5L2SA

The x-ray co-crystal structure of human cdk6 and abemaciclib.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
263
Chain Sequence
b'QQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVPLSTIREVAVLRHLETFEHPNVVRLFDVCTKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLAVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 6
publication title Spectrum and Degree of CDK Drug Interactions Predicts Clinical Performance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 263
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l2sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l2sA01
1V1KA 4B9DA 3NGAA 3I6WA 4AZSA 1YVJA 1H08A 2R0UA 3CP9A 4JIKA 4YPDA 5AV3A 3SC1A 2ETMA 4J99A 4AGWA 4YJQA 3MY5A 3R30A 4O96A 4WNKA 3WZKA 5EM8A 2WQEA 3RPRA 3N4TA 4DAWA 3MYGA 2GPHA 3E88A 4RVLA 1G8AA 4ZXTA 2QR7A 3ZU7A 4DLJA 5ETAA 5M08A 4W4WA 3SW4A 5AA8A 3F88A 3LJ2A 4JXFA 4RWJA 4B8MA 5E4HA 4BY9E 3FI3A 4XG8A 4ZTNA 5ANEA 4M8TA 2W1IA 1KE8A 3VULA 2CKOA 5FLFA 3QD4A 3F3UA 3VBXA 2VTQA 4FG7A 2FVDA 3T9IA 3ZM4A 4WKQA 4ZY5A 5FWKK 2QC6A 3V8TA 1XQZA 2VUWA 5TKDA 1H0WA 1Q61A 3RZFA 5AUVA 3TIYA 4IVBA 3WBLA 4U5JA 3QRKA 1A48A 4I0TA 5DBXA 3HVCA 4RJ6A 4O38A 4XP2A 3VC4A 4AFJA 4E6CA 3UNKA 5F9EA 2C69A 3KK9A 4ZZOA 1ZAOA 1H00A 4IE9A 3E3PA 3W8QA 4HW7A 4YC8A 4S32A 4EH8A 5CF8A 5KMLA 4EOJA 4Y73A 3A60A 3IS5A 4MWIA 5AUXA 4EYMA 4F70A 4ZLZA 2BVAA 4IC8A 4L00A 1BI7A 3V3VA 3GP0A 4QP6A 1I44A 4V05A 4YC3A 4R6VA 3QQJA 2HIWA 4JIAA 5L2QA 4E1ZA 5CANA 2IZUA 3DZOA 4GEOA 4E6DA 3KVXA 4F7LA 2YABA 1VR2A 2AC3A 3EL7A 4ANMA 4LMNA 4XOZA 5HD7A 1UKHA 4J53A 4XV3A 4HVHA 4AU8A 3NRMA 2WQNA 5T3QA 3E7VA 4F6UA 3O7LB 5LQFA 3N4UA 3EFJA 1IEPA 3OWLA 4G2FA 4FYNA 2PUNA 2W1GA 4WOVA 5EDPA 5AR5A 3SRVB 4AT5A 5ANKA 5EHLA 3SQQA 3R8UA 4IB0A 5D11A 5HE2A 5M51A 3K5VA 4MKCA 4ZY4A 2W96B 3FHRA 4TKSA 2ZOQA 3VW8A 2ZV8A 4H3PA 3V5QA 2IJMA 2Q0NA 4FV5A 3RMFA 4YUQA 3P7CA 5JRQA 3AC5A 1OL2A 4AFEA 5AIKA 3VS0A 3QKMA 2Y0AA 1Y91A 3EFWA 4S30A 5LMAA 5CENA 3V6RA 5J79A 3FI8A 3POOA 4EKLA 3BHUA 4YJPA 1PYXA 2VGOA 4V0GB 4IDVA 1WVXA 3SW7A 4ENYA 4RX9A 3C0IA 2CPKE 4M69A 3A4PA 4EJ7A 3D5WA 4XNEA 5BNJA 4IH8A 5FGKA 4MX9A 1TKIA 3FI4A 2ZM3A 3OY3A 4HNFA 4I24A 4XMOA 3ZO3A 2O64A 4AOIA 5DE2A 2ZB1A 3AMYA 3B8RA 4ARKA 3FV8A 4JDIA 4CTCA 2GFSA 3G2FA 5F4NA 1U54B 3R8VA 4QTEA 4IQ6A 2YCQA 3O17A 1H26A 4CCUA 5J95A 3OOGA 3TV6A 2BRMA 3FBVA 4O1PA 4RLLA 3TJDA 2OBJA 3TXOA 4G3GA 5DHJA 1OL6A 4RVMA 3HX4A 4MBIA 4RGJA 4GU9A 3AC4A 4C7TA 5C03A 3S00A 4PP9A 3K54A 2PSQA 3EQIA 3FZOA 1QMZA 3DAKA 4D4YA 1OZ1A 2JDTA 3NYOA 4FVQA 3ET7A 3KY2A 1YXXA 2OZOA 3PRFA 4KRCA 4A9TA 5FEQA 3OUKA 2NP8A 3IW4A 4RIWA 4ITHA 3UOHA 1BYGA 1Y6BA 2J5EA 4N6YA 4NW5A 1Z5MA 5AMNA 3CD3A 4A4OA 4M12A 3F66A 4WBBB 3T8OA 1Q5KA 2VN9A 4MBJA 1UU9A 4R77A 4PL3A 4XS2A 2HW7A 1PXKA 3FMDA 3OOMA 4P4CA 3R00A 3R8LA 1IG1A 1OI9A 2QI8A 3FMEA 4FTQA 2OXYA 4DEEA 1H25A 4BCHA 1ZMWA 3RKBA 4PP7A 4UXLA 4X6QC 3D7TB 5G1XA 2X9EA 4MXZA 4RA5A 3PXRA 3BIZA 2YEXA 4NTTA 4YNOA 2V62A 4QRCA 5AR3A 5CEMA 5TOZA 5JZJA 1BI8A 4R3RA 2QOIA 5JMSA 3U87A 5AFVA 4WG3A 3NUAA 2J9MA 4YHFA 4C4GA 5LMKC 1M14A 3A7JA 3PA4A 4MYGA 4UB7A 1HCLA 3LCOA 5EG3A 4MHAA 3SHEA 2IVUA 3D9VA 3LFEA 3QHWA 3U55A 4P7EA 1WVYA 3VUKA 5JGDA 3GCVA 2HXQA 4LFIA 4PY1A 5JGBA 1MP8A 4X0MA 4IEBA 3HP2A 3I4BA 1PXMA 2OIBA 3BBWA 4LUEA 2WQMA 2X4ZA 4X2FA 3A8XA 3LXKA 3UO4A 4BWPA 1OIQA 2DUVA 4IX6A 4JRVA 4ZSLA 2QOKA 4QMSA 3M2WA 2Z7QA 5AR4A 4FV3A 3NWWA 4D4SA 5EQEA 3LFAA 2EXMA 3S0OA 3EKKA 2PVHA 3MS9A 5IH5A 4L43A 2R3QA 3UG2A 1KUTA 2YFXA 2QO7A 3BU3A 2XK9A 3A62A 3OXIA 3ZS5A 4ACDA 2VWVA 3PVUA 2XVDA 3ZUTA 2Z7SA 4JT3A 2GFCA 2WD1A 3FLZA 5IEXA 1FVTA 5IA2A 5M4FA 2EB2A 3POZA 4NJ3A 5HBJA 3PSDA 1PKDA 3GCPA 2W4KA 3A7HA 3QTXA 5K3YA 4ANOA 3K5UA 3IG7A 4HGEA 1LEZA 4JI9A 4XV1A 1DI8A 3Q9WA 4BI0A 2W9ZB 3PTGA 3EN4A 3Q52A 3RZBA 3V01A 3EB0A 2OIDA 3KK8A 5KMOA 4QP4A 4J96A 4YHJA 2OFVA 4QMWA 3F82A 3BZ3A 5FM2A 3PLAE 2YWPA 4LMUA 3DKFA 5GHVA 5AP0A 2R9SA 2ZDTA 3JYAA 5LVNA 4IIRA 2PTKA 5ACBC 3LHJA 5DRDA 5H2UA 1OL7A 5JKGA 4F0IA 3BV3A 3ERKA 2GDOA 5DPVA 5F1ZA 1UVRA 3C0GA 2C1BA 2OJGA 4HYSA 3BU6A 1ZYCA 5HCZA 2I0HA 3OEZA 4DCEA 5LCJA 5DRBA 3QXPA 4L7FA 2ITOA 3BHHA 3DXNA 4FZFB 4RZVA 4U8ZA 3CKXA 5A4CA 5IPJA 2GU8A 4C2VA 3Q9XA 4KRDA 4QYGA 4U6RA 4TL0A 3HV6A 3L9NA 4BBMA 1WFCA 5IUGA 3MFUA 3BE9A 4A9SA 2E9VA 1H24A 1OMWA 3QA8A 5HHWA 1U4DA 4RJ3A 4QP7A 4FKTA 5DA3A 2CMWA 2V22A 1JWHA 1DAWA 2OJIA 1CKJA 1OL5A 3LCTA 3NAYA 3QQGA 4Q5HA 3RWPA 2W99B 2QHMA 3ZLWA 4BCFA 5LCKA 5IA3A 3D15A 3MPMA 2PVKA 2GHLA 4GSBA 4DBXA 3QX4A 4NW6A 2BRBA 4XRLA 4PL5A 2OJJA 1KOAA 4BCMA 3OTUA 4FSRA 2VTRA 4FSYA 5AM7A 1NW1A 2R3IA 1SYKA 5LVMA 4QMTA 2BAJA 2HW6A 4RQVA 2AUHA 3CS9A 4PPBA 4OBOA 4GYGA 4AX8A 2C3LA 2C6KA 3LFCA 5ETIA 3EZRA 3LJ0A 5AAFA 1PJKA 3VS7A 3TCPA 4F9CA 3F5PA 3I6UA 1ZOHA 1PMVA 2F2CB 1QPCA 3AXWA 4QP3A 3UOJA 4L67A 4LI5A 4XUFA 3OG7A 5ANIA 5KZIA 1BX6A 3FI2A 2Z7RA 4GKHA 2X8IA 3R7GA 5E1SA 4YMJA 5IQBA 5IQDA 5CF6A 1U5RA 3QRTA 2OF4A 2XYUA 3ALOA 3QD3A 3KMMA 4MNEB 4D0XA 4Z16A 3Q9ZA 4BFMA 3UZPA 5BMMA 4O7YA 4P2KA 5J9ZA 4A9YA 5IMEA 2J2IB 2B0QA 4FI1A 3FZRA 4H1MA 4IAZA 4IVDA 3U6HA 2GQRA 5AV0A 4LG4A 3UIBA 5ICPA 3MVJA 3RAIA 3NNXA 2ERKA 3P5KA 5EYCA 4ZSAA 2IW6A 3C13A 4ORKA 1ZOGA 4FYOA 3W2OA 3F3WA 4OTWA 4Y8DA 5KZ0A 3OFMA 5H8EA 2VZ6A 3EYHA 4FV8A 4BCIA 3HA8A 4Q9SA 3NNUA 4AP7A 4O7RA 5DLSA 3MH0A 4E5AX 4ENXA 4F1MA 3PXQA 3KRXA 3F61A 4H36A 4QQCA 4O7ZA 4QTDA 5LVOA 2BDFA 2WGJA 2Z60A 3R2BA 4DFBA 3BGPA 2JDSA 5HO6A 4D4VA 2HZNA 3EN7A 3PVWA 2Q83A 2PE2A 2VWWA 3NUYA 3ORXA 4AA0A 5JT2A 2J0IA 5ANDA 3LXNA 2HOGA 5J5SA 2P2IA 3ZRLA 1YI6A 3EH9A 2QOBA 2PVMA 2Q0BA 5D10A 4YU2A 3MPTA 2CN5A 2YCSA 5EYKA 2UZDA 2JFMA 3COHA 4GG7A 4RA4A 4Z7GA 1T46A 4G5JA 1YXTA 5C4LA 4D2PA 2YAKA 4OTGA 1W82A 1XH4A 4QMOA 3COMA 1GZKA 2BFXA 2CKEA 5I9WA 3C7QA 2PUIA 3UQGA 3GXLA 3DBFA 5BUJA 4A06A 1QPEA 2A0CX 4AW0A 5KMJA 4BIDA 4DH8A 5IDPA 4N0SA 3P1AA 5DEYA 4RC3A 2EU9A 5E8UA 3LCDA 5BPYA 4B6LA 2WIPA 4LQMA 3PY3A 5HGIA 5BMSA 3KN6A 4LYNA 4D2VA 3DKOA 3VS2A 1JQHA 1VYWA 1WBOA 4L68A 2V55A 2PMIA 2QR8A 5CU3A 4KKEA 4BDFA 4V04A 1GNGA 4G9RA 1PXIA 4L01A 1RW8A 4G6NA 5CTPA 5EK7A 5LXMA 2UVYA 1WBPA 4LM5A 2YM6A 3KQ7A 5FDXA 2JEDA 2C4GA 5HNBA 3ZLXA 3QTQA 5HE3A 3DNDA 4CZTA 5HOAA 5EKOA 4EL9A 4BDJA 1O6YA 4YJVA 3RWQA 3OCSA 4DFNA 2YM5A 3ZM9A 2YWVA 5BUIA 3EQCA 3FLQA 4QMXA 5AIRA 2XKCA 4FODA 2CN8A 2I0YA 2RIOA 4BKYA 4C58A 5BVFA 4J7BA 2BKKA 4YHTA 2PVRA 4JDJA 4U41A 4FKVA 5EFQA 3MH2A 3QGWA 4I20A 4TNBA 3VS6A 5KMIA 1J7UA 3RAHA 3LMIA 4IB3A 4CT1A 3UPZA 3FQHA 4DN5A 2ITUA 4NU1A 3WYYA 2RFSA 4J71A 4F65A 2ESMA 4ZLYA 2OG8A 3UODA 3QZIA 2W06A 4GYIA 4U43A 2BDJA 5EI8A 5HCXA 4FV6A 3GU5A 3ZRMA 2VTLA 2UZNA 3CTHA 2UW9A 4WSYA 3R1QA 5KX8A 5DR9A 3DFCB 5TE0A 2RKUA 4NCTC 5HBHA 3NLBA 2WMUA 2OWBA 3O8TA 3E62A 4XV9A 3CEKA 3EWHA 3AOXA 4O27B 3PXYA 4O7WA 2BROA 1OBGA 2QLQA 3RI1A 4GT5A 2B9JA 4LRJA 2H9VA 2XIXA 1ZXEA 4QMUA 4NKAA 5CEIA 4XRJA 4HVGA 1UNGA 5A4LA 4HGTA 4O1OA 4R1VA 2X6DA 2WAJA 4C4JA 3GOPA 4TYHA 4GVAA 3GCQA 4KS8A 3W2RA 1KOBA 5DG5A 2DWBA 3NZ0A 3EQBA 4RRVA 3FEGA 2WQBA 2GTNA 3O71A 1BUHA 4YTIA 4NWMA 4U9AA 2YZLA 4CFMA 4EHEA 2ZJWA 4C3RA 3JVSA 5FQDC 3NIZA 4FEVA 4BHNA 2VWZA 2J4ZA 2V7OA 2YCFA 3QC9A 2F9GA 3P23A 4M69B 3DB6A 1Y57A 5L2SA 1OPLA 3KF4A 1ND4A 4MAOA 2R3LA 4F0GA 4AUAA 1XH8A 2WTIA 3Q9YA 4O7VA 2UW7A 3MJ1A 4G3DA 2PULA 3WF9A 2QD9A 2H34A 3ENMA 1FMOE 5FTOA 3KVWA 4BWXA 5CU6A 1YWNA 1PY5A 5T6KA 3QTSA 2B52A 4C38A 3PFQA 2NO3A 2PE0A 3HV3A 2IW8A 3FPMA 5KCVA 2V5QA 3GI3A 4PWNA 3LFNA 3BQRA 3MESA 3SG8A 4C02A 4I22A 3EQFA 4LOPA 2BIYA 5EI6A 2YACA 2E9NA 4WSQA 3L9LA 3WF6A 4EH4A 4ZY6A 4DFYA 4NSTA 4MF0A 4FIGA 2VO7A 2H6DA 1M2RA 5DEWA 4E4NA 2VNYA 5BVDA 1KSWA 5HI2A 4D1SA 3HGKA 4I0SA 2E9PA 3ZEWA 4UYAA 4RIWB 2A19B 3QQHA 3Q96A 3DV3A 4YZDA 3U51A 4EZ5A 4ZAUA 4O0WA 3IOPA 3FXWA 4EBWA 4LOOA 2FUMA 3P0MA 4I3ZA 3ZTXA 2F7EE 4C3PA 4M14A 4ZSJA 3TKHA 4GJ3A 4JBVA 3F7WA 5L4QA 5K4JA 3KRLA 3PDTA 1OM1A 2H8HA 2UVXA 3BYMA 2LAVA 3QZGA 2ZV9A 3BQCA 5CQWA 4JX7A 2HK5A 2VO6A 3KRWA 1SVGA 4RT7A 4AZEA 1JSVA 2R7IA 2ITNA 3NSZA 3Q3BA 4MCVA 4CV9A 4DFUA 4AOJA 2RFNA 1WAKA 1OIUA 3R21A 2UW0A 4PMTA 1GZOA 1RDQE 1H27A 2C47A 4JVGA 3QQLA 4MH7A 3LJ1A 5AR7A 3UYTA 4UEUA 4BCQA 4ZTHA 3FKOA 3L1SA 4C61A 2BZIB 4XX9A 3Q4ZA 3TTJA 5GINE 4BF2A 3CQUA 3AG9A 3VS1A 2J0JA 5ANOA 3WZUA 3SG9A 4CVAA 2G2IA 1HOWA 5M4CA 2PMOX 3IGOA 3PPZA 4QQJA 3R04A 4O0VA 4CSVA 3LQ5A 4FE2A 2VTOA 3TV7A 4LGDA 4GIHA 2YN8A 5E8SA 3R9NA 4JQEA 4YC6A 4KKHA 2GHMA 4FSZA 2XKEA 3PJ3A 4MXCA 5IUIA 3VO3A 3W2PA 3TTIA 2Z7LA 4H05A 2VRXA 5DVRA 2HZ4A 3BGQA 2PUUA 2BZKB 4LUDA 5GNKA 3C4ZA 4UWBA 3CGOA 1V0BA 3ANRA 4MD7E 4ZJIA 5I9XA 5LVPA 4BRXA 4DEHA 3WILA 3KL8A 3PRIA 1ZYSA 5M4IA 4UWYA 3BE2A 3NX8A 3HMOA 1IA8A 4XYFA 3RPYA 2WOTA 4FIHA 4BR3A 4RLKA 3E87A 4CRLA 4IAAA 5E91A 5CAVA 1UU7A 4FTLA 4X7QA 5I3RA 3MVMA 5JFVA 4GT4A 2ETRA 3MIYA 4NTSA 4QMZA 4UBAA 5DOSA 5TF9A 4H3QA 1PMUA 4HPUE 2JC6A 4NM5A 3C4CA 3V51A 5C8MA 2XF0A 3FLYA 3QFVA 2C5VA 1WBVA 3NPCA 4IX5A 4F1TA 2P2HA 2CJMA 4BGGA 1XO2B 4R3PA 1FINA 4AGCA 3U4WA 3ZDUA 4A4XA 1H4LA 3CIKA 4OLIA 2OXDA 5EI2A 3LFBA 1SNXA 1CMKE 1OKZA 4FUYA 2R2PA 3GEQA 4M3QA 5FTQA 4ASZA 2BRHA 1JKLA 4RZWA 2CNUA 4FICA 2OK1A 2F4JA 2RL5A 3KGAA 2UVZA 2RFDA 1P4OA 4FUXA 4IC7A 5HNGA 4F4PA 4BTMA 5HNIX 4EHGA 1JLUE 3FSFA 3V8SA 1ERKA 5HCYA 4TYIA 4E7WA 1GY3A 4JDHA 4NM7A 3EQPA 5AAGA 3VQHA 2YIRA 4GG5A 5I9VA 2AC5A 2B9FA 3F5UA 2QKRA 5D41A 2BTSA 4FTNA 4QTCA 2X2KA 4FKJA 3Q4UA 2E9OA 4DYMA 1TVOA 2SRCA 2B4SB 2PUPA 2VO3A 5AV4A 3DK7A 3IW5A 5HD4A 2QOCA 4JLCA 4EWHA 2RGPA 3GQLA 4GW8A 4P5QA 4CRSA 1CTPE 3RJCA 3ZZEA 3TIZA 3UC3A 2CKPA 4QMNA 4MD9E 2PZ5A 2VX3A 4F7NA 1MRVA 2W1DA 2X4FA 3OT3A 4A07A 3WARA 4F1OA 3BYSA 3D7ZA 2C5YA 4BCPA 3R28A 2C6MA 3DLZA 4YJSA 3RAKA 2OLCA 3COIA 4EC8A 3F69A 2IO6A 4LOQA 5IUHA 4M66A 4YLJA 4BICA 2XJ2A 5FM3A 1H1SA 3ZYAA 2XYNA 1SMHA 2CCHA 4EZ3A 1FGKA 2C3JA 1M17A 5HTIA 3C1XA 5KMNA 3SD0A 3ELJA 4K6ZA 1FOTA 3R2YA 5TR6A 3ZFYA 3TUDA 4Y95A 5JFXA 4L3LA 2X2LA 5L8LA 3U4UA 4EOMA 2VTNA 5FXSA 4O86A 2ETKA 5GZ9A 4IAFA 5K5NA 4E4XA 4U97A 3WIKA 5C4KA 3C5UA 1YI4A 4HJOA 3HRCA 4QP8A 3QCYA 4EOSA 4MBLA 4MK0A 3A99A 2BZHB 3G51A 3LM0A 3NW5A 1G3NA 2XNEA 4IWQA 2WB8A 3VHEA 4F9WA 3SA0A 4FV2A 3A61A 4HYHA 4AA5A 1JKTA 1JSUA 4I6FA 4I1ZA 3PJCA 5AP1A 5CAPA 4II5A 4C62A 4YJTA 4H1JA 3KXHA 5A14A 2CLXA 4GUBA 4MWHA 3L8SA 4FV9A 4B99A 1H1QA 4UXQA 4CMUA 4MQ1A 4DEIA 5C1QB 2OI4X 4ZTSA 5L8JA 4EOOA 4HVDA 1ZZ2A 3R73A 2CHLA 3AC8A 5KUPA 3UO5A 4FTJA 2OF2A 4BB4A 3FC2A 2R64A 3DDPA 5AUZA 3OP5A 3IOKA 5M4UA 3WF5A 3DA6A 4AE9A 5A6NA 3PVGA 3P7AA 3UTOA 2B53A 1XWSA 1GZ8A 4AZWA 4J98A 2VWUA 4GH2A 2QOFA 3OBJA 4JR7A 5AUTA 4M0ZA 3UOKA 1H1WA 3CQEA 3V5TA 4BYJA 3S2PA 3LLTA 5K4IA 4XP0A 5DWRA 4IXPA 3V5WA 2CNVA 2VTHA 3DBCA 4IACA 2WEIA 3MTFA 5CU4A 1OKWA 4DTAA 4U81A 4UX9A 3AGLA 4EONA 4X6RA 4QYHA 3IONA 5KHXA 2ITPA 4IM0A 4FKGA 4M97A 3CPBA 3RPOA 3VRZA 1RJBA 2J0KA 5HG9A 4F64A 4L8MA 3N51A 3ENHA 3UZTA 5IZFA 5GJDA 2YIYA 3QX2A 3UBDA 4O7NA 3FL5A 3DTCA 3KFAA 2BKZA 3IDPA 3A8WA 3FHIA 4FSUA 2YIWA 2GCDA 2J0LA 3CPCA 3QUEA 4DEDA 4FZ7A 4O91A 5E90A 3RM6A 1MQBA 3QUDA 5EW9A 5BVWA 3ID6C 3LQ8A 4PTCA 3DB8A 2XBAA 4Y83A 4ID7A 2XKFA 3WI6A 5CAOA 3M1SA 3W33A 3ROCA 2O0UA 2OH4A 2Y6MA 3EN9A 3GU6A 4QD6A 4ZMEA 5IQHA 4LL5A 4KIPA 3QTUA 4KA3A 4MXAA 5HVKA 4TT7A 3HV4A 4FSMA 3I7BA 3R0TA 1M7QA 4PMSA 3MH1A 3TNWA 4AQCA 3QQKA 3HDMA 4QT1A 5JQ8A 4ANLA 2UZLA 3TNHA 5E9EA 3ZC6A 4NFNA 2OJFE 2QU5A 2V7AA 1YXSA 4BCKA 5M57A 2KTYA 3PWYA 4WRGA 3V5LA 2UZVA 5K0KA 3Q6UA 2W0JA 4U0IA 4YLKA 1Z9XA 3CCNA 1DI9A 4E4MA 5JH6A 2PVYA 3FWQA 5T68A 3VJNA 2EXCX 3OVVA 3E93A 4QYFA 3P08A 5L6PA 4FEXA 1J7LA 3VS3A 4ACMA 5LOHA 4MEDA 4XHKB 5D1JA 3UMWA 5H8BA 4CXAA 3Q32A 4BWKA 2P55A 2GS6A 2UW6A 2P3GX 3TACA 4O2PA 3W55A 2XK7A 2PZIA 4TW9A 2EB3A 2Y7JA 2JKKA 4CD0A 3FXXA 3TDWA 1PMNA 2JIUA 4ALUA 3Q5IA 1URCA 3NCZA 3PIYA 5FTGA 4S31A 5CEKA 4DGLC 3D4QA 4I5CA 4C59A 3C0HA 4FEWA 3MI9A 4OTDA 4R5SA 3LFDA 5AWMA 4AN9A 2CCIA 4RC4A 1XH5A 5AADA 2I7QA 2JDRA 4YNEA 2FO0A 1VZOA 2O2UA 2VGPA 2UV2A 2W1EA 3PJ1A 3FMKA 3GOKA 2E9UA 3M42A 1F3MC 3PJ2A 4TYHB 1M2PA 1OPJA 3F3VA 4FVPA 4ZTRA 5HIBA 4FTRA 3VBWA 4BKJA 2P4IA 5AP5A 3BYVA 4IWOA 4C37A 3UOLA 1XH7A 4FTUA 2BHEA 2C6OA 4FV0A 5EOLA 3RCJA 4FGRA 4KIOA 5KHWA 3MIAA 5CT0A 4GIIA 3QRJA 4YO4A 2FYSA 4FSNA 4ZS0A 4OT6A 3QZFA 2UZEA 4G5PA 1V0OA 4XBRA 2HENA 3EOCA 4MVFA 4PNKA 3DK6A 1A9UA 3C4WA 4KB8A 4BN1A 5IQIA 3DBDA 3QALE 4GVJA 4Y5HA 4DEBA 3ZOSA 4Y5QA 2DYLA 4GJ2A 4JAIA 4QYEA 3N4VA 5CSPA 4D5KA 4DH3A 5JK3A 4WRSA 4TWCA 3RBWA 2I40A 4O7TA 1F0QA 3HLLA 3ETAA 3ZSGA 1KV1A 4KIQA 4EK5A 3R01A 1P5EA 4FT5A 3UIMA 3EKNA 3F2AA 3HUBA 3BKBA 1QPJA 3DAJA 4MF1A 3NYXA 2OFUA 3F7ZA 1PXNA 3PXFA 3RK9A 2XZSA 4F0FA 4WUAA 4FNXA 4BDKA 3HMNA 3IKAA 2BDWA 4I23A 4O81A 4A9UA 2BALA 4OTPA 5CY3A 4AN3A 3H0ZA 5IU2A 2OIQA 2C3IB 1V0PA 3C5IA 4OTQA 3RHXA 2WXVA 1WCCA 2QOLA 3DJ7A 4QP2A 3CJGA 2VV9A 2GHGA 3PWDA 4FZ6A 5HIEA 2XNGA 3QHRA 2QU6A 4K8AA 4QMMA 3NW7A 2ACXA 4U3ZA 2R7BA 3FZTA 2RG6A 2W05A 5CZHA 4EZ7A 1LPUA 4CLJA 3IECA 4KWPA 3JUHA 5BVEA 1IA9A 2J90A 2VAGA 4EH5A 2G1TA 4I4EA 4MXOA 4WD5A 3AC3A 5I9YA 4TYGA 3RP9A 2C0OA 3QTWA 2BHHA 4AE6A 2C1AA 3DFAA 3OZ6A 4JX3A 5CSXA 4ERWA 3AD6A 3VF9A 2P0CA 4ALWA 5KBRA 1UV5A 3W18A 3KXNA 3TNPC 3ALNA 3LXLA 4USDA 4FV7A 3F5GA 4F08A 4C33A 4UWCA 4U40A 3MVLA 4EOPA 5D12A 4BCGA 3GBZA 3EFKA 4EKKA 3DDQA 3U9CA 2BRNA 4BGHA 1OPKA 3JY0A 3G6GA 3LAUA 4F6SA 4G1WA 2WPAA 4BCOA 3RGFA 2G9XA 2C0TA 3VAPA 2QOHA 3W32A 1YDTE 2RFEA 1FGIA 1MRUA 3LPBA 2ZV7A 3MB6A 2O5KA 2J0MB 4UYNA 2PMNX 1H8FA 3L8PA 2WU6A 3QXOA 4MTAA 4CV8A 2RF9A 3BCEA 3PXZA 4QPSA 4Z9LA 3PY1A 2OGVA 4AZTA 2GQSA 3BLQA 1Q3WA 5FXRA 4M15A 3W1FA 1QCFA 3DCVA 2ITQA 2WTWA 3ORPA 4PDYA 5IQFA 4HCTA 3VS5A 2JLDA 3OUNB 4EI4A 1OITA 3FLNC 5DIAA 3TEIA 1GAGA 4Y46A 3UNZA 2XBJA 4EQCA 3RHKA 3SX9A 2Y6OA 5DR2A 2NRUA 4CFXA 5L3AA 4NH1A 3NEWA 1CM8A 4YJUA 4TZRA 1Q8YA 3FUPA 2ITWA 3UVRA 5E8ZA 4TXCA 3OXZA 4AOTA 4BBEA 3BU5A 4GFMA 2B1PA 5DH3A 5CXZA 4GV1A 5L2WA 5CZIA 4M68A 1YDSE 3MBLA 5IA4A 2WTKB 4FG8A 3CTJA 4QPMA 5AP3A 1W98A 5BVNA 3MJ2A 3EQDA 1YDRE 4IAKA 5F94A 4IJPA 3U6JA 3JVRA 1WBWA 4FMQA 3LCKA 4FEUA 2WTKC 4QMLA 5A3XA 4GL9A 3WYXA 3E5AA 1YXUA 3GC0A 5ITAA 2JBPA 2XM8A 5CNNA 2PWLA 3LXPA 4L3JA 2O3PA 1PXJA 3B2TA 2YM4A 3KCFA 3O23A 2QVSE 4Y85A 4BTKA 4XG9A 3ZRKA 1I09A 3CJFA 3QA0A 4RMZA 4TNDA 1Q8WA 2YM8A 3QYZA 4AN2A 5IA1A 1J1BA 5BYLA 4B8LA 4Z7HA 3GFEA 2C30A 3WF8A 3PP1A 4H3BA 3SGCA 4PDOA 3DK3A 4S33A 1K2PA 2A1AB 4BDAA 4FOCA 4EUUA 3ZO4A 1SNUA 3G9LX 1KE5A 2IZTA 2RG5A 5E1EA 2ITVA 1ZYLA 4O7SA 2VTSA 4FKIA 5CEPA 5CS6A 4OTHA 3KKVA 5AP4A 4I6QA 4ZS4A 2W9FB 3UO6A 3EQRA 4CT2A 1SVHA 4DFLA 3R8MA 3CY2A 1NT2A 2PZPA 2YDIA 3C4FA 4G31A 4PL4A 3QC4A 5HZNA 5AUUA 3F3TA 3C51A 1DAYA 2QOQA 2BIKB 4OGRA 2ZMCA 4BTJA 3R7OA 3FAAA 3OHTA 5FP5A 3R7UA 3UP2A 4A7CA 4YTHA 3EZVA 3Q2MA 4XG4A 1FMKA 2PZRA 2X2MA 1H0VA 2PL0A 3UIUA 4EK3A 1STCE 3BPRA 1Y8GA 1SM2A 2FSLX 4G16A 3DBEA 4LGGA 3S4QA 1WMKA 2WMAA 4CG9A 3QL8A 4FNWA 3PZHA 2OKRA 2VNWA 5I5ZA 4HGLA 4ANBA 5M07A 4FIFA 3CC6A 2CGXA 1B6CB 2V0DA 3I1AA 4X3FA 3VW6A 5A4EA 2XEZA 4DA5A 3HMIA 3AT4A 3RPSA 5GIPE 3PVBA 2UW8A 3PSCA 4NFMA 3R1NA 4FX3A 4DH7A 4WNMA 2VTIA 2VWXA 4L6QA 2XNOA 2FGIA 3ACKA 3GQIA 4JR3A 1LR4A 3PE2A 3Q53A 5CF5A 2ZMDA 3QTZA 3ZFMA 3OT8A 3OTVA 3DKGA 3VBYA 5DYJA 4DG0E 4CFFA 4AT3A 5HG7A 2QODA 3GCSA 3DXQA 3HRFA 4FTKA 3OWPA 1KWPA 1PXLA 5IKWA 5IQAA 3G15A 3LFFA 4AA4A 4PTGA 2X7FA 5BYZA 4DBNA 3CSVA 4L46A 1R3CA 4JOAA 5M06A 1OECA 2JIVA 3LZBA 2VTAA 4DTBA 1FPUA 3DQXA 4D2TA 2YAAA 3CLYA 3D83A 3MN3A 3R1YA 4D1ZA 4LV5A 3K3IA 5IA0A 4OUCA 3NUXA 5DNRA 2C6DA 1FQ1B 3MDYA 4BIBA 5L6OA 2XKDA 3OC1A 5B0XA 5FXQA 1WBNA 4O82A 2W5BA 1R39A 5CEOA 3GGFA 4O0SA 3LW0A 5JSMA 4F63A 5K9IA 2ITTA 2W7XA 2Y4IB 3I5ZA 2EXEA 4C36A 3FMJA 3NNVA 3IK3A 4C35A 2XK4A 1F5QA 2Z8CA 3GC8A 3O7LD 5IG1A 3D5UA 2XK8A 3U9NA 4FZDB 3O2MA 1O6KA 4X2GA 5IEYA 4RIXB 3FY0A 3A2CA 4USEA 2YZAA 4M0YA 5AX9A 1ZZLA 3DQWA 1YOJA 4R7IA 5L2IA 4C4HA 4CYIA 3ZONA 4G3FA 1W83A 2Y8OA 4RWIA 4QTBA 3OBGA 3EQHA 2JFLA 1O6LA 2XIKA 3FYJX 3PE1A 3UQFA 4YJRA 1UNLA 3MPAA 5EHYA 5KE0A 3FMNA 5DN3A 4OTRA 5CT7A 4KS7A 5EQPA 2OZAA 2VX1A 4O0RA 5DFPA 4S34A 4ASEA 3R7YA 1E1XA 2IVVA 3I79A 3QCXA 5DMZA 5HG5A 3UVPA 4C4EA 4ZTLA 3FMMA 4Q2AA 3I7CA 4OAUC 4BZDA 3F6XA 4EHZA 2XM9A 4DFXE 4AXAA 5HLNA 1UA2A 2X8EA 5HICA 4UZHA 4YZBA 4XP3A 4U80A 1TQIA 3QRUA 3BLRA 4F9YA 2OSCA 4FV1A 2UW4A 4BL1A 2DS1A 3HKOA 1KE6A 5HESA 5JQ5A 3FLSA 2X6EA 1Q24A 1XH9A 3OWJA 4UV0A 5EQYA 3UMXA 4CKRA 3SOCA 4KIKA 3L9MA 3R63A 2HWPA 4YTFA 5E7RA 4AGDA 3W10A 4EC9A 1A06A 3BEAA 3FJQE 2WOUA 4FKOA 4J8MA 5CSVA 3PSBA 3VQUA 4E3CA 2ZVAA 1OKVA 4ZLOA 4FTMA 2HWOA 3MFSA 2X81A 2VWYA 1REKA 1YI3A 3OXTA 5D7AA 4YGAA 5AX3A 5C9CA 5HIDA 3ZZWA 3D5XA 5F20A 4RWLA 3AC2A 1PYEA 4D55A 3NAXA 5A4TA 4NIFA 2FSMX 4G3CA 4RG0A 3RALA 4BDIA 2PVJA 5IMXA 4KBKA 4HPTE 4EEVA 4F09A 2YM3A 4IANA 4DLIA 2YITA 2FSOX 4CG8A 3C4EA 2OW3A 4FL1A 3AD5A 2BAKA 2R0IA 3DJ6A 5BUEA 4EORA 3E63A 2JITA 3G0FA 2FSTX 1DM2A 4V01A 3BWFA 4RQKA 1JBPE 5HBEA 3NUUA 3WZJA 3MSSA 5I4NA 1YHVA 5CI6A 2G01A 5JFSA 1M52A 1QPDA 1ZY5A 1APME 4D58A 4U3YA 3P4KA 3P86A 4Q5EA 4E6QA 4N4SA 4EK6A 1LUFA 3FZ1A 4XBUA 3PIZA 5F95A 4PRJA 5DT4A 3FC1X 4EJNA 1YQJA 3IW6A 2BFYA 3WZDA 3Q5ZA 3PY0A 2GNHA 4E93A 4C57A 4C8BA 2PPQA 2W4OA 1H01A 4UMRA 3D94A 3BELA 3HAMA 3RK7A 2O8YA 4C34A 3PA5A 1XKKA 4ZTQA 3LQ3A 4Z3VA 4EYJA 1ZARA 2VWIA 4QMQA 3KRRA 2UZTA 3R6XA 5E8YA 5FEEA 2R3FA 4O0XA 5JRSA 4KD1A 3ZSIA 2H96A 4YSJA 4XG2A 5L2TA 4JG7A 4NEUA 3W2SA 1CKIA 4ZP5A 1ZY4A 2B9HA 4USFA 3ZUUA 3D0EA 4DT8A 1Q3DA 3F2NA 4GCJA 3TL8A 4I93A 3HYHA 4CZUA 3GC7A 2HCKA 3SAYA 3DKCA 4GFGA 3ORZA 3TV4A 4AAAA 4CNHA 5FDPA 4O84A 3MA3A 3UIXA 2CKQA 2HZIA 4JBQA 3ODYX 3UJGA 4QPAA 3UGCA 3JR1A 1MRYA 1XBAA 2C6LA 4QMVA 4TRLA 3E3BX 2R3OA 1GJOA 4IHPA 3E8DA 4IMYA 4DG2E 1Q41A 3H30A 4I21A 4IZ7A 5M56A 3H9FA 3KN5A 3GUBA 4FR4A 2X8DA 3R71A 5BQ0A 3MA6A 2PY3A 1URWA 4GS6A 4JAJA 5EM5A 5EH0A 5GJFA 3TZMA 3MW1A 1WZYA 4H39A 1QL6A 3AGMA 4QNYA 3QLGA 4KUJA 3F3ZA 1RE8A 3KXMA 4NT4A 5EYDA 3ZBFA 2I1MA 3PP0A 4XH6A 1TQMA 5AUWA 4AWIA 4DTKA 4ZJJA 2BPMA 2YDKA 3H9RA 3WIGA 5HG8A 4DE4A 4CKIA 5ACKA 4G17A 4R1YA 3R8PA 3VRYA 4AW5A 5IA5A 3S3IA 4YTCA 1GIJA 4C3FA 3V5JA 2VO0A 4OTFA 3SLSA 1SZMA 1AQ1A 3RVGA 3R1SA 5AV2A 5B2MA 4QP9A 1YOMA 1W7HA 2GNLA 2XB7A 3BX5A 3TNQB 3D2IA 5M44A 1Q99A 3A7FA 3TZ9A 2HY0A 4XLVA 5FP6A 4YBKA 3ZLSA 3KB7A 3MV5A 3R7VA 3ULIA 5J9LA 4ASXA 2GQGA 3NNWA 4X2NA 4FKWA 1ZYJA 4FOBA 4IM3A 2GS2A 3HUCA 4RC2A 4XLIA 4TYJA 3UG1A 4F9BA 3NIEA 1H07A 4NK9A 3ZHPC 4HCUA 3EN5A 1OUYA 4BYIA 4D9UA 4WUNA 3LLAA 1IRKA 5CYIA 4QQTA 3QTRA 3R9RA 1J7IA 2WEVA 3NUNA 2C6IA 5TT7A 3QCSA 1YOLA 1AGWA 3FPQA 4HZRA 5D9HA 4X2JA 5ETCA 3IDCA 4Z55A 4ZMFA 3NDMA 5CASA 5EM6A 5AUYA 3VJOA 4M67A 2GTMA 1XHAA 4IDTA 5EHOA 4NM0A 3R9OA 4F7JA 4FC0A 4DT9A 1W84A 2YA9A 1IAJA 2WO6A 4CFVA 1UU8A 3KCKA 3U54A 3AD4A 3AT2A 2XNNA 2VTMA 3ORTA 4AZFA 3CGFA 3LM5A 1H1RA 2W1ZA 4O7LA 4CZYB 1PRYA 4FZAB 4P5ZA 4JL9A 3HMPA 4DITA 3QWJA 2XNPA 3QBNA 3VUHA 4MQ2A 3AC1A 4IAIA 2OXXA 2YERA 2QO2A 2WQOA 4K9YA 5AA9A 4UMTA 5IF1A 5HTBA 5E8WA 4W9XA 4L53A 4A4LA 2C5NA 1JAMA 1O9UA 3G33A 5CEQA 3VIDA 4WNOA 3W8LA 4F9AA 3H3CA 4O83A 4WG4A 5HVYA 4D0WA 4F7SA 1BKXA 3G5DA 4U44A 5EKNA 3PZEA 5C01A 4RIYA 3NS9A 4PMPA 5CF4A 4NCTA 5J9YA 2W1CA 4I6HA 2F2UA 3UP7A 4CLIA 3OMVA 1Q4LA 4WO5A 4YSMA 4FIJA 1VEBA 4C4FA 3UYSA 2GSFA 3HP5A 4G6LA 4U7ZA 3I5NA 4WT6A 4BI1A 5J7BA 4A9RA 2R3RA 3LFSA 3CD8A 5FEDA 1L8TA 3IW8A 3C50A 4RIXA 4ACGA 3P79A 3LCSA 3CBLA 4FKQA 4BCJA 4WIHA 5AR2A 4KSQA 4XOYA 3ITZA 2ONLA 5I9UA 1YRPA 4OW8A 3UC4A 2ZB0A 4IX3A 4RX8A 5E8TA 2P33A 4PMMA 2HAKA 3THBA 3VBTA 1R78A 3PYYA 4ASDA 4BGQA 3REPA 3VBVA 5BYYA 4L44A 2NPQA 4FT0A 3VWAA 3OW4A 5M53A 1NY3A 1S9IA 2F7XE 3E8EA 4I6BA 1J1CA 3TUBA 5LVLA 3R8ZA 4CGAA 3LIJA 2XK6A 4AT4A 1CSNA 5IDNA 4YPSA 3D2KA 5A46A 4W4YA 2YIQA 3CY3A 3NUPA 5DGZA 1ZMUA 4AG8A 4J95A 3ZSHA 3CTQA 2QG5A 2BCJA 2R5TA 5CSHA 3IGGA 3G0EA 2REIA 3ODZX 4EHVA 3R9DA 1Q8ZA 3V8WA 4W9WA 3H0YA 3GC9A 4IFGA 3V04A 3LKMA 4XV2A 3BHTA 3DTWA 3LMHA 2F57A 2BILB 2PMLX 3E64A 4HVSA 4AACA 3G90X 3SXSA 4KINA 3KU2A 2R3NA 2FB8A 4U79A 2ZV2A 1IR3A 3JPVA 4I0RA 4ZIMA 4X3FB 4D2SA 3NVKI 3V5PA 5C8KA 3NW6A 5L6WL 5JGAA 3DS6A 3TZ8A 4APCA 1ZLTA 2C6TA 2O65A 4BDHA 4ITJA 5IH4A 2UZUE 4FKSA 3RINA 2VTTA 4TTHB 4D2WA 2WU7A 4X3FC 4OR5A 3C4XA 5EW8A 3TN8A 3TDVA 3ZBXA 4CKJA 3LMGA 1FVRA 4BVUA 3FLWA 1YWVA 3O51A 3Q2JA 2JKQA 2QHNA 1R0PA 5ANJA 3MH3A 3GENA 3RK5A 3SKCA 4EOIA 4FTCA 3HV5A 3U6IA 4FL3A 4ZSGA 3MY1A 3TWJA 4TWOA 3WF7A 1OBDA 4ERKA 3HAVA 4DFZE 4XEYA 1K9AA 2C0IA 1ZRZA 2E2BA 3FZPA 3QAME 3VUDA 1Y6AA 2GNGA 3DAEA 3LFQA 4OT5A 2ITZA 4PDPA 3BEGA 4QNAA 3C9WA 3TNIA 5CVFA 4EOQA 1YKRA 1XH6A 2IWIA 4CCBA 2EUFB 1Y8YA 4CQEA 4GK4A 3RCDA 2IZRA 5KBQA 2PK9A 5AP7A 3SDJA 3VUIA 3GNIB 3IQ7A 4RFYA 1EH4A 1GOLA 3P9JA 4HCVA 4D5HA 3PPKA 4B7TA 4ZZNA 3DT1A 2OH0E 5J5TA 3QLFA 4LGHA 1WBSA 1W0XC 2PHKA 4QMYA 4E8AA 3BGZA 3WE8A 3KMUA 4KABA 3OD6X 5CSWA 2VX0A 4FSTA 4FTAA 2XNBA 2QQ7A 4FKLA 1IAHA 2XK3A 4YR8A 4FA2A 2WNTA 3BYUA 3DGKA 4ZZMA 4NZWB 2HXLA 3BI6A 2WKMA 3B8QA 4CYJA 4O22A 4AW2A 2Y4PA 4OAVB 4KBAA 2XIZA 3DZQA 5CVGA 4FNZA 2X39A 1ZOEA 2IVTA 1G5SA 4FSWA 5CI7A 4E73A 1ZYDA 4N70A 4IZYA 2JAMA 2WFYA 3NYVA 4KKGA 4L52A 3ULZA 4QP1A 1SVEA 2UZWE 3GFWA 5B7VA 4MXXA 4FT3A 2FH9A 1HCKA 1YW2A 3DXPA 1U5QA 2UZBA 3HECA 4O0TA 2X7OA 4CEGA 4GRBA 5AAEA 4X3JA 2WMVA 3K3JA 3NR9A 5M55A 1UKIA 4AS0A 4B4LA 5AEPA 2OZAB 3HEGA 2PE1A 3NUSA 4KNBA 3NCGA 3AMBA 3PIXA 3KULA 4FGBA 4NUSA 4BZNA 5J1WA 5KO1A 3FDNA 4PF4A 4YZCA 4IFCA 2C68A 1REJA 1X8BA 3RNIA 4FT9A 3IPHA 4JQ7A 2WTDA 4YURA 2ITYA 3FZSA 3KXXA 4UY9A 3D14A 2R3MA 3OW3A 3MB7A 2XEYA 1OIYA 3T3VA 4DINA 4ZTMA 3DU8A 4ACCA 2G2HA 1CDKA 3FMHA 5IH6A 5CALA 3R22A 3FY2A 3M11A 5J87A 3WZEA 2W5AA 4LL0A 5HO8A 2PVNA 4KIKB 4BDCA 4RJ4A 1VYZA 3RNYA 2XIYA 4K2RA 3UPXA 4GKIA 2RSVA 3GU7A 4I4FA 2WMXA 4DGOA 4DGGA 5M09A 4RJ7A 3PJ8A 4HVIA 1H28A 3ZUVA 4RVTA 5HKMA 3LVPA 4BZOA 4IM2A 4ZOGA 5LMBA 5IQGA 4C2WA 1LP4A 3ZO2A 3GVUA 1OGUA 4AGUA 4EH7A 3F2RA 4EOLA 2W4JA 4RPVA 4NIFB 4APPA 4G3EA 2EWAA 3IDBA 3D5VA 4HOKA 5AJQA 1BMKA 2WIHA 2YISA 1FBNA 1MQ4A 3FSKA 3AQVA 4IAYA 5AR8A 4IW0A 4FSQA 2XH5A 4IB5A 3KREA 1BL7A 1PKGA 2W17A 3ORKA 2Z2WA 4BI2A 1WVWA 4L9IA 5IISA 5IQCA 2W5HA 2J5FA 2WMWA 3BBTB 4M13A 4OTIA 3IO7A 3JY9A 1JKSA 1YHWA 5FBOA 2C5OA 3EHAA 5GZAA 1T45A 3EN6A 4JBPA 4N6ZA 2CNQA 4W8EA 4GFOA 5D7VA 1NA7A 2JBOA 4CMTA 2QLUA 2XP2A 3PG3A 4RFMA 4EK8A 4DH5A 4PV0A 1Q62A 3K2LA 3QQFA 4BTFA 3TUCA 4J1RA 5LJJA 3H9OA 3O0GA 4E4LA 2B55A 4TY1A 4PPAA 2Y9QA 3O96A 1PHKA 1E1VA 1WBTA 2VTPA 3HA6A 4L45A 3QKLA 3AT3A 4ZSEA 2A2AA 4NYEA 4FF8A 3OCGA 3FQSA 3Q4CA 5CU0A 4GT3A 5LWNA 2PVFA 2NRYA 3DNEA 3HV7A 4QMPA 4I5HA 2J50A 4TWPA 3BHVA 3A7GA 2JDVA 5HX8A 3HL7A 4K18A 4HYUA 4W8DA 2R3HA 2I0EA 2QNJA 3L9PA 1OB3A 4ANSA 2JIIA 2UW5A 4R3CA 3W16A 2B7AA 4BCNA 3Q04A 2HY81 3H10A 3SXFA 2X1NA 4F99A 3NVMB 4L3PA 1Q97A 2GNIA 1YXVA 3ROYA 4DG3E 3UZRA 5CAQA 3TM0A 4WBOA 4J97A 5GJGA 3G6HA 1Q8TA 3ZC5A 2XCKA 4EK4A 3TI1A 3ZLYA 4EQUA 4JBOA 5KNJA 2JAVA 2QOOA 5I3OA 4ALVA 3I60A 2WMRA 2A4LA 1FVVA 4K33A 4PDSA 2J51A 3MVHA 3S95A 3W2CA 2WHBA 4IVAA 4BC6A 4GMYA 5B2KA 1AD5A 1XBCA 3VUGA 2F7ZE 4PX6A 4ZK5A 3R7IA 3MGYA 4HNIA 4N57A 3S1HA 4EH3A 4UZDA 4CFWA 3DPKA 2G15A 5H9BA 4O6LA 4FKRA 4C0TA 5E8VA 5H3QA 1OL1A 4RX7A 4EH2A 3DJ5A 4IWDA 4M84A 4X2KA 4EWQA 5CQUA 1BLXA 3TZ7A 4D9TA 3GU4A 3NMUF 3JS2A 4YJNA 5K0XA 3OS3A 3II5A 2WZJA 2GNFA 4AZVA 1PXPA 1S9JA 3UDBA 3ZCLA 4G6OA 3UQCA 4YZNA 3SRVA 3E7OA 4TYEA 3VHKA 2BUJA 5TO8A 2KULA 3QWKA 4D28A 2WTVA 4XG6A 1XJDA 3ORMA 5FUTA 3FQEA 4U42A 4DGMA 3PPJA 4DC2A 1YHSA 2C5XA 3ANQA 1J3HA 2BAQA 3KEXA 3EJ1A 2OO8X 5ANGA 4UMPA 3LE6A 2BMCA 4KAOA 2BRGA 3KRJA 4K77A 3WE4A 2WMQA 4Y72A 4V0GA 4C4IA 4ITIA 3ACJA 2WMSA 4BDGA 2IVSA 4ANQA 3RAWA 2AYPA 2YJRA 3H4JA 4K0YA 2PVLA 1U46A 4MNFA 3QD2B 1UWHA 2XJ0A 5A4QA 5L8KA 2LGCA 1JPAA 4FIIA 2X7GA 2DQ7X 2ZM1A 3BV2A 5A54A 2R4BA 5FD2A 5KMMA 3VN9A 3GU8A 1XR1A 5EW3A 4CMOA 3GCUA 1U54A 4OBPA 5CAUA 2UUEA 3OCBA 4FBXA 3CXWA 3MY0A 4MXYA 3CKWA 4QQ5A 3B2WA 5HLWA 4L7SA 3IW7A 3FYKX 2OICA 3ZFXA 3HNGA 4FV4A 4HGSA 5KMKA 5FRIA 3EMGA 4GU6A 4YO6A 1JSTA 1P14A 3FMLA 1XBBA 3P78A 3R83A 3MTLA 3Q60A 4U45A 4EH9A 4EOKA 2HELA 3P7BA 5JZNA 1Q8UA 3T9TA 3ZDIA 4DH1A 2WTJA 4PNIA 2HYYA 4FTIA 1OIRA 4KBCA 4XJ0A 2YLFA 3TKIA 4DEGA 2GNJA 2G2FA 3OEFX 2JGZA 3BLHA 3OROA 4IZ5A 4LRKA 4O6EA 1L3RE 4JQ8A 5DI1A 3UE4A 4E26A 1G8SA 5C26A 4GK3A 3U8WA 3SVVA 2IG7A 4RIOA 4BKZA 4QO9A 4NJDA 2X0GA 4O21A 4F6WA 4E5WA 5HORA 1NVRA 4HYIA 2XIRA 4XCUA 4Q9ZA 4QOXA 5EDRA 3HDNA 3AMAA 4RVKA 5HU9A 4L42A 4RJ5A 4TWNA 2ERZE 3ZO1A 3PXKA 3V6SA 4RIYB 5AP2A 4XG7A 2HZ0A 3D7TA 3EIDA 3F5XA 3FKNA 4J8NA 4IX4A 1E9HA 3TT0A 4FG9A 3PUPA 5LMKA 4LRMA 4OBQA 3TKUA 2B54A 2BTRA 2O63A 1DS5A 2QCSA 2QURA 3BRBA 4UMQA 5HU3A 3Q4TA 3PG1A 5GZ8A 1NVQA 2CGVA 5DR6A 4WNPA 5HQ0A 2FA2A 2Y4IC 2YDJA 1ATPE 3F9NA 3BYOA 3L8XA 2WTCA 4NKSA 5AV1A 4E6AA 2IZSA 3FL4A 4QYYA 3I81A 5AP6A 2ITXA 3QGYA 5HE0A 5EDQA 5C27A 1GIHA 2VTJA 3ZXTA 1UU3A 4EH6A 1H1PA 1CKPA 1TQPA 2WMTA 3COKA 5EOBA 2I6LA 4PTEA 4FT7A 4P90A 1KV2A 2ONLC 4JG8A 3SOAA 4AF3A 4X21A 4CQGA 1OKYA 3PLSA 5BX0A 2W1HA 1UNHA 4DCAA 1JNKA 4EBVA 2CDZA 1NVSA 4S2ZA 4D2RA 5JEBA 1B38A 4RX5A 4RWKA 1M7NA 2QONA 2QO9A 4RJ8A 3FXZA 3R7EA 4DF3A 4FK3A 2J7TA 5HX6A 2J6MA 4KSPA 3O8PA 4H58A 3BHYA 4I41A 4FTTA 4YLLA 4FIEA 2GS7A 3QKKA 3ATSA 3FKLA 2IN6A 2YCRA 3KXGA 3HZTA 5HO7A 1RQQA 3VBQA 4EQMA 2XJ1A 1GIIA 2XRWA 3VUTA 4R7BA 4PQNA 3UVQA 4CFUA 1R0EA 4FKPA 4FKUA 4PPCA 4O2ZA 5JFWA 5IEVA 1M2QA 2QKWB 1UWJA 3T3UA 3UNJA 4I94A 3I0QA 1MUOA 4BBFA 4BDDA 3N9XA 3QZHA 5CVHA 2Z02A 4I5PA 4E5BA 5EM7A 1BL6A 2R3PA 3EL8A 2YHVA 2B9IA 4RBLA 2XMYA 3O8UA 4WA9A 5FBNC 4MD8E 2CGUA 3WOWA 1PW2A 2UZOA 3LOKA 4UMUA 1OUKA 2C6EA 2VU3A 3DLSA 4IZAA 4FVRA 3ZH8A 2GMXA 3E8CA 1PF8A 2F49A 4R7HA 4RFZA 2IPXA 4E20A 1J91A 2W1FA 1P4FA 2YLEA 5K5XA 3CQWA 4J52A 3GT8A 3R02A 5HLPA 3RTPA 4UN0C 3A7IA 2ZYBA 4JDKA 3MFRA 1LEWA 3JXWA 5HE1A 3TG1A 3KF7A 2ZAZA 4K11A 5J8IA 5A6OA 3EYGA 4M7IA 3OCTA 2ZM4A 1GZNA 3VF8A 2A27A 4FNYA 2R3GA 3DOGA 2PYWA 4UALA 5LWMA 3RM7A 2OU7A 5BVOA 3R9HA 2UW3A 1YWRA 3HMMA 3BWJA 3QD0A 2PZYA 1K3AA 5A9UA 3KMWA 5BVKA 3I0OA 3DY7A 2XCHA 4O0YA 3QU0A 4JJRA 3ATTA 1JVPP 1PXOA 2BZJA 2R3JA 4JNWA 3EFLA 4RSSA 2JKOA 2EVAA 3ORNA 3QQUA 2YJSA 2WELA 3QRIA 3HRBA 3VS4A 3MWUA 3KA0A 5HTCA 2I0VA 3OF0A 3Q6WA 4I5MA 4K1BA 4W4VA 4BDBA 2PU8A 3DBQA 5HVJA 4ZJVA 4CFNA 3ORIA 4FTOA 2C3KA 4EUTA 5CX9A 4B0GA 4YBJA 3A4OX 2XRUA 3SV0A 4IWPA 1VJYA 4BIEA 2OJ9A 2JD5A 4O0UA 3O50A 4IB1A 2VD5A 2XS0A 4DHFA 5C8NA 3QCQA 1ZMVA 2ZDUA 3NYNA 5E92A 2CSNA 3KXZA 5EYMA 4BDEA 1KE9A 5CNOA 4R78A 4MNEA 4IJ9A 4BHZA 2XA4A 1Z57A 3KULB 5JN2A 4QTAA 1OVEA 4I92A 5GIOE 5H8GA 4TPTA 4G34A 4GK2A 3TJCA 2X9FA 4JS8A 4D1XA 5HEZA 1JOWB 1U59A 5J1VA 3RPVA 4NL0A 3OWKA 3CE3A 4NM3A 5FG8A 2XUUA 1JKKA 3VNTA 3L8VA 3QF9A 3ZXZA 4XG3A 1IASA 3E8NA 4FK6A 4AW1A 4ANNA 4TN6A 1W8CA 4IVCA 3VUMA 4IBMA 1R1WA 1NXKA 4IADA 3OY1A 4JG6A 5B2LA 5DT3A 3KC3A 5CXHA 3EQGA 4CTBA 5CU2A 5LARA 3E92A 4G9CA 4R5YA 4WG5A 5J7HA 4ACHA 2VWBA 3W2QA 3MFTA 1ZWSA 5I0BA 4YP8A 3G9NA 3QYWA 2JDOA 4HZSA 2WMBA 2JKMA 4ONAA 4LV8A 4W4XA 4D4RA 4DEAA 2CGWA 3PA3A 1PMEA 3QUPA 4PUZA 4ZEGA 5DT0A 5KKRB 4YZMA 4FL2A 4WHZA 1P2AA 3ZMMA 3GB2A 2R3KA 5CLPA 3SXRA 2BR1A 3QTIA 3CR0A 3FE3A 4YZ9A 5G6VA 4YJOA 2NNWB 4GUEA 1B39A 1KE7A 5CWZA 5KKRC 2YM7A 3ORLA 5ETFA 3ZEPA 3VVHA 2QG7A 4R8QA 2IW9A 5I9ZA 4JRNA 5AM6A 4DGNA 5IQEA 5E8XA 4FEQA 2YIXA 2CLQA 2XNMA
chains in the Genus database with same CATH superfamily
1V1KA 4B9DA 3NGAA 3I6WA 4AZSA 1YVJA 1H08A 2R0UA 3CP9A 4JIKA 4YPDA 5AV3A 3SC1A 2ETMA 4J99A 4AGWA 4YJQA 3MY5A 3R30A 4O96A 4WNKA 3WZKA 5EM8A 2WQEA 3RPRA 3N4TA 4DAWA 3MYGA 2GPHA 3E88A 4RVLA 1G8AA 4ZXTA 2QR7A 3ZU7A 4DLJA 5ETAA 5M08A 4W4WA 3SW4A 5AA8A 3F88A 3LJ2A 4JXFA 4RWJA 4B8MA 5E4HA 4BY9E 3FI3A 4XG8A 4ZTNA 5ANEA 4M8TA 2W1IA 1KE8A 3VULA 2CKOA 5FLFA 3QD4A 3F3UA 3VBXA 2VTQA 4FG7A 2FVDA 3T9IA 3ZM4A 4WKQA 4ZY5A 3PUFC 5FWKK 2QC6A 3V8TA 1XQZA 2VUWA 5TKDA 1H0WA 1Q61A 3RZFA 5AUVA 3TIYA 4IVBA 3WBLA 4U5JA 2XANA 3QRKA 1A48A 4I0TA 5DBXA 3HVCA 4RJ6A 4O38A 4XP2A 3VC4A 4AFJA 4E6CA 3UNKA 5F9EA 2C69A 3KK9A 4ZZOA 1ZAOA 1H00A 4IE9A 3E3PA 3W8QA 4HW7A 4YC8A 4S32A 4EH8A 5CF8A 5KMLA 4EOJA 4Y73A 3A60A 3IS5A 4MWIA 5AUXA 4EYMA 4F70A 4ZLZA 2BVAA 4IC8A 4L00A 3ML1A 1BI7A 3V3VA 3GP0A 4QP6A 1I44A 4V05A 4YC3A 4R6VA 3QQJA 2HIWA 4JIAA 5L2QA 4E1ZA 5CANA 2IZUA 3DZOA 4GEOA 4E6DA 3KVXA 4F7LA 2YABA 1VR2A 2AC3A 3EL7A 4ANMA 4LMNA 4XOZA 5HD7A 1UKHA 4J53A 4XV3A 4HVHA 4AU8A 3NRMA 2WQNA 5T3QA 3E7VA 4F6UA 3O7LB 5LQFA 3N4UA 3EFJA 1IEPA 3OWLA 4O4EA 4G2FA 4FYNA 2PUNA 2W1GA 4WOVA 5EDPA 5AR5A 3SRVB 4AT5A 5ANKA 5EHLA 3SQQA 3R8UA 4IB0A 5D11A 5HE2A 5M51A 3K5VA 4MKCA 4ZY4A 2W96B 3FHRA 4TKSA 2ZOQA 3VW8A 2ZV8A 4H3PA 3V5QA 2IJMA 2Q0NA 4FV5A 3RMFA 4YUQA 3P7CA 5JRQA 3AC5A 1OL2A 4AFEA 5AIKA 3VS0A 3QKMA 2Y0AA 1Y91A 3EFWA 4S30A 5LMAA 5CENA 3V6RA 5J79A 3FI8A 3POOA 4EKLA 3BHUA 4YJPA 1PYXA 2VGOA 4V0GB 4IDVA 1WVXA 3SW7A 4ENYA 4RX9A 3C0IA 2CPKE 4M69A 3A4PA 4EJ7A 3D5WA 4XNEA 5BNJA 4IH8A 5FGKA 4MX9A 1TKIA 3FI4A 2ZM3A 3OY3A 4HNFA 4I24A 4XMOA 3ZO3A 2O64A 4AOIA 5DE2A 2ZB1A 3AMYA 3B8RA 1TZDA 3KIOC 4ARKA 3FV8A 4JDIA 4CTCA 2GFSA 3G2FA 5F4NA 1U54B 4F78A 3R8VA 4QTEA 4IQ6A 2YCQA 3O17A 1H26A 4CCUA 5J95A 3OOGA 4QDEA 3TV6A 2BRMA 3FBVA 4O1PA 4RLLA 3TJDA 2OBJA 3TXOA 4G3GA 5DHJA 1OL6A 4RVMA 3HX4A 4MBIA 4RGJA 4GU9A 3AC4A 4C7TA 5C03A 3S00A 4PP9A 3K54A 2PSQA 3EQIA 3FZOA 1QMZA 3DAKA 4D4YA 1OZ1A 2JDTA 3NYOA 4FVQA 3ET7A 3KY2A 1YXXA 2OZOA 3PRFA 4KRCA 4A9TA 5FEQA 3OUKA 2NP8A 3IW4A 4RIWA 4ITHA 3UOHA 1BYGA 1Y6BA 2J5EA 4N6YA 4NW5A 1Z5MA 5AMNA 3CD3A 4A4OA 4M12A 3F66A 4WBBB 3T8OA 1Q5KA 2VN9A 4MBJA 1UU9A 4R77A 4PL3A 4XS2A 2HW7A 1PXKA 3FMDA 3OOMA 4P4CA 3R00A 3R8LA 1IG1A 1OI9A 2QI8A 3FMEA 4FTQA 2OXYA 4DEEA 1H25A 4BCHA 1ZMWA 3RKBA 4PP7A 4UXLA 4X6QC 3D7TB 5G1XA 2X9EA 4MXZA 4RA5A 3PXRA 3BIZA 2YEXA 4NTTA 4YNOA 2V62A 4QRCA 5AR3A 5CEMA 5TOZA 5JZJA 1BI8A 4R3RA 2QOIA 5JMSA 3U87A 5AFVA 4WG3A 3NUAA 2J9MA 4YHFA 4C4GA 5LMKC 1M14A 3A7JA 3PA4A 4MYGA 4UB7A 1HCLA 3LCOA 5EG3A 4MHAA 3SHEA 2IVUA 3D9VA 3LFEA 3QHWA 3U55A 4P7EA 1WVYA 3VUKA 5JGDA 3GCVA 2HXQA 4LFIA 4PY1A 5JGBA 1MP8A 4X0MA 4IEBA 3HP2A 3I4BA 1PXMA 2OIBA 3BBWA 4LUEA 2WQMA 2X4ZA 4X2FA 3A8XA 3LXKA 3UO4A 4BWPA 1OIQA 2DUVA 4IX6A 4JRVA 4ZSLA 2QOKA 4QMSA 3M2WA 2Z7QA 5AR4A 4FV3A 3NWWA 4O4FA 4D4SA 5EQEA 3LFAA 2EXMA 3S0OA 3EKKA 2PVHA 3MS9A 5IH5A 3NFFB 4L43A 2R3QA 3UG2A 1KUTA 2YFXA 2QO7A 3BU3A 2XK9A 3A62A 3OXIA 3ZS5A 4ACDA 2VWVA 3PVUA 2XVDA 3ZUTA 2Z7SA 4JT3A 2GFCA 2WD1A 3FLZA 5IEXA 1ST0A 1FVTA 5IA2A 5M4FA 2EB2A 3POZA 4NJ3A 5HBJA 3PSDA 1PKDA 3GCPA 2W4KA 3A7HA 3QTXA 5K3YA 4ANOA 3K5UA 3IG7A 4HGEA 1LEZA 3VONA 4JI9A 4XV1A 1DI8A 3Q9WA 4BI0A 2W9ZB 3PTGA 3EN4A 3Q52A 3RZBA 3V01A 3EB0A 2OIDA 3KK8A 5KMOA 4QP4A 4J96A 4YHJA 2OFVA 4QMWA 3F82A 3BZ3A 2XARA 5FM2A 3PLAE 2YWPA 4LMUA 3DKFA 5GHVA 5AP0A 2R9SA 2ZDTA 3JYAA 5LVNA 4IIRA 2PTKA 5ACBC 3LHJA 5DRDA 5H2UA 3UDTA 1OL7A 5JKGA 4F0IA 3BV3A 3ERKA 2GDOA 5DPVA 5F1ZA 1UVRA 3C0GA 2C1BA 2OJGA 4HYSA 3BU6A 1ZYCA 5HCZA 2I0HA 3OEZA 4DCEA 5LCJA 5DRBA 3QXPA 4L7FA 2ITOA 3BHHA 3DXNA 4FZFB 4RZVA 4U8ZA 3CKXA 5A4CA 5IPJA 2GU8A 4C2VA 2AQXA 3Q9XA 4KRDA 4QYGA 4U6RA 4TL0A 3HV6A 3L9NA 4BBMA 1WFCA 5IUGA 3MFUA 3BE9A 4A9SA 2E9VA 1H24A 1OMWA 3QA8A 5HHWA 1U4DA 4RJ3A 4QP7A 4FKTA 5DA3A 2CMWA 2V22A 1JWHA 1DAWA 2OJIA 1CKJA 1OL5A 3LCTA 3NAYA 3QQGA 4Q5HA 3RWPA 2W99B 2QHMA 3ZLWA 4BCFA 5LCKA 5IA3A 3D15A 3MPMA 2PVKA 2GHLA 4GSBA 4DBXA 3QX4A 4NW6A 2BRBA 4XRLA 4PL5A 2OJJA 1KOAA 4BCMA 3OTUA 4FSRA 4FJVA 2VTRA 4FSYA 5AM7A 1NW1A 3W0OA 2R3IA 1SYKA 5LVMA 4QMTA 2BAJA 2HW6A 4RQVA 2AUHA 3CS9A 4PPBA 4OBOA 4GYGA 4AX8A 2C3LA 2C6KA 3LFCA 5ETIA 3EZRA 3LJ0A 5AAFA 4DDGA 1PJKA 3VS7A 3TCPA 4F9CA 3F5PA 3I6UA 2NYAA 1ZOHA 1PMVA 2F2CB 1QPCA 3AXWA 4QP3A 3UOJA 4L67A 4LI5A 4XUFA 3OG7A 5ANIA 5KZIA 1BX6A 2AEGA 3FI2A 2Z7RA 4GKHA 2X8IA 3R7GA 5E1SA 4YMJA 5IQBA 5IQDA 5CF6A 1U5RA 3QRTA 2OF4A 2XYUA 3ALOA 3QD3A 3KMMA 4MNEB 4D0XA 4Z16A 3Q9ZA 4AXFA 4BFMA 3UZPA 5BMMA 4O7YA 4P2KA 5J9ZA 4A9YA 5IMEA 2J2IB 2B0QA 4FI1A 3FZRA 4H1MA 4IAZA 4IVDA 3U6HA 2GQRA 5AV0A 4LG4A 3UIBA 5ICPA 3MVJA 3RAIA 3NNXA 2ERKA 3P5KA 5EYCA 4ZSAA 2IW6A 3C13A 4ORKA 1ZOGA 4FYOA 3W2OA 3F3WA 4OTWA 4Y8DA 5KZ0A 3OFMA 5H8EA 2VZ6A 3EYHA 4FV8A 4BCIA 3HA8A 4Q9SA 3NNUA 4AP7A 4O7RA 5DLSA 3MH0A 4E5AX 4ENXA 4F1MA 3PXQA 3KRXA 3F61A 4H36A 4QQCA 4O7ZA 4QTDA 5LVOA 2BDFA 2WGJA 2Z60A 3R2BA 4DFBA 3BGPA 2JDSA 5HO6A 4D4VA 2HZNA 3EN7A 3PVWA 2Q83A 2PE2A 2VWWA 3NUYA 3ORXA 4AA0A 5JT2A 2J0IA 5ANDA 3LXNA 2HOGA 5J5SA 2P2IA 3ZRLA 1YI6A 3EH9A 2QOBA 2PVMA 2Q0BA 5D10A 4YU2A 3MPTA 2CN5A 2YCSA 5EYKA 2UZDA 2JFMA 3COHA 4GG7A 4RA4A 4Z7GA 1T46A 4G5JA 1YXTA 5C4LA 4D2PA 2YAKA 4OTGA 1W82A 1XH4A 4QMOA 3COMA 1GZKA 2BFXA 2CKEA 5I9WA 3C7QA 2PUIA 3UQGA 3GXLA 3DBFA 5BUJA 4A06A 1QPEA 2A0CX 4AW0A 5KMJA 4BIDA 4DH8A 5IDPA 4N0SA 3P1AA 5DEYA 4RC3A 2EU9A 5E8UA 3LCDA 5BPYA 4B6LA 2WIPA 4LQMA 3PY3A 5HGIA 5BMSA 3KN6A 4LYNA 4D2VA 3DKOA 3VS2A 1JQHA 1VYWA 1WBOA 4L68A 2V55A 2PMIA 2QR8A 5CU3A 4KKEA 4BDFA 4V04A 1XMLA 1GNGA 4G9RA 1PXIA 4L01A 3BL9A 1RW8A 4G6NA 5CTPA 5EK7A 5LXMA 2UVYA 1WBPA 4LM5A 2YM6A 3KQ7A 5FDXA 2JEDA 2C4GA 5HNBA 3ZLXA 3QTQA 5HE3A 3DNDA 4CZTA 5HOAA 5EKOA 4EL9A 4BDJA 1O6YA 4YJVA 3RWQA 3OCSA 4DFNA 2YM5A 3ZM9A 2YWVA 5BUIA 3EQCA 3FLQA 4QMXA 5AIRA 2XKCA 4FODA 2CN8A 2I0YA 2RIOA 4BKYA 4C58A 5BVFA 4J7BA 2BKKA 4YHTA 2PVRA 4JDJA 4U41A 4FKVA 5EFQA 3MH2A 3QGWA 4I20A 4TNBA 3VS6A 5KMIA 1J7UA 3RAHA 3LMIA 4IB3A 4CT1A 3UPZA 3FQHA 4DN5A 2ITUA 4NU1A 3WYYA 2RFSA 4J71A 4F65A 2ESMA 4ZLYA 2OG8A 3UODA 3QZIA 2W06A 4GYIA 4U43A 2BDJA 5EI8A 5HCXA 4FV6A 3GU5A 3ZRMA 2VTLA 2UZNA 3CTHA 2UW9A 4WSYA 3R1QA 5KX8A 5DR9A 3DFCB 5TE0A 2RKUA 4NCTC 5HBHA 3NLBA 2WMUA 2OWBA 3O8TA 3E62A 3W0NA 4XV9A 3CEKA 3EWHA 3AOXA 4O27B 3PXYA 4O7WA 3UQFA 2BROA 1OBGA 2QLQA 3RI1A 4GT5A 2B9JA 4LRJA 2H9VA 2XIXA 1ZXEA 4QMUA 4NKAA 5CEIA 4XRJA 4HVGA 1UNGA 5A4LA 4HGTA 4O1OA 4R1VA 2X6DA 2WAJA 4C4JA 3GOPA 4TYHA 4GVAA 3GCQA 4KS8A 3W2RA 1KOBA 5DG5A 2DWBA 3NZ0A 3EQBA 4RRVA 3FEGA 2WQBA 2GTNA 3O71A 1BUHA 4YTIA 4NWMA 4U9AA 2YZLA 4CFMA 4EHEA 2ZJWA 4C3RA 3JVSA 5FQDC 3NIZA 4FEVA 4BHNA 2VWZA 2J4ZA 2V7OA 2YCFA 3QC9A 2F9GA 3P23A 4M69B 3DB6A 1Y57A 5L2SA 1OPLA 3KF4A 1ND4A 4MAOA 2R3LA 4F0GA 4AUAA 1XH8A 2WTIA 3Q9YA 4O7VA 2UW7A 3MJ1A 4G3DA 2PULA 3WF9A 2QD9A 2H34A 3ENMA 1FMOE 5FTOA 3KVWA 4BWXA 5CU6A 1YWNA 1PY5A 5T6KA 3QTSA 2B52A 4C38A 3PFQA 2NO3A 2PE0A 3HV3A 2IW8A 3FPMA 5KCVA 2V5QA 3GI3A 4PWNA 3LFNA 3BQRA 3MESA 3SG8A 4C02A 4I22A 3EQFA 4LOPA 2BIYA 5EI6A 2YACA 2E9NA 4WSQA 3L9LA 3WF6A 4EH4A 4ZY6A 4DFYA 4NSTA 4MF0A 4FIGA 2VO7A 2H6DA 1M2RA 5DEWA 4E4NA 2VNYA 5BVDA 1KSWA 5HI2A 4D1SA 3HGKA 4I0SA 2E9PA 3ZEWA 4UYAA 4RIWB 2A19B 3QQHA 2IF8A 3Q96A 3DV3A 4YZDA 3U51A 4EZ5A 4ZAUA 4O0WA 3IOPA 3FXWA 4EBWA 4LOOA 2FUMA 3P0MA 4I3ZA 3ZTXA 2F7EE 4C3PA 4M14A 4ZSJA 3TKHA 4GJ3A 4JBVA 3F7WA 5L4QA 5K4JA 3KRLA 3PDTA 1OM1A 2H8HA 2UVXA 3BYMA 2LAVA 3QZGA 2ZV9A 3BQCA 5CQWA 4JX7A 2HK5A 2VO6A 3KRWA 1SVGA 4RT7A 4AZEA 1JSVA 2R7IA 2ITNA 3NSZA 3Q3BA 4MCVA 4CV9A 4DFUA 4AOJA 2RFNA 1WAKA 1OIUA 3R21A 2UW0A 4PMTA 1GZOA 1RDQE 1H27A 2C47A 4JVGA 3QQLA 4MH7A 3LJ1A 5AR7A 3UYTA 4UEUA 4BCQA 4ZTHA 3FKOA 3L1SA 4C61A 2BZIB 4XX9A 3Q4ZA 3TTJA 5GINE 4BF2A 3CQUA 3AG9A 3VS1A 2J0JA 5ANOA 3WZUA 3SG9A 4CVAA 2G2IA 3AKLA 1HOWA 5M4CA 2PMOX 3IGOA 3PPZA 4QQJA 3R04A 4O0VA 4CSVA 3LQ5A 4FE2A 2VTOA 3TV7A 4LGDA 4GIHA 2YN8A 5E8SA 3R9NA 4JQEA 4YC6A 4KKHA 2GHMA 4FSZA 2XKEA 3PJ3A 4MXCA 5IUIA 3VO3A 3W2PA 3TTIA 2Z7LA 4H05A 2VRXA 5DVRA 2HZ4A 3BGQA 2PUUA 2BZKB 4LUDA 5GNKA 3C4ZA 4UWBA 3CGOA 1V0BA 3ANRA 4MD7E 4ZJIA 5I9XA 5LVPA 4BRXA 4DEHA 3WILA 3KL8A 4DDIA 3PRIA 1ZYSA 5M4IA 4UWYA 3BE2A 3NX8A 3HMOA 1IA8A 4XYFA 3RPYA 2WOTA 4FIHA 4BR3A 4RLKA 3E87A 4CRLA 4IAAA 5E91A 5CAVA 1UU7A 4FTLA 4X7QA 5I3RA 3MVMA 5JFVA 4GT4A 2ETRA 3MIYA 4NTSA 4QMZA 4UBAA 5DOSA 5TF9A 4H3QA 1PMUA 4HPUE 2JC6A 4NM5A 3C4CA 3V51A 5C8MA 2XF0A 3FLYA 3QFVA 2C5VA 1WBVA 3NPCA 4IX5A 4F1TA 2P2HA 2CJMA 4BGGA 1XO2B 4R3PA 1FINA 4AGCA 3U4WA 3ZDUA 4A4XA 1H4LA 3CIKA 4OLIA 2OXDA 5EI2A 3LFBA 1SNXA 1CMKE 1OKZA 4FUYA 2R2PA 3GEQA 4M3QA 5FTQA 4ASZA 2BRHA 1JKLA 4RZWA 2CNUA 4FICA 2OK1A 2F4JA 2RL5A 3KGAA 2UVZA 2RFDA 1P4OA 4FUXA 4IC7A 5HNGA 4F4PA 4BTMA 5HNIX 4EHGA 1JLUE 3FSFA 3V8SA 1ERKA 5HCYA 4TYIA 4E7WA 1GY3A 4JDHA 4NM7A 3EQPA 5AAGA 3VQHA 2YIRA 4GG5A 5I9VA 2AC5A 2B9FA 3F5UA 2QKRA 5D41A 2BTSA 4FTNA 4QTCA 2X2KA 4FKJA 3Q4UA 2E9OA 4DYMA 1TVOA 2SRCA 2B4SB 2PUPA 2VO3A 5AV4A 3DK7A 3IW5A 5HD4A 2QOCA 4JLCA 4EWHA 2RGPA 3GQLA 4GW8A 4P5QA 4CRSA 1CTPE 3RJCA 3ZZEA 3TIZA 3UC3A 2CKPA 4QMNA 4MD9E 2PZ5A 2VX3A 4F7NA 1MRVA 2W1DA 2X4FA 3OT3A 4A07A 3WARA 4F1OA 3BYSA 3D7ZA 2C5YA 4BCPA 3R28A 2C6MA 3DLZA 4YJSA 3RAKA 2OLCA 3COIA 4EC8A 3BLAA 3F69A 2IO6A 4LOQA 5IUHA 4M66A 4YLJA 4BICA 2XJ2A 5FM3A 1H1SA 3ZYAA 2XYNA 2X0OA 1SMHA 2CCHA 4EZ3A 1FGKA 2C3JA 1M17A 5HTIA 3C1XA 5KMNA 3SD0A 3ELJA 4K6ZA 1FOTA 3R2YA 5TR6A 3ZFYA 3TUDA 4Y95A 5JFXA 4L3LA 4LDTA 2X2LA 5L8LA 3U4UA 4EOMA 2VTNA 5FXSA 4O86A 2ETKA 5GZ9A 4IAFA 5K5NA 4E4XA 4U97A 3WIKA 5C4KA 3C5UA 1YI4A 4HJOA 3HRCA 4QP8A 3QCYA 4EOSA 4MBLA 4MK0A 3A99A 2BZHB 3G51A 3LM0A 3NW5A 1G3NA 2XNEA 4IWQA 2WB8A 3VHEA 4F9WA 3SA0A 4FV2A 3A61A 4HYHA 4AA5A 1JKTA 1JSUA 4I6FA 4I1ZA 3PJCA 5AP1A 5CAPA 4II5A 4C62A 4YJTA 4H1JA 3KXHA 5A14A 2CLXA 4GUBA 4MWHA 3L8SA 4FV9A 4B99A 1H1QA 4UXQA 4CMUA 4MQ1A 4DEIA 5C1QB 2OI4X 4ZTSA 5L8JA 4EOOA 4HVDA 1ZZ2A 3R73A 2CHLA 3AC8A 5KUPA 3UO5A 4FTJA 2OF2A 4BB4A 3FC2A 2R64A 3DDPA 5AUZA 3OP5A 3IOKA 5M4UA 3WF5A 3DA6A 4AE9A 5A6NA 3PVGA 3P7AA 3UTOA 2B53A 1XWSA 1GZ8A 4AZWA 4J98A 2VWUA 4GH2A 2QOFA 3OBJA 4JR7A 5AUTA 4M0ZA 3UOKA 1H1WA 3CQEA 3V5TA 4BYJA 3S2PA 3LLTA 5K4IA 4XP0A 5DWRA 4IXPA 3V5WA 2CNVA 2VTHA 3DBCA 4IACA 2WEIA 3MTFA 5CU4A 1OKWA 4DTAA 4U81A 4UX9A 3AGLA 4EONA 4X6RA 4QYHA 3IONA 5KHXA 2ITPA 4IM0A 4FKGA 4M97A 3CPBA 3RPOA 3VRZA 1RJBA 2J0KA 5HG9A 4F64A 4L8MA 3N51A 3ENHA 3UZTA 5IZFA 5GJDA 2YIYA 3QX2A 3UBDA 4O7NA 3FL5A 3DTCA 3KFAA 2BKZA 3IDPA 3A8WA 3FHIA 4FSUA 2YIWA 2GCDA 2J0LA 3CPCA 3QUEA 4DEDA 4FZ7A 4O91A 5E90A 3RM6A 1MQBA 3QUDA 5EW9A 5BVWA 3ID6C 3LQ8A 4PTCA 3DB8A 2XBAA 4Y83A 4ID7A 2XKFA 3WI6A 5CAOA 3M1SA 3W33A 3ROCA 2O0UA 2OH4A 2Y6MA 3EN9A 3GU6A 4QD6A 4ZMEA 5IQHA 4LL5A 4KIPA 3QTUA 4KA3A 4I6LA 4MXAA 5HVKA 4TT7A 3HV4A 4FSMA 3I7BA 3R0TA 1M7QA 4PMSA 3MH1A 3TNWA 4AQCA 3QQKA 3HDMA 4QT1A 5JQ8A 4ANLA 2UZLA 3TNHA 5E9EA 3ZC6A 4NFNA 2OJFE 2QU5A 2V7AA 1YXSA 4BCKA 5M57A 2KTYA 3PWYA 4WRGA 2XAOA 3V5LA 2UZVA 5K0KA 3Q6UA 2W0JA 4U0IA 4YLKA 1Z9XA 3CCNA 1DI9A 4E4MA 5JH6A 4QDVA 2PVYA 3FWQA 5T68A 3VJNA 2EXCX 3OVVA 3E93A 4QYFA 3P08A 5L6PA 4FEXA 1J7LA 3VS3A 4ACMA 5LOHA 4MEDA 4XHKB 5D1JA 3UMWA 5H8BA 4CXAA 3Q32A 4BWKA 2P55A 2GS6A 2UW6A 2P3GX 3TACA 4O2PA 3W55A 2XK7A 2PZIA 4TW9A 2EB3A 2Y7JA 2JKKA 4CD0A 3FXXA 3TDWA 1PMNA 2JIUA 4ALUA 3Q5IA 1URCA 3NCZA 3PIYA 5FTGA 4S31A 5CEKA 4DGLC 3D4QA 4I5CA 4C59A 3C0HA 4FEWA 3MI9A 4OTDA 4R5SA 3LFDA 5AWMA 4AN9A 2CCIA 4RC4A 1XH5A 5AADA 2I7QA 2JDRA 4YNEA 2FO0A 1VZOA 2O2UA 2VGPA 2UV2A 2W1EA 3PJ1A 3FMKA 3GOKA 2E9UA 3M42A 1F3MC 3PJ2A 4TYHB 1M2PA 1OPJA 3F3VA 4FVPA 4ZTRA 5HIBA 4FTRA 3VBWA 4BKJA 2P4IA 5AP5A 3BYVA 4IWOA 4C37A 3UOLA 1XH7A 4FTUA 2BHEA 2C6OA 4FV0A 5EOLA 3RCJA 4FGRA 4KIOA 5KHWA 3MIAA 5CT0A 4GIIA 3QRJA 4YO4A 2FYSA 4FSNA 4ZS0A 4OT6A 3QZFA 2UZEA 4G5PA 1V0OA 4XBRA 2HENA 3EOCA 4MVFA 4PNKA 3DK6A 1G8KA 1A9UA 3C4WA 4KB8A 4BN1A 5IQIA 3DBDA 3QALE 4GVJA 4Y5HA 4DEBA 3ZOSA 4Y5QA 2DYLA 4GJ2A 4JAIA 4QYEA 3N4VA 5CSPA 4D5KA 4DH3A 5JK3A 4WRSA 4TWCA 3RBWA 2I40A 4O7TA 1F0QA 3HLLA 3ETAA 3ZSGA 1KV1A 4KIQA 4EK5A 3R01A 1P5EA 4LV7A 4FT5A 3UIMA 3EKNA 3F2AA 3HUBA 3BKBA 1QPJA 3DAJA 4MF1A 3NYXA 2OFUA 3F7ZA 1PXNA 3PXFA 3RK9A 2XZSA 4F0FA 4WUAA 4FNXA 4BDKA 3HMNA 3IKAA 2BDWA 4I23A 4O81A 4A9UA 2BALA 4OTPA 5CY3A 4AN3A 3H0ZA 5IU2A 2OIQA 2C3IB 1V0PA 3C5IA 4OTQA 3RHXA 2WXVA 1WCCA 2QOLA 3DJ7A 4QP2A 3CJGA 2VV9A 2GHGA 3PWDA 4FZ6A 5HIEA 2XNGA 3QHRA 2QU6A 4K8AA 4QMMA 3NW7A 2ACXA 4U3ZA 2R7BA 3FZTA 2RG6A 2W05A 5CZHA 4EZ7A 1LPUA 4CLJA 3IECA 4KWPA 3JUHA 5BVEA 1IA9A 2J90A 2VAGA 4EH5A 2G1TA 4I4EA 4MXOA 4WD5A 3AC3A 5I9YA 4TYGA 3RP9A 2C0OA 3QTWA 2BHHA 4AE6A 2C1AA 3DFAA 3OZ6A 4JX3A 5CSXA 4ERWA 3AD6A 3VF9A 2P0CA 4ALWA 5KBRA 1UV5A 3W18A 3KXNA 3TNPC 3ALNA 3W0SA 3LXLA 4USDA 4FV7A 3F5GA 4F08A 4C33A 4UWCA 4U40A 3MVLA 4EOPA 5D12A 4BCGA 3GBZA 3EFKA 4EKKA 3DDQA 3U9CA 2BRNA 4BGHA 1OPKA 4BJJA 3JY0A 3G6GA 3LAUA 4F6SA 4G1WA 2WPAA 4BCOA 3RGFA 2G9XA 2C0TA 3VAPA 2QOHA 3W32A 1YDTE 2RFEA 1FGIA 1MRUA 3LPBA 2ZV7A 3MB6A 2O5KA 2J0MB 4UYNA 2PMNX 1H8FA 3L8PA 2WU6A 3QXOA 4MTAA 4CV8A 2RF9A 3BCEA 3PXZA 4QPSA 4Z9LA 3PY1A 2OGVA 4AZTA 2GQSA 3BLQA 1Q3WA 5FXRA 4M15A 3W1FA 1QCFA 3DCVA 2ITQA 2WTWA 3ORPA 4PDYA 5IQFA 4HCTA 3VS5A 2JLDA 3OUNB 4EI4A 1OITA 3FLNC 5DIAA 3TEIA 1GAGA 4Y46A 3UNZA 2XBJA 4EQCA 3RHKA 4FRFA 3SX9A 2Y6OA 5DR2A 2NRUA 4CFXA 5L3AA 4NH1A 3NEWA 1CM8A 4YJUA 4TZRA 1Q8YA 3FUPA 2ITWA 3UVRA 5E8ZA 4TXCA 3OXZA 4AOTA 4BBEA 3BU5A 4GFMA 2B1PA 5DH3A 5CXZA 4GV1A 5L2WA 5CZIA 4M68A 1YDSE 3MBLA 5IA4A 2WTKB 4FG8A 3CTJA 4QPMA 5AP3A 1W98A 5BVNA 3MJ2A 3EQDA 1YDRE 4IAKA 5F94A 4IJPA 3U6JA 3JVRA 1WBWA 4FMQA 3NFGB 3LCKA 4FEUA 2WTKC 4QMLA 5A3XA 4GL9A 3WYXA 3E5AA 1YXUA 3GC0A 5ITAA 2JBPA 2XM8A 5CNNA 2PWLA 3LXPA 4L3JA 2O3PA 1PXJA 3B2TA 2YM4A 3KCFA 3O23A 2QVSE 4Y85A 4BTKA 4XG9A 3ZRKA 1I09A 3CJFA 3QA0A 4RMZA