5L2SA

The x-ray co-crystal structure of human cdk6 and abemaciclib.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
263
Chain Sequence
QQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVPLSTIREVAVLRHLETFEHPNVVRLFDVCTKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLAVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 6
publication title Spectrum and Degree of CDK Drug Interactions Predicts Clinical Performance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 263
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l2sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l2sA01
5LMKC 1GZNA 1RW8A 4NWMA 5LVNA 2UZWE 1GZOA 2ZV7A 4XV2A 5CXHA 2PMOX 3ZFMA 3IECA 2BHHA 5HU3A 4QMZA 3SXRA 5FTGA 2PVLA 2W1ZA 5E1SA 3KC3A 4R78A 2PVRA 1QPDA 3RNYA 5EQPA 3CGFA 1DS5A 2Q0NA 3K5VA 4KSQA 4N0SA 4QP9A 1OPKA 4YZCA 3UG1A 2PZIA 4C35A 1NVSA 4L43A 2OF2A 2YCSA 3PPJA 4FTIA 5CSVA 1U5QA 4O81A 4GJ2A 4IAFA 3I0QA 1UWJA 4WNPA 5CAVA 4D2SA 4BCKA 4JL9A 4FT5A 1GIJA 4JDIA 4BHNA 3QTRA 1G8SA 4NYEA 4DEHA 5CSPA 4U3YA 2R3MA 2CNVA 5ICPA 3LIJA 4CYIA 5HG5A 1GIIA 3QKKA 4ITHA 4BDDA 3BELA 3RALA 2I7QA 2ZB0A 3B8RA 3IW5A 3R71A 4I0TA 4KBAA 4O83A 4P5ZA 5FP6A 3VRZA 4CFNA 4BDHA 5AA8A 5K5XA 1NVQA 4CZYB 3E5AA 4E6CA 4DITA 1UKHA 4AN2A 5M09A 4C8BA 4M12A 4MNFA 4FKTA 4O7VA 1OIRA 4FL3A 4UY9A 4QRCA 4D2PA 4BDIA 3PPKA 4G3EA 1OIUA 2JKQA 4QPAA 4EJ7A 2CCHA 3QD2B 2Z02A 4OBPA 1IASA 2ZM1A 3PWDA 4QYHA 5AV3A 1ZMUA 4CKIA 4YTCA 5I5ZA 3QALE 5DG5A 4E4XA 4IDTA 2HW7A 3OY1A 3KXHA 4NCTA 4JQ7A 4Y5HA 3EQRA 4RX9A 4H1MA 3ATTA 5L6WL 2FB8A 4OTPA 5LMAA 4BI1A 4WA9A 5HE3A 5BVDA 5CEOA 3FL5A 2KULA 3HA6A 4B7TA 4AFEA 5E8ZA 4CT1A 4DBXA 3RCDA 3ZBFA 4UBAA 2HENA 2XNGA 4ZZOA 3TNWA 3QTWA 5K4JA 2ITOA 2PVFA 3AXWA 3ZXZA 4EL9A 4CG9A 4FSMA 2JFLA 4RJ6A 5A4EA 5F4NA 3SRVB 4EQCA 4JR3A 3ROCA 4ZLYA 3NX8A 3I4BA 5KMOA 3DBFA 1Z57A 5EI2A 5H8GA 3KK8A 2JDOA 2VTOA 4BDCA 3RWPA 4DEGA 2J5EA 2UZBA 3CIKA 3PP0A 2HOGA 4JDHA 4ACHA 1A48A 4D0WA 4YZBA 3LLTA 4O2ZA 4RVMA 4PDYA 2PZ5A 4TWCA 2AYPA 2AUHA 5C9CA 2VO0A 5AWMA 3P7AA 4C3FA 4LYNA 2W96B 5E8SA 4XHKB 3FSFA 4BCGA 2NRUA 2W7XA 3LCKA 4FYNA 4J98A 4IWDA 3HRCA 4P4CA 2X4ZA 3L9MA 4XCUA 4EBVA 2OLCA 2PSQA 3QHWA 3LXLA 2JBOA 4HGEA 4WD5A 1JPAA 2Z7QA 3SXFA 4RRVA 5CSWA 3VW6A 1GZ8A 2XCKA 4XG6A 2YDJA 3MPMA 1F5QA 3H3CA 3E7OA 4OTQA 4QMUA 3A7GA 3K2LA 3L9NA 3UVQA 1IAJA 2RGPA 3VBTA 1JNKA 4ZJJA 3NAXA 2B53A 4ERKA 5AP6A 4IANA 4MQ2A 3O7LB 5HO6A 4WRSA 3UJGA 3BZ3A 2YEXA 1QL6A 3WZJA 4Z7HA 4O82A 5DOSA 4BGHA 1M2RA 1WCCA 2R3LA 4R3CA 5J5SA 5HX8A 3PIYA 3VUDA 2BILB 3A4PA 3QXPA 4UB7A 3LFDA 3CE3A 4GUEA 2PTKA 2VNYA 4X6RA 3NPCA 3PZHA 3PLSA 3UQFA 2C47A 3HV5A 4RVLA 3MV5A 1XBAA 4BCHA 3SRVA 1UA2A 5H2UA 2WTVA 1JSTA 3BWJA 4FTMA 4F64A 2QI8A 4TPTA 1UV5A 1H0WA 3TT0A 1Y57A 5JZNA 4JAJA 4TW9A 4YGAA 2PUPA 4XNEA 5FWKK 3WILA 2BTSA 4YZMA 2PK9A 2R3NA 1YXXA 4JDKA 4E6DA 2G9XA 4CKJA 5DR6A 4AS0A 1YWRA 3DK6A 3GU8A 2WQOA 5H8EA 2JD5A 3Q5IA 2UZVA 2UZUE 4EWQA 4ACCA 3VAPA 3FMEA 4LGDA 5AUWA 5DBXA 3OY3A 5CEMA 3CSVA 5CVGA 4FG8A 4FIEA 4LOPA 3BEGA 4ZTQA 3EL8A 4A9SA 4D58A 1NW1A 3WI6A 1CKIA 1H01A 4RJ5A 3V51A 4X3JA 3R83A 1YOLA 4ZIMA 4DEIA 5EFQA 3EN7A 3OXIA 4E5AX 3CPCA 2PVYA 3K54A 3LPBA 3PJCA 2FSTX 3RK5A 5J7BA 3LQ8A 4BKYA 5C26A 3HLLA 4O0UA 3VS1A 5GZ9A 1Q8WA 3LFSA 3MFTA 4IFCA 4IJ9A 4BCMA 5FM2A 2XZSA 4LOQA 3VBYA 2PMIA 3ERKA 4RSSA 4ZTSA 4DFLA 3R9OA 4XG4A 5HVJA 3BLHA 4YHTA 2E9VA 4EHGA 1AGWA 3MPTA 4X2FA 3PXYA 3R0TA 5HE1A 2C5VA 3C0HA 5FEEA 4AU8A 2JDRA 5FUTA 3CXWA 4AGUA 1UNGA 2QD9A 1GOLA 2REIA 3HGKA 2QLQA 3MH3A 3TI1A 1YDRE 4D2WA 5IA3A 1OZ1A 2CDZA 3KXGA 4X2GA 4X7QA 5DH3A 4HYUA 4WKQA 3SLSA 3PWYA 4RIXB 4E93A 1JSVA 4W4WA 2YCRA 4B8LA 3DB8A 3B2WA 4YURA 4ZXTA 1RE8A 3GENA 5EW8A 3VBXA 3TUDA 4ONAA 4ZK5A 2XKDA 2ZB1A 1ZAOA 4O1PA 3N51A 4GUBA 5CEQA 5DEWA 2OGVA 1H28A 4DE4A 2QHMA 4R1YA 5AP2A 1ND4A 3R00A 4U5JA 1FINA 3IOPA 4F1OA 2QC6A 3F61A 3PIXA 1VYZA 1YI4A 4FSTA 3O7LD 4K11A 3K3JA 3EKNA 2VTMA 3QTSA 2ZOQA 3G33A 1H1QA 1WBOA 4PMTA 5EQEA 2X7GA 3EQHA 5FG8A 4CFVA 4E3CA 3AT2A 4L3PA 2QOLA 3DS6A 4B9DA 5DLSA 2I0EA 4DFNA 4C0TA 4ZY4A 5K9IA 3AT4A 4C2VA 5JT2A 2OXXA 2IW8A 1M7QA 4FTRA 3OCSA 4EBWA 3ORKA 4DCAA 4HNFA 2W1IA 2RG6A 3U6HA 1QMZA 3FEGA 3Q52A 2WQBA 3SW4A 3QD4A 4RA4A 5E8WA 2VWYA 4EOIA 1YW2A 2BPMA 1BL7A 4HNIA 2P4IA 3ACJA 4FV5A 3T8OA 5J9YA 2ITUA 2IZSA 2WTIA 3ENMA 1OKWA 4L52A 1YHSA 4G5PA 4NEUA 4RQVA 5EQYA 1XBCA 4DT8A 1PY5A 2WNTA 4EI4A 4FMQA 2QO9A 4R5YA 2R2PA 3NUNA 2C6IA 3FMNA 1L3RE 5GNKA 3VUTA 2PL0A 3QX2A 3K3IA 2J90A 4RIXA 5DMZA 2VX3A 1GJOA 3WZEA 4TY1A 3ZU7A 4RZVA 3FZOA 4BTJA 3FL4A 4BBMA 3A7HA 1TQIA 4QQCA 3R7EA 4AZVA 5I4NA 1NT2A 3DQXA 3KB7A 1WBTA 4UWCA 4AW5A 3ZDIA 4DN5A 3EB0A 4GFMA 4Y72A 2VWZA 2QO7A 3D4QA 4LGHA 2GSFA 5DR9A 3VVHA 2QLUA 3KKVA 3TDVA 3WF5A 1U5RA 3R8VA 2OJ9A 5KUPA 2IVUA 5E4HA 4IB5A 3DJ5A 1Y8YA 1OL2A 3UO6A 2GS6A 4YJPA 3GOKA 3KGAA 2I6LA 1PYEA 1AD5A 4O6LA 4IM0A 3CJFA 5CU6A 1H8FA 3F2AA 3DA6A 1X8BA 5ANOA 3ZRLA 4C36A 1JLUE 3PA4A 4EUUA 5B0XA 2A1AB 5D41A 2G1TA 1ZYSA 4MWHA 3VBQA 1ZYJA 4FV7A 2XBAA 5DGZA 4H3PA 2WTDA 3W2QA 2WU6A 4FVRA 3PVBA 3U54A 4GVJA 4OTIA 4PTEA 3TACA 3LMIA 1W83A 1QPCA 2OH0E 3FI2A 3LZBA 4GL9A 4KIOA 1FQ1B 1VJYA 1CDKA 2F2CB 4BB4A 4BDBA 3I5ZA 4J1RA 4PP9A 5HE2A 5EM8A 4FKSA 5HO7A 2BFXA 3VIDA 2IVVA 3HV3A 3ULZA 3SW7A 3FXWA 2VTNA 4R3RA 2C6LA 3LXPA 3QAME 1REKA 4HYSA 5GJGA 2R3RA 3FZ1A 4BVUA 5TOZA 4NTTA 5GIPE 4BDFA 5EDRA 4Y8DA 3JY0A 3ZCLA 5L2TA 5IQDA 4IX4A 3AMAA 5T3QA 2FO0A 4AA5A 3P9JA 4A4XA 4CFWA 3DOGA 2C3JA 3QQGA 4XYFA 5DPVA 4IFGA 4G6NA 1ZY4A 1Y91A 3BYVA 4HOKA 1ZZLA 4K77A 3OWPA 4BCIA 4DFXE 4E4MA 3IW8A 2CCIA 4B6LA 5AAEA 3D15A 3AC8A 5D12A 3EQFA 4OTWA 2UZOA 3BIZA 3HMMA 2GNGA 2WMWA 5ACBC 2J0LA 4KSPA 4BKZA 1OIQA 2ITYA 2WAJA 4FTAA 3DB6A 3Q96A 4YUQA 1V0BA 4W4YA 3Q4CA 4L8MA 3PYYA 4FIGA 4BTKA 4E4NA 3PY0A 4AACA 4KKHA 3PJ3A 4QTDA 3W2SA 4Q2AA 2WOUA 2PVMA 3F88A 3VS7A 3EIDA 1W7HA 4HVDA 5FEDA 1TQMA 2GNJA 4AZWA 1J7UA 3CEKA 3HV4A 4IB1A 4CV9A 3R8LA 4R7BA 4CLJA 2GHMA 1CKPA 2XM9A 3MBLA 5CZHA 5G6VA 3JUHA 4AX8A 3R7GA 4GU6A 1U54B 3MB6A 4KS8A 5CI7A 3W2RA 3NUXA 3DGKA 4QP1A 1TQPA 3LQ3A 2NNWB 3MWUA 2XYNA 4UV0A 3E88A 4RIWB 5DHJA 5M08A 3QGWA 2PVJA 2UVZA 5A6NA 2PULA 4O21A 1MRVA 1Q99A 3IGOA 5ANDA 2IW6A 2B1PA 4K8AA 5ANEA 3GNIB 5HLNA 3SXSA 2VZ6A 3L1SA 3FUPA 3W8LA 3Q9XA 4MWIA 5LWMA 5HVYA 3R63A 4F9YA 5M51A 3RPSA 3VF9A 5A4CA 4YR8A 4FKIA 3OFMA 2VX0A 3EFKA 1I44A 5KZIA 3QBNA 4ANOA 4F9BA 4EHEA 1ZYDA 3MW1A 4GK2A 5DT3A 2YCFA 3C4WA 4YLKA 2V5QA 5M55A 4AE9A 4FKLA 1IRKA 3MDYA 3D5VA 5HG8A 2IZRA 3DKGA 5HIEA 3F5PA 5GIOE 4I3ZA 3V5TA 5HHWA 2ACXA 4H3QA 3VC4A 3WIGA 2IW9A 4FK3A 3FSKA 3KVXA 3IOKA 4D4RA 2PMNX 4E8AA 3MH1A 3NW7A 3E8EA 4ANQA 4YJNA 1WBPA 2OJJA 2EXCX 5GZ8A 3KCFA 2GQSA 4XUFA 3HV6A 3RKBA 4RIYA 2V7AA 1Z5MA 2HYYA 2C0IA 3DY7A 2CKQA 4X2KA 4F1TA 2B0QA 2XJ2A 2UW7A 2YIQA 3LMGA 4FV0A 4I6FA 4JLCA 2UVXA 2HW6A 4FIIA 2JDSA 4D2VA 4DEAA 3ZONA 3U9NA 2JDVA 4WOVA 4RPVA 4C4GA 4P5QA 1V0OA 4BTMA 4JDJA 2XB7A 3PFQA 3TN8A 3UPXA 3V04A 3LOKA 5J79A 3KRWA 3LJ2A 2XK8A 3F6XA 3ORLA 3V01A 4H05A 4ACGA 2BTRA 1TVOA 2WMUA 3ZSHA 3T9TA 4AN9A 5C01A 2YM7A 4IBMA 4O7WA 3UP2A 3EH9A 3HDMA 5CI6A 5HNIX 2EWAA 1PKDA 3QTZA 2ZM4A 1WZYA 3IGGA 4FKQA 4OGRA 4N57A 2QVSE 3ZC5A 4GYGA 5JN2A 4FEUA 4XV9A 3SX9A 3UIBA 2J7TA 3I7CA 4FODA 3UG2A 1UNHA 2ITNA 3MFUA 1OUKA 4XBRA 3QQUA 4DFYA 3JPVA 2ITZA 4YZNA 4ZOGA 1K2PA 4L44A 5HO8A 1JKSA 4KNBA 5A4QA 5K5NA 5JEBA 1REJA 5CF6A 3PP1A 4CFMA 5EW3A 3KXXA 4TTHB 4P7EA 1OPLA 3PRIA 2OXYA 4XG2A 5IUGA 4GG5A 1XH7A 4D0XA 1YHWA 3DBCA 3NUYA 4LFIA 4AWIA 2VX1A 4BWXA 3SGCA 4K2RA 4EOJA 2WQEA 4MD8E 4KA3A 4Y5QA 2W06A 4G2FA 3I81A 1XBBA 3KF4A 3VS0A 2QG7A 4YJOA 3QU0A 5AP3A 4FE2A 3ANQA 3EQCA 3LCOA 1M14A 3ATSA 3BU3A 3LXNA 3A8XA 4IIRA 4OT5A 4RJ4A 5I9ZA 5I9YA 1M17A 3F2RA 5IU2A 5AR8A 4HVSA 4FUXA 4WNMA 3FMJA 5M4CA 2HZIA 3KULB 2X2KA 2VWXA 4QP6A 2FGIA 2XK9A 4ORKA 5DVRA 5KNJA 4XS2A 4FV9A 4B99A 3ZLWA 3OOGA 4LRMA 5IQIA 2VAGA 2EXEA 4HGTA 4D9UA 2C1BA 3AG9A 4TNBA 5F9EA 2YZLA 5TE0A 3SHEA 4GCJA 4PNIA 4YC8A 4ITIA 3P7BA 5B2MA 5LCJA 4GVAA 1URCA 3RTPA 2YDIA 4K1BA 2J50A 3OVVA 3V3VA 3EZVA 4XG8A 3BQCA 3OMVA 3FMHA 4FKJA 3TXOA 3R22A 5J87A 3U51A 4F0FA 4F1MA 4XOYA 5EM6A 1MRYA 4J96A 5IA2A 3HMNA 1V1KA 5AR5A 3I7BA 4MF0A 2X81A 2P33A 3HP5A 2VGPA 4FK6A 5D9HA 2XIKA 5E8YA 5I9WA 1UU3A 1H27A 1APME 1W8CA 1P2AA 3QKLA 1ZWSA 3NGAA 4GRBA 4USDA 2J6MA 4GFOA 2BRBA 4LV5A 4RMZA 4XP3A 2C69A 3F7WA 1PW2A 4TZRA 4W4XA 5IUIA 4F7JA 4HYIA 5GINE 4A4LA 1W0XC 4FGRA 4OTGA 2PUIA 4FT7A 3O51A 5CALA 2VTSA 3D2KA 2J51A 3QD3A 4F7NA 2ITVA 3PJ1A 4ERWA 3H10A 3V5PA 3VUHA 5KMLA 5ETFA 3FY0A 4IAKA 4RX8A 5AR3A 3K5UA 4NT4A 5KX8A 2ZAZA 2CKOA 3GCVA 4PMSA 2A0CX 4YHJA 3LFAA 4XRJA 3FHRA 2EU9A 2O5KA 4Y95A 2UZEA 3VBVA 4F9CA 2BZJA 4G31A 3A4OX 4JRNA 3ZS5A 4QMPA 2JIUA 4HCTA 1ZMVA 3BHYA 3OCTA 3KULA 3DJ6A 3QCYA 3QCQA 4GSBA 1OBGA 4QP7A 3KN5A 2IZTA 5AFVA 5CTPA 4QMLA 1OVEA 3ZZEA 3TZ9A 2EXMA 1R0EA 3U4UA 2I0VA 4TN6A 3FI4A 5EYDA 4AFJA 1KOAA 2XEYA 2VD5A 4JT3A 1BL6A 3IKAA 2BRHA 2WD1A 4J97A 4BBEA 3GXLA 3ZUTA 4RLLA 3HMOA 3N4UA 3F66A 3R8PA 4RFYA 3SKCA 3BE2A 3GB2A 3C0IA 4MXOA 5EI6A 4ZZNA 3MESA 2C6DA 2VV9A 4K6ZA 4MBIA 1VZOA 3OF0A 4FTOA 4WSQA 4D1XA 1G8AA 5HU9A 4IVBA 5AMNA 3TV6A 4NM3A 4XLIA 2CN8A 4I5PA 4NJDA 4C59A 2CN5A 5I3RA 3FC1X 4GYIA 1PXNA 3R9HA 3DNDA 3FLNC 3C9WA 3MGYA 2H9VA 1CSNA 3OXTA 4ENXA 4F6UA 4DT9A 4KRCA 3F7ZA 4JRVA 5IDPA 3TJCA 3P5KA 3EN5A 2W1FA 3GUBA 4J99A 4JBQA 5AIRA 2CLXA 4BI0A 2JGZA 4G1WA 4KINA 5BX0A 5C4LA 3WARA 2C68A 4FSYA 4UEUA 5AEPA 4DFUA 2CGXA 2JKMA 4GMYA 3W2CA 3DLZA 2ONLC 4ACDA 3DKCA 4S2ZA 5EK7A 1WBSA 2XJ1A 3MIAA 5FP5A 3ALOA 2OKRA 4TWOA 4G3GA 2BZIB 2PE2A 4J53A 4ZTNA 3Q60A 3TV4A 4I0RA 2UW8A 3D0EA 5CVFA 2CLQA 3C13A 3UOJA 3HAMA 3POOA 4FI1A 4YPDA 2P2IA 2PWLA 3DK3A 3KA0A 5FBOA 2W4KA 4ARKA 1F0QA 2XK4A 4EH9A 2WTCA 4W9WA 1WVXA 4O22A 5A4LA 2G2IA 3I79A 3MJ2A 1DM2A 3NUAA 4NKAA 3E87A 2ZYBA 3V6SA 3VS5A 2YM3A 3Q53A 3UDBA 3KF7A 5J1WA 5AUTA 2XKEA 2QCSA 3UYSA 4U80A 3MVLA 3QZHA 4EOOA 1PXPA 5FTQA 4EOLA 4BWPA 5HEZA 5BUEA 3NIEA 2VO6A 3PIZA 3R9NA 1M2QA 2GS7A 1I09A 4NU1A 2WMAA 3ZH8A 3TKHA 2G2HA 5CU4A 1Q4LA 3SV0A 4J95A 2G15A 4BZDA 5FGKA 3UOKA 3FKOA 5L2QA 3FE3A 1Q8ZA 2XNBA 4A07A 2ZV9A 2GQGA 3HYHA 3MTFA 4FNYA 4Y73A 2FSOX 4XG7A 4ZSLA 4KBKA 4R3PA 3PRFA 1T45A 2VTJA 5IQHA 3ROYA 3UIMA 1EH4A 3DT1A 3Q04A 1OL6A 2JIVA 5FDXA 4FX3A 4FKUA 2ETRA 3Q9YA 3FY2A 3KCKA 4TWNA 2O3PA 3FZRA 3FC2A 4CYJA 5CU0A 1Q8YA 2R3KA 3AGMA 3ORXA 5AP1A 5DN3A 2R3PA 5E7RA 2XH5A 3ZBXA 3UZTA 4CD0A 1H1WA 3R02A 1UU7A 3ZC6A 3R7YA 5LVLA 5E91A 3QWKA 4ANNA 2Z7SA 4BRXA 5L2IA 3BBTB 3QZIA 4DFBA 4O86A 1Q41A 4RWKA 3BU5A 2XYUA 4FV1A 1FPUA 3VQUA 3QL8A 1MQBA 3E8DA 4L45A 5C27A 3FBVA 4RJ7A 4QMTA 2W1DA 3D94A 5HNBA 3IW4A 4CTBA 5CAPA 1IA9A 3ZEPA 3Q2MA 1PXMA 2A27A 1Q61A 4EHVA 3PE2A 4FSWA 4DA5A 3QTIA 2B4SB 2BRMA 5JGDA 3DDPA 4MEDA 3RMFA 4I5MA 3LCDA 3TWJA 2DWBA 3NEWA 3NUUA 5HI2A 3UVRA 1OGUA 4F99A 5IEYA 5CX9A 4MTAA 4PX6A 3FHIA 5KKRC 4QMMA 1PF8A 1SM2A 3LLAA 2QU5A 3F69A 3JVRA 2C3IB 2RFDA 4I92A 4FKRA 5EYMA 4GKHA 3QC9A 4USFA 5TT7A 1Q8TA 2GTMA 4AGCA 2OG8A 2W05A 4LL0A 2E2BA 3W16A 2PMLX 1LPUA 4BR3A 3PLAE 2YN8A 5FEQA 5ETAA 3EQIA 3AMYA 5E8TA 1PMVA 3GCUA 5ANIA 4U41A 3VULA 1JVPP 4J71A 3BPRA 4TXCA 4EOKA 4F70A 3VUIA 3C4EA 4EK8A 3UTOA 5JFXA 2ZJWA 5C4KA 5IH5A 3E8CA 2BFYA 2UW6A 2OIDA 5HOAA 5FXQA 4XEYA 3UNZA 5L6PA 1S9JA 2O0UA 3REPA 2WELA 2UW0A 4IB0A 4M7IA 5LOHA 3EFJA 3PXZA 4IDVA 2YJRA 4ZY6A 4OTFA 4F0GA 3SDJA 2YLEA 3DTCA 4DH7A 5M4FA 4BZNA 2JDTA 1JWHA 4FZFB 4KAOA 2J0JA 2QODA 4FNXA 2NRYA 3O71A 4XV1A 3E7VA 3ZOSA 1P4FA 4FV6A 2H6DA 4QTAA 5HCZA 4NW5A 2C5NA 3A61A 4F9AA 3OG7A 2JFMA 3V5WA 4YP8A 4U9AA 2VGOA 1XH5A 2JKKA 3TG1A 4EYJA 3CD3A 4KIQA 3NRMA 4Z9LA 3HNGA 1H25A 5KMNA 5CANA 2BAJA 4FSNA 5AV4A 3IQ7A 4EHZA 3SVVA 4M8TA 1O6LA 4PMPA 3L8SA 4EH2A 1W98A 2R64A 5BVEA 3B2TA 5DYJA 3QZFA 4O6EA 2DS1A 3GU7A 3GCPA 2F4JA 4E26A 3ODZX 3L9PA 4JQEA 4NM7A 2W17A 4Y46A 3C4CA 5EHYA 3A7FA 2VWIA 2GFCA 5DT0A 4NJ3A 3KEXA 4CQGA 2C6MA 3D5WA 3G6GA 2QKWB 3GOPA 3QA0A 4RWJA 1FBNA 3BGZA 5JQ8A 3LKMA 3MTLA 2WFYA 4RC4A 2XIRA 3BEAA 4LQMA 2W99B 4UMRA 4FGBA 1PJKA 3V6RA 3RAIA 2F49A 3ALNA 3AMBA 3G51A 4HZRA 2VNWA 4BCQA 4ZMEA 4AOJA 2ETKA 1KE8A 2BCJA 5CT7A 2O8YA 4IEBA 3VF8A 4UMQA 4Y83A 3MI9A 4S31A 4XBUA 5EKNA 3MSSA 3O8PA 4QNAA 3PSBA 4ZJVA 3R28A 2PVKA 3DTWA 4L7FA 2GFSA 2V62A 3P1AA 3ID6C 3JY9A 3L8PA 4FV2A 4O7YA 2X0GA 2V55A 5JQ5A 1VEBA 5L3AA 1ZLTA 5EH0A 5JRQA 2W5HA 4E20A 3WBLA 5CF5A 4AT4A 3KXZA 3AD5A 5KE0A 2J2IB 3EMGA 3A8WA 4W9XA 2EVAA 3BCEA 3EL7A 3FMLA 5DE2A 4FOBA 4JOAA 4D5KA 1H08A 4NW6A 3TJDA 3RZBA 1ZARA 3CQUA 3QLFA 4EK6A 2BIYA 2C3KA 2R3GA 3CCNA 5AAGA 3ENHA 3BI6A 5F1ZA 4I6QA 5FTOA 4LUDA 2YAAA 4FUYA 1SVGA 3NAYA 5LVMA 3N4VA 4H36A 4KIPA 4BIBA 5IQEA 3ANRA 2XBJA 3FAAA 1CKJA 4XP0A 3DDQA 3C0GA 3O17A 3S1HA 4AT5A 4Z7GA 4W8EA 3VS4A 3DBDA 3V5LA 3KRRA 3MB7A 1O6YA 3D7ZA 5KHXA 4DLIA 3WF8A 1QPJA 2X1NA 4GH2A 3NDMA 2QOOA 2E9OA 1WVWA 2VRXA 4NM5A 4UYNA 1XR1A 3GU4A 1E1XA 4PL3A 5AJQA 2A19B 4YHFA 1WFCA 3G0EA 2VWBA 3FV8A 5CWZA 3ORPA 4N70A 4QMSA 3AC3A 5LWNA 4FTQA 3DNEA 3WE8A 4B4LA 3QF9A 4C57A 5E8XA 3BHVA 3COMA 5EI8A 5FQDC 5AR4A 4FL1A 2X6EA 5C1QB 3BWFA 4HCVA 3OXZA 2XMYA 4ANMA 1U59A 3O0GA 4MD7E 3CKXA 4WSYA 2W9ZB 3ZO1A 2XIYA 3G9LX 4JX3A 4Q9ZA 5M4IA 5D11A 4QPSA 2F7XE 2R3JA 3D9VA 5L6OA 1MQ4A 2YA9A 1ZMWA 5GJDA 3QRIA 3RP9A 3LFQA 1BKXA 3RPVA 4MXXA 3VJNA 1XWSA 4YZ9A 4ALUA 3KREA 1NXKA 1YXTA 3EYGA 3PPZA 3GFEA 2IVTA 3F3UA 3BGPA 3FKNA 2ITWA 4R7IA 5H9BA 1ZYCA 3NNVA 2CGUA 4OBOA 1IR3A 3SOCA 4EOQA 2BZKB 2ERZE 4I4FA 4FEXA 4BIDA 5AAFA 4F08A 3GI3A 2XUUA 2I0YA 3CJGA 1LUFA 4QYGA 3UNKA 3TIYA 4D4YA 1FVVA 3TZ7A 4CEGA 3N9XA 5BMMA 1JAMA 4CGAA 5EM5A 4P2KA 2XK3A 5EG3A 2CMWA 3F2NA 4LRKA 4BIEA 4DINA 4I24A 3I60A 2Y4IC 4I23A 3QTUA 3WIKA 3TZ8A 3MY5A 2QKRA 4C4EA 4FZ7A 3FXXA 1UVRA 3LE6A 1KE9A 4IW0A 3DAEA 4BN1A 4XMOA 3R7VA 4DAWA 1OKZA 4C33A 1WBWA 1BI7A 4JIAA 3FKLA 5CAQA 4PUZA 2GDOA 1YXUA 3BYSA 4NCTC 3WF7A 4QTEA 3O8UA 4TT7A 2J0IA 4FT0A 1SZMA 3HV7A 5IPJA 2HWOA 4RWIA 4TRLA 4BI2A 3SAYA 3V8SA 2HCKA 2X7OA 4KABA 2ITPA 3P79A 4IACA 2VTQA 2ZMDA 3ZM4A 4AZTA 4C7TA 2I1MA 2IJMA 3TZMA 2PY3A 1P4OA 2UW9A 5AR7A 2QONA 3Q4TA 3OOMA 3C51A 3CGOA 3AQVA 3IO7A 1Q5KA 3RCJA 3R8ZA 2GCDA 2QO2A 3VUGA 2J0KA 4JNWA 4USEA 4B8MA 5LVPA 1KOBA 1J1CA 3ORIA 3ORTA 4CCUA 1H0VA 1IG1A 4FNZA 5CNOA 3QRUA 5JKGA 4X3FC 4IAZA 5TO8A 2X2MA 4A9UA 2WIPA 4IMYA 4ANSA 4E7WA 4FC0A 3QCSA 4FKGA 3ETAA 2BDJA 3OT3A 4FV8A 3KXNA 1YOMA 4FIHA 3PXKA 5CQUA 5TR6A 1YDSE 2JLDA 4GT4A 4UWYA 3QGYA 3IK3A 4M69B 4EC8A 5CYIA 2CPKE 1OITA 2WMXA 4FZDB 4IZAA 1BMKA 4HGSA 3R8MA 5BUIA 3LM5A 3OEZA 2IO6A 3H0YA 2XP2A 2Y4PA 4IC8A 5I0BA 2YZAA 5HZNA 3F3ZA 4YC6A 5HX6A 3DKFA 3W18A 5AX3A 2RIOA 3MVMA 5CEPA 4BDEA 1G3NA 2HELA 2RL5A 3HRBA 1WBNA 3G2FA 1YOJA 4XG3A 3VHEA 2UZLA 4HGLA 5ETIA 4IE9A 3R1QA 4FEQA 4PY1A 4JAIA 3CQEA 1Z9XA 4RA5A 1P14A 3T3UA 3MA3A 5AP7A 3TEIA 4DEBA 3OUKA 4ZSEA 4FIFA 2GHLA 2F7ZE 2NPQA 4C2WA 4G5JA 4GK3A 4ZSJA 5JRSA 4BCJA 2BVAA 3D7TB 4DHFA 4O7NA 3IDCA 2XKCA 2CNQA 5L2WA 5D10A 2JEDA 4K18A 1WBVA 4U0IA 4LUEA 3A60A 4U79A 5CEIA 2ONLA 3TNHA 4AT3A 5LMKA 2H34A 5CS6A 4ALVA 4ZJIA 3MY1A 5BMSA 4QPMA 4CCBA 3Q6UA 2EB3A 4I22A 3M11A 1FOTA 3PA5A 1M2PA 2BKZA 4L68A 4OTHA 5TF9A 3ZTXA 4FR4A 4YJSA 3HA8A 1CMKE 4MAOA 4GS6A 3ZRMA 4CLIA 4IH8A 4JJRA 3MFRA 3GCSA 3QA8A 3PE1A 3ZEWA 5C8KA 3E3BX 3GT8A 3QRJA 5ETCA 2QOHA 1E9HA 2XCHA 3VUMA 3P7CA 4F65A 3LFBA 3QTXA 4MXCA 4C4JA 3W2OA 3FMDA 3RHXA 3G5DA 1KWPA 3LQ5A 4L01A 3V5JA 4EH6A 5B7VA 5HIBA 5BUJA 4U7ZA 4R77A 1QCFA 4UXLA 2Z7LA 1YXSA 1OPJA 5KKRB 4CMOA 1OUYA 5BVNA 3DKOA 4FTKA 1J7IA 2ETMA 3HUCA 1R1WA 3MJ1A 4U45A 3EHAA 5AUZA 5HCXA 4YLJA 3SOAA 3PDTA 5J7HA 3UYTA 4J8NA 3R2YA 3HKOA 4AOIA 2OFVA 5BNJA 2HXLA 4WG5A 3FZTA 4UZHA 3TM0A 4D9TA 4GW8A 4O7LA 3A62A 2WGJA 3U6JA 5KMJA 3R1SA 2GHGA 3BE9A 3OHTA 4BCOA 4BICA 2YM8A 1YI3A 5AIKA 5CF4A 3D7TA 4YU2A 1W84A 4II5A 3UC3A 4J7BA 5GJFA 5DT4A 3ZRKA 3KVWA 4CSVA 1HCLA 2HY0A 4MNEB 3DBEA 1O6KA 4FV4A 4DGNA 3O50A 4H39A 5BPYA 4A7CA 4ZSAA 4LMNA 4O0RA 4AE6A 1U54A 5EOLA 4D4VA 1GAGA 2CGWA 3D5XA 4BHZA 3AOXA 4HVGA 4H3BA 1YI6A 4QO9A 3TKIA 1H00A 5M07A 3FI3A 4O2PA 4N6YA 4RIWA 2UW5A 3GU5A 4BKJA 1LR4A 3PXRA 4JR7A 2OWBA 2R3OA 3Q6WA 4ZTRA 4WRGA 3OW3A 4IADA 4CTCA 2HIWA 5KMKA 2XNMA 2WB8A 4C4FA 2VWWA 3ZFYA 5CAOA 2SRCA 3FMKA 3ZM9A 2FVDA 1RJBA 4GT5A 4IX3A 4XH6A 4MXYA 3OEFX 3WOWA 4YNOA 4IWOA 4DTKA 2O65A 3R73A 4E73A 5AP4A 2IZUA 4QYEA 4RVKA 3N4TA 3M42A 5CVHA 4XOZA 4CRSA 4M15A 4ZS4A 3CS9A 5IMXA 2RFEA 4HZSA 4L6QA 4BCPA 5BVWA 2X8DA 4NL0A 3TDWA 2XRWA 3C7QA 2FUMA 3NYXA 3UNJA 3QFVA 1FVRA 1R3CA 3L8XA 5HCYA 3MY0A 4MXZA 4EQMA 4I21A 5J1VA 4BDKA 5KHWA 2WMTA 3OP5A 2J0MB 3ELJA 4IVCA 2W5BA 3AGLA 3WE4A 4E6AA 4QQ5A 4FBXA 1K9AA 3F3WA 4X2NA 4FTCA 1MRUA 3WF9A 3W33A 4MH7A 2FSMX 5D7AA 1RDQE 3DXQA 3G15A 2YAKA 4KIKB 4R1VA 4PL5A 3HX4A 1OL5A 3U87A 4EH5A 4WUAA 5GHVA 2FH9A 4C62A 1FVTA 1YDTE 1IA8A 3TKUA 2VN9A 3TCPA 4A9TA 4MCVA 3SA0A 4G9CA 4HVIA 5CNNA 2WZJA 4I4EA 4YJRA 2UVYA 3W10A 3R7IA 4IVAA 4IAYA 3IONA 3F3VA 4QMQA 3EYHA 3VS6A 5LVOA 3D14A 2I40A 4RVTA 3RVGA 3D83A 4ZLZA 1PMNA 1PYXA 3LM0A 3DAJA 3UP7A 2VO3A 3FLQA 3DZQA 4DG2E 4G16A 2OSCA 5IG1A 2PHKA 2IG7A 4O7ZA 4Z16A 3QUDA 5A4TA 5DA3A 3G0FA 3CTJA 3GC8A 1U4DA 4KKEA 4FSZA 3TNIA 1SVHA 1XKKA 4QP4A 2OO8X 4FT3A 4RLKA 4FTJA 4L7SA 2GU8A 3OBGA 4FV3A 4MK0A 2WMQA 3NZ0A 3HECA 5DIAA 2DQ7X 3Q2JA 2CKEA 4UX9A 4G3CA 5EDQA 3PJ8A 4QYFA 2GS2A 5DRBA 4BGQA 2QNJA 2WMBA 4UXQA 4DGMA 3NCGA 3OS3A 4UYAA 3MA6A 3PVGA 4D5HA 3CY3A 4DG3E 4CRLA 2QOKA 4E4LA 5IQAA 1GY3A 1XHAA 4JX7A 3OCGA 4JXFA 5A46A 5HNGA 4XRLA 3UMXA 2BMCA 2C6TA 4CFFA 3RK7A 4N6ZA 4FIJA 4U42A 2HZ0A 4HCUA 4LGGA 2WTJA 3G9NA 3PZEA 4TWPA 4U81A 5C03A 3PY3A 4G9RA 3BYMA 5LQFA 1OI9A 3HL7A 4FOCA 4QT1A 3M1SA 4NH1A 4QP8A 4I0SA 3THBA 4AOTA 3OW4A 4GG7A 1WMKA 2G01A 2Y6MA 3CPBA 4FSUA 4OW8A 4WNOA 3W2PA 4FKVA 4MHAA 3BHTA 3NVMB 5BVOA 2UV2A 4C58A 3NIZA 3JYAA 3TIZA 3PTGA 4WIHA 2RFSA 3OT8A 5KMIA 3C1XA 3GGFA 4JG7A 4BC6A 3QQLA 3NYOA 1B6CB 3F82A 5I9VA 4QTBA 1A9UA 5IQCA 4TYHB 2OFUA 5CU2A 4FTTA 4GIHA 5H3QA 4DBNA 1STCE 5ANKA 3DU8A 1KE6A 5LARA 2UW4A 1OL1A 4IM3A 1E1VA 4FVQA 1ZOGA 4RQKA 4UMTA 3HEGA 4I94A 3MIYA 4IM2A 1R78A 4A9YA 4YJUA 4J52A 1OIYA 3TV7A 4RZWA 4UN0C 3S95A 3RK9A 2B9IA 2ZV8A 5EHLA 2C3LA 3KRJA 2ERKA 2WHBA 4X21A 5IH6A 5JSMA 3HRFA 4RFMA 1SNUA 1H1SA 4EZ5A 4O0YA 1DI9A 3LJ0A 2PU8A 4GEOA 4BCNA 2YABA 2GPHA 3RINA 1H4LA 3PVWA 3UC4A 3VS3A 4O96A 1JOWB 3S00A 4JQ8A 1G5SA 3BLRA 5IKWA 4A4OA 4FNWA 4D55A 3PVUA 3GCQA 4CG8A 4FL2A 2XA4A 2FYSA 4RX7A 1Q62A 4L67A 4TNDA 2VTIA 4IC7A 4BDAA 4IZYA 3MYGA 3H9OA 3ZDUA 4DYMA 3FPQA 5L8KA 3C5UA 2GQRA 2JIIA 3F9NA 2RKUA 4M13A 4M3QA 5CU3A 1GNGA 4YNEA 1MUOA 4YSJA 4S33A 3R9RA 4GK4A 2X7FA 4V01A 3EQGA 4QP3A 3FZPA 4DFZE 3I6UA 3VO3A 5EW9A 3QKMA 4FKPA 2OBJA 2C5YA 3R7OA 5K0KA 2HY81 3G90X 5L8JA 3RZFA 2EB2A 3Q4ZA 4CZUA 4O38A 3BYOA 3LXKA 4RJ8A 2BZHB 3WF6A 4DF3A 1H1RA 4FICA 4BYJA 4Z3VA 4GT3A 3I0OA 3QLGA 4CV8A 5IZFA 4DC2A 2OW3A 4JI9A 5E1EA 4APCA 1OECA 1OBDA 4UALA 4PMMA 4X3FB 5IA5A 4U44A 2FSLX 2C30A 2JC6A 2PZYA 2QOQA 4TYHA 4WBOA 4MBLA 3BHHA 4MQ1A 4GIIA 1XH6A 4EOPA 3OROA 3ZMMA 4OTRA 3GBZA 3UOLA 3LAUA 4APPA 5BVFA 2OJGA 2VTRA 2BDWA 2XNEA 4ZTMA 2WQNA 5ACKA 3C50A 3E62A 4G34A 3C5IA 4MKCA 4LOOA 4M97A 3HVCA 4WG4A 5B2LA 2OICA 3GQIA 5F20A 1J1BA 3A7JA 3CTHA 3PG1A 4AA4A 3FI8A 4HW7A 4LG4A 5DI1A 1BUHA 1IEPA 4J8MA 2QU6A 3EKKA 4M67A 5KO1A 4PPBA 5HICA 5FBNC 5EOBA 2YITA 1KV2A 3PUPA 1XH9A 4QQTA 3FMMA 3GVUA 4FTUA 2JKOA 2C0TA 3LFCA 4PPCA 3EZRA 5M06A 4QP2A 4JBVA 5IA4A 3R30A 3NMUF 2YHVA 2C6KA 4IXPA 5JFSA 1JBPE 3AC5A 4D28A 3FQHA 2P55A 2EUFB 3ZHPC 3BV3A 5D1JA 1U46A 1XH8A 4F4PA 4H1JA 2BKKA 4RGJA 3UZRA 3QRTA 5J95A 3VHKA 3FLYA 4KKGA 4L3JA 3U8WA 3HDNA 3TNPC 4CKRA 3FLZA 3DXPA 1WVYA 1R39A 3RI1A 4DH5A 2HZNA 3U9CA 3DPKA 5JGAA 1Q3DA 1ZY5A 2VTTA 4TYJA 5E9EA 4JG8A 3OUNB 5AA9A 4CQEA 3BRBA 3UO5A 5HBEA 2HK5A 1A06A 4QYYA 3QQKA 4V04A 4X3FA 3GP0A 4Y85A 4HYHA 3ZLXA 5T68A 5HORA 5M4UA 3DBQA 2R3QA 4UZDA 5CF8A 4L46A 2A2AA 3P23A 5HBHA 2R3HA 2QOBA 4QOXA 1Y6AA 3R1NA 3U6IA 4O1OA 1GIHA 1SMHA 4OT6A 2UUEA 2R0IA 4Q9SA 4YLLA 4KWPA 1Q24A 4D2TA 5A9UA 2QR7A 4ACMA 2X39A 4YJQA 2WEIA 3FQSA 2XM8A 1UKIA 3DJ7A 4G3DA 3KRXA 4PWNA 3RM7A 3VJOA 1TKIA 5AUVA 3ZYAA 1FGIA 2PUUA 3P86A 3QX4A 4AZSA 4F9WA 4C3RA 1JKLA 3DCVA 4KS7A 2XK7A 5IMEA 1BLXA 4R8QA 4A06A 5F94A 3SG9A 4FG7A 4YPSA 3GU6A 2VO7A 4L9IA 2VU3A 3KL8A 5AUUA 4M0ZA 4MYGA 4FTNA 2J4ZA 4EH8A 3F3TA 3LJ1A 3OC1A 1IAHA 2YIXA 3AD4A 5BVKA 4IB3A 4EH3A 4TYIA 4I5CA 2VWVA 3IW7A 4R5SA 4E1ZA 4CMUA 3VW8A 4CT2A 1T46A 3LW0A 4LL5A 3R21A 1FMOE 4IJPA 3OCBA 4HPTE 4FZ6A 4QMVA 5HG9A 3R1YA 3T3VA 1GZKA 5JZJA 3UQCA 1KV1A 5HTCA 4M0YA 2WU7A 3EFWA 2YWPA 3Q32A 1LP4A 3CKWA 2Y9QA 5A54A 1DAYA 2W1CA 5JFVA 2GNLA 3ZO2A 3CP9A 2WTKC 2DUVA 2HZ4A 3GC9A 2RF9A 5AUYA 3CC6A 4RFZA 4TKSA 1OL7A 4S34A 5H8BA 4AUAA 4QMYA 4Q5EA 3COHA 3VN9A 5T6KA 4CMTA 3BV2A 3C4XA 3AC2A 5DRDA 3CLYA 3WZKA 3EOCA 3CY2A 1HOWA 4W4VA 1DAWA 2BR1A 1Q3WA 3E92A 2BIKB 5E8VA 4QTCA 3UIXA 4XP2A 2XIXA 3U4WA 2HWPA 4NZWB 5CSHA 3JR1A 2Q83A 3JXWA 4FSRA 2Y0AA 2YERA 3CR0A 4LV8A 4C37A 4BY9E 2BRGA 3H9FA 3KK9A 4NSTA 2YLFA 3MVHA 2OIBA 5HLPA 3S3IA 3V5QA 2X4FA 4ASDA 3F5GA 5GZAA 2UZTA 4RWLA 1ATPE 2BRNA 1ERKA 4AGDA 5JK3A 3U55A 3BKBA 3WZDA 5JH6A 5K4IA 3D2IA 2ZM3A 3T9IA 2XS0A 4XX9A 4ITJA 3PJ2A 4ZTLA 2YM4A 3CQWA 2WOTA 4IZ5A 4EOSA 4I93A 4WG3A 3EWHA 2ZVAA 2ZV2A 3DQWA 3DLSA 3FPMA 3HMPA 4I6BA 4IWPA 4DH3A 5IQBA 3FDNA 4L00A 4EH7A 3PG3A 4ALWA 3ODYX 3LCSA 2B55A 1R0PA 2VWUA 5AM6A 5AADA 4OAVB 2PZPA 3BU6A 4PRJA 4F0IA 3KY2A 5FDPA 3KFAA 3W8QA 2BUJA 4ANBA 5J5TA 5B2KA 3UBDA 5AX9A 4I41A 5IUHA 2WIHA 1HCKA 4WUNA 2NP8A 4M66A 1JKKA 4ANLA 4DEEA 1UNLA 3NNWA 3R04A 2IVSA 4V0GB 3LVPA 3W55A 4RX5A 3NCZA 1Y8GA 3TNQB 3QUPA 5DFPA 3Q4UA 2F57A 1J91A 2P0CA 3ITZA 2O2UA 3Q3BA 5E8UA 5J8IA 4BGGA 4BYIA 1BX6A 4AN3A 5LJJA 3OZ6A 3WYYA 1DI8A 3H30A 4IX6A 4BL1A 3UGCA 4KRDA 4CNHA 5JGBA 4HPUE 4EORA 1JSUA 3QXOA 4KB8A 4RC2A 5CEKA 2E9NA 3R6XA 2C6OA 3OTUA 1PKGA 3O96A 3OD6X 4QD6A 4ZLOA 2UW3A 4MXAA 5HBJA 2X9FA 4CZTA 2GNIA 4FG9A 3CD8A 1H1PA 2GMXA 1VR2A 3QYWA 4IHPA 3MN3A 1YKRA 1YWVA 2R0UA 1V0PA 2PVHA 3LMHA 4MBJA 2HAKA 2QOFA 2ZMCA 4NK9A 2W1EA 3BBWA 4U40A 4WHZA 3UIUA 5FXRA 4MX9A 5CASA 1KUTA 4RT7A 3FYKX 1B38A 4EJNA 4FF8A 2XJ0A 1PMEA 3HP2A 5F95A 2GNFA 2XRUA 3QCXA 3C4FA 4M84A 3MH2A 4YC3A 5EM7A 5AR2A 4D1SA 2C6EA 2XIZA 3QYZA 5IA1A 3DK7A 3COIA 2YJSA 4PTCA 3NW6A 3DXNA 3NS9A 1QPEA 3RPYA 3MH0A 3R9DA 4KUJA 4O7RA 2V22A 5M56A 3P0MA 2P3GX 4YTHA 2OJFE 4U97A 2X9EA 2F7EE 3R7UA 2BDFA 3SQQA 4EYMA 3Q9ZA 3I6WA 3NSZA 2KTYA 4RIOA 4K0YA 4C3PA 4KD1A 4EZ3A 3QTQA 3NUPA 4IQ6A 4PPAA 4V0GA 3G6HA 1YWNA 3FZSA 3NYNA 3V8WA 2Y6OA 4AZFA 2PZRA 3QQJA 3UQGA 3PA3A 2VTHA 3RAHA 3ORZA 3W1FA 3ZZWA 3IS5A 2H96A 3COKA 4E5WA 4ZP5A 4O84A 5CSXA 4NIFB 2XNNA 3ORNA 4C61A 4QNYA 3HMIA 4GV1A 4ENYA 4EOMA 4F09A 2YFXA 2Y7JA 3FLWA 3EN9A 5HQ0A 5E92A 4ZZMA 3BQRA 4I6HA 4U8ZA 4JS8A 4AW2A 4WNKA 4EK3A 1J7LA 3GFWA 3NVKI 4HVHA 3UZPA 1K3AA 4U43A 1PXOA 1WAKA 3EN4A 2Z2WA 4AGWA 1NVRA 2C4GA 2X2LA 2ZDUA 3AC4A 3EQDA 4EK5A 5A14A 2LGCA 3TUBA 2XK6A 1KE5A 3PY1A 4ASZA 3RJCA 2YISA 3NYVA 4WT6A 4QMNA 3E64A 5EKOA 3DAKA 4RBLA 5EYKA 5CLPA 3VRYA 1Y6BA 3KXMA 1ZXEA 3UE4A 3F5UA 1PXKA 3P08A 4R6VA 2BALA 2YIWA 4PNKA 4UMUA 4MVFA 4PV0A 3E8NA 3QC4A 5DNRA 1YVJA 1ZYLA 3H0ZA 4PQNA 4DGGA 5DR2A 3SG8A 5AV2A 4UWBA 2FA2A 4DG0E 5HTBA 3ACKA 4CFXA 4DLJA 1JQHA 3LFFA 2R4BA 3II5A 4KBCA 1B39A 2DYLA 1CTPE 1NA7A 2PYWA 2X8IA 5J9ZA 4O7TA 4U3ZA 2BAKA 2QHNA 2Z8CA 2X8EA 4NM0A 4BF2A 3RBWA 4RC3A 3UODA 4YTIA 1LEZA 2J9MA 3KMMA 4NIFA 1M7NA 4ASXA 1OM1A 3IDBA 3I5NA 1UWHA 2RFNA 5E90A 3UMWA 3QD0A 3HZTA 3UOHA 4TYGA 5CXZA 2OK1A 2BAQA 5IQFA 4MD9E 1O9UA 2ZDTA 4FYOA 2W1HA 5A3XA 2CJMA 5DWRA 4AW1A 4AF3A 2WMRA 5BYYA 3ZLSA 4XV3A 3V8TA 4C4HA 3R8UA 3KMWA 3SD0A 4E6QA 3ZSIA 3QWJA 2WTWA 2CGVA 2RSVA 3IW6A 2QG5A 2ITXA 2OJIA 4DH8A 1VYWA 4FTLA 5M57A 4RIYB 3TTIA 3FYJX 1CM8A 3M2WA 5HD7A 2OI4X 1W82A 3L9LA 3W32A 4BDJA 3FJQE 3LFEA 5HTIA 2W1GA 2OZAB 3O8TA 5HG7A 4DTAA 2R5TA 3E3PA 1MP8A 4ZSGA 2XNOA 4FKOA 5LCKA 2AC3A 3PXQA 5IF1A 4BTFA 2B7AA 4L3LA 5TKDA 3S4QA 3A99A 5I3OA 4M69A 5HD4A 3OBJA 3AT3A 2VTLA 4I1ZA 2YIRA 1URWA 3PSCA 4DGOA 3D5UA 4A9RA 4UMPA 5LXMA 2GNHA 2ITQA 4BFMA 2C1AA 5K3YA 3VNTA 3BX5A 5FM3A 4S30A 4AXAA 5CENA 4FA2A 3QQHA 5JFWA 2YACA 4G6OA 2W0JA 4I5HA 4O0WA 2F2UA 1F3MC 4ZAUA 2V7OA 3TL8A 4LM5A 4PDPA 4AW0A 4ZY5A 5KBQA 2VTPA 3BYUA 3KMUA 3JS2A 2W4OA 2YCQA 2XEZA 3EJ1A 4HJOA 2R3FA 3I1AA 2BHEA 4RG0A 2W5AA 4H58A 1FGKA 2B52A 4YBJA 3KN6A 4WBBB 2PVNA 4GFGA 4JIKA 3VBWA 4AZEA 4OLIA 4EKLA 2JAVA 5L8LA 2CNUA 5HIDA 4GJ3A 5IEXA 4EH4A 1PHKA 2OH4A 4YJTA 4JG6A 4CFUA 5L2SA 4C4IA 4K9YA 5IDNA 4O0VA 3FWQA 4PTGA 4BCFA 4E5BA 3CTQA 3ZO3A 2R3IA 4RJ3A 4XG9A 1YRPA 3FLSA 4B0GA 2OXDA 1H26A 5BYZA 4EK4A 3UO4A 2CSNA 5IA0A 3MVJA 2CKPA 3DFAA 3NNUA 1L8TA 5C8NA 2WXVA 3LHJA 2Q0BA 4ZS0A 3A2CA 5I9XA 3IPHA 3OWLA 3DFCB 3BHUA 1SVEA 2OZAA 4PF4A 4R7HA 2XVDA 3H9RA 4L53A 5K0XA 5CY3A 1ZOEA 4WO5A 4EEVA 5G1XA 3RNIA 2R9SA 3EQBA 1YQJA 2QURA 4OBQA 4NKSA 5DEYA 2YWVA 2OF4A 4ZTHA 3RM6A 3POZA 1LEWA 1XQZA 1UU8A 2OIQA 4TYEA 5M53A 4FEWA 3RHKA 2QR8A 4FVPA 5FLFA 2YM6A 3PSDA 3VQHA 3C4ZA 3AD6A 3WZUA 2GTNA 4OUCA 2LAVA 4EQUA 1PXIA 4EWHA 4PP7A 2WO6A 2WMVA 2Z60A 2C5OA 1P5EA 2PE1A 1OB3A 2WTKB 3IG7A 4FKWA 3P78A 1KE7A 4EUTA 5M44A 1H07A 2OU7A 2Z7RA 1Q8UA 2IN6A 4O27B 5HVKA 4PL4A 4NTSA 3R01A 4D1ZA 5CT0A 4DTBA 2IWIA 3MS9A 3NLBA 1JKTA 5CZIA 4YO4A 2O63A 3GQLA 4IAIA 4F7LA 5I9UA 5KCVA 3KRLA 4YJVA 4YBKA 3RAWA 4BDGA 4YO6A 2PE0A 3O23A 2QOCA 3H4JA 4BZOA 4PDOA 4F63A 3A7IA 5HE0A 3TUCA 2R7BA 1J3HA 2VTAA 4K33A 3BGQA 1SNXA 3GC0A 4BBFA 4C34A 1FMKA 4MNEA 4NFMA 5AUXA 3L8VA 3NW5A 4F6SA 1BYGA 3EN6A 2PUNA 1XH4A 4FSQA 2QQ7A 1KSWA 4S32A 5D7VA 5EDPA 2PPQA 2VUWA 4N4SA 4EKKA 5A6OA 4ASEA 3MPAA 4ZEGA 3VS2A 4X0MA 2G2FA 5IEVA 3S0OA 1YHVA 3Q9WA 4U6RA 4AQCA 1NY3A 3OWKA 4JBOA 4OTDA 5HKMA 1UU9A 1XJDA 2NO3A 3BLQA 4P90A 3HUBA 3UPZA 4DGLC 2B54A 2E9PA 3VUKA 5JMSA 4L42A 4LRJA 2QOIA 4O7SA 4D2RA 3ZXTA 4YZDA 2C5XA 5HGIA 4EZ7A 2AC5A 3JVSA 4M68A 3UVPA 5KBRA 5AV1A 5LMBA 5AV0A 3CBLA 4FEVA 2RG5A 3RPRA 1SYKA 4D4SA 4QQJA 3ZSGA 1AQ1A 1OKVA 4AP7A 1OMWA 2HXQA 2Y8OA 2WMSA 4F6WA 2ESMA 2C0OA 2UZDA 3HAVA 3GC7A 4G17A 1BI8A 4NFNA 4QMXA 5AM7A 3RPOA 4CVAA 3QRKA 4F7SA 4YMJA 4OAUC 1PXJA 2WQMA 2IPXA 3MFSA 2YDKA 2YM5A 4O0SA 4Q5HA 4IX5A 3PXFA 4DEDA 2WPAA 3IDPA 1ZRZA 4AA0A 2F9GA 1OKYA 4O0TA 4TL0A 4QMOA 5BQ0A 4GKIA 5AP5A 1XO2B 3NUSA 4CXAA 2I0HA 2BROA 2J5FA 3NNXA 5ITAA 3WYXA 3LFNA 1H24A 3R2BA 1Q97A 4GU9A 4KIKA 1PMUA 3DZOA 3S2PA 3ULIA 4JBPA 4I20A 2O64A 2CHLA 1ZOHA 5FD2A 3P4KA 4IVDA 4XJ0A 2JBPA 1ZZ2A 4BWKA 1S9IA 2V0DA 2JAMA 3E93A 2B9FA 3TTJA 3KQ7A 4IAAA 4PDSA 2E9UA 4LI5A 3RWQA 3VWAA 3ZO4A 2W4JA 3DV3A 4M14A 2XNPA 5HLWA 4IZ7A 4FT9A 4QMWA 1PRYA 5EHOA 4X6QC 3Q5ZA 3ORMA 4DH1A 5L4QA 3ET7A 5J9LA 4G3FA 4C38A 4ZMFA 1PXLA 4EC9A 3FQEA 5AP0A 4FZAB 4AG8A 4DCEA 2R7IA 3LCTA 2XF0A 2H8HA 3B8QA 4O91A 4YTFA 5FXSA 3QUEA 5CQWA 3RAKA 4AAAA 2P2HA 2WKMA 5IQGA 4EONA 2UZNA 5ANGA 3GEQA 2XKFA 2JITA 4W8DA 3AC1A 5KZ0A 4OR5A 1RQQA 4G6LA 2A4LA 4C02A 3QQFA 4ID7A 2B9JA 3EFLA 4YSMA 4MF1A 1YXVA 2B9HA 3ZUUA 4XLVA 2WEVA 5C8MA 2YIYA 3QHRA 2Y4IB 3RGFA 5EYCA 3ZUVA 3KU2A 3O2MA 4IWQA 2X6DA 4V05A 4X2JA 3ZFXA 3NWWA 3OTVA 4JVGA 5HESA 3E63A 3ZLYA 3F5XA 2ITTA 4NUSA 4LMUA 5IH4A 3OWJA 2OZOA 3QZGA 3SC1A 5KMMA 4Z55A 5BYLA 3EQPA 1M52A 5ANJA 2W9FB 3FXZA 5CAUA 5IISA 5FRIA 3NR9A 4O0XA
chains in the Genus database with same CATH superfamily
5LMKC 1GZNA 1RW8A 4NWMA 5LVNA 2UZWE 1GZOA 2ZV7A 4XV2A 5CXHA 2PMOX 3ZFMA 3IECA 2BHHA 5HU3A 4QMZA 3SXRA 5FTGA 2PVLA 2W1ZA 5E1SA 3KC3A 4R78A 2PVRA 1QPDA 3RNYA 5EQPA 3CGFA 1DS5A 2Q0NA 3K5VA 4KSQA 4N0SA 4QP9A 1OPKA 4YZCA 3UG1A 2PZIA 4C35A 1NVSA 4L43A 2OF2A 2YCSA 3PPJA 4FTIA 5CSVA 1U5QA 4O81A 4GJ2A 4IAFA 3I0QA 1UWJA 4WNPA 3W0OA 5CAVA 4D2SA 4BCKA 4JL9A 4FT5A 1GIJA 4JDIA 4BHNA 3QTRA 1G8SA 4NYEA 4DEHA 5CSPA 4U3YA 2R3MA 2CNVA 5ICPA 3LIJA 4CYIA 5HG5A 1GIIA 3QKKA 4ITHA 4BDDA 3BELA 3RALA 2I7QA 2ZB0A 3B8RA 3IW5A 3R71A 4I0TA 4KBAA 4O83A 4P5ZA 5FP6A 3VRZA 4CFNA 4BDHA 5AA8A 5K5XA 1NVQA 4CZYB 3E5AA 4E6CA 4DITA 1UKHA 4AN2A 5M09A 4C8BA 4M12A 2XAMA 4MNFA 4FKTA 4O7VA 1OIRA 4FL3A 4UY9A 4QRCA 4D2PA 4BDIA 3PPKA 4G3EA 1OIUA 2JKQA 4QPAA 3W0NA 4EJ7A 2CCHA 3QD2B 2Z02A 4OBPA 1IASA 2ZM1A 3PWDA 4QYHA 5AV3A 1ZMUA 4CKIA 4YTCA 5I5ZA 3QALE 5DG5A 4E4XA 4IDTA 2HW7A 3OY1A 3KXHA 4NCTA 4JQ7A 4Y5HA 3EQRA 4RX9A 4H1MA 3ATTA 5L6WL 2FB8A 4OTPA 5LMAA 4BI1A 4WA9A 5HE3A 5BVDA 5CEOA 3FL5A 2KULA 3HA6A 4FRFA 4B7TA 4AFEA 5E8ZA 4CT1A 4DBXA 3RCDA 3ZBFA 4UBAA 2HENA 2XNGA 1W2FA 4ZZOA 3TNWA 3QTWA 5K4JA 2ITOA 2PVFA 3AXWA 3ZXZA 4EL9A 4CG9A 4FSMA 2JFLA 4RJ6A 5A4EA 5F4NA 3SRVB 4EQCA 4JR3A 3ROCA 4ZLYA 3NX8A 3I4BA 5KMOA 3DBFA 1Z57A 5EI2A 5H8GA 3KK8A 2JDOA 2VTOA 4BDCA 3RWPA 4DEGA 2J5EA 2UZBA 3CIKA 3PP0A 2HOGA 4JDHA 4ACHA 1A48A 4D0WA 4YZBA 3LLTA 4O2ZA 4RVMA 4PDYA 2PZ5A 4TWCA 2AYPA 2AUHA 5C9CA 2VO0A 5AWMA 3P7AA 4C3FA 4LYNA 2W96B 5E8SA 4XHKB 3FSFA 4BCGA 2NRUA 2W7XA 3LCKA 4FYNA 4J98A 4IWDA 3HRCA 4P4CA 2X4ZA 3L9MA 4XCUA 4EBVA 2OLCA 2PSQA 3QHWA 3LXLA 2JBOA 4HGEA 4WD5A 1JPAA 2Z7QA 3SXFA 4RRVA 5CSWA 3VW6A 1GZ8A 2XCKA 4XG6A 2YDJA 3MPMA 1F5QA 3H3CA 3E7OA 4OTQA 4QMUA 3A7GA 3K2LA 3L9NA 3UVQA 1IAJA 2RGPA 3VBTA 1JNKA 4ZJJA 3NAXA 2B53A 4ERKA 5AP6A 4IANA 4MQ2A 3O7LB 5HO6A 4WRSA 3UJGA 3BZ3A 2YEXA 1QL6A 3WZJA 4Z7HA 4O82A 5DOSA 4BGHA 1M2RA 1WCCA 2R3LA 4R3CA 5J5SA 5HX8A 3PIYA 3VUDA 2BILB 3A4PA 3QXPA 4UB7A 3LFDA 3CE3A 4GUEA 2PTKA 2VNYA 4X6RA 3NPCA 3PZHA 3PLSA 3UQFA 2C47A 3HV5A 4RVLA 3MV5A 1XBAA 4BCHA 3SRVA 1UA2A 5H2UA 2WTVA 1JSTA 3BWJA 4FTMA 4F64A 2QI8A 4TPTA 1UV5A 1H0WA 3TT0A 1Y57A 5JZNA 4JAJA 4TW9A 4YGAA 4BJJB 2PUPA 4XNEA 5FWKK 3WILA 2BTSA 4YZMA 2PK9A 2R3NA 1YXXA 4JDKA 4E6DA 2G9XA 4CKJA 5DR6A 4AS0A 1YWRA 3DK6A 3GU8A 2WQOA 5H8EA 2JD5A 3Q5IA 2UZVA 2UZUE 4EWQA 4ACCA 3VAPA 3FMEA 4LGDA 5AUWA 5DBXA 4F78A 3OY3A 5CEMA 3CSVA 5CVGA 4FG8A 4FIEA 4LOPA 3BEGA 4ZTQA 3EL8A 4A9SA 4D58A 1NW1A 3WI6A 1CKIA 1H01A 4RJ5A 3V51A 4X3JA 3R83A 1YOLA 4ZIMA 4QEBA 4DEIA 5EFQA 3EN7A 3OXIA 4E5AX 3CPCA 2PVYA 3K54A 3LPBA 3PJCA 2FSTX 3RK5A 5J7BA 3LQ8A 4BKYA 5C26A 3HLLA 4O0UA 3VS1A 5GZ9A 1Q8WA 3LFSA 3MFTA 4IFCA 4IJ9A 4BCMA 5FM2A 2XZSA 4LOQA 3VBYA 2PMIA 3ERKA 4RSSA 4ZTSA 4DFLA 3R9OA 4XG4A 5HVJA 3BLHA 4YHTA 2E9VA 4EHGA 1AGWA 3MPTA 4X2FA 3PXYA 3R0TA 5HE1A 2C5VA 3C0HA 5FEEA 4AU8A 2JDRA 5FUTA 3CXWA 4AGUA 1UNGA 2QD9A 1GOLA 2REIA 3HGKA 2QLQA 3MH3A 3TI1A 1YDRE 4D2WA 5IA3A 1OZ1A 2CDZA 3KXGA 4X2GA 4X7QA 5DH3A 4HYUA 4WKQA 3SLSA 3PWYA 4RIXB 4E93A 1JSVA 4W4WA 2YCRA 4B8LA 3DB8A 3B2WA 4YURA 4ZXTA 1RE8A 3GENA 5EW8A 3VBXA 3TUDA 4ONAA 4ZK5A 4BJJA 2XKDA 2ZB1A 1ZAOA 4O1PA 3N51A 4GUBA 5CEQA 5DEWA 2OGVA 1H28A 4DE4A 2QHMA 4R1YA 5AP2A 1ND4A 3R00A 4U5JA 1FINA 3IOPA 4F1OA 2QC6A 3F61A 3PIXA 1VYZA 1YI4A 4FSTA 3O7LD 4K11A 3K3JA 3EKNA 2VTMA 3QTSA 2ZOQA 3G33A 1H1QA 1WBOA 5BV3A 4PMTA 5EQEA 2X7GA 3EQHA 5FG8A 4CFVA 4E3CA 3AT2A 4L3PA 2QOLA 3DS6A 4B9DA 5DLSA 2I0EA 4DFNA 4C0TA 4ZY4A 5K9IA 3AT4A 4C2VA 5JT2A 2OXXA 2IW8A 1M7QA 4FTRA 3OCSA 4EBWA 3ORKA 4DCAA 4HNFA 2W1IA 2RG6A 3U6HA 1QMZA 3FEGA 3Q52A 2WQBA 3SW4A 3QD4A 4RA4A 5E8WA 3UDSA 2VWYA 4EOIA 1YW2A 2BPMA 1BL7A 4HNIA 2P4IA 3ACJA 4FV5A 3T8OA 5J9YA 2ITUA 2IZSA 2WTIA 3ENMA 1OKWA 4L52A 1YHSA 4G5PA 4NEUA 4RQVA 5EQYA 1XBCA 4DT8A 1PY5A 2WNTA 4EI4A 4FMQA 2QO9A 4R5YA 2R2PA 3NUNA 2C6IA 3FMNA 1L3RE 5GNKA 3VUTA 2PL0A 3QX2A 3K3IA 2J90A 4RIXA 5DMZA 2VX3A 1GJOA 3WZEA 4TY1A 3ZU7A 4RZVA 3FZOA 4BTJA 3FL4A 4BBMA 3A7HA 1TQIA 4QQCA 3R7EA 4AZVA 5I4NA 1NT2A 3DQXA 3KB7A 1WBTA 4UWCA 4AW5A 3ZDIA 4DN5A 3EB0A 4GFMA 4Y72A 2VWZA 2QO7A 3D4QA 4LGHA 2GSFA 5DR9A 3VVHA 2QLUA 3KKVA 3TDVA 3WF5A 1U5RA 3R8VA 2OJ9A 5KUPA 2IVUA 5E4HA 4IB5A 3DJ5A 1Y8YA 1OL2A 3UO6A 2GS6A 4DHZA 4YJPA 3GOKA 3KGAA 2I6LA 1PYEA 1AD5A 4O6LA 4IM0A 3CJFA 5CU6A 1H8FA 3F2AA 3DA6A 1X8BA 5ANOA 3ZRLA 4C36A 1JLUE 3PA4A 4EUUA 5B0XA 2A1AB 5D41A 2G1TA 1ZYSA 4MWHA 3VBQA 1ZYJA 4FV7A 2XBAA 5DGZA 4H3PA 2WTDA 3UDZA 3W2QA 2WU6A 4FVRA 3PVBA 3U54A 4GVJA 4OTIA 4PTEA 3TACA 3LMIA 1W83A 1QPCA 2OH0E 3FI2A 3LZBA 4GL9A 4KIOA 1FQ1B 1VJYA 1CDKA 2F2CB 4BB4A 4BDBA 3I5ZA 4J1RA 4PP9A 5HE2A 5EM8A 4FKSA 5HO7A 2BFXA 3VIDA 2IVVA 3HV3A 3ULZA 3SW7A 3FXWA 2VTNA 4R3RA 2C6LA 3LXPA 3QAME 1REKA 4HYSA 5GJGA 2R3RA 3FZ1A 4BVUA 5TOZA 4NTTA 5GIPE 4BDFA 5EDRA 4Y8DA 3JY0A 3ZCLA 5L2TA 5IQDA 4IX4A 3AMAA 5T3QA 2FO0A 4AA5A 3P9JA 4A4XA 4CFWA 3DOGA 2C3JA 3QQGA 4XYFA 5DPVA 4IFGA 4G6NA 1ZY4A 1Y91A 3BYVA 4HOKA 1ZZLA 4K77A 3OWPA 4BCIA 4DFXE 4E4MA 3IW8A 2CCIA 4B6LA 5AAEA 3D15A 3AC8A 5D12A 3EQFA 4OTWA 2UZOA 3BIZA 3HMMA 2GNGA 2WMWA 5ACBC 2J0LA 4KSPA 4BKZA 1OIQA 2ITYA 2WAJA 4FTAA 3DB6A 3Q96A 4YUQA 1V0BA 4W4YA 3Q4CA 4L8MA 3PYYA 2IEWA 4FIGA 4BTKA 4E4NA 3PY0A 4AACA 4KKHA 3PJ3A 4QTDA 3W2SA 4Q2AA 2WOUA 2PVMA 3F88A 3VS7A 3EIDA 1W7HA 4HVDA 5FEDA 2XARA 1TQMA 2GNJA 4AZWA 1J7UA 3CEKA 3HV4A 4IB1A 4CV9A 3R8LA 4R7BA 4CLJA 2GHMA 1CKPA 2XM9A 3MBLA 5CZHA 5G6VA 3JUHA 4AX8A 3R7GA 4GU6A 1U54B 3MB6A 4KS8A 5CI7A 3W2RA 3NUXA 3DGKA 4QP1A 1TQPA 3LQ3A 2NNWB 3MWUA 2XYNA 4UV0A 3E88A 4RIWB 5DHJA 5M08A 3QGWA 2PVJA 2UVZA 5A6NA 2PULA 4O21A 1MRVA 1Q99A 3IGOA 5ANDA 2IW6A 2B1PA 4K8AA 5ANEA 3GNIB 4AXFA 5HLNA 3SXSA 2VZ6A 3L1SA 3FUPA 3W8LA 3Q9XA 4MWIA 5LWMA 5HVYA 3W0MA 3R63A 4F9YA 5M51A 3RPSA 3VF9A 5A4CA 4YR8A 4FKIA 3OFMA 2VX0A 3EFKA 1I44A 5KZIA 3QBNA 4ANOA 4F9BA 4EHEA 1ZYDA 3MW1A 4GK2A 5DT3A 2YCFA 3C4WA 4YLKA 2V5QA 5M55A 4AE9A 4FKLA 1IRKA 3MDYA 3D5VA 5HG8A 2IZRA 3DKGA 5HIEA 3F5PA 5GIOE 4I3ZA 3V5TA 5HHWA 2ACXA 4H3QA 3VC4A 3WIGA 2IW9A 4FK3A 3FSKA 3KVXA 3IOKA 4D4RA 2PMNX 4E8AA 3MH1A 3NW7A 3E8EA 4ANQA 4YJNA 1WBPA 2OJJA 2EXCX 5GZ8A 3KCFA 2GQSA 4XUFA 3HV6A 3RKBA 4RIYA 2V7AA 1Z5MA 2HYYA 2C0IA 3DY7A 2CKQA 4X2KA 4F1TA 2B0QA 2XJ2A 2UW7A 2YIQA 3LMGA 4FV0A 4I6FA 4JLCA 2UVXA 2HW6A 4FIIA 2JDSA 4D2VA 4DEAA 3ZONA 3U9NA 2JDVA 4WOVA 4RPVA 4C4GA 4P5QA 1V0OA 4BTMA 4JDJA 2XB7A 3PFQA 3TN8A 3UPXA 3V04A 3LOKA 5J79A 3KRWA 3LJ2A 2XK8A 3F6XA 3ORLA 3V01A 4H05A 4ACGA 2BTRA 1TVOA 2WMUA 3ZSHA 3T9TA 4AN9A 5C01A 2YM7A 4IBMA 4O7WA 3UP2A 3EH9A 3HDMA 5CI6A 3UDTA 5HNIX 2EWAA 4AXDA 1PKDA 3QTZA 2ZM4A 1WZYA 3IGGA 4FKQA 4OGRA 4N57A 2QVSE 3ZC5A 4GYGA 5JN2A 4FEUA 4XV9A 3SX9A 3UIBA 2J7TA 3I7CA 4FODA 3UG2A 1UNHA 2ITNA 3MFUA 1OUKA 4XBRA 3QQUA 4DFYA 3JPVA 2ITZA 4YZNA 4ZOGA 1K2PA 4L44A 5HO8A 1JKSA 4KNBA 5A4QA 5K5NA 5JEBA 1REJA 5CF6A 3PP1A 4CFMA 5EW3A 3KXXA 4TTHB 4P7EA 1OPLA 3PRIA 2OXYA 4XG2A 5IUGA 4GG5A 1XH7A 4D0XA 1YHWA 3DBCA 3NUYA 4LFIA 4AWIA 2VX1A 4BWXA 3SGCA 4K2RA 4EOJA 2WQEA 4MD8E 4KA3A 4Y5QA 2W06A 4G2FA 3I81A 1XBBA 3KF4A 3VS0A 2QG7A 4YJOA 3QU0A 5AP3A 4FE2A 3ANQA 3EQCA 3LCOA 1M14A 3ATSA 3BU3A 3LXNA 3A8XA 4IIRA 4OT5A 4RJ4A 5I9ZA 5I9YA 1M17A 3F2RA 5IU2A 5AR8A 4HVSA 4FUXA 4WNMA 3FMJA 5M4CA 2HZIA 3KULB 2X2KA 2VWXA 4QP6A 2FGIA 2XK9A 4ORKA 5DVRA 5KNJA 4XS2A 4FV9A 4B99A 3ZLWA 3OOGA 4LRMA 5IQIA 2VAGA 2EXEA 4HGTA 4D9UA 2C1BA 3AG9A 4TNBA 5F9EA 2YZLA 5TE0A 3SHEA 4GCJA 4PNIA 4YC8A 4ITIA 3P7BA 5B2MA 5LCJA 4GVAA 1URCA 3RTPA 2YDIA 4K1BA 2J50A 3OVVA 3V3VA 3EZVA 4XG8A 3BQCA 3OMVA 3FMHA 4FKJA 3TXOA 3R22A 5J87A 3U51A 3W0PA 4F0FA 4F1MA 4XOYA 5EM6A 1MRYA 4J96A 5IA2A 3HMNA 1V1KA 5AR5A 3I7BA 4MF0A 2X81A 2P33A 3HP5A 2VGPA 4FK6A 5D9HA 2XIKA 5E8YA 5I9WA 1UU3A 1H27A 1APME 1W8CA 1P2AA 3QKLA 1ZWSA 3NGAA 4GRBA 4USDA 2J6MA 4GFOA 2BRBA 4LV5A 4RMZA 4XP3A 2C69A 3F7WA 1PW2A 4TZRA 4W4XA 5IUIA 4F7JA 4HYIA 5GINE 4A4LA 1W0XC 4FGRA 4OTGA 2PUIA 4FT7A 3O51A 5CALA 2VTSA 3D2KA 2J51A 3QD3A 4F7NA 2ITVA 3PJ1A 4ERWA 3H10A 3V5PA 3VUHA 5KMLA 3TMOA 5ETFA 3FY0A 4IAKA 4RX8A 5AR3A 3K5UA 4NT4A 5KX8A 2ZAZA 2CKOA 3GCVA 4PMSA 2A0CX 4YHJA 3LFAA 4XRJA 3FHRA 2EU9A 2O5KA 4Y95A 2UZEA 3VBVA 4F9CA 2BZJA 4G31A 3A4OX 4JRNA 3ZS5A 4QMPA 2JIUA 4HCTA 1ZMVA 3BHYA 3OCTA 3KULA 3NFGB 3DJ6A 3QCYA 3QCQA 4GSBA 1OBGA 4QP7A 3KN5A 2IZTA 5AFVA 5CTPA 4QMLA 1OVEA 3ZZEA 3TZ9A 2EXMA 1R0EA 3U4UA 2I0VA 4TN6A 3FI4A 5EYDA 4AFJA 1KOAA 2XEYA 2VD5A 4JT3A 1BL6A 3IKAA 2BRHA 2WD1A 4J97A 4BBEA 3GXLA 3ZUTA 4RLLA 3HMOA 3N4UA 3F66A 3R8PA 4RFYA 3SKCA 3BE2A 3GB2A 3C0IA 4MXOA 5EI6A 4ZZNA 3MESA 2C6DA 2VV9A 4K6ZA 4MBIA 1VZOA 3OF0A 4FTOA 4WSQA 4D1XA 1G8AA 5HU9A 4IVBA 5AMNA 3TV6A 4NM3A 4XLIA 2CN8A 4I5PA 4NJDA 4C59A 2CN5A 5I3RA 3FC1X 4GYIA 1PXNA 3R9HA 3DNDA 3FLNC 3C9WA 3MGYA 2H9VA 1CSNA 3OXTA 4ENXA 4F6UA 4DT9A 4KRCA 3F7ZA 4JRVA 5IDPA 3TJCA 3P5KA 3EN5A 2W1FA 3GUBA 4J99A 4JBQA 5AIRA 2CLXA 4BI0A 2JGZA 4G1WA 4KINA 5BX0A 5C4LA 3WARA 2C68A 4FSYA 4UEUA 5AEPA 4DFUA 2CGXA 2JKMA 4GMYA 3W2CA 3DLZA 2ONLC 4ACDA 3DKCA 4S2ZA 5EK7A 1WBSA 2XJ1A 3MIAA 5FP5A 3ALOA 2OKRA 4TWOA 4G3GA 2BZIB 2PE2A 4J53A 4ZTNA 3Q60A 3TV4A 4I0RA 2UW8A 3D0EA 5CVFA 2CLQA 3C13A 3UOJA 3HAMA 3POOA 4FI1A 4YPDA 2P2IA 2PWLA 3DK3A 3KA0A 5FBOA 2W4KA 4ARKA 1F0QA 2XK4A 4EH9A 2WTCA 4W9WA 1WVXA 4O22A 5A4LA 2G2IA 3I79A 3MJ2A 1DM2A 3NUAA 4NKAA 3E87A 2ZYBA 3V6SA 3VS5A 2YM3A 3Q53A 3UDBA 3KF7A 5J1WA 5AUTA 2XKEA 1ST4A 2QCSA 3UYSA 4U80A 3MVLA 3QZHA 4EOOA 1PXPA 5FTQA 4EOLA 4BWPA 5HEZA 5BUEA 3NIEA 2VO6A 3PIZA 3R9NA 1M2QA 2GS7A 1I09A 4NU1A 2WMAA 3ZH8A 3TKHA 2G2HA 5CU4A 1Q4LA 3SV0A 4J95A 2G15A 4BZDA 5FGKA 3UOKA 3FKOA 4DHJA 5L2QA 3FE3A 1Q8ZA 2XNBA 4A07A 2ZV9A 2GQGA 3HYHA 3MTFA 4FNYA 4Y73A 2FSOX 4XG7A 4ZSLA 4KBKA 4R3PA 3PRFA 1T45A 2VTJA 5IQHA 3ROYA 3UIMA 1EH4A 3DT1A 3Q04A 1OL6A 2JIVA 5FDXA 4FX3A 4FKUA 2ETRA 3Q9YA 3FY2A 3KCKA 4TWNA 2O3PA 3FZRA 3FC2A 4CYJA 5CU0A 1Q8YA 2R3KA 3AGMA 3ORXA 5AP1A 5DN3A 2R3PA 5E7RA 2XH5A 3ZBXA 3UZTA 4CD0A 1H1WA 3R02A 1UU7A 3ZC6A 3R7YA 5LVLA 5E91A 3QWKA 4ANNA 2Z7SA 4BRXA 5L2IA 3BBTB 3QZIA 4DFBA 4O86A 1Q41A 4RWKA 3BU5A 2XYUA 4FV1A 1FPUA 3VQUA 3QL8A 1MQBA 3E8DA 4L45A 5C27A 3FBVA 4RJ7A 4QMTA 2W1DA 3D94A 5HNBA 3IW4A 4CTBA 5CAPA 1IA9A 3ZEPA 3Q2MA 1PXMA 2A27A 1Q61A 4EHVA 3PE2A 4FSWA 4DA5A 3QTIA 2B4SB 2BRMA 5JGDA 3DDPA 4MEDA 3RMFA 4I5MA 3LCDA 3TWJA 2DWBA 3NEWA 3NUUA 5HI2A 3UVRA 1OGUA 4F99A 5IEYA 5CX9A 4MTAA 4PX6A 3FHIA 5KKRC 4QMMA 1PF8A 1SM2A 3LLAA 2QU5A 3F69A 3JVRA 2C3IB 2RFDA 4I92A 4FKRA 5EYMA 3AKLA 4GKHA 3QC9A 4USFA 5TT7A 1Q8TA 2GTMA 4AGCA 2OG8A 2W05A 4LL0A 2E2BA 3W16A 2PMLX 1LPUA 4BR3A 3PLAE 2YN8A 5FEQA 5ETAA 3EQIA 3AMYA 5E8TA 1PMVA 3GCUA 5ANIA 4U41A 3VULA 1JVPP 4J71A 3BPRA 4TXCA 4EOKA 4F70A 3VUIA 3C4EA 4EK8A 3UTOA 5JFXA 2ZJWA 5C4KA 5IH5A 3E8CA 2BFYA 2UW6A 2OIDA 5HOAA 5FXQA 4XEYA 3UNZA 5L6PA 1S9JA 2O0UA 3REPA 2WELA 2UW0A 4IB0A 4M7IA 5LOHA 3EFJA 3PXZA 4IDVA 2YJRA 4ZY6A 4OTFA 4F0GA 3SDJA 2YLEA 3DTCA 4DH7A 5M4FA 4BZNA 2JDTA 1JWHA 4FZFB 4KAOA 2J0JA 2QODA 4FNXA 2NRYA 3O71A 4XV1A 3E7VA 3ZOSA 1P4FA 4FV6A 2H6DA 4QTAA 5HCZA 4NW5A 3PUFC 2C5NA 3A61A 4F9AA 3OG7A 2JFMA 3V5WA 4YP8A 4U9AA 4AXCA 2VGOA 1XH5A 2JKKA 3TG1A 4EYJA 3CD3A 4KIQA 3NRMA 4Z9LA 3HNGA 1H25A 5KMNA 5CANA 2BAJA 4FSNA 5AV4A 3IQ7A 4EHZA 3SVVA 4M8TA 1O6LA 4PMPA 3L8SA 4EH2A 1W98A 2R64A 5BVEA 3B2TA 5DYJA 3QZFA 4O6EA 2DS1A 3GU7A 3GCPA 2F4JA 4E26A 3ODZX 3L9PA 4JQEA 4NM7A 2W17A 4Y46A 3C4CA 5EHYA 3A7FA 2VWIA 2GFCA 5DT0A 4NJ3A 3KEXA 4CQGA 2C6MA 3D5WA 3G6GA 2QKWB 3GOPA 3QA0A 4RWJA 1FBNA 3BGZA 5JQ8A 3LKMA 3MTLA 2WFYA 4RC4A 2XIRA 3BEAA 4LQMA 2W99B 4UMRA 4FGBA 1PJKA 3V6RA 1TFFA 3RAIA 2F49A 3ALNA 3AMBA 3G51A 4HZRA 2VNWA 4BCQA 4ZMEA 4AOJA 2ETKA 1KE8A 2BCJA 5CT7A 2O8YA 4IEBA 3VF8A 4UMQA 4Y83A 3MI9A 4S31A 4XBUA 5EKNA 3MSSA 3O8PA 4QNAA 3PSBA 4ZJVA 3R28A 2PVKA 3DTWA 4L7FA 2GFSA 2V62A 3P1AA 3ID6C 3JY9A 3L8PA 4FV2A 4O7YA 2X0GA 2V55A 5JQ5A 1VEBA 5L3AA 1ZLTA 5EH0A 4DDIA 5JRQA 2W5HA 4E20A 3WBLA 5CF5A 4AT4A 3KXZA 3AD5A 5KE0A 2J2IB 3EMGA 3A8WA 4W9XA 2EVAA 3BCEA 3EL7A 3FMLA 5DE2A 4FOBA 4JOAA 4D5KA 1H08A 4NW6A 3TJDA 3RZBA 1ZARA 3CQUA 3QLFA 4EK6A 2BIYA 2C3KA 2R3GA 3CCNA 5AAGA 3ENHA 3BI6A 5F1ZA 4I6QA 5FTOA 4LUDA 2YAAA 4FUYA 1SVGA 3NAYA 5LVMA 3N4VA 4H36A 4KIPA 1OGYA 4BIBA 5IQEA 3ANRA 2XBJA 3FAAA 1CKJA 4XP0A 3DDQA 3C0GA 3O17A 3S1HA 4AT5A 4Z7GA 4W8EA 3VS4A 3DBDA 3V5LA 3KRRA 3MB7A 1O6YA 3D7ZA 5KHXA 4DLIA 3WF8A 1W2DA 1QPJA 2X1NA 4GH2A 3NDMA 2QOOA 2E9OA 1WVWA 2VRXA 4NM5A 4UYNA 1XR1A 3GU4A 1E1XA 4PL3A 5AJQA 2A19B 4YHFA 1WFCA 3G0EA 2VWBA 3FV8A 1XMMA 5CWZA 3ORPA 4N70A 4QMSA 3AC3A 5LWNA 4FTQA 3DNEA 3WE8A 4B4LA 3QF9A 4C57A 5E8XA 3BHVA 3COMA 5EI8A 5FQDC 5AR4A 4FL1A 2X6EA 5C1QB 3BWFA 4HCVA 3OXZA 2XMYA 4ANMA 1U59A 3O0GA 4MD7E 1XMLA 3CKXA 4WSYA 2W9ZB 3ZO1A 2XIYA 3G9LX 4JX3A 4Q9ZA 5M4IA 5D11A 4QPSA 2F7XE 2R3JA 3D9VA 5L6OA 1MQ4A 2YA9A 1ZMWA 5GJDA 3QRIA 3RP9A 3LFQA 1BKXA 3RPVA 4MXXA 3VJNA 1XWSA 4YZ9A 4ALUA 3KREA 1NXKA 1YXTA 3EYGA 3PPZA 3GFEA 2IVTA 3F3UA 3BGPA 3FKNA 2ITWA 4R7IA 5H9BA 1ZYCA 3NNVA 2CGUA 4OBOA 1IR3A 3SOCA 4EOQA 2BZKB 2ERZE 4I4FA 4FEXA 4BIDA 5AAFA 4F08A 3GI3A 2XUUA 2I0YA 3CJGA 1LUFA 4QYGA 3UNKA 3TIYA 4D4YA 1FVVA 3TZ7A 4CEGA 3N9XA 5BMMA 1JAMA 4CGAA 5EM5A 4P2KA 2XK3A 5EG3A 2CMWA 3F2NA 4LRKA 4BIEA 4DINA 4I24A 3I60A 2Y4IC 4I23A 3QTUA 3WIKA 3TZ8A 3MY5A 2QKRA 4C4EA 4FZ7A 3FXXA 3AKKA 1UVRA 3LE6A 1KE9A 4IW0A 3DAEA 4BN1A 4XMOA 3R7VA 4DAWA 1OKZA 4C33A 1WBWA 1BI7A 4JIAA 3FKLA 5CAQA 4PUZA 2GDOA 1YXUA 3BYSA 4NCTC 3WF7A 4QTEA 3O8UA 4TT7A 2J0IA 4FT0A 1SZMA 3HV7A 5IPJA 2HWOA 4RWIA 4TRLA 4BI2A 3SAYA 3V8SA 2HCKA 2X7OA 4KABA 2ITPA 3P79A 4IACA 2VTQA 2ZMDA 3ZM4A 4AZTA 4C7TA 2I1MA 2IJMA 3TZMA 2PY3A 1P4OA 2UW9A 5AR7A 2QONA 3Q4TA 3OOMA 3C51A 3CGOA 3AQVA 3IO7A 1Q5KA 3RCJA 3R8ZA 2GCDA 2QO2A 3VUGA 2J0KA 4JNWA 4USEA 4B8MA 5LVPA 1KOBA 1J1CA 3ORIA 3ORTA 4CCUA 1H0VA 1IG1A 4FNZA 5CNOA 3QRUA