIA 3G9LX 3QWJA 4BIDA 5AM7A 5I4NA 2HW6A 1V0PA 4L3LA 5BPYA 4EQCA 3Q3BA 4O4EA 3LAUA 4YC6A 2ZV8A 4FSZA 3QC9A 5CX9A 2GPHA 1JOWB 1WCCA 4FTRA 4M15A 3VQUA 5IEXA 3GCVA 5EHOA 2OGVA 4R3RA 3UVRA 2ETMA 5JK3A 3D7TB 4CQEA 3GQIA 4BBEA 4JBQA 5DOSA 4TZRA 5ETIA 5IA2A 4GK2A 2CCIA 3BBTB 4AW0A 5LCJA 4X2FA 4BKZA 1UV5A 4XRJA 2XRWA 4FTAA 4K0YA 2YLEA 5DFPA 4CKIA 4EKKA 3W2QA 4QMSA 1YI6A 3VS6A 2RF9A 4C59A 1FVVA 1XQZA 4LOQA 3ODYX 4GT5A 5HD7A 3QUEA 4UX9A 1OGUA 4OBPA 3KF4A 4RX5A 3ZLWA 1PXLA 3QQKA 5D12A 2OIQA 5J5SA 4BDEA 3OW3A 3Q9WA 4F6WA 4IC7A 3DDPA 3P79A 3UG1A 1J91A 4MVFA 4W4WA 3RINA 4EYJA 4B4LA 4FIHA 3PFYA 5F4NA