4FIIA

Catalytic domain of human pak4 with rpkplvdp peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
291
Chain Sequence
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/peptide
molecule keywords Serine/threonine-protein kinase PAK 4
publication title Type II p21-activated kinases (PAKs) are regulated by an autoinhibitory pseudosubstrate.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 291
sequence length 292
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fiiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fiiA01
3Q3BA 4GIHA 3R1NA 5DHJA 2BILB 4C3FA 5GZ9A 1Y8YA 3PFQA 2ZOQA 2GSFA 4RWIA 4WOVA 2GMXA 4YBJA 4DH7A 2VTHA 1JSVA 2BPMA 2C0IA 3S0OA 4FUYA 2UV2A 3D5XA 5B2KA 3SVVA 3L9LA 5ANGA 3SC1A 3R2YA 4XHKB 4D58A 3PWDA 3EIDA 3TNPC 4EOSA 2PL0A 4M15A 1GOLA 3CD8A 3PXRA 1OL1A 2NP8A 3KGAA 4AU8A 3SOAA 5IDNA 5J1VA 5GJFA 3ZRLA 5HX6A 2BDFA 2XKEA 4V01A 4O7VA 2WQMA 5AR8A 4FKTA 3PSCA 2FSLX 4FX3A 1HCKA 5LWMA 3ULIA 3FDNA 4L00A 1ZMWA 4YR8A 4RA4A 2WQOA 2QNJA 3EKKA 3RMFA 2W9FB 5AA9A 1QPCA 2QU6A 2IW6A 4IADA 2YEXA 2RL5A 4FT0A 4BZOA 1CSNA 3F6XA 3GFEA 3QRTA 3R22A 4IX3A 4BWPA 5KNJA 4ZTRA 2ITVA 3PPZA 2HIWA 2P4IA 3QYWA 1JKKA 1BKXA 5HIDA 5EQYA 3QTRA 4XG3A 2ETRA 2GHMA 3OWJA 2XIRA 3ZXZA 4LL5A 4TYHB 5H8EA 3PJ1A 4OTFA 4YP8A 2A0CX 4EH7A 2VTJA 2YFXA 3MH1A 3OCGA 2CKPA 3T9IA 4DN5A 3I0QA 4FKSA 4EK5A 3ZUVA 3P7CA 3IONA 3RI1A 5HBJA 3EYGA 3O0GA 1PXNA 3U6JA 3F2RA 4MXCA 5I3OA 4A9SA 3PVUA 4AZEA 1UNHA 3HAVA 4QP9A 4F1OA 3R02A 5FRIA 1H0VA 2UVYA 3ZXTA 4XG7A 4D2PA 2X8EA 1ZZ2A 5ANOA 4KRDA 1OPKA 2R3HA 2OO8X 3HZTA 2J0IA 4D2VA 3UTOA 2PMIA 4X7QA 5TR6A 1YHVA 2H9VA 2I0YA 2PZYA 3BIZA 2WQBA 3ODZX 3FC1X 5DT3A 5IEXA 2OJGA 3RBWA 4F0FA 4L53A 4YTIA 3QQFA 2C6EA 4O0UA 4E73A 3HEGA 5K9IA 5L8KA 1CMKE 4FTRA 2BRHA 2HW6A 3A7JA 4GT5A 2J50A 5IG1A 3EMGA 5HTIA 1FVVA 4MNEB 3V5LA 5HVKA 3I6UA 1J3HA 4J7BA 4MVFA 4X21A 1BX6A 2PHKA 4HPUE 1H00A 3MVHA 3V6SA 3CJFA 4EQCA 3LMIA 3W55A 4O7RA 3CXWA 5ACBC 3NNVA 4F7NA 4QTDA 3OXZA 2C5XA 3TNHA 4C8BA 5I9XA 2VTIA 2OJJA 5GHVA 3BELA 5BQ0A 3D0EA 3OROA 4Z7HA 4IMYA 5FM3A 2PUPA 1JBPE 4EKKA 2RG5A 5E8SA 3NUAA 3EQFA 1REKA 3PJCA 4L7SA 4AGWA 5JN2A 3E62A 4F0IA 2IVUA 3HMMA 4QYEA 1GZ8A 5HLNA 4CEGA 2VO7A 4I23A 1GY3A 2XYNA 3ZLSA 5LCJA 2YDKA 4BIDA 4JR3A 4CG8A 2C3IB 3K54A 3VWAA 2IW9A 2PZIA 2BRNA 4YZDA 5F94A 5GJGA 5KBRA 3PDTA 4R8QA 3TI1A 3MB6A 3AT3A 1PYXA 4ZAUA 1M7NA 4IWOA 5BVWA 3BE9A 3EZVA 3VF8A 4B8MA 1P4FA 5I9WA 2W1IA 4WG5A 4C2VA 4RIYB 4RIXA 3TN8A 2QQ7A 2QHMA 2R3JA 4FL1A 5AR3A 4A9TA 4ERKA 1GJOA 4R1YA 4DFBA 4CXAA 3LE6A 4HYUA 3U54A 4OTHA 4MQ2A 1WVWA 3A7GA 4I0RA 4G3DA 4UMTA 3H9FA 4KWPA 5LVLA 2YJRA 3NCGA 4G5JA 2HXLA 5EM6A 5BVDA 4QP4A 1O6YA 4GFMA 4MXYA 1PXMA 3LFFA 4GCJA 2F2UA 4ZY6A 5E8UA 4HZRA 3FXXA 3RNIA 3D94A 3HMPA 2JAVA 2C0TA 3DFAA 4F6UA 3RHXA 2UW5A 1ZXEA 1A48A 2PPQA 4NW6A 1UU9A 4ZSEA 4WG3A 3ZOSA 1UWJA 3UOHA 3KRJA 3FZTA 1UU8A 1J7IA 3BYOA 1MRVA 2BAQA 3HL7A 2PZPA 5AR2A 3LHJA 3BQRA 2XYUA 4IJ9A 3ZRKA 4BCMA 4CRSA 4R6VA 1APME 4GKHA 3QC4A 4B7TA 4U80A 4JJRA 4DFZE 2V62A 5D1JA 2ZM1A 2ERKA 3FKOA 1NXKA 3FI3A 4HVHA 3P78A 2J5EA 3MH3A 4Z55A 1CKJA 2IZSA 4UMUA 2G2HA 1Y57A 3MA3A 3AC2A 3SLSA 3RPVA 1FPUA 4W4VA 2XJ1A 4P7EA 4R3CA 3R63A 3MFRA 4EYJA 5CXZA 3DNDA 1UA2A 2XA4A 4ONAA 3UVQA 3KN6A 2XCHA 3EKNA 2RGPA 5FGKA 1NVSA 4FTLA 1H28A 3FLYA 5KZIA 1R0PA 4AFEA 1OBDA 2X4FA 2JKOA 4GUBA 1KE8A 5D12A 4O82A 3CSVA 4MD8E 3ZC5A 4O7LA 2CN5A 4ZP5A 3I5ZA 5HEZA 4FV7A 3SRVB 4NM7A 4NFNA 5F1ZA 2WNTA 3FBVA 3E87A 2DS1A 5KMLA 3OG7A 2BUJA 2OZAB 4HGSA 5BYYA 5M4UA 3GC8A 1TKIA 3WZDA 1KE9A 3E8NA 4ZOGA 2JDVA 2UZLA 4FT9A 5CY3A 3NAYA 4HCTA 4O38A 4DGNA 3EQBA 3VN9A 4IB0A 2UZBA 3B8RA 4JIKA 2HAKA 4A06A 5M4CA 5FTGA 4DC2A 5EFQA 2WB8A 3C4WA 3NPCA 4I24A 3VJNA 3IG7A 4W4WA 4ZTMA 4TY1A 1O9UA 4EK4A 4H3PA 3PZEA 4I41A 2JGZA 3L9PA 2CDZA 1IAHA 5IQBA 3GU7A 3H0YA 3PUPA 3ZM4A 5LQFA 4G2FA 2ITZA 3UJGA 4K9YA 5J87A 3C4CA 4FICA 2X8IA 4XV9A 5HE1A 4CFFA 2NPQA 5ICPA 3DZQA 3QD0A 4YGAA 2OXDA 4KSPA 4BICA 4IE9A 3P7BA 4KRCA 4KKEA 5E8VA 4FEWA 4OTRA 5DRDA 3LXKA 4UXLA 2ZV7A 2XMYA 2PVLA 4YJQA 3CBLA 2R4BA 2XIZA 4FV0A 3UO6A 5JK3A 5M4FA 4O7TA 5DG5A 2QO9A 2YABA 3NUYA 3FXZA 4BB4A 5DBXA 3LKMA 1ZLTA 4J96A 3HX4A 3RAKA 4L3PA 3NNXA 2WOTA 4FTCA 2XRWA 2BDWA 2GCDA 3L8XA 2HZNA 4ANOA 4JG8A 3MPAA 2X81A 1M14A 3ZDIA 3GC0A 4B99A 1GZKA 3GEQA 5HI2A 1H8FA 2CN8A 3EN7A 5KKRB 2PVKA 1JKTA 5J9YA 2CNUA 5CVHA 1XQZA 3WZJA 1Q3WA 4NCTA 5DPVA 4CTCA 4F63A 4J53A 3C4ZA 4G16A 3FYKX 3IECA 1CM8A 1V1KA 4QMQA 2OSCA 3F82A 3QALE 1B39A 3FI4A 3FLZA 3R7YA 4MAOA 2JIIA 4YLLA 2PWLA 4H36A 3DKOA 4UWBA 4F9YA 5HVYA 4MH7A 4P4CA 5EM5A 1U5QA 4EUUA 3GCUA 4DEGA 2FSOX 4FTIA 2FUMA 2B53A 2HWPA 4XV1A 1JQHA 2VRXA 5FDXA 3VUGA 2QOBA 4F6SA 3CGOA 2XK9A 3PA4A 5CU6A 5AV1A 1W98A 4KABA 2KULA 2UZWE 3LM5A 1OKVA 2WMUA 4Y83A 3R9OA 3ZTXA 5KMNA 4NM3A 1ZRZA 4C0TA 4IC7A 2QOCA 2C6IA 2R2PA 4KIKA 4OTIA 1CDKA 3SKCA 4ACCA 1PHKA 3H3CA 4PQNA 3GP0A 5CAPA 3O50A 3R6XA 4FA2A 4XJ0A 5HU9A 4PP9A 1H07A 5DEWA 3G0EA 2GNLA 2YM4A 4WUNA 1KSWA 5EH0A 4O84A 5E7RA 4I0SA 1PXOA 4IIRA 3C5UA 1SZMA 4P5ZA 3VBXA 1IRKA 1ERKA 4A9YA 4D0XA 4UXQA 4USEA 2UZOA 2A1AB 5FP6A 4BHZA 5HD7A 4NW5A 5K3YA 1SNUA 3IW4A 3MPMA 4YHJA 2BRBA 3E63A 3FLNC 4BL1A 3B2WA 5G6VA 3R9DA 4IAAA 4EI4A 3LFAA 4RJ8A 1W8CA 2F7XE 3ALNA 4C7TA 1YDTE 1YRPA 1VZOA 1W83A 4ZXTA 3FZPA 4WBOA 4ZEGA 3VW8A 2G01A 2CLXA 2WU6A 5J8IA 5L2QA 2VWWA 3WBLA 4UMPA 4G5PA 4OBOA 3W32A 4ACMA 4D2SA 4Y85A 3TV7A 3UVRA 4JBOA 3BI6A 4DT9A 2PE2A 4FK3A 4X0MA 4DEIA 2O64A 3PXKA 4O0VA 2OJ9A 4I1ZA 2PVNA 2C6OA 3JXWA 3RPOA 2G9XA 4YJVA 2X1NA 2B52A 3MVLA 2UZNA 3PP1A 4MF0A 4K77A 3BWFA 3HLLA 3RZBA 5AUVA 4N4SA 4FF8A 4C4IA 3UPZA 1YWVA 5JSMA 3BE2A 2WQEA 1XBCA 2YCQA 4D5KA 4NFMA 1H24A 3OW4A 3CGFA 4MNFA 2X9FA 3FWQA 3OBGA 2J6MA 4Z3VA 4IVAA 4ZLZA 1V0PA 4USFA 2J9MA 3DJ6A 4YNEA 3V8TA 5HZNA 4EH3A 5D9HA 2QCSA 3ORXA 5IUHA 4LMNA 5J7HA 4DE4A 3LCOA 3RM6A 4TYHA 2OFUA 2Q0NA 4IWPA 5CVGA 3N4UA 3KXXA 2W96B 2UW8A 1KWPA 4XP2A 3G15A 4FIHA 1XWSA 4GL9A 3NUPA 2VTTA 2ZV8A 4LFIA 4JDIA 2OI4X 3IW5A 4V0GB 3PP0A 3U51A 5HIBA 4YTHA 4BKJA 3KU2A 2IVTA 2GPHA 2YHVA 4QQTA 3ULZA 3E7OA 4WSQA 1YWNA 4ZJJA 4GT4A 2IN6A 5IQGA 4CCBA 3NAXA 1E1XA 4M69A 4MXAA 3LCKA 5CS6A 5HO6A 4ACDA 4LM5A 2QLUA 2RSVA 4FEVA 2B54A 4I6QA 3BGQA 1S9IA 4MX9A 5CAQA 3CTQA 4KKHA 3UZPA 3FEGA 1GZNA 4U45A 3RPYA 3KXHA 3Q9XA 5CSHA 3QAME 4C4JA 5BVOA 4FEUA 5TF9A 3MW1A 4X3FC 5TKDA 2R0UA 1YXUA 2W5BA 3RGFA 3NX8A 4LUEA 4EH9A 2R3KA 4MNEA 1VJYA 4HZSA 4LV5A 2WAJA 4HPTE 3V8SA 4QP1A 4AG8A 4BHNA 3BYVA 3PE1A 3O7LD 3V6RA 1GIHA 1MQBA 2F49A 3BHVA 4A9RA 4NL0A 5E8XA 5B0XA 3NUXA 3V5QA 3LFCA 4E6CA 3NGAA 4FKOA 4MYGA 4EK8A 3LFQA 3DLSA 4APCA 2CPKE 1XO2B 4TN6A 3I6WA 2HY0A 2VWBA 2X39A 4BCPA 3RZFA 4PPBA 1ZOGA 5AEPA 3QCSA 3MBLA 4BCIA 2EB2A 3EQGA 3HDNA 3LQ8A 4EOKA 4GFOA 4OTPA 5M07A 3QD3A 4IZ5A 4L9IA 3NUNA 5AM6A 2J5FA 2RG6A 3DBCA 1Q97A 3RINA 3TKUA 3R2BA 3IW6A 4FL2A 2VWVA 1OBGA 3FMLA 3QD4A 4NKAA 2W5HA 2LAVA 3FLSA 2BFXA 1YXXA 3AXWA 3AT4A 4I6HA 3S4QA 2V7AA 3ZC6A 2VNWA 3UO5A 5GINE 3LQ3A 3R30A 4DTAA 4E4LA 3TM0A 4RIYA 1Q8YA 3W18A 2Y6MA 1Q99A 4M14A 3P7AA 2WTIA 3AQVA 3EJ1A 3GU8A 4FR4A 1BUHA 5CEPA 1BL6A 3HGKA 3PRIA 2X9EA 2YISA 3MGYA 1ZZLA 3EZRA 4YJNA 4CFXA 5EDQA 4QMLA 3UQCA 1OUKA 1OMWA 4B4LA 2HZ0A 3FY2A 4U44A 3OVVA 2KTYA 4F9BA 3K2LA 3QQJA 4O0YA 4RJ4A 5A14A 2F2CB 3QC9A 4G9CA 3VW6A 3QD2B 3L9MA 2VTOA 4M0YA 2CCIA 3NRMA 4BDCA 2I1MA 1UVRA 5ANKA 4BTFA 2C6LA 2ZVAA 2X2KA 5H8GA 5HVJA 4RZWA 1ZMVA 1XBAA 2V0DA 4D9TA 5H2UA 3U6IA 3TDVA 4GRBA 1R3CA 3BU6A 4GFGA 4IFGA 4IM3A 4CFNA 5BUIA 3EQRA 2VUWA 2W1CA 4FI1A 5AV0A 4C3RA 3DT1A 5A4CA 3T3UA 4G3EA 4LQMA 4BGQA 4O7NA 4DCEA 4FV8A 5CALA 4DG3E 3R9RA 5AUYA 1YI6A 2W4KA 4CV8A 4QPMA 4FSZA 4FK6A 4PL3A 4APPA 2PVJA 1LEZA 3CY3A 4O0TA 4GVAA 5KCVA 5J9LA 4FG8A 5AWMA 3VBVA 2YM3A 3RAWA 4QMUA 4YMJA 4ZZOA 3K3JA 3RVGA 3DLZA 4EHEA 3C50A 1PRYA 3MTFA 1XH4A 2ETKA 2VO3A 3RPSA 1BL7A 3QKKA 3CCNA 4FTUA 5HG9A 3SRVA 4XUFA 4O81A 2F7EE 1OIYA 4TYIA 4ZZNA 4YZCA 4S33A 5AX3A 2HOGA 1W7HA 3ORMA 3DK3A 4FKWA 2OZAA 4X6QC 4AXAA 5KZ0A 3KRXA 4X2FA 5M53A 2C0OA 2Y4IB 3DBDA 3H4JA 4P2KA 5C8NA 3NVKI 4U9AA 2WTDA 4AN3A 3F2AA 5CLPA 5IA2A 3DU8A 1OPJA 2QOHA 2X8DA 3LJ2A 3GU5A 4AT5A 5CT0A 1GIIA 4IX4A 3AC8A 3ZO2A 4FVRA 4DH1A 3SDJA 4ZLOA 4D28A 3GB2A 5AMNA 3FKNA 4MKCA 3ETAA 1P2AA 3DQXA 4FSTA 4MEDA 1GNGA 5E1EA 4CKIA 3QKLA 5IA3A 3A7IA 4I92A 2GS2A 4LYNA 4QMPA 4C35A 2XBJA 3KCKA 2VO6A 3JPVA 3P86A 4QNAA 4I22A 3VBYA 1M2RA 5DYJA 2XF0A 4X3FB 5A46A 4XYFA 2QURA 4XG6A 4CLIA 2YAKA 2BHEA 3H9RA 4JRVA 4U79A 3VQHA 1OL7A 5AADA 1R78A 2YERA 3G90X 3ERKA 4E93A 4O2PA 2BZIB 4TWPA 2XP2A 1YW2A 3NYVA 4FL3A 2F9GA 5DLSA 4D4SA 3QKMA 2OIDA 2HW7A 4D2RA 2JKKA 4NM5A 3OUNB 3OP5A 2YIXA 4KS8A 1YKRA 5T6KA 5JT2A 3FMKA 4FV5A 4O7WA 3AG9A 3BLRA 3GI3A 4IZ7A 5HLPA 5IF1A 5M57A 4EKLA 5AUZA 3KMWA 2JBPA 3KMMA 3L8PA 1RDQE 2BALA 2IWIA 4XMOA 3SX9A 2YIYA 3QA8A 5JGDA 3TNWA 5EYCA 4JQ7A 3ZU7A 2C6TA 3PY0A 3K3IA 4U41A 4AA5A 4AX8A 2HY81 4FOCA 1WBNA 4KBAA 2AC5A 3Q6UA 4YHTA 1S9JA 4AACA 5FP5A 5L2TA 4O22A 4IM0A 5LMKA 2CKQA 2PMNX 3M42A 4PNIA 3M11A 4WUAA 4LUDA 4AN2A 4PL5A 3LJ1A 4C61A 5JFSA 3LQ5A 5CF6A 2CCHA 4YZMA 2ZAZA 3U6HA 1PKDA 2QVSE 4E4XA 4ERWA 3P23A 4ASEA 2XIKA 4ALWA 4RX7A 1QL6A 2HYYA 3D7ZA 3TIZA 4ANMA 5F9EA 4NKSA 3LVPA 4YZNA 4R3PA 5CZIA 3F5UA 3F7WA 3C0HA 1SVGA 5ITAA 3MFTA 5EYMA 4ZTNA 4BWKA 4F70A 4M12A 5AUWA 3FQSA 4YLKA 2QC6A 2PMOX 4FVQA 3FMNA 2VN9A 4S2ZA 2JFLA 3W8LA 4EL9A 2VWUA 4LMUA 4HVGA 3QTUA 4CCUA 3RWQA 4O1PA 3R83A 4ZTSA 1PXPA 4PP7A 4N6YA 5HE0A 4QTEA 3NUUA 1J7LA 3SXSA 2UZVA 4ORKA 3R04A 2DWBA 3RAIA 4WA9A 4TKSA 4ZSJA 5BVFA 2PZRA 3QQHA 2PMLX 5EW8A 4XCUA 3VUHA 4CYJA 3SW4A 5K4IA 4HJOA 3DBEA 4FZ7A 3PVBA 4YHFA 5EI2A 4IB3A 4TXCA 1Q41A 4EOOA 4BBEA 4IH8A 4N70A 3IGGA 5F4NA 4BR3A 1LEWA 4F99A 4U7ZA 5M51A 2UUEA 4MK0A 2Y9QA 2W1DA 2OW3A 3PZHA 3BV3A 5ANDA 5AR4A 3TV4A 4KIQA 4DG2E 5DOSA 5AP4A 5LCKA 3WZEA 4E5BA 2YN8A 2C5OA 4AOIA 5CEOA 2R3NA 5A4TA 3DBFA 3MWUA 2QO7A 2W0JA 3C4FA 4TYEA 2OH0E 2GNIA 3BBTB 4EH2A 3LMHA 3ZBXA 3OBJA 4W9XA 2XNEA 3MDYA 3UP2A 5KHWA 2CHLA 3OT8A 3LZBA 4RC3A 3GOKA 1JVPP 2B1PA 4Z16A 2VWXA 5E1SA 4NH1A 5LVPA 2X6DA 3ZMMA 3BRBA 3RK5A 5CSXA 3QZFA 4FSWA 4EH5A 4P5QA 2G2IA 3JY0A 3R1QA 3A8WA 5CF8A 2HZIA 2ZM3A 4X3JA 3F69A 4M84A 3R7IA 3NWWA 3AGMA 4TYJA 3KK8A 3CQWA 1Z5MA 4M69B 1PMVA 2QOOA 3EB0A 3EFJA 4PF4A 4V0GA 3ENMA 4KBCA 3G6HA 4O83A 4JBVA 2NNWB 4RVKA 2C3LA 2JC6A 3RP9A 2ZDTA 2VTQA 3W2PA 1JNKA 5JMSA 2UVXA 3FMMA 2ACXA 3FPMA 4WD5A 4ITJA 5CSPA 4GS6A 3NLBA 1GZOA 3OFMA 2ZM4A 5KMMA 2EXMA 5EDPA 3OS3A 4RWLA 3SD0A 5ETFA 4DFUA 2OGVA 3ALOA 4BY9E 4D4YA 5CSWA 3E92A 4EH4A 1UKIA 3FI2A 1TQPA 4DGMA 2VTPA 2XIXA 3Q2JA 2C3JA 3PSBA 3TXOA 3HV7A 5FXRA 5TO8A 2XKDA 4EUTA 4PDOA 5FD2A 4KUJA 4ZS4A 1IEPA 2VTLA 4WNPA 4RG0A 5AP6A 1BYGA 1KE7A 3OHTA 3SW7A 2XEYA 3Q53A 4Y5HA 4YURA 4HVIA 4JL9A 3PXYA 1A9UA 1FMOE 1UU3A 4BKZA 3PJ3A 2NRYA 4CZTA 2I7QA 1V0OA 4OTWA 5TT7A 2QR7A 4ENYA 5F20A 2B9JA 3DNEA 4GV1A 4AE6A 4K1BA 4A4OA 5LWNA 1YQJA 4U81A 5E8WA 3RTPA 2J0JA 4OGRA 4BCOA 3V5JA 3CLYA 3MJ2A 3O23A 4I21A 2QR8A 4S31A 4L3LA 4L3JA 5JQ5A 5DH3A 3C51A 4ZSAA 3GT8A 1F3MC 2B9IA 2I0HA 4XOYA 4F6WA 2GTNA 4X6RA 2Z7SA 1VR2A 3N4VA 1BMKA 5J95A 3LFBA 4EZ3A 2BCJA 5CEQA 4JX3A 4AF3A 4L7FA 4PMMA 2UW6A 3EQPA 4MD9E 4X2NA 3VS3A 4BCFA 4PTEA 1SYKA 1URCA 3QYZA 4U42A 3K5VA 3OEFX 2W05A 4IVCA 5AIRA 4TWNA 5C9CA 4BDDA 4XNEA 5IEVA 3OXIA 4OR5A 3KKVA 3OW3A 1ATPE 1CKPA 5GZAA 1E1VA 5HG8A 3NNUA 4JG7A 4DTKA 2XBAA 5IQHA 3O8UA 5FTQA 2E9OA 3OXTA 4NM0A 4AQCA 4H1JA 3HDMA 4GVJA 4N0SA 4UX9A 1OL2A 2AYPA 2ZJWA 4IXPA 5AAEA 3MY0A 4TNBA 5HTCA 5BVEA 4ANLA 2R3RA 3OEZA 4FODA 4ZSLA 3Q96A 3O2MA 1H01A 3IGOA 4QTAA 4FTQA 3O8PA 1H26A 2VGPA 3FQEA 2GNHA 4G31A 3DS6A 2WMWA 3BHHA 1R1WA 3EN6A 4ZS0A 3WILA 2BAKA 4QMXA 2W4JA 1WMKA 4RWJA 3MS9A 5H8BA 4U3ZA 2V55A 4FV3A 3UNZA 4C36A 1H4LA 1M52A 3EL8A 2JITA 3OZ6A 4HYHA 4IAZA 2OBJA 3ZBFA 4AW2A 4MBJA 4EOJA 2OU7A 5LARA 1K2PA 2CGVA 3G5DA 3N9XA 2WQNA 4IX5A 2ZV2A 5LVMA 1ZYLA 2UW0A 3DAJA 4I6FA 4FUXA 4O86A 1YDRE 1R39A 1XH8A 4EOQA 4G3CA 3N51A 1OKYA 3VULA 2XKFA 1UV5A 4MBLA 1ZYCA 2F4JA 3I79A 3DV3A 4DA5A 3VIDA 3R7EA 4RBLA 5A4QA 4ACGA 1QMZA 3OWKA 3OD6X 4XRJA 3NR9A 5CTPA 1P5EA 2J4ZA 4TYGA 4DLJA 3Q2MA 4WKQA 4YC8A 5DI1A 4QP6A 3W2OA 2WMVA 3FZSA 5EW9A 3KF4A 2ITTA 3QXOA 5TOZA 5FEDA 5FDPA 3W8QA 3LPBA 3QA0A 3KRWA 4D2TA 2OIQA 4DGOA 4WO5A 4TTHB 3NIZA 4ALVA 4AW5A 4II5A 3OWPA 5IU2A 3R9HA 4G17A 4BIEA 4BKYA 3NMUF 2J51A 4ANNA 1BLXA 2JKQA 5HKMA 4Y72A 3OTUA 4IHPA 3MV5A 2XS0A 5IA5A 3O51A 4GJ2A 5AFVA 2XVDA 1XH6A 4IC8A 4QMOA 3ITZA 3SAYA 4EYMA 2GFCA 4ZY5A 5HQ0A 5HOAA 2W1EA 4WRGA 2I40A 5AP0A 4KD1A 1XR1A 2JLDA 4K11A 3NYNA 4L8MA 4A4LA 4NTTA 3EFKA 5KUPA 5IA1A 5AP5A 2QHNA 2YA9A 4I4EA 3LIJA 4B9DA 3GQLA 2CNQA 2ZMCA 4NUSA 3ZRMA 1ZARA 3ZFXA 4CYIA 4F64A 1G3NA 1P14A 3AT2A 3CQUA 3FC2A 4PUZA 2BKKA 2CLQA 4X3FA 5HCZA 4FBXA 3TJDA 4E4NA 2PU8A 3G0FA 4BCJA 1ZAOA 4H3BA 4G34A 4JOAA 2FSTX 3LM0A 5AIKA 3AC4A 3PXQA 5CYIA 2IG7A 4R3RA 4FV1A 3WF7A 4TNDA 4LG4A 2ESMA 1T45A 3F3VA 4JIAA 4LGHA 4B0GA 1ZYJA 4F7JA 5CXHA 5BYLA 2YM6A 3F5PA 4F9AA 4XOZA 3PA3A 1T46A 3PRFA 4GIIA 2W4OA 2QOKA 2C6KA 3PTGA 4S34A 4F1MA 3HAMA 4XRLA 3DK7A 2P2IA 1Q3DA 2XNBA 3FKLA 4NT4A 3U4WA 3V51A 4AZWA 4DAWA 4QMZA 4D5HA 1O6KA 1ZWSA 5AR7A 1SNXA 1A06A 2GDOA 4D0WA 2QO2A 3E7VA 5EHYA 2C4GA 1I09A 4LRJA 3GC9A 5L2WA 3ZYAA 1H25A 4N6ZA 3HA8A 3FMEA 3D7TB 3A4OX 4FIEA 2ETMA 4TT7A 5B2LA 4ITHA 4IZYA 4FV2A 4CSVA 5E4HA 3UQGA 5L8JA 1PMNA 3T9TA 5C4LA 5HX8A 3ORKA 2JIVA 3C7QA 1PW2A 4CGAA 2I6LA 2YM5A 2JKMA 4J71A 2B55A 3PSDA 2WTKC 4EONA 4QPSA 5BYZA 4ZZMA 4H05A 4BDHA 4U97A 5FLFA 2O63A 5AAFA 2I0VA 5BX0A 4YSJA 3LFNA 4AT4A 3CPCA 3O71A 4IWDA 1DS5A 1TVOA 1URWA 4RT7A 1Q8TA 4AZVA 4FZAB 3UNKA 3IDPA 3Q9ZA 3EN5A 3Q4ZA 3RKBA 2FVDA 3GCQA 5A6OA 2BROA 2VWZA 2YZLA 4WG4A 5L3AA 1YDSE 4DH3A 1Z9XA 4RC2A 4UWCA 3CKXA 3D5VA 3IDBA 4PL4A 5CNNA 4O21A 2R7BA 1DI9A 3MFSA 4YBKA 3SA0A 1G8SA 4Y73A 3C5IA 3U8WA 1M2QA 5CVFA 2SRCA 4FNXA 1ND4A 2BMCA 4D1SA 2RFSA 3UPXA 2P3GX 1AD5A 3BYUA 3LCDA 3FI8A 2ITQA 2UZTA 2YACA 4QNYA 5DA3A 4L6QA 2E9VA 1GIJA 2GNJA 4MTAA 4XBRA 4ANBA 4C3PA 3MH2A 3TZ9A 1PXLA 1ZOHA 4YJSA 3H10A 5CEIA 4BDJA 1OGUA 3KA0A 2C68A 1U5RA 1FMKA 2BZHB 4FSUA 2BHHA 3E3PA 4NSTA 3HVCA 5FWKK 3VF9A 4O2ZA 4FNZA 1YXTA 3RHKA 1IR3A 3DK6A 3G9LX 4ANSA 3F66A 4AT3A 4Q9SA 2C1AA 4AGUA 4XLIA 3KVWA 4RVTA 3A62A 5M44A 2VAGA 3A8XA 5ANEA 5L4QA 3D5WA 4M8TA 4QYYA 4XG8A 3UNJA 4QP3A 5EM8A 3H9OA 2C30A 3HYHA 4RPVA 3RWPA 5AJQA 4AA0A 1SM2A 2X2MA 4FTMA 1YHSA 4LV8A 4ITIA 3HMIA 4C33A 2C69A 2WEVA 3P1AA 3SHEA 5L6PA 2DYLA 4G6NA 5AP7A 3KN5A 4C62A 3T8OA 2X7FA 5TE0A 4IAFA 4I4FA 3AD4A 3DTCA 4BWXA 5AUTA 2PVYA 3P0MA 3WZKA 4HVDA 4ZY4A 2QU5A 5LVNA 2ZYBA 3R0TA 2P33A 2X2LA 3QTWA 4DFYA 2IZTA 4RLLA 4E6AA 5CF5A 1ZMUA 4Z9LA 3D2IA 3PE2A 3NW5A 1BI7A 5AP1A 2Y7JA 3R8LA 2ONLA 3TNIA 2OIBA 3TNQB 2QI8A 4E8AA 2VWIA 3W10A 2BRGA 3LAUA 3QX2A 4FTKA 2Z02A 4YJTA 4QRCA 5DIAA 3ZSHA 4TWOA 4I6BA 2JBOA 3R8ZA 5DWRA 4FTOA 3AGLA 3VUMA 3LXNA 5FXQA 4GG5A 5HU3A 3EQCA 1NT2A 1JKSA 1WAKA 4YPSA 3S2PA 3RK7A 3HMNA 4WRSA 2G2FA 2PSQA 2AC3A 4BDIA 4EH8A 5C01A 3QTZA 1PF8A 4JVGA 1L8TA 3WIKA 2JEDA 3OC1A 4BVUA 3QUDA 3QX4A 4F4PA 2BVAA 4UYNA 1H1RA 4C02A 4FVPA 4IM2A 5JGBA 4EC9A 2CMWA 3BU3A 4HVSA 2Y4PA 2OK1A 1GAGA 2ITPA 4GMYA 4EQMA 4XLVA 3ZLYA 1FQ1B 4AZSA 4Y46A 4BI1A 4BYIA 4FSQA 3IO7A 4RFMA 4Y95A 5DN3A 4NCTC 4AGCA 5IQAA 4YC6A 5A9UA 2IW8A 1J1CA 2CNVA 2WU7A 4XV3A 5IUIA 5E8TA 3I5NA 4QMMA 4DEBA 3ZSIA 1Y6AA 3EN4A 4L45A 5CI7A 4F9CA 2R64A 4FKJA 5EQPA 4L44A 4QYHA 2W1FA 1IG1A 4JDKA 5IZFA 1FVRA 2ITNA 3R7VA 3Q5ZA 4UN0C 3PY3A 5A4EA 4FTJA 4S30A 4QMVA 2GQGA 4X2GA 5HHWA 4E5AX 2QG7A 3FY0A 5CU3A 3KREA 5B7VA 4RWKA 2XNNA 5EM7A 4PMSA 2BTSA 3DFCB 3S3IA 1SVHA 4KINA 4G3GA 4FGBA 4IVBA 4RX8A 3VBWA 3FL4A 5EW3A 1H1WA 4H3QA 3ZZEA 2CSNA 4OAUC 2VWYA 3FL5A 3F2NA 5AP3A 2WMQA 5IISA 3ZFYA 3K5UA 2UW3A 4RIWB 4U6RA 4JXFA 4CMOA 5FEEA 1W0XC 1NVRA 2GS6A 2PUIA 5HESA 5I0BA 2C3KA 3QTXA 3S00A 3PVWA 2B9FA 4HGLA 3VVHA 5FBOA 3SXFA 4LOPA 3ZM9A 3AOXA 3UMWA 2R3QA 4I5MA 4PDPA 4QD6A 1NA7A 4GT3A 3NNWA 3HV6A 4XV2A 3VAPA 4IJPA 2JAMA 1ZYDA 3MN3A 1OIUA 5HNGA 1B38A 2QOQA 1QPJA 5AV2A 3QUEA 1FBNA 5K0KA 4J52A 3C1XA 2OG8A 2GU8A 2FB8A 2V5QA 2XK4A 4BBMA 4MXXA 4YTCA 3QGYA 2XUUA 3NZ0A 2G1TA 1UU7A 1UKHA 4GW8A 4FEXA 1J1BA 3ZHPC 4CG9A 3HV4A 2RFEA 3QQGA 1R0EA 2UW9A 2GFSA 4G9RA 3PIZA 1OITA 5ANIA 4ANQA 3KQ7A 1FGKA 3RNYA 4E5WA 3A60A 1V0BA 2JDSA 4PPAA 3MPTA 3PXZA 1JLUE 2Y8OA 3OWLA 4FG7A 3R8PA 4EZ7A 4DCAA 4NZWB 3QCXA 4QP7A 3VBQA 1PJKA 3ET7A 4YLJA 5EG3A 3W1FA 5K5NA 5C4KA 2YLEA 2RFNA 3CP9A 3JS2A 4NIFB 5BMSA 4RX5A 2OWBA 5AA8A 3TG1A 3PWYA 3R01A 3QU0A 3JUHA 4I5PA 1OL5A 3WI6A 3EQIA 1QPEA 4D1XA 3TKIA 3CEKA 3QWJA 5EKNA 4CVAA 3ATSA 3KVXA 3M1SA 4BCNA 3BZ3A 4OT5A 2ZMDA 4BCHA 4ACHA 2GTMA 2WTCA 4NK9A 3KF7A 4IEBA 4U3YA 4NU1A 3UO4A 1PXKA 3F5GA 2V22A 1QCFA 3A99A 2YIQA 3I1AA 4TWCA 3QCYA 2OJIA 3R8VA 3A2CA 3MY1A 2ITOA 3B2TA 3FZRA 3D2KA 4BDEA 3BQCA 3EYHA 3W2CA 3W16A 4DITA 5M08A 2QOIA 2QLQA 3O8TA 3GCSA 3QTIA 4K33A 5FBNC 3TUDA 2VTAA 4ZLYA 5L6OA 4NTSA 4RZVA 4FSMA 4FNWA 2B9HA 2EVAA 4R77A 5A6NA 1WZYA 3JY9A 4EJ7A 4KNBA 5A54A 4YZ9A 5I3RA 1CKIA 4BF2A 3QRJA 4O6EA 2WO6A 5L2SA 4O1OA 3ELJA 4F0GA 4KBKA 3VHEA 2EU9A 1TQIA 2W1GA 5EDRA 4ZTLA 4A7CA 4WNKA 2PK9A 3KB7A 3LOKA 4B6LA 3WARA 4RFYA 5AR5A 5JRQA 2XH5A 3IOPA 3BU5A 3RM7A 5HCXA 4ASDA 1XKKA 3SXRA 3VS1A 5AAGA 4OAVB 5HIEA 4FT7A 4AA4A 4BZNA 4U5JA 3ROYA 2YCRA 3CC6A 3GVUA 4JBQA 3GQIA 4O96A 4CD0A 4Q5HA 4KSQA 3BHYA 2ITXA 3HMOA 4QO9A 2DUVA 3NYOA 3VQUA 3ORIA 2VGOA 5CSVA 4JDJA 4C2WA 3D83A 3I7BA 3IPHA 2EXCX 3SOCA 2WKMA 4RVMA 4R78A 3ACKA 5CAVA 3EH9A 5IA0A 5LMAA 3QQUA 3ZDUA 2BDJA 2FH9A 4IZAA 3TKHA 2PUNA 1PKGA 3OCTA 4GSBA 4J8NA 3ANRA 1U54B 4FZDB 2IO6A 3D7TA 2O65A 5E91A 3WF6A 2C6MA 1DI8A 2YAAA 3LFEA 3F3TA 4JAJA 3V04A 4HYSA 3WIGA 3NUSA 5J5SA 1WBTA 2WZJA 4FSNA 1H1PA 1VYWA 5IH4A 3Q9YA 2DQ7X 5JFXA 3KL8A 2VTSA 4YSMA 2NRUA 2VZ6A 2OZOA 1F0QA 3COMA 3DY7A 4KB8A 4RIOA 4V04A 5E92A 5FXSA 1YI4A 5L8LA 4G6OA 1JSTA 1OUYA 5EI8A 2BIKB 4BZDA 5IA4A 3MTLA 4HGTA 4O7ZA 5E9EA 3ORPA 4MF1A 5BUEA 4CKJA 3TDWA 4FIGA 5C8MA 4YJOA 1WBSA 5HNBA 5AM7A 2BIYA 3ZO1A 2EUFB 4UBAA 3BX5A 3R71A 4CFWA 4NYEA 4BCQA 4PMTA 3KULB 4C4FA 5E90A 5I9UA 2GHLA 3DXPA 5IMXA 3H0ZA 3ORZA 4D4RA 1K9AA 3QRUA 2BRMA 4IDTA 2VV9A 3SGCA 1Z57A 4OTQA 1UNLA 3TUBA 1PMEA 4OTDA 2OF4A 3TJCA 1STCE 4OUCA 3RCJA 5FTOA 3G2FA 4RJ7A 1SVEA 2X6EA 5EOLA 3PPKA 3QWKA 4XP3A 2J0KA 3PJ8A 3NSZA 4DH5A 4FE2A 2W7XA 3MI9A 1PYEA 3V8WA 3ZZWA 3DKGA 3I7CA 4JDHA 4RVLA 3TCPA 5AV4A 4O0XA 3HECA 3ZS5A 5EHOA 5F95A 3ENHA 3CE3A 3BKBA 4QTBA 4BIBA 2R3PA 1DM2A 4QMNA 2H96A 4MBIA 5DRBA 3CS9A 1Q62A 3ANQA 5C03A 2ZB0A 2OF2A 3BLQA 4HNIA 4FT3A 4DEHA 4FIFA 3QZHA 3ZEWA 4RLKA 3UIBA 3OMVA 4RSSA 3BPRA 4ASXA 1CTPE 3DDPA 2Q83A 3U9CA 1BI8A 2PZ5A 4OW8A 4YU2A 5CT7A 4UY9A 3SQQA 1NY3A 5JZJA 4HCVA 3ZCLA 2C6DA 3ZUTA 4GU9A 4RJ3A 5EYDA 2A2AA 3VC4A 4LGGA 5HCYA 3MJ1A 1NVQA 3F3WA 3F9NA 2PE1A 5DEYA 3SG9A 3AC5A 3E8CA 5CAOA 1UNGA 3QQLA 3R7UA 3R7GA 2GS7A 4FTAA 5J9ZA 1TQMA 4AN9A 2XNOA 4UWYA 4EQUA 2ZV9A 3QXPA 2WMAA 1JOWB 2BFYA 1IA8A 3BEAA 4FV4A 4IFCA 4WBBB 4YNOA 3C0GA 2LGCA 3G33A 3DAEA 2A4LA 4W8DA 3ZH8A 4LRMA 5I9ZA 5KMKA 5GIOE 4BDAA 1J7UA 1LUFA 1KE6A 5A4LA 5ETCA 3E8DA 4RQVA 5HG5A 3FQHA 4HW7A 3QFVA 3PLAE 2IPXA 1U59A 4FKVA 3ZSGA 1M7QA 3DDQA 4RRVA 1XJDA 4KIOA 2R3MA 2BTRA 4EOIA 3SV0A 3T3VA 5GJDA 2O5KA 4DFXE 3HRBA 3FHRA 4NWMA 3F5XA 3IOKA 3FE3A 2ITYA 4RX9A 3ROCA 2W1HA 3QCQA 4QPAA 4BGGA 3BCEA 1YXSA 5BPYA 5GIPE 3BBWA 2J7TA 5J5TA 3ZO3A 3RK9A 2QKWB 4HNFA 1PMUA 1WCCA 4OT6A 1Y8GA 4W8EA 5CWZA 2CJMA 5DT4A 5K5XA 2IJMA 2BZKB 5IPJA 5ETAA 4KS7A 4DEEA 4JG6A 2X4ZA 4MXOA 3FHIA 5LMBA 5HO8A 1Q61A 3ORLA 3MB7A 3MIYA 5HBHA 1ZY4A 4BI0A 3KFAA 3HKOA 3Q9WA 3CR0A 3QTQA 3UG2A 3HRCA 5M09A 3CKWA 4RA5A 4UYAA 1I44A 3C13A 3GCPA 3P9JA 3WYXA 3BHUA 3QF9A 2I0EA 4JT3A 5KKRC 1KOBA 4TZRA 2OLCA 4EBVA 1JWHA 3E3BX 2YJSA 2PUUA 3V5WA 3Q6WA 4E4MA 4PX6A 1WVYA 3GBZA 1U4DA 3KRLA 2GQRA 3JVRA 1PXIA 3FMDA 4EOPA 3PPJA 4QMYA 4FYOA 3ATTA 4M7IA 1K3AA 4XG9A 3V01A 3QQKA 3DB8A 5EKOA 4XG4A 2GQSA 5LMKC 2OFVA 5AX9A 2PVHA 4K18A 4MXZA 4RQKA 4FV9A 3PIYA 3MH0A 4RFZA 4F08A 3FPQA 3UG1A 1Q5KA 3FJQE 3R7OA 3DKCA 4CV9A 3O17A 4F65A 1E9HA 3MFUA 4G3FA 2B0QA 2B4SB 3E64A 1H08A 3II5A 4FKUA 3P79A 4C37A 4U40A 1J91A 1VYZA 2OXXA 2NO3A 2RFDA 3VS5A 3R1YA 3QL8A 3P4KA 2C5VA 3DGKA 3EHAA 4RIWA 4IB1A 4PY1A 3UE4A 3ID6C 4D9UA 4QOXA 3D9VA 4XX9A 4WIHA 5T3QA 3IKAA 4IWQA 1IA9A 3C4EA 4YZBA 4FGRA 2ZB1A 4FSYA 4K2RA 4DGGA 3WF9A 4QT1A 3Q5IA 4FMQA 4E1ZA 1YI3A 3PG1A 4J8MA 5L2IA 1OM1A 4GKIA 2VTMA 3QUPA 5K4JA 5KMIA 3UP7A 5DNRA 3R73A 2Q0BA 5HG7A 2W17A 2A27A 4FKQA 2F7ZE 1IASA 5EQEA 2Z7QA 1U46A 4YO6A 4LOQA 4AOJA 4DLIA 5CASA 2XCKA 3U4UA 3F3UA 3Q32A 2EXEA 4E20A 4PNKA 1OI9A 2UW4A 4L46A 1MQ4A 4D4VA 3A4PA 3DJ7A 3UIXA 3VBTA 4CRLA 2CKEA 1WBWA 4FIJA 1PY5A 2VX0A 4X2KA 1JSUA 4C58A 4W4YA 5A3XA 3L1SA 2P2HA 2XNMA 3F7ZA 4WSYA 1HCLA 3DJ5A 3UZTA 4DBNA 3QLGA 4XS2A 4EHZA 4O7YA 1OB3A 3UOLA 4E26A 3HP2A 3E93A 3EWHA 4EK3A 2H6DA 2X0GA 5C8KA 4CLJA 3MVMA 3FSFA 4J1RA 4ZMEA 1H1QA 4NIFA 4DFNA 4AS0A 2PYWA 1OKWA 2IZUA 4IAKA 4ZSGA 4C57A 4DBXA 4EHVA 2O8YA 1QPDA 1OVEA 4Q2AA 2XZSA 3OUKA 2W06A 1G5SA 3UODA 1KUTA 2ITUA 2PULA 3WE4A 4YJPA 3KCFA 1AGWA 5IMEA 3WE8A 2XB7A 4AW1A 4MHAA 5E8YA 3VS4A 5KMOA 3CJGA 4CT1A 5B2MA 5JH6A 3F61A 1G8AA 3FUPA 4DGLC 5LJJA 1XH7A 4EORA 1Q8UA 4F09A 4W9WA 2FO0A 4O7SA 2OH4A 1EH4A 2Z7RA 4MWHA 3VRYA 5CF4A 4ID7A 3LXPA 3LMGA 3PYYA 5LVOA 4JNWA 4RC4A 2Y6OA 1FVTA 4FKGA 4BDFA 2E9NA 5JEBA 1WVXA 1KE5A 4IACA 2HXQA 5I9VA 2O3PA 4CZUA 4EZ5A 5JFWA 2WXVA 2XK6A 3I81A 3U55A 2X7OA 2VD5A 3HA6A 2HZ4A 3Q04A 5DR9A 5KE0A 3TUCA 2PVFA 4FKLA 4QP2A 3AD5A 2AUHA 4BC6A 4AFJA 4F9WA 3UOKA 3NW6A 3UIUA 3ZEPA 4GH2A 5AUUA 5CU0A 3R8UA 1B6CB 3OCBA 3R8MA 3TV6A 3UGCA 4Q9ZA 1YHWA 5M56A 3DXQA 5HE2A 3VUTA 4PMPA 4TL0A 4QMWA 3KEXA 3VNTA 4UALA 2FA2A 4MD7E 4NJDA 4HYIA 4YC3A 1REJA 5EHLA 4CT2A 4ZTQA 4H58A 4EOMA 2ERZE 1Q8WA 2W5AA 4FZFB 4MQ1A 5CENA 2BKZA 3TZ8A 4JX7A 4M3QA 3RPRA 2VTRA 4CZYB 4BTJA 4DEDA 4PTCA 3KRRA 4UZHA 5DT0A 4U0IA 1MRYA 2IVSA 3LXLA 4L52A 4G6LA 4GUEA 4Y8DA 4M97A 2YDIA 4PWNA 3UMXA 1H27A 3L8SA 3BLHA 1LR4A 4FKIA 3VUIA 3THBA 2OJFE 5FG8A 4DTBA 2WIPA 3FZ1A 1OECA 3Q60A 3ZUUA 2GNGA 4BCGA 4QMSA 3PA5A 2BR1A 5HNIX 4AGDA 3HV5A 1U54A 3O7LB 5JGAA 4KIPA 3GXLA 1WBOA 4ZIMA 4WNOA 4LI5A 4L01A 1YOMA 3BGZA 3TZMA 3C9WA 3PXFA 1Y91A 1KV1A 4WNMA 2P55A 2PTKA 3GNIB 3I4BA 3REPA 3VS0A 5KMJA 3D15A 3MSSA 3ORNA 3LCTA 2QKRA 4B8LA 4BI2A 4L42A 3LFSA 3QBNA 4IQ6A 2JDTA 5ANJA 3MA6A 1PXJA 3DTWA 2YITA 3WYYA 1RW8A 2UW7A 5IQDA 3FLQA 3LW0A 4UMRA 3R21A 4FT5A 4IAYA 3A7HA 3JR1A 3KK9A 3CY2A 3CQEA 4JR7A 3RJCA 4GK4A 4CMUA 3UC4A 3R28A 4A9UA 2YIWA 5FQDC 4MCVA 3W2RA 4O91A 5HE3A 4JS8A 2CKOA 4UMQA 3IS5A 4XP0A 5JFVA 3I60A 5G1XA 4PPCA 4U8ZA 4FEQA 2VX1A 4H39A 3KULA 5EOBA 4CTBA 5JKGA 4KA3A 2VO0A 4EBWA 3ACJA 4NEUA 2J90A 3DAKA 4BTMA 4ZTHA 4IAIA 3E88A 4RJ5A 5H3QA 1OIQA 1RQQA 4FIIA 2JDOA 3BGPA 4AWIA 5HORA 3G9NA 3EFLA 4RGJA 5T68A 4BGHA 3PG3A 5CANA 2YCSA 2YM8A 4DHFA 2OKRA 3EN9A 1DAWA 2IZRA 4EWHA 4R7HA 2QODA 2W99B 4DFLA 4DG0E 3W33A 4QMTA 4XEYA 3AMBA 4DF3A 1FINA 4I94A 1XH9A 2GHGA 5M06A 5BUJA 3S1HA 2XKCA 4CMTA 3WF5A 3A7FA 5C1QB 5HO7A 2RIOA 2YWPA 2R3FA 4ARKA 4GK2A 4M67A 3V5TA 5M4IA 5IH6A 4O6LA 5IH5A 3F88A 5IUGA 3AMAA 3RALA 3ZLXA 2VNYA 5ETIA 5FEQA 4K0YA 3FMHA 3GOPA 2WEIA 4X2JA 3QGWA 3AC1A 2G15A 2JFMA 3LFDA 3UBDA 3V5PA 3HNGA 1YOLA 1OZ1A 4OTGA 5CI6A 3AC3A 4E6QA 4LRKA 5C26A 4J99A 3RAHA 2PE0A 4FTTA 4YJUA 3GU4A 3EL7A 3BYMA 1XH5A 2YLFA 3DQWA 5D10A 2E9UA 3UOJA 3D14A 5BVKA 2Y4IC 3WOWA 1JAMA 1H0WA 4E7WA 4IDVA 5BNJA 1RJBA 3TT0A 2XEZA 4I0TA 1FOTA 3HP5A 3PJ2A 4BFMA 5DMZA 4DT8A 1UWHA 4HCUA 4OBQA 4P90A 1WBVA 4XG2A 1OPLA 2FSMX 3QZIA 2REIA 4OBPA 4GJ3A 3MVJA 3HRFA 4EWQA 3R1SA 4FKRA 3Q52A 5IQFA 1LP4A 2WMXA 3TL8A 4YJRA 3D4QA 2E2BA 2YCFA 4FOBA 5DR6A 5AP2A 2Z2WA 3COIA 3UDBA 5IQCA 4ZMFA 4FSRA 4EC8A 2WFYA 4EEVA 4C4HA 2Y0AA 4A07A 4GK3A 2R3GA 4NJ3A 4S32A 5IEYA 3S95A 4MWIA 3TIYA 3UYTA 2XRUA 3UQFA 4K6ZA 1OL6A 1X8BA 2PVRA 2XNPA 5HGIA 4WHZA 4JRNA 3AMYA 4C4GA 4CFUA 4EH6A 4KAOA 2WIHA 4AOTA 2WTVA 2QG5A 4AUAA 2HWOA 4ALUA 2YIRA 1L3RE 2A19B 4LGDA 3QRKA 2WELA 3NYXA 3QTSA 5CZHA 3VRZA 3VS7A 4L43A 3TWJA 3POOA 5KO1A 1Q24A 2BZJA 2WTJA 4O0RA 4UZDA 3RCDA 3HV3A 5HICA 4AZTA 5KX8A 3UYSA 5FM2A 5I9YA 3IDCA 3NW7A 1YXVA 1M17A 3R00A 5IKWA 2CGUA 4D2WA 2XM9A 4XBUA 2E9PA 2C5NA 3OF0A 5I5ZA 5CU4A 3LJ0A 3OTVA 5CAUA 2R9SA 5C27A 1Q4LA 2C5YA 4GEOA 4KKGA 4Q5EA 4R5YA 5HD4A 2WPAA 1FGIA 4M13A 5JQ8A 4FKPA 2V7OA 2WTKB 4QYFA 5FUTA 4UV0A 3ZFMA 4RIXB 2WMBA 3M2WA 3OY3A 4CFVA 4V05A 3B8QA 1Q8ZA 2EB3A 4BDBA 2HCKA 4BBFA 1NW1A 3NEWA 4LOOA 3FYJX 5EI6A 4D55A 4GYGA 5HLWA 4UEUA 2UZUE 3JYAA 2J2IB 4G1WA 4FG9A 3CTJA 3U87A 2JDRA 4USDA 4CQGA 4IX6A 5H9BA 3PY1A 2XK8A 4IVDA 4RJ6A 4TW9A 1ZYSA 1RE8A 2IVVA 3VUDA 4C38A 4HOKA 4QP8A 4R1VA 2CGWA 3PVGA 3AD6A 4M68A 5ACKA 3EQHA 2B7AA 4R7IA 4J98A 4FYNA 3UVPA 1Y6BA 3LLTA 4DH8A 1MUOA 2WD1A 5K0XA 3CTHA 2H34A 3GFWA 4CFMA 5DVRA 3IW8A 3DCVA 4PDYA 1HOWA 1ZY5A 5IQIA 4R5SA 3FV8A 3N4TA 3GGFA 3POZA 3KXMA 3MIAA 2XIYA 3IW7A 4JQ8A 3HUCA 2WMTA 3VS6A 4BYJA 4ZK5A 3BV2A 3DBQA 4D1ZA 4C34A 2QOFA 3NS9A 2XJ2A 5CQUA 1XBBA 3O96A 3NCZA 4YO4A 4BDGA 4BDKA 4PRJA 4WT6A 2X7GA 3FMJA 3NDMA 2GNFA 3VS2A 3ZONA 5EYKA 5DFPA 3JVSA 3NVMB 4DYMA 2ZDUA 4FNYA 2YM7A 5GNKA 3VJOA 5CEKA 5GZ8A 1W84A 3NIEA 2J0LA 4ZJVA 3TACA 2HELA 2VTNA 2W9ZB 5JZNA 3ODYX 4HGEA 3COHA 5I4NA 1WBPA 4QTCA 1IAJA 2XK7A 5M55A 3CIKA 2WHBA 1F5QA 3CD3A 4E6DA 5CEMA 3QHRA 4TPTA 3F3ZA 5L6WL 3OT3A 4RMZA 4QQJA 5BMMA 3PIXA 3W2QA 4Z7GA 3IQ7A 1SMHA 2QD9A 4IB5A 3I0OA 3WF8A 3PLSA 2WMSA 3KC3A 5IQEA 2ITWA 5CQWA 3C4XA 3MESA 2H8HA 4J95A 4O0WA 4N57A 5CU2A 4M66A 4EJNA 5LOHA 1JPAA 4U43A 5HBEA 4BTKA 4CKRA 1LPUA 2JIUA 4FZ6A 4K8AA 5D7AA 3V3VA 3LLAA 3EQDA 3FLWA 3COKA 2VX3A 4I20A 1KV2A 4I3ZA 4L67A 4PDSA 4YPDA 1P4OA 5AV3A 2XM8A 4Y5QA 1YWRA 4E3CA 4I93A 4R7BA 4ENXA 1YOJA 4JAIA 3WZUA 4EHGA 3QHWA 1MRUA 4F7SA 3DKFA 2FYSA 3GENA 3DOGA 5E8ZA 4CNHA 2OXYA 4BRXA 4JQEA 4EOLA 3A61A 1VEBA 5IDPA 4UB7A 2XK3A 2O2UA 1XHAA 4M0ZA 2PVMA 1YVJA 5CNOA 1M2PA 5DE2A 4AP7A 3GC7A 2P0CA 3E5AA 4FC0A 5J1WA 2R0IA 3DPKA 2OICA 3KXNA 3KY2A 2UVZA 4PTGA 3DA6A 5D11A 2R7IA 2J0MB 2WMRA 1W82A 3BYSA 3BWJA 4GG7A 4PV0A 2Z60A 3Q4UA 3OCSA 4F7LA 4GYIA 2HENA 2HK5A 3G6GA 2PY3A 4QQCA 3KXZA 3FZOA 4JBPA 4BN1A 3IK3A 3DZOA 4O27B 3H30A 2UZDA 2ONLC 4ZJIA 2XJ0A 4YTFA 2CGXA 3GUBA 3ZO4A 1MP8A 3KXGA 3QRIA 4FTNA 1JKLA 5CX9A 1AQ1A 3TTIA 3SG8A 4C4EA 2R3OA 3D5UA 5JRSA 3DB6A 2YWVA 3E8EA 4AW0A 2R3IA 3L9NA 3QZGA 4CQEA 5J79A 1KOAA 5D41A 5J7BA 3GCVA 4DEAA 2Z7LA 2EWAA 3OOGA 2R3LA 2WOUA 2YZAA 3P08A 4H1MA 4I5HA 2FGIA 5BVNA 3QLFA 2QOLA 3MY5A 5HTBA 5D7VA 3BHTA 4IBMA 4XH6A 3TTJA 3UIMA 2UZEA 1H1SA 2QONA 3ZLWA 4F1TA 4L68A 4A4XA 3UC3A 4BCKA 3CPBA 4W4XA 3OY1A 3L8VA 4YUQA 5EK7A 4J97A 2YDJA 3VHKA 3LCSA 4JI9A 3G51A 5DR2A 3TZ7A 2JD5A 4AE9A 2VU3A 4ASZA 4IANA 4JLCA 3TEIA 1OKZA 4QQ5A 5KHXA 4C59A 4GU6A 2WGJA 3EOCA 3GU6A 2RKUA 2W1ZA 2C1BA 3FSKA 1DAYA 3W2SA 4IW0A 2WTWA 2RF9A 2XNGA 3Q4TA 4TRLA 4KIKB 1OIRA 4QYGA 3HUBA 1O6LA 3ORTA 4EK6A 4FV6A 3EFWA 3FAAA 3KMUA 4AAAA 3VO3A 1ZOEA 5KBQA 3R9NA 2F57A 2BAJA 3OOMA 2R5TA 3U9NA 2Z8CA 4DINA 5LXMA 3BEGA 4LL0A 4OLIA 3FXWA 4AZFA 1WFCA 4I5CA 3Q4CA 2O0UA 5AUXA 4O0SA 3MYGA 3DXNA 3P5KA 3UZRA 3C0IA 3VUKA 5DGZA 2C47A
chains in the Genus database with same CATH superfamily
3Q3BA 4GIHA 3R1NA 5DHJA 2BILB 4C3FA 5GZ9A 1Y8YA 3PFQA 2ZOQA 2GSFA 4RWIA 4WOVA 2GMXA 4YBJA 4DH7A 2VTHA 1JSVA 2BPMA 2C0IA 3UDZA 3S0OA 4FUYA 2UV2A 3D5XA 5B2KA 3SVVA 3L9LA 5ANGA 3SC1A 3R2YA 4XHKB 4O4CA 3PWDA 3EIDA 3TNPC 4D58A 2PL0A 4M15A 4EOSA 1GOLA 3CD8A 3PXRA 1OL1A 2NP8A 3KGAA 4AU8A 3SOAA 5IDNA 5J1VA 3W0MA 5GJFA 3ZRLA 5HX6A 2BDFA 2XKEA 4V01A 4O7VA 2WQMA 5AR8A 4FKTA 3PSCA 2FSLX 4FX3A 1G8KA 1HCKA 5LWMA 3ULIA 3FDNA 4L00A 1ZMWA 4YR8A 4RA4A 2WQOA 2QNJA 3EKKA 3RMFA 2W9FB 5AA9A 1QPCA 2QU6A 2IW6A 4IADA 2YEXA 2RL5A 4FT0A 4BZOA 1CSNA 3F6XA 3GFEA 3QRTA 3R22A 4IX3A 4BWPA 5KNJA 4ZTRA 2ITVA 3PPZA 2HIWA 2P4IA 3QYWA 1JKKA 1BKXA 5HIDA 5EQYA 3QTRA 4XG3A 2ETRA 2GHMA 3OWJA 2XIRA 3ZXZA 4LL5A 4TYHB 5H8EA 3PJ1A 4OTFA 4YP8A 2A0CX 4EH7A 2VTJA 2YFXA 3MH1A 3OCGA 2CKPA 3T9IA 4DN5A 3I0QA 4FKSA 4EK5A 3ZUVA 3P7CA 3IONA 3RI1A 5HBJA 3EYGA 3O0GA 1PXNA 3U6JA 3F2RA 4MXCA 5I3OA 4A9SA 3PVUA 4AZEA 1UNHA 3HAVA 4QP9A 4F1OA 3R02A 5FRIA 1H0VA 2UVYA 3ZXTA 2XARA 4XG7A 4D2PA 2X8EA 1ZZ2A 5ANOA 4KRDA 1OPKA 2R3HA 2OO8X 3HZTA 2J0IA 4D2VA 3UTOA 2PMIA 4X7QA 5TR6A 1YHVA 2H9VA 2I0YA 2PZYA 3BIZA 2WQBA 3ODZX 3FC1X 5DT3A 5IEXA 2OJGA 3RBWA 4F0FA 4L53A 4YTIA 3QQFA 2C6EA 4O0UA 4E73A 3HEGA 5K9IA 5L8KA 1CMKE 4FTRA 2BRHA 2HW6A 3A7JA 4GT5A 2J50A 5IG1A 3EMGA 5HTIA 1FVVA 4MNEB 3V5LA 5HVKA 3I6UA 1J3HA 4J7BA 4MVFA 4X21A 1BX6A 2PHKA 4HPUE 1H00A 3MVHA 3V6SA 3CJFA 4EQCA 3LMIA 3W55A 4O7RA 3CXWA 5ACBC 3NNVA 4F7NA 4QTDA 3OXZA 2C5XA 3TNHA 4C8BA 5I9XA 2VTIA 2OJJA 5GHVA 3BELA 5BQ0A 3D0EA 3OROA 4Z7HA 4IMYA 5FM3A 2PUPA 1JBPE 4EKKA 2RG5A 5E8SA 3NUAA 3EQFA 1REKA 3PJCA 4L7SA 4AGWA 5JN2A 3E62A 4F0IA 2IVUA 3HMMA 4QYEA 1GZ8A 5HLNA 4CEGA 4DDIA 2VO7A 1ST4A 4I23A 1GY3A 2XYNA 3ZLSA 5LCJA 2YDKA 4BIDA 4JR3A 4CG8A 2C3IB 3K54A 3VWAA 2IW9A 2PZIA 2BRNA 4YZDA 5F94A 5GJGA 5KBRA 3PDTA 4R8QA 3TI1A 3MB6A 3AT3A 1PYXA 4ZAUA 1M7NA 4IWOA 5BVWA 3BE9A 3EZVA 3VF8A 4B8MA 1P4FA 5I9WA 2W1IA 4WG5A 4C2VA 4RIYB 4RIXA 3TN8A 2QQ7A 2QHMA 2R3JA 4FL1A 5AR3A 4A9TA 4ERKA 1GJOA 4R1YA 2AEGA 4CXAA 3LE6A 4HYUA 3U54A 3VONA 4OTHA 4MQ2A 1WVWA 3A7GA 4FRFA 4G3DA 4I0RA 3H9FA 4KWPA 4UMTA 5LVLA 2YJRA 3NCGA 4G5JA 2HXLA 5EM6A 5BVDA 4QP4A 1O6YA 4GFMA 4MXYA 1PXMA 3LFFA 4GCJA 4BJJA 2F2UA 4ZY6A 5E8UA 4HZRA 3FXXA 3RNIA 3D94A 3HMPA 2JAVA 2C0TA 3DFAA 4F6UA 3RHXA 2UW5A 1ZXEA 2IF8A 1A48A 2PPQA 4NW6A 1UU9A 4ZSEA 4WG3A 3ZOSA 1UWJA 3UOHA 3KRJA 3FZTA 1UU8A 1J7IA 3BYOA 1MRVA 2BAQA 3HL7A 2PZPA 5AR2A 3LHJA 3BQRA 2XYUA 4IJ9A 3ZRKA 4BCMA 4CRSA 4R6VA 1APME 4GKHA 3QC4A 4B7TA 4U80A 4JJRA 4DFZE 2V62A 5D1JA 2ZM1A 2ERKA 3FKOA 1NXKA 3FI3A 4HVHA 3P78A 4AXDA 2J5EA 3MH3A 4Z55A 1CKJA 2IZSA 4UMUA 2G2HA 1Y57A 3MA3A 3AC2A 3SLSA 3RPVA 1FPUA 4W4VA 2XJ1A 4P7EA 4R3CA 3R63A 3MFRA 4EYJA 5CXZA 3DNDA 1UA2A 2XA4A 4ONAA 3UVQA 3KN6A 2XCHA 3EKNA 2RGPA 5FGKA 1NVSA 4FTLA 1H28A 3FLYA 5KZIA 1R0PA 4AFEA 1OBDA 2X4FA 2JKOA 4GUBA 1KE8A 5D12A 4O82A 3CSVA 4MD8E 3ZC5A 4O7LA 2CN5A 4ZP5A 3I5ZA 5HEZA 4FV7A 3SRVB 4NM7A 4NFNA 5F1ZA 2WNTA 3FBVA 3E87A 2DS1A 5KMLA 5BV3A 3OG7A 2BUJA 2OZAB 4HGSA 5BYYA 5M4UA 3GC8A 1TKIA 3WZDA 1KE9A 3E8NA 4ZOGA 2JDVA 2UZLA 4FT9A 5CY3A 3NAYA 4HCTA 4O38A 4DGNA 3EQBA 3VN9A 4IB0A 2UZBA 3B8RA 4JIKA 2HAKA 4A06A 5M4CA 5FTGA 4DC2A 5EFQA 2WB8A 3C4WA 3NPCA 4I24A 3VJNA 3IG7A 4W4WA 4ZTMA 4TY1A 1O9UA 4EK4A 4H3PA 3PZEA 4I41A 2JGZA 3L9PA 2CDZA 1IAHA 5IQBA 3GU7A 3H0YA 3PUPA 3ZM4A 5LQFA 4G2FA 4FJVA 2ITZA 3UJGA 4K9YA 5J87A 3C4CA 4FICA 2X8IA 4XV9A 5HE1A 4CFFA 2NPQA 5ICPA 3DZQA 3QD0A 4YGAA 2OXDA 4KSPA 4BICA 4IE9A 3P7BA 4KRCA 4KKEA 5E8VA 4FEWA 4OTRA 5DRDA 3LXKA 4UXLA 2ZV7A 2XMYA 2PVLA 4YJQA 3CBLA 2R4BA 2XIZA 4FV0A 3UO6A 5JK3A 5M4FA 4O7TA 5DG5A 2QO9A 2YABA 3NUYA 3FXZA 4BB4A 5DBXA 3LKMA 1ZLTA 4J96A 3HX4A 3RAKA 4L3PA 3W0PA 3NNXA 2WOTA 4FTCA 2XRWA 2BDWA 2GCDA 3L8XA 2HZNA 4ANOA 4JG8A 3MPAA 2X81A 1M14A 3ZDIA 3GC0A 4B99A 1GZKA 3GEQA 5HI2A 1H8FA 2CN8A 3EN7A 5KKRB 2PVKA 1JKTA 5J9YA 2CNUA 5CVHA 1XQZA 3WZJA 1Q3WA 4NCTA 5DPVA 4CTCA 4F63A 4J53A 3C4ZA 4G16A 3FYKX 3IECA 1CM8A 1V1KA 4QMQA 2OSCA 3F82A 3QALE 1B39A 3FI4A 3FLZA 3R7YA 4MAOA 2JIIA 4YLLA 2PWLA 4H36A 3DKOA 4UWBA 4F9YA 5HVYA 4MH7A 4P4CA 5EM5A 1U5QA 4EUUA 3GCUA 4DEGA 2FSOX 4FTIA 2FUMA 2B53A 2HWPA 4XV1A 1JQHA 2VRXA 5FDXA 3VUGA 2QOBA 4F6SA 3CGOA 2XK9A 3PA4A 5CU6A 5AV1A 1W98A 4KABA 2KULA 2UZWE 3LM5A 1OKVA 2WMUA 4Y83A 3R9OA 3ZTXA 5KMNA 4NM3A 1ZRZA 4C0TA 4IC7A 2QOCA 2C6IA 2R2PA 4KIKA 4OTIA 1CDKA 3SKCA 4ACCA 1PHKA 3H3CA 4PQNA 3GP0A 5CAPA 3O50A 3R6XA 4FA2A 4XJ0A 5HU9A 4O4DA 1H07A 4PP9A 5DEWA 3G0EA 2GNLA 2YM4A 4WUNA 1KSWA 5EH0A 4O84A 5E7RA 4I0SA 1PXOA 4IIRA 3C5UA 1SZMA 4P5ZA 3VBXA 1IRKA 1ERKA 4A9YA 4D0XA 4UXQA 4USEA 2UZOA 2A1AB 5FP6A 4BHZA 5HD7A 4F78A 4NW5A 5K3YA 1SNUA 3IW4A 3MPMA 4YHJA 2BRBA 3E63A 3FLNC 4BL1A 3B2WA 1G8JA 5G6VA 3R9DA 4IAAA 4EI4A 3LFAA 4RJ8A 1W8CA 2F7XE 3ALNA 4C7TA 1YDTE 1YRPA 1VZOA 1W83A 4ZXTA 3FZPA 4WBOA 4ZEGA 3VW8A 2G01A 2CLXA 2WU6A 5J8IA 5L2QA 2VWWA 3WBLA 4UMPA 4G5PA 4OBOA 3W32A 4ACMA 4D2SA 4Y85A 3TV7A 3UVRA 4JBOA 3BI6A 4DT9A 2PE2A 4FK3A 4X0MA 4DEIA 2O64A 3PXKA 4O0VA 2OJ9A 4I1ZA 2PVNA 2C6OA 3JXWA 3RPOA 2G9XA 4YJVA 2X1NA 2B52A 3MVLA 2UZNA 3PP1A 4MF0A 4K77A 3BWFA 3HLLA 3RZBA 5AUVA 4N4SA 4FF8A 4C4IA 3UPZA 1YWVA 5JSMA 3BE2A 2WQEA 1XBCA 2YCQA 4D5KA 4NFMA 1H24A 3OW4A 3CGFA 4MNFA 2X9FA 3FWQA 3OBGA 2J6MA 4Z3VA 4IVAA 4ZLZA 1V0PA 4USFA 2J9MA 3DJ6A 4YNEA 3V8TA 5HZNA 4EH3A 5D9HA 2QCSA 3ORXA 5IUHA 4LMNA 5J7HA 4DE4A 3LCOA 3RM6A 4TYHA 2OFUA 2Q0NA 4IWPA 5CVGA 3N4UA 3KXXA 2W96B 3W0QA 2UW8A 1KWPA 4XP2A 3G15A 4FIHA 1XWSA 4GL9A 3NUPA 2VTTA 2ZV8A 4LFIA 4JDIA 2OI4X 3IW5A 4V0GB 3PP0A 3U51A 1TZDA 5HIBA 4YTHA 4BKJA 3KU2A 2IVTA 2GPHA 2YHVA 4QQTA 3ULZA 3E7OA 4WSQA 2NYAA 1YWNA 4ZJJA 4GT4A 2IN6A 5IQGA 4CCBA 3NAXA 1E1XA 4M69A 4MXAA 3LCKA 5CS6A 5HO6A 4ACDA 4LM5A 2QLUA 2RSVA 4FEVA 2B54A 4I6QA 3BGQA 1S9IA 4MX9A 5CAQA 3CTQA 4KKHA 3UZPA 3FEGA 1GZNA 4U45A 3RPYA 3KXHA 3Q9XA 5CSHA 3QAME 4C4JA 5BVOA 4FEUA 5TF9A 3MW1A 4X3FC 5TKDA 2R0UA 1YXUA 2W5BA 3RGFA 3NX8A 4LUEA 4EH9A 2R3KA 4MNEA 1VJYA 4HZSA 4LV5A 2WAJA 4HPTE 3V8SA 4QP1A 4AG8A 4BHNA 3BYVA 3PE1A 3O7LD 3V6RA 1GIHA 1MQBA 2F49A 3BHVA 4A9RA 4NL0A 5E8XA 5B0XA 3NUXA 3V5QA 3LFCA 4E6CA 3NGAA 4FKOA 4MYGA 4EK8A 3LFQA 3DLSA 4APCA 2CPKE 1XO2B 4TN6A 3I6WA 2HY0A 2VWBA 2X39A 4BCPA 3RZFA 4PPBA 1ZOGA 5AEPA 3QCSA 3MBLA 4BCIA 2EB2A 3EQGA 3HDNA 3LQ8A 4EOKA 4GFOA 4OTPA 5M07A 3QD3A 4IZ5A 4L9IA 3NUNA 5AM6A 2J5FA 2RG6A 3DBCA 1Q97A 3RINA 3TKUA 3R2BA 3IW6A 4FL2A 2VWVA 1OBGA 3FMLA 3QD4A 4NKAA 2W5HA 2LAVA 3FLSA 2BFXA 1YXXA 3AXWA 3AT4A 4I6HA 3S4QA 2V7AA 3ZC6A 2VNWA 3UO5A 5GINE 3LQ3A 3R30A 4DTAA 4E4LA 3TM0A 4RIYA 1Q8YA 3W18A 2Y6MA 1Q99A 4M14A 3P7AA 2WTIA 3AQVA 3EJ1A 3GU8A 4FR4A 1BUHA 5CEPA 1BL6A 3HGKA 3PRIA 2X9EA 2YISA 3MGYA 1ZZLA 3EZRA 4YJNA 4CFXA 5EDQA 4QMLA 3UQCA 1OUKA 1OMWA 4B4LA 2HZ0A 3FY2A 4U44A 3OVVA 2KTYA 4F9BA 3K2LA 3QQJA 4O0YA 4RJ4A 5A14A 2F2CB 3QC9A 4G9CA 3VW6A 3QD2B 3L9MA 2VTOA 4M0YA 2CCIA 3NRMA 4BDCA 2I1MA 1UVRA 5ANKA 4BTFA 2C6LA 2ZVAA 2X2KA 5H8GA 5HVJA 4RZWA 1ZMVA 1XBAA 2V0DA 4D9TA 5H2UA 3U6IA 3TDVA 4GRBA 1R3CA 3BU6A 4GFGA 4IFGA 4IM3A 4CFNA 5BUIA 3EQRA 2VUWA 2W1CA 4FI1A 5AV0A 4C3RA 3DT1A 5A4CA 3T3UA 4G3EA 4LQMA 4BGQA 4O7NA 4DCEA 4FV8A 5CALA 4DG3E 3R9RA 5AUYA 1YI6A 2W4KA 4CV8A 4QPMA 4FSZA 4FK6A 4PL3A 4APPA 2PVJA 1LEZA 3CY3A 4O0TA 4GVAA 5KCVA 5J9LA 4FG8A 5AWMA 3VBVA 2YM3A 3RAWA 4QMUA 4YMJA 4ZZOA 3K3JA 3RVGA 3DLZA 4EHEA 3C50A 1PRYA 3MTFA 1XH4A 2ETKA 2VO3A 3RPSA 1BL7A 3QKKA 3CCNA 4FTUA 5HG9A 3SRVA 4XUFA 4O81A 2F7EE 1OIYA 4TYIA 4ZZNA 4YZCA 4S33A 5AX3A 2HOGA 1W7HA 3ORMA 3DK3A 4FKWA 2OZAA 4X6QC 4AXAA 5KZ0A 3KRXA 4X2FA 5M53A 2C0OA 2Y4IB 3DBDA 3H4JA 4P2KA 5C8NA 3NVKI 1W2CA 4U9AA 2WTDA 4AN3A 3F2AA 5CLPA 5IA2A 3DU8A 1OPJA 2QOHA 2X8DA 3LJ2A 3GU5A 4AT5A 5CT0A 1GIIA 4IX4A 2X0QA 3AC8A 3ZO2A 4FVRA 4DH1A 3SDJA 4ZLOA 4D28A 3GB2A 5AMNA 3FKNA 4MKCA 3ETAA 1P2AA 3DQXA 4FSTA 4MEDA 1GNGA 5E1EA 4CKIA 3QKLA 5IA3A 3A7IA 4I92A 2GS2A 4LYNA 4QMPA 4C35A 2XBJA 3KCKA 2VO6A 3JPVA 3P86A 4QNAA 4I22A 3VBYA 1M2RA 5DYJA 2XF0A 4X3FB 5A46A 4XYFA 2QURA 4XG6A 4CLIA 2YAKA 2BHEA 3H9RA 4JRVA 4U79A 3VQHA 1OL7A 5AADA 1R78A 2YERA 3G90X 3ERKA 4E93A 4O2PA 2BZIB 4TWPA 2XP2A 1YW2A 3NYVA 4FL3A 2F9GA 5DLSA 4D4SA 3QKMA 2OIDA 2HW7A 4D2RA 2JKKA 4NM5A 3OUNB 3OP5A 2YIXA 4KS8A 1YKRA 5T6KA 5JT2A 3FMKA 4FV5A 4O7WA 3AG9A 3BLRA 3GI3A 4IZ7A 5HLPA 5IF1A 5M57A 4EKLA 5AUZA 3KMWA 2JBPA 3KMMA 3L8PA 1RDQE 2BALA 2IWIA 4XMOA 3SX9A 2YIYA 3QA8A 5JGDA 3TNWA 5EYCA 4JQ7A 3ZU7A 2C6TA 3PY0A 3K3IA 4U41A 4AA5A 4AX8A 2HY81 4FOCA 1WBNA 4KBAA 2AC5A 3Q6UA 4YHTA 1S9JA 4AACA 5FP5A 5L2TA 4O22A 4IM0A 5LMKA 2CKQA 2PMNX 3M42A 4PNIA 3M11A 4WUAA 4LUDA 4AN2A 4PL5A 3LJ1A 4C61A 5JFSA 4LV7A 3LQ5A 5CF6A 2CCHA 4YZMA 2ZAZA 3U6HA 1PKDA 2QVSE 4E4XA 4ERWA 3P23A 4ASEA 2XIKA 4ALWA 4RX7A 1QL6A 2HYYA 3D7ZA 3TIZA 4ANMA 5F9EA 4NKSA 3LVPA 4YZNA 4R3PA 5CZIA 3F5UA 3F7WA 3P5JC 3C0HA 1SVGA 4O4BB 5ITAA 3MFTA 5EYMA 4ZTNA 4BWKA 4F70A 4M12A 5AUWA 3FQSA 4YLKA 2QC6A 2PMOX 4FVQA 3FMNA 2VN9A 4S2ZA 2JFLA 3W8LA 4EL9A 2VWUA 4LMUA 4HVGA 3QTUA 4CCUA 3RWQA 4O1PA 3R83A 4ZTSA 1PXPA 4PP7A 4N6YA 5HE0A 4QTEA 3NUUA 1J7LA 3SXSA 2UZVA 4ORKA 3R04A 2DWBA 3RAIA 4WA9A 4TKSA 4ZSJA 5BVFA 2PZRA 3QQHA 2PMLX 5EW8A 4XCUA 3VUHA 4CYJA 3SW4A 5K4IA 4HJOA 3DBEA 4FZ7A 3PVBA 4YHFA 5EI2A 4IB3A 4TXCA 1Q41A 4EOOA 4BBEA 4IH8A 4N70A 3IGGA 5F4NA 4BR3A 1LEWA 4F99A 4QDEA 4U7ZA 5M51A 2UUEA 4MK0A 2Y9QA 2W1DA 2OW3A 3PZHA 3BV3A 5ANDA 5AR4A 3TV4A 4KIQA 4DG2E 5DOSA 5AP4A 5LCKA 3WZEA 4E5BA 2YN8A 2C5OA 4AOIA 5CEOA 2R3NA 5A4TA 3DBFA 3MWUA 2QO7A 2W0JA 3C4FA 4TYEA 2OH0E 2GNIA 3BBTB 4EH2A 3LMHA 3ZBXA 3TYKA 3OBJA 4W9XA 2XNEA 3MDYA 3UP2A 5KHWA 2CHLA 3OT8A 3LZBA 4RC3A 3GOKA 1JVPP 2B1PA 4Z16A 2VWXA 5E1SA 4NH1A 5LVPA 2X6DA 3ZMMA 3BRBA 3RK5A 3W0RA 5CSXA 3QZFA 4FSWA 4EH5A 4P5QA 2G2IA 3JY0A 3R1QA 3A8WA 5CF8A 2HZIA 2ZM3A 4X3JA 3F69A 4M84A 3R7IA 3NWWA 3AGMA 4TYJA 3KK8A 3CQWA 1Z5MA 4M69B 1PMVA 2QOOA 3EB0A 3EFJA 4PF4A 4V0GA 3ENMA 4KBCA 3G6HA 4O83A 4JBVA 2NNWB 4RVKA 2C3LA 2JC6A 3RP9A 2ZDTA 2VTQA 3W2PA 1JNKA 5JMSA 2UVXA 3FMMA 2ACXA 3FPMA 4WD5A 4ITJA 5CSPA 4GS6A 3NLBA 1GZOA 3OFMA 2ZM4A 5KMMA 2EXMA 5EDPA 3OS3A 4RWLA 3SD0A 5ETFA 4DFUA 2OGVA 3ALOA 4BY9E 4D4YA 5CSWA 3E92A 4EH4A 1UKIA 3FI2A 1TQPA 4DGMA 2VTPA 2XIXA 3Q2JA 2C3JA 3PSBA 3TXOA 3HV7A 5FXRA 5TO8A 2XKDA 4EUTA 4PDOA 5FD2A 4KUJA 4ZS4A 1IEPA 2VTLA 4WNPA 4RG0A 5AP6A 1BYGA 1KE7A 3OHTA 3SW7A 2XEYA 3Q53A 4DFBA 4Y5HA 4YURA 4HVIA 4JL9A 3PXYA 1A9UA 1FMOE 1UU3A 4BKZA 3PJ3A 2NRYA 4CZTA 2I7QA 1V0OA 2XAOA 4OTWA 5TT7A 2QR7A 4ENYA 5F20A 2B9JA 3DNEA 4GV1A 4AE6A 4K1BA 4A4OA 5LWNA 1YQJA 4U81A 5E8WA 3RTPA 2J0JA 4OGRA 4BCOA 3V5JA 3CLYA 3MJ2A 3O23A 4I21A 2QR8A 4S31A 4L3LA 4L3JA 5JQ5A 5DH3A 3C51A 4ZSAA 3GT8A 1F3MC 2B9IA 2I0HA 4XOYA 4AQKA 4F6WA 2GTNA 4X6RA 2Z7SA 1VR2A 3N4VA 1BMKA 5J95A 3LFBA 4EZ3A 2BCJA 5CEQA 4JX3A 4AF3A 4L7FA 4PMMA 2UW6A 3EQPA 4MD9E 4X2NA 3VS3A 4BCFA 4PTEA 1SYKA 1URCA 3QYZA 4U42A 3K5VA 3OEFX 2W05A 4IVCA 5AIRA 4TWNA 5C9CA 4BDDA 4XNEA 5IEVA 3OXIA 4OR5A 3KKVA 3OW3A 1ATPE 1CKPA 5GZAA 1E1VA 5HG8A 3NNUA 4JG7A 4DTKA 2XBAA 5IQHA 3O8UA 5FTQA 2E9OA 3OXTA 4NM0A 4AQCA 3BLAA 4H1JA 3HDMA 4GVJA 4N0SA 4UX9A 1OL2A 3PUFC 2AYPA 2ZJWA 4IXPA 5AAEA 3MY0A 4TNBA 5HTCA 5BVEA 4ANLA 2R3RA 3OEZA 4FODA 2AQXA 4ZSLA 3Q96A 3O2MA 1H01A 3IGOA 4QTAA 4FTQA 3O8PA 1H26A 2VGPA 3FQEA 2GNHA 4G31A 3DS6A 2WMWA 3BHHA 1R1WA 3EN6A 4ZS0A 3WILA 2BAKA 4QMXA 2W4JA 1WMKA 4RWJA 3MS9A 5H8BA 4U3ZA 2V55A 4FV3A 3UNZA 4C36A 1H4LA 1M52A 3EL8A 2JITA 3OZ6A 4HYHA 4IAZA 2OBJA 3ZBFA 4AW2A 4MBJA 4EOJA 2OU7A 5LARA 1K2PA 2CGVA 3G5DA 3N9XA 2WQNA 4IX5A 2ZV2A 5LVMA 1ZYLA 2UW0A 3DAJA 4I6FA 4FUXA 4O86A 1YDRE 1R39A 1XH8A 4EOQA 4G3CA 3N51A 1OKYA 3VULA 2XKFA 1UV5A 4MBLA 1ZYCA 2F4JA 3I79A 3DV3A 4DA5A 3VIDA 3R7EA 4RBLA 5A4QA 4ACGA 1QMZA 3OWKA 3OD6X 4XRJA 3NR9A 5CTPA 1P5EA 2J4ZA 4TYGA 4DLJA 3Q2MA 4WKQA 4YC8A 5DI1A 4QP6A 3W2OA 2WMVA 3FZSA 5EW9A 3KF4A 3NFFB 2ITTA 3QXOA 5TOZA 4LDTA 5FEDA 5FDPA 3W8QA 3LPBA 3QA0A 3KRWA 4D2TA 2OIQA 4DGOA 4WO5A 4TTHB 3NIZA 4ALVA 4AW5A 4II5A 3OWPA 5IU2A 3R9HA 4G17A 4BIEA 4BKYA 3NMUF 2J51A 4ANNA 1BLXA 2JKQA 5HKMA 4Y72A 3OTUA 4IHPA 3MV5A 2XS0A 5IA5A 3O51A 4GJ2A 5AFVA 2XVDA 1XH6A 4IC8A 4QMOA 3ITZA 3SAYA 4EYMA 2GFCA 4ZY5A 5HQ0A 5HOAA 2W1EA 4WRGA 2I40A 5AP0A 4KD1A 1XR1A 2JLDA 2X0OA 4K11A 3NYNA 4L8MA 4A4LA 4NTTA 3EFKA 5KUPA 5IA1A 5AP5A 2QHNA 2YA9A 4I4EA 3LIJA 4B9DA 3GQLA 2CNQA 2ZMCA 4NUSA 3ZRMA 1ZARA 3ZFXA 4CYIA 4F64A 1G3NA 1P14A 3AT2A 3CQUA 3FC2A 4PUZA 2BKKA 2CLQA 4X3FA 5HCZA 4FBXA 3TJDA 4E4NA 2PU8A 3G0FA 4BCJA 1ZAOA 4H3BA 4G34A 4JOAA 2FSTX 3LM0A 5AIKA 3AC4A 3PXQA 5CYIA 2IG7A 4R3RA 4FV1A 3WF7A 4TNDA 4LG4A 2ESMA 1T45A 3F3VA 4JIAA 4LGHA 4B0GA 1ZYJA 4F7JA 5CXHA 5BYLA 2YM6A 3F5PA 4F9AA 4XOZA 3PA3A 1T46A 3PRFA 4AXCA 4GIIA 2W4OA 2QOKA 2C6KA 3PTGA 4S34A 4F1MA 3HAMA 2XAMA 4XRLA 3DK7A 2P2IA 1Q3DA 2XNBA 3FKLA 4NT4A 3U4WA 3V51A 4AZWA 4DAWA 4QMZA 4D5HA 1O6KA 1ZWSA 5AR7A 1SNXA 1A06A 2GDOA 4D0WA 2QO2A 3E7VA 5EHYA 4O4FA 2C4GA 1I09A 4LRJA 3GC9A 5L2WA 3ZYAA 1H25A 4N6ZA 3HA8A 3FMEA 3D7TB 3A4OX 4FIEA 2ETMA 4TT7A 5B2LA 4ITHA 4IZYA 4FV2A 4CSVA 5E4HA 3UQGA 5L8JA 1PMNA 3T9TA 5C4LA 5HX8A 3ORKA 2JIVA 3C7QA 1PW2A 4CGAA 2I6LA 2YM5A 2JKMA 4J71A 2B55A 3PSDA 2WTKC 4EONA 4QPSA 5BYZA 4ZZMA 4H05A 4BDHA 4U97A 5FLFA 2O63A 5AAFA 2I0VA 5BX0A 4YSJA 3LFNA 4AT4A 3CPCA 3O71A 4IWDA 1DS5A 1TVOA 1URWA 4RT7A 1Q8TA 4AZVA 4FZAB 3UNKA 3IDPA 3Q9ZA 3EN5A 3Q4ZA 3RKBA 2FVDA 3GCQA 5A6OA 2BROA 2VWZA 2YZLA 4WG4A 5L3AA 1YDSE 4DH3A 2ZFYA 1Z9XA 4RC2A 4UWCA 3CKXA 3D5VA 3IDBA 4PL4A 5CNNA 4O21A 2R7BA 1DI9A 3MFSA 4YBKA 3SA0A 1G8SA 4Y73A 3C5IA 3U8WA 1M2QA 5CVFA 2SRCA 4FNXA 1ND4A 2BMCA 4D1SA 2RFSA 3UPXA 2P3GX 1AD5A 3BYUA 3LCDA 3FI8A 2ITQA 2UZTA 2YACA 4QNYA 5DA3A 4L6QA 2E9VA 1GIJA 2GNJA 4MTAA 4XBRA 4ANBA 4C3PA 3MH2A 3TZ9A 1PXLA 1ZOHA 4YJSA 3H10A 5CEIA 4BDJA 4QDVA 1OGUA 3KA0A 1W2DA 2C68A 1U5RA 1FMKA 2BZHB 4FSUA 2BHHA 3E3PA 4NSTA 3HVCA 5FWKK 3VF9A 4O2ZA 4FNZA 1YXTA 3RHKA 1IR3A 3DK6A