5L2SA

The x-ray co-crystal structure of human cdk6 and abemaciclib.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
263
Chain Sequence
QQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVPLSTIREVAVLRHLETFEHPNVVRLFDVCTKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLAVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cyclin-dependent kinase 6
publication title Spectrum and Degree of CDK Drug Interactions Predicts Clinical Performance.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 263
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l2sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l2sA01
2QURA 4FGBA 3MY5A 1Y91A 5IH4A 1DAYA 4X3FB 2BHHA 5HE0A 3F5UA 3FC2A 3NAYA 4TPTA 1R0EA 5CENA 2XS0A 3CIKA 4FV4A 4ERWA 2BZKB 4FSMA 2R7IA 3R7IA 2VTJA 4DT9A 4JIAA 3DCVA 4F7JA 5B2KA 4BDCA 3LPBA 4XS2A 4ZSJA 1YOJA 5AWMA 4DT8A 1SNXA 2VUWA 3HV5A 4I0SA 5ICPA 2JAMA 4RA4A 5B2LA 4BBFA 1UVRA 2I6LA 3BYMA 4DINA 3P86A 4AT4A 2UUEA 4D5KA 4FKSA 4FT3A 4FV0A 3PY0A 4QP9A 5TT7A 3H3CA 4NH1A 4QMXA 4QYHA 3UNKA 3F3ZA 3KQ7A 1QMZA 3WF5A 3E88A 2X81A 3D5UA 4BGQA 4CTCA 4E4MA 4MNFA 4JOAA 3UOHA 4HPUE 3A62A 1H1QA 3QXPA 2DWBA 4YLKA 5C8MA 4DGLC 2QOQA 4CFMA 1KSWA 2BALA 2VWIA 2WMVA 3GC0A 3G2FA 3FBVA 4BI2A 2YN8A 2RG5A 3FL5A 3PXQA 5HBEA 3R7UA 4B8LA 4AGUA 4V04A 2F4JA 3E62A 4Q9ZA 4IVAA 1PXIA 1YQJA 2YCRA 3R8VA 3NR9A 4DITA 4EK3A 3PXZA 3QKKA 2X6DA 5DA3A 5E91A 5AX3A 3BE9A 2CPKE 5CX9A 3C4WA 4AQCA 5DFPA 3WF6A 3G0EA 3RKBA 3FLZA 3QQUA 3WE8A 4GRBA 3LE6A 4M0ZA 5FXRA 2CKPA 4X3FC 2J0KA 2JIUA 3M2WA 4TKSA 5E8WA 5F94A 3CLYA 3SW4A 4E73A 2R3JA 2WMQA 3M42A 1XJDA 2VO6A 3HDMA 3L9MA 3OROA 1WMKA 3MVJA 3UOLA 3WF9A 1ZMUA 5IG1A 5JFVA 3H9OA 1XH6A 3UYTA 4KIOA 4D4YA 3I0OA 2XKFA 2A4LA 3DJ7A 3EQGA 4RVLA 3UP2A 3TUDA 3LKMA 4DTAA 3FZOA 1SVEA 2OIDA 5HCXA 4P7EA 4WRGA 5I4NA 1Q8WA 5JFXA 5KNJA 5D12A 4YHJA 3W2CA 3PA4A 1H28A 5IA2A 4QYGA 3C4CA 3DBFA 3G0FA 3BQRA 4IM2A 2QONA 4C4HA 5HU3A 4KB8A 5DG5A 3ZZWA 2HIWA 3VRYA 3F9NA 3CKWA 3O71A 3N4VA 4FTJA 5HHWA 5BVDA 5J87A 3PG1A 4DFLA 3TV4A 4F6WA 3DT1A 4D0XA 4JR3A 4A9YA 4FGRA 5FUTA 3EQCA 2A1AB 2W05A 3FZSA 3KGAA 4A06A 2NPQA 3NUPA 4TYHA 1M2QA 2GS7A 3MH0A 4BIEA 4C34A 2UZLA 4EOJA 3TACA 4K2RA 4GV1A 3D9VA 1M7QA 2OLCA 3IS5A 4W8DA 3RI1A 4U41A 3HRFA 4DFBA 5AX9A 4O38A 1WFCA 2CMWA 2VTPA 2BRGA 2WMWA 1XWSA 4EOPA 1ZYCA 3IDBA 3QFVA 4YLLA 2UW5A 3HMOA 2YWVA 1MRUA 1LR4A 3FAAA 2VX0A 3QD2B 4AA4A 1DS5A 3VF9A 4N57A 3CJGA 5C03A 4NJDA 4YSMA 5IU2A 4PTGA 4LI5A 4B7TA 4YP8A 4BDFA 1SZMA 4I5CA 5AUZA 2B9IA 3RZFA 3UE4A 4BZNA 3QC9A 3R00A 1PRYA 1AD5A 5CLPA 3MY0A 4JBVA 5AP6A 2GFSA 4S2ZA 4IHPA 5F1ZA 2JDTA 3ZCLA 1APME 4H05A 3SG9A 5M09A 3P4KA 4HGSA 4JDKA 2UV2A 2F2UA 3WZKA 3H4JA 4IZ7A 3VRZA 3TM0A 3FZTA 2C5VA 5CSPA 1OBGA 4RRVA 3B8RA 1Q3DA 4MXXA 4NW5A 4OBOA 2HZNA 4LGGA 4FSZA 5HG8A 1K9AA 1BYGA 2UZOA 3BV2A 4FTKA 5CSWA 4K33A 1YXUA 3AT3A 1PHKA 1RDQE 2W1IA 4Q5HA 3PWYA 4DH1A 2R3FA 3PSBA 3K2LA 3CE3A 3EHAA 4J52A 1H8FA 2X8IA 3OEFX 4ASZA 3GEQA 3LXKA 5CT7A 4LRKA 3UZRA 5EI8A 5IQAA 3A7JA 3C0HA 3EJ1A 5AR8A 2BKKA 5AA9A 3LMHA 3Q9XA 3G6GA 4N6YA 1MUOA 3E93A 5ETCA 3OXIA 2XK6A 5CF4A 4PP9A 4U5JA 4MXYA 3JVSA 4TL0A 4ACMA 4QOXA 1Z5MA 4ZTHA 4F6SA 5M08A 1FVVA 3FMKA 5CF8A 4FKJA 4GW8A 4FSWA 4J7BA 5ETAA 3UG2A 2YZAA 3CQUA 1OKYA 4BFMA 4ZK5A 4FTTA 4XOYA 3I6UA 3QALE 3MYGA 5IKWA 3GCUA 4C4EA 4KSPA 1YW2A 4IAFA 2PMNX 2UZDA 1LP4A 3DXNA 3U55A 4KSQA 4FV6A 4XRJA 4L7SA 5EG3A 2BUJA 1UNLA 2JLDA 5CI6A 4RJ7A 3COHA 2IVSA 3SA0A 2XCHA 4CG9A 3L9LA 4I5PA 4YHFA 5D10A 5AV1A 4DBNA 1OKWA 1NVQA 3COMA 3I5NA 4ALVA 4CCBA 4CFFA 3ZDUA 1HCKA 4ZSAA 3A4OX 1JBPE 3FUPA 3H0YA 2X1NA 2GHLA 4IVBA 4XHKB 2YM8A 4UMRA 4XLIA 4P5ZA 2V22A 3VS4A 4AACA 1OGUA 1OPKA 5AUYA 3ATSA 3KXHA 5JRQA 2YABA 3DJ5A 5GZAA 3ZO4A 3QTWA 4IW0A 2NRUA 4RMZA 5CQUA 5A4TA 4N6ZA 3SXFA 2UZWE 5J9YA 3QWJA 4IWPA 4V0GA 3WI6A 3T8OA 4E26A 5KO1A 4E5AX 5IA5A 2REIA 4XG6A 4R78A 2V5QA 4JX3A 2X6EA 5FEEA 3OCBA 2AUHA 3UC4A 4YBJA 3ZFMA 1AQ1A 4UALA 5HICA 1YWVA 3COKA 3PJCA 1FOTA 1M52A 2G2IA 4C59A 4I0RA 3MJ2A 2BDJA 3KULA 3IW8A 4Y72A 2GS2A 3LFBA 4FBXA 4Y73A 3HV7A 1FQ1B 1JKLA 2PY3A 2W5HA 1URWA 2SRCA 3KK9A 3OOGA 5EYKA 5FP6A 5GNKA 4CD0A 3OMVA 2YFXA 3NVKI 2YM6A 4XX9A 4FMQA 4FV7A 4EONA 4F7NA 5H9BA 4YTCA 4YNOA 2RKUA 2E9PA 1PMNA 4OBPA 3F82A 4ZY6A 3ZSHA 2UZEA 5GZ9A 3QD3A 4X2GA 4BBMA 4NKSA 3HUBA 2BAKA 2WMUA 3FWQA 2CLQA 3QTSA 4RIYB 5AP0A 4ALWA 3F2RA 4D1XA 5CEKA 4ITJA 4YJOA 3IK3A 5I3OA 3D7TA 2Z7SA 4FUXA 3DGKA 1U4DA 2WMTA 4XYFA 1YWRA 5HTBA 4FIGA 4YUQA 4LV8A 4QTEA 1ZMWA 3FSKA 4B8MA 4E20A 4O84A 3LFQA 3LXLA 2PHKA 4QP2A 2E9VA 3MB7A 4IXPA 4FC0A 3W2PA 5J1VA 3DKFA 5J7HA 2BRBA 1ND4A 2OFUA 2W7XA 5F20A 2X2MA 1A9UA 5ANIA 2IVUA 1OPJA 3KL8A 4XMOA 3QA8A 3RWPA 3NAXA 3QXOA 4I93A 3SAYA 4BDDA 4EQCA 4F0GA 4EJ7A 1H25A 1NA7A 3EL8A 2VO3A 3ZS5A 5IMXA 4W4WA 3ALNA 4R3PA 4TNDA 3CY3A 4YNEA 1XBAA 2JDOA 5AP7A 4F6UA 5BVOA 3PPZA 1W82A 2JEDA 2ZV8A 3BQCA 5C27A 4HYHA 3F3VA 2YDJA 4U6RA 5FG8A 2HZ0A 5FXQA 5ACKA 2V0DA 2I0YA 3EZVA 3NNUA 5ANEA 3CP9A 2RL5A 4OTIA 4L53A 3VS6A 4R77A 4C57A 3ALOA 3C0GA 4OR5A 3TKIA 3HX4A 3D2KA 2HYYA 2OGVA 5IA4A 3ZUUA 2C0OA 5LXMA 2YIXA 3R9NA 3DNDA 1ZRZA 2ERZE 2R3GA 3BGPA 3UYSA 2W4JA 4WOVA 1GZNA 2VO0A 4IIRA 4ZJIA 2CKOA 2UW6A 3PXYA 4NIFA 2RSVA 2O8YA 2HZ4A 4C3RA 4BYIA 4D4SA 4FSTA 3LW0A 4BCOA 4I6BA 2XJ0A 3FQHA 2R0UA 4H36A 4OTPA 3CQWA 3OBGA 4HYIA 3VW6A 4O6LA 5IPJA 4FTNA 2VN9A 3DK3A 2W4KA 2QLQA 1UKIA 2ZM3A 4RC3A 3GXLA 2B55A 4Q5EA 4AZEA 1X8BA 2W5AA 3Q2MA 4C0TA 4KBCA 1WVXA 3ZHPC 4PP7A 4FG9A 3RWQA 4FYNA 3R7VA 2ITOA 4C7TA 4FTLA 2QG5A 3BLRA 3NW6A 3PA5A 4W9WA 3GQLA 4YURA 4ANBA 3HAVA 4Y95A 3GC8A 3N9XA 5AP5A 2ITVA 4DFYA 2PZYA 1UV5A 3CGFA 2ZVAA 3EL7A 5CAUA 4LOPA 1YXTA 4TNBA 3ZC5A 4D2TA 2PVNA 2BRMA 2GFCA 2RG6A 2Y6OA 1BLXA 4O0SA 4YC6A 4AN9A 4E93A 1REKA 3HA6A 5IH5A 3MPTA 5CU0A 3F7ZA 3DB8A 4FKQA 3ZXZA 4FL3A 3EQHA 4QYFA 5FTQA 4ZZMA 5BVFA 4L6QA 2AC3A 4EWQA 2I0HA 5DI1A 4EK8A 4AGCA 4E6QA 3VUIA 2QO9A 1P14A 4TXCA 2YISA 2NO3A 3BHUA 3Q53A 4CKIA 1ZYSA 4XP2A 2PE2A 5I9XA 4EYMA 4C4JA 5HGIA 3RINA 3G5DA 4DF3A 2Q0BA 2X2LA 1BKXA 2IW6A 4PMTA 1UWHA 2OZAA 5AR3A 3AD6A 4PMPA 3MN3A 4ARKA 3VUMA 3HUCA 4AW0A 3ET7A 4RVKA 3EQFA 3THBA 3WZEA 4C35A 4KS7A 3EN6A 3DFCB 2BIKB 5AR4A 2C3JA 4EOLA 3QD0A 5GZ8A 4GG5A 4O0XA 2CCHA 3GU6A 3QBNA 2Z2WA 4UX9A 1PMVA 3BE2A 4D4RA 5A9UA 5F9EA 3NWWA 4JNWA 3NUYA 3Q32A 1TQIA 4AW5A 3VS1A 2ERKA 1ZMVA 5HIDA 3A7GA 3D5XA 2VWZA 4RIWB 4EOOA 3ORPA 5FM2A 3OTVA 5L8JA 4C4IA 4D5HA 4RZVA 4WUAA 2G15A 1J91A 3ZYAA 1KV2A 1GAGA 3NIEA 3P7BA 4KBAA 5TO8A 4FV8A 3V5QA 3HVCA 3SD0A 1NW1A 3SRVB 4IZ5A 3EQRA 3MGYA 2FO0A 4GU9A 2FB8A 5D7AA 3F3WA 4EOQA 2Q0NA 4W4YA 1YVJA 4FIHA 3MVLA 4K6ZA 4DH3A 1PMUA 2PTKA 3HYHA 5EYCA 3KC3A 5CEPA 3DY7A 5B2MA 4O7VA 4UMTA 4O82A 4C61A 2Y4PA 4AFJA 4EH9A 4ORKA 3CKXA 2PZPA 5EHOA 4FIJA 3FYKX 3II5A 4GYIA 3SC1A 2I40A 5EKOA 4G3GA 1PKGA 4KNBA 3RHXA 4DGGA 3UIUA 5EH0A 4EQMA 5KKRC 3BHHA 3S1HA 4C62A 2WIPA 1JSUA 4RZWA 3FI8A 2BROA 5J8IA 3FDNA 1M14A 2BRNA 5A54A 3U6JA 4L01A 3LJ2A 5EHLA 4QMMA 2H9VA 3ODZX 4QNAA 4RLLA 5BVNA 2YWPA 4YZMA 3R9DA 2JFLA 3AGLA 4BB4A 2BVAA 1Q41A 4DGNA 1G3NA 5AUTA 4R8QA 5LMKC 3FLYA 3L8SA 3UO5A 4QTDA 3PDTA 3MA6A 4FKLA 4J71A 3UNJA 1OUYA 1UNGA 2JDVA 4H3PA 4RLKA 5CSVA 5C26A 1OIQA 4I5HA 4AZFA 5E1EA 4IVCA 5KMOA 4CFWA 4XV1A 2OIQA 4E7WA 3W55A 3ORMA 2ZM4A 5HBJA 3LM0A 4JG7A 1YKRA 4DGOA 4ZJJA 3E3BX 4BCHA 4M84A 5HI2A 3ANRA 4MF1A 4ENXA 3LCKA 4AN3A 1JQHA 3H30A 4BN1A 1B39A 2BDFA 3NEWA 4Y46A 3V8SA 5GIPE 3NUXA 3MVMA 4RSSA 2OG8A 2I1MA 1VEBA 3A60A 5J5TA 5M4IA 2GNGA 3C4EA 3KXNA 3W8LA 3R22A 2YIYA 3HMPA 4GUBA 4ERKA 4UWYA 3KCKA 2BZHB 4G3EA 1YHVA 4M7IA 4FOBA 4FNYA 4MX9A 5CEOA 2B0QA 3LFFA 5AAGA 5FLFA 1Z57A 4CMTA 3EFLA 3OWKA 1CKIA 4LOQA 1ZOGA 4PPBA 4JL9A 4NEUA 4NSTA 3IGGA 1Q62A 4JLCA 4HYSA 4PTCA 5AP1A 4EQUA 2XCKA 3H9RA 2E2BA 2IVTA 3DNEA 3PLSA 5BYZA 3ZMMA 3MA3A 5CSHA 2YZLA 3U8WA 3D2IA 1L3RE 3SVVA 4W8EA 2CGXA 3IW5A 4FICA 5E7RA 5IQBA 2WELA 3BYOA 3EN5A 3IO7A 4QT1A 4O83A 4GK4A 1ZZLA 3G33A 4AA5A 2R3LA 4FSYA 4YR8A 4YJVA 5CU2A 3E3PA 5EHYA 5T6KA 1DI8A 4EJNA 2OI4X 5IEXA 3G90X 3HGKA 1PW2A 4GJ3A 4BCFA 3CTHA 1V0PA 2ZMCA 2KULA 1T46A 3ZUTA 2HW7A 4UZHA 5BYYA 2QHNA 2VAGA 4FT0A 3LJ0A 2PVJA 4FKUA 3LHJA 3MFUA 3ZH8A 4RIOA 3RPSA 5IISA 4BDKA 1OVEA 1Y57A 3PG3A 4YZDA 3V6RA 3QUEA 2AYPA 4QQCA 3RNIA 3VUGA 3LMGA 4A9UA 4FA2A 2EVAA 4ZTMA 2W1FA 4RWKA 2YIRA 3QGWA 2W1CA 4XBUA 4O7NA 4PUZA 1OIUA 3PXRA 2J50A 3ZBFA 4U3YA 3ZO2A 4KUJA 5CQWA 4FZ7A 3TJCA 4CZYB 2GNHA 5GINE 5DR9A 4CKRA 2J5EA 4S34A 3Q4TA 3FMEA 4ACGA 4YJSA 4IB3A 3EN9A 3GCSA 2R4BA 4FEXA 4O7TA 4HGEA 1P5EA 3QTQA 4RIXA 4CXAA 5ITAA 5E9EA 2R0IA 2R64A 3A61A 4GG7A 4IWOA 3D5VA 3L8PA 3OXZA 1H4LA 5M07A 4QQJA 5IQHA 5M51A 3ORNA 5HNBA 4MK0A 1SVGA 5AAEA 3TDVA 4XG3A 5FP5A 3GU7A 3ZSIA 2ZV9A 4O86A 4GSBA 2JIIA 2YCFA 4HYUA 3COIA 5DHJA 4PV0A 3FXWA 3WZDA 1Y8GA 2GTMA 4QMVA 3PIZA 4G6LA 5HE3A 3QTRA 4WIHA 4BDEA 4F9WA 1WCCA 2X4ZA 4BDIA 3AT4A 3PSCA 2XIYA 1LUFA 5A4LA 2VX3A 3GB2A 3RK9A 4WSQA 4DGMA 1Q4LA 1VYWA 1Y8YA 2WQBA 2X9FA 4USEA 5LJJA 1OKVA 3EKKA 4BCMA 3RJCA 3BX5A 4BHZA 5DPVA 1H0VA 2IZTA 4EKKA 4TYGA 4D9UA 5HIEA 2XIXA 4Z7GA 3QF9A 5AR2A 3ZLXA 4NK9A 4G16A 3IKAA 3SLSA 4D28A 5EM5A 4G9CA 1YDTE 2PVKA 3LM5A 3HL7A 4ZTNA 4RVMA 3QTIA 4RT7A 3T9IA 2VWYA 2OFVA 5GJFA 3F2AA 3OEZA 3DLZA 3VS2A 2WMSA 4BDGA 4EH2A 4XV3A 3F5PA 4G3CA 3R7OA 4KS8A 3VO3A 4NCTC 4BICA 5E8YA 3EB0A 2YDIA 3F88A 2YM3A 5L6WL 4I20A 5A4QA 2JBOA 3QRKA 4IQ6A 2B9FA 4IAAA 2GU8A 4FX3A 3JPVA 4HZSA 3HP5A 4M12A 3ZEPA 3I7BA 4BTKA 5DRBA 4AZVA 4ID7A 5IEVA 1ERKA 4I3ZA 4PPCA 2PVLA 5DN3A 3V8TA 5JQ8A 2WO6A 5KUPA 4H1MA 4U81A 4U45A 5KMMA 5L4QA 3NNVA 1OBDA 3A99A 1I44A 3QHWA 2Z60A 3NYOA 1H1RA 2XKEA 4XH6A 3WE4A 4YTFA 2CNUA 3NYVA 2CN8A 5EM8A 2BZIB 1YI4A 1NVRA 1KE5A 4G3DA 2WPAA 4FVQA 3Q52A 4NM7A 4H58A 5E8ZA 1IRKA 2YM4A 3GCQA 4L68A 5E8XA 2OF4A 2C30A 4U44A 4RC2A 2GTNA 2XNPA 1G8SA 3E8CA 2VV9A 3KK8A 3D83A 3LFAA 3DZOA 2YCQA 3JY9A 3UBDA 3QZIA 4F1TA 4LMNA 1I09A 3ITZA 4HCVA 3QX4A 4NUSA 5EI6A 5HNGA 3W2SA 3ZM4A 2UW8A 1U59A 1MQBA 2WNTA 3G6HA 3R2YA 4AU8A 2XK9A 5CAPA 2R2PA 2EXMA 3QUDA 5K0XA 4HVHA 4GK3A 2KTYA 3LCTA 4JG8A 3PJ1A 4G3FA 2HAKA 3JY0A 2VU3A 4MXOA 3GBZA 4I6FA 5AUVA 2QODA 4GU6A 1PKDA 2H6DA 2YJRA 4FUYA 4M69B 1R78A 5LCKA 3W8QA 4AT5A 4U7ZA 2JITA 2Z02A 3JYAA 4G5JA 4EH6A 3W16A 3LFCA 4O22A 4QP8A 5EYDA 5L8LA 3OUNB 4NM0A 4IFGA 5TE0A 3M1SA 3C50A 3E87A 4CRSA 3V6SA 2XUUA 4ZS0A 3WYYA 5HU9A 2BIYA 5BMMA 1SMHA 4O0TA 3IG7A 4L43A 4PDYA 2UW4A 4IDTA 4R1VA 3PJ2A 4JS8A 3U9NA 2UW0A 3ZLYA 3NUUA 5DRDA 5IZFA 2DYLA 3PY3A 3SXRA 4FTCA 3GI3A 4WRSA 3RAKA 3AQVA 4EH5A 1U54A 2EXEA 4G5PA 4DBXA 1OL2A 3QCYA 4O0WA 5DEYA 2R3NA 3SW7A 4CGAA 5DMZA 2XK3A 3QCXA 4NJ3A 4ONAA 3FMLA 3UMWA 2UVZA 2YIQA 4JJRA 3LLTA 3W2QA 3R8PA 3FE3A 4DCEA 2A27A 4UMQA 3MTFA 3BGZA 1V1KA 3KF7A 3OWJA 3R01A 1ZAOA 2PE0A 3E8DA 3N51A 4BWXA 5A6NA 2XNEA 4TWPA 3HRBA 2WTVA 1OUKA 3FC1X 4G2FA 3SOAA 3ZZEA 5JZJA 1VR2A 2XYNA 3BYVA 4AZWA 4I4FA 4JBOA 3U54A 4O0RA 2OWBA 3QYWA 3C0IA 3QD4A 4QMSA 4M13A 5AUWA 4YGAA 4AZTA 2RFDA 2V7OA 2QOIA 3DJ6A 3DZQA 2VTIA 4J53A 4ZY4A 3OOMA 4IDVA 4NWMA 4WD5A 5HBHA 1JNKA 1Y6BA 2X2KA 1OECA 2X7FA 3ROYA 3OCSA 4WKQA 5HVKA 3KN6A 2VX1A 5AA8A 3EYGA 3LJ1A 2GQRA 3RAIA 4FZFB 1H01A 5H8EA 5EFQA 5EW3A 1K3AA 2F9GA 2O64A 4FODA 3RCDA 2YERA 4FKPA 3TZ7A 2WU7A 3TG1A 5HLWA 3FJQE 4CT1A 1DI9A 3BU6A 4UN0C 1G5SA 3EN7A 3BZ3A 2PVRA 3FLSA 4X0MA 4L3LA 4M14A 4B6LA 2BFXA 2J0LA 5CNOA 5M4CA 5FWKK 2DUVA 3RM6A 4JRVA 4L3JA 4D2PA 2XK4A 4WNOA 2C6EA 4F0FA 5HOAA 3U6HA 2FSLX 1H0WA 3SXSA 4BCIA 1H07A 3BGQA 4E8AA 2GNIA 2GHMA 3EIDA 4FSRA 5CT0A 5CSXA 4C37A 5C8NA 5L8KA 2BTSA 3TUBA 3BRBA 4D58A 4JQ8A 3KXXA 5AUXA 2Z7QA 4XG7A 1EH4A 4FOCA 5KZIA 3V5JA 5DIAA 3ZRKA 3H9FA 4BKZA 3FPQA 4KIKA 4K77A 4BCJA 2OSCA 2XJ2A 5K3YA 4II5A 4O2PA 4KIPA 2JFMA 4P4CA 1PXLA 5ACBC 5AIKA 3EQDA 4OW8A 4U8ZA 2B7AA 4O1OA 1A06A 1Z9XA 1UU7A 2PE1A 3BU5A 3QRTA 4OGRA 4N4SA 2JDRA 2OJJA 2WEVA 3VUHA 4FT7A 4M68A 2P55A 5EQPA 3W18A 2XB7A 3UQGA 3FY2A 1OIYA 2WTWA 4MH7A 4FEWA 4EUTA 1OM1A 5AAFA 3QAME 3C9WA 5FXSA 2P33A 4GT3A 3CS9A 3R73A 3PWDA 4FSNA 1BL7A 5HO7A 3FHRA 1A48A 2XM9A 2XIRA 4FK6A 2WQNA 3TV6A 4JR7A 4DCAA 4AE9A 5FQDC 4DN5A 2OK1A 4QP7A 1YOLA 4CMUA 4DG3E 3ORLA 2HOGA 3TJDA 2QG7A 5HIBA 4X2KA 2XNBA 3ANQA 2W9ZB 4HVGA 4CFNA 4UWCA 2ZM1A 4QPSA 2C6IA 1JWHA 1MQ4A 1REJA 1ZLTA 2BMCA 4GIHA 4G17A 3MB6A 1GZOA 5CAVA 4MYGA 2B1PA 3OY3A 5AR7A 3QRIA 3UO6A 2PZIA 2PVYA 4CSVA 3QHRA 1FGIA 3VNTA 5H3QA 4F9BA 3PPJA 1OL6A 4PX6A 2QOCA 3WZUA 4FTAA 3BHYA 4FKTA 5LVMA 3I5ZA 5CAOA 1TQMA 4W9XA 2VRXA 4J1RA 4F64A 5L2IA 5KMKA 5AR5A 5CVGA 3HMNA 4P90A 2WOUA 2UZUE 4RIWA 5FTOA 3F2NA 3I81A 2JD5A 2XIKA 2H96A 1ZY4A 1UU9A 2JDSA 3PVUA 4FKVA 5KCVA 4JQ7A 4IWQA 4Y5QA 2C3KA 4I21A 5D7VA 3A2CA 1W98A 3H10A 4S31A 3RGFA 3SRVA 4F4PA 1LEWA 3ZONA 4G34A 4CFUA 2GCDA 2J2IB 5A4EA 2YLFA 3K54A 4I6QA 4AG8A 4ZP5A 5ANJA 4QMQA 1XKKA 2ZV2A 3LLAA 3FLWA 2QOBA 4QTBA 3WBLA 3UQCA 3UPXA 5FGKA 3V01A 1ZWSA 4EH8A 2EB3A 4FZDB 2J90A 4WSYA 4PF4A 2X4FA 3W1FA 3SQQA 3L1SA 5LMBA 4ZY5A 3EMGA 4JI9A 1ZYJA 4EH7A 5CZIA 5IQFA 1ZXEA 1JVPP 4AFEA 4M15A 4LM5A 5G6VA 3UVQA 4KKHA 3E8EA 3R1QA 3LQ3A 4BTJA 3L9PA 3TTJA 3HLLA 2QO2A 1H1WA 2Y6MA 4RFMA 5LWMA 2PUPA 1YXXA 4DA5A 5A4CA 3P78A 1JLUE 1GIIA 2WMBA 3A7IA 2A2AA 3HA8A 3KRXA 4XOZA 5CEIA 3S2PA 3SV0A 4B0GA 2HCKA 2XNMA 1VJYA 5HORA 2FSTX 4MAOA 1OMWA 5EW9A 3UODA 4A4XA 4EBVA 2UW3A 4X7QA 4HW7A 4R6VA 4FKWA 4F09A 4YSJA 4KINA 4FTOA 1QPEA 1HCLA 1SM2A 3UJGA 3M11A 5E4HA 5HVJA 3R6XA 2W96B 3O8UA 4WHZA 3TNPC 2WGJA 3BEAA 4C3FA 1P2AA 3TCPA 4HVDA 4QMWA 1OL1A 3QQKA 4J8NA 4X6RA 1O6KA 4QMNA 1J7UA 4X6QC 4AGWA 4QP3A 3JVRA 4F1OA 4FSUA 2GNFA 2R3IA 4AUAA 3OT3A 3PE2A 5DT0A 5B7VA 4O81A 3PUPA 4ZLYA 3OCTA 4KRCA 4UEUA 3BEGA 3CCNA 3MPAA 5F4NA 5KHWA 3R9RA 2BDWA 4NM3A 3EWHA 2Q83A 4QYEA 1J3HA 3OUKA 3C4FA 2C1AA 5CF6A 4BRXA 4ZZNA 3HKOA 4IM3A 3DAJA 3ULIA 4D2WA 4DEHA 5EI2A 4BI1A 2A0CX 3VQHA 2W9FB 2CGUA 3BU3A 3MSSA 4D55A 3OXTA 2YACA 3QKLA 2UZBA 2OKRA 2YHVA 1YWNA 2GQGA 2XNOA 2LGCA 1PXJA 5DYJA 3GFEA 3VS3A 5HQ0A 3VVHA 3O7LD 5J5SA 4FV9A 2WOTA 4ITHA 5C8KA 4PDPA 1WBVA 2PUNA 1YI6A 2CDZA 4MNEA 2W06A 1JAMA 4U97A 5EM6A 4BCPA 2ZOQA 3NGAA 1ZARA 4NL0A 2ONLA 3TZ9A 3FI4A 2C1BA 4CFVA 2W5BA 5J9ZA 2XJ1A 2EUFB 4GT5A 4EOMA 3GCVA 3NPCA 4WA9A 4A4OA 2PVMA 3A7FA 1WZYA 2HW6A 5CU4A 4L52A 5DOSA 4YC8A 5IA0A 4FKRA 4DFUA 2VTOA 5LVPA 3CJFA 1B38A 5H8GA 4BCQA 4C3PA 5KBQA 2XZSA 4RVTA 4BI0A 1QPCA 3UPZA 1XHAA 2W4OA 4IX6A 4KWPA 4C02A 3OT8A 2QD9A 3I6WA 4XJ0A 2OH0E 4KABA 4F0IA 2PL0A 3CXWA 3OF0A 5FRIA 3D5WA 4DE4A 3MIAA 3ZU7A 1H00A 3CD8A 3TNQB 3ZRLA 1PXKA 1G8AA 2H34A 4UMPA 3NDMA 5KZ0A 2JGZA 5KKRB 4LRJA 3UO4A 5C4KA 3NMUF 4AX8A 3R63A 2QCSA 1WBWA 2QOLA 4EZ3A 3C4XA 5CZHA 5L2TA 5HLPA 4J99A 3FEGA 4IFCA 2FVDA 4EK5A 2PYWA 5TR6A 3OZ6A 4UY9A 4ZTQA 5F95A 5IA1A 5KMIA 1F3MC 4DFNA 4E4NA 2DQ7X 4E5WA 3OC1A 2W0JA 3MJ1A 4X3JA 2QOFA 5HD4A 4V05A 3S3IA 1QPJA 3CPCA 4BDHA 2LAVA 4F63A 2ZAZA 2VWBA 3F69A 3REPA 4QMLA 3B8QA 5BNJA 2NRYA 3GC9A 3LFNA 4QP4A 3A8XA 4FTIA 3ZFYA 3Q9YA 1K2PA 1UWJA 2OF2A 3FQSA 4YLJA 2XM8A 1YDSE 4FI1A 3ETAA 1PXOA 3K3JA 5HZNA 1F5QA 4ACCA 3ZC6A 4D9TA 2JKOA 2QLUA 5ETIA 5AM7A 3ULZA 4W4XA 3PIXA 5LVLA 3WYXA 1OKZA 4DLIA 2BCJA 4AN2A 4M0YA 4O7ZA 1H1SA 4UV0A 3EFJA 4DAWA 3V5LA 3MFTA 3NLBA 3Q5ZA 4QMZA 3OHTA 1IEPA 4RFZA 3TN8A 3KVWA 4YZ9A 2E9NA 5H8BA 5GJDA 5DR2A 4D4VA 4O27B 4YZCA 5EK7A 2C6KA 3L9NA 5CVHA 4QMPA 5C01A 3VS7A 5I5ZA 4X2JA 4O91A 4FEUA 5HE2A 3KMUA 3GQIA 3FI2A 1CSNA 1J1CA 3GU5A 4HCTA 2QR7A 3WZJA 2HXQA 4RX8A 4X3FA 2FYSA 2G2HA 1GY3A 3DK7A 4ZSGA 3TIYA 5JQ5A 1KE9A 2XNGA 4YC3A 2ITWA 2I0VA 3KULB 3KXZA 4QTCA 4AOTA 3K5VA 3V04A 4F9CA 3JR1A 3GUBA 4MHAA 3ROCA 5E92A 3PLAE 4GEOA 5BX0A 4O96A 4EHZA 3TZ8A 2YJSA 4NFMA 4QP6A 3MVHA 4XG2A 4BKJA 3KA0A 1KE6A 4RG0A 2RF9A 3UC3A 2F57A 2R3PA 3DB6A 2QKWB 2QI8A 3MH3A 4PDSA 3UIBA 3ZEWA 4ALUA 2QOHA 4QQ5A 3R7YA 3QUPA 4CRLA 3D7TB 4IH8A 3FXZA 3FI3A 3R8MA 2XNNA 2ZB0A 2WQEA 2BR1A 4QYYA 3U4WA 4FEVA 3ZFXA 4FZAB 2VNYA 3BELA 3RK5A 4CYJA 3DOGA 2OXXA 5E90A 2XEYA 4M66A 4AXAA 4UMUA 4TT7A 1KOAA 1URCA 4ITIA 4L44A 1YRPA 4OBQA 4XG4A 2QQ7A 2YM7A 2W99B 4GL9A 3W2RA 3NX8A 2QOOA 2ITNA 3C5IA 2ITPA 5LWNA 4LGDA 5I9ZA 2ITYA 1R0PA 1GIJA 3DQXA 4RA5A 3BLHA 4PY1A 4RWIA 3JXWA 2XH5A 4IJ9A 4RGJA 1KE8A 2RIOA 4BHNA 3ENMA 4Y85A 2OIBA 1H24A 5A6OA 5FTGA 3SOCA 3VJNA 5IUIA 3NCGA 4IB5A 5A3XA 1ATPE 4EI4A 3FZ1A 3ZTXA 4C2WA 4KIQA 3RPVA 3ZRMA 1VYZA 1R1WA 3POZA 1S9JA 2XVDA 2P2IA 4EKLA 3GC7A 3NNXA 2F2CB 3TIZA 5DWRA 3AMAA 2BTRA 3DU8A 3PVWA 4LGHA 3GU4A 4XNEA 2C47A 5T3QA 5M4UA 4GJ2A 4ZOGA 3EFKA 3E7OA 1QCFA 3EQIA 3Q96A 1B6CB 5DH3A 5EQYA 1NY3A 3VUTA 4AF3A 3P7AA 1WBPA 2EWAA 3O96A 5KMJA 2R3RA 4JDIA 3RAWA 4NIFB 5TKDA 2X8DA 5BUIA 4WNPA 3PVBA 3R7GA 1OL5A 2O65A 2CGVA 4N70A 5HVYA 3QTZA 1LEZA 3OG7A 4X21A 2C6DA 2Y0AA 3VJOA 3NVMB 4AW2A 5HO6A 2GS6A 2E9OA 5AV2A 2WZJA 4LUEA 3QC4A 4GFOA 4XRLA 3FMHA 4EH4A 4WG3A 1PMEA 4O7WA 3PY1A 4HGLA 5I9UA 3N4UA 4ZSEA 4E4XA 5E8UA 3EQPA 2X7GA 1RE8A 3QCQA 2YDKA 2W1HA 2BHEA 3GFWA 2WB8A 2XK7A 3R83A 4DEBA 2WAJA 2R3KA 3FXXA 4M8TA 1U46A 4XG9A 1NT2A 3DTCA 1Q8UA 4RQKA 3R1SA 3FLQA 4O7LA 5DBXA 4ACDA 3MBLA 3PP0A 2F7EE 4CQEA 4FF8A 4ANSA 2CNQA 3ACJA 3NSZA 3P5KA 4GUEA 3DBCA 5AMNA 2IW8A 3VUKA 3VW8A 5AEPA 3F5GA 3P9JA 4ZTSA 5BQ0A 1S9IA 4IMYA 4DC2A 5HD7A 3OW4A 5AP4A 1Q8ZA 4AOIA 5A14A 2VTMA 1O6YA 3OY1A 4F70A 4IVDA 4AWIA 5JH6A 1GIHA 3FZRA 1DAWA 4LOOA 4EZ7A 4A4LA 4RFYA 2HY81 3NUNA 1KE7A 3OD6X 5CEMA 3ENHA 4CG8A 3TNHA 1XH5A 2XA4A 1PJKA 4YTIA 5I9YA 2HZIA 5CEQA 4XCUA 4RJ6A 1XH7A 2OZAB 5EDPA 3ZM9A 3ACKA 4YO4A 3NW7A 3P0MA 4YPDA 5CYIA 4EOSA 5I3RA 4LYNA 4OTHA 2NP8A 4BIDA 3HEGA 4S33A 1BI8A 4FV2A 2O3PA 1IG1A 3MW1A 2GSFA 4GYGA 4PWNA 1QPDA 5M56A 1L8TA 3DKCA 1OZ1A 4RWLA 4I94A 2F7ZE 4GKHA 5EW8A 3V5WA 4O21A 3U4UA 2Z7RA 3F6XA 3LXPA 3Q04A 2ETKA 3D15A 5ANGA 1OPLA 2C69A 3Q3BA 4HNFA 3FV8A 4UBAA 5HKMA 2W1ZA 4FV3A 5HO8A 4BTMA 1IAJA 3LQ8A 1CKJA 3R0TA 3KN5A 2EU9A 1V0OA 4PL3A 4FE2A 3TDWA 2QVSE 3EFWA 3Q2JA 3PTGA 3RBWA 3RPRA 2VTAA 4YZBA 3ZBXA 2V7AA 3Q9WA 4GFGA 3DTWA 4ENYA 2XBJA 3AC3A 2J9MA 3LVPA 3AT2A 3RM7A 3LQ5A 4Z16A 5JN2A 4R3RA 4R1YA 4G6NA 4A07A 4AW1A 3FSFA 4G31A 3W32A 3GNIB 4YPSA 3OTUA 3IONA 5HTIA 3RALA 4I22A 4IAKA 3UZPA 4DLJA 3VULA 5HCYA 2F7XE 3HV6A 3VIDA 5AJQA 3UOKA 1IASA 5KE0A 2WMAA 3WIKA 4ANMA 3U51A 4A7CA 4ZLOA 3G9LX 2WTIA 5DE2A 2WFYA 4QTAA 2CN5A 1GOLA 4O7RA 2WD1A 5CXZA 4YBKA 3ORXA 5AIRA 1YXVA 3RCJA 2GNJA 4Z3VA 5KMNA 4BL1A 3IW6A 4RX9A 3CTQA 5L6OA 1M7NA 2IN6A 3OCGA 5M06A 5CS6A 2VWWA 4TZRA 3ZOSA 1XH4A 4DG0E 4MBLA 1UU3A 4M67A 3VBTA 3H0ZA 3F7WA 3TV7A 1T45A 4O1PA 3IECA 3LFDA 3VBVA 2ITUA 3DAEA 3O2MA 5DR6A 3DXQA 4I5MA 4ZZOA 3QU0A 5JFWA 3VS5A 4TWOA 4H1JA 5CF5A 3ORTA 2QOKA 3CBLA 3PA3A 4H3QA 4L42A 4CYIA 1OIRA 1JOWB 5HEZA 1MP8A 3NRMA 5H2UA 2PSQA 3UTOA 4BCNA 3TUCA 2XKDA 4ZMFA 4LG4A 2R3HA 3QRUA 2ETRA 4BGGA 2I7QA 4F99A 4OLIA 3CPBA 3RHKA 3RZBA 1SNUA 4AS0A 2ZDUA 3DBQA 3LFEA 3MV5A 2PVFA 4ASXA 3F3UA 2V55A 3QZHA 4A9TA 3JS2A 5M44A 4GT4A 2WXVA 3V3VA 1VZOA 4F7LA 3KRWA 3TKHA 3V51A 2OJGA 1BL6A 5A46A 1M17A 5AV4A 2J0MB 1Q61A 4NZWB 2C6MA 2CJMA 3E63A 3S4QA 5AADA 4V01A 2QNJA 4HVIA 4RIYA 4JXFA 2WQOA 3CR0A 4TY1A 2QU6A 3SX9A 4BDAA 3R71A 4CV8A 3PZEA 4DEAA 5BYLA 3LOKA 4NM5A 4B4LA 3KRRA 1RW8A 2ZDTA 3UIXA 3SGCA 3F66A 5M55A 4EYJA 3VAPA 4CNHA 4UB7A 5J1WA 1GNGA 3WILA 3TWJA 3R2BA 3EQBA 1O9UA 3FL4A 2HELA 4O0YA 1QL6A 4TYIA 3DV3A 1KUTA 4OTQA 1R39A 5E8VA 3GT8A 3K5UA 1P4OA 2OBJA 1WBNA 2C5OA 3D94A 4BVUA 1FINA 5K5XA 5IEYA 4I92A 2PMIA 2UVXA 2J7TA 2Z7LA 3VN9A 2C5XA 4DHFA 3EOCA 3R1NA 1WAKA 4GH2A 1MRVA 3CC6A 3UP7A 4PQNA 5CY3A 5I9WA 3C13A 4JRNA 5IH6A 3ID6C 4FEQA 2IZUA 5JMSA 2BILB 3RTPA 2PMOX 3QA0A 4RJ5A 3UVRA 4GS6A 5KHXA 3AGMA 3AC4A 2XK8A 3WARA 4YJUA 4LQMA 4ZS4A 4O7YA 2FSOX 1O6LA 4PMMA 4UZDA 5D1JA 3VHEA 5DGZA 5K0KA 1FBNA 1J7IA 1E1VA 4QMYA 4C2VA 4BC6A 4XLVA 1YXSA 4DFXE 3WF8A 2WTKB 2NNWB 3VBYA 5J9LA 2C3LA 3R7EA 4E6DA 4KRDA 2CHLA 1H27A 1Q8YA 3PJ8A 3HECA 3V5PA 4F65A 4XV9A 3QZFA 4C58A 2OXDA 1PYEA 3DAKA 5IQEA 3E64A 3MIYA 5CNNA 5J95A 3BYUA 3LAUA 1JKKA 3LCDA 2WKMA 2G9XA 2VTTA 5IMEA 3A4PA 5K4JA 1PXPA 2B52A 3EZRA 3KXMA 4JDJA 4MXCA 3FMJA 4O2ZA 5LVNA 4FT5A 4IC8A 3TEIA 4NTSA 4FKIA 2YM5A 2G2FA 1Q8TA 4AZSA 3HV4A 3IOPA 2CKQA 5D9HA 3PFQA 3F61A 5BPYA 2EXCX 5JT2A 4JDHA 4ANQA 4RIXB 3AMBA 3QQJA 4YU2A 4L7FA 4MTAA 3QTXA 2XBAA 4GVJA 5HESA 3GVUA 4I1ZA 5FD2A 3RAHA 3RK7A 5KBRA 4WNMA 1SVHA 4B99A 4QNYA 3GOPA 3IW4A 3P23A 5AM6A 2WMXA 2WU6A 3FKOA 4IADA 4CEGA 3P7CA 4HGTA 5LQFA 4CQGA 3DBEA 3NS9A 4YJNA 4BGHA 3DS6A 3LZBA 4IANA 1Q24A 1KOBA 3C7QA 3IQ7A 1UNHA 4IAIA 1GZ8A 2PVHA 3MDYA 5GHVA 2FA2A 3RVGA 4TRLA 3AC1A 4I4EA 3MTLA 3HZTA 3ZO3A 3ZUVA 5LVOA 3R8LA 1NVSA 5M57A 3VWAA 4WBBB 2WTKC 4ANNA 3Q4CA 4RQVA 3MY1A 4JAIA 4L9IA 5EOBA 2VTNA 2B4SB 2QU5A 2VD5A 4ANOA 5DT3A 2FH9A 2XIZA 5FEDA 5L2SA 3E92A 2PUIA 4BWKA 3FMDA 1KV1A 4OT5A 4M97A 3QGYA 1V0BA 1UU8A 3DA6A 4PTEA 5CU6A 4EK6A 3TTIA 2C0IA 5K5NA 5K4IA 1JPAA 5K9IA 4QMUA 2Y8OA 3ZLWA 4FSQA 4DTKA 3UQFA 4FNXA 3KFAA 3LCSA 4L45A 5D11A 1CDKA 3GGFA 4D2VA 3AXWA 3KMMA 3PRIA 3MH2A 2RFEA 3R21A 4I23A 3FMNA 2EB2A 2WIHA 2X8EA 4BIBA 3R1YA 4KD1A 5AV3A 4JIKA 2GMXA 3NZ0A 2PK9A 2JKKA 4DG2E 2E9UA 3PP1A 3Q4UA 2C3IB 4I0TA 3PRFA 2OXYA 1WBTA 3G51A 5LOHA 3FQEA 4P5QA 4KKEA 5IQGA 3MFSA 5CI7A 4FNWA 4RX7A 4WBOA 5TOZA 4BCGA 5IDNA 3GP0A 2OJFE 2C5NA 1XBBA 1CKPA 2PUUA 3OS3A 3C51A 4PL4A 3R8ZA 5LMKA 5IF1A 4FT9A 2VZ6A 4PNKA 3KB7A 4XUFA 2YAAA 3SDJA 3W33A 3MFRA 4K0YA 3ZO1A 2IWIA 1Y6AA 4DEIA 4F7SA 1JKSA 2GPHA 4FL1A 3HNGA 3QQGA 4OTGA 3ORKA 4ZLZA 1BMKA 2OICA 4ASEA 4U9AA 3B2TA 4IX4A 5CVFA 1SYKA 5JZNA 4K9YA 3SG8A 5FBNC 2R7BA 4DH5A 4NKAA 1FVRA 2Y4IB 3U87A 1UKHA 5AP2A 5TF9A 3O51A 5HX8A 3QCSA 3VQUA 4USDA 5CALA 4CVAA 4TTHB 5HG5A 1BX6A 4IZYA 2IZSA 2VO7A 3AC5A 2OO8X 2YAKA 2VTLA 4ZTLA 1TKIA 5JSMA 1CM8A 5C4LA 4NT4A 4OAUC 5LCJA 3UG1A 3NYNA 1FGKA 2C6TA 1U5RA 3CGOA 1H08A 2X7OA 3FMMA 4YJPA 4ANLA 4PNIA 5L6PA 3R02A 3R04A 3O50A 4DEDA 5L2WA 5JRSA 4C33A 5ETFA 3PJ3A 3LFSA 2J0IA 5BVKA 4BY9E 4HPTE 1R3CA 4GCJA 5L3AA 5HE1A 3ATTA 3QWKA 4H39A 5HLNA 3CD3A 3KF4A 4QD6A 2VGOA 2IO6A 3KRLA 3OP5A 3UGCA 2OH4A 2WMRA 4K18A 4BDBA 3EYHA 2CGWA 2GDOA 3EKNA 4ZMEA 4L3PA 1BUHA 4C8BA 2ESMA 4CTBA 1WVWA 2C5YA 3OVVA 4Q2AA 4IM0A 3QQFA 4R5SA 2ACXA 3C4ZA 2VWUA 2XRWA 1PYXA 4X2NA 3AG9A 2CCIA 1U54B 4TYJA 4E5BA 5IUGA 2Y4IC 2CKEA 4BZDA 3D0EA 4TWNA 4K11A 3Q9ZA 4L46A 4FIIA 1W83A 3U9CA 4CKJA 2VTHA 3BIZA 3D4QA 4ZJVA 4BF2A 3TNIA 5GIOE 2C6OA 2VGPA 5IQIA 5HG9A 3RMFA 2BZJA 3RP9A 3KU2A 4BCKA 3Q5IA 3DDQA 5FDPA 2ITXA 5DNRA 4GKIA 4C4GA 2CNVA 2XYUA 4FG8A 4JQEA 4RC4A 3DQWA 3O17A 4I24A 2B54A 4CMOA 4JG6A 2W1GA 5G1XA 2C68A 5HTCA 2X39A 4O0VA 4QP1A 2VTQA 2FUMA 3BWFA 4R7BA 3O8TA 5I0BA 1CMKE 2FSMX 4UWBA 4AT3A 5JGAA 3GENA 4TYHB 3UIMA 4EHEA 3P1AA 3BBWA 3K3IA 1E9HA 4LRMA 3VBWA 5BVWA 4F9AA 4PL5A 1PXNA 3NW5A 3QZGA 3KXGA 1XR1A 4BR3A 2X9EA 4YTHA 4FR4A 4E1ZA 5L2QA 1WVYA 2F49A 5IQCA 4E6AA 2ITQA 1XBCA 1IA9A 1OITA 2OJ9A 2BAJA 2RGPA 5EM7A 4EBWA 3ORIA 2P4IA 5JKGA 1GZKA 3LCOA 1U5QA 3QQLA 4LUDA 3MH1A 5LARA 4FV1A 4Y83A 3QKMA 2C6LA 2O5KA 2V62A 3F3TA 1YDRE 3GOKA 4TWCA 5HG7A 3BHTA 3ZXTA 4F9YA 3N4TA 4MEDA 2JBPA 4KAOA 4AP7A 3D7ZA 4J98A 4R7IA 3DKOA 3NNWA 3TZMA 3EH9A 2ZJWA 4MVFA 4C4FA 3R9OA 5BUJA 1ZYLA 2PPQA 1PXMA 4IB1A 3PE1A 1ZYDA 4FTRA 4ZXTA 3BWJA 1F0QA 1Q97A 3CQEA 3F5XA 4AOJA 2GHGA 3FLNC 5M4FA 1P4FA 5EOLA 3FHIA 2R9SA 3A8WA 2WTDA 3AMYA 3BHVA 3IPHA 3KY2A 3Q4ZA 2J6MA 4NCTA 4KIKB 1UA2A 4RWJA 2R5TA 4O7SA 3WOWA 5E8SA 3S95A 1XH8A 3P79A 4BYJA 4QPMA 3HAMA 4J97A 5CASA 5DEWA 2IPXA 1TVOA 4XEYA 5AUUA 2W1DA 4D0WA 3I1AA 2XMYA 3MPMA 4HNIA 3BYSA 4R7HA 1W7HA 4IJPA 3BLQA 4U40A 2B9HA 2R3MA 1JSTA 3BCEA 3ERKA 3TKUA 5BUEA 4B9DA 3PVGA 1H26A 3QLGA 5E1SA 2WHBA 3OW3A 4Y8DA 3Q6UA 4O0UA 1J7LA 1OL7A 5AP3A 3FZPA 4ZEGA 3U6IA 3OFMA 1YI3A 4IC7A 4AE6A 4FVPA 2J5FA 2QKRA 1E1XA 2YLEA 4Z7HA 4UXQA 2P3GX 3RNYA 2XP2A 3R8UA 4EC8A 2OJIA 4Y5HA 5CTPA 3TI1A 4M3QA 4GIIA 4CT2A 4WT6A 3WIGA 4IBMA 4FIFA 1M2RA 2WTCA 3PXFA 4ZIMA 3C5UA 2HXLA 2HWPA 3T3VA 3PSDA 4QMOA 3P08A 4IB0A 4J96A 3PXKA 3ORZA 2JC6A 3DBDA 3QRJA 4C38A 4YO6A 3B2WA 2PULA 3ELJA 4G6OA 4LFIA 4OTRA 4UYAA 2G01A 3I79A 2YEXA 2PWLA 3HMMA 1GJOA 4L00A 3HRCA 3BKBA 3EN4A 4FKOA 4U3ZA 3AD4A 4EUUA 3E5AA 4JBPA 4RJ8A 4HOKA 4KKGA 4APPA 3AOXA 1XH9A 3R28A 3T9TA 3SHEA 1FVTA 2UZTA 2BRHA 2VWVA 2Z8CA 3DLSA 4IACA 4EORA 5JFSA 4RJ3A 4ZTRA 5DVRA 2O0UA 2W17A 4X2FA 1Q99A 5HNIX 3CTJA 1PY5A 5DT4A 4MD8E 2GQSA 4V0GB 4F08A 2ITTA 3A7HA 4FK3A 5GJGA 5T68A 3I0QA 4MXAA 4BDJA 5HX6A 4W4VA 4U43A 1BI7A 4FTUA 3CEKA 4JBQA 4IX5A 4UXLA 1CTPE 2QR8A 4NYEA 4BBEA 4E3CA 2UW7A 4BTFA 2C0TA 3VBQA 3HMIA 2OU7A 4DFZE 4NU1A 1TQPA 4OTDA 4GK2A 4DYMA 4FYOA 4MKCA 5J79A 3PYYA 4K1BA 5E8TA 3D14A 4IAYA 5EYMA 5CWZA 3R9HA 5CU3A 2J0JA 4JVGA 3FPMA 5FBOA 3AC8A 4S30A 4H3BA 4LL5A 3T3UA 4YZNA 3L8XA 4CFXA 1M2PA 4D2SA 5JEBA 4E4LA 5CAQA 3CY2A 3S0OA 3ZDIA 2QC6A 4FTMA 4R3CA 4C36A 4DH7A 4JAJA 3IDCA 3Q6WA 3MS9A 2UZNA 3KRJA 2PMLX 3TNWA 4YMJA 3QX2A 4NTTA 1ZY5A 3O0GA 3KEXA 5FM3A 5KMLA 4BZOA 2ZV7A 5M53A 2JKMA 4MBIA 2ZYBA 4OUCA 2PZ5A 3VF8A 4FVRA 2Y9QA 3UNZA 4AGDA 4XP0A 5IDPA 3W2OA 4CZTA 2X0GA 4L8MA 4M69A 4XBRA 2VTSA 4GVAA 4ASDA 2WTJA 4XP3A 4AAAA 5JGDA 3FYJX 5AV0A 4O6EA 5FEQA 2BFYA 3POOA 3SKCA 2B53A 3L8VA 1KWPA 2R3OA 4XG8A 1W0XC 3G9NA 5C1QB 4JX7A 4CCUA 4PRJA 5D41A 1FMOE 3UVPA 4IZAA 4U79A 2RFNA 4MXZA 4TN6A 3RPOA 3NYXA 5IQDA 3ZLSA 4OTFA 3VC4A 2JKQA 3DKGA 4UYNA 2HWOA 4RJ4A 2QHMA 3ODYX 4LMUA 2IZRA 4BWPA 2JIVA 4MQ1A 4FKGA 4FNZA 3VBXA 4A9RA 3DDPA 4EWHA 4EC9A 4U0IA 1WBOA 3KMWA 2UZVA 4USFA 3O8PA 3TL8A 3QLFA 1OI9A 2YIWA 3LIJA 3I60A 3PPKA 4Q9SA 3RPYA 4EHGA 4FIEA 4F1MA 4N0SA 5IA3A 3LMIA 1YOMA 2FGIA 2HENA 4HZRA 4TW9A 2P2HA 2W1EA 1ZOEA 3BPRA 3OWPA 2BPMA 3VHKA 2H8HA 3QL8A 3QYZA 2XRUA 2YA9A 4FV5A 5BVEA 1RQQA 2HY0A 1DM2A 2CLXA 4MCVA 4EOIA 3GU8A 3I4BA 3QQHA 1W8CA 1HOWA 4WO5A 2OZOA 4PPAA 4YJRA 4QO9A 4TYEA 2J4ZA 4PDOA 5DLSA 3DFAA 5J7BA 4LL0A 1FPUA 3KCFA 4EEVA 2BKZA 3R30A 4QQTA 3KREA 4DEGA 4IE9A 3HV3A 4RBLA 1ZZ2A 4MNEB 2WEIA 4MBJA 1XQZA 2UVYA 4EH3A 2XKCA 4EHVA 4MQ2A 4DH8A 1IAHA 3VS0A 4D1SA 2C4GA 4IX3A 4KA3A 3C1XA 2ZB1A 4XV2A 3NCZA 3UDBA 3VUDA 3G15A 5EKNA 4EZ5A 4BKYA 3UOJA 4ACHA 1OB3A 3E8NA 5IUHA 4P2KA 3DXPA 2YCSA 3BV3A 2O63A 3AD5A 4A9SA 2ETMA 2RFSA 3KKVA 4IAZA 3V8WA 4K8AA 4NW6A 1IA8A 4GMYA 5ANDA 1Q3WA 5EDRA 2IW9A 3E7VA 4HVSA 5I9VA 1MRYA 3NIZA 4G1WA 3BI6A 4CV9A 1WBSA 4D2RA 4EOKA 3MI9A 4L67A 3MESA 1PF8A 1XO2B 2IG7A 5B0XA 4DEEA 4FTQA 4S32A 3CSVA 3BBTB 3HDNA 4J8MA 5BMSA 1H1PA 4FG7A 4MWHA 4YHTA 2VTRA 4QMTA 4I6HA 2OW3A 5ANOA 4FL2A 5JGBA 4CZUA 3AC2A 4HJOA 4AA0A 4JT3A 4MD7E 3S00A 5AFVA 2P0CA 1NXKA 2HK5A 4OTWA 4WUNA 4DTBA 5HCZA 2CSNA 3OBJA 2XF0A 4MF0A 4Z9LA 3KVXA 4RPVA 2QO7A 2O2UA 1JKTA 4PMSA 5CXHA 3FKLA 4OT6A 2ONLC 1ZOHA 1FMKA 1JSVA 3PZHA 4WG5A 4WG4A 4APCA 3OWLA 3DPKA 1Q5KA 4YJQA 4HCUA 4ZSLA 2R3QA 3V5TA 3FY0A 3W10A 4ZAUA 1RJBA 3FKNA 3HP2A 2Y7JA 4U80A 3TXOA 4GFMA 3TT0A 5JK3A 4NFNA 3IOKA 2BAQA 3Q60A 3NUAA 2ITZA 4MWIA 3UMXA 4MD9E 1IR3A 4YJTA 1W84A 3IDPA 5EDQA 5EQEA 4QPAA 2VWXA 2UW9A 4G9RA 2XEZA 4R5YA 1J1BA 1LPUA 5C9CA 4CLIA 4RX5A 1AGWA 4U42A 5KX8A 4LV5A 3MWUA 3PIYA 2G1TA 5LMAA 2ZMDA 2IJMA 2AC5A 2B9JA 3ZSGA 5CANA 2DS1A 3QTUA 3JUHA 4KBKA 4IWDA 4Z55A 4E6CA 3IGOA 2VNWA 3O23A 5FDXA 3UZTA 3NUSA 4I41A 1YHWA 2IVVA 2A19B 4FZ6A 4IEBA 2WQMA 3DK6A 4QRCA 2YITA 3O7LB 4J95A 2GNLA 3GCPA 2J51A 3LXNA 1STCE 5ANKA 4EL9A 4WNKA 4CLJA 4D1ZA 3I7CA 3IW7A 2JAVA 3WF7A 4EK4A 2PU8A 1YHSA 4OAVB 2PZRA 2I0EA
chains in the Genus database with same CATH superfamily
2QURA 4FGBA 3MY5A 1Y91A 5IH4A 1DAYA 4X3FB 2BHHA 5HE0A 3F5UA 3FC2A 3NAYA 4TPTA 1R0EA 5CENA 2XS0A 3CIKA 4FV4A 4ERWA 2BZKB 4FSMA 2R7IA 3R7IA 2VTJA 4DT9A 4JIAA 3DCVA 4F7JA 5B2KA 4BDCA 3LPBA 4XS2A 4ZSJA 1YOJA 5AWMA 4DT8A 1SNXA 2VUWA 1ST4A 3HV5A 4I0SA 5ICPA 2JAMA 4RA4A 5B2LA 4BBFA 1UVRA 4AXDA 2I6LA 3BYMA 4DINA 3P86A 4AT4A 2UUEA 4D5KA 4FKSA 4FT3A 4FV0A 3PY0A 4QP9A 5TT7A 3H3CA 4NH1A 4QMXA 3PUFC 4QYHA 3UNKA 3F3ZA 3KQ7A 1QMZA 3WF5A 3E88A 2X81A 3D5UA 4BGQA 4CTCA 4E4MA 4MNFA 4JOAA 3UOHA 4HPUE 3A62A 1H1QA 3QXPA 2DWBA 4YLKA 5C8MA 4DGLC 2QOQA 4CFMA 1KSWA 2BALA 2VWIA 2WMVA 3GC0A 3G2FA 3FBVA 4BI2A 2YN8A 2RG5A 3FL5A 3PXQA 5HBEA 3R7UA 4B8LA 4AGUA 4V04A 2F4JA 3E62A 4Q9ZA 4IVAA 1PXIA 1YQJA 2YCRA 3R8VA 3NR9A 4DITA 4EK3A 3PXZA 3QKKA 2X6DA 5DA3A 5E91A 5AX3A 3BE9A 2CPKE 5CX9A 3C4WA 4AQCA 5DFPA 3WF6A 3G0EA 3RKBA 3FLZA 3QQUA 1VLRA 3WE8A 4GRBA 3LE6A 4M0ZA 5FXRA 2CKPA 4X3FC 2J0KA 2JIUA 3M2WA 4TKSA 5E8WA 5F94A 3CLYA 3SW4A 4E73A 2R3JA 2WMQA 3M42A 1XJDA 2VO6A 3HDMA 3L9MA 3OROA 1WMKA 3MVJA 3UOLA 3WF9A 1ZMUA 5IG1A 5JFVA 3H9OA 1XH6A 3UYTA 4KIOA 4D4YA 3I0OA 2XKFA 2A4LA 3DJ7A 2IEWA 3EQGA 4RVLA 3UP2A 3TUDA 3LKMA 4DTAA 3FZOA 1SVEA 2OIDA 5HCXA 4P7EA 4WRGA 5I4NA 1Q8WA 5JFXA 5KNJA 5D12A 4YHJA 3W2CA 3PA4A 1H28A 5IA2A 4QYGA 3C4CA 3DBFA 3G0FA 3BQRA 4IM2A 2QONA 4C4HA 5HU3A 4KB8A 5DG5A 3ZZWA 2HIWA 3VRYA 3F9NA 3CKWA 3O71A 3N4VA 4FTJA 5HHWA 5BVDA 5J87A 3PG1A 4DFLA 3TV4A 4F6WA 3DT1A 4D0XA 4JR3A 4A9YA 4FGRA 5FUTA 3EQCA 2A1AB 2W05A 3FZSA 3KGAA 4A06A 2NPQA 3NUPA 4TYHA 1M2QA 2GS7A 3MH0A 4BIEA 4C34A 2UZLA 4EOJA 3TACA 4K2RA 4GV1A 3D9VA 1M7QA 2OLCA 3IS5A 4W8DA 3RI1A 4U41A 3HRFA 4DFBA 4MUQA 5AX9A 4O38A 1WFCA 2CMWA 2VTPA 2BRGA 2WMWA 1XWSA 4EOPA 1ZYCA 3IDBA 3QFVA 4YLLA 2UW5A 3HMOA 2YWVA 1MRUA 1LR4A 3FAAA 2VX0A 3QD2B 4AA4A 1DS5A 3VF9A 4N57A 3CJGA 5C03A 4NJDA 4YSMA 4AXCA 5IU2A 4PTGA 4LI5A 4B7TA 4YP8A 4BDFA 1SZMA 4I5CA 5AUZA 2B9IA 3RZFA 3UE4A 4BZNA 3QC9A 3R00A 1PRYA 1AD5A 5CLPA 3MY0A 4JBVA 5AP6A 2GFSA 4S2ZA 4IHPA 5F1ZA 2JDTA 3ZCLA 1APME 4H05A 3SG9A 5M09A 3P4KA 4HGSA 4JDKA 2UV2A 2F2UA 3WZKA 3H4JA 4IZ7A 3VRZA 3TM0A 3FZTA 2C5VA 5CSPA 1OBGA 4RRVA 3B8RA 1Q3DA 4MXXA 4NW5A 4OBOA 2HZNA 4LGGA 4FSZA 5HG8A 1K9AA 1BYGA 2UZOA 3BV2A 4FTKA 5CSWA 4K33A 1YXUA 3AT3A 1PHKA 1RDQE 2W1IA 4Q5HA 3PWYA 4DH1A 2R3FA 3PSBA 3K2LA 3CE3A 3EHAA 4J52A 1H8FA 2X8IA 3OEFX 4ASZA 3GEQA 3LXKA 5CT7A 4LRKA 3UZRA 5EI8A 5IQAA 3A7JA 3C0HA 3EJ1A 5AR8A 2BKKA 5AA9A 3LMHA 3Q9XA 3G6GA 4N6YA 1MUOA 3E93A 5ETCA 3OXIA 2XK6A 5CF4A 4PP9A 4U5JA 4MXYA 3JVSA 4TL0A 1G8JA 4ACMA 4QOXA 1Z5MA 4ZTHA 4F6SA 5M08A 1FVVA 3FMKA 5CF8A 4FKJA 4DHJA 4GW8A 4FSWA 4J7BA 5ETAA 3UG2A 2YZAA 3CQUA 1OKYA 4BFMA 4ZK5A 4FTTA 4XOYA 3I6UA 3QALE 3MYGA 5IKWA 3GCUA 4C4EA 4KSPA 1YW2A 4IAFA 2PMNX 2UZDA 1LP4A 3DXNA 3U55A 4KSQA 4FV6A 4XRJA 4L7SA 5EG3A 2BUJA 1UNLA 2JLDA 5CI6A 4RJ7A 3COHA 2IVSA 3SA0A 2XCHA 4CG9A 3L9LA 4I5PA 4YHFA 5D10A 5AV1A 4DBNA 1OKWA 1NVQA 3COMA 3I5NA 4ALVA 4CCBA 4CFFA 3ZDUA 1HCKA 4ZSAA 3A4OX 1JBPE 3FUPA 3H0YA 2X1NA 2GHLA 4IVBA 4XHKB 2YM8A 4UMRA 4XLIA 4P5ZA 2V22A 3VS4A 4AACA 1OGUA 1OPKA 5AUYA 3ATSA 3KXHA 5JRQA 2YABA 3DJ5A 5GZAA 3ZO4A 3QTWA 4IW0A 2NRUA 4RMZA 4O4EA 5CQUA 5A4TA 4N6ZA 3SXFA 2UZWE 5J9YA 3QWJA 4IWPA 4V0GA 3WI6A 3T8OA 4E26A 5KO1A 4E5AX 5IA5A 2REIA 4XG6A 3O5AA 4R78A 2V5QA 4JX3A 2X6EA 5FEEA 3OCBA 2AUHA 3UC4A 4YBJA 3ZFMA 1AQ1A 4UALA 5HICA 1YWVA 3COKA 3PJCA 1FOTA 1M52A 2G2IA 4C59A 4I0RA 3MJ2A 2BDJA 3KULA 3IW8A 4Y72A 2GS2A 3LFBA 4FBXA 4Y73A 3HV7A 1FQ1B 1JKLA 2PY3A 2W5HA 1URWA 2SRCA 3KK9A 3OOGA 5EYKA 5FP6A 5GNKA 4CD0A 3OMVA 2YFXA 3NVKI 2YM6A 4XX9A 4FMQA 4FV7A 4EONA 4F7NA 5H9BA 4YTCA 4YNOA 2RKUA 2E9PA 1PMNA 4OBPA 3F82A 4ZY6A 3ZSHA 2UZEA 5GZ9A 3QD3A 4X2GA 4BBMA 4NKSA 3HUBA 2BAKA 2WMUA 3FWQA 2CLQA 3QTSA 4RIYB 5AP0A 4ALWA 3F2RA 4D1XA 5CEKA 4ITJA 4YJOA 3IK3A 5I3OA 3D7TA 2Z7SA 4FUXA 3DGKA 1U4DA 2WMTA 4XYFA 1YWRA 5HTBA 4FIGA 4YUQA 4LV8A 4QTEA 1ZMWA 3FSKA 4B8MA 4E20A 4O84A 3LFQA 3LXLA 2PHKA 4QP2A 2E9VA 3MB7A 4IXPA 4FC0A 3W2PA 5J1VA 3DKFA 5J7HA 2BRBA 1ND4A 2OFUA 2W7XA 5F20A 2X2MA 1A9UA 5ANIA 2IVUA 1OPJA 3KL8A 4XMOA 3QA8A 3RWPA 3NAXA 3QXOA 4I93A 3SAYA 4BDDA 4EQCA 4F0GA 4EJ7A 1H25A 1NA7A 3EL8A 2VO3A 3ZS5A 5IMXA 4W4WA 3ALNA 4R3PA 4TNDA 3CY3A 4YNEA 1XBAA 2JDOA 5AP7A 4F6UA 5BVOA 3PPZA 1W82A 2JEDA 2ZV8A 3BQCA 5C27A 4HYHA 3F3VA 2YDJA 4U6RA 5FG8A 2HZ0A 5FXQA 5ACKA 2V0DA 2I0YA 3EZVA 3NNUA 5ANEA 3CP9A 2RL5A 4OTIA 4L53A 3VS6A 2XARA 4R77A 4C57A 3ALOA 3C0GA 4OR5A 3TKIA 3HX4A 3D2KA 2HYYA 2OGVA 5IA4A 3ZUUA 2C0OA 5LXMA 2YIXA 3R9NA 3DNDA 1ZRZA 2ERZE 2R3GA 3BGPA 3UYSA 2W4JA 4WOVA 1GZNA 2VO0A 4IIRA 4ZJIA 2CKOA 2UW6A 3PXYA 4NIFA 2RSVA 2O8YA 2HZ4A 4C3RA 4BYIA 4D4SA 4FSTA 3LW0A 4BCOA 4I6BA 2XJ0A 3FQHA 2R0UA 4H36A 4OTPA 3CQWA 3OBGA 4HYIA 3VW6A 4O6LA 5IPJA 4FTNA 2VN9A 3DK3A 2W4KA 2QLQA 1UKIA 2ZM3A 4RC3A 3GXLA 2B55A 4Q5EA 4AZEA 1X8BA 2W5AA 3Q2MA 4C0TA 4KBCA 1WVXA 3ZHPC 4PP7A 4FG9A 3RWQA 4BJJB 4FYNA 3R7VA 2ITOA 4C7TA 4FTLA 2QG5A 3BLRA 3NW6A 3PA5A 4W9WA 3GQLA 4YURA 4ANBA 3HAVA 4Y95A 3GC8A 3N9XA 5AP5A 2ITVA 4DFYA 2PZYA 1UV5A 3CGFA 2ZVAA 3EL7A 5CAUA 3W0QA 4LOPA 1YXTA 4TNBA 3ZC5A 4D2TA 2PVNA 2BRMA 2GFCA 2RG6A 2Y6OA 1BLXA 4O0SA 4YC6A 4AN9A 4E93A 1REKA 3HA6A 5IH5A 3BL9A 3MPTA 5CU0A 3F7ZA 3DB8A 4FKQA 3ZXZA 4FL3A 3EQHA 4QYFA 5FTQA 4ZZMA 5BVFA 4L6QA 2AC3A 4EWQA 2I0HA 5DI1A 4EK8A 4AGCA 4E6QA 3VUIA 2QO9A 1P14A 4TXCA 2YISA 2NO3A 3BHUA 3Q53A 4CKIA 1ZYSA 4XP2A 2PE2A 5I9XA 4EYMA 4C4JA 5HGIA 3RINA 3G5DA 4DF3A 2Q0BA 2X2LA 1BKXA 2IW6A 4PMTA 1UWHA 2OZAA 5AR3A 3AD6A 4PMPA 3MN3A 4ARKA 3VUMA 3HUCA 4AW0A 3ET7A 4RVKA 3EQFA 3THBA 3WZEA 4C35A 4KS7A 3EN6A 3DFCB 2BIKB 5AR4A 2C3JA 4EOLA 3QD0A 5GZ8A 4GG5A 4O0XA 2CCHA 3GU6A 3QBNA 2Z2WA 4UX9A 1PMVA 3BE2A 4D4RA 5A9UA 5F9EA 3NWWA 4JNWA 3NUYA 3Q32A 1TQIA 4AW5A 3VS1A 2ERKA 1ZMVA 5HIDA 3A7GA 3D5XA 2VWZA 4RIWB 4EOOA 3ORPA 5FM2A 3OTVA 5L8JA 4C4IA 4D5HA 4RZVA 1TFFA 4WUAA 2G15A 1J91A 3ZYAA 1KV2A 1GAGA 3NIEA 3P7BA 4KBAA 5TO8A 4FV8A 3V5QA 3HVCA 3SD0A 1NW1A 3SRVB 4IZ5A 3EQRA 3MGYA 2FO0A 4GU9A 2FB8A 5D7AA 3F3WA 4EOQA 2Q0NA 4W4YA 1YVJA 4FIHA 3MVLA 4K6ZA 4DH3A 1PMUA 2PTKA 3HYHA 5EYCA 3KC3A 5CEPA 3DY7A 5B2MA 4O7VA 4UMTA 4O82A 4C61A 2Y4PA 4AFJA 4EH9A 4ORKA 3CKXA 2PZPA 5EHOA 4FIJA 3FYKX 3II5A 4GYIA 3SC1A 2I40A 5EKOA 4G3GA 1PKGA 4KNBA 3RHXA 4DGGA 3UIUA 5EH0A 4EQMA 5KKRC 3BHHA 3S1HA 1XMMA 4C62A 2WIPA 1JSUA 4RZWA 3FI8A 2BROA 5J8IA 3FDNA 1M14A 2BRNA 5A54A 3U6JA 4L01A 3LJ2A 5EHLA 4QMMA 2H9VA 3ODZX 4QNAA 4RLLA 5BVNA 2YWPA 4YZMA 3R9DA 2JFLA 3AGLA 4BB4A 2BVAA 1Q41A 4DGNA 1G3NA 5AUTA 4R8QA 5LMKC 3FLYA 3L8SA 3UO5A 4QTDA 3PDTA 3MA6A 4FKLA 4J71A 3UNJA 1OUYA 1UNGA 2JDVA 4H3PA 4RLKA 5CSVA 5C26A 1OIQA 4I5HA 4AZFA 5E1EA 4IVCA 5KMOA 4CFWA 4XV1A 2OIQA 4E7WA 3W55A 3ORMA 2ZM4A 5HBJA 3LM0A 4JG7A 1YKRA 4DGOA 4ZJJA 3E3BX 4BCHA 4M84A 5HI2A 3ANRA 4MF1A 4ENXA 3LCKA 4AN3A 1JQHA 3H30A 4BN1A 1B39A 2BDFA 3NEWA 4Y46A 3V8SA 5GIPE 3NUXA 3MVMA 4RSSA 2OG8A 2I1MA 1VEBA 3A60A 5J5TA 5M4IA 2GNGA 3C4EA 3KXNA 3W8LA 3R22A 2YIYA 3HMPA 4GUBA 4ERKA 4UWYA 3KCKA 2BZHB 4G3EA 1YHVA 4M7IA 4FOBA 4FNYA 4MX9A 5CEOA 2B0QA 3LFFA 5AAGA 5FLFA 1W2DA 1Z57A 4CMTA 3EFLA 3OWKA 1CKIA 4LOQA 1ZOGA 4PPBA 4JL9A 4NEUA 4NSTA 3IGGA 1Q62A 4JLCA 4HYSA 4PTCA 5AP1A 4EQUA 2XCKA 3H9RA 2E2BA 2IVTA 3DNEA 3PLSA 5BYZA 3ZMMA 3MA3A 5CSHA 2YZLA 3U8WA 3D2IA 1L3RE 3SVVA 4W8EA 2CGXA 3IW5A 4FICA 5E7RA 5IQBA 2WELA 3BYOA 3EN5A 3IO7A 4QT1A 4O83A 4GK4A 1ZZLA 3G33A 4AA5A 3P5JC 2R3LA 4FSYA 4YR8A 4I6LA 4YJVA 5CU2A 3E3PA 5EHYA 5T6KA 1DI8A 4EJNA 2OI4X 5IEXA 3G90X 3HGKA 1PW2A 4GJ3A 4BCFA 3CTHA 1V0PA 2ZMCA 2KULA 1T46A 3ZUTA 2HW7A 4UZHA 5BYYA 2QHNA 2VAGA 4FT0A 3LJ0A 2PVJA 4FKUA 3LHJA 3MFUA 3ZH8A 4RIOA 3RPSA 5IISA 4BDKA 1OVEA 1Y57A 3PG3A 4YZDA 3V6RA 3QUEA 2AYPA 4QQCA 3RNIA 3VUGA 3LMGA 4A9UA 4FA2A 2EVAA 4ZTMA 3AKKA 2W1FA 4RWKA 2YIRA 3QGWA 2W1CA 4XBUA 4O7NA 4PUZA 1OIUA 3PXRA 2J50A 3ZBFA 4U3YA 3ZO2A 4KUJA 5CQWA 4FZ7A 3TJCA 4CZYB 2GNHA 5GINE 5DR9A 4CKRA 2J5EA 4S34A 3Q4TA 3FMEA 4ACGA 4YJSA 4IB3A 3EN9A 3GCSA 2R4BA 4FEXA 4O7TA 4HGEA 1P5EA 3QTQA 4RIXA 4CXAA 5ITAA 5E9EA 2R0IA 2R64A 3A61A 4GG7A 4IWOA 3D5VA 3L8PA 3OXZA 1H4LA 5M07A 4QQJA 5IQHA 5M51A 3ORNA 5HNBA 4MK0A 1SVGA 5AAEA 3TDVA 4XG3A 5FP5A 3GU7A 3ZSIA 2ZV9A 4O86A 4GSBA 2JIIA 2YCFA 4HYUA 3COIA 5DHJA 4PV0A 3FXWA 3WZDA 1Y8GA 2GTMA 4QMVA 3PIZA 4G6LA 5HE3A 3QTRA 4WIHA 4BDEA 4F9WA 1WCCA 2X4ZA 4BDIA 3AT4A 2XANA 3PSCA 2XIYA 1LUFA 5A4LA 2VX3A 3GB2A 3RK9A 4WSQA 4DGMA 1Q4LA 1VYWA 1Y8YA 2WQBA 2X9FA 4USEA 5LJJA 1OKVA 3EKKA 4BCMA 3RJCA 3BX5A 4BHZA 5DPVA 1H0VA 2IZTA 4EKKA 4TYGA 4D9UA 5HIEA 2XIXA 4Z7GA 3QF9A 5AR2A 3ZLXA 4NK9A 4G16A 3IKAA 3SLSA 4D28A 5EM5A 4G9CA 1YDTE 2PVKA 3LM5A 3HL7A 4ZTNA 4RVMA 3QTIA 4RT7A 3T9IA 2VWYA 2OFVA 5GJFA 3F2AA 3OEZA 3DLZA 3VS2A 2WMSA 4BDGA 2AEGA 4EH2A 4XV3A 3F5PA 4G3CA 3R7OA 4KS8A 3VO3A 4NCTC 4BICA 5E8YA 3EB0A 2YDIA 3F88A 2YM3A 5L6WL 4I20A 5A4QA 2JBOA 3QRKA 4IQ6A 2B9FA 4IAAA 2GU8A 4FX3A 3JPVA 4HZSA 3HP5A 4M12A 3ZEPA 3I7BA 4BTKA 5DRBA 4AZVA 4ID7A 5IEVA 1ERKA 4I3ZA 4PPCA 2PVLA 5DN3A 3V8TA 5JQ8A 2WO6A 5KUPA 4H1MA 4U81A 4U45A 5KMMA 5L4QA 3NNVA 1OBDA 3A99A 1I44A 3QHWA 2Z60A 3NYOA 1H1RA 2XKEA 4XH6A 3WE4A 4YTFA 2CNUA 3NYVA 2CN8A 5EM8A 2BZIB 1YI4A 1NVRA 1KE5A 4G3DA 2WPAA 4FVQA 3Q52A 4NM7A 4H58A 5E8ZA 1IRKA 2YM4A 3GCQA 4L68A 5E8XA 2OF4A 2C30A 4U44A 4RC2A 2GTNA 2XNPA 1G8SA 3E8CA 2VV9A 3KK8A 3D83A 3LFAA 3DZOA 2YCQA 3JY9A 3UBDA 3QZIA 4F1TA 4LMNA 1I09A 3ITZA 4HCVA 3QX4A 4NUSA 5EI6A 5HNGA 3W2SA 3ZM4A 2UW8A 1U59A 1MQBA 2WNTA 3G6HA 3R2YA 4AU8A 2XK9A 5CAPA 2R2PA 2EXMA 3QUDA 5K0XA 4HVHA 4GK3A 2KTYA 3LCTA 4JG8A 3PJ1A 4G3FA 2HAKA 3JY0A 2VU3A 4MXOA 3GBZA 4I6FA 5AUVA 2QODA 4GU6A 1PKDA 2H6DA 2YJRA 4FUYA 4M69B 1R78A 5LCKA 3W8QA 4AT5A 4U7ZA 2JITA 2Z02A 3JYAA 4G5JA 4EH6A 3W16A 3LFCA 4O22A 4QP8A 5EYDA 5L8LA 3OUNB 4NM0A 4IFGA 5TE0A 3M1SA 3C50A 3E87A 4CRSA 3V6SA 2XUUA 4ZS0A 3WYYA 5HU9A 2BIYA 5BMMA 1SMHA 4O0TA 3IG7A 4L43A 4PDYA 2UW4A 4IDTA 4R1VA 3PJ2A 4JS8A 3U9NA 2UW0A 3ZLYA 3NUUA 5DRDA 5IZFA 2DYLA 3PY3A 3SXRA 4FTCA 3GI3A 4WRSA 3RAKA 3AQVA 4EH5A 1U54A 2EXEA 4G5PA 4DBXA 1OL2A 3QCYA 4O0WA 5DEYA 2R3NA 3SW7A 4CGAA 5DMZA 2XK3A 3QCXA 4NJ3A 4ONAA 3FMLA 3UMWA 2UVZA 2YIQA 4JJRA 3LLTA 3W2QA 3R8PA 3FE3A 4DCEA 2A27A 4UMQA 3MTFA 3BGZA 1V1KA 3KF7A 3OWJA 3R01A 1ZAOA 2PE0A 3E8DA 3N51A 4BWXA 5A6NA 2XNEA 4TWPA 3HRBA 4FRFA 2WTVA 1OUKA 3FC1X 4G2FA 3SOAA 3ZZEA 5JZJA 1VR2A 2XYNA 3BYVA 4AZWA 4I4FA 4JBOA 3U54A 4O0RA 2OWBA 3QYWA 3C0IA 3QD4A 4QMSA 4M13A 5AUWA 4YGAA 4AZTA 2RFDA 2V7OA 2QOIA 3DJ6A 3DZQA 2VTIA 4J53A 4ZY4A 3OOMA 4IDVA 4NWMA 4WD5A 5HBHA 1JNKA 1Y6BA 2X2KA 1OECA 2X7FA 3ROYA 3OCSA 4WKQA 5HVKA 3KN6A 2XALA 2VX1A 5AA8A 3EYGA 3LJ1A 2GQRA 3RAIA 4FZFB 1H01A 5H8EA 5EFQA 5EW3A 1K3AA 2F9GA 2O64A 4FODA 3RCDA 2YERA 4FKPA 3TZ7A 2WU7A 3TG1A 5HLWA 3FJQE 4CT1A 1DI9A 3BU6A 4UN0C 1G5SA 3EN7A 3BZ3A 2PVRA 3FLSA 3AKJA 4X0MA 3TMOA 4L3LA 4M14A 4F78A 2AQXA 4B6LA 2BFXA 2J0LA 5CNOA 5M4CA 5FWKK 2DUVA 3RM6A 4JRVA 4L3JA 4D2PA 2XK4A 4WNOA 2C6EA 4F0FA 5HOAA 3U6HA 2FSLX 1H0WA 3SXSA 4BCIA 1H07A 3BGQA 4E8AA 2GNIA 2GHMA 3EIDA 4FSRA 5CT0A 5CSXA 4C37A 5C8NA 5L8KA 2BTSA 3TUBA 3BRBA 4D58A 4JQ8A 3KXXA 5AUXA 2Z7QA 4XG7A 1EH4A 4FOCA 5KZIA 3V5JA 5DIAA 3ZRKA 3H9FA 4BKZA 2ZFYA 4BJJA 3FPQA 4KIKA 4K77A 4BCJA 2OSCA 2XJ2A 5K3YA 4II5A 4O2PA 4KIPA 2JFMA 4P4CA 1PXLA 5ACBC 5AIKA 3EQDA 4OW8A 4U8ZA 2B7AA 4O1OA 1A06A 1Z9XA 1UU7A 2PE1A 3BU5A 3QRTA 4OGRA 4N4SA 2JDRA 2OJJA 2WEVA 3VUHA 4FT7A 4M68A 2P55A 5EQPA 3W18A 2XB7A 3UQGA 3FY2A 1OIYA 2WTWA 4MH7A 4FEWA 4EUTA 1OM1A 5AAFA 3QAME 3C9WA 5FXSA 2P33A 4GT3A 3CS9A 3R73A 3PWDA 4FSNA 1BL7A 5HO7A 3FHRA 1A48A 2XM9A 2XIRA 4FK6A 2WQNA 3TV6A 4JR7A 4DCAA 4AE9A 5FQDC 4DN5A 2OK1A 4QP7A 1YOLA 4CMUA 4DG3E 3ORLA 2HOGA 3TJDA 2QG7A 5HIBA 4X2KA 2XNBA 3ANQA 2W9ZB 4HVGA 4CFNA 4UWCA 2ZM1A 4QPSA 2C6IA 1JWHA 1MQ4A 1REJA 1ZLTA 2BMCA 4GIHA 4G17A 3MB6A 1GZOA 4AAYA 5CAVA 4MYGA 2B1PA 3OY3A 5AR7A 3QRIA 3UO6A 2PZIA 2PVYA 4CSVA 3QHRA 1FGIA 3VNTA 5H3QA 4F9BA 3PPJA 1OL6A 4PX6A 2QOCA 3WZUA 4FTAA 3BHYA 4FKTA 5LVMA 3I5ZA 5CAOA 1TQMA 4W9XA 2VRXA 4J1RA 4F64A 5L2IA 5KMKA 5AR5A 5CVGA 3HMNA 4P90A 2WOUA 2UZUE 4RIWA 5FTOA 3F2NA 3I81A 2JD5A 2XIKA 2H96A 1ZY4A 1UU9A 2JDSA 3PVUA 4FKVA 5KCVA 4JQ7A 4IWQA 4Y5QA 2C3KA 4I21A 5D7VA 3A2CA 1W98A 3H10A 4S31A 3RGFA 3SRVA 4F4PA 1LEWA 3ZONA 4G34A 4CFUA 2GCDA 2J2IB 5A4EA 2YLFA 5BV3A 3K54A 4I6QA 4AG8A 4ZP5A 5ANJA 4QMQA 1XKKA 2ZV2A 3LLAA 3FLWA 2QOBA 4QTBA 3WBLA 3UQCA 3UPXA 5FGKA 3V01A 1ZWSA 4EH8A 3VONA 2EB3A 4FZDB 2J90A 4WSYA 4PF4A 2X4FA 3W1FA 3SQQA 3L1SA 5LMBA 4ZY5A 3EMGA 4JI9A 1ZYJA 4EH7A 5CZIA 5IQFA 1ZXEA 1JVPP 4AFEA 4M15A 4LM5A 5G6VA 3UVQA 4KKHA 3E8EA 3R1QA 3LQ3A 4BTJA 3L9PA 3TTJA 3HLLA 1W2CA 2QO2A 1H1WA 2Y6MA 4RFMA 5LWMA 2PUPA 1YXXA 4DA5A 5A4CA 3P78A 1JLUE 1GIIA 2WMBA 3A7IA 2A2AA 3HA8A 3KRXA 4XOZA 5CEIA 3S2PA 3SV0A 4B0GA 2HCKA 2XNMA 1VJYA 5HORA 2FSTX 4MAOA 1OMWA 5EW9A 3UODA 4A4XA 4EBVA 2UW3A 4X7QA 4HW7A 4R6VA 4FKWA 4F09A 4YSJA 4KINA 4FTOA 1QPEA 1HCLA 1SM2A 3UJGA 3M11A 5E4HA 5HVJA 3R6XA 2W96B 3O8UA 4WHZA 3TNPC 2WGJA 3BEAA 4C3FA 1P2AA 3TCPA 4HVDA 4QMWA 1OL1A 3QQKA 4J8NA 4X6RA 1O6KA 4QMNA 1J7UA 4X6QC 4AGWA 4QP3A 3JVRA 4F1OA 4FSUA 2GNFA 2R3IA 4AUAA 3OT3A 3PE2A 4O4CA 5DT0A 5B7VA 4O81A 3PUPA 4ZLYA 3OCTA 4KRCA 4UEUA 3BEGA 3CCNA 3MPAA 5F4NA 5KHWA 3R9RA 2BDWA 4NM3A 3EWHA 2Q83A 4QYEA 1J3HA 3OUKA 3C4FA 2C1AA 5CF6A 4BRXA 4ZZNA 3HKOA 4IM3A 3DAJA 3ULIA 4D2WA 4DEHA 5EI2A 4BI1A 2A0CX 3VQHA 2W9FB 2CGUA 3BU3A 3MSSA 4D55A 3OXTA 2YACA 3QKLA 2UZBA 2OKRA 2YHVA 1YWNA 2GQGA 2XNOA 2LGCA 1PXJA 5DYJA 3GFEA 2XAMA 3VS3A 5HQ0A 3VVHA 3O7LD 5J5SA 4FV9A 2WOTA 4ITHA 5C8KA 4PDPA 1WBVA 2PUNA 1YI6A 2CDZA 4MNEA 2W06A 1JAMA 4U97A 5EM6A 4BCPA 2ZOQA 3NGAA 1ZARA 4NL0A 2ONLA 3TZ9A 3FI4A 2C1BA 4CFVA 2W5BA 5J9ZA 2XJ1A 2EUFB 4GT5A 4EOMA 3GCVA 3NPCA 4WA9A 4A4OA 2PVMA 3A7FA 1WZYA 2HW6A 5CU4A 4L52A 5DOSA 4YC8A 5IA0A 4FKRA 4DFUA