5L2SA

The x-ray co-crystal structure of human cdk6 and abemaciclib.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
263
Chain Sequence
QQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVPLSTIREVAVLRHLETFEHPNVVRLFDVCTKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLAVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 6
publication title Spectrum and Degree of CDK Drug Interactions Predicts Clinical Performance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 263
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l2sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l2sA01
2QKWB 5HVKA 4JVGA 5I9YA 4BBMA 5AUZA 4TYJA 1U5RA 4I4FA 1M52A 2VWUA 3MIAA 4UY9A 3LIJA 4B4LA 2WGJA 5DT0A 1OL2A 5E8YA 5AEPA 4I1ZA 4K6ZA 4ANMA 4G3EA 1HCLA 2XVDA 1Q8TA 4QP6A 4HVIA 4YC3A 4AZFA 4UYNA 3VIDA 2BRBA 4PWNA 3PRFA 4HW7A 3TIZA 3D5WA 3SA0A 5L8JA 4C36A 4RSSA 5A6OA 4CV9A 3H4JA 4O1OA 4EK5A 3FI8A 5J87A 3TZ8A 3DBFA 3A8WA 4NTSA 4BWKA 2XMYA 3U6IA 3DKFA 5CEKA 3VULA 2VWZA 1APME 2WMAA 3CJFA 4BTJA 3GCQA 4PPBA 2HY81 3QU0A 1H0WA 4QRCA 2DQ7X 4A4LA 4W4XA 3DXPA 4EH4A 2VWWA 5K3YA 1CSNA 2V0DA 2G2HA 4NK9A 3O8UA 4C57A 2FO0A 4FTKA 3TKUA 3MGYA 5IKWA 3ZFXA 4AXAA 4JLCA 2J4ZA 1R1WA 2RG5A 3I7BA 3VUKA 3ZONA 2Z7SA 5B2LA 4FZ7A 3E8EA 5EHLA 3CC6A 4RFYA 3ZEWA 3QRUA 2CHLA 2X9EA 4AN9A 3NCZA 1WAKA 2WIHA 3NW6A 4DTAA 3W2QA 4B8MA 4DH8A 3FAAA 4V0GA 5M44A 3NAYA 4ANBA 5IG1A 1W0XC 3AMBA 5CANA 3VO3A 4MH7A 4E4LA 5JK3A 5EFQA 1YDSE 2JDOA 4KAOA 3ZO1A 3HMOA 4Q9SA 3F9NA 4TNBA 4ZTQA 1GY3A 1W84A 4DCEA 3RPYA 1H07A 4I22A 5K0KA 3QTSA 2YIYA 2O65A 4JDHA 3CSVA 4PUZA 4FKQA 4X2GA 2XIYA 4RX9A 4KKHA 3GC0A 1XBCA 3R0TA 4U8ZA 3K2LA 2HWOA 4R7IA 3F3VA 3QAME 3QTWA 2VGOA 2UW4A 4QNYA 2OZAB 2QR7A 5EW3A 2I0EA 4L7SA 4TPTA 5BUJA 4PTGA 4AT4A 3OBJA 3ZLYA 1LEWA 2C0TA 3U51A 5EKNA 2GQRA 4FV6A 3OUNB 2WTKB 3MH1A 4RIYA 2O5KA 3WIKA 4I6QA 4D2WA 2ETKA 5L2TA 5C8NA 4DGGA 2FB8A 1OVEA 3QLFA 5ANGA 4O0XA 4EOKA 2B52A 2HY0A 2FSOX 3FSKA 3MTFA 4G34A 2HELA 2R7IA 3BKBA 4KS8A 2UW9A 3RBWA 4R3CA 2EWAA 4KSQA 5BYYA 4XG2A 3O2MA 4M67A 3LFEA 4U45A 5JH6A 5K5XA 2VZ6A 3OOGA 3D5UA 5HBEA 4M84A 5F95A 3TNWA 3I60A 4RJ4A 2QLUA 1OBGA 5AUXA 3KK9A 2VGPA 4IAKA 3P86A 3FV8A 3MPAA 4F7SA 2WKMA 4EONA 2BDFA 4CZUA 4DG0E 1OKWA 4YP8A 4FSWA 2W5HA 4QYEA 4XH6A 4UMQA 3MVHA 5KMLA 4R7BA 4E4MA 4LYNA 4RG0A 3NPCA 4GSBA 4RJ5A 3SV0A 3F5PA 3C0IA 1Y57A 3DS6A 5CS6A 3LCKA 1LUFA 1EH4A 5GIOE 4C3FA 2ZDUA 2O63A 1W8CA 3C51A 4IJ9A 3ALNA 3R9NA 5BVKA 2FSTX 5KMIA 3WILA 3GU5A 2ETRA 4F7LA 4FG7A 4QP1A 5CEQA 5AJQA 4C3PA 3COHA 1YW2A 3G9LX 4FYNA 4BKJA 1JBPE 3PIXA 4N70A 3GOKA 4FOCA 3COKA 4OR5A 3SVVA 3KGAA 2PK9A 2Z7QA 3GC9A 3NYXA 4FKLA 3C4XA 3V6SA 2Z8CA 1H26A 5IQIA 3ZO2A 2JDTA 2X81A 5AUVA 3WIGA 2G15A 2Z02A 3FPMA 4BGQA 3P1AA 2XM8A 3V51A 1SVGA 3JUHA 5EW8A 3D7TA 2HXQA 3SRVB 3QRIA 5HCYA 4O0RA 4AZVA 4H1MA 3UOKA 2YLEA 4AAAA 4ASDA 4UMTA 4FTCA 3PA5A 4OBQA 2C6OA 3EQIA 5F4NA 1LEZA 4MD7E 4H3BA 3RHKA 4IIRA 4GKIA 3S3IA 5CENA 2V22A 3QA0A 4FIJA 3OG7A 4XP0A 3Q4UA 2VD5A 3RPSA 2XNBA 5K9IA 3DTWA 3KF4A 4ANOA 4P5QA 1YHWA 4GV1A 3DAJA 3VHEA 5CU0A 4GFGA 2CLQA 3R9RA 1UU9A 4TNDA 2IG7A 3VS2A 3FMMA 4UMPA 3RAIA 4RJ7A 4BYIA 3BQRA 3D14A 4MNFA 4EWHA 4ZZNA 1JKKA 4BIDA 2AC5A 2GNIA 2I0VA 2JKOA 3RAKA 4X2JA 3UP7A 2I0HA 3RWQA 1BI7A 3DAKA 4NM0A 4FV9A 3WF6A 2PVRA 2J50A 2XNPA 3WYXA 3R30A 1H00A 5FQDC 4LRMA 4XS2A 1CTPE 1KE8A 3RK7A 4LL0A 3REPA 5FBNC 5DWRA 3CKXA 1YI4A 3RK5A 5D10A 2X8EA 3KA0A 4I20A 4LMUA 3NRMA 2VTQA 4MXAA 3ZSGA 4AF3A 3MI9A 3PPZA 4AUAA 4I92A 5I9UA 3FUPA 3ZUTA 1PRYA 1WBWA 2ITYA 4A9UA 2QO2A 3HA6A 5BMMA 4AGWA 4O0WA 2X7OA 4EZ3A 2B9FA 5L2QA 4L68A 4MQ2A 3UOJA 1W7HA 3P7CA 2RL5A 3MB6A 3UDBA 4U80A 2ZM3A 1OKVA 1WCCA 3QRTA 4FKJA 3DOGA 4IZYA 4FT0A 2B9JA 2BRNA 4XV3A 3QQJA 4HOKA 2LGCA 3Q4ZA 4DHFA 2YCQA 3C7QA 3OS3A 4ARKA 4K8AA 3TL8A 4F6SA 4ITIA 3P23A 4IX6A 3MA6A 3FMJA 4W4WA 2VWYA 2XKFA 4DFZE 3BWJA 2VTAA 4I6BA 3BHVA 4RMZA 1OIQA 1IAHA 3QC9A 4QQCA 2P4IA 4G5PA 4JT3A 4YJRA 5F20A 5IA4A 4DEGA 4N6YA 4XRLA 4AW0A 2YZAA 2R3OA 4D58A 4EQMA 2BHEA 4YTHA 2XS0A 3FZRA 4TW9A 5J95A 4BI0A 5HG5A 3GI3A 4W4YA 4MBIA 2A4LA 3VNTA 5E8WA 4FNXA 2W1GA 1VEBA 2FH9A 2WMSA 2JITA 2ZM4A 3ETAA 3T9IA 3F2NA 4C4GA 3PY3A 4PMTA 1IA9A 3CY3A 1YOLA 2J5FA 4FK6A 4O96A 4ZEGA 5IQAA 2B53A 2R64A 5EQEA 2ITTA 4OBPA 4FSYA 4LOPA 5EM5A 4MX9A 4LV5A 4EOMA 2F4JA 2BIYA 4OW8A 3G9NA 4RWJA 3LXNA 3OHTA 4FTAA 1PXNA 4XG4A 3GGFA 5EM6A 5J1VA 4DF3A 1URWA 1OECA 4RWIA 3F82A 5HZNA 1K9AA 1H1WA 3QALE 4XMOA 3R1QA 5M4UA 3QCYA 2BZIB 1H28A 4FV2A 4V0GB 3ZFYA 5HLNA 3FQEA 4IM2A 3ZMMA 2JKKA 4U79A 5JGDA 3IW7A 3DCVA 5CXZA 5FDPA 2IN6A 5FWKK 1Y8YA 5CAQA 4O0UA 2QKRA 4DN5A 5KKRC 1H08A 1R0EA 2BMCA 1M14A 3PXRA 1J1BA 3GENA 2OFUA 2RFEA 2YDIA 2WEVA 1FPUA 4FSRA 5ANJA 2QR8A 2IVVA 3MW1A 4Q2AA 4A9YA 5EK7A 2WQBA 5AP1A 3MDYA 3C5UA 4ANQA 3ZZWA 5A4EA 1PHKA 4CVAA 1STCE 4RVLA 3BLRA 4Y5HA 3HKOA 1P4FA 2GFSA 4R77A 5JGAA 3DLSA 3OY3A 4BCNA 3EQDA 2QONA 4FKOA 2VTPA 4O81A 4CG8A 4AP7A 4O27B 5BVEA 3V5LA 2BAJA 2OK1A 3HP2A 3R71A 5CF8A 4FTLA 4M0ZA 1U5QA 2ZVAA 4QQJA 3BGQA 3R1YA 3RALA 3TV6A 3LFDA 4O82A 1PMUA 1ZY5A 2DS1A 1BUHA 3LAUA 4AZWA 5KBRA 1WBNA 5AP4A 4G2FA 2YN8A 4FKWA 5E1EA 1YHSA 3FXWA 3ZS5A 2C6DA 4HYIA 5AM6A 3TIYA 3SGCA 2YITA 3KY2A 4BWPA 4CQEA 5FRIA 2HZNA 4E6CA 4FTRA 3VWAA 3O51A 3MESA 3DJ6A 3MVLA 2FSLX 3ULIA 4C7TA 3IKAA 3CQEA 4PY1A 5J9YA 1AQ1A 2PMOX 4U7ZA 3C1XA 4RC4A 2VTNA 4YBKA 4OTDA 2XIXA 3E92A 4PMSA 3QRJA 4I93A 2VO7A 3FLNC 5CASA 2UVZA 5GZAA 1Y6BA 4TTHB 1DS5A 5EHYA 3ORPA 4KIKA 5FBOA 4B0GA 5HD4A 5LCJA 4BCMA 2CCHA 2ZB0A 3ZYAA 4J97A 4H58A 4AQCA 2JKMA 3DK6A 5L4QA 1CKPA 3UC4A 3E7VA 2PHKA 4E7WA 3OBGA 4L3LA 4FZAB 4OTIA 3DDPA 3CLYA 5BPYA 2R5TA 4QP3A 2Z60A 5EG3A 2PVKA 3H9RA 3UTOA 2V7OA 5DE2A 4FV0A 4WSYA 4ACMA 3FZPA 2BCJA 4GL9A 2QOLA 4PV0A 3BZ3A 4F99A 3ORKA 5C01A 2WQMA 4BFMA 2WEIA 2ZV2A 3QKKA 4PP7A 4DBNA 4FUXA 3E88A 4D0XA 4GVJA 1Q61A 2HIWA 2WFYA 3EFWA 3BGPA 4ASEA 4KIPA 3QL8A 4EJ7A 4GEOA 3D94A 4FGRA 4TY1A 4BICA 5CAVA 2CJMA 4CQGA 1PXLA 5BVDA 3DKCA 3KREA 5I3RA 1MRUA 4M3QA 4TL0A 3KU2A 5B2KA 3MVJA 4C4IA 3HL7A 3EN6A 4IFCA 5DHJA 1W98A 2CGWA 3QZIA 4QMUA 4XBUA 3W2SA 5KX8A 5DI1A 2YZLA 3QD4A 3BLHA 4W8DA 3KF7A 5FXQA 2UW5A 2C5NA 4MAOA 5CQUA 5EYCA 3TKHA 3ERKA 3QA8A 5AV1A 5J5SA 5HTBA 3PFQA 2YM3A 2VO3A 2O8YA 4U41A 3QYWA 5IA5A 4XV1A 3R00A 4TYGA 4C34A 4UXQA 3R73A 2RIOA 4FEQA 4FYOA 3R7OA 4IZAA 2I6LA 3TZ7A 3D4QA 2BHHA 3N4TA 4ERKA 4UWYA 1RJBA 5F1ZA 2X1NA 4CTBA 4ALVA 5IH6A 4ZIMA 1WBTA 2O2UA 3DA6A 3UIBA 4F70A 4AW1A 1Q41A 3KXHA 5E4HA 1JSVA 2GFCA 4E5WA 3LQ5A 2QG5A 4BBEA 3O7LB 3R8PA 1GZKA 3C50A 4JIAA 4UEUA 5KMKA 4XEYA 1MQ4A 1H8FA 3GOPA 3NZ0A 1XH8A 2F7ZE 4MYGA 4OT6A 3NVKI 2GHMA 4QD6A 3E3PA 1Q8YA 5FDXA 5BYLA 3SXFA 4ZSAA 3R8MA 2CSNA 2UVXA 1ZRZA 4Z16A 4YNOA 5HBJA 3BU5A 3DXNA 2X7FA 3UG1A 1R39A 4EH7A 4F9YA 3R22A 3DBCA 1KOAA 1UV5A 2JBOA 4F1TA 2ONLC 2GTMA 4EH6A 4NL0A 5E8ZA 3VBYA 3G0EA 5M06A 4O83A 4KA3A 3QLGA 4QMYA 4A9RA 1VYWA 3GC7A 2W99B 4A07A 4CFNA 5L2IA 4S34A 3RPRA 1OITA 4FC0A 3W8QA 2UW0A 3IPHA 3ZSHA 2ZJWA 4KBCA 4OBOA 5FEEA 3T3UA 3IW5A 4D28A 3QQKA 3C13A 2CN5A 5BNJA 1OPJA 3A62A 4ZXTA 2PVFA 4IM0A 3OVVA 5KUPA 4OTFA 2B7AA 1ZMWA 4ZSLA 4NU1A 3GEQA 4UWBA 4X2NA 3NIZA 4D5HA 4ACGA 4JNWA 5EKOA 3LQ8A 4RA5A 1OB3A 4ZP5A 5FLFA 2JDRA 4CZYB 1G8SA 2EVAA 3PA3A 1H1RA 3KN5A 3LXLA 3FMLA 3WE4A 2ERKA 1JSUA 5F94A 1YXUA 5KKRB 4FI1A 1LR4A 4GIHA 4BCKA 3DU8A 3IDBA 3NGAA 4NW6A 2X8IA 2XIKA 2Y8OA 3I81A 3NUUA 4L8MA 4PNIA 1RQQA 3LCSA 5C8MA 3G33A 5JMSA 1TQPA 2OXXA 4RGJA 4UYAA 5HGIA 4NWMA 4OGRA 5EDRA 1O9UA 4F08A 5CVFA 5TR6A 1FOTA 2W1DA 1YXXA 2YAKA 4YSJA 3R8VA 5M57A 2P33A 3RPVA 4V01A 4CYJA 3IGOA 1Q99A 2C6LA 3HECA 4EQCA 3F3WA 1H1QA 5AM7A 3TACA 1ZOEA 4QPAA 4ASZA 3DPKA 4EK8A 4DH5A 4BZOA 5CVGA 2WMTA 4L42A 4FIIA 2GNFA 2PVJA 5E8UA 1QCFA 3GC8A 3EQBA 4R5YA 3ZLSA 4D1XA 1PYXA 4FOBA 1KOBA 4M66A 5DG5A 4EJNA 3Q5ZA 4I6FA 2PZPA 4X0MA 2PVNA 3G15A 4DINA 3MS9A 1E1VA 5E9EA 3HRCA 3R7YA 4BF2A 3TDVA 3TUBA 2QOFA 3ENHA 4MCVA 3G90X 2R3MA 4PQNA 2IZRA 5IH5A 2CKOA 2ZMCA 4FKSA 1WBSA 4XLVA 4IVAA 3N4UA 5LMBA 5JQ5A 2PMIA 3T9TA 5HESA 4O2PA 4BDIA 2QODA 4EHZA 2E9PA 3Q2JA 4ZY4A 3EMGA 4PL4A 2Y4IC 4IAZA 5BX0A 2UZTA 2VWVA 4JI9A 2XKDA 4ZY6A 3VUGA 4E73A 3CCNA 3QQHA 2P3GX 2AC3A 4XG8A 5IISA 3SQQA 4FV1A 1J1CA 2UZEA 4E1ZA 4CCUA 4EEVA 3C4EA 3HGKA 1W82A 3R7VA 4ERWA 5EYKA 2QOIA 4U43A 4YHFA 1WFCA 3Q6WA 4BCIA 4XG9A 4YJQA 5HVYA 3ORTA 2OIQA 2X9FA 2PSQA 2B4SB 2QI8A 3COIA 3FE3A 3OF0A 3ORXA 4LRJA 5CU4A 3BYSA 4F6UA 5M56A 3DFCB 4WD5A 3ZUUA 3MYGA 2O3PA 5DT3A 3SOAA 2A2AA 2UZLA 4XG3A 2PZ5A 1G5SA 3PJ1A 3B2WA 3Q4TA 4GW8A 4EKKA 4P7EA 3EZRA 4O1PA 1M2PA 3F3TA 2ZV9A 1SM2A 4IXPA 4NFMA 3UNJA 4MXZA 3HUBA 3AMAA 4APCA 1ZYLA 2BKZA 3JY0A 4FVQA 3VUHA 1XKKA 4XNEA 3PY1A 1GJOA 4J71A 2F57A 1UNGA 2GCDA 4ZS4A 3IS5A 1V0PA 3I0OA 3HV5A 3AGMA 3OCSA 4FV4A 1DAWA 3QUDA 4HYSA 5HEZA 1BKXA 5LQFA 3BEGA 3OCGA 3RM6A 4KIKB 4ZZOA 2GHLA 4X3FA 4GVAA 1NVRA 3L9NA 3MY0A 4R5SA 5AAEA 3OMVA 5BMSA 2NNWB 4AA5A 3I4BA 3A8XA 3LFFA 5AUYA 3VJNA 2E9UA 2ZAZA 5FXSA 4C2VA 4JXFA 3SD0A 4HVDA 4O91A 4JRVA 1IA8A 4PNKA 1DM2A 3AD4A 2W1ZA 2R4BA 4YJUA 4DE4A 2X8DA 1K2PA 1ZZLA 2XK6A 5JRSA 3BU3A 3Q5IA 4QTCA 4J8MA 4C02A 4WNKA 3H0YA 3KXGA 4CFFA 4GJ2A 4BCPA 4ZSJA 5DA3A 3T8OA 3NS9A 2WMUA 4Y5QA 4O7LA 5IMEA 1CKJA 2CGUA 5KMJA 5EDQA 4WBOA 4ZMEA 4IJPA 4A9TA 2ITOA 3VVHA 3ZRKA 4DFNA 5JFWA 1GAGA 4FODA 4H3PA 5AV4A 4FZFB 5H8BA 3E8DA 4O7VA 4X3FC 4C61A 5IQFA 1M7NA 3PVGA 4L53A 3PVBA 4MF1A 1PXKA 4UALA 2C6IA 3KCKA 4FNWA 1U59A 4LFIA 4WO5A 3KRXA 1Y8GA 1ZMUA 3SLSA 2YCSA 5D11A 1PJKA 5DMZA 3FLZA 5AV2A 3QD0A 3DTCA 1OBDA 2YA9A 3RHXA 3DQXA 3ELJA 3EFKA 3UO6A 4QMVA 4R3RA 3L9MA 4D2PA 3LCOA 3L8PA 2HAKA 4QO9A 3E93A 3MVMA 3UMWA 3ZO4A 4YSMA 4LL5A 2WHBA 5HO8A 5IQDA 3LCTA 1XQZA 2I1MA 4LUDA 4M15A 1NA7A 2W1EA 4Q9ZA 4ID7A 1J7IA 4EK4A 4MXXA 4AW2A 3W2CA 2XKCA 3A7JA 3IECA 1QL6A 3KCFA 4KIQA 2B54A 2C5YA 4V04A 1BLXA 3CXWA 3PZHA 5EYMA 1YWNA 3ZU7A 5HQ0A 3B2TA 4QMQA 3NAXA 4ZMFA 3R8LA 2IZTA 4TWOA 3KRLA 4MD9E 3LMIA 4UXLA 2C6TA 3LXPA 3L1SA 4WT6A 3EN7A 5AUTA 3NNWA 5IQBA 2XIZA 1QPDA 3ZUVA 2OI4X 4CLIA 3U4WA 3EQGA 3OC1A 3QWKA 2VX1A 3BHYA 3LE6A 3UQFA 2H9VA 3R83A 2PU8A 2AYPA 3FC1X 2YAAA 2JIUA 1A06A 3R63A 4N6ZA 3RCJA 4CMTA 3BEAA 2PVMA 4ZTRA 5L6WL 2QQ7A 3ZCLA 4L52A 3OW4A 3TJDA 3R02A 3UZPA 1F0QA 2EB2A 1J7LA 2RGPA 2VX3A 3CIKA 3BHHA 4MHAA 4PPAA 4HPTE 2F7XE 1E9HA 5AMNA 3W1FA 2QO7A 5ANDA 2P55A 4O0SA 5DRBA 4NFNA 3ZEPA 4G5JA 4D1ZA 4F9CA 4ZLOA 3ATSA 3AXWA 3NYVA 4D5KA 4ALUA 2WQNA 4AT3A 1YDRE 3AT4A 3HMNA 5E8SA 5K0XA 3GU8A 3C0GA 5IQHA 5F9EA 2QOKA 3G6HA 3TUCA 2PPQA 3EN4A 3HV3A 3VS3A 4WNOA 3D2IA 3V8TA 4RIWA 2NP8A 5ANKA 3PDTA 4KB8A 5E1SA 5DYJA 4FICA 4RJ8A 5J9LA 3AC8A 4D9TA 4FNYA 4KUJA 4QTAA 3EN5A 4TRLA 5EHOA 4JG6A 5B2MA 2J5EA 3NYNA 5L6PA 2OJ9A 3MPMA 4YJOA 2BIKB 3PTGA 3W2OA 4JX3A 1FGIA 3KC3A 2OGVA 3C4ZA 3RAWA 1SNUA 4HGLA 3KRRA 4CXAA 3BHTA 3TV4A 3AT3A 3Q9ZA 4Y83A 4ZJIA 4L00A 5J5TA 2J9MA 5AADA 2P2IA 4NEUA 4YLKA 3UZTA 2P2HA 5CU3A 5I9VA 4IB1A 1UU7A 5CSVA 5CQWA 4AN3A 3ZM4A 3QX4A 3DKGA 4ENXA 5JZJA 1WVXA 4JS8A 3N4VA 4JL9A 4JDIA 4YPSA 5M08A 4I5PA 4K33A 3UE4A 3QFVA 4BCOA 4EC9A 4XV9A 5EM8A 1F3MC 5I9ZA 4N0SA 2CMWA 3BV2A 5M53A 3GNIB 4G6LA 4FTOA 5HOAA 5AA8A 4WG5A 2IVTA 4MTAA 4MVFA 2C47A 4I0SA 5KNJA 3UOLA 3NX8A 4XP2A 4YC8A 3NNVA 4IAYA 4X6QC 4DITA 3V5JA 4D4VA 5GIPE 2OW3A 1PXIA 2VO6A 2GS7A 5HVJA 4BDGA 4CFWA 1FMKA 2XM9A 3BLQA 5HNGA 3M42A 5EM7A 4ACDA 3HV4A 2CCIA 4NM3A 4YLLA 4FSNA 4HYHA 2EUFB 2XRWA 1JLUE 4JG8A 3FZ1A 4CT1A 2R3FA 4GFMA 3A2CA 1OIYA 2VTIA 3D15A 4M7IA 4TN6A 2VRXA 1H1SA 4YZBA 5CXHA 3R9OA 3AC3A 1H0VA 1JPAA 2W1IA 2XNGA 3A7GA 3DAEA 4KBKA 2VU3A 5IUHA 5C9CA 2BFYA 2GHGA 2CGXA 3R7EA 3O71A 3F5XA 3V3VA 4E6QA 4FIGA 3ALOA 4I94A 1M2QA 3HV6A 3PSDA 3QKMA 4OTRA 1Q3WA 1O6KA 1OUKA 2WTVA 5FEDA 4GYIA 3SXSA 1Y91A 3L8VA 4PTEA 2C3LA 2RF9A 5IZFA 4AGUA 2YCRA 4LQMA 4ANLA 4DH3A 4FT5A 4KSPA 3ORIA 4S30A 4D4RA 4FV7A 4CEGA 4FKGA 2UUEA 4KKGA 2YABA 3DB8A 3IQ7A 4DH1A 2ITUA 3OWLA 3D5XA 5LARA 5JN2A 4LOQA 5GJGA 5AP5A 5IU2A 3VBQA 4A06A 2VNYA 5CAPA 4JX7A 3QXOA 5K4IA 4F0IA 4WRSA 3GU7A 5CZHA 5BYZA 2W5AA 3IW4A 4YTIA 4D2RA 4FX3A 3MJ2A 3ACJA 4M69B 3BYUA 1G3NA 3LXKA 5CT0A 1PXOA 3W55A 1YOJA 1Q97A 2PVYA 3LJ0A 2B0QA 3THBA 2C4GA 4RQVA 3FQHA 2OFVA 4FSZA 3OOMA 4IEBA 2VTJA 3E3BX 4L7FA 3SW4A 2IVSA 3JVRA 3NUNA 4X3FB 2BAQA 2QOBA 4Y95A 4FNZA 5LVNA 3OW3A 3MY5A 1J91A 4U3ZA 4PDOA 3VF8A 3HAMA 3VUDA 3QF9A 3DKOA 4UX9A 5CSXA 4HZSA 2JFMA 3VHKA 3B8RA 3AGLA 4BKYA 1U46A 2GTNA 3ODYX 3ORZA 4Y8DA 3R7UA 5A14A 5IEYA 1LP4A 2C1AA 3CGOA 3UMXA 4R1VA 4AG8A 5HU3A 3NUPA 3R6XA 4E5AX 1HCKA 1OL5A 1Q5KA 3L9PA 5J1WA 1WMKA 2RSVA 3E62A 2ITZA 2WO6A 4JBPA 4M14A 5H8EA 2XK7A 5EQPA 5AP3A 2NO3A 4FL2A 4WG4A 4IDVA 3A7HA 2W1HA 4E4NA 4DFUA 3VAPA 2FYSA 4JR3A 4KBAA 4H05A 4DFBA 1ZLTA 5J79A 3DK3A 1PXMA 4RRVA 3H10A 1MQBA 4X2FA 4BDJA 3D83A 4MXOA 3CKWA 5DR6A 5CF6A 5IPJA 4XYFA 5LWMA 3OEFX 4ORKA 2OH0E 4DEAA 3ROCA 2VO0A 3E7OA 2EU9A 4FEWA 2JKQA 1OKYA 4O7SA 3O23A 5GZ9A 3ID6C 3EQFA 1JKTA 4IZ5A 3FZTA 4GJ3A 2GS2A 1BI8A 4XCUA 2R3IA 4H3QA 2RKUA 4WKQA 3DFAA 2BKKA 1SNXA 4IVDA 4WUNA 3AC1A 3PG3A 3UO4A 5HIDA 3I6UA 3LZBA 5C27A 2BZHB 3UVPA 4FMQA 3W2PA 3R1SA 4UN0C 3FI4A 2C3KA 3IK3A 3O50A 1URCA 4BDBA 4BL1A 2B9HA 4FKRA 4JDKA 5FM2A 4EK6A 1CM8A 2REIA 2ZB1A 4O7WA 3D9VA 5C8KA 4EOOA 4MXYA 5JEBA 5DR2A 2X2LA 4RWKA 1GOLA 3DBEA 5KBQA 4DEEA 3ET7A 1WBPA 3KRWA 3LFSA 4QTBA 3OP5A 2CN8A 3P79A 1QPEA 1I09A 4S32A 5HU9A 4Q5EA 5DR9A 3BPRA 3JYAA 5FEQA 4HZRA 2OJFE 3OT8A 4BDKA 4J53A 1UA2A 3UODA 4MKCA 2UZVA 4U3YA 4CNHA 1OKZA 2OJJA 2WMXA 3LVPA 2DYLA 4QMXA 2WTIA 4ANSA 5A4LA 3NYOA 4JBVA 2EXCX 4LOOA 3V04A 1W83A 3FJQE 3V5QA 4DEIA 4ENYA 3DT1A 3NUSA 3F88A 4M0YA 3PXFA 4QP2A 5LVOA 5FTQA 3ZRMA 3D0EA 2GU8A 4ONAA 4CGAA 1I44A 3CD8A 2V62A 1YXVA 4IHPA 5LMAA 4RIYB 3U55A 3R01A 4EH5A 5TE0A 4XG6A 2AUHA 2PMLX 1WZYA 4RIWB 4C4FA 4RQKA 3S0OA 2WTCA 1P2AA 1YQJA 4NKSA 4PDSA 2CGVA 5HD7A 2R7BA 3MIYA 4QTDA 3HYHA 4QP8A 3RZFA 1H1PA 3ZOSA 4F6WA 2WU7A 5H2UA 4QP7A 4USFA 3NUXA 3GQLA 2WU6A 4JQ7A 4GK3A 2YEXA 5LWNA 4E20A 2R0UA 1OGUA 5T68A 4ZTLA 4AA4A 3F66A 4CT2A 2QU5A 3QZGA 5HCXA 5A4TA 4JQEA 4DA5A 3I5ZA 1FBNA 5FM3A 5DN3A 2XA4A 4D4YA 2J6MA 3A4PA 2XJ1A 4BR3A 5TOZA 4O7TA 4DG3E 5E91A 5HTCA 3ZC5A 3GFEA 5D1JA 2YISA 4QYGA 4F09A 4EOPA 3ZH8A 3WZDA 4D4SA 4EOJA 5KZ0A 2PY3A 4J7BA 3GXLA 3F61A 4TWPA 4RZWA 2WIPA 3JS2A 4YTCA 4LG4A 1CMKE 3E8NA 1TKIA 3H3CA 3CD3A 4UBAA 2WQOA 3QCQA 1OPLA 1QPCA 4WUAA 3D7ZA 1Z9XA 2OZOA 3NR9A 4QOXA 5D7VA 5LJJA 4TZRA 3OTUA 3BGZA 2V7AA 4PRJA 4WHZA 5FTOA 4NYEA 4W9WA 3PXKA 2GDOA 2UV2A 4F9WA 1YWRA 3LFQA 5J8IA 4GUBA 3ZTXA 3QTIA 4D0WA 3UPZA 2PUIA 1ZOGA 4XHKB 4FTTA 4UMUA 1MRYA 4ZTHA 1ZMVA 3FHRA 2YIQA 4IX5A 5EDPA 5GHVA 3RCDA 3EQCA 3GVUA 3MH2A 2W9FB 2PE0A 2Y6OA 3OCBA 4HNIA 4IFGA 4QMZA 4WOVA 2VWBA 2R3QA 5AP6A 3D7TB 3F3UA 3KMMA 4DEBA 1OPKA 4F0GA 5CSPA 3FKLA 4PL5A 3MY1A 4F65A 4L43A 4A9SA 3QGYA 2OF2A 4MD8E 3BCEA 4O2ZA 5FD2A 4HVSA 2UW3A 3BE9A 4WIHA 2HYYA 4QMNA 3V5PA 3PIYA 4O0TA 5DPVA 2RFSA 5EI6A 4K77A 4BYJA 2YM6A 4JOAA 2XEYA 2X2KA 5HX8A 3KFAA 2H96A 2WELA 2ONLA 5CLPA 3DQWA 3SG9A 3KULA 5TKDA 4BDHA 2IPXA 3PRIA 3K5UA 5LVLA 3TKIA 1TQMA 2PYWA 4AS0A 5TO8A 4DLJA 2VTLA 3F6XA 2F2CB 2Z2WA 3HMMA 4RFZA 1OL1A 2J90A 3VS7A 3TDWA 3DJ5A 5D9HA 4O0YA 5CY3A 4BZNA 2ZV8A 3NUAA 2JEDA 4UZHA 4EH8A 2Z7RA 3EWHA 4YGAA 3C9WA 3ACKA 3HP5A 4M13A 4E6AA 2I40A 2JAMA 3UVQA 4EUTA 2EXEA 5A4CA 2BDWA 2GNGA 2W4JA 4C2WA 3RKBA 4DT9A 3VRZA 1OIUA 4KWPA 3O17A 2WOUA 4OTWA 4FR4A 3AC2A 1KV2A 2OJGA 1P14A 5FUTA 4O0VA 1XH6A 2QD9A 1FQ1B 1SMHA 2XNOA 4GT3A 5EYDA 4ZS0A 4DGMA 4UWCA 2XCHA 2WXVA 3H30A 2CNVA 2GQSA 5FGKA 4U9AA 5CU2A 3OY1A 4I41A 4M97A 2GQGA 4FTMA 5IA3A 1VYZA 3ZFMA 4YU2A 4FKPA 4I3ZA 5A54A 3R2YA 5L3AA 3UNKA 1XH4A 3H9OA 2PUUA 4U40A 3EL7A 4I5MA 4K9YA 5AFVA 4CKRA 4HCVA 3QTUA 4OTPA 1GZ8A 1Q8WA 2J7TA 3JVSA 3POZA 4FT9A 4FTIA 1RW8A 3VW6A 3UJGA 1BYGA 2E9VA 2C69A 3EYGA 3UYTA 3VS4A 3W33A 4AX8A 3QQLA 4WNPA 5AV0A 2PL0A 4JAIA 4BGGA 3KXZA 1BL7A 2XKEA 4BDCA 4APPA 4FEUA 2V55A 2XIRA 3LQ3A 4FZ6A 3FXZA 4UMRA 4USDA 3W10A 5EI8A 1FVVA 2IZSA 2X39A 4HGSA 4NH1A 3SOCA 1NW1A 3R7GA 2QHNA 3TXOA 5BQ0A 2WMWA 3FI3A 1KE9A 2G2FA 1XJDA 2XP2A 3C4WA 3I0QA 1KE6A 2HWPA 3QCSA 4MK0A 5HE3A 3RMFA 2HXLA 3S1HA 3U8WA 4BBFA 4O84A 4KNBA 2OXDA 2R0IA 3FZOA 3GCVA 5BVWA 4IB5A 1Q8ZA 1BX6A 1IG1A 4YZNA 4M8TA 4IB3A 3B8QA 4YR8A 3R8ZA 5M51A 1PXJA 5IDNA 1A48A 4AWIA 4ZTMA 5CI7A 5HE2A 5KMOA 2XNMA 3SC1A 4QMTA 4FZDB 2J0MB 3LM0A 2LAVA 3HX4A 2Y4PA 3P0MA 4IC7A 4A4OA 4CRLA 1S9IA 4OUCA 4YC6A 5CSWA 4CFMA 3LPBA 3ZHPC 2R3HA 4CMUA 2OBJA 2YIWA 5IQGA 3QZHA 3DZQA 2FVDA 5HG9A 2QLQA 4C4HA 3HUCA 1JVPP 4F64A 4J52A 4YZ9A 4C8BA 5HORA 3Q2MA 1KE5A 3PWDA 3UQCA 5HG8A 4FV8A 5HHWA 2A0CX 1GZNA 2J0IA 4QQTA 3HV7A 4PDPA 3KL8A 4AE9A 4FSTA 2OKRA 2PMNX 4BTKA 3PJ8A 2PUPA 3VW8A 3FKOA 4JDJA 2J0KA 3L8SA 2CKQA 4OTHA 2XNEA 1ZYJA 5T3QA 3NLBA 5HNIX 3FLSA 4RX7A 1H25A 4FIEA 1FINA 2DWBA 4J1RA 5CI6A 2KTYA 2ESMA 3MFTA 3RPOA 4N57A 3ZM9A 4F4PA 4II5A 2W5BA 4AZTA 4JIKA 4KINA 2UW6A 2CLXA 3FZSA 3BWFA 1AD5A 2BRMA 5AP7A 5AR4A 1UNHA 4CZTA 2R9SA 2YM8A 1ZYDA 2XYNA 3G6GA 5DLSA 1PY5A 3FI2A 3Q04A 3FY2A 5ANIA 4U0IA 4E26A 4U97A 4U42A 3LFNA 4IZ7A 3LW0A 3II5A 2Q0NA 1M7QA 4YHTA 3P5KA 2FSMX 3IW6A 5HIBA 3AG9A 4FVRA 5EH0A 3H9FA 5IQEA 2WPAA 2F9GA 2QOQA 3RWPA 3NSZA 4ASXA 5EOBA 2G2IA 4FKUA 4QP9A 5LXMA 2F49A 3FQSA 2GNLA 2XBJA 4EBVA 3RTPA 2ETMA 4W8EA 1NT2A 3CE3A 4HYUA 3OROA 4M68A 1F5QA 3OTVA 4NW5A 2C30A 2YCFA 5GJDA 3WOWA 3HAVA 3DK7A 4U44A 5CZIA 4JAJA 2QVSE 3COMA 2F7EE 1JWHA 4FTJA 3FYJX 3P4KA 4IAIA 4ITJA 2JIIA 2ZDTA 1O6LA 5HE1A 2CNQA 3MH3A 1KV1A 4B99A 4C4JA 4G1WA 3WF7A 1G8AA 3A99A 4QMLA 3ROYA 4YJSA 4F7JA 1P4OA 1Z5MA 5E7RA 3Q6UA 5AR5A 4NSTA 3CBLA 3BYMA 2A1AB 4HVGA 3UC3A 4BN1A 1REJA 4O7NA 3LM5A 3HMIA 4DH7A 3WYYA 1XH7A 4CRSA 5DOSA 4G31A 1ZYSA 3GQIA 5I3OA 4BKZA 4TXCA 1JNKA 2VV9A 1V0OA 3Q32A 2O64A 1XH5A 3GCSA 1XH9A 3Q60A 2CPKE 2WOTA 4GT4A 2XK8A 5AX9A 3Q9YA 1SYKA 2XZSA 4MWHA 4X6RA 3TNIA 4Z3VA 4G9CA 3VC4A 2BAKA 5HBHA 4EC8A 3SHEA 1YKRA 3WF9A 3P08A 3EFLA 1SVHA 3F2AA 4FV3A 4BDEA 2ITVA 3UGCA 4QMWA 3TM0A 3UVRA 4YZDA 1NVSA 4IH8A 4JRNA 2W9ZB 5GZ8A 3MSSA 2C3JA 3GT8A 3Q52A 4M12A 1QPJA 2UZNA 2X7GA 4FSUA 2QHMA 3U6HA 1BL6A 5A3XA 3FLYA 1YWVA 3DXQA 5FG8A 1YI6A 5KMMA 5K4JA 2YIRA 2E9NA 2P0CA 4JJRA 4FTUA 4G17A 2UZWE 3CPCA 3RK9A 2C1BA 4FT7A 4IX4A 4RC2A 2Q83A 2YLFA 4DG2E 3ZBXA 5JFSA 3KULB 4AZEA 1ZARA 4I0RA 4RJ6A 1UVRA 4I5HA 4IX3A 2JDVA 1K3AA 4NKAA 5DRDA 4ZSGA 3RI1A 4AZSA 3QHRA 2VTSA 3HRBA 1X8BA 3RJCA 3M2WA 4E6DA 4F1OA 4ZY5A 1M17A 4EHEA 1WBVA 3A61A 3I79A 3PXYA 3TN8A 3CY2A 2W1CA 4P4CA 3Q4CA 3K5VA 4TT7A 4C4EA 4IVBA 4TYHA 4FL3A 4PX6A 4AOJA 1OL7A 2QCSA 4MXCA 5AR8A 3C5IA 4QMSA 2ITPA 2YACA 3FMDA 3LLTA 5I9WA 3LLAA 3SAYA 4FEXA 2R3GA 5EQYA 4IW0A 4O21A 5DEYA 2IW9A 4G16A 4B7TA 4KRCA 1KSWA 5D7AA 4EYMA 2JIVA 4WNMA 2GNJA 4RX8A 5ETAA 3MTLA 4GG5A 4FE2A 4EHGA 4RWLA 3I6WA 2OH4A 5AAFA 4O7YA 5CTPA 5CYIA 5CNOA 3OWJA 3QWJA 3QBNA 3VS0A 2WTWA 3D5VA 3DZOA 1UKHA 4QPMA 3PVWA 4TWCA 4ZSEA 3SW7A 3QYZA 3P9JA 3PJCA 4GMYA 4OAVB 4LMNA 2E2BA 3OD6X 3S00A 4EOIA 4RFMA 4RA4A 2VTOA 4ZOGA 4CSVA 3ZO3A 4LV8A 4MF0A 2WD1A 4YHJA 2QO9A 2VTHA 3GP0A 3FKNA 3K3JA 4NM5A 4B6LA 5BUEA 4Z9LA 3CQUA 5JT2A 3OXTA 4EBWA 2I7QA 2OO8X 5EOLA 4AOTA 2IWIA 4GIIA 3UYSA 1PMEA 2GPHA 1UWHA 2X0GA 3ORNA 2YDJA 2WMRA 3TT0A 4ACCA 3CJGA 3GFWA 4F63A 4HCUA 4X3JA 4F9BA 2RG6A 2YFXA 3DNEA 2XEZA 3FPQA 1V1KA 3E63A 5DGZA 1TQIA 4E5BA 5JSMA 5IUIA 5CEOA 3ITZA 1OMWA 2YHVA 3VS5A 3HMPA 3DBDA 3MFSA 4ALWA 4IADA 4EZ5A 3LFBA 4HJOA 1R78A 3VF9A 3A7FA 3UBDA 4QT1A 2Y6MA 4G3CA 3V6RA 2XUUA 5AR2A 4IE9A 1XBAA 2XH5A 4DTKA 3ANQA 2Y4IB 2PE2A 1SVEA 2W4OA 3OZ6A 3AD5A 4E4XA 3QTXA 2WTDA 4MQ1A 3V01A 4BCGA 3BBWA 4S31A 3W16A 4LI5A 4FVPA 4L44A 3W2RA 4AGCA 2BILB 3IGGA 2IVUA 5A9UA 2X6EA 1E1XA 3WBLA 4I21A 4IBMA 2JFLA 3R9HA 4BZDA 5LMKA 3FC2A 4D2TA 2HK5A 4AGDA 4NIFA 3QGWA 2R3PA 4MEDA 4B8LA 5IA0A 4ZAUA 4GUEA 4IDTA 5AR7A 5C03A 2XK3A 3DBQA 4RIXA 3A4OX 4CTCA 3T3VA 4XRJA 5E90A 5BUIA 5C1QB 2W1FA 3F7ZA 2ITWA 3I7CA 3OXZA 3UO5A 4C58A 4NUSA 2QNJA 3EQPA 4BCQA 2C5OA 2ITNA 4BHNA 1BMKA 4BRXA 4F1MA 4L6QA 3FDNA 5C26A 3EOCA 2GSFA 4C59A 3TWJA 1PF8A 3VBTA 2H34A 3F2RA 2UZOA 2OSCA 1OL6A 2X2MA 3MBLA 4W4VA 2C0IA 2FGIA 1SZMA 2BZKB 2BRHA 2R3LA 3BELA 3F3ZA 2UW7A 4D55A 3ZDUA 4H39A 4LM5A 1IR3A 2ZV7A 1UWJA 2YM5A 3QCXA 5GINE 2VX0A 3VUMA 3EN9A 4IMYA 3QTZA 4I4EA 4BGHA 3ZBFA 1IEPA 5L6OA 5HO7A 3ZXZA 5LMKC 3PSCA 2R3KA 3OXIA 5JKGA 4YLJA 4OTGA 3M11A 4FKVA 3WZUA 1YHVA 3CQWA 5M4CA 5A4QA 3UQGA 4BCHA 4NJDA 3PJ2A 4H36A 3RGFA 3BI6A 5I9XA 4IC8A 4JR7A 1Q24A 2ERZE 2ITQA 2WAJA 3W32A 2H8HA 3EKNA 3R7IA 2IJMA 3QHWA 5CU6A 4BY9E 4FL1A 1QMZA 2YJSA 5A6NA 1FVTA 4G6OA 4K18A 1WBOA 2C5VA 3L8XA 5IMXA 5KE0A 3FMHA 5JQ8A 3AT2A 3OFMA 5AP2A 2BUJA 2C0OA 3DB6A 5EI2A 4NZWB 4BIBA 1GIHA 5AIKA 3KKVA 1J7UA 5DFPA 4CD0A 4GU6A 3W18A 1V0BA 1DI8A 2ZMDA 4MBLA 3KXXA 3MFUA 4K2RA 4WBBB 4E93A 3JPVA 3TZ9A 3OWPA 4AFJA 4UB7A 4BI2A 5I0BA 3U6JA 4CCBA 3FSFA 3VQHA 2XK4A 4O86A 4FF8A 3Q53A 4QYHA 4GRBA 5M55A 3VN9A 4XP3A 4PF4A 3TJCA 4BWXA 1JSTA 2WMVA 3PIZA 4I0TA 4Z7GA 1FVRA 5E8XA 2R3JA 1XBBA 3P7BA 4QYFA 3FMNA 1YXTA 3ZZEA 2BR1A 3R2BA 4E8AA 1Y6AA 2XNNA 4PPCA 5M09A 4LGGA 4BB4A 2OJIA 5IA2A 2XJ0A 4LGDA 5BVNA 1ERKA 3KQ7A 3NWWA 1J3HA 2FA2A 5D41A 5TT7A 4FKIA 2WTJA 3TG1A 1ZOHA 4EI4A 5CALA 2PZYA 3UZRA 4IANA 3POOA 1PMVA 4WSQA 1T45A 2G1TA 3BBTB 2HZIA 3IONA 3QUPA 3TTIA 5ANEA 1H4LA 4MNEA 4C62A 4MBJA 4TKSA 3TNHA 2JD5A 2BDJA 3QQGA 4GU9A 4I24A 4BTFA 5G1XA 4DFLA 5IQCA 3CTJA 1OI9A 4NT4A 4YJPA 3UIMA 1OM1A 1ND4A 4J98A 1GZOA 3DDQA 2BTRA 4FTNA 4P90A 2PULA 3E8CA 4PL3A 1VR2A 3A7IA 3RZBA 5FP6A 3U9NA 2QU6A 3ZXTA 3FMEA 2BZJA 3P78A 5CEMA 2PUNA 3EKKA 4GS6A 4L46A 4XUFA 1NXKA 5DVRA 4FSQA 4XV2A 2YJRA 4KIOA 4C35A 2BTSA 2PZRA 4G9RA 1YXSA 4I23A 4EOLA 2E9OA 5CNNA 2HW7A 5M4FA 2IZUA 3CS9A 3QD2B 1WVWA 3ANRA 3SKCA 5HG7A 4FTQA 4IWPA 2WQEA 4U81A 4BTMA 2Q0BA 2W7XA 5IEXA 5BVFA 4QP4A 3KEXA 3PXZA 4ZJJA 3OUKA 5CEIA 2UZDA 4FGBA 1Z57A 3MFRA 3PLSA 4BC6A 4EUUA 5CAUA 5HTIA 2XBAA 3IO7A 4IAFA 4OLIA 3BHUA 3UIUA 3HVCA 4ZJVA 3C4CA 4DT8A 3F7WA 4TYHB 3EZVA 4YBJA 1OIRA 3WE8A 1IRKA 5IDPA 4GK2A 4YPDA 4DCAA 2GNHA 3H0ZA 3S4QA 2OICA 4RVTA 3BRBA 3EH9A 3ZSIA 3GU6A 3BX5A 5CF4A 5DT4A 1ZAOA 5AAGA 5ITAA 5CAOA 1FMOE 3VRYA 2Y7JA 1TVOA 4R8QA 3MV5A 4G3DA 2BPMA 3PUPA 5HO6A 4R78A 3KXMA 4BCFA 4EQUA 4YMJA 3PE2A 3TNQB 3AC5A 3V5WA 3TUDA 4RLLA 5JFXA 3U4UA 1IASA 3QZFA 3IOPA 2SRCA 5G6VA 3UP2A 3HDMA 4EOQA 3QQUA 4DLIA 5M07A 5AX3A 4ZZMA 3LFCA 3G2FA 3EJ1A 1ZY4A 2VAGA 4FV5A 4IQ6A 4KABA 3V5TA 5L8KA 3QX2A 1DAYA 2WNTA 4AA0A 5L2SA 3AC4A 4F7NA 5HE0A 3PZEA 4R6VA 3L9LA 4V05A 4BIEA 4XOZA 2OLCA 5AUUA 1VJYA 3HZTA 2YWPA 4XOYA 5AUWA 1Q3DA 2WMBA 3ZLXA 1KUTA 1RDQE 3QD3A 4IWDA 4J8NA 1L8TA 4WG3A 5C4KA 1Q62A 3FHIA 2EB3A 3EYHA 4EWQA 3KN6A 2VNWA 4Y72A 3UPXA 4DC2A 4L67A 1XO2B 4WA9A 1L3RE 3VJOA 5I5ZA 4DFXE 4FA2A 4GT5A 4TYEA 5FTGA 1S9JA 3JY9A 2Z7LA 3KVWA 4G3FA 3OEZA 5CEPA 3I5NA 2YWVA 4YO6A 5CSHA 3BIZA 3VUIA 4RZVA 3SXRA 4U5JA 1LPUA 4QNAA 3KMWA 5HNBA 5LVPA 1YOMA 5HICA 4FIFA 5LVMA 5J9ZA 4YUQA 2ZOQA 1WVYA 3CTHA 2WZJA 3FMKA 4EH3A 4D1SA 4D9UA 4YNEA 4QMOA 2HCKA 3MPTA 4L9IA 3TNPC 4QPSA 4CG9A 4J99A 4UV0A 2Y9QA 4O6EA 2QOCA 4DGLC 2JGZA 4JG7A 1T46A 2NRYA 4RVMA 2OXYA 2IO6A 4CFUA 4FG8A 4YJTA 5J7BA 5HLPA 4EKLA 4IAAA 4JQ8A 2ACXA 4P2KA 4IWOA 3WZKA 2R3NA 3KRJA 4CV8A 1ZYCA 1H24A 4FBXA 1P5EA 1ATPE 2BRGA 4ZLZA 4NIFB 3RP9A 2VWIA 4PDYA 2C6MA 3BE2A 4RIXB 4RX5A 1Q8UA 4R7HA 5KCVA 3LJ1A 3C0HA 3IOKA 3U9CA 4K1BA 3TZMA 3MA3A 4NJ3A 4DTBA 2ZM1A 3GU4A 3G0FA 2XB7A 2EXMA 3VS6A 4HGEA 5FXRA 2R3RA 5K5NA 2B9IA 3LHJA 2YM4A 3DY7A 3QTRA 2F2UA 2XF0A 3PSBA 4IM3A 3CTQA 4W9XA 4GH2A 3TCPA 4FG9A 4Y46A 4D2SA 4Z55A 1JAMA 4N4SA 2PE1A 2CKEA 4WRGA 3WARA 3NVMB 2RFNA 1REKA 2J0JA 1CDKA 2QURA 3PPKA 5LOHA 1H27A 4GKHA 5M4IA 5H3QA 3WF5A 1ZWSA 2I0YA 3VBVA 4C37A 5IH4A 2CNUA 1R3CA 2YIXA 3RAHA 4CFXA 5KO1A 2A27A 3IW8A 3NDMA 1U54A 4ZLYA 4J95A 4FUYA 3CR0A 5IF1A 3U54A 2HOGA 5KMNA 5CT7A 3EFJA 3LFAA 1XWSA 4KD1A 5E92A 3RVGA 1FGKA 2W4KA 3CP9A 4LUEA 4R1YA 3RNYA 2VWXA 3BU6A 2UVYA 3SG8A 3KXNA 3ENMA 5E8VA 3LMHA 4BDDA 3EQRA 2VTMA 5J7HA 3IDPA 2H6DA 2J51A 5C4LA 3G51A 4L01A 4GCJA 5HIEA 1YRPA 4XJ0A 2JBPA 2PVLA 3UNZA 4EYJA 3A60A 3N9XA 3QQFA 1PXPA 2R2PA 3K3IA 2XK9A 4MWIA 3WI6A 2CKPA 2B1PA 2VN9A 2W17A 1PKGA 3QKLA 4R3PA 4H1JA 5JGBA 3F69A 4L3JA 2UZBA 4O7ZA 4F9AA 2C6EA 4HGTA 4USEA 2C68A 4FSMA 2BVAA 1ZXEA 4EOSA 1YVJA 3BYOA 4RIOA 2NRUA 4GK4A 5ETFA 3R28A 2ITXA 3HDNA 1B39A 3LJ2A 4CKJA 4C3RA 4NCTA 3N51A 3NEWA 3AD6A 4IB0A 1XHAA 3AQVA 3FL4A 3WF8A 3MB7A 3ZLWA 4BDFA 4C38A 5HI2A 3Q3BA 5AR3A 2W0JA 3F5UA 4QMPA 2BROA 5ETCA 4X7QA 4CFVA 5L2WA 3VBXA 2G9XA 4EL9A 1RE8A 1PYEA 2GMXA 2OF4A 2XYUA 2O0UA 4ANNA 4E3CA 3WZJA 3FBVA 4EK3A 4OAUC 3ZDIA 4MNEB 2YERA 2QG7A 5KHXA 3OT3A 4XLIA 1UKIA 3HEGA 3RINA 3TTJA 3UIXA 4PTCA 4YO4A 4B9DA 3VS1A 1PMNA 3PWYA 3MN3A 5GNKA 2WB8A 1DI9A 2VTTA 3KMUA 2OIBA 4OT5A 2QOHA 3IG7A 4RC3A 4YZMA 1B38A 3O96A 3PVUA 4FK3A 1IAJA 3I1AA 4S33A 4FEVA 1JKSA 3LOKA 5JZNA 3SDJA 1PW2A 5H9BA 4GYGA 2JLDA 3EHAA 4AE6A 3GB2A 2W96B 4O6LA 4QTEA 4NCTC 5AA9A 5AIRA 2IW8A 3KVXA 4L45A 4L3PA 3HLLA 4YJNA 1UNLA 3QXPA 2OZAA 2C6KA 5IA1A 5ICPA 1B6CB 4YZCA 4YTFA 2HZ4A 3E87A 3JXWA 5FP5A 4DEHA 4J96A 5I4NA 3O7LD 2PTKA 1MRVA 4CKIA 3D2KA 1OUYA 3K54A 3ORLA 3OWKA 1NVQA 4BVUA 4CLJA 3MJ1A 3FLWA 3PA4A 4YURA 4RLKA 5AP0A 5ETIA 3VBWA 1GNGA 4IWQA 5E8TA 2PVHA 3KB7A 4GFOA 5HKMA 4DEDA 5ACKA 2C3IB 2JC6A 4DAWA 5TF9A 4AW5A 3ORMA 3QTQA 2C5XA 5EW9A 2Y0AA 3FYKX 3FLQA 4RVKA 2ZYBA 2KULA 5AV3A 4X2KA 4Y73A 3R9DA 4PP9A 4ITHA 4K11A 2YDKA 3PY0A 4O22A 4BCJA 4XBRA 1U4DA 3IDCA 4K0YA 4HPUE 3FEGA 1OZ1A 4LGHA 4XG7A 3EB0A 1MP8A 2BFXA 4HCTA 3MWUA 3ATTA 3R1NA 4QQ5A 5CX9A 3LKMA 5B7VA 4S2ZA 2WTKC 3E5AA 1H01A 2XJ2A 4P5ZA 4LRKA 1O6YA 4AN2A 4QYYA 3PP1A 3HA8A 5CWZA 3AMYA 3C4FA 3EL8A 3NW7A 3O8TA 4KS7A 5ANOA 3FWQA 2PZIA 2YM7A 4ZTSA 4G6NA 1NY3A 4BI1A 3BYVA 4C33A 4A7CA 3NMUF 4RBLA 4DGNA 5JFVA 1XR1A 3GCUA 4BHZA 4AT5A 2XRUA 5DEWA 1JKLA 4AOIA 4Y85A 3QRKA 3S2PA 1A9UA 2QC6A 3QC4A 3S95A 2HENA 4EORA 5KZIA 4IACA 3UG2A 4OTQA 5T6KA 4EHVA 5DH3A 2RFDA 4AFEA 3EIDA 5ACBC 3M1SA 1R0PA 3QUEA 3O0GA 3V8WA 4CMOA 4EH2A 3NIEA 3FY0A 3NCGA 4ACHA 4O7RA 3DV3A 4RT7A 3W8LA 4PMMA 2V5QA 4HVHA 5L8LA 1AGWA 3BV3A 2BALA 3VQUA 2WMQA 2X4ZA 3AOXA 5CVHA 3PP0A 1UU3A 4FT3A 2HZ0A 3Q96A 2OIDA 3LMGA 5B0XA 4DGOA 3R8UA 4EH9A 4DBXA 2NPQA 2FUMA 3GUBA 3PYYA 4JBOA 3DJ7A 3FL5A 3SRVA 3DGKA 4I5CA 4F0FA 3NUYA 1UU8A 2OG8A 5IUGA 1VZOA 3PPJA 2UZUE 4NTTA 5GJFA 4NM7A 2A19B 3TEIA 3F5GA 3Q9XA 1KE7A 5A46A 3UOHA 1GIJA 1CKIA 1PKDA 3SX9A 3BQCA 5D12A 3RNIA 1JOWB 2OWBA 4RPVA 2VTRA 5IEVA 1JQHA 1YDTE 4ZK5A 2UW8A 4JBQA 3GBZA 4YJVA 4CYIA 2X4FA 4ZTNA 2J0LA 2GS6A 3HRFA 5AWMA 5DBXA 3DNDA 3FXXA 1YI3A 3RM7A 3CPBA 4FKTA 3E64A 2OU7A 3PJ3A 4TYIA 4KKEA 4C0TA 3ZC6A 3TI1A 3ZRLA 4AU8A 2G01A 3NNXA 4HNFA 4XX9A 2JDSA 3ULZA 3R04A 4AACA 5HLWA 4U6RA 1MUOA 3NNUA 4M69A 4A4XA 5KHWA 3PLAE 5LCKA 4KRDA 4DFYA 5BVOA 2B55A 2VUWA 3CGFA 2HW6A 3R21A 3P7AA 3PG1A 4GG7A 5HCZA 1HOWA 2DUVA 3JR1A 3LCDA 2IW6A 3OCTA 3O8PA 4DYMA 1ZZ2A 4QMMA 4UZDA 3CEKA 4IVCA 3V8SA 3ODZX 3KK8A 1GIIA 3G5DA 4Q5HA 1KWPA 2XCKA 3VUTA 5CF5A 5HX6A 3NW5A 5DNRA 2W06A 2PWLA 2JAVA 2J2IB 3DLZA 4BDAA 3WZEA 3EQHA 4PMPA 4X21A 3MH0A 5JRQA 4EZ7A 3TV7A 5DIAA 4RJ3A 1M2RA 1U54B 3Q9WA 3U87A 4D2VA 2W05A 4G3GA 3PXQA 4TWNA 4Z7HA 3PE1A 4FIHA 5H8GA 1Q4LA 3HNGA 2CDZA 3GCPA 2QOOA 4O38A 2X6DA 4I6HA
chains in the Genus database with same CATH superfamily
2QKWB 5HVKA 4JVGA 5I9YA 4BBMA 5AUZA 4TYJA 1U5RA 4I4FA 1M52A 2VWUA 3MIAA 4UY9A 3LIJA 4B4LA 2WGJA 5DT0A 1OL2A 5E8YA 5AEPA 4I1ZA 4K6ZA 4ANMA 4G3EA 1HCLA 2XVDA 1Q8TA 4QP6A 4HVIA 4YC3A 4AZFA 4UYNA 3VIDA 2BRBA 4PWNA 3PRFA 4HW7A 3TIZA 3D5WA 3SA0A 5L8JA 4C36A 4RSSA 5A6OA 4CV9A 3H4JA 4O1OA 4EK5A 3FI8A 5J87A 3TZ8A 3DBFA 3A8WA 4NTSA 4BWKA 2XMYA 3U6IA 3DKFA 5CEKA 3VULA 2VWZA 1APME 2WMAA 3CJFA 4BTJA 3GCQA 4PPBA 2HY81 3QU0A 1H0WA 4QRCA 2DQ7X 4A4LA 4W4XA 3DXPA 4EH4A 2VWWA 5K3YA 1CSNA 2V0DA 2G2HA 4NK9A 3O8UA 4C57A 2FO0A 4FTKA 3TKUA 3MGYA 5IKWA 3ZFXA 4AXAA 4JLCA 2J4ZA 1R1WA 2RG5A 3I7BA 3VUKA 3ZONA 2Z7SA 5B2LA 4FZ7A 3E8EA 5EHLA 3CC6A 4RFYA 3ZEWA 3QRUA 2CHLA 2X9EA 4AN9A 3NCZA 1WAKA 2WIHA 3NW6A 4DTAA 3W2QA 4B8MA 4DH8A 3FAAA 4V0GA 5M44A 3NAYA 4ANBA 5IG1A 1W0XC 3AMBA 5CANA 3VO3A 4MH7A 1W2CA 4E4LA 5EFQA 1YDSE 2JDOA 4KAOA 3ZO1A 3HMOA 4Q9SA 3F9NA 4TNBA 4ZTQA 1GY3A 1W84A 4DCEA 3RPYA 1H07A 4I22A 5K0KA 3QTSA 2YIYA 2O65A 4JDHA 3CSVA 4PUZA 4FKQA 4X2GA 2XIYA 4RX9A 4KKHA 3GC0A 1XBCA 3R0TA 4U8ZA 3K2LA 2HWOA 4R7IA 3F3VA 3QAME 3QTWA 2VGOA 2UW4A 4QNYA 2OZAB 2QR7A 5EW3A 2I0EA 4L7SA 4TPTA 5BUJA 4PTGA 4AT4A 3OBJA 3ZLYA 1LEWA 2C0TA 3U51A 5EKNA 2GQRA 4FV6A 3OUNB 2WTKB 3MH1A 4RIYA 2O5KA 3WIKA 4I6QA 4D2WA 2ETKA 5L2TA 5C8NA 4DGGA 2FB8A 1OVEA 3QLFA 5ANGA 4O0XA 4EOKA 2B52A 2HY0A 2FSOX 3FSKA 3MTFA 4G34A 2HELA 2R7IA 3BKBA 4KS8A 2UW9A 3RBWA 4R3CA 2EWAA 4KSQA 5BYYA 4XG2A 3O2MA 4M67A 3LFEA 4U45A 5JH6A 5K5XA 2VZ6A 3OOGA 3D5UA 5HBEA 4M84A 3W0PA 5F95A 3TNWA 3I60A 4RJ4A 2QLUA 1OBGA 5AUXA 3KK9A 2VGPA 4IAKA 3P86A 3FV8A 3MPAA 4F7SA 2WKMA 4EONA 2BDFA 4CZUA 4DG0E 1OKWA 4YP8A 4FSWA 2W5HA 4QYEA 4XH6A 4UMQA 3MVHA 5KMLA 4R7BA 4E4MA 4LYNA 4RG0A 3NPCA 4GSBA 4RJ5A 3SV0A 3F5PA 3C0IA 1Y57A 3DS6A 4AXDA 5CS6A 3LCKA 1LUFA 1EH4A 5GIOE 4C3FA 2ZDUA 2O63A 1W8CA 3C51A 4IJ9A 3ALNA 3R9NA 5BVKA 2FSTX 5KMIA 3WILA 3GU5A 2ETRA 4F7LA 4FG7A 4QP1A 5CEQA 5AJQA 4O4BB 3COHA 1YW2A 4C3PA 2XALA 3G9LX 4FYNA 4BKJA 1JBPE 3PIXA 4N70A 3GOKA 4FOCA 3COKA 4OR5A 3SVVA 3KGAA 2PK9A 2Z7QA 3GC9A 3NYXA 4FKLA 3C4XA 3V6SA 2Z8CA 1H26A 5IQIA 3ZO2A 2JDTA 2X81A 5AUVA 3WIGA 2G15A 2Z02A 3FPMA 4BGQA 1XMLA 3P1AA 2XM8A 3V51A 1SVGA 3JUHA 5EW8A 3D7TA 2HXQA 3SRVB 3QRIA 5HCYA 4O0RA 4AZVA 4H1MA 3UOKA 2YLEA 4AAAA 4ASDA 2A98A 4UMTA 4FTCA 3PA5A 4OBQA 2C6OA 3EQIA 5F4NA 1LEZA 4MD7E 4H3BA 3RHKA 4IIRA 4GKIA 3S3IA 4AXEA 5CENA 2V22A 3QA0A 4FIJA 3OG7A 4XP0A 3Q4UA 2VD5A 3RPSA 2XNBA 5K9IA 3DTWA 3KF4A 4ANOA 4P5QA 1YHWA 4GV1A 3DAJA 3VHEA 5CU0A 4GFGA 2CLQA 3R9RA 1UU9A 4TNDA 2IG7A 3VS2A 3FMMA 4UMPA 3RAIA 4RJ7A 4BYIA 3BQRA 3D14A 4MNFA 4EWHA 4ZZNA 1JKKA 4BIDA 2AC5A 2GNIA 2I0VA 2JKOA 3RAKA 4X2JA 3UP7A 2I0HA 3RWQA 1BI7A 3DAKA 4NM0A 4FV9A 3WF6A 2PVRA 2J50A 2XNPA 3WYXA 3R30A 1H00A 5FQDC 4LRMA 4XS2A 1CTPE 1KE8A 3RK7A 4LL0A 3REPA 5FBNC 5DWRA 3CKXA 1YI4A 3RK5A 5D10A 2X8EA 3KA0A 4I20A 4LMUA 3NRMA 2VTQA 4MXAA 3ZSGA 4AF3A 3MI9A 3PPZA 4AUAA 4I92A 5I9UA 3FUPA 3ZUTA 1PRYA 1WBWA 2ITYA 4A9UA 2QO2A 3HA6A 5BMMA 4AGWA 4O0WA 2X7OA 4EZ3A 2B9FA 5L2QA 4L68A 4MQ2A 3UOJA 1W7HA 3P7CA 2RL5A 3MB6A 3UDBA 4U80A 2ZM3A 1OKVA 1WCCA 3QRTA 4FKJA 3DOGA 4IZYA 4FT0A 2B9JA 2BRNA 4XV3A 3QQJA 4HOKA 2LGCA 3Q4ZA 4DHFA 2YCQA 3C7QA 3OS3A 4ARKA 4K8AA 3TL8A 4F6SA 4ITIA 3AKKA 3P23A 4IX6A 3MA6A 3FMJA 4W4WA 2VWYA 2XKFA 4DFZE 3BWJA 2VTAA 4I6BA 3BHVA 4RMZA 1OIQA 1IAHA 3QC9A 4QQCA 2P4IA 4G5PA 4JT3A 4YJRA 5F20A 5IA4A 4DEGA 4N6YA 4XRLA 4AW0A 2YZAA 2R3OA 4D58A 4EQMA 2BHEA 4YTHA 2XS0A 3FZRA 4TW9A 5J95A 4BI0A 5HG5A 3GI3A 4W4YA 4MBIA 2A4LA 3VNTA 5E8WA 4FNXA 2W1GA 1VEBA 2FH9A 2WMSA 2JITA 2ZM4A 3ETAA 3T9IA 3F2NA 4C4GA 3PY3A 4PMTA 1IA9A 3CY3A 1YOLA 2J5FA 4FK6A 4O96A 4ZEGA 5IQAA 2B53A 2R64A 5EQEA 2ITTA 4OBPA 4FSYA 4LOPA 5EM5A 4MX9A 4LV5A 4EOMA 2F4JA 2BIYA 4OW8A 3G9NA 4RWJA 3LXNA 3AKJA 3OHTA 4FTAA 1PXNA 4XG4A 3GGFA 5EM6A 5J1VA 4DF3A 1URWA 1OECA 4RWIA 3F82A 3G15A 5HZNA 1K9AA 1H1WA 3QALE 4XMOA 3R1QA 5M4UA 3QCYA 2BZIB 1H28A 4FV2A 4V0GB 3ZFYA 5HLNA 3FQEA 4IM2A 3ZMMA 2JKKA 4U79A 5JGDA 3IW7A 3DCVA 5CXZA 5FDPA 2IN6A 5FWKK 1Y8YA 5CAQA 4O0UA 2QKRA 4DN5A 5KKRC 1H08A 1R0EA 2BMCA 1M14A 3PXRA 1J1BA 3GENA 2OFUA 2RFEA 2YDIA 2WEVA 1FPUA 4FSRA 5ANJA 2QR8A 2IVVA 3MW1A 4Q2AA 4A9YA 5EK7A 2WQBA 5AP1A 3MDYA 3C5UA 4ANQA 3ZZWA 5A4EA 1PHKA 4CVAA 1STCE 4RVLA 3BLRA 4Y5HA 3HKOA 1P4FA 2GFSA 4R77A 5JGAA 3DLSA 3OY3A 4BCNA 3AKLA 3EQDA 2QONA 4FKOA 2VTPA 4O81A 4CG8A 4AP7A 4O27B 5BVEA 3V5LA 2BAJA 2OK1A 3HP2A 3R71A 5CF8A 4FTLA 4M0ZA 1U5QA 2ZVAA 4QQJA 3BGQA 3R1YA 3RALA 3TV6A 3LFDA 4O82A 1PMUA 1ZY5A 2DS1A 1BUHA 3LAUA 4AZWA 5KBRA 1WBNA 5AP4A 4G2FA 2YN8A 4FKWA 5E1EA 1YHSA 3FXWA 3ZS5A 2C6DA 4HYIA 5AM6A 3TIYA 3SGCA 2YITA 3KY2A 4BWPA 4CQEA 5FRIA 2HZNA 4E6CA 4FTRA 3VWAA 3O51A 3MESA 4JMQA 3DJ6A 3MVLA 2FSLX 1G8JA 3ULIA 4C7TA 3IKAA 3CQEA 4PY1A 5J9YA 1AQ1A 2PMOX 4U7ZA 3C1XA 4RC4A 2VTNA 4YBKA 4OTDA 2XIXA 3E92A 4PMSA 3QRJA 4I93A 2VO7A 3FLNC 5CASA 2UVZA 5GZAA 1Y6BA 4TTHB 1DS5A 5EHYA 3ORPA 4KIKA 5FBOA 4B0GA 5HD4A 5LCJA 4BCMA 2CCHA 2ZB0A 3ZYAA 4J97A 4H58A 4AQCA 2JKMA 3DK6A 5L4QA 1CKPA 3UC4A 3E7VA 2PHKA 4E7WA 3OBGA 4L3LA 4FZAB 4OTIA 3DDPA 3CLYA 5BPYA 2R5TA 4QP3A 2Z60A 5EG3A 2PVKA 3H9RA 3UTOA 2V7OA 5DE2A 4FV0A 4WSYA 4ACMA 3FZPA 2BCJA 4GL9A 2QOLA 4PV0A 3BZ3A 4F99A 3ORKA 5C01A 2WQMA 4BFMA 2WEIA 2ZV2A 3QKKA 4PP7A 4DBNA 4FUXA 3E88A 4D0XA 4GVJA 3UDSA 1Q61A 2HIWA 2WFYA 3EFWA 3BGPA 4ASEA 4KIPA 3QL8A 4EJ7A 4GEOA 3D94A 4FGRA 4TY1A 4BICA 5CAVA 2CJMA 4CQGA 1PXLA 5BVDA 3DKCA 3KREA 5I3RA 1MRUA 4M3QA 4TL0A 3KU2A 5B2KA 3MVJA 4C4IA 3HL7A 3EN6A 4IFCA 5DHJA 1W98A 2CGWA 3QZIA 4QMUA 4XBUA 3W2SA 5KX8A 5DI1A 2YZLA 3QD4A 3BLHA 4W8DA 3KF7A 5FXQA 2UW5A 2C5NA 4MAOA 5CQUA 5EYCA 3TKHA 3ERKA 3QA8A 5AV1A 5J5SA 5HTBA 3PFQA 2YM3A 2VO3A 2O8YA 4U41A 3QYWA 5IA5A 4XV1A 3R00A 4TYGA 4C34A 4UXQA 3R73A 2RIOA 4FEQA 4FYOA 3R7OA 4IZAA 2I6LA 3TZ7A 3D4QA 2BHHA 3N4TA 4ERKA 4UWYA 1RJBA 5F1ZA 2X1NA 4CTBA 4ALVA 5IH6A 4ZIMA 1WBTA 2O2UA 3DA6A 3UIBA 4F70A 4AW1A 1Q41A 3KXHA 5E4HA 1JSVA 2GFCA 4E5WA 3LQ5A 2QG5A 4BBEA 3O7LB 3R8PA 1GZKA 3C50A 4JIAA 4UEUA 5KMKA 4XEYA 1MQ4A 1H8FA 3GOPA 3NZ0A 1XH8A 2F7ZE 4MYGA 4OT6A 3NVKI 2GHMA 4QD6A 3E3PA 1Q8YA 5FDXA 5BYLA 3SXFA 4ZSAA 3R8MA 2CSNA 2UVXA 1ZRZA 4Z16A 4YNOA 5HBJA 3BU5A 3DXNA 2X7FA 3UG1A 1R39A 4EH7A 4F9YA 3R22A 3DBCA 1KOAA 1UV5A 2XANA 2JBOA 4F1TA 2ONLC 2GTMA 4EH6A 4NL0A 5E8ZA 3VBYA 3G0EA 5M06A 4O83A 4KA3A 3QLGA 4QMYA 2IF8A 4A9RA 1VYWA 3GC7A 2W99B 4A07A 4CFNA 4F78A 5L2IA 4S34A 3RPRA 1OITA 4FC0A 3W8QA 3W0OA 2UW0A 3IPHA 3ZSHA 2ZJWA 4KBCA 4OBOA 5FEEA 3T3UA 3IW5A 4D28A 3QQKA 3C13A 2CN5A 5BNJA 1OPJA 3A62A 4ZXTA 2PVFA 4IM0A 3OVVA 5KUPA 4OTFA 2B7AA 1ZMWA 4ZSLA 4NU1A 3GEQA 4UWBA 4X2NA 3NIZA 4D5HA 4ACGA 4JNWA 5EKOA 3LQ8A 4RA5A 1OB3A 4ZP5A 5FLFA 2JDRA 4CZYB 1G8SA 2EVAA 3PA3A 1H1RA 3KN5A 3LXLA 3FMLA 3WE4A 2ERKA 1JSUA 5F94A 1YXUA 5KKRB 4FI1A 1LR4A 4GIHA 4BCKA 3DU8A 3IDBA 3NGAA 4NW6A 2X8IA 2XIKA 2Y8OA 3I81A 3NUUA 4L8MA 4PNIA 1RQQA 3LCSA 5C8MA 3G33A 5JMSA 1TQPA 2OXXA 4RGJA 4UYAA 5HGIA 4NWMA 4OGRA 5EDRA 1O9UA 4F08A 5CVFA 5TR6A 1FOTA 2W1DA 1YXXA 2YAKA 4YSJA 3R8VA 5M57A 2P33A 3RPVA 4V01A 4CYJA 3IGOA 1Q99A 2C6LA 3HECA 4EQCA 3F3WA 1H1QA 5AM7A 3TACA 1ZOEA 4QPAA 4ASZA 3DPKA 4EK8A 4DH5A 4BZOA 5CVGA 2WMTA 4L42A 4FIIA 2GNFA 2PVJA 5E8UA 1QCFA 3GC8A 3EQBA 4R5YA 3ZLSA 4D1XA 1PYXA 4FOBA 1KOBA 4M66A 5DG5A 4EJNA 3Q5ZA 4I6FA 2PZPA 1TZDA 2PVNA 4X0MA 4DINA 3MS9A 1E1VA 5E9EA 3HRCA 3R7YA 4BF2A 3TDVA 3TUBA 2QOFA 3ENHA 4MCVA 3G90X 2R3MA 4PQNA 2IZRA 5IH5A 2CKOA 2ZMCA 4FKSA 1WBSA 4XLVA 4IVAA 3N4UA 5LMBA 5JQ5A 2PMIA 3T9TA 5HESA 4O2PA 4BDIA 2QODA 4EHZA 2E9PA 3BLAA 3Q2JA 4ZY4A 3EMGA 4PL4A 1W2DA 2Y4IC 4IAZA 2UZTA 2VWVA 4JI9A 2XKDA 4ZY6A 3VUGA 4E73A 3CCNA 3QQHA 2XAOA 2P3GX 2AC3A 4XG8A 5IISA 3SQQA 4FV1A 1J1CA 2UZEA 4E1ZA 4CCUA 4EEVA 3C4EA 3HGKA 1W82A 3R7VA 4ERWA 5EYKA 2QOIA 4U43A 4YHFA 1WFCA 3Q6WA 4BCIA 4XG9A 4YJQA 5HVYA 3ORTA 2OIQA 2X9FA 2PSQA 2B4SB 2QI8A 3COIA 3FE3A 3OF0A 3ORXA 4LRJA 5CU4A 3BYSA 4F6UA 5M56A 3BL9A 3DFCB 4WD5A 3ZUUA 3MYGA 2O3PA 5DT3A 3SOAA 2A2AA 2UZLA 4XG3A 2PZ5A 1G5SA 3PJ1A 3B2WA 3Q4TA 4GW8A 4EKKA 4P7EA 3EZRA 4O1PA 1M2PA 3F3TA 2ZV9A 1SM2A 4IXPA 4NFMA 3UNJA 4MXZA 3HUBA 3AMAA 4APCA 1ZYLA 2BKZA 3JY0A 4FVQA 3VUHA 1XKKA 4XNEA 3PY1A 1GJOA 4J71A 2F57A 1UNGA 2GCDA 4ZS4A 3IS5A 1V0PA 3I0OA 3HV5A 3AGMA 3OCSA 4FV4A 1DAWA 3QUDA 4HYSA 5HEZA 1BKXA 5LQFA 3BEGA 3OCGA 3RM6A 4KIKB 4ZZOA 2GHLA 4X3FA 4GVAA 1NVRA 3L9NA 3MY0A 4R5SA 5AAEA 3OMVA 5BMSA 2NNWB 4AA5A 3I4BA 3A8XA 3LFFA 5AUYA 3VJNA 2E9UA 2ZAZA 5FXSA 4C2VA 4JXFA 3SD0A 4HVDA 4O91A 4JRVA 1IA8A 4PNKA 1DM2A 3AD4A 2W1ZA 2R4BA 4YJUA 4DE4A 2X8DA 1K2PA 1ZZLA 2XK6A 5JRSA 3BU3A 3Q5IA 4QTCA 4J8MA 4C02A 4WNKA 3H0YA 3KXGA 4CFFA 4GJ2A 4BCPA 4ZSJA 5DA3A 4QEBA 3T8OA 3NS9A 2WMUA 4Y5QA 4O7LA 5IMEA 1CKJA 2CGUA 5KMJA 5EDQA 4WBOA 4ZMEA 4DDIA 4IJPA 4A9TA 2ITOA 3VVHA 3ZRKA 4DFNA 5JFWA 1GAGA 4FODA 4H3PA 5AV4A 4FZFB 5H8BA 3E8DA 4O7VA 4X3FC 4C61A 5IQFA 1M7NA 3PVGA 4L53A 3PVBA 4MF1A 1PXKA 4UALA 2C6IA 3KCKA 4FNWA 1U59A 4LFIA 4WO5A 3KRXA 1Y8GA 1ZMUA 1TFFA 4QDEA 3SLSA 2YCSA 5D11A 1PJKA 5DMZA 3FLZA 5AV2A 3QD0A 3DTCA 1OBDA 2YA9A 3RHXA 3DQXA 3ELJA 3EFKA 3UO6A 4QMVA 4R3RA 3L9MA 4D2PA 3LCOA 3L8PA 2HAKA 4QO9A 3E93A 3MVMA 3UMWA 3ZO4A 4YSMA 4LL5A 2WHBA 5HO8A 5IQDA 3LCTA 1XQZA 2I1MA 4LUDA 4M15A 1NA7A 2W1EA 4Q9ZA 4ID7A 1J7IA 4EK4A 4MXXA 4AW2A 3W2CA 2XKCA 3A7JA 3IECA 1QL6A 3KCFA 4KIQA 2B54A 2C5YA 4V04A 1BLXA 3CXWA 3PZHA 5EYMA 1YWNA 3ZU7A 5HQ0A 3B2TA 4QMQA 3NAXA 4ZMFA 3R8LA 2IZTA 4TWOA 3KRLA 4MD9E 3LMIA 4UXLA 2C6TA 3LXPA 3L1SA 4WT6A 3EN7A 5AUTA 3NNWA 5IQBA 2XIZA 1QPDA 3ZUVA 2OI4X 4CLIA 3U4WA 3EQGA 3OC1A 3QWKA 2VX1A 3BHYA 4QDVA 3LE6A 3UQFA 2H9VA 3R83A 2PU8A 2AYPA 3FC1X 2YAAA 2JIUA 1A06A 3R63A 4N6ZA 3RCJA 4CMTA 3BEAA 2PVMA 4ZTRA 5L6WL 2QQ7A 3ZCLA 4L52A 3OW4A 3TJDA 3R02A 3UZPA 1F0QA 2EB2A 1J7LA 2RGPA 2VX3A 3CIKA 3BHHA 4MHAA 4PPAA 4HPTE 2F7XE 1E9HA 5AMNA 3W1FA 2QO7A 5ANDA 2P55A 4O0SA 5DRBA 4NFNA 3ZEPA 4G5JA 4D1ZA 4F9CA 4ZLOA 3ATSA 3AXWA 3NYVA 4D5KA 4ALUA 2WQNA 4AT3A 1YDRE 3AT4A 3HMNA 5E8SA 5K0XA 3GU8A 3C0GA 5IQHA 5F9EA 2QOKA 3G6HA 3TUCA 2PPQA 3EN4A 3HV3A 3VS3A 4WNOA 3D2IA 3V8TA 4RIWA 2NP8A 5ANKA 3PDTA 4KB8A 5E1SA 5DYJA 4FICA 4RJ8A 5J9LA 3AC8A 4D9TA 4FNYA 4KUJA 4QTAA 3EN5A 4TRLA 5EHOA 4JG6A 5B2MA 2J5EA 3NYNA 5L6PA 2OJ9A 3MPMA 4YJOA 2BIKB 3PTGA 3W2OA 4JX3A 1FGIA 3KC3A 2OGVA 3C4ZA 3RAWA 3NFFB 1SNUA 4HGLA 3KRRA 4CXAA 3BHTA 3TV4A 3AT3A 3Q9ZA 4Y83A 4ZJIA 4L00A 5J5TA 2J9MA 5AADA 2P2IA 4NEUA 4YLKA 3UZTA 2P2HA 5CU3A 5I9VA 4IB1A 1UU7A 5CSVA 5CQWA 4AN3A 3ZM4A 3QX4A 3DKGA 4ENXA 5JZJA 1WVXA 4JS8A 3N4VA 4JL9A 4JDIA 4YPSA 5M08A 4I5PA 4K33A 3UE4A 3QFVA 4BCOA 4EC9A 4XV9A 5EM8A 1F3MC 5I9ZA 4N0SA 2CMWA 3BV2A 5M53A 3GNIB 4G6LA 4FTOA 5HOAA 5AA8A 4WG5A 2IVTA 4MTAA 4MVFA 2C47A 4I0SA 5KNJA 2AEGA 3UOLA 3NX8A 4XP2A 4YC8A 3NNVA 4IAYA 4X6QC 4DITA 3V5JA 4D4VA 5GIPE 2OW3A 1PXIA 2VO6A 2GS7A 5HVJA 4BDGA 4CFWA 1FMKA 2XM9A 3BLQA 5HNGA 3M42A 5EM7A 4ACDA 3HV4A 2CCIA 4NM3A 4YLLA 4FSNA 4HYHA 2EUFB 2XRWA 1JLUE 4JG8A 3FZ1A 4CT1A 2R3FA 4GFMA 3A2CA 1OIYA 2VTIA 3D15A 4M7IA 4TN6A 2VRXA 1H1SA 4YZBA 5CXHA 3R9OA 3AC3A 1H0VA 1JPAA 2W1IA 2XNGA 3A7GA 3DAEA 4KBKA 2VU3A 5IUHA 4AAYA 5C9CA 2BFYA 2GHGA 2CGXA 3R7EA 3O71A 3F5XA 3V3VA 4E6QA 4FIGA 3ALOA 4I94A 1M2QA 3HV6A 3PSDA 3QKMA 4OTRA 1Q3WA 1O6KA 1OUKA 2WTVA 5FEDA 4GYIA 3SXSA 1Y91A 3L8VA 4PTEA 2C3LA 2RF9A 5IZFA 4AGUA 2YCRA 4LQMA 4ANLA 4DH3A 4FT5A 4KSPA 3ORIA 4S30A 4D4RA 4FV7A 4CEGA 4FKGA 2UUEA 4KKGA 2YABA 3DB8A 3IQ7A 4DH1A 2ITUA 3OWLA 3D5XA 5LARA 5JN2A 4LOQA 5GJGA 5AP5A 5IU2A 3VBQA 4A06A 2VNYA 5CAPA 4JX7A 3QXOA 5K4IA 4F0IA 4WRSA 3GU7A 5CZHA 5BYZA 2W5AA 3IW4A 4YTIA 4D2RA 4FX3A 3MJ2A 3ACJA 4M69B 3BYUA 1G3NA 3LXKA 5CT0A 1PXOA 3W55A 1YOJA 1Q97A 2PVYA 3LJ0A 2B0QA 3THBA 2C4GA 4RQVA 3FQHA 2OFVA 4FSZA 3OOMA 4IEBA 2VTJA 3E3BX 4L7FA 3SW4A 2IVSA 3JVRA 3NUNA 4X3FB 2BAQA 2QOBA 4Y95A 4FNZA 5LVNA 3OW3A 4DHJA 3MY5A 1J91A 4U3ZA 4PDOA 3VF8A 3HAMA 3VUDA 3QF9A 3DKOA 4UX9A 5CSXA 4HZSA 2JFMA 3VHKA 3B8RA 3AGLA 4BKYA 1U46A 2GTNA 3ODYX 3ORZA 4Y8DA 3R7UA 5A14A 5IEYA 1LP4A 2C1AA 3CGOA 3UMXA 4R1VA 4AG8A 5HU3A 3NUPA 3R6XA 4E5AX 1HCKA 1OL5A 1Q5KA 3L9PA 5J1WA 1WMKA 2RSVA 3E62A 2ITZA 2WO6A 4JBPA 4M14A 5H8EA 2XK7A 5EQPA 5AP3A 2NO3A 4FL2A 4WG4A 4IDVA 3A7HA 2W1HA 4E4NA 4DFUA 3VAPA 2FYSA 4JR3A 4KBAA 4H05A 4DFBA 1ZLTA 5J79A 3DK3A 1PXMA 4RRVA 3H10A 1MQBA 4X2FA 4BDJA 3D83A 4MXOA 3CKWA 5DR6A 5CF6A 5IPJA 4XYFA 5LWMA 3OEFX 4ORKA 2OH0E 4DEAA 3ROCA 2VO0A 3E7OA 2EU9A 4FEWA 2JKQA 1OKYA 4O7SA 3O23A 5GZ9A 3ID6C 3EQFA 1JKTA 4IZ5A 3W0SA 3FZTA 4GJ3A 2GS2A 1BI8A 4XCUA 2R3IA 4H3QA 2RKUA 4WKQA 3DFAA 2BKKA 3VONA 1SNXA 4IVDA 4WUNA 2XARA 3AC1A 3PG3A 3UO4A 5HIDA 3I6UA 3LZBA 5C27A 2BZHB 3UVPA 4FMQA 3W2PA 3R1SA 4O4CA 4UN0C 3FI4A 2C3KA 3IK3A 3O50A 1URCA 4BDBA 4BL1A 2B9HA 4FKRA 4JDKA 5FM2A 4EK6A 1CM8A 2REIA 3UDZA 2ZB1A 4O7WA 3D9VA 5C8KA 4EOOA 4MXYA 5JEBA 5DR2A 2X2LA 4RWKA 1GOLA 3DBEA 5KBQA 4DEEA 3ET7A 1WBPA 3KRWA 3LFSA 4QTBA 3OP5A 2CN8A 3P79A 1QPEA 1I09A 4S32A 5HU9A 4Q5EA 5DR9A 3BPRA 3JYAA 5FEQA 4HZRA 2OJFE 3OT8A 4BDKA 4J53A 4AXFA 1UA2A 2XAMA 3UODA 4MKCA 2UZVA 4U3YA 4CNHA 1OKZA 2OJJA 2WMXA 3LVPA 2DYLA 4QMXA 2WTIA 4ANSA 5A4LA 3NYOA 4JBVA 2EXCX 4LOOA 3V04A 1W83A 3FJQE 3V5QA 4DEIA 4ENYA 3DT1A 3NUSA 3F88A 4M0YA 3PXFA 4QP2A 5LVOA 5FTQA 3ZRMA 3D0EA 2GU8A 4ONAA 4CGAA 1I44A 3CD8A 2V62A 1YXVA 4IHPA 5LMAA 4RIYB 3U55A 3R01A 4EH5A 5TE0A 4XG6A 2AUHA 2PMLX 1WZYA 4RIWB 4C4FA 4RQKA 3S0OA 2WTCA 1P2AA 1YQJA 4NKSA 4PDSA 2CGVA 5HD7A 1ST0A 2R7BA 3MIYA 4QTDA 3HYHA 4QP8A 3RZFA 1H1PA 3ZOSA 4F6WA 2WU7A 5H2UA 4QP7A 4USFA 3NUXA 3GQLA 2WU6A 4JQ7A 4GK3A 2YEXA 5LWNA 4E20A 2R0UA 1OGUA 5T68A 4ZTLA 4AA4A 3F66A 4CT2A 2QU5A 3QZGA 5HCXA 5A4TA 4JQEA 4DA5A 3I5ZA 1FBNA 5FM3A 5DN3A 2XA4A 4D4YA 2J6MA 3A4PA 2XJ1A 4BR3A 5TOZA 4O7TA 4DG3E 5E91A 5HTCA 3ZC5A 3GFEA 5D1JA 2YISA 4QYGA 4F09A 4EOPA 3ZH8A 3WZDA 4D4SA 4EOJA 5KZ0A