1JBPE

Crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with a substrate peptide, adp and detergent
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
339
Chain Sequence
GEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADEPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title cAMP-dependent protein kinase: crystallographic insights into substrate recognition and phosphotransfer.
pubmed rcsb
source organism Mus musculus
molecule tags Transferase
total genus 113
structure length 339
sequence length 342
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1jbpE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1jbpE02
4MCVA 1JKKA 3NNUA 4UZHA 2NPQA 3F7ZA 4FIJA 4IM2A 1H01A 4X3FC 4I23A 5CEQA 1GIJA 3HDMA 4FL1A 3LMHA 4XG7A 3DA6A 1UA2A 1BYGA 5D7AA 1Q99A 4QYYA 2C3KA 4C35A 4O22A 2XUUA 3HMIA 4E4NA 4FV5A 5JZNA 4FIEA 4O2PA 2OJ9A 3UP7A 3GGFA 3NW7A 4FL3A 1M17A 1VJYA 4H39A 5AUUA 2FH9A 3O51A 4WNPA 5JKGA 3FXWA 3IDCA 3UNKA 1O6YA 3VS1A 3DBCA 3DQWA 2R4BA 4FTAA 4C34A 3GCQA 5CWZA 4YZ9A 3BKBA 2GTMA 3OWPA 5DIAA 5IMXA 2PL0A 5JT2A 1W0XC 3QCSA 5KBQA 3EN7A 3QX2A 4JIAA 4FTNA 1NW1A 5CXZA 2YWVA 3H10A 3KXXA 3GNIB 2X81A 3W2RA 3BELA 3R9RA 1PY5A 3QD3A 3CCNA 5ANKA 2WXVA 3V6RA 4LQMA 1RDQE 3LFBA 3NNXA 4FV4A 1OIYA 1M7QA 4AGUA 4CMTA 4GUEA 3QTZA 1R0EA 4E73A 1TQIA 2WNTA 4TXCA 4ZSAA 1UVRA 3LFCA 4PP7A 4FEUA 2HOGA 5CT0A 3I0OA 4IXPA 4TRLA 4FTUA 2QLQA 4X21A 3KA0A 3SOCA 4EUUA 4DLIA 4QD6A 2A19B 5AUWA 2C69A 1UU8A 3ZUTA 4X3FA 4DGLC 2CNUA 1Q8TA 3NNWA 4BDHA 2QOKA 3TKHA 3SGCA 5A4CA 2UZNA 3I7BA 4B4LA 2QG7A 5M06A 3P1AA 4XG4A 2QHNA 4M0ZA 4O27B 3EQHA 5EH0A 5KZIA 4KBKA 1OPJA 2XK4A 3FLQA 4FT9A 4GIIA 4BIEA 3TUBA 3DLSA 1YRPA 2OH4A 4PTGA 3TN8A 2VRXA 2X8IA 4AW0A 2E9OA 2OWBA 3DKOA 4ZTLA 2XA4A 1CM8A 1O6LA 4YURA 4ZTMA 2IZUA 4TNDA 3GU6A 2WMXA 5IQEA 5JRQA 4FG8A 2X6EA 4FIFA 2ESMA 4APPA 3I4BA 3FLZA 1UWHA 5IEYA 3V5JA 2XK7A 3AG9A 4JOAA 1QCFA 2WO6A 4UYNA 4O7YA 5D9HA 3CD8A 3COMA 2WQBA 4M12A 3R7EA 4B9DA 4OLIA 3ZLSA 4O81A 4X3FB 1OMWA 2Y9QA 3F82A 1R0PA 2BRNA 3Q53A 5AR8A 4LGDA 4XLVA 4I6BA 2YIQA 3B2WA 3QZHA 1FINA 4YU2A 3RK9A 2QONA 4IADA 5GIOE 5CAVA 2ITUA 4F99A 4GH2A 3ACKA 1KE6A 2XBAA 4JX3A 5BUEA 4QQTA 5ANGA 3NEWA 3PIZA 2IVVA 2XS0A 3EL8A 4YHFA 2J5FA 4Y85A 5J9LA 5DRBA 4TWNA 2OLCA 4P5QA 4C4FA 3VBWA 4QP2A 5HEZA 2A4LA 3C4CA 4IZ7A 2ERZE 4LRKA 3C0HA 2Q0BA 4O83A 2GNHA 2FSMX 3OBGA 2EUFB 1OM1A 4N6ZA 2WMAA 4D1ZA 3NYOA 4ACHA 4G9CA 1FMOE 1WAKA 1YXXA 3C50A 3G6HA 1XO2B 3DK3A 5CAPA 4FZ7A 2HWOA 2W7XA 3RHKA 2XNMA 5G1XA 1SNUA 3ALOA 5DPVA 5C8MA 1Y57A 2YZAA 4A07A 4AWIA 3FMNA 1PW2A 3P7BA 4II5A 4EKLA 4G3GA 4C36A 3LFEA 3E8EA 2BPMA 2GHGA 2BUJA 2HXLA 3AMBA 1PXJA 5L8LA 4N57A 4K18A 4YBKA 1A06A 5DNRA 1ZMUA 5GIPE 3G51A 4NKSA 3R7OA 3EKNA 4CQGA 3ZDUA 4RVKA 4YZNA 5DT0A 5L3AA 3QL8A 2RFEA 4H3BA 2OXYA 4ZY6A 1XBBA 2XRWA 4ZZMA 3FI3A 4BTFA 3EYHA 2BCJA 3O50A 4FTQA 4QMWA 4BCGA 4GG7A 2E9UA 1ERKA 3VS3A 1YHWA 2IVUA 2XCKA 2F49A 2OH0E 3L9NA 3OXIA 4MXAA 3HMPA 4RA5A 5TT7A 3PXRA 4Y5HA 2UV2A 4PPBA 3VS5A 1OB3A 3JR1A 4O0SA 2YIXA 4G17A 4FTOA 2PE2A 2W9ZB 1UU9A 3AD6A 3DKCA 3FSFA 3MH3A 4TT7A 5DR2A 3WF9A 2G2IA 5HE1A 4XRLA 4YLKA 2OICA 2CN8A 4CRSA 4ITJA 4LRJA 4IBMA 2VWVA 4AZVA 4IX3A 3UC3A 3DY7A 3B8QA 4TY1A 5FRIA 1X8BA 3IW7A 2CCIA 4RWIA 3PUPA 3TJDA 5IF1A 2Y6MA 4MTAA 5FWKK 4O0VA 4O6EA 3AGLA 5C01A 1OL6A 4L7FA 1Y91A 3E7VA 4PX6A 2QOQA 4QOXA 2QOCA 4BDDA 3BE2A 3RK5A 1RE8A 4BDFA 4F9WA 3TCPA 4JI9A 5KBRA 2BAKA 3TL8A 4OBPA 5CANA 1P4OA 4JQ7A 3UIXA 3LAUA 3P08A 2WGJA 1ZY5A 3I79A 3F66A 3UO4A 2R0IA 3ENMA 4ENXA 3E5AA 4FI1A 3VIDA 4BBMA 3I6UA 1V0BA 3FY2A 5AV3A 5EM5A 3AMAA 4IAIA 3W16A 1OPKA 1Q5KA 1VYZA 1YDRE 2WIHA 4JQEA 2DYLA 4W4YA 4EH4A 3ZCLA 3SG8A 5M53A 3BCEA 4FODA 5AUZA 5BVDA 4CNHA 4LI5A 1BLXA 3M42A 4IC8A 4JR3A 1XWSA 4NM7A 5CSHA 5G6VA 3G90X 4YLLA 3L9MA 3HV5A 4WRSA 1OL7A 4G3DA 3HP2A 3D0EA 4MYGA 4FX3A 2ERKA 3LOKA 2CCHA 2PUUA 4QMTA 3RPVA 4DEAA 3AC2A 2WOTA 3QCXA 4O0UA 3EQDA 4BZOA 3ZXTA 3CJFA 4KKHA 4I3ZA 3GU7A 2HIWA 3HMOA 3ORLA 3A7IA 3OXTA 3ZO2A 4CFWA 5C8KA 3I60A 1XH8A 4HVSA 4K77A 3RM6A 2OKRA 1WVYA 3VUMA 2OBJA 4LOQA 2J50A 4XX9A 3HA8A 3Q04A 4E8AA 5KZ0A 3TI1A 5EM7A 2OGVA 4USDA 4M69A 3OTVA 2BDWA 4ZZNA 3WOWA 3FMJA 4ORKA 3JUHA 2GS7A 2I40A 3CXWA 3PSCA 3KRLA 3NGAA 4FTIA 4LGGA 3ZO3A 2J0IA 2UW5A 3GFWA 3QA0A 4NWMA 4W4VA 5CXHA 2Y4IC 4UY9A 3RWPA 3TEIA 3DJ6A 4YR8A 4CG8A 3PZEA 3MFSA 4XV2A 4AX8A 4Z7HA 4C0TA 3N4UA 4YNOA 3IDPA 2X7GA 3QC4A 4AN9A 4ARKA 3R7GA 4Q2AA 5HX8A 1YXSA 3A7HA 4NTSA 2ETMA 3VQUA 1H28A 2OFUA 2O64A 2IW9A 4DFYA 5CSVA 3HVCA 4DHFA 3JPVA 4FT7A 5D1JA 2VAGA 4C3FA 3R8LA 5HZNA 3EWHA 3A4OX 3O7LD 5JGAA 4XCUA 4NUSA 4M13A 3VBTA 4TYJA 1SM2A 2XB7A 3NVMB 3PP1A 2ZV7A 4NW6A 5DG5A 4HCVA 4RVLA 5E8VA 5B0XA 4F1TA 1KOBA 3Q6WA 2YISA 2VO0A 3DCVA 3OWJA 1M7NA 3NS9A 3QRKA 4M69B 5EM8A 5AR7A 3ULIA 4H05A 5CX9A 5FEEA 3E64A 3TT0A 4FKOA 3TV4A 2OU7A 2RFDA 3HECA 5HICA 3H4JA 5BYYA 3PVGA 2QO9A 4IVCA 4IB5A 4DEBA 3G9LX 3E92A 3MFUA 3Q32A 3AC3A 2Z7QA 3FQSA 4AE9A 3KRXA 4A9SA 2FYSA 4GFGA 3RNIA 4BDAA 1UNHA 5BVFA 4B7TA 5KE0A 4JXFA 3ANQA 3EHAA 1QMZA 4PY1A 4XLIA 4EOQA 5LWNA 3QTXA 4YJTA 5GJFA 4R7IA 4ZMFA 4ZP5A 5IQBA 2E2BA 4MH7A 4Q9ZA 5EW3A 4PNKA 3TDWA 2QOBA 3BHYA 1U54A 3W2QA 4XYFA 3L8PA 2BVAA 1YOLA 2ZAZA 4UMTA 4XP3A 1MRUA 5LMBA 4BI1A 2IN6A 4R77A 5EYMA 3ATSA 3LQ3A 4X2GA 4OBOA 1B6CB 1FVRA 1VR2A 3FKOA 1PF8A 2WMTA 2HW6A 4RVTA 3R8ZA 4EYJA 4LOOA 4D0WA 1XH5A 5L4QA 3OUNB 1YOMA 3IS5A 1Q61A 2YCFA 3M2WA 4OTWA 3P9JA 4H3PA 4CCUA 1JKLA 2FB8A 4BN1A 2W1CA 5LXMA 2WU7A 4WO5A 2A0CX 5M44A 3EB0A 1TVOA 3O2MA 5CAOA 3P4KA 2PVJA 3DDQA 3Q6UA 4IM3A 2REIA 3BU3A 4LV8A 4ZTQA 5LARA 4EL9A 4F09A 2QU5A 4ZSJA 3TKIA 2PZPA 4FKGA 4U43A 3EFLA 3GCPA 4ZTHA 1U54B 3VRYA 4XG9A 4L01A 4F0GA 4FC0A 4F6WA 2Y4IB 4D2VA 4FGRA 4DT9A 4PDSA 1URCA 2DS1A 3NAYA 4NW5A 3TXOA 3TG1A 4CFMA 2O8YA 2OSCA 4L52A 4TNBA 4EHGA 4AA5A 3PIYA 4MBIA 4HVGA 4L3PA 4QMVA 4WBBB 2PVFA 4XOYA 2VTLA 1QPJA 3DLZA 4R5YA 5CENA 1UNLA 4BCOA 3L8VA 4UMUA 3Q5IA 3KY2A 2X1NA 2IW8A 4CEGA 5ETAA 3UZTA 5K5XA 3EKKA 4YNEA 3DNDA 4CRLA 4C57A 2P55A 2PVRA 3R8UA 2GU8A 5AR2A 5C1QB 3H0YA 3UZPA 2VTJA 1UU3A 4L42A 4O0RA 5HLWA 3Q2JA 3ZM9A 4MNEA 4FKIA 2B1PA 3QRIA 5KHWA 1PMEA 3MVMA 2JFMA 5EK7A 2BZJA 2KULA 5AJQA 2QHMA 2G1TA 3QAME 5LVPA 2V22A 3IW6A 4EONA 1OITA 5F95A 3D2KA 2YM7A 3PPKA 2Q0NA 2ZM1A 3V3VA 3R30A 3VWAA 3NAXA 1YXUA 4Y8DA 1OIUA 2UW3A 4CLIA 4L45A 5LVOA 3PSDA 2YJRA 2DUVA 3AT3A 3DFAA 4B8LA 2HAKA 4YHTA 5E91A 1K9AA 1J7IA 1YVJA 4ASDA 2XNPA 1FVTA 3Q9XA 3F5PA 3N4TA 3BLHA 4GVAA 2YDJA 2VWIA 3D7TA 4RLKA 1Y8GA 2GQGA 4EWQA 5B2MA 4NJ3A 5KCVA 3ODZX 4XV9A 5CSWA 2AUHA 3QF9A 4C61A 4NYEA 3E88A 4NFMA 2WU6A 4QMSA 4DC2A 5HBJA 3QTIA 5EDPA 4QPAA 2W4JA 2W1IA 2GCDA 3O8TA 5M56A 2H6DA 4RWJA 3V8SA 2UVXA 4TWPA 5C03A 1G5SA 1RQQA 5AM6A 5LVLA 4EZ5A 3LFQA 3L9PA 2X7OA 5AP7A 1JPAA 2XK9A 4KBAA 5JZJA 3I6WA 3FDNA 3ZFXA 1VEBA 3LM0A 4D5KA 1JQHA 2XIKA 4DGNA 1OBDA 2WTIA 2IW6A 2X8EA 3ZFMA 4LYNA 1ZOEA 1OIRA 2NO3A 3EQIA 4RJ3A 4AN2A 2C5VA 2W9FB 4G5PA 4OTDA 4BYJA 5HE3A 1KE8A 3W32A 4FNYA 4QPMA 4ANNA 2QOOA 2WIPA 2JGZA 3S00A 3TJCA 2R7BA 4ONAA 1OKYA 1SVGA 3ZRKA 2VU3A 3HP5A 3PJ3A 3BU5A 5KHXA 4HZRA 3D7TB 2WTVA 4BCJA 3R8VA 2WD1A 5M4IA 2CDZA 2VX0A 3ZZWA 4E3CA 2BRHA 4Z3VA 5JEBA 4RJ8A 3HRBA 4J8NA 4UV0A 3GOPA 3PWDA 4AW2A 4KS8A 3NNVA 1PKGA 5GNKA 4BKJA 3DAEA 5BVKA 3BYUA 3RK7A 1V1KA 2PZ5A 4D0XA 3GC0A 3UIBA 2R3RA 5TKDA 4FNXA 3F88A 3ZBXA 2X8DA 4MD8E 2GS2A 3GQIA 1YWVA 3QZFA 2W5HA 3EZRA 4M97A 3TDVA 4AE6A 1XR1A 5IG1A 4OTQA 4X2KA 2CGVA 3WBLA 4KSPA 3W10A 1NVQA 2ZV8A 3LCOA 1Q97A 4I6FA 4IJ9A 2QO7A 3WZJA 5LCKA 5D10A 5L6OA 3FKNA 4LL5A 3R1YA 4FG7A 4FT3A 4A9RA 4NM3A 4HPUE 3GU8A 2HK5A 2ZYBA 2C30A 4RX7A 4RIXA 5GJDA 2VTTA 4J95A 2J6MA 3A99A 3QGYA 3DAJA 5IA3A 4BZDA 4G3CA 4GK3A 2J2IB 3ZUVA 3ZLXA 3R21A 4XBRA 2JIUA 2BRGA 2FO0A 4IB3A 4QP7A 4O6LA 3TZ7A 3MVLA 1PMUA 4JBPA 3DFCB 3OD6X 1ZRZA 4U8ZA 4A9UA 3CPBA 4CQEA 5E4HA 4FOBA 5D7VA 4IIRA 3KCFA 2VN9A 3VS0A 3TM0A 1CKJA 1T45A 1FMKA 3JY9A 3Q9WA 1Y6BA 2O2UA 3KK8A 3I81A 4FSYA 4KNBA 1PRYA 4DBXA 1ZYDA 5IH5A 3V5QA 2UW0A 3MTFA 3RGFA 3CR0A 3IOKA 3QXOA 3LJ1A 3PA3A 3QUEA 3KF7A 4TN6A 5CAUA 5IDNA 5FLFA 1K2PA 5E8TA 3LMGA 5KMNA 5FP6A 4M68A 2QG5A 4BGQA 1ATPE 1WFCA 3QD4A 3D2IA 5J7HA 4FSTA 5HTBA 3O23A 2JDRA 3OWKA 2HYYA 5EHLA 2BILB 3MESA 1XKKA 4WKQA 3WZKA 3KMWA 4I94A 4JT3A 2WQMA 4RIXB 1ZZLA 2CHLA 5DMZA 4NIFA 2W5AA 5F4NA 3T8OA 4A7CA 3BYVA 4D2WA 3PVUA 4O91A 1W84A 5J5SA 5CF6A 4L00A 4GFOA 3KFAA 5DBXA 4DGMA 4CKRA 2WZJA 2YWPA 2CKQA 4ID7A 4LGHA 5HO8A 3VBVA 4AOJA 3BIZA 4P90A 3COHA 4DG3E 1ND4A 5KO1A 5FD2A 5E1SA 1ZZ2A 4YTHA 2YLFA 4F0IA 4FA2A 3BE9A 5IEVA 3EFJA 2I1MA 4BI0A 2VWWA 4NM5A 1A48A 3Q4TA 2YM3A 3SD0A 2WMQA 3MB6A 5K4JA 3OMVA 5CU6A 5A4LA 3VHKA 1YI4A 3KU2A 4XG2A 4IZYA 1KV2A 4EC9A 3R83A 2WFYA 2UW7A 2BR1A 3PRFA 2GHMA 2PVLA 4XG6A 4BDCA 2A2AA 1Q24A 4DA5A 4FKLA 4YUQA 2FSOX 1H0WA 2BZHB 4FSRA 4QMYA 1URWA 4ACDA 4FV2A 4NFNA 2R3NA 4FBXA 5L8JA 3OOGA 3GC9A 4EJ7A 4U81A 3I5ZA 4W4WA 2QQ7A 5IZFA 4K11A 3G15A 3U6IA 5M4FA 4C3PA 3HNGA 5L2QA 2SRCA 3BQCA 4PL5A 3LLAA 5BNJA 3HRCA 4FSZA 4R3RA 4XS2A 2GPHA 4XRJA 5ETIA 4AU8A 5LJJA 3QUDA 4I5HA 4OW8A 4DFBA 4BCNA 3MFRA 2GSFA 4AN3A 3EN4A 1P2AA 4O0YA 1IG1A 1J1CA 2R3PA 5M55A 2C6DA 4D2SA 4J1RA 4JL9A 3ZLWA 2YIYA 4PQNA 1QPCA 2F2UA 4WIHA 5HBEA 5AX9A 2ITWA 4F08A 2BTRA 5ANEA 2PU8A 3NUXA 3GQLA 4TWCA 2VO6A 3R1NA 2YDKA 4ANMA 3R8MA 3KXHA 3IGOA 4BB4A 1WZYA 1REKA 3LQ5A 4QPSA 4AT4A 4O82A 3Q4CA 4FEXA 3FI4A 4IFGA 3PJ2A 4KKGA 4QP1A 3VBYA 2I7QA 4IE9A 4NSTA 4K33A 3IO7A 3MVHA 1UWJA 4RC3A 3UPZA 3AD5A 4O21A 3IK3A 3UJGA 3DT1A 3KKVA 4EOMA 2ZDUA 4FV8A 4I22A 2JAVA 4F7NA 3BQRA 3BYOA 4V01A 5TE0A 1R3CA 2ZMDA 5HNIX 2QR8A 1PXNA 3R02A 3WF8A 5KMKA 4W4XA 5HNGA 1SMHA 3FI2A 3LJ2A 2XP2A 1ZLTA 2J90A 3LQ8A 4EHZA 5LMAA 3NUUA 4E5AX 4FEQA 3P0MA 4S34A 3D5XA 4EWHA 2VTAA 4S31A 5LMKC 4JJRA 2YIWA 4FIGA 5CI6A 5I4NA 5IUIA 3ZEPA 1JKSA 2UZBA 1UKIA 4B6LA 5FBOA 4UZDA 2RFNA 4CFFA 2I6LA 4OTIA 5HVYA 5A4QA 2PE0A 4YZCA 3ZC5A 4O0WA 4J98A 4F6SA 5H8BA 3R9NA 4RPVA 2YM4A 4XH6A 5CVFA 1H8FA 3AD4A 2ZB1A 3FE3A 1GZ8A 3H9FA 2VTMA 4YPDA 5DGZA 2FA2A 5A9UA 1PKDA 3QRJA 2WTCA 3OTUA 4FSQA 1LEZA 3CY2A 4U3YA 2OXXA 1H1WA 2BDJA 5F94A 3PRIA 3NR9A 2PE1A 3PXFA 3EL7A 4U80A 3F3VA 4D1XA 5L6PA 3QD0A 2RFSA 3UYTA 2WEVA 1F5QA 2XKFA 4I20A 5DHJA 2OF4A 4WG4A 3MYGA 5IH4A 3PFQA 3R6XA 5FEDA 5IQAA 4OTFA 5DE2A 4LM5A 3D83A 4FSWA 3HL7A 3PXQA 4EOJA 4WRGA 2ZB0A 1H00A 2WMUA 1JSTA 3PY0A 2VTHA 3KCKA 3D7ZA 3FLYA 4JAIA 5K5NA 4C4EA 3KRWA 3IONA 4C4GA 4KINA 5EI8A 4E7WA 4GFMA 5DRDA 2BKZA 5DT3A 3ERKA 5CF8A 3EZVA 4C8BA 5J87A 3KXNA 5CEIA 1ZOGA 5DEYA 3RPYA 4K1BA 4F0FA 2GS6A 2XJ0A 1KE7A 4XHKB 4C3RA 2YCRA 3BWJA 4IB1A 5LMKA 2W17A 4I0TA 2C0IA 2WOUA 1Q4LA 3DGKA 3NIZA 4F7SA 3GC8A 3C7QA 1PXKA 3KQ7A 4C4JA 4U41A 4JVGA 4HGEA 4JX7A 2W0JA 1TKIA 4ZTSA 4FKSA 2VD5A 3MV5A 5HU3A 1MUOA 2GFCA 4G6OA 4NEUA 3DKGA 4M67A 5E8UA 4EH3A 3OG7A 5LWMA 4IHPA 5HI2A 3ORKA 5JFWA 5HVJA 4JG6A 4BYIA 3SRVA 4AS0A 2XM9A 4L46A 3QALE 4HOKA 3ZYAA 3H3CA 2ZOQA 3F2RA 4RWKA 5D41A 3CQWA 1ZMVA 2X7FA 3NZ0A 4I6HA 5DFPA 4FVPA 5T6KA 1Q3WA 4YJUA 3UQCA 1OKZA 4TKSA 3MBLA 3SQQA 1Q8WA 2W4KA 2YEXA 3KRRA 3O8UA 4U6RA 3T3UA 2VZ6A 3IOPA 5E8XA 4D1SA 3R0TA 4Y73A 1T46A 3TTIA 5GZAA 4NK9A 2RL5A 1YWNA 4I0SA 2HZIA 4LMUA 4M15A 4F65A 3LFAA 4FEWA 1XHAA 4FTRA 4DTKA 3T9IA 4JRVA 4JDHA 1GY3A 3BI6A 3WILA 4FF8A 3VJNA 2EWAA 3OC1A 4RZVA 4GRBA 3POZA 2W1EA 2F57A 1B38A 5AP1A 1GJOA 4QMPA 1SZMA 4IWDA 4MBLA 3MDYA 2CMWA 4R3CA 2ITOA 4ACMA 3ORPA 1SYKA 2PMNX 4DYMA 4ERWA 2WELA 3SRVB 1ZYJA 4BKZA 2OJFE 5AP0A 3HV7A 3KL8A 3PLSA 3R1SA 4OT6A 5IQCA 4PV0A 4M3QA 2WTKC 4A9TA 4KIQA 3FYKX 5BQ0A 3P23A 2I0YA 3AC1A 4FV9A 5CF4A 4CMUA 2JDSA 3LM5A 3HDNA 1KUTA 4L43A 5IA0A 4S2ZA 4M84A 4RJ4A 4O1OA 1ZAOA 4S30A 1Q41A 4RGJA 4EHVA 4BRXA 2ZV2A 4DFUA 4AF3A 4D4YA 1JAMA 2R3IA 2CKPA 4LMNA 3VO3A 5H3QA 3DB8A 2VO7A 2C6IA 4MWHA 3SW7A 3DZQA 4QTAA 3ORMA 4O0XA 1H4LA 5FBNC 1H1QA 3EQFA 3FZ1A 3OUKA 4IC7A 3F2AA 2EB2A 3ET7A 3ORZA 4C62A 5KX8A 2R3LA 2XZSA 3DB6A 1H1PA 1E1XA 1NVSA 1AGWA 3JVSA 1GZKA 4DITA 2Y0AA 1HCLA 3RBWA 2P4IA 5E1EA 4J53A 4EYMA 4QT1A 1GZNA 2CNVA 3KF4A 4EH9A 4W9WA 4FV1A 2C68A 3ZZEA 5H8GA 5FUTA 5J5TA 4G2FA 4FV6A 4IVBA 3V6SA 2UZTA 1OL5A 2HY0A 3OCGA 3D5WA 5AIKA 3F61A 1CSNA 4YBJA 4L53A 4LL0A 3AC5A 3PPJA 4ZY5A 2R0UA 5K9IA 2W1FA 1WBOA 2ZMCA 4O7ZA 4GJ3A 4F70A 1AD5A 3OXZA 3ZRLA 2UZVA 4D9UA 2OJJA 3IGGA 1WBPA 3A8XA 3IECA 4IEBA 5HIBA 4JG7A 5ACBC 1Y8YA 2V55A 2V5QA 3R71A 4E93A 4EHEA 4QMNA 2XM8A 3U4UA 1OVEA 5ETCA 5KMJA 3R22A 3Q4UA 2WQOA 4HYIA 2AC5A 5AUYA 5J7BA 5CTPA 4E6CA 4EC8A 4QTCA 4OAVB 2F7ZE 3BYMA 3ODYX 3U4WA 4EQMA 5IQGA 3E3PA 3DS6A 1O9UA 1OUKA 4AGWA 3VUGA 5HOAA 4FEVA 4IH8A 2XVDA 3KC3A 3Q9YA 2C1AA 3QTRA 3QQFA 3JY0A 5CNNA 2UUEA 4KKEA 5EW9A 5HG9A 3WZDA 1ZARA 2XJ2A 3AT4A 4RMZA 1H24A 2YIRA 4YO6A 5FQDC 3LCDA 4RA4A 3UVPA 3VS6A 2VUWA 3R28A 2RGPA 3DNEA 5IQFA 4ZS4A 4C37A 5EM6A 2R3FA 3ZBFA 2R3OA 4BDEA 4AAAA 5CT7A 3FPQA 3MW1A 4QP9A 5FXSA 1Q3DA 4C7TA 5M57A 3TNIA 5CEPA 4EK3A 4KB8A 4TYGA 2VWBA 4CKIA 3OT8A 3U55A 3NUSA 4IMYA 2WTKB 2WHBA 3Q3BA 3U54A 4DG2E 2JKKA 4A4XA 5BUJA 1SVEA 4QP6A 4GJ2A 2G01A 4LOPA 4PTEA 3ZHPC 3ID6C 4TWOA 4I5MA 2EXMA 2WTJA 3OW4A 3LPBA 3MB7A 4DT8A 3NSZA 4DEDA 4DG0E 1CDKA 4RJ5A 5HG7A 1Q8YA 2W1GA 4CSVA 2RKUA 4EQCA 3FPMA 2J51A 4LG4A 4U5JA 4BBFA 3BHTA 1B39A 4FGBA 4G5JA 5JQ8A 4R78A 4PWNA 4FOCA 5C26A 3FUPA 3AMYA 1S9IA 3MVJA 5AR3A 4C2WA 4L8MA 4FKUA 5CEMA 3T9TA 1DAYA 3UBDA 5EOLA 4HVDA 1LR4A 5HO6A 3BHVA 5BUIA 3EQRA 3MPTA 2AC3A 1GZOA 2I0VA 4G16A 4GG5A 3CEKA 5AADA 3RALA 1IA9A 3CLYA 4PMTA 3ETAA 1K3AA 1GIHA 2ETRA 4U44A 3U9NA 4FVQA 4R8QA 4RVMA 5DR9A 3R7IA 3F6XA 2PVNA 3P7CA 4RSSA 3OHTA 4QO9A 5AV0A 4QMUA 3D9VA 4BCMA 3C13A 4UB7A 4U9AA 4DLJA 4FT5A 4MNFA 3LFSA 3R01A 4D28A 1M52A 1WBTA 4ASZA 1KSWA 1W83A 4B0GA 5FM3A 4AZSA 4H1JA 5FTOA 3OVVA 4X2NA 4RJ7A 4AA4A 3C5IA 2BMCA 4O2ZA 4YTIA 3K54A 3NW6A 3ORNA 3HRFA 4O7VA 1ZXEA 2B9FA 4JLCA 5HO7A 3H30A 3MY0A 1QPDA 3VN9A 2WMBA 4IAZA 1XQZA 4IVAA 4X6QC 3O17A 5CI7A 3GU5A 1MQ4A 3QBNA 5CQUA 4EH2A 3QYWA 4R3PA 3C1XA 4E6DA 2UVYA 3VC4A 3FMKA 4RBLA 3OS3A 4FV0A 3KVWA 4KUJA 1JSUA 2Q83A 4IDTA 4A4OA 3S1HA 1J3HA 2X39A 5IEXA 5L2TA 4JDIA 2ETKA 3S3IA 5TR6A 3OCTA 1LP4A 4HYUA 4YZMA 1I09A 3A7FA 5JQ5A 4H36A 2GNIA 4GVJA 1G8SA 5EQPA 1APME 3DK6A 3QQJA 3PLAE 3DBDA 3G0EA 4IANA 4MD7E 2B53A 1H07A 4PUZA 5KKRC 3D5VA 3NDMA 4QRCA 3KRJA 4KIKA 4U7ZA 4EBVA 1YOJA 3FHRA 4PF4A 4RT7A 4DH8A 4IDVA 3BLQA 5EDQA 1PMVA 5HLPA 3HV6A 2C1BA 2QU6A 4GU6A 4BGGA 2PUNA 3NWWA 3CIKA 2GQSA 3DTWA 2EXEA 4D4SA 1SVHA 5I5ZA 2WQEA 4HGLA 1CTPE 3UVQA 2B52A 2XRUA 1DS5A 4BDJA 4BTJA 5E90A 4EH5A 3KMMA 4RIWA 4R1VA 5ANJA 3CPCA 4CFXA 4DFNA 4O7NA 2QNJA 3KULA 5AV1A 4NL0A 4QQJA 5IKWA 1ZMWA 4EOLA 3PTGA 3LKMA 3GC7A 4YC8A 5IQIA 2GHLA 5CEOA 1Z9XA 3DU8A 4BZNA 2JAMA 3CTQA 1ZYCA 2PK9A 3THBA 2JLDA 4DH7A 1W98A 4GT5A 1BX6A 3IW5A 2UZOA 4BCHA 3ZU7A 2Z7SA 2F7EE 3FKLA 5HIDA 4R1YA 2B55A 2FSLX 2X2KA 1Q62A 2XK3A 4EH7A 2IJMA 4KIKB 4QNYA 1R39A 4NT4A 3FYJX 4EBWA 2OG8A 4RX5A 2GTNA 2XYNA 3R2YA 4GK4A 4AA0A 4FZ6A 2ZDTA 3IG7A 3MWUA 5A3XA 5HGIA 4EORA 5HG8A 3W2CA 4K9YA 4UYAA 4MAOA 1HCKA 1XH6A 1XJDA 3KULB 3EMGA 5AP6A 3R7YA 2P0CA 3MN3A 3TV6A 4CV9A 4EKKA 3E7OA 4F9YA 2XF0A 5IDPA 3BV3A 3GXLA 4WG3A 3W1FA 4ZLZA 3VUKA 4AGCA 3UP2A 4CZUA 3MSSA 5KMLA 2QOHA 3W2PA 1JKTA 3H0ZA 2C6KA 4QYGA 1ZYLA 4UEUA 2VWZA 3U51A 2ZV9A 5AAGA 5CEKA 3RPRA 5GZ8A 2CGWA 5AV2A 5KMIA 2XKCA 2BTSA 4Z55A 4WNKA 1WBWA 4G3FA 5KNJA 4AFJA 3MH0A 5E9EA 3QA8A 2XYUA 2FGIA 1KE5A 4ZTRA 5M4UA 2JKQA 3E87A 3QTUA 2JC6A 4U40A 5TO8A 4ASEA 1NT2A 2YCSA 4WOVA 1G3NA 3O71A 3BBWA 3PA4A 4XEYA 4ZOGA 3QHRA 1H27A 4OR5A 5AMNA 1J91A 2ITYA 5K3YA 2VX1A 3QTQA 3NLBA 3BEGA 4MNEB 4DAWA 3RKBA 4FTLA 2PVMA 4NTTA 5EYKA 3VUIA 3A7JA 3LXNA 4FV3A 4QQ5A 5KKRB 3MJ2A 4BF2A 5AP4A 4F9AA 4BWKA 3SG9A 3HUCA 4USFA 4JDJA 4Z9LA 4AZWA 4PL3A 1WBVA 5HG5A 1REJA 4M7IA 4IFCA 4QMZA 1ZYSA 2F7XE 3BYSA 2YLEA 4O1PA 2BROA 3BWFA 3GOKA 3P78A 5CF5A 3MGYA 3ROCA 2QR7A 2HENA 2UW4A 4FSMA 2GMXA 4CD0A 4D55A 5I3OA 5CVGA 2C5NA 4IAFA 2X9FA 2NP8A 2JBPA 1G8AA 2XIYA 3RM7A 3FLNC 5E7RA 2JKMA 2WKMA 1OPLA 2O3PA 1R78A 3QKMA 5HKMA 3TNWA 2VGPA 4EUTA 3DBQA 4CCBA 4NKAA 2KTYA 1H1SA 1YHSA 4WUNA 1U59A 3CKWA 2OZOA 4O96A 3QCYA 2PHKA 2QD9A 4BDKA 4IQ6A 3TUDA 2PPQA 4FZFB 4AQCA 4FKJA 1WVWA 2YFXA 4UX9A 2FSTX 3LJ0A 2AYPA 1P4FA 2PVYA 3DK7A 3QWJA 1JNKA 5EHOA 4ZXTA 4ANOA 2IVSA 3E63A 4ACCA 4EK5A 1R1WA 2JDTA 3R63A 3SOAA 3OBJA 4E6AA 5L8KA 3OCSA 3M1SA 4YPSA 3KEXA 3WIGA 4C59A 3NW5A 3FZTA 5GINE 3EQGA 4IM0A 4CVAA 3TACA 5DA3A 4AGDA 5BYZA 4FIHA 3HV4A 4DFZE 2PZIA 1XBCA 3QZIA 5IMEA 2YJSA 4MEDA 3QCQA 1H25A 3UG2A 2V7AA 4ZTNA 2WMVA 4AG8A 2EVAA 3A2CA 3DAKA 3TNHA 3QGWA 2J0LA 3K3IA 2HELA 4RIOA 5D12A 3QQLA 4N70A 3QFVA 2BAQA 4EZ3A 3F3ZA 4MQ1A 3O96A 5ANDA 1O6KA 3NRMA 5IUHA 1W7HA 2ZM3A 3SXRA 1YQJA 4ALWA 4FV7A 3WZUA 4BR3A 2LGCA 2C6TA 2WTWA 4RLLA 4Q5EA 1V0OA 4YLJA 4ZLYA 3W2SA 2XIRA 4DEHA 4Y5QA 4PTCA 2HZ4A 3TZMA 4I21A 4WUAA 1BL7A 4AOIA 4FNWA 4NU1A 3OEFX 5HNBA 3C0IA 4QYHA 3WF6A 4G9RA 4O0TA 3VAPA 4S33A 4CYJA 4KIPA 4APCA 4U0IA 3TNPC 1CKPA 5CQWA 3D94A 5A54A 3E93A 1W8CA 3SLSA 2ITNA 3GI3A 2YERA 3RP9A 4PP9A 2J0JA 4FE2A 1VYWA 4YZDA 4LFIA 4XMOA 5HQ0A 5I9XA 4BFMA 4BKYA 3QQHA 4LUDA 3OOMA 1M2QA 4PDPA 1IEPA 4ALUA 3R1QA 2XK8A 4YHJA 4S32A 4FSNA 1BI8A 1KE9A 2RF9A 4K0YA 4HPTE 3QTWA 4JQ8A 4NM0A 3SKCA 5EYCA 5DR6A 3FZRA 3AT2A 4RFYA 4F63A 5F9EA 4WG5A 4FYOA 1JBPE 1PXOA 2R5TA 3F3TA 4E6QA 5J1VA 3RHXA 2YDIA 4DH5A 5I3RA 4W8EA 4Z7GA 1MRVA 2X0GA 3QD2B 3LFNA 5M51A 4DFLA 4P2KA 3QC9A 4GK2A 5AWMA 4MX9A 3ZRMA 2G2FA 4P7EA 3CTJA 3VJOA 4YTCA 4EI4A 5E8SA 4X2JA 3KN6A 4FKQA 1UU7A 2WB8A 3CY3A 3UPXA 4PMPA 2VGOA 1FQ1B 3DJ5A 1Z5MA 3OFMA 3RPOA 1J7UA 4QTDA 5E8ZA 2EU9A 3S0OA 1DI8A 2O63A 2W1DA 3PIXA 4UXLA 3SHEA 5ANOA 4G6LA 4OTHA 4CYIA 1PMNA 3FEGA 2I0EA 3MY5A 2UZDA 2CGUA 4NIFB 2ITTA 3BGPA 2XK6A 3OWLA 2F9GA 1KV1A 1JSVA 2P3GX 3VUTA 4D58A 3QQGA 4EJNA 5BPYA 2H34A 2QKWB 3AOXA 3Q52A 4RZWA 4UALA 3TWJA 2C3IB 4MXOA 5FXQA 5A6OA 1LEWA 1FVVA 4CFNA 1BKXA 5E8YA 3C0GA 4IWPA 5GZ9A 5HD7A 2OI4X 3GCVA 1PXLA 3QRTA 5HTCA 2PZYA 4ALVA 4IB0A 2XBJA 3COKA 2CPKE 3DOGA 5LVMA 1H26A 4FZAB 5M4CA 2VWUA 5EI6A 3C51A 5HTIA 1ZWSA 1YI6A 3QKLA 4L6QA 5FEQA 3W18A 5IA5A 4PL4A 5TOZA 5L2SA 5AM7A 1IR3A 4LRMA 3I7CA 4EOOA 1IAJA 3ENHA 5BVWA 5B2KA 5IQHA 2GQRA 2IPXA 4ACGA 3N51A 2XIXA 2C3JA 2XNBA 3RTPA 4YTFA 3WE4A 3BHUA 2VTIA 3BGZA 4FG9A 4FZDB 3BGQA 3LLTA 4MF0A 4C33A 2J4ZA 2QC6A 4ZJIA 3PSBA 2QODA 3MFTA 5AA8A 4CT2A 3NMUF 4E1ZA 2CJMA 3AGMA 1WBSA 4Q9SA 3D5UA 4X2FA 2OFVA 3FAAA 5CU3A 5EQEA 4UWBA 3QX4A 2YA9A 4QNAA 4OUCA 2X2MA 3HA6A 3MS9A 2R7IA 1OIQA 3COIA 2Z8CA 4L67A 3TTJA 3LE6A 4BDIA 4EQUA 1L8TA 3P5KA 4IACA 2HW7A 2C5OA 2W4OA 4KIOA 3VUHA 3VW6A 2IZTA 3C4ZA 1LPUA 4L3JA 3CD3A 3QTSA 5DOSA 4DTAA 1TQMA 5HORA 3C9WA 2FVDA 1NY3A 4HYHA 4MXZA 4YZBA 3QRUA 3PXKA 4PMSA 1UV5A 2CKOA 3VRZA 4DCEA 4JBQA 1W82A 4HYSA 2OW3A 5B7VA 2HXQA 2W96B 2ZM4A 4CLJA 2DWBA 3ULZA 2B0QA 1PXPA 2YAAA 5A14A 2WMRA 3GB2A 4D2RA 5CZIA 3EFWA 3FBVA 2R3KA 4RC2A 2OXDA 3GFEA 3SW4A 5JMSA 3L8SA 3ZFYA 4EEVA 3UOJA 1KWPA 3QHWA 4WSQA 4ZZOA 3EN6A 4BCFA 4FTJA 5EW8A 2B9IA 2WEIA 3IW8A 2GNGA 1DAWA 5BMMA 4QYEA 3WF5A 4V04A 2A27A 2JIVA 2R3JA 4G1WA 4G6NA 4UMRA 5A46A 3R00A 4ANSA 3GUBA 3SA0A 3HAMA 1GNGA 4Y95A 4XBUA 4D9TA 3GCUA 3E8CA 4PMMA 5BVNA 5BVEA 5AR5A 2JIIA 5EFQA 3REPA 3K5UA 2R3MA 3LHJA 1WBNA 2O65A 3WE8A 2RIOA 5E92A 3ZSIA 2B54A 2OZAA 4GEOA 3KN5A 3RCDA 5HBHA 1FOTA 1FGKA 4AFEA 3F69A 3DV3A 4WSYA 2F2CB 1P14A 2HY81 3RCJA 4CT1A 4P4CA 3OF0A 2HCKA 4ZLOA 4CKJA 4FKWA 1WVXA 3F7WA 4JS8A 3LXKA 3PP0A 4QMXA 4DGOA 1JLUE 3DJ7A 3EIDA 2ITZA 2O5KA 4TL0A 3P7AA 2PY3A 2J5EA 3QYZA 1Q8ZA 4KSQA 3U6JA 3ATTA 3K3JA 5EYDA 4IZ5A 5ETFA 3V5LA 4F64A 1KOAA 1PXIA 2YAKA 2BFXA 4YJQA 3VNTA 4JAJA 3DBFA 4M0YA 3V01A 4F9BA 4I5CA 4RG0A 3FXZA 3QLFA 4KAOA 4MBJA 4F4PA 2OIDA 4UMQA 3ZOSA 2VWXA 4Y46A 4Y72A 3WI6A 3UO5A 1F0QA 2UZUE 3TKUA 3WF7A 3VVHA 2PVHA 4XNEA 3SDJA 4EH8A 2XNNA 2ACXA 3KXGA 2OZAB 1YKRA 4JG8A 3DPKA 2YACA 3QU0A 4D4RA 3PE2A 3V5PA 3IDBA 4I5PA 5EKNA 3F2NA 2JBOA 4AT5A 3EQBA 4K2RA 3EJ1A 4V05A 2X9EA 1STCE 5H8EA 5IUGA 3ZO4A 4A4LA 3WYYA 5EQYA 5I9YA 3HUBA 3VBXA 3PZHA 2HZNA 4KBCA 2P2HA 3BPRA 3NIEA 3JXWA 4DH3A 4BY9E 3CC6A 3VF8A 4BL1A 1ZOHA 3LFDA 5AAEA 3UQGA 4OAUC 4IW0A 4YJRA 3W33A 5CU0A 1L3RE 5BVOA 3T3VA 3WARA 4FUYA 4WNMA 4AACA 4XP2A 2V62A 4FK6A 3GBZA 3PVWA 1NVRA 4J52A 3TV7A 3HZTA 5HCXA 5JK3A 4FT0A 1OBGA 4MF1A 3UNJA 2LAVA 2VWYA 2EXCX 2PMOX 2YM8A 3LXPA 5H9BA 4YC6A 2X2LA 2GDOA 3FMDA 3HLLA 5AP2A 5FXRA 3SX9A 4AW5A 5L2IA 4RRVA 5LCJA 4HNIA 1RW8A 4E4XA 1BL6A 4U3ZA 5AUTA 5C27A 4QMQA 1IAHA 1CKIA 3A4PA 2GNJA 3NPCA 3ORXA 2W06A 2C47A 5HU9A 2UW8A 4FICA 4R6VA 5DWRA 3R9HA 3F3UA 4AW1A 5JFSA 4J8MA 4TPTA 3R8PA 4CZTA 1YDTE 2FUMA 3LW0A 4ZIMA 4O7WA 4MKCA 4HJOA 4F1OA 3MA3A 5D11A 3ZM4A 4D2PA 5I9VA 2R2PA 3QLGA 3WZEA 4B8MA 1H0VA 5HCZA 4EZ7A 3SXFA 4JNWA 4HCTA 4ERKA 1PHKA 4DBNA 4IZAA 2BKKA 3UIUA 5T68A 3PG1A 4HNFA 4BCPA 4BGHA 1OKWA 2C6OA 2J9MA 5AFVA 2C0TA 4GS6A 3W55A 3V04A 4GCJA 4E4LA 3W8QA 4RJ6A 2VNWA 4JRNA 4Q5HA 2PZRA 1UNGA 5AUVA 4I4FA 5FP5A 3NYVA 2UVZA 4EOIA 1TQPA 4ZY4A 3CQEA 4DGGA 3FZOA 4X7QA 4KWPA 3ACJA 5CSPA 5IA4A 3LCSA 1XBAA 4FUXA 3VBQA 4BIDA 2QOLA 4H58A 3ANRA 4NH1A 3ZTXA 1OL1A 4ASXA 5BMSA 1P5EA 4FMQA 4USEA 2C3LA 4IX4A 2HWPA 4HW7A 5C4LA 2CKEA 4I0RA 5EOBA 5HCYA 3UC4A 5KMOA 4GKHA 5FTQA 5IISA 1IASA 3LZBA 3BX5A 5CU2A 4IAAA 3QZGA 4G31A 2PULA 1YWRA 4EOPA 3MPMA 2QOFA 4UMPA 4KD1A 3M11A 2IZRA 4BDBA 4TYHA 2P33A 1OECA 2PMIA 2VX3A 3DQXA 3V51A 4EK4A 3R7VA 5DVRA 5CY3A 1E9HA 5BX0A 4B99A 5KMMA 4WT6A 3BU6A 2WAJA 3E3BX 3ZDIA 3MH2A 3PXZA 2GNFA 3D15A 3DBEA 3GCSA 3PDTA 3Q4ZA 4TYIA 3CSVA 1JOWB 2BIKB 4PPAA 4ZS0A 4O7RA 2B4SB 1NA7A 3UZRA 2BRBA 4GUBA 2Z2WA 4QP3A 5GJGA 3ZS5A 4FKPA 3NUAA 4ENYA 2ITPA 1U5QA 2YITA 2YN8A 4XV3A 2XNGA 2YM6A 2O0UA 4YSJA 3PJ1A 2R3GA 3MA6A 5ICPA 2XEZA 3WYXA 1GAGA 1BMKA 1OZ1A 3MI9A 4XP0A 2Y4PA 3ZSGA 3HYHA 3NYNA 3ORTA 5LVNA 3W8LA 4DTBA 2OO8X 3JS2A 3UIMA 4MXYA 4IWOA 4RIYA 4TYHB 2UW6A 4AOTA 2JKOA 4R7HA 1EH4A 3OP5A 3OT3A 3OEZA 2H8HA 4DH1A 3NYXA 4N0SA 3PE1A 4FTCA 2PMLX 3NUPA 3Q9ZA 4E5WA 3F9NA 3EQPA 4TW9A 2IVTA 4FTKA 4O7LA 3FMHA 4E5BA 4RQKA 5HLNA 4IX6A 2C5XA 2W1HA 1XH4A 3E8DA 3II5A 4WNOA 4HVHA 4PNIA 4D2TA 5CASA 5IQDA 4O86A 1M2RA 2J7TA 4QMOA 5J8IA 3FQHA 3VW8A 2UZEA 2IG7A 2ONLC 3LCKA 3E8NA 1WCCA 3PYYA 1JVPP 3Q2MA 4C38A 5K0KA 4ZAUA 3PVBA 2PYWA 1RJBA 4I6QA 2ITVA 2ITQA 5HE0A 4I4EA 4L44A 3UGCA 1MQBA 3AXWA 3D14A 3SXSA 3SVVA 3D4QA 1M2PA 4TYEA 3UTOA 4GL9A 4HGSA 5JGDA 4RFZA 3V5WA 5HHWA 4C58A 3VS4A 2PTKA 4RIYB 3IKAA 2NRYA 4RC4A 2YABA 4MXXA 2XIZA 1MRYA 4IJPA 2OJIA 4G34A 2HZ0A 3G2FA 3AC8A 1U4DA 2VTRA 4J99A 2H9VA 2JDVA 4EOKA 4E26A 4CGAA 3NCZA 5DLSA 4BCIA 4CTBA 2ITXA 4H3QA 2UZLA 2JDOA 4MD9E 3V5TA 3PJ8A 2XCHA 5FGKA 4EOSA 3HAVA 2VTNA 5A4EA 4F6UA 3RNYA 2R3HA 4XV1A 3EN9A 3BBTB 5CLPA 3OY3A 2XMYA 3CGOA 3SAYA 3UYSA 3HGKA 4JIKA 4TTHB 4HCUA 3U9CA 2E9VA 4GU9A 3SV0A 3C4FA 1PYEA 4JR7A 1ZY4A 1XH7A 2W99B 3CGFA 3A7GA 1Q8UA 2OK1A 3NCGA 3F5XA 4YGAA 5AP5A 3RJCA 5HVKA 3BLRA 3N4VA 4AZFA 5BYLA 2IO6A 3UDBA 2ONLA 3G0FA 2G9XA 2RSVA 1QPEA 3G9NA 4ZSGA 3W2OA 1PYXA 3PPZA 4J97A 4GW8A 4NJDA 3PJCA 3ZC6A 4G3EA 5DN3A 3POOA 4F7JA 2XNEA 3DTCA 3JYAA 2CNQA 3HKOA 5J9ZA 4DEIA 3UNZA 5LQFA 4NCTC 4BVUA 2UW9A 1E1VA 3LCTA 3P86A 3ZH8A 3F3WA 3L8XA 4C4HA 3FMEA 1J1BA 3R9OA 3TZ9A 3OZ6A 2QI8A 3GENA 1MP8A 5T3QA 1U5RA 4ANBA 4FKTA 4PDOA 3UO6A 4M14A 4MVFA 3ZONA 2QVSE 4CG9A 4X6RA 3Q96A 3U8WA 1OGUA 5EHYA 3UMXA 5JH6A 4UWCA 1NXKA 2A1AB 3R2BA 4FSUA 4J71A 2W1ZA 5CNOA 3F5UA 2CLQA 1J7LA 2BFYA 3GEQA 1YW2A 1FBNA 5J95A 2VTOA 5IA1A 5L2WA 4CTCA 4DEEA 4OTGA 1F3MC 1VZOA 3N9XA 4ITHA 1YHVA 4CV8A 4O7TA 4HGTA 4XOZA 3CQUA 1BUHA 3GVUA 3BZ3A 2BAJA 4YJNA 4C2VA 3ZUUA 1XH9A 3UOHA 4GT4A 3Q60A 3R73A 3ZXZA 1OI9A 3DZOA 5AX3A 4CFVA 5JN2A 2C6EA 5CSXA 5DH3A 4L9IA 4QP4A 1QL6A 1DM2A 3FMMA 4R5SA 4RIWB 2DQ7X 2R64A 4U97A 4BCKA 5IA2A 4AZEA 4YJOA 3KMUA 3FWQA 4YMJA 5C4KA 2E9NA 3DKFA 4FIIA 2BHEA 3FC1X 4OTRA 2EB3A 4NZWB 4J96A 4MXCA 4YSMA 4QTEA 2OF2A 3FSKA 3FXXA 3ITZA 4D4VA 3RVGA 3FZPA 4ZJJA 3TZ8A 2E9PA 5CS6A 2XKEA 5CU4A 5CYIA 3ALNA 1OKVA 3EQCA 4EK6A 1GOLA 4NCTA 3CS9A 3RMFA 5CZHA 4L68A 1YI3A 1OUYA 4ZSLA 4GKIA 4AXAA 3VHEA 3BRBA 3R7UA 3R9DA 5JGBA 3CBLA 4QTBA 4MK0A 3KXMA 5FG8A 2RG5A 2R3QA 4ZJVA 2G15A 2OIQA 1Y6AA 5E8WA 4UN0C 5JSMA 2Y7JA 2QKRA 5CVHA 2RG6A 3C4EA 2P2IA 5AA9A 2C0OA 4TZRA 2B9HA 1FGIA 4FR4A 4BHNA 3UVRA 4RX8A 2Y8OA 3EYGA 2F4JA 2YHVA 3KB7A 5C9CA 3O0GA 5JFXA 3NVKI 3UODA 5A4TA 2BHHA 3QKKA 4I24A 5DT4A 2PVKA 5I0BA 3RAWA 3EH9A 5F20A 4GMYA 3VS7A 3FMLA 4JDKA 4WD5A 2WMWA 5I9ZA 4EH6A 3DDPA 3RINA 3O8PA 4BDGA 4XUFA 3HMNA 4BICA 5J9YA 3VUDA 1CMKE 3PY1A 4BWPA 4FKRA 2BZIB 3GP0A 3G5DA 1YXTA 3QWKA 3RAKA 3RWQA 4F1MA 5J79A 3BHHA 5L6WL 4AZTA 2JITA 3ZLYA 4QQCA 2C6MA 1H1RA 2VV9A 3OW3A 3PWYA 3FZSA 3RZBA 2JFLA 3VULA 4A06A 4BCQA 2YCQA 2CSNA 2R9SA 2Z7RA 2VTPA 5M09A 3PY3A 3HX4A 3NUYA 4GIHA 4UWYA 2CLXA 4AT3A 3TIYA 4BWXA 3MY1A 3FJQE 5KUPA 3MIYA 3SC1A 3IQ7A 2WQNA 3LXLA 5EDRA 4CFUA 3FQEA 3FL5A 4YJPA 2PUIA 3BEAA 3CKXA 4RWLA 4U42A 4CXAA 4XG8A 4Z16A 2PSQA 4L7SA 3G6GA 4MQ2A 4MWIA 4Y83A 4N6YA 3H9OA 3RZFA 2V7OA 2X4ZA 4GV1A 4IAKA 4WA9A 4P5ZA 4W9XA 3ZMMA 2W05A 4XG3A 2Z02A 4KABA 4CZYB 5M07A 3A60A 3HEGA 1WMKA 2NRUA 3PG3A 1I44A 4IVDA 4YJVA 2BALA 5EKOA 4ZK5A 4BC6A 5J1WA 3KK9A 4HVIA 3LVPA 4IWQA 2GNLA 4FYNA 2X6DA 3FY0A 1PJKA 4MHAA 4O38A 3ZO1A 4ITIA 4OT5A 2CGXA 4PDYA 5AEPA 2W5BA 5H2UA 1Z57A 2XJ1A 3DXNA 4YC3A 4DCAA 1JWHA 4FTTA 4BIBA 4RFMA 5ACKA 2QCSA 3ROYA 3O7LB 1U46A 3UOKA 1LUFA 5IU2A 2I0HA 1S9JA 3OY1A 4F9CA 5FDXA 2Z7LA 2BRMA 3C5UA 3KGAA 3AC4A 3U6HA 3DXQA 5DI1A 3LMIA 5TF9A 3L1SA 3U87A 2C4GA 3QQKA 2B7AA 4FL2A 2ZVAA 3ZSHA 2G2HA 1V0PA 4KA3A 5AP3A 5DYJA 3KREA 3P79A 2QO2A 3FV8A 4X0MA 4AUAA 4KRDA 4JBVA 5GHVA 3FC2A 5AUXA 3AQVA 3CTHA 3QUPA 4GYIA 3VF9A 3OCBA 2VNYA 3F5GA 3L9LA 4YJSA 4N4SA 4DN5A 2XH5A 5ITAA 3K5VA 4RQVA 5LOHA 4DINA 2V0DA 1IRKA 3NUNA 5IPJA 4PRJA 4QYFA 4DFXE 3A62A 5EG3A 4XJ0A 5FM2A 2OJGA 4BBEA 4GT3A 4IX5A 2WMSA 2X4FA 3ELJA 2XNOA 3I1AA 4U79A 3PA5A 4I92A 5IH6A 3IPHA 2JEDA 2QOIA 3UG1A 3V8TA 4LV5A 4BTMA 3EN5A 5AIRA 2B9JA 3H9RA 2OIBA 4BI2A 2GFSA 5EI2A 4OTPA 4CMOA 2J0KA 4L3LA 3UMWA 3VS2A 4V0GA 4EK8A 5I9WA 2XEYA 4O7SA 3TNQB 3EFKA 1UKHA 1IA8A 4FTMA 3MJ1A 3A8WA 4K8AA 3CP9A 3RAHA 3UOLA 3TUCA 3R04A 5AV4A 2H96A 3CE3A 3NX8A 1HOWA 2WTDA 4GYGA 4M8TA 4JBOA 5CALA 2WPAA 5JFVA 2UZWE 3FLSA 3I5NA 3RI1A 3I0QA 3LIJA 4ZMEA 3RPSA 5A6NA 5AAFA 4D5HA 3WIKA 3CJGA 3S2PA 3E62A 3LFFA 5AR4A 4FVRA 1FPUA 4K6ZA 2CN5A 2BZKB 2IWIA 2J0MB 1BI7A 2Z60A 4QMMA 1YDSE 4QP8A 4W8DA 5HESA 5FDPA 3C4WA 5HD4A 2IZSA 2C6LA 3RAIA 3GT8A 5K4IA 2JD5A 2C5YA 4LUEA 4I93A 3ORIA 1PXMA 4RX9A 1H08A 3MPAA 3QQUA 3V8WA 4DEGA 4BHZA 4ANQA 5CAQA 2PUPA 4DE4A 4WHZA 3B8RA 3FHIA 5HX6A 4U45A 3C4XA 4V0GB 4FKVA 3IW4A 1A9UA 4I1ZA 4PPCA 3FI8A 3FL4A 4UXQA 4DF3A 1AQ1A 5HIEA 3QXPA 5ANIA 3HV3A 3MIAA 2YZLA 4FK3A 3GU4A 4I41A 3JVRA 4C4IA 4YO4A 4IAYA 3KVXA 3ZEWA 3S4QA 4ZSEA 5I9UA 2QURA 2Y6OA 3TIZA 2XKDA 2QLUA 5F1ZA 4ZEGA 4BTKA 2NNWB 3G33A 4R7BA 3UE4A 4A9YA 2ZJWA 3EOCA 4ANLA 4FNZA 4E4MA 3K2LA 3KXZA 4KRCA 1M14A 4UBAA 3MTLA 4KS7A 3FLWA 3OROA 3BV2A 4OBQA 2VO3A 2BIYA 4H1MA 5C8NA 5JRSA 3B2TA 3VQHA 5FTGA 1DI9A 2PWLA 4J7BA 4F7LA 2VTQA 1OL2A 2YM5A 4O84A 5HE2A 3A61A 1SNXA 1YXVA 3PXYA 4E20A 3S95A 4GSBA 4OGRA 4QMLA 1GIIA 4AP7A 2VTSA 5B2LA 3Q5ZA 3MH1A 3DXPA 4M66A 3UQFA 2BDFA 3HMMA 4HZSA 5K0XA 5M08A 5DEWA 4WBOA 4YP8A 4X3JA 4C02A
chains in the Genus database with same CATH superfamily
4MCVA 1JKKA 3NNUA 4UZHA 2NPQA 3F7ZA 4FIJA 4IM2A 1H01A 4X3FC 4I23A 5CEQA 1GIJA 3HDMA 4FL1A 3LMHA 4XG7A 3DA6A 1UA2A 1BYGA 5D7AA 4AAYA 1Q99A 4QYYA 2C3KA 4C35A 4O22A 1ST0A 2XUUA 3HMIA 4E4NA 3BLAA 4FV5A 5JZNA 4FIEA 4O2PA 2OJ9A 3UP7A 3GGFA 3NW7A 4FL3A 1M17A 1VJYA 4H39A 5AUUA 2FH9A 3O51A 4WNPA 5JKGA 3FXWA 3IDCA 3UNKA 1O6YA 3VS1A 3DBCA 3DQWA 2R4BA 4FTAA 4C34A 3GCQA 5CWZA 4YZ9A 3BKBA 2GTMA 3OWPA 5DIAA 5IMXA 2PL0A 5JT2A 1W0XC 3QCSA 5KBQA 3EN7A 3QX2A 4JIAA 4FTNA 1NW1A 5CXZA 2YWVA 3H10A 3KXXA 3GNIB 2X81A 3W2RA 3BELA 3R9RA 1PY5A 3QD3A 3CCNA 5ANKA 2WXVA 3V6RA 4LQMA 1RDQE 3LFBA 3NNXA 4FV4A 1OIYA 1M7QA 4AGUA 4CMTA 4GUEA 3QTZA 1R0EA 4E73A 1TQIA 2WNTA 4TXCA 4ZSAA 1UVRA 3LFCA 4PP7A 4FEUA 2HOGA 5CT0A 3I0OA 4IXPA 4TRLA 4FTUA 2QLQA 4X21A 3KA0A 3SOCA 4EUUA 4DLIA 4QD6A 2A19B 5AUWA 2C69A 1UU8A 3ZUTA 4X3FA 4DGLC 2CNUA 1Q8TA 3NNWA 4BDHA 2QOKA 3TKHA 3SGCA 5A4CA 2UZNA 3I7BA 4B4LA 2QG7A 5M06A 3P1AA 4XG4A 2QHNA 4M0ZA 4O27B 3EQHA 5EH0A 5KZIA 4KBKA 1OPJA 2XK4A 3FLQA 4FT9A 4GIIA 4BIEA 3TUBA 3DLSA 1YRPA 2OH4A 4PTGA 3TN8A 2VRXA 2X8IA 4AW0A 2E9OA 2OWBA 3DKOA 4ZTLA 3AKJA 2XA4A 1CM8A 1O6LA 4YURA 4ZTMA 2IZUA 4JMQA 4TNDA 3GU6A 2WMXA 5IQEA 5JRQA 4FG8A 2X6EA 4FIFA 2ESMA 4APPA 3I4BA 3FLZA 1UWHA 5IEYA 3V5JA 2XK7A 3AG9A 4JOAA 1QCFA 2WO6A 4UYNA 4O7YA 5D9HA 3CD8A 3COMA 4QDEA 2WQBA 4M12A 3R7EA 4B9DA 4OLIA 3ZLSA 4O81A 4X3FB 1OMWA 2Y9QA 3F82A 1R0PA 2BRNA 3Q53A 5AR8A 4LGDA 4XLVA 4I6BA 2YIQA 3B2WA 3QZHA 1FINA 4YU2A 1G8KA 3RK9A 2QONA 4IADA 5GIOE 5CAVA 2ITUA 4F99A 4GH2A 3ACKA 1KE6A 2XBAA 4JX3A 5BUEA 4QQTA 5ANGA 3NEWA 3PIZA 2IVVA 2XS0A 3EL8A 4YHFA 4O4BB 2J5FA 4Y85A 5J9LA 5DRBA 4TWNA 2OLCA 4P5QA 4C4FA 3VBWA 4QP2A 5HEZA 2A4LA 3C4CA 4IZ7A 2ERZE 4LRKA 3C0HA 2Q0BA 4O83A 2GNHA 2FSMX 3OBGA 2EUFB 1XMMA 1OM1A 4N6ZA 2WMAA 4D1ZA 3NYOA 4ACHA 4G9CA 1FMOE 1WAKA 1YXXA 3C50A 3G6HA 3PUFC 1XO2B 3DK3A 5CAPA 4FZ7A 2HWOA 2AQXA 2W7XA 3RHKA 2XNMA 5G1XA 1SNUA 3ALOA 5DPVA 5C8MA 1Y57A 2YZAA 4A07A 4AWIA 3FMNA 1PW2A 3P7BA 4II5A 4EKLA 3AKKA 4G3GA 4C36A 3LFEA 3E8EA 2BPMA 2GHGA 2BUJA 2HXLA 3AMBA 1PXJA 5L8LA 4N57A 4K18A 4YBKA 1A06A 5DNRA 1ZMUA 5GIPE 2XAMA 3G51A 4NKSA 3R7OA 3EKNA 4CQGA 3ZDUA 4RVKA 4YZNA 5DT0A 5L3AA 4LDTA 3QL8A 2RFEA 4H3BA 2OXYA 4MUQA 4ZY6A 1XBBA 2XRWA 4ZZMA 3FI3A 4BTFA 3EYHA 2BCJA 3O50A 4FTQA 4QMWA 4BCGA 4GG7A 2E9UA 1ERKA 3VS3A 1YHWA 2IVUA 2XCKA 2F49A 2OH0E 3L9NA 3OXIA 4MXAA 3HMPA 4RA5A 5TT7A 3PXRA 4Y5HA 2UV2A 4PPBA 3VS5A 1OB3A 3JR1A 4O0SA 2YIXA 4G17A 4FTOA 2PE2A 2W9ZB 1UU9A 3AD6A 3DKCA 3FSFA 3MH3A 4TT7A 5DR2A 3WF9A 2G2IA 5HE1A 4XRLA 4YLKA 2OICA 2CN8A 4CRSA 4ITJA 4LRJA 4IBMA 2VWVA 4AZVA 4IX3A 3UC3A 3DY7A 3B8QA 4TY1A 5FRIA 1X8BA 3IW7A 2CCIA 4RWIA 3PUPA 3TJDA 5IF1A 2Y6MA 4MTAA 5FWKK 4O0VA 4O6EA 3AGLA 5C01A 1OL6A 4L7FA 1Y91A 3E7VA 4PX6A 2QOQA 4QOXA 2QOCA 4BDDA 3BE2A 3RK5A 1RE8A 4BDFA 4F9WA 3TCPA 4JI9A 5KBRA 2BAKA 3TL8A 4OBPA 5CANA 1P4OA 4JQ7A 3UIXA 3LAUA 3P08A 2WGJA 1ZY5A 3I79A 3F66A 3UO4A 2R0IA 3ENMA 4ENXA 3E5AA 4FI1A 3VIDA 4AXEA 4BBMA 3I6UA 1V0BA 3FY2A 5AV3A 5EM5A 3AMAA 4IAIA 3W16A 2IF8A 1OPKA 1Q5KA 1VYZA 1YDRE 2WIHA 2X0OA 2DYLA 4JQEA 4W4YA 3ZCLA 3SG8A 5M53A 3BCEA 4FODA 5AUZA 5BVDA 4CNHA 4LI5A 1BLXA 3M42A 4IC8A 4JR3A 1XWSA 4NM7A 5CSHA 5G6VA 3G90X 4YLLA 3L9MA 3HV5A 4WRSA 1OL7A 4G3DA 3HP2A 4I6LA 3D0EA 4MYGA 4FX3A 2ERKA 3LOKA 2CCHA 2PUUA 4QMTA 3RPVA 4DEAA 3AC2A 2WOTA 3QCXA 4O0UA 3EQDA 4BZOA 3ZXTA 3CJFA 4KKHA 4I3ZA 3GU7A 2HIWA 3HMOA 3ORLA 3A7IA 3OXTA 3ZO2A 4CFWA 1TFFA 5C8KA 3I60A 1XH8A 4HVSA 4K77A 3RM6A 2OKRA 1WVYA 3VUMA 2OBJA 4LOQA 2J50A 4XX9A 3HA8A 3Q04A 4E8AA 5KZ0A 3TI1A 5EM7A 2OGVA 4USDA 4M69A 3OTVA 2BDWA 4ZZNA 3WOWA 3FMJA 4ORKA 3JUHA 2GS7A 2I40A 3CXWA 3PSCA 3KRLA 3NGAA 4FTIA 4LGGA 3ZO3A 2J0IA 2UW5A 3GFWA 3QA0A 4NWMA 4W4VA 5CXHA 2Y4IC 4UY9A 3RWPA 3TEIA 3DJ6A 4YR8A 4CG8A 3PZEA 3MFSA 4XV2A 4AX8A 4Z7HA 4C0TA 3N4UA 4YNOA 3IDPA 2X7GA 3QC4A 4AN9A 4ARKA 3R7GA 4Q2AA 5HX8A 1YXSA 3A7HA 4NTSA 2ETMA 3VQUA 1H28A 2OFUA 2O64A 2IW9A 4DFYA 5CSVA 3HVCA 4DHFA 3JPVA 4FT7A 5D1JA 2VAGA 4C3FA 3R8LA 5HZNA 3EWHA 3A4OX 3O7LD 5JGAA 4XCUA 4NUSA 4M13A 3VBTA 4TYJA 1SM2A 2XB7A 3NVMB 3PP1A 2ZV7A 4NW6A 5DG5A 4HCVA 4RVLA 5E8VA 5B0XA 4F1TA 1KOBA 3Q6WA 2YISA 2VO0A 3DCVA 3OWJA 1M7NA 3NS9A 3QRKA 4M69B 5EM8A 5AR7A 3ULIA 4H05A 5CX9A 5FEEA 3E64A 3TT0A 4FKOA 3TV4A 2OU7A 2RFDA 3HECA 5HICA 3H4JA 5BYYA 3PVGA 2QO9A 4IVCA 3W0QA 4IB5A 4DEBA 3G9LX 3E92A 3MFUA 3Q32A 3AC3A 2Z7QA 3FQSA 4AE9A 3KRXA 4A9SA 2FYSA 4GFGA 3RNIA 4BDAA 1UNHA 5BVFA 4O4EA 4B7TA 5KE0A 4JXFA 3ANQA 3EHAA 1QMZA 4PY1A 4XLIA 4EOQA 5LWNA 3QTXA 4YJTA 5GJFA 4R7IA 4ZMFA 4ZP5A 5IQBA 2E2BA 4MH7A 4Q9ZA 5EW3A 4PNKA 3TDWA 2QOBA 3BHYA 1U54A 3W2QA 4XYFA 3L8PA 2BVAA 3NFGB 1YOLA 2ZAZA 4UMTA 4XP3A 1MRUA 5LMBA 4BI1A 2IN6A 4R77A 5EYMA 3ATSA 3LQ3A 4X2GA 4OBOA 1B6CB 1FVRA 1VR2A 3FKOA 1PF8A 2WMTA 2HW6A 4RVTA 3R8ZA 4EYJA 4LOOA 4D0WA 1XH5A 5L4QA 3OUNB 1G8JA 1YOMA 3IS5A 1Q61A 2YCFA 3M2WA 4OTWA 3P9JA 4H3PA 4CCUA 1JKLA 2FB8A 4BN1A 2W1CA 5LXMA 2WU7A 4WO5A 2A0CX 5M44A 3EB0A 1TVOA 3O2MA 5CAOA 3P4KA 2PVJA 3DDQA 3Q6UA 4IM3A 2REIA 3BU3A 4LV8A 4ZTQA 5LARA 4EL9A 4F09A 2QU5A 4ZSJA 3TKIA 2PZPA 4FKGA 4U43A 3EFLA 3GCPA 4ZTHA 1U54B 3VRYA 4XG9A 4L01A 4F0GA 4FC0A 4F6WA 2Y4IB 4D2VA 4FGRA 4DT9A 4PDSA 1URCA 2DS1A 3NAYA 4NW5A 3TXOA 3TG1A 4CFMA 2O8YA 2OSCA 4L52A 4TNBA 4EHGA 4AA5A 3PIYA 4FRFA 4MBIA 4HVGA 4L3PA 4QMVA 4WBBB 2PVFA 4XOYA 2VTLA 1QPJA 3DLZA 4R5YA 5CENA 1UNLA 4BCOA 3L8VA 4UMUA 3Q5IA 3KY2A 2X1NA 2IW8A 4CEGA 5ETAA 3UZTA 5K5XA 3EKKA 4YNEA 3DNDA 4CRLA 3W0MA 4C57A 2P55A 2PVRA 3R8UA 2GU8A 5AR2A 5C1QB 3H0YA 3UZPA 2VTJA 1UU3A 4L42A 4O0RA 5HLWA 3Q2JA 3ZM9A 2XANA 4MNEA 4FKIA 2B1PA 3QRIA 5KHWA 1PMEA 3MVMA 2JFMA 5EK7A 2BZJA 2KULA 5AJQA 2QHMA 2G1TA 3NFFB 3BL7A 3QAME 5LVPA 2V22A 3IW6A 4EONA 1OITA 3UDTA 5F95A 3D2KA 2YM7A 3PPKA 2Q0NA 2ZM1A 3V3VA 3R30A 3VWAA 3NAXA 1YXUA 4Y8DA 1OIUA 2UW3A 4CLIA 4L45A 5LVOA 2IEWA 3PSDA 2YJRA 2DUVA 3AT3A 3DFAA 4B8LA 2HAKA 4YHTA 5E91A 1K9AA 1J7IA 1YVJA 4ASDA 2XNPA 1FVTA 3Q9XA 3F5PA 3N4TA 3BLHA 4GVAA 2YDJA 2VWIA 3D7TA 4RLKA 1Y8GA 2GQGA 4EWQA 5B2MA 4NJ3A 5KCVA 3ODZX 4XV9A 5CSWA 2AUHA 3QF9A 4C61A 4NYEA 3E88A 4NFMA 2WU6A 4QMSA 4DC2A 5HBJA 3QTIA 5EDPA 4QPAA 2W4JA 2W1IA 2GCDA 3O8TA 5M56A 2H6DA 4RWJA 3V8SA 4AXFA 2UVXA 4TWPA 5C03A 1G5SA 1RQQA 5AM6A 5LVLA 4EZ5A 3LFQA 3L9PA 2X7OA 5AP7A 1JPAA 2XK9A 4KBAA 5JZJA 3KIOC 3I6WA 3FDNA 3ZFXA 1VEBA 3LM0A 4D5KA 1JQHA 2XIKA 4DGNA 1OBDA 2WTIA 2IW6A 2X8EA 3ZFMA 4LYNA 4O4FA 1ZOEA 1OIRA 2NO3A 3EQIA 4RJ3A 4AN2A 2C5VA 2W9FB 4G5PA 4OTDA 4BYJA 5HE3A 1KE8A 3W32A 4FNYA 4QPMA 4ANNA 2QOOA 2WIPA 2JGZA 3S00A 3TJCA 2R7BA 4ONAA 1OKYA 1SVGA 3ZRKA 2VU3A 3HP5A 3PJ3A 3BU5A 5KHXA 4HZRA 3D7TB 2WTVA 4BCJA 3R8VA 2WD1A 5M4IA 2CDZA 2VX0A 3ZZWA 4E3CA 2BRHA 4Z3VA 5JEBA 4RJ8A 3HRBA 4J8NA 4UV0A 3GOPA 3PWDA 4AW2A 4KS8A 4QDVA 3NNVA 1PKGA 5GNKA 4BKJA 3DAEA 5BVKA 3BYUA 3RK7A 1V1KA 2PZ5A 4D0XA 3GC0A 3UIBA 2R3RA 5TKDA 4FNXA 3F88A 3ZBXA 2X8DA 4MD8E 2GS2A 3GQIA 1YWVA 3QZFA 2W5HA 3EZRA 4M97A 3TDVA 4AE6A 1XR1A 5IG1A 4OTQA 4X2KA 2CGVA 3WBLA 4KSPA 3W10A 1NVQA 2ZV8A 3LCOA 1Q97A 4I6FA 4IJ9A 2X0QA 2QO7A 3WZJA 5LCKA 5D10A 5L6OA 3FKNA 4LL5A 3R1YA 4FG7A 4FT3A 4A9RA 4NM3A 4HPUE 3GU8A 2HK5A 2ZYBA 2C30A 4RX7A 4RIXA 5GJDA 2VTTA 4J95A 2J6MA 3A99A 3QGYA 3DAJA 5IA3A 4BZDA 4G3CA 4GK3A 2J2IB 3ZUVA 3ZLXA 3R21A 4XBRA 2JIUA 2BRGA 2FO0A 4IB3A 4QP7A 4O6LA 3TZ7A 3MVLA 1PMUA 4JBPA 3DFCB 3OD6X 1ZRZA 4U8ZA 4A9UA 3CPBA 4CQEA 5E4HA 4FOBA 5D7VA 4IIRA 3KCFA 2VN9A 3VS0A 3TM0A 1CKJA 1T45A 1FMKA 3JY9A 3Q9WA 1Y6BA 2O2UA 3KK8A 3I81A 4FSYA 4KNBA 1PRYA 4DBXA 1ZYDA 5IH5A 3V5QA 2UW0A 3MTFA 3RGFA 3CR0A 3IOKA 3QXOA 3LJ1A 3PA3A 3QUEA 3KF7A 4TN6A 5CAUA 5IDNA 5FLFA 1K2PA 5E8TA 3LMGA 5KMNA 5FP6A 4M68A 2QG5A 4BGQA 1ATPE 1WFCA 3QD4A 3D2IA 5J7HA 4FSTA 5HTBA 3O23A 2JDRA 3OWKA 2HYYA 5EHLA 2BILB 3MESA 1XKKA 4WKQA 3WZKA 3KMWA 4I94A 4JT3A 2WQMA 4RIXB 1ZZLA 2CHLA 5DMZA 4NIFA 2W5AA 5F4NA 3T8OA 4A7CA 3BYVA 4D2WA 3PVUA 4O91A 1W84A 5J5SA 5CF6A 4L00A 4GFOA 3KFAA 5DBXA 4DGMA 4CKRA 2WZJA 2YWPA 2CKQA 4ID7A 4LGHA 5HO8A 3VBVA 4AOJA 3BIZA 4P90A 3COHA 4DG3E 1ND4A 5KO1A 5FD2A 5E1SA 1ZZ2A 4YTHA 2YLFA 4F0IA 4FA2A 3BE9A 5IEVA 3EFJA 2I1MA 4BI0A 2VWWA 4NM5A 1A48A 3Q4TA 2YM3A 3SD0A 2WMQA 3MB6A 5K4JA 3OMVA 5CU6A 5A4LA 3VHKA 1YI4A 3KU2A 4XG2A 4IZYA 1KV2A 4EC9A 3R83A 2WFYA 2UW7A 2BR1A 3PRFA 2GHMA 2PVLA 4XG6A 4BDCA 2A2AA 1Q24A 4DA5A 4FKLA 4YUQA 2FSOX 1H0WA 2BZHB 4FSRA 4QMYA 1URWA 4ACDA 4FV2A 4NFNA 2R3NA 4FBXA 5L8JA 3OOGA 3GC9A 4EJ7A 4U81A 3I5ZA 4W4WA 2QQ7A 5IZFA 4K11A 3G15A 3U6IA 5M4FA 4C3PA 3HNGA 5L2QA 2SRCA 3BQCA 4PL5A 3LLAA 5BNJA 3HRCA 4FSZA 4R3RA 4XS2A 2GPHA 4XRJA 5ETIA 4AU8A 5LJJA 3QUDA 4I5HA 4OW8A 4DFBA 4BCNA 3MFRA 2GSFA 4AN3A 3EN4A 1P2AA 4O0YA 1IG1A 1J1CA 2R3PA 5M55A 2C6DA 4D2SA 4J1RA 4JL9A 3ZLWA 2YIYA 4PQNA 1QPCA 2F2UA 4WIHA 5HBEA 5AX9A 2ITWA 4F08A 2BTRA 5ANEA 2PU8A 3NUXA 3GQLA 4TWCA 2VO6A 3R1NA 2YDKA 4ANMA 3R8MA 3KXHA 3IGOA 4BB4A 1WZYA 1REKA 3LQ5A 4QPSA 4AT4A 4O82A 3Q4CA 4FEXA 3FI4A 4IFGA 3PJ2A 4KKGA 4QP1A 3VBYA 2I7QA 4IE9A 4NSTA 4K33A 3IO7A 3MVHA 1UWJA 4RC3A 3UPZA 3AD5A 4O21A 3IK3A 3UJGA 3DT1A 3KKVA 4EOMA 2ZDUA 4FV8A 2ZFYA 4I22A 2JAVA 4F7NA 3BQRA 3BYOA 4V01A 5TE0A 1R3CA 2ZMDA 5HNIX 2QR8A 1PXNA 3R02A 3WF8A 5KMKA 4W4XA 5HNGA 1SMHA 3FI2A 3LJ2A 2XP2A 1ZLTA 4QEBA 2J90A 3LQ8A 4EHZA 5LMAA 3NUUA 4E5AX 4FEQA 3P0MA 4S34A 3D5XA 4EWHA 2VTAA 4S31A 5LMKC 4JJRA 2YIWA 4FIGA 5CI6A 5I4NA 5IUIA 3ZEPA 1JKSA 2UZBA 1UKIA 4B6LA 5FBOA 4UZDA 2RFNA 4CFFA 2I6LA 4OTIA 5HVYA 5A4QA 2PE0A 4YZCA 3ZC5A 4O0WA 4J98A 4F6SA 5H8BA 3R9NA 4RPVA 2YM4A 4XH6A 5CVFA 1H8FA 3AD4A 2ZB1A 3FE3A 1GZ8A 3H9FA 2VTMA 4YPDA 5DGZA 2FA2A 5A9UA 1PKDA 3QRJA 2WTCA 3OTUA 4FSQA 1LEZA 3CY2A 4U3YA 2OXXA 1H1WA 2BDJA 5F94A 3PRIA 3NR9A 2PE1A 3PXFA 3EL7A 4U80A 3F3VA 4D1XA 5L6PA 3QD0A 2RFSA 3UYTA 2WEVA 1F5QA 2XKFA 4I20A 5DHJA 2OF4A 4WG4A 3MYGA 5IH4A 3PFQA 3R6XA 5FEDA 5IQAA 4OTFA 5DE2A 4LM5A 3D83A 4FSWA 3HL7A 3PXQA 4EOJA 4WRGA 1TZDA 2ZB0A 1H00A 2WMUA 1JSTA 3PY0A 2VTHA 3KCKA 3D7ZA 3FLYA 4JAIA 5K5NA 4C4EA 3KRWA 3IONA 4C4GA 4KINA 5EI8A 4E7WA 4GFMA 5DRDA 2BKZA 5DT3A 3ERKA 5CF8A 3EZVA 4C8BA 5J87A 3KXNA 5CEIA 1ZOGA 5DEYA 3RPYA 4K1BA 4F0FA 2GS6A 2XJ0A 1KE7A 4XHKB 4C3RA 2YCRA 3BWJA 4IB1A 5LMKA 2W17A 4I0TA 3TYKA 2C0IA 2WOUA 1Q4LA 3DGKA 3NIZA 4F7SA 3GC8A 3C7QA 1PXKA 3KQ7A 4C4JA 4U41A 4JVGA 4HGEA 4JX7A 2W0JA 1TKIA 4ZTSA 4FKSA 2VD5A 3MV5A 5HU3A 1MUOA 2GFCA 4G6OA 4NEUA 3DKGA 4M67A 5E8UA 4EH3A 4AXDA 3OG7A 5LWMA 4IHPA 5HI2A 3ORKA 5JFWA 5HVJA 4JG6A 4BYIA 3SRVA 4AS0A 2XM9A 4L46A 3QALE 4HOKA 3ZYAA 3H3CA 2ZOQA 3F2RA 4RWKA 5D41A 3CQWA 1ZMVA 2X7FA 3NZ0A 4I6HA 5DFPA 4FVPA 5T6KA 1Q3WA 4YJUA 3UQCA 1OKZA 4TKSA 3MBLA 3SQQA 1Q8WA 2W4KA 2YEXA 3KRRA 3O8UA 4U6RA 3T3UA 4DHZA 2VZ6A 3IOPA 5E8XA 4D1SA 3R0TA 4Y73A 1T46A 3TTIA 5GZAA 4NK9A 2RL5A 1YWNA 4I0SA 2HZIA 4LMUA 4M15A 4F65A 3LFAA 4FEWA 1XHAA 4FTRA 4DTKA 3UDSA 3T9IA 4JRVA 4JDHA 1GY3A 3BI6A 3WILA 4FJVA 4FF8A 3VJNA 2EWAA 3OC1A 4RZVA 4GRBA 3POZA 2W1EA 2F57A 1B38A 5AP1A 1GJOA 4QMPA 1SZMA 4IWDA 4MBLA 3MDYA 2CMWA 4R3CA 2ITOA 4ACMA 3ORPA 1SYKA 2PMNX 4DYMA 4ERWA 2WELA 3SRVB 1ZYJA 4BKZA 2OJFE 5AP0A 3HV7A 3KL8A 3PLSA 3R1SA 4OT6A 5IQCA 4PV0A 4M3QA 2WTKC 4A9TA 4KIQA 3FYKX 5BQ0A 3P23A 2I0YA 3AC1A 4FV9A 5CF4A 4CMUA 2JDSA 3LM5A 3HDNA 1KUTA 4L43A 5IA0A 4S2ZA 4M84A 4RJ4A 4O1OA 1ZAOA 4S30A 1Q41A 4RGJA 4EHVA 4BRXA 2ZV2A 4DFUA 4AF3A 4D4YA 1JAMA 2R3IA 2CKPA 4LMNA 3VO3A 5H3QA 3DB8A 2VO7A 2C6IA 4MWHA 3SW7A 3DZQA 4QTAA 3ORMA 4O0XA 1H4LA 5FBNC 1H1QA 3EQFA 3FZ1A 3OUKA 4IC7A 3F2AA 2EB2A 3ET7A 3ORZA 4C62A 5KX8A 2R3LA 2XZSA 3DB6A 1H1PA 1E1XA 1NVSA 1AGWA 3JVSA 1GZKA 4DITA 2Y0AA 1HCLA 3RBWA 2P4IA 5E1EA 4J53A 4EYMA 4QT1A 1GZNA 2CNVA 3KF4A 4EH9A 4W9WA 4FV1A 2C68A 3ZZEA 5H8GA 5FUTA 5J5TA 4G2FA 4FV6A 4IVBA 3V6SA 2UZTA 1OL5A 2HY0A 3OCGA 3D5WA 5AIKA 3F61A 1CSNA 4YBJA 4L53A 4LL0A 3AC5A 3PPJA 4ZY5A 3W0RA 2R0UA 5K9IA 2W1FA 1WBOA 2ZMCA 4O7ZA 4GJ3A 4F70A 1AD5A 3OXZA 3ZRLA 2UZVA 4D9UA 2OJJA 3IGGA 1WBPA 3A8XA 3IECA 4IEBA 5HIBA 4JG7A 5ACBC 1Y8YA 2V55A 2V5QA 3R71A 4E93A 4EHEA 4QMNA 2XM8A 3U4UA 1OVEA 5ETCA 5KMJA 3R22A 3Q4UA 2WQOA 4HYIA 2AC5A 5AUYA 5J7BA 5CTPA 4E6CA 4EC8A 4QTCA 4OAVB 2F7ZE 3BYMA 3ODYX 3U4WA 4EQMA 5IQGA 3E3PA 3DS6A 1O9UA 1OUKA 4AGWA 3VUGA 5HOAA 4FEVA 4IH8A 2XVDA 3KC3A 3Q9YA 2C1AA 3QTRA 3QQFA 3JY0A 5CNNA 2UUEA 4KKEA 5EW9A 5HG9A 3WZDA 4F9BA 1ZARA 2XJ2A 3AT4A 4RMZA 1H24A 2YIRA 4YO6A 5FQDC 3LCDA 4RA4A 3UVPA 3VS6A 2VUWA 3R28A 2RGPA 3DNEA 5IQFA 4ZS4A 4C37A 5EM6A 2R3FA 3ZBFA 2R3OA 4BDEA 4AAAA 5CT7A 3FPQA 3MW1A 4QP9A 5FXSA 1Q3DA 4C7TA 5M57A 3TNIA 5CEPA 4EK3A 4KB8A 4TYGA 2VWBA 4CKIA 3OT8A 3U55A 3NUSA 4IMYA 2WTKB 2WHBA 3Q3BA 3U54A 4DG2E 2JKKA 4A4XA 5BUJA 1SVEA 4QP6A 4GJ2A 2G01A 4LOPA 4PTEA 3ZHPC 3ID6C 4TWOA 4I5MA 2EXMA 2WTJA 3OW4A 3LPBA 3MB7A 4DT8A 3NSZA 4DEDA 4DG0E 1CDKA 4RJ5A 5HG7A 1Q8YA 2W1GA 4CSVA 2RKUA 4EQCA 3VONA 3FPMA 2J51A 4LG4A 4U5JA 4BBFA 3BHTA 1B39A 4FGBA 4G5JA 5JQ8A 4R78A 4PWNA 4FOCA 5C26A 3FUPA 3AMYA 1S9IA 1W2DA 3MVJA 5AR3A 4C2WA 4L8MA 4FKUA 5CEMA 3T9TA 1DAYA 3UBDA 5EOLA 4HVDA 1LR4A 5HO6A 3BHVA 5BUIA 3EQRA 3MPTA 2AC3A 1GZOA 2I0VA 4G16A 4GG5A 3CEKA 5AADA 3RALA 1IA9A 3CLYA 4PMTA 3ETAA 1K3AA 1GIHA 2ETRA 4U44A 3U9NA 4FVQA 4R8QA 4RVMA 5DR9A 3R7IA 3F6XA 2PVNA 3P7CA 4RSSA 3OHTA 4QO9A 5AV0A 4QMUA 3D9VA 4BCMA 3C13A 4UB7A 4U9AA 4DLJA 4FT5A 4MNFA 3LFSA 3R01A 4D28A 1M52A 1WBTA 4ASZA 3W0SA 1KSWA 1W83A 4B0GA 5FM3A 4AZSA 4H1JA 5FTOA 3OVVA 4X2NA 4RJ7A 4AA4A 3C5IA 2BMCA 4O2ZA 4YTIA 3K54A 3NW6A 3ORNA 3HRFA 4O7VA 1ZXEA 2B9FA 4JLCA 5HO7A 3H30A 3MY0A 1QPDA 3VN9A 2WMBA 4IAZA 1XQZA 4IVAA 4X6QC 3O17A 5CI7A 3GU5A 1MQ4A 3QBNA 5CQUA 4EH2A 3QYWA 4R3PA 3C1XA 4E6DA 2UVYA 3VC4A 3FMKA 4RBLA 3OS3A 4FV0A 3KVWA 4KUJA 1JSUA 2Q83A 4IDTA 4A4OA 3S1HA 1J3HA 2X39A 5IEXA 5L2TA 4JDIA 2ETKA 4DHIB 3S3IA 5TR6A 3OCTA 1LP4A 2A98A 4HYUA 4YZMA 1I09A 3A7FA 5JQ5A 4H36A 2GNIA 4GVJA 1G8SA 5EQPA