4FIIA

Catalytic domain of human pak4 with rpkplvdp peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
291
Chain Sequence
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title Type II p21-activated kinases (PAKs) are regulated by an autoinhibitory pseudosubstrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 96
structure length 291
sequence length 292
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fiiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fiiA01
4M15A 4BDGA 3QTZA 3DPKA 4AW1A 1Y6BA 3R1QA 4EJNA 3TKIA 1CKJA 4QPAA 1YXXA 3BE9A 3R22A 4C33A 5DRDA 4R3CA 3BV3A 1H26A 5H2UA 4MNEA 1PHKA 4E7WA 5LVOA 4R7HA 2GCDA 3ZO4A 1OIQA 4D2SA 2GS2A 1G8AA 3EHAA 4FSWA 1OIRA 2QHMA 3O50A 4C38A 1CDKA 2B55A 1G8SA 3MVHA 4Y83A 3AD4A 5DBXA 3LFSA 3PVGA 4EL9A 3DK6A 3VO3A 3RCDA 5IEYA 4ANOA 5JGBA 1PXMA 3BELA 5C26A 3PXYA 4A9SA 5LOHA 1K2PA 3LJ0A 2Z2WA 3ZXZA 3C5UA 3E5AA 5E4HA 3QZGA 2OJFE 4BCJA 3UP2A 1WFCA 4QNAA 4ERWA 3GUBA 2JKKA 3P08A 3VW8A 3EFJA 2VWIA 3TG1A 3E8DA 1LEZA 4BZOA 3POOA 2OFVA 2X6EA 3PJ3A 4NKAA 1JOWB 3SQQA 3A60A 1PYEA 3T3VA 2JDVA 4C3PA 4FEUA 4PDPA 3H0ZA 2F4JA 2JGZA 4NTTA 3C4XA 4FZAB 3I4BA 3Q5IA 4W8EA 3MY1A 1IAJA 4AFJA 2A19B 4BN1A 2OIQA 5EOLA 5HNGA 2VTHA 2VWZA 3PZEA 3ZDIA 1W84A 5BYYA 3MVMA 4BB4A 4O22A 3IG7A 5HE3A 4Z9LA 2O5KA 2XBJA 1ZYDA 3WZKA 3EB0A 4WT6A 1VJYA 4BCPA 4USDA 4EYJA 4JI9A 1FGIA 3MB7A 3TM0A 3FUPA 3DBCA 4YUQA 5AM7A 1PF8A 1ZRZA 4WBBB 2I1MA 3P78A 4D58A 2HXQA 5HO6A 2WTVA 3ODYX 2X7FA 4I0SA 1FMOE 1ERKA 3FY0A 3GU5A 1XO2B 5J9LA 4IVDA 2F2UA 3GQIA 2R3JA 3U55A 4IW0A 5IQCA 3V8TA 3VRYA 3R63A 3OCTA 4DG0E 3BV2A 4PUZA 5CANA 1XHAA 2PSQA 3JY0A 4LOOA 2WIHA 4FTOA 2XNNA 3DK3A 4DEEA 4OGRA 2YAKA 4UN0C 4L42A 3W2OA 3B8QA 2X8EA 3FAAA 4LGDA 3E3BX 2GS7A 4QMTA 3ULIA 4HNFA 4CFVA 2B9HA 2FSTX 2QODA 5BVEA 3V5QA 4C2VA 1XH6A 4F1TA 5M53A 3OBJA 2YM8A 4IAIA 4OTPA 1K3AA 4DCEA 5DH3A 4QP2A 4AACA 4B7TA 3HAVA 4X7QA 2BMCA 1URCA 2R3MA 2PZIA 2VWVA 3FL5A 4P5ZA 5DR6A 5AR5A 2YABA 3RWPA 1PRYA 4F9WA 3ZLXA 3LQ5A 1R3CA 4FR4A 1XBBA 2FO0A 3VUMA 2E2BA 3PVBA 4AP7A 3ETAA 4ZS4A 4K0YA 4W9WA 4KSPA 5CNOA 4BDHA 4YTIA 5GNKA 5FGKA 4PPCA 3WE4A 4LL5A 5DFPA 4G17A 5KMOA 2BDJA 2DWBA 3TN8A 4EBVA 4MD7E 5HTBA 4RJ8A 2UZDA 3TI1A 4KRDA 4YSMA 4S34A 4MWIA 4IVBA 4Q5EA 4QQJA 4YLLA 5K4IA 3KVXA 4AG8A 4XH6A 3W2PA 3G51A 1O9UA 2QKRA 3QFVA 3PXQA 4D0WA 4FV5A 4L9IA 4BVUA 3FKLA 3HA6A 3DKCA 2PK9A 4LRMA 4DEBA 1YXTA 2JAMA 3IW6A 5DOSA 3F61A 4ZIMA 2IN6A 2GTNA 3FQSA 3GVUA 4YZNA 3R9HA 4MD9E 2H6DA 5CU3A 4BWPA 1H00A 4ASEA 1ZZ2A 3HP5A 2I0EA 3BU5A 2YWPA 4RWJA 1U5RA 4MXOA 3TUCA 4RJ6A 3RAWA 3FSKA 2Z8CA 4HYSA 4JG7A 2Z7RA 3RCJA 4EHVA 5A4TA 5CF8A 3R28A 2XVDA 4M12A 3ZBFA 1NXKA 3LXNA 4K6ZA 4QMSA 3KVWA 2G2FA 4DFUA 3RALA 4FK3A 4YHTA 2C6MA 3P7BA 5CU0A 2VTJA 4CYJA 3VUHA 2HY81 2PE2A 2BAJA 4BI1A 3CY3A 2I7QA 2B7AA 4EJ7A 2UZBA 3DCVA 4N0SA 4B8MA 3V6SA 4U9AA 2BPMA 2XNMA 3IW5A 4D55A 4YZ9A 4TWCA 5ANIA 1ZOHA 1EH4A 2YCQA 3VW6A 3AC4A 4EH6A 4EYMA 1IAHA 2VNYA 2VTTA 2X2KA 3O17A 4MAOA 4FKUA 2Y0AA 3CPBA 2GHLA 4RWIA 4IAFA 3QLFA 2ETRA 4QTDA 3CSVA 3SVVA 4NCTA 2PYWA 2C3KA 2P2IA 5JQ8A 3QXPA 3BEGA 4KKHA 4UALA 5KE0A 4O2ZA 2E9UA 4WNMA 4DYMA 1B39A 3U4WA 4ZTMA 3S1HA 3UO4A 4IB0A 4WBOA 3A2CA 4OBQA 5CU6A 5HESA 5CS6A 2A4LA 2OZAA 4IZAA 2OH4A 1SNUA 4L52A 4DGMA 5HLPA 5HG9A 5BVNA 5JGAA 5M51A 2O65A 3COMA 4GFMA 4QMOA 4IVCA 5HZNA 5EG3A 3NUSA 3UZTA 3VQUA 5HLWA 5LMBA 3ZZWA 4K8AA 4LV5A 3ZFXA 2KTYA 5LMKA 2O63A 4C3RA 4E5AX 2R9SA 5CALA 2X2LA 2IVUA 3F69A 4MXCA 4EWQA 5DMZA 1A06A 1FQ1B 1I09A 4USFA 2RFDA 4OTQA 2PL0A 4ALVA 4FUXA 1GIHA 4AF3A 5CXZA 2GNHA 2YLEA 1GIJA 3UIMA 3UTOA 1K9AA 4EHGA 4YC6A 3KREA 2E9NA 5FXSA 4Q9SA 3V51A 4LQMA 2R3RA 2J0JA 2WAJA 2JAVA 4ZP5A 3BBTB 3DKFA 3S3IA 4PV0A 4PP7A 3IW7A 5E9EA 4RA4A 4DFLA 2AC3A 5EW8A 4X6QC 1OUYA 1XH4A 3KMMA 3RPSA 4XLIA 3C9WA 4FK6A 3ZRLA 2IVTA 1PXIA 3DBFA 5CI7A 4DF3A 2WEIA 5FLFA 4DHFA 4YTCA 1W8CA 3OP5A 2PZRA 2FGIA 3PXKA 4QYGA 4D0XA 3EZRA 3COHA 4FKIA 4F99A 4C0TA 4JLCA 4NFMA 2FVDA 4FT9A 3BYSA 4KIQA 3DT1A 2EB3A 5IUGA 5EYKA 3GEQA 3VS4A 4U41A 3VRZA 5LXMA 3CD3A 2BAQA 3AD6A 1LP4A 3K2LA 4A07A 3BQRA 2W9ZB 4RIYA 3GC0A 1TQMA 4NSTA 5CZHA 4ALWA 2CGWA 4QQ5A 4TKSA 2NO3A 4BCOA 1ZZLA 4JBPA 2HCKA 3UODA 5K0KA 4F7SA 4O7VA 4CMOA 2X4ZA 2WIPA 4EH7A 5JGDA 4R7BA 2J9MA 3PYYA 4PDSA 3TV6A 5KUPA 3IGOA 2JD5A 3F3WA 4FV7A 3OW3A 5T68A 3RZFA 4FIGA 2P33A 5F1ZA 4M3QA 1OL5A 2PY3A 3EKNA 4FL3A 3HNGA 2J7TA 3PJ1A 4GU9A 3UC4A 2PUPA 4FZ7A 4CFXA 3FZRA 1Y91A 1ZAOA 3UVQA 4U79A 3FPMA 4I6HA 4U3ZA 5EDQA 4FG9A 3W16A 4ERKA 4ZSAA 5IUHA 3QTSA 4RC2A 5HX8A 1P5EA 3IO7A 3FEGA 3EMGA 3S0OA 1KWPA 2C30A 4M0ZA 3DXPA 4U0IA 3FLNC 4BBMA 1M52A 2UV2A 4BYIA 4NJDA 3QGWA 4DEIA 4TNDA 3ZSHA 3NYNA 4RGJA 3NAXA 3PE2A 3R7EA 4L43A 5K5NA 4RX8A 4FEXA 2W1ZA 4RVMA 4IZYA 5L6WL 5AUTA 5K0XA 3PVWA 3BKBA 3E3PA 2JIUA 3KXNA 4QP9A 1BL7A 4QYFA 3FQHA 5EOBA 3LFAA 3TWJA 5FQDC 3KRWA 2R3OA 3D15A 3QTWA 3UG2A 3ZLWA 4C59A 3ZM4A 5DR2A 2VUWA 4V04A 2VTRA 3PXZA 2QI8A 5EHOA 1UNLA 2C4GA 3EQIA 3NZ0A 5LARA 3ZS5A 3FI2A 1STCE 2FUMA 2HZIA 5EI8A 1E1VA 3UZPA 3Q9WA 3NVMB 4J8MA 1M2QA 1XH9A 4ZJJA 5DA3A 2XH5A 2UZUE 4E20A 4BIDA 4DAWA 4M8TA 4EOLA 4AW2A 5A6NA 3ROCA 1JKTA 5AR7A 3G5DA 1FGKA 1SYKA 3FLZA 2J0IA 2Y4PA 4XEYA 4G6LA 5CVFA 4Y85A 5J1VA 3L9MA 5TE0A 2R3LA 3V5WA 4GFGA 5J79A 5FWKK 4IWQA 3W8LA 5M57A 1KE9A 4BC6A 3HP2A 2CKQA 1H4LA 2GNLA 4C4HA 5HVYA 5HGIA 4U81A 5AEPA 4UYAA 5ETAA 3QL8A 3EQRA 4O0UA 4A9YA 3MWUA 4HCVA 5EM7A 5DT4A 3Q9ZA 5KKRC 3VULA 4BCIA 5TO8A 3GCQA 1H24A 4KABA 3LMHA 4BF2A 2JIVA 1FVVA 2W1CA 2JFLA 4CFUA 5HG5A 5EHLA 1BUHA 1Q8WA 5DWRA 2OJJA 3OXZA 2QO9A 3MSSA 3JR1A 4AAAA 3E64A 2VX0A 2WOUA 1L3RE 5FP6A 4ZLYA 4WRGA 3OFMA 3L8XA 1OL7A 1PMVA 3LFQA 4IJ9A 3MPTA 4HCTA 4PMMA 2X9EA 5DIAA 5HOAA 2R5TA 2BKKA 4UMQA 1RW8A 2W96B 3EFLA 4IIRA 5CLPA 5C1QB 2ITWA 4IM0A 4UWYA 3L1SA 2W4KA 1SVHA 3L8SA 3CTHA 4B99A 5ANJA 3GU4A 4GCJA 1YRPA 1R39A 4P90A 3FKNA 3DNEA 4L3LA 4G6OA 5H3QA 4DH5A 1OL6A 1QPJA 4FTAA 4JQ8A 4GK3A 3KXXA 1H8FA 4GK4A 5BVKA 3PVUA 1KE7A 3HV6A 3LW0A 3FMKA 4N70A 4O0TA 4DEAA 4F70A 3M42A 4V05A 2WMRA 1Q8ZA 3FMDA 2XS0A 2VGOA 3LQ8A 3KMUA 3O0GA 4IAKA 2EUFB 4J52A 3CKWA 2IO6A 4F7NA 4QPSA 5KNJA 2GQRA 3KGAA 1UU7A 1HOWA 3LCSA 1WBWA 3MFTA 3QBNA 2NNWB 4E4NA 4FTRA 4RLKA 3TIZA 2JITA 4FV2A 2XIKA 1J91A 2EB2A 4O7TA 5AFVA 4HVIA 3GCUA 2WQEA 3RM7A 3PY0A 3TNPC 2XK9A 5CVGA 1J1BA 5I0BA 5J5SA 5D7VA 5CU2A 2CSNA 2O2UA 5F20A 3BIZA 3ZXTA 3C0HA 2C3JA 2NRUA 3WF6A 1WBOA 1WBTA 3E8CA 5DEYA 3A7HA 3NAYA 3UO5A 2J4ZA 1JVPP 2W1DA 4X3JA 4XHKB 3KXZA 4P7EA 1APME 5LWMA 2YM5A 4MTAA 3A4PA 3Q9YA 1ATPE 3KULA 5EM8A 4CV9A 4D2WA 4ALUA 1VR2A 1IA8A 2C3LA 1OPJA 3FMJA 4C62A 5A46A 2VTAA 3ZC5A 4RJ3A 4RC4A 5JZJA 4JDHA 3KN5A 4IQ6A 4ASDA 2EVAA 5L8JA 3KRJA 5LCKA 4DBXA 4KKEA 5F9EA 4XCUA 5DYJA 4FKVA 4LUEA 4PRJA 2C6LA 4ONAA 3A4OX 2IJMA 3HV3A 3QRUA 5CQWA 2E9PA 2QHNA 2WU6A 3ATTA 2IZTA 3OROA 2ACXA 4IJPA 3DQXA 4IC7A 5DRBA 4AS0A 5LMKC 1T46A 4K18A 3P79A 3KK9A 4KBAA 2UW6A 1PY5A 3DGKA 3LCTA 4AT5A 5B2KA 3SX9A 1B38A 2X1NA 5FDXA 4DT8A 5AMNA 4BCMA 5JT2A 4TYIA 5AAFA 4MBIA 3RGFA 4L7SA 3C4WA 3CC6A 2Y4IC 3PSCA 5K5XA 4C4GA 4GKHA 5CSXA 2YM4A 5HEZA 3KCKA 4IAZA 3H0YA 2VO3A 3VBVA 4EK5A 5L2WA 3QD0A 5IMXA 4EH9A 2UUEA 4NUSA 4ASZA 3DU8A 4I5PA 1NA7A 5CAVA 2XEZA 5E1EA 4AW5A 1GIIA 5EYDA 3VC4A 3QHWA 4Z3VA 3PA3A 4CKJA 2AYPA 3WBLA 3QRKA 3WOWA 4YZCA 4MXZA 3ZH8A 3PSBA 3ZYAA 5CAUA 2ZYBA 3MYGA 4O2PA 5BVOA 1WBVA 3C4ZA 3ORIA 4F9BA 3OD6X 4FL2A 2IWIA 4O84A 3R6XA 3M2WA 4FZFB 1S9IA 2GTMA 4I6FA 2X2MA 3FZ1A 4HGEA 2R7IA 3WARA 4U42A 3QX4A 2OXXA 5HCXA 1KE8A 3OUNB 3I6UA 3MVLA 2F7EE 4X21A 5E8ZA 4RZVA 2RGPA 1XJDA 2ONLA 3DBDA 4RFZA 4R6VA 2C0TA 4ZEGA 3LOKA 2QO7A 1FBNA 3GT8A 3IOKA 1NVRA 3AC8A 1MQBA 4O6EA 1WVWA 4O7LA 3EN4A 4L53A 5CEOA 2J0KA 2WMUA 3R2BA 4RT7A 5IG1A 3U6HA 3A7IA 4JS8A 4L3JA 5L3AA 2XYNA 3E7OA 2WHBA 3QRTA 5IQBA 3LJ2A 2C5OA 3R01A 3UOLA 5IQAA 2B9IA 1AD5A 4ACHA 1KE5A 3E93A 3F7ZA 4DCAA 1MRVA 4FKPA 3BPRA 5EM6A 4BFMA 4H3BA 4U40A 3NVKI 4ANLA 4AZFA 5HU9A 2CKOA 3O23A 2B0QA 4EQMA 5L2QA 5L8KA 4PL4A 3BYOA 4E5BA 2BRBA 5HE1A 2KULA 4HW7A 3AMYA 2J50A 4LGHA 4QMXA 3UIBA 3QZHA 5J7BA 2PUNA 2X8DA 3GOPA 4FT5A 1QMZA 2XYUA 2GNJA 4AT3A 1UV5A 3AD5A 2DQ7X 3F2RA 5CENA 2JBOA 3JYAA 4HZSA 2UW5A 2VV9A 3GC8A 4S2ZA 2ITPA 3ORKA 4GEOA 5CAPA 3PSDA 4AX8A 1P4FA 3PP1A 2ETKA 3ORTA 2JFMA 4FKRA 4PNIA 4N4SA 5IA1A 2PU8A 3HRBA 4CGAA 5DHJA 5HKMA 3W33A 3VHEA 3WF9A 5A9UA 4EZ3A 3KRLA 3D94A 1JKKA 1FPUA 1OUKA 2Y9QA 4LM5A 1WVYA 2F57A 2ZV8A 1ZARA 4I1ZA 3FZTA 4H1JA 4YTHA 5JN2A 2J0LA 3Q6UA 3HV7A 4GJ2A 4ARKA 3NW6A 5AX9A 4EBWA 3MIYA 3EIDA 4FT0A 2YIXA 4PY1A 3AC3A 4NM3A 4CCUA 3DAEA 3R7OA 4CTBA 4HGLA 3NNUA 1REKA 4M67A 1MQ4A 3UGCA 5BUEA 5HX6A 2PWLA 4CFFA 2ITOA 1XH8A 1SMHA 5BVFA 3OXIA 3P5KA 1H1QA 4D9UA 2JDTA 2YM6A 4Z55A 3L9PA 4GV1A 2QOBA 2P3GX 5ITAA 4LG4A 4XX9A 3CQWA 1ZMVA 1JQHA 4UMPA 1G3NA 3ZSIA 3TZ8A 4MYGA 3GB2A 3RJCA 1H27A 1O6YA 3A99A 3QYZA 4KIKA 1QL6A 3EQCA 4YO6A 2ZMCA 1YQJA 1TQIA 2VWYA 3DDQA 4CLJA 5FEDA 3GBZA 3KKVA 4YC8A 4ZMFA 3CPCA 3QQUA 3R9DA 3RMFA 2F49A 3GCPA 3ERKA 3HVCA 1FVTA 4WHZA 3SRVB 2IPXA 4WA9A 3Q96A 2J5FA 5AX3A 2EU9A 4L01A 2ZAZA 2X81A 4X2JA 1Q3WA 3R21A 2QKWB 4X3FA 1DM2A 5E8SA 2GNFA 3DZOA 3RWQA 4QMNA 5IDPA 3D7ZA 4OTHA 3NEWA 4ZY5A 4OTIA 2QC6A 3QF9A 4YJSA 2WQNA 4E6DA 5G1XA 3UBDA 4FSRA 4GG5A 4YO4A 4O1PA 5DVRA 4QMMA 4KKGA 3A7JA 3RAHA 3SV0A 3QKMA 3F66A 3R04A 1YW2A 3G15A 1VZOA 3EQHA 4U7ZA 4APCA 1QPEA 2XKFA 2YJRA 3NUXA 4DLIA 2YIYA 4M68A 1YI3A 4QT1A 3V04A 3DQWA 4FKSA 1NW1A 4E1ZA 4J95A 3PIYA 3GGFA 4XYFA 4USEA 5E90A 3ZUVA 2OIBA 4E4XA 3DB6A 3N9XA 4GKIA 1JBPE 5CZIA 3NYOA 2YCFA 2IZUA 3QTXA 4DH1A 3TKUA 1IEPA 1OZ1A 3E7VA 1CMKE 2RIOA 4S30A 5B2MA 3FWQA 4TT7A 1XH5A 1OIUA 2DYLA 3L9NA 4G3EA 2QOFA 4WNKA 4MHAA 4YU2A 2W1FA 4ZK5A 4F6WA 3A61A 3KA0A 4JDJA 3V5JA 3ORPA 3AC5A 4D2PA 4DG3E 5CEPA 2W99B 3CD8A 3ORLA 4FA2A 1OPLA 3WZUA 4JR3A 2ZB0A 4UZHA 4EHEA 2ITNA 3WYYA 3FDNA 4AA0A 4CTCA 5HICA 2QU5A 3OBGA 4M0YA 3DNDA 2OF4A 1DAYA 3BX5A 3NDMA 2Q83A 4FOCA 2EXCX 2Y6OA 2OGVA 4Y5QA 2G15A 2B9JA 2F7XE 3NX8A 3A62A 5CAQA 1MUOA 1JNKA 4I24A 3PWYA 5I9WA 4QQCA 2B9FA 2ZM1A 5EW3A 4O7WA 5FEQA 4YZMA 3ORZA 4FV0A 5L6OA 4KIOA 1JSUA 1PXPA 4FICA 1V0PA 4YJNA 5J9ZA 2OF2A 3JPVA 5HIDA 2Z7QA 4ZJVA 3Q52A 3VBQA 3BLQA 4ZSEA 3PRFA 2X9FA 4I22A 4EUUA 4PTEA 5ANGA 4BCQA 4ZSLA 3PIXA 1WBSA 4GK2A 2XK4A 3R1SA 2C3IB 3H10A 4AZWA 3PWDA 3FXXA 4ANNA 4AT4A 4K33A 3F2AA 4LFIA 4BZDA 5LWNA 2WTJA 4XP0A 5FG8A 4ENXA 1YOMA 2Y6MA 3OG7A 4GVJA 2E9OA 1PXJA 4XS2A 3R8LA 4BZNA 1Q99A 2XRUA 3AMAA 4U3YA 2WTKB 5CI6A 4FI1A 5IA5A 2XA4A 4XP2A 2PVLA 3I7CA 3N51A 4IAYA 3R7YA 4W4VA 3REPA 3TXOA 1OL1A 2YITA 4G3CA 3DB8A 3NIZA 1YI6A 2DS1A 2C6TA 4IX6A 5H8GA 4AGWA 4BCGA 5M55A 4HVHA 2FSOX 3T8OA 4NT4A 3I81A 4XG9A 5JFXA 3QD2B 3UNJA 5IZFA 5AUVA 4U43A 3V5LA 2BIKB 3PP0A 2RG6A 4BDEA 4YJRA 3LCOA 1UWJA 2OI4X 2WZJA 2XB7A 3SRVA 3KEXA 5AIRA 3NMUF 2E9VA 2UW8A 5HE0A 2V62A 4FSUA 5EM5A 2VAGA 2J90A 3V3VA 1PJKA 2JKMA 4O38A 3FE3A 2JLDA 5A4LA 4JBVA 3MGYA 5I3RA 4BR3A 3N4VA 1ZMWA 5L2TA 1IRKA 2FH9A 3D83A 1YHSA 3RTPA 4DT9A 3FSFA 3ALNA 4A9UA 3W2RA 5C01A 4B9DA 4O91A 3E87A 3SG9A 3B2WA 4KBKA 4UB7A 2V55A 2OJIA 2PVHA 1CTPE 2JDSA 3F5GA 4WOVA 4G3GA 3D14A 4XG6A 5D11A 5ETFA 4EKKA 4I3ZA 3ACJA 5CEMA 3DLSA 4TYGA 4X2FA 3ZOSA 4RA5A 4PX6A 1TVOA 2ZB1A 3B8RA 3IW4A 1AGWA 4ZTHA 5TKDA 3R9NA 4EK8A 4L45A 3EFWA 2JKQA 4IX3A 4MCVA 4IX4A 3OEZA 3IDPA 5ETIA 5IQDA 5HNIX 4M66A 1KV1A 1UKHA 2PZ5A 2GHGA 2VO6A 3RAKA 1Q8YA 2QURA 4NU1A 4DFXE 2YM7A 4OT6A 4JBQA 4U44A 5I9VA 1Q41A 1XQZA 5IA0A 5L2SA 2XZSA 3DA6A 3LVPA 4I92A 2PMNX 3PXRA 4QTAA 3TV4A 2VTPA 3W32A 3WF5A 4BTKA 3ELJA 3NLBA 3F6XA 5IKWA 5BVWA 4XBRA 4D2VA 1Q97A 4EI4A 5AR2A 5G6VA 1GOLA 4G31A 4QYEA 4OLIA 1J7LA 1MP8A 4QP6A 4UBAA 5HHWA 4CKIA 5ANEA 4F6UA 3FC2A 1RJBA 5H8BA 3FMLA 4II5A 4L8MA 3RK9A 5BVDA 3Q4ZA 4DTKA 1WVXA 4O1OA 5EI2A 4JOAA 4M69B 4KB8A 4JIAA 5CSVA 5BUJA 3GNIB 2PUUA 4R78A 1Y8GA 3KC3A 4O96A 5M44A 5AR8A 1OKYA 3P86A 1UVRA 3VS2A 4EORA 3LQ3A 3G0EA 4CT1A 4KBCA 4IBMA 3MFRA 4LMUA 2C6OA 2C0OA 3NUUA 2UW3A 3IQ7A 2P2HA 3EN6A 3PPKA 4MKCA 1OKVA 4I21A 5EHYA 1KE6A 3DAKA 4NIFB 3NCGA 3C1XA 3GCSA 4FTTA 4W4XA 3R7IA 4CSVA 3HV4A 3HUCA 3FZSA 4AQCA 3K5UA 5HBHA 4QRCA 4RG0A 3L8VA 3F82A 3KF7A 3MFSA 5E8XA 4BGGA 3QKLA 4NH1A 1OKZA 4NM0A 4TWPA 4ZY6A 4IACA 4O0XA 4FVPA 1VYZA 2HENA 1OBGA 1M14A 2Z7SA 3BHHA 4C61A 3FL4A 3ROYA 3PPZA 3JY9A 5I3OA 5I9XA 1FMKA 5DLSA 2P55A 4GS6A 4QTEA 5I5ZA 1YDRE 3ZDUA 1YXSA 2QCSA 3KK8A 4ZY4A 2A27A 3SD0A 1JLUE 3DZQA 3UNKA 2NPQA 4IAAA 2XNOA 3CTJA 3GFEA 4FV1A 4IM2A 5DI1A 4A9TA 1OECA 3ENHA 3K5VA 1S9JA 2Z02A 4X3FC 4F9AA 3DOGA 2Q0BA 2QONA 4AE6A 3P23A 5D7AA 5J7HA 3BBWA 2XJ0A 3PA4A 2I6LA 5CEIA 4D1ZA 3IW8A 5C8KA 5EKOA 4G9RA 1P14A 5LVMA 1OI9A 2HW6A 5AP4A 1WMKA 2VRXA 4ZSGA 4BBFA 5M4FA 4ZTSA 3S2PA 4YC3A 4ORKA 5GZAA 4XV1A 1OB3A 3CJFA 4WRSA 4DH7A 3TEIA 1DI8A 4GIHA 4CQGA 2WXVA 3ORXA 4ZSJA 4W4YA 3TCPA 4KNBA 3RBWA 3UJGA 3WI6A 5GZ8A 3UYTA 5AR4A 3MW1A 4NTSA 5AA8A 1CKPA 1WAKA 4MXYA 5EFQA 4GH2A 3D2IA 3MS9A 4EEVA 2YN8A 2BAKA 4LI5A 4ZTRA 4O7ZA 4EKLA 3R9RA 2PPQA 5IA2A 3FY2A 4DINA 5HIEA 3OWKA 2CGXA 4ZLZA 5IEVA 3Q2JA 4MQ1A 3VS5A 4A4OA 3SOAA 3VAPA 5HU3A 3ZRMA 3NNWA 3C4CA 3NW7A 4HJOA 4L7FA 3W2SA 2C5NA 3QD3A 4R5SA 3CP9A 4XG2A 4BTJA 3FQEA 3VNTA 5HIBA 2XJ1A 3DBEA 3DY7A 4QD6A 4XG4A 5CT7A 4AU8A 3FHIA 2OJ9A 3W55A 3MJ1A 4D1XA 2G2IA 1OIYA 3BCEA 1PW2A 3DFCB 5A4QA 2PVRA 2XIYA 4EK6A 4F7LA 1BKXA 4L44A 1UNHA 5FM3A 5EYCA 3QC9A 3U87A 2QOQA 1ZYJA 4NM5A 3TUDA 3COKA 4J97A 1NY3A 4QP3A 1JPAA 4JVGA 2WGJA 4KIPA 3UQGA 3LLAA 3NUYA 2R2PA 5EK7A 3QD4A 4RIXB 2RKUA 3ZO2A 3QUDA 4O81A 4MXAA 3JXWA 4HYUA 1OPKA 4YHJA 3ULZA 1XKKA 4V01A 4J7BA 5GZ9A 3LXPA 2XK8A 1Y8YA 3FI8A 5IQHA 5HCYA 4QTBA 3P9JA 4C4EA 5BQ0A 5IQEA 5KBRA 1U54B 3QQKA 3PJCA 4ASXA 2OLCA 1PMEA 5ACBC 4DGOA 3TJCA 2YM3A 3ALOA 4FG8A 3HDMA 3H30A 5LVLA 1ZXEA 3EQFA 4UMUA 1JKLA 2ITVA 4CXAA 3FMNA 4OT5A 5DGZA 4FTKA 5IMEA 1OITA 4HPUE 3FMMA 1Q8UA 4M69A 4TTHB 1ZLTA 3R7GA 5A4CA 3TT0A 5J5TA 5AM6A 5K4JA 3AMBA 3EOCA 4IDVA 4R8QA 5EW9A 3UE4A 2YJSA 3UIXA 1QPCA 3GC7A 4N57A 4I23A 3R73A 4PL5A 4XUFA 4RVLA 2BROA 2BRMA 4GYGA 4BRXA 4XRJA 4E4LA 2BZIB 4DGNA 4QOXA 1VEBA 4RC3A 4LV8A 2QR8A 4I5CA 3NPCA 4ITIA 4LL0A 4XOYA 2R3PA 4PTGA 4D5HA 2BZHB 1Q5KA 1R1WA 3ACKA 2W4JA 5M4IA 2ERZE 3QU0A 5CY3A 3UO6A 3I0QA 2C0IA 4F6SA 3CE3A 3LPBA 3OWJA 1YI4A 3HMPA 4FKLA 4RVKA 4ACGA 3ZEPA 2VTMA 1Q24A 4QMQA 3QX2A 2WMQA 4C8BA 3ODZX 2BILB 4AOTA 1PXOA 3HAMA 3ZM9A 4PTCA 4FTCA 3QGYA 4E26A 3T9TA 4UXLA 4AE9A 2XIRA 3PG1A 1UKIA 4V0GB 5D9HA 3UP7A 2ZV7A 2O8YA 3ZO3A 2YIWA 4ZTLA 5AP0A 2BFYA 2RG5A 4RWKA 2PTKA 3OY3A 4GSBA 3N4TA 5L2IA 3VF9A 2UW7A 4CCBA 1F3MC 4E8AA 4MX9A 3HA8A 5T3QA 2CCHA 3W2CA 3F3TA 2R3QA 2X0GA 2VU3A 3BGQA 3EKKA 3PPJA 3LCKA 4F0FA 4XJ0A 3HYHA 2V0DA 2OW3A 4O0SA 2XIXA 5AUUA 2VO7A 4RJ4A 5AV1A 3M1SA 4HVGA 4MXXA 4Y5HA 5KHXA 4JX3A 1GAGA 2R7BA 4EOKA 4NJ3A 2QOIA 3UQFA 4FNWA 3E63A 3Q9XA 4FTJA 4M97A 5EQYA 3TTIA 4YMJA 3NUNA 4HVDA 4IM3A 2PHKA 1PYXA 3OC1A 4IANA 4QP1A 1G5SA 4L3PA 3E88A 4RZWA 5H8EA 1U59A 5FRIA 3H3CA 3TKHA 3G0FA 4DC2A 5IH6A 2QOCA 2F2CB 3IDCA 3OOGA 3VIDA 3DXQA 4WD5A 4GL9A 2H34A 2FSLX 3OT8A 4NCTC 1TKIA 3DJ6A 4I94A 3OTUA 4UZDA 5IQIA 3PG3A 5IQFA 3WF7A 4DLJA 4ACCA 2GQSA 1JSVA 4D4RA 5E8YA 3TIYA 5C4LA 2CJMA 2ITYA 4GT4A 2GS6A 3PLSA 3R83A 5L4QA 4I20A 3AT2A 5D12A 3CQUA 3RNYA 3Q5ZA 2ESMA 2WOTA 4WG3A 3W18A 2VWBA 3NCZA 4BDKA 4CG8A 3ENMA 3ORMA 4FZDB 3G9NA 4FT7A 4R5YA 3QA8A 2C5XA 2C5YA 4TXCA 3QZFA 3VF8A 5KCVA 3U6JA 5CWZA 3OS3A 2PUIA 3L9LA 2IW8A 3R9OA 3MPMA 4DA5A 2XRWA 5B0XA 2W06A 3OZ6A 3JUHA 1GJOA 5HG8A 3F3ZA 2J0MB 4HOKA 4W4WA 3RPYA 3SXRA 5GJDA 2C69A 4AGCA 3ATSA 1KOAA 2I0YA 2AUHA 1U54A 4IH8A 2CKPA 3FBVA 4CEGA 3RK5A 4NL0A 3GQLA 4G5JA 3VN9A 3MV5A 2R3KA 3SW7A 4YJVA 3G6GA 4BCKA 4RJ7A 3UOJA 3NR9A 2BTSA 3VJOA 3WIKA 3ZCLA 4I5MA 5DE2A 1TQPA 4DITA 4DFYA 4FV6A 3II5A 3EYGA 2ZJWA 3DKOA 3HMIA 4PP9A 2H96A 2OIDA 3Q2MA 4YJOA 4U45A 1Y57A 4RLLA 5J8IA 4OBOA 1UU3A 3V8SA 3SC1A 1R0PA 3JVSA 4OTGA 2V7AA 2WO6A 3FLQA 5KMLA 4FKWA 1P2AA 3HMOA 2CGUA 4YNOA 5CAOA 5E8UA 4A06A 5HTIA 4H3QA 4FT3A 2R64A 3UZRA 2RSVA 5CSPA 4IB5A 5ANKA 2XCKA 5CQUA 4LOQA 1HCLA 3VS6A 1E1XA 2XM8A 3M11A 4CFWA 4RX5A 2BRHA 5A6OA 3OCSA 4JNWA 5AAGA 5AP7A 2G01A 4YBKA 3O8TA 4YJUA 3TL8A 1KV2A 2CPKE 3QRIA 3D5XA 2NP8A 4CRSA 3F7WA 3G90X 2B1PA 3IONA 4D2RA 4N6ZA 3UG1A 2Q0NA 2W4OA 3BHUA 5T6KA 5LCJA 5GJFA 3Q6WA 2VN9A 3AC1A 1GZKA 4J96A 3S95A 5E8VA 2VNWA 3I60A 2XNEA 3GU8A 4R3RA 4V0GA 3VS7A 4BDIA 4BIEA 4X0MA 2O64A 4YZBA 3EL7A 2VO0A 2XNBA 2HWOA 4FNYA 4GFOA 4IEBA 4P5QA 3FYKX 5K9IA 5EQPA 4O83A 4RFYA 1U4DA 4MNEB 5L8LA 5HG7A 4QYYA 1H25A 1DS5A 3KRRA 1YXUA 2R3FA 3I0OA 4FF8A 2YEXA 4NZWB 5EH0A 2HAKA 4MVFA 5JRQA 4QP8A 4FGRA 2HXLA 2RFEA 3QUPA 1AQ1A 2PMLX 4M14A 4FV4A 5JQ5A 2UZOA 3DTCA 3AC2A 2WKMA 4DN5A 1BL6A 5ANOA 3U51A 3QWJA 2QD9A 5IEXA 5JH6A 5C9CA 3R0TA 3Q4CA 4NKSA 4YPSA 4O6LA 4DTBA 4FBXA 4K77A 4RIWB 2YLFA 3VUIA 2WMTA 1M2RA 2P0CA 3KRXA 4U80A 3BHTA 3FLSA 4ENYA 2GFCA 4K9YA 2GNIA 4C35A 4AZSA 5IUIA 1I44A 3IOPA 1YVJA 3PTGA 2J2IB 3AT4A 3DXNA 5BPYA 4QMVA 2OK1A 4IFGA 2H9VA 4OUCA 3C5IA 4FSMA 3PIZA 1W0XC 4GT3A 4RSSA 1V1KA 5HBEA 4EC9A 2CHLA 4WIHA 3F3VA 2BHEA 3QTIA 3MI9A 3A8XA 2YERA 3Q4TA 3QZIA 4H1MA 4BDCA 5D10A 5AUWA 2PE1A 5EQEA 3RNIA 2BDFA 3FZOA 2PVMA 1Z57A 3IS5A 3C0IA 4DH8A 3SG8A 4IWPA 4WKQA 5DNRA 3COIA 3RVGA 3OUKA 1X8BA 3N4UA 1B6CB 2Y7JA 4KAOA 4AN2A 5KMKA 4J1RA 3GC9A 3KFAA 4B4LA 3SKCA 3ZZEA 4CNHA 2I0VA 4CRLA 3CCNA 3HL7A 4GVAA 4FKGA 1NVQA 5CT0A 1ND4A 3PZHA 4GMYA 3V6RA 4F08A 4G6NA 3NGAA 3VS3A 4C4FA 2BCJA 4DG2E 5FBOA 5LMAA 5CF6A 4JAIA 2UVZA 2WU7A 3LXLA 2HZNA 3EWHA 2CLXA 2JKOA 2VTOA 4U6RA 4A9RA 1A48A 1J1CA 3BYMA 5AUZA 5J9YA 4A4LA 2YZAA 3NYXA 2CMWA 4CZYB 5J1WA 4P2KA 5IH4A 4EK3A 3DJ5A 4HVSA 4D28A 4NYEA 1JWHA 4FTUA 5FTQA 3HRCA 1YDTE 4F0IA 3KY2A 2ITXA 5KZ0A 2ETMA 1UU9A 3ID6C 2VTNA 5AUYA 4FEWA 3D0EA 4HPTE 3G9LX 3ZUUA 2IZRA 3S4QA 3V5TA 2W17A 5C27A 2UZLA 4F64A 3MPAA 5C4KA 4WO5A 5E92A 1LPUA 3ANQA 1BI7A 3TNIA 1H01A 3MH3A 3NSZA 2CNVA 3VBTA 3UYSA 2OBJA 4TRLA 1KSWA 3U4UA 4JAJA 3C50A 4JRVA 3RPOA 2HZ4A 4MQ2A 5JRSA 1YWNA 5CXHA 4QMZA 4FSQA 1Q8TA 4E6QA 3K3JA 3EFKA 2PZPA 4RRVA 2WQBA 5CYIA 3P4KA 5E91A 3UMXA 4XBUA 3VHKA 4PDYA 4CKRA 3HGKA 4I4EA 4UWCA 3IDBA 3IECA 5DPVA 4O0YA 3ET7A 4JXFA 3OWLA 2R0IA 3R00A 4L6QA 4M84A 4AZVA 2XM9A 4UY9A 4JRNA 2QLQA 3RPRA 3C51A 3K54A 2W9FB 4HCUA 2YFXA 4GRBA 4JQ7A 4TZRA 4XP3A 3ORNA 1H0VA 3BGPA 1R0EA 2XNPA 4E5WA 3ZTXA 4BICA 1BYGA 2ZDTA 3KXMA 4MD8E 5DT0A 4EUTA 1PXKA 3EZVA 2FYSA 3PA5A 2VX1A 3AGLA 3PJ8A 3THBA 4FEVA 3ZU7A 4JBOA 2VX3A 4TY1A 4EOSA 3LFCA 2JDOA 3PUPA 2BR1A 2ZV9A 1MRUA 1ZYCA 4PQNA 2UZVA 2WMWA 2R3NA 3NUPA 4FC0A 3TNHA 4BI2A 1XWSA 2QQ7A 4R1YA 4TYEA 4WSYA 3F5UA 3Q04A 5HO7A 3UPZA 3QQHA 2ZM4A 2OG8A 3MY5A 4I0TA 3MBLA 2UZNA 3MTFA 2F7ZE 5KMMA 4FSTA 2BALA 1H07A 4H3PA 4RIWA 5AIKA 5TF9A 3UIUA 4I6BA 4AGUA 4AWIA 3LZBA 5HTCA 2QOLA 4Y72A 1ZOEA 3CY2A 1J7IA 1IR3A 5I9YA 4FIFA 3P1AA 4XLVA 4WG5A 3SHEA 5EDPA 2HYYA 4GG7A 4ANSA 3RHXA 2PMOX 4BTMA 4FTQA 4EOPA 4UMRA 5K3YA 3TUBA 4Z7GA 2ZM3A 4IDTA 4IZ7A 4G3DA 3GP0A 3LE6A 2J6MA 4L68A 3FMEA 3HEGA 4ZZNA 1SZMA 3RI1A 3W10A 3ZBXA 3FLYA 5GIPE 2EXMA 4FL1A 2YISA 4BIBA 4C58A 3FI4A 3AGMA 4B0GA 1PXNA 2OZAB 4BGQA 1JSTA 5CSWA 5IA4A 3B2TA 3CTQA 5CF4A 3MDYA 5F94A 3E92A 4R77A 2R4BA 4GYIA 5JKGA 3VS1A 3C0GA 2XIZA 1YOJA 2XK7A 3MJ2A 5GJGA 4Z16A 2CNQA 4QNYA 3CGOA 4IWOA 2Y8OA 5CEKA 4F9CA 4P4CA 1XBAA 4O86A 4OAVB 2IVSA 2IZSA 2YCRA 5EKNA 2VWUA 5HI2A 3EYHA 2GNGA 2FB8A 4BDBA 4F09A 2VWXA 1VYWA 5AWMA 2HOGA 3R02A 3KN6A 4X2KA 4CFMA 4EH4A 5FXRA 3UQCA 3MB6A 5HVKA 1RDQE 3EQPA 2BRGA 3ZLYA 2CN5A 2QG7A 2OICA 4O7YA 3ITZA 3Q32A 4UMTA 1GZOA 2XBAA 3HV5A 3BEAA 4QMPA 2ONLC 3FHRA 2PE0A 3OTVA 4W8DA 2Y4IB 4IB3A 3WILA 1SVEA 3SDJA 2W1HA 5HQ0A 2O0UA 5EI6A 3ZO1A 2GQGA 4XNEA 1YHWA 2PVKA 4S33A 2YWVA 1JKSA 3F5XA 4JX7A 4UYNA 3FC1X 2J51A 2R0UA 4XV3A 2A1AB 3UVPA 2QVSE 4F9YA 3HUBA 4YSJA 1MRYA 1J7UA 3MESA 4KS8A 3MIAA 4RJ5A 2V22A 3FPQA 4Z7HA 3RP9A 4I5HA 4CVAA 4F65A 4FSYA 4RIYB 1YHVA 2BZJA 3Q3BA 2X7GA 3UC3A 4IB1A 2BFXA 2GDOA 3Q53A 4XV9A 3SLSA 4BKJA 2C47A 2HY0A 2C6IA 1H1RA 4ANBA 3Q60A 4EK4A 3HLLA 3UMWA 4IWDA 2ZV2A 2OKRA 5C8NA 4OTWA 2QOOA 4MWHA 2SRCA 4PWNA 5ETCA 1L8TA 4XRLA 3HX4A 3ZUTA 3QTUA 4KINA 4PL3A 4TWNA 4YJPA 2XEYA 3EH9A 4DH3A 3OF0A 2B54A 4YNEA 2UZWE 3LAUA 2XP2A 2AC5A 3SA0A 4EOMA 1IG1A 2R3HA 5LQFA 5GINE 1H1PA 3TJDA 2O3PA 1PXLA 4RBLA 2WMAA 1F0QA 5E7RA 1SM2A 5JEBA 3SGCA 3KCFA 4DE4A 4TPTA 1BMKA 4ITHA 3QQLA 1Y6AA 4DEGA 3S00A 3R8PA 4AW0A 3BU6A 4M13A 4PPBA 4FV8A 1H0WA 3GXLA 5JZNA 4QQTA 5A54A 2P4IA 1Z5MA 1WBPA 3QXOA 3PRIA 4FV9A 5AP2A 2VWWA 5TT7A 1GZNA 4AN9A 5M4CA 4FIHA 4GJ3A 5CU4A 3R8ZA 4UEUA 5CF5A 3EJ1A 3KXHA 5EYMA 1M17A 4JJRA 4OTDA 1HCKA 1UA2A 5D41A 2BUJA 3T9IA 3HRFA 4YBJA 2XJ2A 3ZSGA 3UOKA 3FI3A 4D4SA 3VBWA 5ACKA 4FTLA 4BTFA 3VUTA 4IFCA 2YACA 2VD5A 4C4JA 5HE2A 3H9FA 3BWJA 4FE2A 2GMXA 4WNOA 2BRNA 1M2PA 2WELA 3LJ1A 2BVAA 2G1TA 4FYNA 4JDKA 2XK6A 3EN7A 4UXQA 3UPXA 4QPMA 1UNGA 4CZUA 1XH7A 4FKOA 1H28A 2WPAA 2UW4A 4C57A 4ZTQA 3F9NA 4D4VA 4PMTA 3GU7A 4BDDA 5AP6A 1OMWA 3ZEWA 4E6AA 3ZMMA 3BYVA 4GIIA 5E1SA 4AOJA 5M08A 2WTIA 4A7CA 2QO2A 2UVXA 4A4XA 3PDTA 4L00A 4AA5A 1SNXA 4J53A 3QQFA 2XUUA 5AUXA 5FXQA 4S31A 4E73A 4OAUC 2YIRA 1FINA 1ZYSA 2JEDA 4FG7A 2OXYA 5JFWA 3D4QA 3U8WA 3GU6A 4RQKA 1URWA 3PY1A 2UZTA 2VTQA 3DAJA 1YKRA 3MN3A 4KD1A 3I5ZA 2OFUA 4FOBA 3ZONA 2DUVA 2V7OA 4O0RA 4IX5A 4OBPA 4YJTA 2EXEA 2HK5A 2LAVA 1R78A 1U5QA 5C8MA 3BZ3A 4NFNA 1ZY4A 5TOZA 2ITTA 3VUKA 3NIEA 3BWFA 3RM6A 4EOQA 4W9XA 5CEQA 5A4EA 2CDZA 3G33A 3LFBA 3TNWA 3VUDA 4C36A 5I9ZA 3O7LB 3VS0A 3BHVA 3AXWA 2OXDA 5JFVA 1BI8A 2XNGA 4ZMEA 4C4IA 2VTLA 2X7OA 4KWPA 2WD1A 4MK0A 1GY3A 3R30A 4FYOA 3MY0A 3GOKA 4AZEA 3BRBA 5IH5A 3HDNA 1OL2A 3MTLA 4DFNA 4LGGA 4DFZE 3RK7A 2J5EA 3NS9A 4QO9A 4FIEA 2OSCA 4YR8A 4EWHA 5AV4A 3BHYA 3P7CA 4PDOA 2W1IA 1LEWA 3UOHA 4Y95A 2V5QA 4HZRA 1KUTA 2WEVA 3AQVA 3F2NA 3O51A 3DJ7A 4H58A 5KMIA 4Q9ZA 3C13A 3JS2A 5J87A 3RKBA 5FD2A 5FEEA 3VQHA 3ZC6A 4YJQA 3BYUA 3MH2A 4HNIA 4UWBA 3U54A 4O7SA 3OW4A 3I1AA 3UNZA 3TZ7A 4C37A 4GT5A 4OR5A 5CSHA 3PFQA 4EQCA 1ZOGA 3QUEA 4ZLOA 4YGAA 4F63A 2YAAA 4YZDA 4BGHA 2R3IA 4E93A 3RZBA 5M56A 2BZKB 3LXKA 5BYLA 1Z9XA 4QTCA 4C34A 1U46A 4O82A 4K2RA 3QKKA 1Q61A 3H4JA 4H05A 3EQBA 2C6KA 1RE8A 1F5QA 2JIIA 4EOOA 3AT3A 4DEDA 4MBLA 3OCGA 5HD4A 4FIJA 1J3HA 4FNZA 5ICPA 4BDFA 2FSMX 3MH1A 1H1WA 3SAYA 1Q62A 3O96A 3FV8A 3I7BA 5AADA 3GCVA 4IXPA 1O6LA 3OEFX 1NT2A 4KUJA 2WTWA 4APPA 3O8PA 5CX9A 3QWKA 3LFEA 2Z7LA 4S32A 4EH3A 2YA9A 2YDJA 4YP8A 3O71A 3QCXA 4LYNA 4BDAA 1WZYA 4BI0A 3CBLA 3KULB 3MA6A 4R7IA 4YPDA 4BCHA 4ZAUA 3R8MA 4LOPA 4AUAA 4QMLA 4Y46A 4TL0A 2WMBA 5JSMA 5KO1A 5M09A 2XKCA 3W2QA 4D4YA 4DBNA 3OXTA 2I40A 3C7QA 5AR3A 4EH5A 3NYVA 4J8NA 3TDWA 3TZMA 2W7XA 4QMUA 3V8WA 4H36A 2X39A 3QRJA 5F95A 4YTFA 2GSFA 3WZEA 1IASA 2WTDA 1KOBA 2W5BA 4E3CA 2WTCA 3FZPA 3NRMA 4U5JA 2YCSA 2X4FA 3CJGA 4CD0A 2HWPA 1UWHA 3C4FA 3D5VA 4BYJA 2B52A 3DFAA 2XKDA 3D2KA 4AZTA 4F4PA 2ITZA 3PLAE 4WUNA 4IHPA 2RFNA 2I0HA 1OBDA 4KRCA 4NIFA 4I4FA 1V0BA 5DR9A 3W1FA 3QA0A 4KS7A 2UW9A 3KF4A 4AN3A 4EONA 4TWOA 4EZ7A 2YZLA 4O21A 4FVQA 4J99A 1PKGA 5AP1A 4EOJA 2F9GA 3R7UA 5FTOA 1PMNA 5FUTA 5CNNA 3D5UA 5LVNA 1IA9A 4OTFA 4DEHA 3FKOA 3CIKA 4TW9A 5CVHA 3UVRA 4EOIA 1GZ8A 4ZZOA 2RL5A 3W8QA 4CV8A 2PMIA 4O7NA 2UW0A 3DS6A 4IC8A 5FM2A 4CMTA 2PVNA 2VTSA 4TYJA 4YHFA 2PVFA 2CKEA 3T3UA 4U97A 2B4SB 4J71A 4X2NA 4R3PA 1NVSA 5AJQA 3GENA 4F0GA 4J98A 1XR1A 2QU6A 3FLWA 3R8VA 3O7LD 2PZYA 4ACMA 4TNBA 2PVYA 4FTIA 4QMYA 3OHTA 5M4UA 2C5VA 2QOHA 3G6HA 3KU2A 4CMUA 4ITJA 2W05A 3CGFA 1QCFA 3LFFA 4FV3A 3QCYA 4HYHA 4WSQA 3TV7A 5GHVA 1OKWA 3C4EA 3OWPA 4CT2A 4LRJA 3TZ9A 1SVGA 4O27B 2CN8A 3EN5A 3MA3A 4K11A 3G2FA 4WG4A 5C03A 3SW4A 4C2WA 2WFYA 3HKOA 4EQUA 5A3XA 4F1OA 3JVRA 4RX7A 3IGGA 2A0CX 3I79A 3CKXA 3V5PA 4GU6A 1H1SA 1WBNA 1OVEA 1QPDA 3BGZA 4G34A 3SXSA 2WNTA 1WCCA 5AAEA 3BQCA 5HNBA 4WUAA 4HYIA 3OCBA 3PE1A 4IE9A 4MBJA 3NNXA 3R71A 4RIOA 4MH7A 3HECA 4O0VA 2XCHA 1W7HA 3LCDA 4ZZMA 2IW6A 4CQEA 2WMSA 4K1BA 2G2HA 3K3IA 2IVVA 3WIGA 4FZ6A 3CR0A 4EC8A 4EH2A 3IKAA 3D7TB 4PMPA 4O7RA 1DI9A 3LKMA 3OMVA 3RINA 3QYWA 4L46A 3KB7A 2YHVA 3CS9A 3F5PA 3DK7A 5AP5A 4DFBA 5LJJA 4BKYA 4G2FA 3D5WA 4QMWA 3KXGA 2VGPA 4TYHB 4D9TA 2QOKA 1YWRA 3A7FA 3DTWA 3OY1A 5E8TA 5HBJA 3O8UA 4XG7A 4RIXA 2GHMA 5HLNA 1XBCA 4FNXA 4E4MA 2OO8X 2C68A 3A7GA 4JR7A 4G9CA 3I5NA 4XV2A 4RVTA 3LLTA 3CEKA 4JL9A 4RQVA 5HCZA 4ID7A 5AP3A 3VBXA 3WYXA 5IU2A 2W1EA 2OJGA 4FGBA 5KKRB 4ZXTA 4MNFA 3H9OA 1FOTA 3ANRA 4FODA 4X2GA 5AA9A 2PULA 4I6QA 4EZ5A 4LRKA 3TDVA 2IG7A 1P4OA 4FTMA 1GNGA 4DTAA 2JC6A 2NRYA 5FDPA 4U8ZA 3WE8A 3NW5A 4D1SA 2C1AA 2YDKA 2LGCA 3ZHPC 5DG5A 4PMSA 4G5PA 3CLYA 4Y73A 5CTPA 4ZS0A 4ZJIA 5DEWA 2W5AA 1M7QA 1REJA 2RF9A 4RMZA 5A14A 3BE2A 4AFEA 2WTKC 1DAWA 2BKZA 5ANDA 2ZDUA 5KZIA 1W82A 3TTJA 4RFMA 2REIA 1ZYLA 1V0OA 5AV2A 3LFNA 4M7IA 3O2MA 4FUYA 2A2AA 1ZWSA 2RFSA 1YDSE 4I93A 4XMOA 3L8PA 3OVVA 2IW9A 4YURA 4BDJA 4YLJA 3FXZA 2R3GA 4NW5A 4I41A 5KBQA 3IPHA 2X8IA 4KIKB 3VVHA 4E6CA 3LHJA 3MFUA 3E8EA 3SXFA 4B8LA 3NWWA 5BMMA 3U9CA 5FP5A 1Q3DA 2CCIA 5L6PA 2ITQA 2XKEA 3GI3A 1Q4LA 2VZ6A 3EQGA 3QQJA 2GFSA 3EQDA 2YIQA 3PY3A 5CASA 4PPAA 3R8UA 4BHZA 5IA3A 1CKIA 4Q2AA 5I4NA 4FX3A 4ZTNA 3HZTA 4FSZA 2QG5A 5IPJA 2CNUA 3CQEA 2CLQA 4X3FB 2XMYA 3PXFA 1ZMUA 3R1YA 1O6KA 3OOMA 3POZA 2ITUA 2VTIA 5EDRA 4BY9E 4XG8A 4L67A 5BYZA 2ZOQA 3E62A 2Z60A 3F88A 3KMWA 4ZOGA 4GW8A 4H39A 2HZ0A 4MF1A 3MVJA 2OZOA 3KQ7A 4FEQA 4FIIA 1RQQA 1YOLA 3FJQE 4FKQA 4JQEA 4KSQA 3WF8A 3BLRA 3LMIA 5KX8A 4FKJA 3VBYA 2UVYA 5HO8A 4B6LA 4C7TA 4BWXA 5IQGA 1LR4A 2WQOA 4XG3A 3TACA 3RHKA 3ZLSA 3DKGA 4FKTA 3NNVA 3U9NA 4CYIA 4DGLC 4AXAA 4D5KA 3P7AA 4BKZA 1PMUA 1T45A 2CGVA 2ZMDA 4DGGA 2X6DA 2YDIA 1UU8A 4BBEA 4R1VA 3HMNA 3R1NA 4IADA 5LVPA 2W5HA 4WNPA 4YLKA 5BX0A 2XK3A 1W83A 3QC4A 5B2LA 5TR6A 4QP4A 2WMVA 5IDNA 4I0RA 3D7TA 4JT3A 1OGUA 2QNJA 3QTRA 1YWVA 5JMSA 2OU7A 2QLUA 2H8HA 4NWMA 1E9HA 5E8WA 4F1MA 4UX9A 4X6RA 2BTRA 2PVJA 4JDIA 3OT3A 3QTQA 4PNKA 4TYHA 4BHNA 3TNQB 5BUIA 1OM1A 3QALE 4IMYA 4GUEA 4JG6A 5JK3A 2G9XA 4CG9A 5JFSA 5F4NA 3DDPA 1H08A 2FA2A 3WZDA 4GUBA 1W98A 3ZRKA 4ANMA 4AA4A 4G16A 3BI6A 5HVJA 4FTNA 2JBPA 3GFWA 4F7JA 4C02A 3U6IA 4BWKA 2HELA 5D1JA 5DT3A 5AV0A 3VUGA 4C3FA 3EN9A 4MEDA 3DLZA 4UV0A 1BLXA 1BX6A 5IF1A 4FVRA 1JAMA 1CSNA 2ERKA 2W1GA 4N6YA 4KA3A 1PKDA 5H9BA 2W0JA 2OWBA 3D9VA 2GPHA 3E8NA 4OW8A 3VJNA 3SOCA 4JG8A 3PJ2A 3VWAA 2GU8A 4AGDA 4QP7A 4BCFA 5KMNA 1A9UA 4LUDA 3DBQA 3LM0A 3FMHA 5BMSA 3EL8A 4G1WA 3MH0A 2WMXA 3I6WA 4O0WA 5DN3A 3ZFYA 4D2TA 2BDWA 4TN6A 3UDBA 3BU3A 3QLGA 1FVRA 4FMQA 4NEUA 2B53A 2BHHA 3P0MA 4BL1A 2UZEA 3A8WA 2BIYA 4CZTA 1ZY5A 4IZ5A 5AV3A 3QQGA 3H9RA 3FXWA 4MF0A 4JIKA 4Q5HA 3QCQA 3Q4UA 4XOZA 2C6DA 3CXWA 4ANQA 3IK3A 2EWAA 2OH0E 1M7NA 2QR7A 4CLIA 5BNJA 4FSNA 3LFDA 3QAME 1YXVA 5J95A 4QYHA 4LMNA 5IISA 5I9UA 4BCNA 4NW6A 2WQMA 2HW7A 4PF4A 3R7VA 4RPVA 4RWLA 1LUFA 4ACDA 5HORA 5KHWA 2C6EA 3FYJX 3HMMA 3LMGA 3QCSA 4AOIA 3ZFMA 4EH8A 5M06A 4CFNA 3BLHA 4HGSA 4NM7A 3LIJA 5HD7A 4IVAA 4EHZA 2XF0A 3V01A 2JDRA 4Y8DA 5FTGA 3R2YA 4RX9A 3KL8A 3F3UA 2C1BA 3AOXA 1CM8A 3QHRA 2HIWA 5B7VA 5KMJA 4NK9A 4OTRA 3RAIA 3WZJA 2ZVAA 3RPVA 3LM5A 3NUAA 4HGTA 5M07A 2WB8A 5FBNC 5GIOE 3DV3A 3AG9A 4G3FA
chains in the Genus database with same CATH superfamily
4M15A 4BDGA 3QTZA 3DPKA 4AW1A 1Y6BA 3R1QA 4EJNA 3TKIA 1CKJA 4QPAA 1YXXA 3BE9A 3R22A 4C33A 5DRDA 4R3CA 3BV3A 1H26A 5H2UA 4MNEA 1PHKA 4E7WA 5LVOA 4R7HA 2GCDA 3ZO4A 1OIQA 4D2SA 2GS2A 1G8AA 3EHAA 4FSWA 1OIRA 2QHMA 3O50A 4C38A 1CDKA 2B55A 1G8SA 3MVHA 4Y83A 3AD4A 5DBXA 3LFSA 3PVGA 4EL9A 3DK6A 3VO3A 3RCDA 5IEYA 4ANOA 5JGBA 1PXMA 3BELA 5C26A 3PXYA 4A9SA 5LOHA 1K2PA 3LJ0A 2Z2WA 3ZXZA 3C5UA 3E5AA 5E4HA 3QZGA 2OJFE 4BCJA 3UP2A 1WFCA 4QNAA 4ERWA 3GUBA 2JKKA 3P08A 3VW8A 3EFJA 2VWIA 3TG1A 3E8DA 1LEZA 4BZOA 3POOA 2OFVA 2X6EA 3PJ3A 4NKAA 1JOWB 3SQQA 3A60A 1PYEA 3T3VA 2JDVA 4C3PA 4FEUA 4PDPA 3H0ZA 2F4JA 2JGZA 4NTTA 3C4XA 4FZAB 3I4BA 3Q5IA 4W8EA 3MY1A 1IAJA 4AFJA 2A19B 4BN1A 2OIQA 5EOLA 5HNGA 2VTHA 2VWZA 3PZEA 3ZDIA 1W84A 5BYYA 3MVMA 4BB4A 4O22A 3IG7A 5HE3A 4Z9LA 2O5KA 2XBJA 1ZYDA 3WZKA 3P5JC 3EB0A 4WT6A 1VJYA 4BCPA 4USDA 4EYJA 4JI9A 1FGIA 3MB7A 3TM0A 3FUPA 3DBCA 4YUQA 5AM7A 1PF8A 1ZRZA 4WBBB 2I1MA 3P78A 4D58A 2HXQA 5HO6A 2WTVA 3ODYX 2X7FA 4I0SA 1FMOE 1ERKA 3FY0A 3GU5A 1XO2B 5J9LA 4IVDA 2F2UA 3GQIA 2R3JA 3U55A 4IW0A 5IQCA 3V8TA 3VRYA 3R63A 3OCTA 4DG0E 3BV2A 4PUZA 5CANA 1XHAA 2PSQA 3JY0A 4LOOA 2WIHA 4FTOA 2XNNA 3DK3A 4DEEA 4OGRA 2YAKA 4UN0C 4L42A 3W2OA 3B8QA 2X8EA 3FAAA 4LGDA 3E3BX 2GS7A 4QMTA 3ULIA 4HNFA 4CFVA 2B9HA 2FSTX 2QODA 5BVEA 3V5QA 4C2VA 1XH6A 4F1TA 5M53A 3OBJA 2YM8A 4IAIA 4OTPA 1K3AA 4DCEA 5DH3A 4QP2A 4AACA 4B7TA 3HAVA 4X7QA 2BMCA 1URCA 2R3MA 2PZIA 2VWVA 3FL5A 4P5ZA 5DR6A 5AR5A 2YABA 3RWPA 1PRYA 4F9WA 3ZLXA 3LQ5A 1R3CA 4FR4A 1XBBA 2FO0A 3VUMA 2E2BA 3PVBA 4AP7A 3ETAA 4ZS4A 4K0YA 4W9WA 4KSPA 5CNOA 4BDHA 4YTIA 5GNKA 5FGKA 2XAMA 4PPCA 3WE4A 4LL5A 5DFPA 4G17A 5KMOA 2BDJA 2DWBA 3TN8A 4EBVA 4MD7E 5HTBA 4RJ8A 2UZDA 3TI1A 4KRDA 4YSMA 4S34A 4MWIA 4IVBA 4Q5EA 4QQJA 4YLLA 5K4IA 3KVXA 4AG8A 4XH6A 3W2PA 3G51A 1O9UA 2QKRA 3QFVA 3PXQA 4D0WA 4FV5A 4L9IA 4BVUA 3FKLA 3HA6A 3DKCA 2PK9A 4LRMA 2XAOA 4DEBA 1YXTA 2JAMA 3IW6A 5DOSA 3F61A 4ZIMA 2IN6A 4AXEA 2GTNA 3FQSA 3GVUA 4YZNA 3R9HA 4MD9E 2H6DA 5CU3A 4BWPA 1H00A 4ASEA 1ZZ2A 3HP5A 2I0EA 3BU5A 2YWPA 4RWJA 1U5RA 4MXOA 3TUCA 4RJ6A 3RAWA 3FSKA 2Z8CA 4HYSA 4JG7A 2Z7RA 3RCJA 4EHVA 5A4TA 5CF8A 3R28A 2XVDA 4M12A 3ZBFA 1NXKA 3LXNA 4K6ZA 4QMSA 3KVWA 2G2FA 4DFUA 3RALA 4FK3A 4YHTA 4O4CA 2C6MA 3P7BA 5CU0A 2VTJA 4CYJA 3VUHA 2HY81 2PE2A 2BAJA 4BI1A 3CY3A 2I7QA 2B7AA 4EJ7A 2UZBA 3DCVA 4N0SA 4B8MA 3V6SA 4U9AA 2BPMA 2XNMA 3IW5A 4D55A 4YZ9A 4TWCA 5ANIA 1ZOHA 1EH4A 2YCQA 3VW6A 3AC4A 4EH6A 4EYMA 1IAHA 2VNYA 2VTTA 2X2KA 3O17A 4MAOA 4FKUA 2Y0AA 3CPBA 2GHLA 4RWIA 4IAFA 3QLFA 2ETRA 4QTDA 3CSVA 3SVVA 4NCTA 2PYWA 2C3KA 2P2IA 5JQ8A 3QXPA 3BEGA 4KKHA 4UALA 5KE0A 4O2ZA 2E9UA 4WNMA 4DYMA 1B39A 3U4WA 4ZTMA 3S1HA 3UO4A 4IB0A 4WBOA 3A2CA 4OBQA 2NYAA 3BL9A 5CU6A 5HESA 5CS6A 2A4LA 1XMMA 2OZAA 4IZAA 2OH4A 1SNUA 4L52A 4DGMA 5HLPA 5HG9A 5BVNA 5JGAA 5M51A 2O65A 3COMA 4GFMA 4QMOA 4IVCA 5HZNA 5EG3A 3NUSA 3UZTA 3VQUA 5HLWA 5LMBA 3ZZWA 4K8AA 4LV5A 3ZFXA 2KTYA 5LMKA 2O63A 4C3RA 4E5AX 2R9SA 5CALA 2X2LA 2IVUA 3F69A 4MXCA 4EWQA 5DMZA 1A06A 1FQ1B 1I09A 4USFA 2RFDA 4OTQA 2PL0A 4ALVA 4FUXA 1GIHA 4AF3A 5CXZA 2GNHA 2YLEA 1GIJA 3UIMA 3UTOA 1K9AA 4EHGA 4YC6A 3KREA 2E9NA 5FXSA 4Q9SA 3V51A 4LQMA 2R3RA 2J0JA 2WAJA 2JAVA 4ZP5A 3BBTB 3DKFA 3S3IA 4PV0A 4PP7A 3IW7A 5E9EA 4RA4A 4DFLA 2AC3A 5EW8A 4X6QC 1OUYA 1XH4A 3KMMA 3RPSA 4XLIA 3C9WA 4FK6A 3ZRLA 2IVTA 1PXIA 3DBFA 5CI7A 4DF3A 2WEIA 5FLFA 4DHFA 4YTCA 1W8CA 3OP5A 2PZRA 2FGIA 3PXKA 4QYGA 4D0XA 3EZRA 3COHA 4FKIA 4F99A 4C0TA 4JLCA 4NFMA 2FVDA 4FT9A 3BYSA 4KIQA 3DT1A 2EB3A 5IUGA 5EYKA 3GEQA 3VS4A 4U41A 3VRZA 5LXMA 3CD3A 2BAQA 3AD6A 1LP4A 3K2LA 4A07A 3BQRA 2W9ZB 4RIYA 3GC0A 1TQMA 4NSTA 5CZHA 4ALWA 2CGWA 4QQ5A 1W2DA 2NO3A 4TKSA 1ZZLA 4BCOA 4JBPA 2HCKA 3UODA 5K0KA 4F7SA 4O7VA 4CMOA 2X4ZA 2WIPA 4EH7A 5JGDA 4R7BA 2J9MA 3PYYA 4PDSA 2X0QA 3TV6A 5KUPA 3IGOA 2JD5A 3F3WA 4FV7A 3OW3A 5T68A 3RZFA 4FIGA 2P33A 5F1ZA 4M3QA 1OL5A 2PY3A 3EKNA 4FL3A 3HNGA 2J7TA 3PJ1A 4GU9A 1XMLA 3O5AA 3UC4A 4O4BB 2PUPA 4FZ7A 4CFXA 3FZRA 1Y91A 1ZAOA 3UVQA 4U79A 3FPMA 4I6HA 4U3ZA 5EDQA 4FG9A 3W16A 4ERKA 4ZSAA 5IUHA 3QTSA 4RC2A 5HX8A 1P5EA 3IO7A 3FEGA 3EMGA 3S0OA 1KWPA 2C30A 4M0ZA 3DXPA 4U0IA 2IF8A 3FLNC 4BBMA 1M52A 2UV2A 4BYIA 4NJDA 3QGWA 4DEIA 4TNDA 3ZSHA 3NYNA 4RGJA 3NAXA 3PE2A 3R7EA 4L43A 5K5NA 3W0PA 4RX8A 4FEXA 2W1ZA 4RVMA 4IZYA 5L6WL 5AUTA 5K0XA 3PVWA 3BKBA 3E3PA 2JIUA 3KXNA 4QP9A 1BL7A 4QYFA 3FQHA 3AKLA 5EOBA 3LFAA 3TWJA 5FQDC 3KRWA 2R3OA 3D15A 3QTWA 3UG2A 3ZLWA 4C59A 3ZM4A 5DR2A 2VUWA 4V04A 2VTRA 3PXZA 2QI8A 5EHOA 1UNLA 2C4GA 3EQIA 3NZ0A 5LARA 3ZS5A 3FI2A 1STCE 2FUMA 2HZIA 5EI8A 1E1VA 3UZPA 3Q9WA 3NVMB 4J8MA 1M2QA 1XH9A 4ZJJA 5DA3A 2XH5A 3VONA 2UZUE 4E20A 4BIDA 4DAWA 4M8TA 4EOLA 4AW2A 5A6NA 3ROCA 1JKTA 5AR7A 3G5DA 2XARA 1FGKA 1SYKA 3FLZA 2J0IA 2XANA 2Y4PA 4XEYA 4G6LA 5CVFA 4Y85A 5J1VA 3L9MA 5TE0A 2R3LA 3V5WA 4GFGA 5J79A 5FWKK 4IWQA 3W8LA 5M57A 1KE9A 4BC6A 3HP2A 2CKQA 1H4LA 2GNLA 4C4HA 5HVYA 5HGIA 4U81A 5AEPA 4UYAA 5ETAA 3QL8A 3EQRA 4O0UA 4A9YA 3MWUA 4HCVA 5EM7A 5DT4A 3Q9ZA 5KKRC 3VULA 4BCIA 5TO8A 3GCQA 1H24A 4KABA 3LMHA 4BF2A 2JIVA 1FVVA 2W1CA 2JFLA 4CFUA 5HG5A 5EHLA 1BUHA 1Q8WA 5DWRA 2OJJA 3OXZA 2QO9A 3MSSA 3JR1A 4AAAA 3E64A 2VX0A 2WOUA 1L3RE 5FP6A 4ZLYA 4WRGA 3OFMA 3L8XA 1OL7A 1PMVA 3LFQA 4IJ9A 3MPTA 4HCTA 4PMMA 2X9EA 5DIAA 5HOAA 2R5TA 2BKKA 4DHIB 4UMQA 1RW8A 2W96B 3EFLA 4IIRA 5CLPA 5C1QB 2ITWA 4IM0A 4UWYA 3L1SA 2W4KA 1SVHA 3L8SA 3CTHA 4B99A 5ANJA 3GU4A 4GCJA 1YRPA 1R39A 4P90A 3FKNA 3DNEA 4L3LA 4G6OA 5H3QA 4DH5A 1OL6A 1QPJA 4FTAA 4JQ8A 4GK3A 3KXXA 1H8FA 4GK4A 5BVKA 3PVUA 1KE7A 3HV6A 3LW0A 3FMKA 4N70A 4O0TA 4DEAA 4F70A 3M42A 4V05A 2WMRA 2X0PA 1Q8ZA 3FMDA 2XS0A 2VGOA 3LQ8A 3KMUA 3O0GA 4IAKA 2EUFB 4J52A 3CKWA 2IO6A 4F7NA 4QPSA 5KNJA 2GQRA 3KGAA 1UU7A 1HOWA 3LCSA 1WBWA 3MFTA 3QBNA 2NNWB 4E4NA 4FTRA 4RLKA 3TIZA 2JITA 4FV2A 2XIKA 1J91A 2EB2A 4O7TA 5AFVA 4HVIA 3GCUA 2WQEA 3RM7A 3PY0A 3TNPC 2XK9A 5CVGA 1J1BA 5I0BA 5J5SA 5D7VA 5CU2A 2CSNA 2O2UA 5F20A 3BIZA 3ZXTA 3C0HA 2C3JA 2NRUA 3WF6A 1WBOA 1WBTA 3E8CA 5DEYA 3A7HA 3NAYA 3UO5A 2J4ZA 1JVPP 2W1DA 4X3JA 4XHKB 3KXZA 4P7EA 1APME 5LWMA 2YM5A 4MTAA 3A4PA 3Q9YA 1ATPE 3KULA 5EM8A 4CV9A 4D2WA 4ALUA 1VR2A 1IA8A 2C3LA 1OPJA 3FMJA 4C62A 5A46A 2VTAA 3ZC5A 4RJ3A 4RC4A 5JZJA 4JDHA 3KN5A 4IQ6A 4ASDA 2EVAA 5L8JA 3KRJA 5LCKA 4DBXA 4KKEA 5F9EA 4XCUA 5DYJA 4FKVA 4LUEA 4PRJA 2C6LA 4ONAA 3A4OX 2IJMA 3HV3A 3QRUA 5CQWA 2E9PA 2QHNA 2WU6A 3ATTA 2IZTA 3OROA 2ACXA 4IJPA 4F78A 3DQXA 4IC7A 5DRBA 4AS0A 5LMKC 1T46A 4K18A 3P79A 3KK9A 4KBAA 2UW6A 1PY5A 3DGKA 3LCTA 4AT5A 5B2KA 3SX9A 1B38A 2X1NA 5FDXA 4DT8A 5AMNA 1G8JA 4BCMA 5JT2A 4TYIA 5AAFA 4MBIA 3RGFA 4L7SA 3C4WA 3CC6A 2Y4IC 3PSCA 5K5XA 4C4GA 4GKHA 5CSXA 2YM4A 5HEZA 3KCKA 4IAZA 3H0YA 2VO3A 3VBVA 4EK5A 5L2WA 3QD0A 5IMXA 4EH9A 2UUEA 4NUSA 4ASZA 3DU8A 4I5PA 1NA7A 5CAVA 2XEZA 5E1EA 4AW5A 1GIIA 5EYDA 3VC4A 3QHWA 4Z3VA 3PA3A 4CKJA 2AYPA 3WBLA 3QRKA 3WOWA 4YZCA 4MXZA 3ZH8A 3PSBA 3ZYAA 5CAUA 2ZYBA 3MYGA 4O2PA 5BVOA 1WBVA 3C4ZA 3ORIA 4F9BA 3OD6X 4FL2A 2IWIA 4O84A 3R6XA 3M2WA 4FZFB 1S9IA 2GTMA 4I6FA 2X2MA 3FZ1A 4HGEA 2R7IA 3WARA 4U42A 3QX4A 2OXXA 5HCXA 1KE8A 3OUNB 3I6UA 3MVLA 2F7EE 4X21A 5E8ZA 4RZVA 2RGPA 1XJDA 2ONLA 3DBDA 4RFZA 4R6VA 2C0TA 4ZEGA 3LOKA 2QO7A 1FBNA 3GT8A 3IOKA 1NVRA 3AC8A 1MQBA 4O6EA 1WVWA 4O7LA 3EN4A 4L53A 5CEOA 2J0KA 2WMUA 3R2BA 4RT7A 5IG1A 3U6HA 3A7IA 4JS8A 4L3JA 5L3AA 2XYNA 3E7OA 2WHBA 3QRTA 5IQBA 3LJ2A 2C5OA 3R01A 3UOLA 5IQAA 2B9IA 1AD5A 4ACHA 1KE5A 3E93A 3F7ZA 4DCAA 1MRVA 4FKPA 3BPRA 5EM6A 4BFMA 4H3BA 4U40A 3NVKI 4ANLA 4AZFA 5HU9A 2CKOA 3O23A 2B0QA 4EQMA 5L2QA 5L8KA 4PL4A 3BYOA 4E5BA 3BLAA 2BRBA 5HE1A 2KULA 4HW7A 3AMYA 2J50A 4LGHA 4QMXA 3UIBA 3QZHA 5J7BA 2PUNA 2X8DA 3GOPA 4FT5A 1QMZA 2XYUA 2GNJA 4AT3A 1UV5A 3AD5A 2DQ7X 3F2RA 5CENA 2JBOA 3JYAA 4HZSA 2UW5A 2VV9A 3GC8A 4S2ZA 2ITPA 3ORKA 4GEOA 5CAPA 3PSDA 4AX8A 1P4FA 3PP1A 2ETKA 3ORTA 2JFMA 4FKRA 4PNIA 4N4SA 5IA1A 2PU8A 3HRBA 4CGAA 5DHJA 5HKMA 3W33A 3VHEA 3WF9A 5A9UA 4EZ3A 3KRLA 3D94A 1JKKA 1FPUA 1OUKA 2Y9QA 4LM5A 1WVYA 2F57A 2ZV8A 1ZARA 4I1ZA 3FZTA 4H1JA 4YTHA 5JN2A 2J0LA 3Q6UA 3HV7A 4GJ2A 4ARKA 3NW6A 4AXCA 5AX9A 4EBWA 3MIYA 3EIDA 4FT0A 2YIXA 3W0MA 4PY1A 3AC3A 4NM3A 4CCUA 3DAEA 3R7OA 4CTBA 4HGLA 3NNUA 1REKA 4M67A 1MQ4A 3UGCA 5BUEA 5HX6A 2PWLA 4CFFA 2ITOA 1XH8A 1SMHA 5BVFA 3OXIA 3P5KA 1H1QA 4D9UA 2JDTA 2YM6A 4Z55A 3L9PA 3UDZA 4GV1A 2QOBA 2P3GX 5ITAA 4LG4A 4XX9A 3CQWA 1ZMVA 1JQHA 4UMPA 1G3NA 3ZSIA 3TZ8A 4MYGA 3GB2A 3RJCA 1H27A 1O6YA 3A99A 3QYZA 4KIKA 1QL6A 3EQCA 4YO6A 2ZMCA 1YQJA 1TQIA 2VWYA 3DDQA 4CLJA 5FEDA 3GBZA 3KKVA 4YC8A 4ZMFA 3CPCA 3QQUA 3R9DA 3RMFA 2F49A 3GCPA 3ERKA 3HVCA 1FVTA 4WHZA 3SRVB 2IPXA 4WA9A 3Q96A 2J5FA 5AX3A 2EU9A 4L01A 2ZAZA 2X81A 4X2JA 1Q3WA 3R21A 4O4DA 2X0OA 2QKWB 4X3FA 1DM2A 5E8SA 2GNFA 3DZOA 3RWQA 4QMNA 5IDPA 3D7ZA 4OTHA 3NEWA 4ZY5A 4OTIA 2QC6A 3QF9A 4YJSA 2WQNA 4E6DA 5G1XA 3UBDA 4FSRA 4GG5A 4YO4A 4O1PA 5DVRA 4QMMA 4KKGA 3A7JA 3RAHA 4DDGA 3SV0A 3QKMA 3F66A 3R04A 1YW2A 3G15A 1VZOA 3EQHA 4U7ZA 4APCA 1QPEA 2XKFA 2YJRA 3NUXA 4DLIA 2YIYA 4M68A 1YI3A 4QT1A 3V04A 3DQWA 4FKSA 1NW1A 4E1ZA 4J95A 3PIYA 3GGFA 4XYFA 4USEA 5E90A 3ZUVA 2OIBA 4E4XA 3DB6A 3N9XA 4GKIA 1JBPE 5CZIA 3NYOA 2YCFA 2IZUA 3QTXA 4DH1A 3TKUA 1IEPA 1OZ1A 3E7VA 1CMKE 2RIOA 4S30A 5B2MA 3FWQA 4TT7A 1XH5A 1OIUA 2DYLA 3L9NA 4G3EA 2QOFA 4WNKA 4MHAA 4YU2A 2W1FA 4ZK5A 4F6WA 3A61A 3KA0A 4JDJA 3V5JA 3ORPA 3AC5A 4D2PA 4DG3E 5CEPA 2W99B 3CD8A 3ORLA 4FA2A 1OPLA 4AXFA 3WZUA 4JR3A 2ZB0A 4UZHA 4EHEA 4DHJA 2ITNA 3WYYA 3FDNA 4AA0A 4CTCA 5HICA 2QU5A 3OBGA 4AAYA 4M0YA 3DNDA 2OF4A 1DAYA 3BX5A 3NDMA 2Q83A 4FOCA 2EXCX 2Y6OA 2OGVA 4Y5QA 2G15A 3TMOA 2B9JA 2F7XE 3NX8A 3A62A 5CAQA 1MUOA 1JNKA 4I24A 3PWYA 5I9WA 4QQCA 2B9FA 2ZM1A 5EW3A 4O7WA 5FEQA 3W0QA 4YZMA 3ORZA 4FV0A 5L6OA 4KIOA 1JSUA 1PXPA 4FICA 1V0PA 4YJNA 5J9ZA 2OF2A 3JPVA 5HIDA 2Z7QA 4ZJVA 3Q52A 3VBQA 3UDTA 3BLQA 4ZSEA 3PRFA 2X9FA 4I22A 4EUUA 4PTEA 5ANGA 4BCQA 4ZSLA 3PIXA 1WBSA 4GK2A 2XK4A 3R1SA 2C3IB 3H10A 4AZWA 3PWDA 3FXXA 4ANNA 4AT4A 4K33A 3F2AA 4LFIA 4BZDA 5LWNA 2WTJA 4XP0A 5FG8A 4ENXA 1YOMA 2Y6MA 3OG7A 4GVJA 2E9OA 1PXJA 4XS2A 3R8LA 4BZNA 1Q99A 2XRUA 3AMAA 4U3YA 2WTKB 5CI6A 4FI1A 1G8KA 5IA5A 2XA4A 4XP2A 2PVLA 3I7CA 3N51A 4IAYA 3R7YA 4W4VA 3REPA 3TXOA 1OL1A 2YITA 4G3CA 3DB8A 3NIZA 1YI6A 2DS1A 2C6TA 4IX6A 5H8GA 4AGWA 4BCGA 5M55A 4HVHA 2FSOX 3T8OA 4NT4A 3I81A 4XG9A 5JFXA 1OGYA 3QD2B 3UNJA 5IZFA 5AUVA 4U43A 3V5LA 2BIKB 3PP0A 2RG6A 4BDEA 4YJRA 3LCOA 1UWJA 2OI4X 2WZJA 2XB7A 3SRVA 3KEXA 5AIRA 4DHZA 3NMUF 2E9VA 2UW8A 3NFFB 5HE0A 2V62A 4FSUA 5EM5A 2VAGA 2J90A 3V3VA 1PJKA 2JKMA 4O38A 3FE3A 2JLDA 5A4LA 4JBVA 3MGYA 5I3RA 4BR3A 3N4VA 1ZMWA 5L2TA 1IRKA 2FH9A 3D83A 1YHSA 3RTPA 4DT9A 3FSFA 3ALNA 4A9UA 3W2RA 5C01A 4B9DA 4O91A 3E87A 3SG9A 3B2WA 4KBKA 4UB7A 2V55A 2OJIA 2PVHA 1CTPE 2JDSA 3F5GA 4WOVA 4G3GA 3D14A 4XG6A 5D11A 5ETFA 4EKKA 4I3ZA 3ACJA 5CEMA 3DLSA 4TYGA 4X2FA 3ZOSA 4RA5A 4PX6A 1TVOA 2ZB1A 3B8RA 3IW4A 1AGWA 4ZTHA 5TKDA 3R9NA 4EK8A 4L45A 3EFWA 2JKQA 4IX3A 4MCVA 4IX4A 3OEZA 3IDPA 5ETIA 5IQDA 5HNIX 4M66A 1KV1A 1UKHA 2PZ5A 2GHGA 2VO6A 3RAKA 1Q8YA 2QURA 4NU1A 4DFXE 2YM7A 4OT6A 4JBQA 4U44A 5I9VA 1Q41A 1XQZA 5IA0A 5L2SA 2XZSA 3DA6A 3LVPA 4I92A 2PMNX 3PXRA 4QTAA 3TV4A 2VTPA 3W32A 3WF5A 4BTKA 3ELJA 3NLBA 3F6XA 5IKWA 5BVWA 4XBRA 4D2VA 1Q97A 4EI4A 5AR2A 5G6VA 1GOLA 4G31A 4QYEA 4OLIA 1J7LA 1MP8A 4QP6A 4UBAA 5HHWA 4CKIA 5ANEA 4F6UA 3FC2A 1RJBA 5H8BA 3FMLA 4II5A 4L8MA 3RK9A 5BVDA 3Q4ZA 4DTKA 1WVXA 4O1OA 5EI2A 4JOAA 4M69B 4KB8A 4JIAA 5CSVA 5BUJA 3GNIB 2PUUA 4R78A 1Y8GA 3KC3A 4O96A 5M44A 5AR8A 1OKYA 3P86A 1UVRA 3VS2A 4EORA 3LQ3A 3G0EA 4CT1A 4KBCA 4IBMA 3MFRA 4LMUA 2C6OA 2C0OA 3NUUA 2UW3A 3IQ7A 2P2HA 3EN6A 3PPKA 4MKCA 1OKVA 4I21A 5EHYA 1KE6A 3DAKA 4NIFB 3NCGA 3C1XA 3GCSA 2IEWA 4FTTA 4W4XA 3R7IA 4CSVA 3HV4A 3HUCA 3FZSA 4AQCA 3K5UA 5HBHA 4QRCA 4RG0A 3L8VA 3F82A 3KF7A 3MFSA 5E8XA 4BGGA 3QKLA 4NH1A 1OKZA 4NM0A 4TWPA 4ZY6A 4IACA 4O0XA 4FVPA 1VYZA 2HENA 1OBGA 1M14A 2Z7SA 3BHHA 4C61A 3FL4A 3ROYA 3PPZA 3JY9A 5I3OA 5I9XA 1FMKA 5DLSA 2P55A 4GS6A 4QTEA 5I5ZA 1YDRE 3ZDUA 1YXSA 2QCSA 3KK8A 4ZY4A 2A27A 3SD0A 1JLUE 3DZQA 3UNKA 2NPQA 4IAAA 2XNOA 3CTJA 3GFEA 4FV1A 4IM2A 5DI1A 4A9TA 1OECA 3ENHA 3K5VA 1S9JA 2Z02A 4X3FC 4F9AA 3DOGA 2Q0BA 2QONA 4AE6A 3P23A 5D7AA 5J7HA 3BBWA 2XJ0A 3PA4A 2I6LA 5CEIA 4D1ZA 3IW8A 5C8KA 5EKOA 4G9RA 1P14A 5LVMA 1OI9A 2HW6A 5AP4A 1WMKA 2VRXA 4ZSGA 4BBFA 5M4FA 4ZTSA 3S2PA 4YC3A 4ORKA 5GZAA 4XV1A 1OB3A 3CJFA 4WRSA 4DH7A 3TEIA 1DI8A 4GIHA 4CQGA 2WXVA 3ORXA 4ZSJA 4W4YA 3TCPA 4KNBA 3RBWA 3UJGA 3WI6A 5GZ8A 3UYTA 5AR4A 3MW1A 4NTSA 5AA8A 1CKPA 1WAKA 4MXYA 5EFQA 4GH2A 3D2IA 3MS9A 4EEVA 2YN8A 2BAKA 4LI5A 4ZTRA 4O7ZA 4EKLA 3R9RA 2PPQA 5IA2A 3FY2A 4DINA 5HIEA 3OWKA 2CGXA 4ZLZA 5IEVA 3Q2JA 4MQ1A 3VS5A 4A4OA 3SOAA 3VAPA 5HU3A 3ZRMA 3NNWA 3C4CA 3NW7A 4HJOA 4L7FA 3W2SA 2C5NA 3QD3A 4R5SA 3CP9A 4XG2A 4BTJA 3FQEA 3VNTA 5HIBA 2XJ1A 3DBEA 3DY7A 4QD6A 4XG4A 5CT7A 4AU8A 3FHIA 2OJ9A 1VLRA 3W55A 3MJ1A 4D1XA 2G2IA 1OIYA 3BCEA 1PW2A 3DFCB 5A4QA 2PVRA 2XIYA 4EK6A 4F7LA 1BKXA 4L44A 1UNHA 5FM3A 5EYCA 3QC9A 3U87A 3AKKA 2QOQA 1ZYJA 4NM5A 3TUDA 3COKA 4J97A 1NY3A 4QP3A 1JPAA 4JVGA 2WGJA 4KIPA 3UQGA 3LLAA 4DDIA 3PFYA 3NUYA 2R2PA 5EK7A 3QD4A 4RIXB 2RKUA 3ZO2A 3QUDA 4O81A 4MXAA 3JXWA 4HYUA 1OPKA 4YHJA 3ULZA 1XKKA 4V01A 4J7BA 5GZ9A 3LXPA 2XK8A 1Y8YA 3FI8A 4I6LA 5IQHA 5HCYA 4QTBA 3P9JA 4C4EA 5BQ0A 5IQEA 5KBRA 1U54B 3QQKA 3PJCA 4ASXA 2OLCA 1PMEA 5ACBC 4DGOA 3TJCA 2YM3A 3ALOA 4FG8A 3HDMA 3H30A 5LVLA 1ZXEA 3EQFA 4UMUA 1JKLA 2ITVA 4CXAA 3FMNA 4OT5A 5DGZA 4FTKA 5IMEA 1OITA 4HPUE 3FMMA 1Q8UA 4M69A 4TTHB 1ZLTA 3R7GA 5A4CA 3TT0A 5J5TA 5AM6A 5K4JA 3AMBA 3EOCA 4IDVA 4R8QA 5EW9A 3UE4A 2YJSA 3UIXA 1QPCA 3GC7A 4N57A 4I23A 3R73A 4PL5A 4XUFA 1ST4A 4RVLA 2BROA 2BRMA 3ML1A 4GYGA 4BRXA 4XRJA 4E4LA 2BZIB 4DGNA 4QOXA 1VEBA 4RC3A 4LV8A 2QR8A 4I5CA 3NPCA 4ITIA 4LL0A