1JBPE

Crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with a substrate peptide, adp and detergent
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
339
Chain Sequence
GEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADEPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title cAMP-dependent protein kinase: crystallographic insights into substrate recognition and phosphotransfer.
pubmed rcsb
source organism Mus musculus
total genus 113
structure length 339
sequence length 342
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1jbpE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1jbpE02
3BI6A 2PZYA 3NW5A 4JI9A 4NIFA 5ACBC 3RK7A 4BDAA 2A2AA 2YDJA 3R8MA 5ETIA 3OOMA 4F70A 3MPTA 2XBAA 5I9YA 5E8UA 3KXXA 5J5SA 1ZMWA 2JC6A 5DRBA 2BMCA 3KRRA 3PJ2A 4WUAA 5EM6A 3ZFYA 4C2VA 3ZH8A 4DTBA 2X8DA 4H58A 5IQHA 3UPXA 3UC4A 4WSQA 3AXWA 4FYNA 1REJA 3TZMA 3NNXA 2X8EA 3RWQA 4N70A 1ZY4A 2F7EE 4DN5A 5J9LA 3F9NA 3R21A 4YURA 4FBXA 3ZSHA 2ETRA 3GU8A 4E6AA 1DI9A 2PVMA 4LOQA 4QQJA 1GOLA 4FT3A 3ZDIA 1K2PA 2Y0AA 4MXOA 4PP7A 1R0PA 5BPYA 2ZOQA 2CN8A 5EH0A 3CQEA 4C36A 3V5QA 4F08A 4IAAA 2HW7A 3PP1A 4IAIA 4RVMA 4ENXA 2R3QA 5DIAA 3HMOA 4IMYA 2CDZA 4CQGA 2W1FA 5ETAA 4FSZA 5C27A 3TZ7A 4FIGA 2XYNA 2OO8X 3H3CA 3W32A 3DNEA 2VUWA 5LXMA 3QYWA 3I6UA 4V0GA 3FLSA 4NJ3A 2YM4A 4AA5A 4CMOA 2VGPA 4ID7A 5HE3A 1E1XA 2FUMA 3WYYA 2UZOA 4YZBA 5HCXA 3IPHA 3ODZX 2GS6A 2J90A 1SM2A 4U79A 5IA5A 1G3NA 5HO6A 4RRVA 5HZNA 2WMTA 5GZ9A 3VS3A 4EZ7A 2P4IA 3ZU7A 5DWRA 3ZBXA 4JG6A 3VS4A 3PFQA 4KBKA 1B39A 3S2PA 4JR3A 5E91A 4O81A 2YCRA 3RCDA 4EH9A 1KE9A 3GENA 4X7QA 3EFLA 2XRWA 3RPYA 3NUXA 3PDTA 2VX0A 4J8MA 3U9NA 2NRYA 3CJGA 3NCGA 3G0FA 1VZOA 3QXOA 3MFUA 4FICA 2XYUA 1ZYJA 4MX9A 5L8JA 4R1VA 1XBBA 2F49A 4HGLA 2BRMA 5IQGA 4DEEA 4PMPA 1OL1A 4JVGA 3CCNA 3R22A 4FT0A 4PTGA 5EHYA 4EOIA 2OI4X 3OFMA 4DGGA 3TTIA 3ZO1A 1W83A 5HNIX 3SW7A 2ERKA 3E93A 3PXKA 4QMWA 4CV9A 3UNKA 1KOBA 3GCVA 1Q41A 5DE2A 1H8FA 1YDTE 2F9GA 3R0TA 4W4YA 4F0IA 5C1QB 2CNUA 4EJ7A 4D1XA 5HBEA 3CQWA 4E6QA 2BZKB 4RG0A 3UOJA 3WF5A 3AG9A 5F1ZA 3VBQA 4DGNA 5C03A 3OUNB 2WTKC 5A6OA 3HUBA 3DQWA 4GT4A 2YCQA 4QYHA 4YP8A 4O0XA 4GRBA 4QPMA 5BUEA 4IDVA 2BR1A 2YFXA 2OJFE 4LV5A 5A3XA 4XHKB 5HE1A 2BKZA 2ETKA 4EKKA 3QHRA 4WG3A 2GU8A 1OUYA 3NW7A 4HYIA 4YNEA 2X9EA 5M09A 2OK1A 4D1ZA 4AOTA 2X2KA 1MRYA 4RJ5A 2QQ7A 4Y85A 5AP2A 4FSYA 4Q2AA 3IDCA 4JBVA 3UYSA 1JKKA 4BKYA 3IW4A 2PMLX 3C5UA 2Q0NA 4L67A 5HESA 2CPKE 2O65A 4NSTA 2YITA 4ZZNA 3KRXA 2IWIA 4EOOA 2B52A 4I4EA 3PE2A 5L2SA 4UWCA 3KL8A 5AUZA 4BDBA 4CKJA 2VTPA 3VUGA 5BUJA 3PLSA 3NYXA 3PIXA 4FV6A 4MNEA 5AX3A 3UMWA 5LVMA 4IC8A 3PLAE 4YJTA 3UOKA 2WQEA 2QOKA 2ZV9A 4UWYA 1Q8ZA 2PUIA 3R71A 3KEXA 4BCQA 4F9BA 4FKVA 1G8SA 3EQIA 3E8DA 1Q3DA 5KMJA 3NDMA 3SRVA 3OF0A 5CEQA 4AZTA 2BAQA 2O64A 2IPXA 2YIQA 3DZOA 1QPCA 4KKGA 1M2PA 2YDIA 4QP1A 4EEVA 2NPQA 5I9WA 4LG4A 3WE8A 2XK7A 3POOA 2C5NA 4QT1A 1ERKA 5BQ0A 5DEYA 4YJOA 5JRSA 2AYPA 4RIWB 4NKSA 3TG1A 5FBNC 1JKTA 2IVUA 4EBVA 2C69A 3PSCA 3F2RA 3C7QA 1CTPE 4RLKA 2YZLA 4FL3A 3WZKA 1PXNA 1Q8TA 2ZB0A 4IJPA 4I6HA 2C5VA 2Y7JA 3FMDA 5CU6A 4BCMA 3MDYA 3IDBA 1LP4A 4LOOA 1ZMVA 3DAJA 3ZS5A 5L2QA 2B9FA 4QP6A 4KIQA 5FRIA 2VAGA 3QD4A 4A4LA 3ETAA 3P7BA 4KS8A 2JD5A 3A2CA 3ZEWA 2X7FA 4QMVA 1YHSA 4WKQA 2RFSA 4JOAA 3OROA 4EK4A 5TT7A 4MD9E 4OR5A 3ORKA 4AN2A 5LWMA 4S2ZA 4OBOA 4WD5A 4NUSA 4DFBA 2RSVA 3QTWA 5HO7A 1SMHA 3AC1A 3HMPA 2VTRA 4I5HA 5JH6A 3HAVA 2F57A 4ACHA 4QQTA 2PE2A 4APCA 3BV2A 2CHLA 2GFSA 1HOWA 3MFTA 4GK4A 2BRGA 2DYLA 4J96A 5AUXA 4HW7A 3AC5A 4FODA 3MH2A 4FUYA 3MSSA 4JG7A 2YCSA 2BTRA 3CR0A 3MY1A 3G6GA 4TT7A 3TXOA 4W8DA 3EFKA 4HCUA 3C4XA 2VX3A 2W1EA 3D2KA 1OVEA 4AXAA 4EH8A 3P7CA 2WTVA 4L7SA 3QUPA 5K4JA 2R3OA 4BHNA 4WG5A 3O7LB 4FKLA 5LMKA 1H08A 3QWJA 2O3PA 3CEKA 4PY1A 2LAVA 4BF2A 2VTHA 5FTOA 3OTUA 2Y4PA 3MA6A 3UVPA 2BDWA 3W2RA 1UU8A 3DT1A 4U6RA 4K18A 4O0VA 3MN3A 4G3EA 4D0WA 5K9IA 4UALA 4AW0A 3VF8A 2QG5A 1CKJA 5M4UA 3R9NA 3EYHA 2C5OA 4JRVA 5ANIA 3P4KA 3I0OA 3CIKA 5I4NA 2Y6MA 3SAYA 3LXLA 4KKEA 4XP3A 2GNGA 4FTCA 3BIZA 4R5YA 2VU3A 3QYZA 4WT6A 4EQMA 3WBLA 4DCAA 5GIPE 3AQVA 4RSSA 3CTQA 1REKA 1F0QA 4IZ5A 4ZTRA 4YLJA 3WI6A 4DH7A 3HMNA 3ZYAA 3ZO3A 4BDCA 5C8NA 1NVRA 2HK5A 4TYIA 4AZVA 4KIOA 3QKMA 3LCSA 1JOWB 5EW3A 4HNFA 2OU7A 4II5A 2ONLC 2QI8A 1Q4LA 3FLYA 5AR8A 3OCTA 5KZ0A 2Z2WA 3IOPA 4EOPA 1J1CA 3ACJA 4OTWA 4PL3A 5IG1A 2CKPA 2I7QA 2RKUA 4G9RA 3UVQA 4XV3A 4U3YA 5CNOA 4F63A 3Q4ZA 3LFAA 2EWAA 1YW2A 1A48A 3NYNA 2NRUA 4NT4A 4ORKA 3U54A 3VAPA 4FUXA 5D41A 2XRUA 4QP9A 1PYXA 1XQZA 1YHVA 1P4OA 4PX6A 5LARA 2V22A 5E8ZA 1PKGA 2WOTA 4QPAA 3P7AA 3K3JA 3KRWA 4FIFA 3BKBA 5CZHA 3RCJA 2QOIA 4BDFA 2PUPA 4E6CA 4IX4A 3EN5A 4K11A 2JKQA 3LFFA 4ANSA 5IA4A 5JT2A 4D4YA 4J99A 2XK6A 4BKJA 2OXYA 5I9VA 2OJ9A 5DR2A 2OXDA 4PMSA 5J9ZA 5LQFA 1PXMA 1H28A 5AP1A 2Z8CA 3L9LA 4I5CA 2BAJA 4FL1A 1H26A 1IAJA 3PJ3A 2HWPA 2OXXA 5ANEA 3DTCA 4JQ8A 3E63A 4CZUA 4M0YA 3FJQE 3E8CA 4BGQA 3DCVA 4O7NA 1X8BA 3MB7A 4QMZA 4OTFA 1H4LA 4EOSA 2E2BA 3Q6UA 1V0BA 3MBLA 2YIWA 3MJ1A 3ZXTA 4AA4A 1GZKA 4C7TA 3ULIA 3PXRA 3OCGA 3M42A 2HCKA 4ZSJA 2B9JA 4JX7A 4BDDA 2FO0A 3CXWA 1UU9A 3N51A 1OUKA 4F4PA 3LFSA 2GS7A 5GNKA 3KN5A 3NUAA 1TQIA 2W4KA 1WAKA 3FY0A 4RC3A 2JDTA 3Q9ZA 4UBAA 2VD5A 3PY1A 5D7AA 1ZZLA 4XG4A 5BVEA 3RMFA 4GS6A 5HIDA 3EFJA 2HZ0A 4NM7A 3ZLWA 4IM2A 4RWKA 3VS1A 5HTIA 3FMLA 4IBMA 1FMKA 4IVAA 5IH5A 5L6OA 2G2FA 4TYGA 4AE9A 5B2MA 3H0ZA 1YI4A 4J7BA 5HICA 4DF3A 3QD3A 1KSWA 4IC7A 2JKMA 4UXLA 4F6UA 2CNQA 1YHWA 2R3IA 1PF8A 2R4BA 2VO3A 3FSFA 3ACKA 4YTFA 4JIKA 4FGBA 2FSTX 4AT5A 4JDHA 3D0EA 3HX4A 3QD0A 4OTQA 4ZTHA 4A06A 4C4JA 4HVGA 4RIOA 1PMNA 3FDNA 4D58A 3D5XA 2NNWB 4M69A 3S4QA 1OI9A 3KK9A 3PWYA 4G3CA 4C59A 4JT3A 2C5YA 4LRMA 5CVHA 4C34A 5EFQA 1YRPA 1U5QA 3IGOA 4FKOA 4ZSAA 4CFWA 3S3IA 2R3KA 3FMKA 1OL6A 4CXAA 4IJ9A 4KBCA 1M2QA 3VBTA 4CFFA 1APME 1IA9A 4FTUA 4MCVA 4PNKA 4IW0A 3D14A 4FSTA 5IPJA 2W1DA 3C4EA 3SQQA 2W1IA 4I6QA 4LI5A 3KRJA 1VYZA 4IX6A 4D0XA 4AGDA 3ZEPA 3HP5A 4IX3A 4G31A 2XNEA 1GZNA 5J7HA 2ZV7A 5LVNA 1OMWA 2C0OA 3AC4A 3EN7A 3PRFA 4LL5A 4CNHA 3KKVA 1YI3A 1YWVA 2YIXA 3M11A 3NAXA 4JG8A 4YBKA 1WBWA 4O7ZA 4R5SA 3BGPA 4PQNA 1R3CA 4K77A 4BWXA 4W4XA 3U6IA 2XS0A 3C50A 3JY9A 5J1WA 4O7TA 3MJ2A 3MPAA 4OTIA 3ANQA 1SYKA 2WOUA 4OTRA 3NNWA 3R02A 4QQCA 5CI7A 5E8VA 4YJPA 4M3QA 4TNBA 4KS7A 1VR2A 4PRJA 3UDBA 3W18A 4DYMA 4GKHA 3A4PA 1Q62A 2H34A 2ZYBA 3PA5A 4H1MA 2VTAA 3K3IA 4MD7E 5L8KA 3LE6A 2BALA 5EOLA 4FZAB 4AN9A 3QFVA 4BN1A 4CKRA 2DWBA 5IA3A 1L3RE 3ANRA 1OIRA 2YACA 4IX5A 4L00A 4EK6A 4EL9A 3KGAA 2WEVA 4YJRA 4F7NA 3L8VA 4WNPA 3RINA 5M55A 5E8XA 4IWDA 5FEQA 4EOMA 1H1QA 5CENA 3UGCA 2VWZA 5CQWA 3BCEA 3ZO4A 1GY3A 5EYCA 3U8WA 4CMTA 4EZ3A 3FI3A 2UW3A 1MQ4A 1R0EA 3GC0A 2VTIA 4QMLA 3KB7A 3V5WA 1H0WA 3E62A 4F7LA 5JQ5A 2FSLX 2PY3A 3JVSA 5AUYA 5HG8A 3DXQA 5FEDA 3FBVA 5CY3A 3FMMA 4HGSA 4EYMA 3WF9A 3QTZA 4NZWB 3RALA 4F9YA 5HBJA 3Q5ZA 5L6PA 3QALE 4J52A 5CAOA 4I22A 4RGJA 3TKUA 3NR9A 4CCBA 2I1MA 3R8UA 3LKMA 4XBRA 3R73A 3D7TB 5CAQA 2OJJA 2ITVA 2P0CA 5D12A 3L8PA 3NUUA 2X8IA 4GV1A 1Z9XA 4ZSGA 3BQCA 3RPRA 4C58A 4KNBA 2B4SB 5AEPA 4E93A 5BNJA 3SD0A 3QTXA 1ZAOA 2O2UA 2WQNA 3FHRA 3HYHA 3PPZA 4NM5A 4TZRA 2UZUE 3ZLXA 4E73A 5I9ZA 2UZWE 2HOGA 4G3GA 5E8SA 2W1GA 4UMTA 1M7NA 4WO5A 4O0YA 1FQ1B 5A6NA 1OKWA 5CWZA 3UOLA 2Z7RA 4MWHA 1KE7A 4YHTA 3TV7A 4YHFA 3WYXA 2Z7LA 3SG9A 1XH8A 2WMRA 4QMMA 1BL6A 3LCDA 3FLQA 3BEAA 3VUDA 2JAVA 3LPBA 4AA0A 4GUEA 1Q97A 2ZMDA 2PZPA 4FTMA 3GU6A 5H8GA 4ANMA 4TY1A 5AP3A 2PVLA 2P55A 3QKKA 5I9XA 2GHMA 3D5WA 5EW9A 4QTAA 3SV0A 2X6EA 3ENMA 3BGZA 3LZBA 3MA3A 3R2BA 3FEGA 3BPRA 4PPBA 2BVAA 4GVAA 5L8LA 1NVSA 2VWWA 4NJDA 3FZPA 4FV4A 3LMIA 2CCHA 4YTIA 5LVOA 2C3IB 3MH3A 3IW7A 1AQ1A 2O5KA 3D2IA 4UMUA 5CU0A 4AZEA 2J0MB 4F1MA 5JK3A 4GYIA 2OIQA 4BBEA 5AP6A 5A4TA 5CASA 4AZFA 4J53A 1H1WA 1OKYA 2RFNA 3PZHA 3TJDA 2A0CX 3A7IA 4DCEA 3OWLA 1V0OA 3EN6A 5DH3A 4BC6A 3QRKA 3L8SA 3RI1A 4O1OA 4BL1A 4ZTMA 1WMKA 5TR6A 5E8TA 2IZRA 3FPMA 3HRFA 4QTEA 1BI7A 5IEXA 2OZAA 3TACA 1H00A 4DTAA 3PXFA 4U44A 4A07A 2JDOA 4DGLC 3UODA 3GCUA 1R39A 4E4XA 4Y5QA 3FZ1A 5AUWA 2P3GX 4D5KA 2X2MA 3FKOA 4FV2A 1PJKA 4U80A 1Q8UA 3DBEA 3R1QA 3UP2A 4QTDA 4QP2A 4WRGA 3O23A 4FTQA 4O6LA 4DC2A 3KXZA 4MBIA 3NUPA 1PKDA 4BZNA 4FV9A 1SNXA 2QCSA 5FEEA 3GUBA 5EQPA 3D94A 2PVJA 3A62A 1PXKA 3IO7A 3NNVA 4RJ4A 4YGAA 4HVHA 4RFMA 2QOCA 2CGXA 2V62A 4HGTA 5J79A 4ZS0A 4MF1A 5E4HA 1VEBA 1ZRZA 4GFOA 2CN5A 3NUNA 3R7EA 3TDVA 3OVVA 5JGAA 4O0UA 3I5ZA 3ZFXA 2ZAZA 4IHPA 3RPVA 4C3PA 3LMGA 1VJYA 4APPA 1BLXA 5HD4A 3Q32A 3FLZA 3UE4A 3HGKA 3DK6A 4E4MA 4EH4A 4ANLA 3ZC6A 2VTOA 1V1KA 3HEGA 4WNKA 2R9SA 2W1HA 5JGDA 4ASEA 5DGZA 4M7IA 2IVTA 3DAEA 4R78A 3GEQA 3P1AA 4DFUA 3GT8A 4QMXA 5AWMA 2O63A 3HNGA 4TWNA 3G33A 3MFRA 3MIAA 4R3RA 2JIVA 2G9XA 3DJ5A 2IZSA 2VGOA 2ITUA 4IWQA 4K0YA 2WQMA 4RWIA 4CG9A 4XJ0A 3GU7A 4DFNA 3UQCA 3TIYA 3VS6A 4FV3A 3PVGA 4C8BA 5GIOE 1ZARA 3SKCA 4O0RA 4LUEA 3FXZA 2C0IA 2XBJA 4AZWA 4EI4A 3UIXA 3KULB 4Z16A 3RKBA 5AR7A 1NA7A 5CAPA 2OZOA 2WFYA 4ZSLA 1FVTA 1Q3WA 2UW5A 4L3LA 4FT9A 4XCUA 3NMUF 5BVOA 3DKGA 4YBJA 1JWHA 3BHYA 1QPJA 4P7EA 2C6DA 3M2WA 4UMRA 4PL5A 4FYOA 4P90A 2ZJWA 4EUUA 5D7VA 3IW5A 4OT6A 3UO5A 4RWJA 4BY9E 3Q9YA 1XO2B 2YAAA 3ALOA 1XJDA 3EN9A 2YWPA 3QU0A 2YIRA 1J7IA 3O8TA 3P5KA 5F20A 5TE0A 1J1BA 1QPDA 3DLZA 3COMA 3HUCA 4GVJA 3C4FA 3NLBA 4KD1A 3TV6A 2UW8A 4CZTA 2WMXA 3G5DA 3AD6A 3VBVA 1OL7A 2RG6A 3JUHA 5HEZA 3VBXA 4QYFA 5H9BA 3IW6A 1WVWA 4QNAA 4YTHA 4EJNA 5K4IA 2F2CB 4RVTA 5CSXA 3I5NA 3TTJA 4AN3A 4E4NA 4D5HA 4BVUA 3VJOA 1IEPA 5IQBA 3KA0A 4QQ5A 3EQGA 3HV6A 4GFMA 3K5UA 3VUTA 2XA4A 3CTJA 3F7WA 1UNHA 4HNIA 3THBA 3C4ZA 4I0SA 5HTBA 1STCE 3RAWA 3SA0A 3W33A 3MFSA 4FV7A 4WG4A 3U9CA 4TRLA 3QQKA 4DT8A 4J95A 4RZWA 2WMAA 3ZUTA 4D2SA 3PJ8A 3Q3BA 3SW4A 5KMKA 3ITZA 3PXYA 4EZ5A 4OGRA 5AP4A 3KRLA 1BI8A 1HCLA 2GNJA 2WQBA 5AR4A 4QTBA 5HCYA 4A9YA 1ZZ2A 3UTOA 2G2IA 2YN8A 3DLSA 4BDIA 4XG7A 3QBNA 3Q53A 5HIBA 1Q8YA 2JDRA 3IOKA 4ZY5A 3CBLA 3F5UA 2O0UA 5EM5A 4BWPA 2JKOA 4DA5A 2KTYA 5HHWA 2GCDA 5FP6A 4DH8A 4DITA 1P2AA 3DBFA 3FXXA 4WBOA 5CANA 2ZDUA 1ZYDA 4HOKA 2R3GA 5HNBA 1WBVA 4OBQA 3UP7A 2FB8A 1WBNA 3VO3A 3T3VA 4EORA 2JBOA 5T3QA 4C4EA 3A8WA 4UZHA 1DAWA 3FE3A 3MVMA 4AP7A 4FOCA 2J6MA 4N57A 4CFMA 3FQHA 4HJOA 3ATTA 4GL9A 2VTNA 4M8TA 4BIEA 4LRKA 4CTBA 4OAUC 4N4SA 3MB6A 2QD9A 4DFYA 1BUHA 4EC8A 2GNIA 4F0FA 5JMSA 4I6BA 4FSMA 5FBOA 3G6HA 5JN2A 3BU5A 3O71A 3R01A 1YXTA 4U3ZA 4EH2A 5HNGA 2BCJA 3C13A 2WMQA 2PMIA 3FYKX 3KFAA 4QMQA 1XR1A 4M15A 2R0UA 4DHFA 3FI8A 5AUUA 2X0GA 4AFEA 3ZTXA 2ITYA 4QYEA 4F9WA 4FT5A 1H1RA 1UKIA 2RFEA 2UVZA 5M07A 5C01A 4TN6A 3F82A 3NS9A 1M2RA 3K54A 1UWJA 3NEWA 5AV1A 3LLTA 3AD5A 3HDNA 3BLQA 2CLQA 4PWNA 1KWPA 2ITQA 2XKDA 4LM5A 5DT0A 4YSMA 5LMAA 1XHAA 1JVPP 4IVDA 3DOGA 3WF8A 3FAAA 4AUAA 3OD6X 4D55A 5ANOA 4I21A 4GFGA 2YM3A 3EQPA 5CVFA 4BTMA 3VS7A 4GCJA 1TQPA 1YWRA 3EN4A 3SOAA 5C9CA 3ZLYA 1AD5A 2GS2A 2J50A 2JAMA 5EDRA 3GP0A 3V3VA 3IKAA 3P9JA 2QC6A 4U42A 5HE2A 3PJCA 4OAVB 2WNTA 4HVIA 4FF8A 3S0OA 1Q8WA 1XH7A 4G2FA 3UIMA 3H4JA 5CALA 5ICPA 5M08A 5ANKA 2E9PA 2GMXA 4KIKB 5AUVA 5AAFA 4ANBA 4B8MA 2V5QA 1H1SA 4I5PA 1PHKA 4IM0A 5FTGA 5E90A 3EZVA 3R1SA 2PVNA 4C61A 4QP7A 4ASDA 2WTJA 3U87A 3KY2A 1OITA 1Z57A 3R9HA 4NFNA 4S33A 2VWIA 3HECA 3HAMA 2QNJA 3TM0A 1R1WA 4DLJA 3PY3A 3F66A 2XH5A 3NZ0A 3QGWA 3W1FA 4E20A 2I0HA 4JAJA 4BHZA 2YM8A 3FMEA 1ZYLA 3Q04A 3VUKA 3TNIA 4IDTA 3KXNA 4D2RA 4DE4A 3MY5A 4L8MA 4PP9A 5CF4A 4O84A 3I81A 3EZRA 2YERA 2GQSA 1H27A 3CC6A 3WARA 4IZ7A 2B53A 4QNYA 3TDWA 1OPKA 2XB7A 3COHA 3DXNA 4FNXA 1XWSA 2C5XA 5LVLA 1T46A 2QODA 3MS9A 3R7VA 1FGKA 2BROA 4U81A 4H05A 3V01A 3O96A 4X2JA 4R77A 1SVEA 5GJDA 2X4ZA 1FPUA 2XM9A 3MVHA 4IB1A 3ORMA 2PU8A 4MVFA 3JYAA 4O91A 3WF7A 4PTEA 2BTSA 2BZHB 3O2MA 4YLKA 3EHAA 3F61A 2C6MA 3F5XA 3GCPA 3VHKA 4L44A 3RJCA 4FKTA 4BCJA 3KMMA 4Y72A 1VYWA 3VVHA 3ZZWA 3I7BA 3KF7A 4C4HA 4O96A 4QD6A 4I0RA 4XV2A 4I24A 3I60A 4YHJA 2XZSA 5HVKA 5CVGA 3TNQB 3QZHA 2B54A 3TL8A 1E1VA 1JSUA 4AF3A 2OH4A 4DH3A 4E5WA 3MGYA 3HV5A 4CFXA 2PHKA 5CU3A 2PK9A 3K5VA 4X3FA 4JS8A 5DT4A 2IN6A 4FKGA 3RP9A 4IWPA 4UXQA 4TTHB 5H2UA 3WILA 2UW9A 2EB2A 5IQAA 2YCFA 2XM8A 4N6ZA 4BCNA 3DKCA 4C3RA 4BIBA 3D4QA 4PV0A 4XG2A 4USFA 1W0XC 3EQHA 3A60A 2GHGA 3NWWA 4EH6A 5DR6A 4DEBA 4EHZA 4ZMEA 2BIKB 2XNGA 2JEDA 4FSNA 3OBJA 3VS5A 1YOJA 4A9TA 4FZDB 5AMNA 5EHOA 3EMGA 5ACKA 4Y8DA 3KC3A 3NUSA 3R7GA 4XRJA 2GSFA 4NW6A 4MTAA 2P33A 5FGKA 2XJ2A 1H07A 3EL7A 1PXOA 3QGYA 4P4CA 4W4VA 4D28A 2QU5A 2ZB1A 4E7WA 3KCFA 2OW3A 5A9UA 3SDJA 3PXQA 3TJCA 4JBQA 3A4OX 4XRLA 5BUIA 3QRTA 1BX6A 5AAGA 1YWNA 2QKWB 5IMXA 4O7LA 3ERKA 5IF1A 1CM8A 4FIHA 4J71A 3B2TA 4JQEA 2SRCA 3D9VA 3AGMA 4DGMA 5IA1A 2YZAA 2VWYA 5EYKA 2ITPA 4ZJJA 4ASXA 1GZ8A 4IQ6A 3NAYA 1UVRA 4RIYA 4U0IA 3O50A 4G5JA 3F3ZA 3FMNA 4Z3VA 3C0GA 4ZJVA 5TOZA 4KBAA 5A4CA 5M44A 4HZRA 2XMYA 4XOYA 5FXSA 4UN0C 3TUBA 3I0QA 4JLCA 3PUPA 3CGOA 1AGWA 4K6ZA 2WTWA 3OHTA 3RAIA 1TQMA 4PDSA 2PUUA 4YTCA 2JDVA 4BBFA 2QOBA 3DFAA 2VO7A 3ZONA 5I3RA 5FM3A 4G9CA 5KX8A 4D2TA 4D2PA 5CZIA 2QKRA 1W84A 3BWJA 3GQIA 4CFUA 3KVXA 3O17A 2CSNA 4AOIA 3DK7A 3GBZA 2QHMA 2VX1A 4NM0A 5L2IA 2YM5A 4NIFB 3FZSA 4QYYA 5M53A 4PNIA 5EDPA 1B38A 3EQCA 3UIUA 3PTGA 3CS9A 2DS1A 3GC9A 4FSRA 4EHEA 5HE0A 4EH5A 4QO9A 3R7OA 1XH5A 4A7CA 5JFSA 3OXTA 1IR3A 3GNIB 5FWKK 4X2KA 4M67A 2VO0A 1WBTA 3EQFA 1MP8A 3P86A 4FNWA 4QMYA 5L2TA 2E9VA 4KIPA 1CKPA 4Y95A 5JGBA 1PY5A 1U54A 2PWLA 5HGIA 3E7OA 5IH6A 4L9IA 1IRKA 1W98A 2UW7A 2Y9QA 3EKNA 3P78A 2HZIA 3C9WA 3QLFA 3R9OA 4LL0A 5FDXA 4DEIA 4IB5A 5HVJA 4RX5A 3ZHPC 4U5JA 3SVVA 5HCZA 4DTKA 4AT4A 4FTRA 3T9IA 3O51A 2PVYA 4UEUA 2PVRA 1GIIA 4JXFA 2QR7A 4FV8A 4O1PA 5F4NA 2J0JA 3VQHA 4BI1A 3S1HA 4JQ7A 4DLIA 3OT3A 3QZFA 3MVJA 2C6LA 3RVGA 3FV8A 1DM2A 2I0VA 1F5QA 5L2WA 5DFPA 5AADA 3V5TA 2UZNA 5DYJA 5JFXA 4DBXA 4X2FA 3DV3A 4V0GB 5DHJA 4BDKA 5KBQA 3NIZA 3G9LX 1YDSE 4RIXA 5CSWA 3WZUA 3HRCA 3DU8A 1U59A 3OTVA 4O38A 3ZUVA 5I5ZA 4C2WA 3ROYA 4NYEA 2OSCA 3KK8A 3L1SA 1T45A 1MRVA 3DKFA 4O2ZA 4F65A 1DAYA 4L52A 3V5JA 4KSPA 1XH4A 1O6KA 5E8WA 3EKKA 3ZC5A 1TVOA 3E92A 2QURA 3E64A 1Y6BA 4KB8A 1FINA 2HENA 2OF4A 3BYOA 1OB3A 3IG7A 4QRCA 4TKSA 4C4IA 3COKA 2R3RA 2W9ZB 3FL4A 4YO6A 1ZOHA 3VW8A 4CT1A 4OLIA 3F88A 5B7VA 3CTHA 4CRSA 3F3TA 4TYJA 1O6YA 2J4ZA 5CLPA 4RVKA 2EUFB 2YJRA 2QOOA 2UUEA 5CTPA 3LFCA 4O7RA 3CPBA 1BL7A 4BDGA 5C8MA 4FVPA 3QKLA 3WOWA 4D2VA 4DINA 4I92A 5HLPA 4RZVA 2G1TA 2H8HA 4O6EA 3GQLA 2BFXA 4BR3A 2FVDA 5TF9A 4FKWA 3PP0A 4I0TA 4LOPA 1BYGA 4YJVA 4EOKA 1LEZA 2IVSA 3CQUA 3N9XA 3RZBA 5EM7A 3Q9XA 3V04A 4E3CA 2IJMA 3ET7A 3ZLSA 3G0EA 2Z7QA 1JKLA 4MF0A 2ZM4A 2XF0A 3FL5A 5CQUA 5E1SA 3AC3A 3ORIA 3W8QA 4J97A 4FSWA 2WD1A 2R3JA 2ERZE 5HOAA 3ZSIA 5C26A 5KCVA 3FLNC 1YOLA 4FGRA 3OBGA 2OICA 3C4WA 2O8YA 3MVLA 3PE1A 4YZ9A 3ZUUA 3GC7A 3U51A 1UA2A 3JXWA 1LUFA 3PSDA 1FOTA 5CT0A 2XIRA 4MQ2A 1GIHA 4NK9A 4ZXTA 3E7VA 2JKKA 2J51A 1KV2A 4NEUA 4BFMA 4O27B 1S9IA 1FVVA 2BRHA 4ONAA 4RJ6A 4YJUA 3DY7A 4ZTSA 4JDKA 3U6JA 1YXUA 4R8QA 3VS0A 3QZIA 5CYIA 5L3AA 4RJ3A 3UJGA 4D4RA 3R1NA 4TXCA 4IANA 4FKIA 5IDPA 2YABA 4IB0A 4GIIA 4MNEB 2XCHA 3I6WA 1PMUA 4PDPA 5KMOA 3QL8A 4U8ZA 5D1JA 2XKCA 4BTJA 5JEBA 4D9TA 1H0VA 3QQGA 4FIIA 1GIJA 2HXLA 3HVCA 5DEWA 3SC1A 3SRVB 5BVWA 3P08A 5DNRA 4OBPA 2VWBA 2YDKA 2W0JA 2ZV8A 3DPKA 2IZUA 4RPVA 5FQDC 4CQEA 2ACXA 2R64A 2X6DA 4DEAA 3RHKA 5DG5A 5LJJA 2R7BA 3AOXA 4PPCA 3VJNA 3UC3A 4E8AA 5AM7A 5AAEA 4BYIA 5E9EA 4CKIA 5GZAA 2WKMA 3SG8A 3E8NA 5BVNA 3ORZA 4H39A 4MBJA 3TZ9A 2F2UA 4MH7A 3TUDA 2ITWA 4QPSA 3BHVA 4R3CA 2VTQA 2PE0A 4Q9SA 3LM5A 2BRBA 3VC4A 2HW6A 4BB4A 5K0KA 4C02A 5IH4A 2P2IA 3OY1A 1JKSA 4ERKA 2WQOA 1RDQE 3KXGA 4S31A 2E9OA 3FSKA 5AM6A 4RJ8A 4O22A 2NO3A 2E9NA 2OLCA 5ETFA 2BIYA 5CEPA 2ZDTA 3MTLA 3OWPA 3TNPC 2X7GA 3QHWA 4FTJA 4USEA 2GFCA 4FTNA 2AC3A 4FTIA 2XJ1A 3OEFX 4A9RA 4U7ZA 4O7WA 5KNJA 4O0SA 5C4KA 4K9YA 3UNJA 2CCIA 3VBYA 3ZRMA 3HRBA 4ZLZA 5A4EA 3RWPA 3PRIA 3BX5A 3LQ3A 3ATSA 3RAHA 2W9FB 2UZDA 4ANNA 2J9MA 2W4OA 3LCKA 3RK9A 2WTCA 2IVVA 3FXWA 4CLJA 5BMSA 2OFVA 5M57A 4NCTA 4DG0E 4I6FA 1OGUA 4O0TA 3HA8A 3UG1A 3UO4A 1MRUA 3NIEA 3LAUA 3V8TA 3PG1A 2PVHA 3H0YA 4IXPA 4MEDA 4MAOA 1E9HA 2A4LA 4UMQA 3C5IA 3VN9A 4O83A 4S32A 3U4WA 3DJ6A 3ZSGA 2Q83A 1LR4A 1XBAA 2PVFA 5G1XA 4BCPA 2V7OA 5FM2A 2W17A 1UNLA 5HX6A 4FEQA 2VRXA 4ACCA 3ZXZA 1OBDA 3LXNA 4PMMA 1H1PA 2R3HA 1O6LA 1OL2A 3DNDA 3FQSA 5DT3A 2C6KA 3EH9A 3A8XA 3QX2A 3R00A 3TI1A 3BLRA 2XK9A 3QX4A 2UZEA 3V8WA 2KULA 5EW8A 5EG3A 4XYFA 3PZEA 4MXCA 4BI2A 2C6OA 2PYWA 3FUPA 4N6YA 3I4BA 2G15A 3OWJA 3W2PA 3OUKA 3OXIA 2ZM1A 3DB6A 3AMAA 3GOPA 4FEWA 1LEWA 2VNWA 4FIEA 5DN3A 3QLGA 5B2KA 5LCKA 3TEIA 3R8PA 2NP8A 2IG7A 3T3UA 2ITTA 5E8YA 2OGVA 5EKOA 1W7HA 3MYGA 3LQ5A 3R8LA 2WMSA 3DJ7A 3VW6A 4ZY4A 4K1BA 2W1CA 3BZ3A 5M4IA 1A06A 5K3YA 4LUDA 5FUTA 4IAFA 4R1YA 4W8EA 4O21A 1Q5KA 3MIYA 4Y83A 1PMEA 3VQUA 2QO9A 2XK8A 4FR4A 5JSMA 1NT2A 2QLUA 3W2OA 4AQCA 5J87A 2GTNA 3KU2A 4XMOA 5E92A 2VTMA 3PPJA 4NH1A 4RIWA 5EI8A 2BILB 4F9AA 5EI6A 4IAKA 3OW4A 4DAWA 2C3LA 4QP4A 5T68A 4RJ7A 1WBPA 4XP2A 5HLNA 3QUDA 3QTSA 3GCQA 4BGHA 5D11A 3Q9WA 4J8NA 4DG2E 2DQ7X 2J2IB 3HKOA 2XJ0A 1GAGA 4TWOA 5FD2A 2CLXA 2HXQA 2OFUA 4ENYA 2OH0E 5CF8A 5AV3A 1M14A 4HGEA 3DB8A 5AR5A 4WIHA 2W5HA 1ZY5A 4XOZA 4TWPA 4D9UA 1ZOEA 2YAKA 3UMXA 4CYIA 2UZBA 3F7ZA 4FK3A 5C4LA 3PVUA 4IVCA 4B8LA 4CZYB 4DBNA 5JQ8A 1OKVA 1URWA 2JBPA 4RVLA 2XNMA 5BVKA 3TZ8A 4XEYA 5DI1A 1DI8A 3LFEA 4I93A 2W7XA 4FVRA 2PZIA 1OL5A 1ZWSA 4HZSA 5DLSA 3OEZA 4BYJA 2R3LA 1CKIA 5CNNA 4RMZA 4DEGA 2XEYA 4UZDA 4AE6A 2GDOA 5DR9A 4CV8A 4G6LA 1BMKA 2ITZA 4ITHA 3V5LA 1U46A 3M1SA 3TV4A 2F7ZE 4FV0A 4RIXB 2FYSA 4WSYA 2IZTA 4FL2A 5CXHA 3BYMA 4ASZA 1ZXEA 3LM0A 4M0ZA 5CU2A 1RJBA 1J7UA 4FV1A 3EFWA 4FSQA 4X6RA 2WEIA 3FMHA 3N4UA 4BI0A 4R7IA 5ANGA 2FGIA 2OBJA 4AT3A 3R8ZA 4NL0A 4GUBA 1JPAA 5FG8A 3UYTA 2UW4A 5CSHA 3NX8A 3FY2A 3HZTA 3AT4A 4XBUA 2FSOX 2W05A 4X0MA 2UVXA 4L46A 4Y5HA 2WMWA 5JRQA 3OMVA 4XUFA 1YOMA 3PA3A 4V05A 4YJSA 2XP2A 5DOSA 3UNZA 3UZPA 3W16A 4U45A 4HPUE 5AV4A 2PULA 3NW6A 1JQHA 2VTTA 2B1PA 4M12A 4EWHA 3F69A 4FT7A 3BYVA 4PUZA 3FZRA 4JAIA 1SVGA 2C0TA 3TN8A 5F9EA 4ZOGA 3A99A 3R2YA 3G9NA 4FTOA 2XKEA 1LPUA 3F3WA 4AGUA 3RHXA 3TKIA 2JFMA 4GH2A 5AA9A 3ZDUA 3BRBA 3POZA 4AGCA 3ZBFA 3GFEA 3NPCA 4FG9A 3QQHA 3F2NA 3GXLA 4HYUA 3S95A 4ALWA 4O82A 4IIRA 3VRZA 2P2HA 5B0XA 3UIBA 5JKGA 1ND4A 3HDMA 4QMUA 3MH1A 4M69B 2BRNA 3RTPA 3VWAA 2UVYA 4IM3A 4KAOA 3EL8A 3HV3A 3P0MA 4K33A 2W99B 4RQKA 1FVRA 4I20A 4L6QA 3PWDA 4QP3A 4RQVA 4FG8A 2VNYA 2XNOA 4WA9A 5DPVA 5AP7A 4BZDA 4F7SA 5KMIA 4O7VA 3OZ6A 3FZTA 4ARKA 3F3UA 4OTDA 4O7YA 2CGWA 2EU9A 5EYDA 3BV3A 3QQLA 4D4SA 3UZTA 4X3JA 3DFCB 4W9XA 1NVQA 1A9UA 3A61A 2ESMA 2C3JA 2X81A 2YIYA 4LFIA 5KHWA 2C30A 3C51A 5ANJA 3PXZA 3U4UA 4X2NA 1PXIA 3FI2A 3BLHA 5I3OA 4ALVA 3LW0A 3PA4A 2V7AA 5HU9A 3FZOA 3GU5A 4YZMA 3QWKA 2WHBA 3WE4A 2JIUA 4AWIA 4BKZA 2BZIB 5FP5A 3UBDA 4FA2A 1RQQA 2C68A 4EH7A 3FYJX 3FHIA 4C37A 3NRMA 5LVPA 5EQYA 3T8OA 4D2WA 4IADA 3UPZA 2BKKA 3Q5IA 5M06A 4ZY6A 4BDEA 1PXPA 1NY3A 2HZNA 5DRDA 3FQEA 4C38A 1J3HA 3TNHA 4ACMA 4R7HA 4E1ZA 4B7TA 3LCTA 4F1TA 1P5EA 4FTKA 3OC1A 3AT3A 3GI3A 3KXHA 4GMYA 4TWCA 2EVAA 4YJNA 1IG1A 2PZRA 5D9HA 4YMJA 3ZMMA 4I3ZA 5HBHA 3DQXA 3VUIA 4UY9A 3AC8A 4C4FA 4LYNA 3KF4A 3R8VA 4ZZOA 4K2RA 3NUYA 4MHAA 5LMBA 5BYZA 3N4VA 4FKJA 1OIQA 4RA5A 3FLWA 5KE0A 3EIDA 2VV9A 3ODYX 4H3QA 4JR7A 4B0GA 1PYEA 1R78A 4JBOA 1L8TA 4B4LA 5IQCA 2J0IA 4GT3A 4TPTA 3MWUA 4O7SA 3Q4TA 2XUUA 5GINE 3OCBA 3ZRLA 1WBSA 4M14A 3UO6A 1XH6A 4F1OA 4IZYA 2ZV2A 1FMOE 5M4CA 2X1NA 4FKRA 3G51A 3KQ7A 3QA8A 4IVBA 5HI2A 3V51A 3PG3A 3PVBA 4OW8A 3AMBA 1OPLA 2J5EA 3CD8A 3H9RA 5J7BA 5CEOA 3U55A 2QOLA 3BHHA 3ULZA 4EOQA 2PTKA 3COIA 5HTCA 5IDNA 2CKQA 3AMYA 4L01A 4HYHA 2ETMA 4L53A 5EHLA 5AX9A 1YXXA 2OJGA 2QO2A 2Y8OA 4MK0A 5HORA 2WAJA 1ZOGA 3T9TA 4HVDA 4AW2A 2I0YA 2XNPA 5ANDA 3BU6A 5CSPA 3FKLA 2VWXA 4EONA 5IZFA 2Q0BA 4PTCA 4D1SA 3DAKA 3R28A 1G8AA 2HYYA 4HCTA 4YU2A 3QQJA 4H36A 1JSTA 4NTTA 3FC1X 4ACDA 3IQ7A 3OY3A 4RX9A 3UOHA 1CMKE 4E5AX 5EKNA 4YSJA 3WIGA 4DH1A 3ENHA 4DEHA 3FKNA 5A14A 2RF9A 2YA9A 5L6WL 3BYSA 5KZIA 1JBPE 3QCQA 3I7CA 2W4JA 1UKHA 2WGJA 5FLFA 4EK8A 2PZ5A 1B6CB 3MTFA 5CAUA 3Q60A 1H01A 2IW6A 3TCPA 3H9FA 1HCKA 4I1ZA 5IEYA 4FEXA 4FV5A 2IO6A 1P4FA 1XKKA 4YLLA 4EQUA 2R3FA 2VWVA 3GVUA 3AC2A 3L9PA 3KMUA 2Y4IB 1YKRA 1EH4A 4QTCA 4WOVA 2GPHA 3CKXA 3RZFA 4F7JA 3BE2A 1WFCA 4QMTA 1XH9A 3CKWA 4YZDA 3VHEA 3ORNA 5M51A 2B0QA 4XS2A 1RW8A 2HELA 2W5BA 3QCXA 4RFZA 4JRNA 5A54A 1KOAA 4PDOA 4FKUA 3EYGA 2BHEA 5CF6A 1CSNA 1Y91A 3F2AA 2HWOA 4YC3A 1IA8A 4YZCA 4KWPA 3FPQA 4MD8E 5FXRA 3H30A 2CGUA 3OWKA 4I4FA 3LFDA 3CPCA 4MXAA 3NVMB 1H24A 4CLIA 1WZYA 4A4XA 4LMUA 1Y8GA 3FWQA 3P79A 5CT7A 4F9CA 3UZRA 4S30A 4BDJA 2ITXA 1URCA 1SZMA 3C4CA 5DVRA 3W2CA 2OZAB 4F64A 4BWKA 3CD3A 3VF9A 5KUPA 3QC9A 4M66A 4BTKA 4ZAUA 2PMNX 1YI6A 1KE8A 1UU3A 4FE2A 3SOCA 2GNFA 1FGIA 5I9UA 4PDYA 4IAZA 3MY0A 2WO6A 3PVWA 3NNUA 4M84A 4LGHA 3BU3A 2E9UA 4J98A 4O2PA 3ZZEA 4DGOA 4X3FC 3SGCA 1QPEA 3DZQA 2F4JA 1Y8YA 4PMTA 2IW8A 4RX8A 4BTFA 4CT2A 1QCFA 5HD7A 4PF4A 4FI1A 4AG8A 4ZP5A 3ZO2A 4GU6A 4OUCA 4EK5A 3LLAA 1WVXA 1OBGA 2YJSA 4GKIA 1OECA 3VUHA 4P5ZA 2WTDA 1PXJA 1Q99A 2A19B 3JS2A 5L4QA 4AFJA 3Q2JA 1JNKA 4KA3A 2H96A 3LHJA 5T6KA 3NCZA 2GQRA 3EJ1A 4FMQA 4IFCA 2YHVA 4U97A 1ZYCA 4Y73A 3D7TA 3ORPA 4YZNA 3WIKA 3ZOSA 4AACA 4G1WA 2PUNA 1Q24A 4J1RA 3JR1A 3E87A 2QONA 2AC5A 3IS5A 3HLLA 5CEMA 4NTSA 4IE9A 1J91A 2PL0A 2UV2A 4H3BA 4M97A 3W2QA 4BZOA 4Z7HA 1GJOA 4CVAA 1JSVA 2XEZA 4FK6A 3ORTA 2B55A 2BHHA 4OT5A 5BMMA 4CTCA 4EBWA 5HKMA 5ITAA 5M56A 4MXYA 1O9UA 3EQBA 5LMKC 2JIIA 4F6WA 3Q2MA 3SXSA 5DMZA 2WELA 4Z7GA 4WNOA 2WMBA 2EXEA 4EOLA 5CEKA 1U4DA 2C6EA 3ID6C 2BZJA 4MQ1A 3WZJA 5G6VA 4MXZA 4FSUA 4DG3E 2XIZA 4IH8A 4JBPA 3BWFA 4FZ7A 1OIYA 4RC4A 3ZRKA 5KMNA 4G17A 4R3PA 3TT0A 4L45A 4A4OA 3FMJA 1ZMUA 4DFZE 3SXRA 2CMWA 3OG7A 4R6VA 4AS0A 5IA2A 2B7AA 2BAKA 2RL5A 4KRCA 3O0GA 1K9AA 3PIZA 4DH5A 4EC9A 4EK3A 4YO4A 2VTLA 4XLVA 4C4GA 5BVFA 4AW1A 4CYJA 3QQUA 3B8RA 5AR3A 4C35A 3G15A 1OIUA 5IUHA 3IK3A 2BUJA 4OTPA 4RA4A 3SHEA 4QMNA 3NSZA 4WBBB 4G6OA 4R7BA 4QOXA 4L7FA 5JFWA 4CSVA 5CEIA 1IAHA 2OKRA 3G2FA 5EOBA 3TUCA 5KO1A 4X6QC 3S00A 3ORXA 4ZEGA 3P23A 2WXVA 3LJ0A 3NGAA 4IAYA 1G5SA 2R3PA 4BCFA 5CX9A 5H8EA 3GGFA 2B9HA 1MUOA 4L42A 3BE9A 2IW9A 4LQMA 3II5A 4N0SA 1UV5A 5HQ0A 3WZEA 5GJGA 4EOJA 2OF2A 5IUIA 4IZAA 1S9JA 3EOCA 3KVWA 5BX0A 4XP0A 4I41A 2ONLA 2ITOA 2WTIA 2G2HA 4FEVA 4KINA 2HZ4A 2GQGA 2W96B 4ZSEA 4QYGA 5J9YA 3BYUA 5A4QA 4JNWA 2CKEA 3KCKA 4YR8A 3E3BX 1ZLTA 4QMPA 2EXMA 2HIWA 4X21A 3F5PA 3R1YA 2YLEA 3N4TA 5KKRC 5JZNA 4FTAA 4XV9A 3D5UA 4GEOA 3UG2A 1SNUA 3R04A 2RGPA 2I40A 2GNLA 1Z5MA 3BBWA 2Y6OA 2EB3A 3LJ2A 2CJMA 4OTHA 4YJQA 5A4LA 4LGDA 5LWNA 3LJ1A 3BQRA 4X2GA 2VO6A 4C0TA 3ZM9A 2XNNA 2R3NA 4AZSA 4DFXE 1TKIA 2X9FA 2XVDA 5BYYA 3A7JA 3DA6A 4YPDA 4RWLA 2BDFA 2QO7A 4EHGA 3VUMA 3LQ8A 3EQRA 2GNHA 4Q5HA 3FC2A 2W1ZA 4NU1A 2Z60A 3QRUA 4G3FA 3WZDA 1NXKA 2WIPA 3O7LD 5HVYA 3IGGA 5KBRA 4MWIA 3C1XA 5CSVA 3PJ1A 4NM3A 3LFQA 4FKSA 3V6RA 2JITA 3H9OA 3QUEA 3UVRA 3ROCA 2PMOX 3V6SA 3A7HA 2CKOA 5F95A 4M13A 5CU4A 4EUTA 4BICA 4A9SA 3H10A 3QA0A 4JJRA 4IACA 5AIKA 4TYEA 1W8CA 2UZLA 4ZJIA 3U6HA 2LGCA 3L9MA 3RM7A 4IWOA 5IQFA 3ZCLA 4BRXA 3Q52A 3KULA 3W55A 4ZMFA 1YXVA 3KXMA 2A1AB 2BFYA 4LGGA 2EXCX 3Q4UA 4E26A 3E3PA 3EB0A 4M68A 1UNGA 2J7TA 3MPMA 4NW5A 1KE6A 4GSBA 4C57A 4DEDA 3ORLA 2JFLA 3CGFA 4GJ3A 4LV8A 4CRLA 3OT8A 2CNVA 3VS2A 2B9IA 2PE1A 4ERWA 2WMVA 4TNDA 4FZ6A 4TYHA 2QOHA 4MNFA 3L8XA 3OOGA 3EWHA 4ANOA 3OXZA 4E5BA 2HY0A 3ALNA 2XK4A 4BCIA 2ZVAA 3ELJA 4XX9A 2HAKA 2REIA 3LXKA 2QHNA 5AP0A 3R63A 4CMUA 2YM6A 3HMIA 1H25A 3PSBA 3QXPA 3JY0A 4FNZA 3F6XA 2ZM3A 3CY3A 4BDHA 5AA8A 3DBQA 3VRYA 3O8PA 2YLFA 5J1VA 4A9UA 4U41A 2C6IA 1UWHA 1OPJA 4CGAA 4FG7A 3HL7A 4FZFB 5CS6A 1ATPE 4XG3A 4CFVA 2WTKB 3R9RA 3LOKA 5F94A 4KABA 4UWBA 3RK5A 2J5FA 4YC8A 4B99A 2VTJA 5CAVA 3W10A 5HU3A 5JZJA 1KUTA 1WBOA 3CSVA 4YUQA 4HPTE 4XNEA 4GU9A 3IECA 4RLLA 3R9DA 4EQCA 3WF6A 3RBWA 2R3MA 4G6NA 3VNTA 3ZFMA 2OWBA 4YC6A 4GIHA 4ANQA 3A7FA 2W5AA 3D7ZA 3C0IA 3PPKA 3QQFA 4AX8A 5KHXA 5J5TA 4F0GA 1YXSA 3HA6A 3OP5A 2W06A 2XK3A 4GW8A 3BELA 4KSQA 3GFWA 4FKQA 4RC2A 2V0DA 2C6TA 4EWQA 2BPMA 4HVSA 4UYNA 3HP2A 4Q5EA 2XKFA 4GK3A 4KUJA 3PY0A 3RPOA 3TKHA 2R5TA 3C0HA 1Q61A 3QTIA 4IFGA 5J8IA 4EYJA 5LOHA 5AIRA 5IMEA 3RPSA 2QLQA 1WVYA 4P5QA 4W4WA 1PW2A 4G5PA 4GG5A 4FEUA 5FTQA 2WMUA 3KMWA 1QMZA 1K3AA 3QAME 3QC4A 2WPAA 5EK7A 3W2SA 3W8LA 5H3QA 3DDPA 3RGFA 2JLDA 3LVPA 4Q9ZA 4U43A 5HX8A 3CE3A 3UQGA 2WU7A 2ZMCA 3E88A 4B9DA 4TL0A 4UX9A 4RT7A 1M52A 2J0LA 2X39A 2VWUA 3DTWA 4USDA 1YQJA 2I0EA 3DKOA 1FBNA 2VN9A 2Z7SA 2WIHA 3IW8A 4FNYA 4G16A 4XV1A 3TWJA 4X3FB 4C3FA 4L68A 2R7IA 5EQEA 3B8QA 3GB2A 5DA3A 4TW9A 2C1AA 3MV5A 3R7UA 5K5XA 1NW1A 1YVJA 2UW0A 5GJFA 4FVQA 3GU4A 2YM7A 4B6LA 4FIJA 5K0XA 1PXLA 2V55A 4WNMA 4JX3A 1KV1A 4Z9LA 5HG9A 4CG8A 4CEGA 2QG7A 2YEXA 3QTRA 3OS3A 5CI6A 3LXPA 4L43A 3V5PA 3ZM4A 4NCTC 5IUGA 3RNIA 3AD4A 4ZTLA 4BBMA 3D15A 2BDJA 4P2KA 4JDJA 5GZ8A 5IISA 2XIYA 4I5MA 4RFYA 3PYYA 4IEBA 4JDIA 4IB3A 4V04A 5IU2A 4GT5A 4CCUA 3CLYA 1KE5A 4NKAA 1SVHA 2AUHA 3MH0A 3LIJA 5AP5A 4KIKA 2XIXA 3DS6A 3L9NA 2J0KA 3QCSA 4NFMA 4AGWA 1U5RA 4GG7A 3GCSA 4LMNA 3D5VA 5EDQA 3I1AA 3NYOA 5TKDA 3TIZA 2XCKA 5IEVA 4W9WA 5HO8A 2F7XE 4FTTA 3GC8A 4F99A 3BEGA 2JDSA 3AT2A 3RAKA 2QOQA 2Y4IC 3Q6WA 4I23A 3DGKA 3R7YA 4K8AA 3DBCA 3REPA 4ZTNA 4V01A 2C47A 5IA0A 2RFDA 4RIYB 2G01A 4H3PA 1RE8A 4XG8A 5IQIA 4FTLA 4Y46A 1MQBA 4RX7A 5CXZA 3MI9A 3QD2B 5DBXA 4HYSA 4GYGA 1W82A 4WUNA 4WRSA 3KREA 1OM1A 5IKWA 2ITNA 4L3PA 5M4FA 3FI4A 3D83A 3LFNA 4BCHA 3O8UA 2UW6A 2UZVA 3DK3A 4DT9A 5IQEA 5JFVA 3Q96A 1OZ1A 4QMOA 1OKZA 1M7QA 4MYGA 1BKXA 1WCCA 2PSQA 4H1JA 2CGVA 4BIDA 4UB7A 4ZZMA 4AAAA 2QR8A 4D4VA 3SX9A 2VZ6A 3F5GA 3JPVA 4FKPA 4KKHA 3F3VA 4BCKA 4WHZA 3RM6A 3V8SA 3A7GA 3VIDA 3BBTB 4OTGA 4PPAA 2R0IA 4UV0A 3QF9A 3Q4CA 4G34A 4NWMA 5HIEA 4E4LA 2R2PA 2QOFA 5HLWA 4LRJA 2UZTA 3OW3A 3MW1A 5TO8A 1F3MC 2X7OA 4AW5A 1ZYSA 2GTMA 1V0PA 1I44A 3IONA 3CY2A 3R6XA 4XG6A 2RIOA 4EHVA 3DDQA 2OG8A 2VTSA 4FX3A 4CFNA 2OJIA 5HG7A 3G90X 2H9VA 1U54B 3QTQA 1CDKA 3TNWA 2JGZA 2XNBA 4O0WA 3EQDA 2PVKA 3R30A 4ITJA 2C4GA 4GK2A 2QVSE 4AU8A 4U40A 3RNYA 5KKRB 1P14A 3BHTA 3E8EA 5E7RA 3VULA 2OIBA 1YDRE 2WU6A 4PL4A 2WZJA 1GZOA 2H6DA 5GHVA 1IASA 4EH3A 5I0BA 5J95A 2QU6A 5B2LA 4QP8A 3QZGA 2FH9A 5EI2A 4RBLA 3IDPA 4ZTQA 5AV0A 5E1EA 1JAMA 4ZLOA 3HV4A 2FA2A 4BGGA 4F6SA 2A27A 1XBCA 2OIDA 3OCSA 3QRIA 5BVDA 4XG9A 2I6LA 2X4FA 4KRDA 1PRYA 4GJ2A 4BCOA 4UMPA 1UU7A 3BGQA 5FXQA 4E6DA 4L3JA 4FOBA 4XLIA 3QTUA 5EYMA 2YWVA 4ITIA 3LMHA 3MESA 1GNGA 3JVRA 3AGLA 4QMSA 1Y57A 4FC0A 4U9AA 4YPSA 5H8BA 4YNOA 4ZS4A 2C3KA 2FSMX 2XIKA 5EM8A 5BYLA 3HV7A 1QL6A 1Y6AA 2Z02A 4HCVA 4I94A 2YISA 5KMLA 5FDPA 3HMMA 4UYAA 4XH6A 4EKLA 2WB8A 3CJFA 5LCJA 3I79A 3R83A 4MXXA 4MBLA 5HG5A 5C8KA 4JIAA 4S34A 4C33A 2C1BA 2GHLA 3SLSA 3KN6A 3SXFA 3LFBA 3E5AA 3NVKI 3QCYA 3GOKA 1JLUE 2X2LA 4CD0A 4ZIMA 5AJQA 3NYVA 5IQDA 2DUVA 5CF5A 3K2LA 4ACGA 3VBWA 1PMVA 5AFVA 3LCOA 2HY81 5ETCA 2PPQA 4BCGA 4F09A 4O86A 4TYHB 4DFLA 3BHUA 5A46A 5AR2A 1DS5A 5KMMA 3UQFA 4Z55A 3R7IA 3QRJA 4C62A 4MKCA 4ZK5A 5AUTA 3DBDA 3PIYA 4JL9A 5K5NA 1M17A 1I09A 2RG5A 3CP9A 5D10A 4AOJA 3B2WA 3DXPA 4ALUA 1J7LA 4ZLYA 5AV2A 4G3DA
chains in the Genus database with same CATH superfamily
3BI6A 2PZYA 3NW5A 4JI9A 4NIFA 5ACBC 3RK7A 4BDAA 2A2AA 2YDJA 3R8MA 5ETIA 3OOMA 4F70A 3MPTA 2XBAA 5I9YA 5E8UA 3KXXA 5J5SA 1ZMWA 2JC6A 5DRBA 2BMCA 3KRRA 3PJ2A 4WUAA 5EM6A 3ZFYA 4C2VA 3ZH8A 4DTBA 2X8DA 4H58A 5IQHA 3UPXA 3UC4A 4WSQA 3AXWA 4FYNA 1REJA 3TYKA 3TZMA 3NNXA 2X8EA 3RWQA 4N70A 1ZY4A 2F7EE 4DN5A 5J9LA 3F9NA 3R21A 4YURA 4FBXA 3ZSHA 2ETRA 3GU8A 4E6AA 1DI9A 2PVMA 4LOQA 4QQJA 1GOLA 4FT3A 3ZDIA 1K2PA 2Y0AA 4MXOA 4PP7A 1R0PA 5BPYA 2ZOQA 2CN8A 5EH0A 3CQEA 4C36A 3V5QA 4F08A 4IAAA 2HW7A 3PP1A 4IAIA 4RVMA 4ENXA 2R3QA 5DIAA 3HMOA 4IMYA 2CDZA 4CQGA 2W1FA 5ETAA 4FSZA 3VONA 5C27A 3TZ7A 4FIGA 2XYNA 2OO8X 3H3CA 3W32A 3DNEA 2VUWA 5LXMA 3QYWA 3I6UA 4V0GA 3FLSA 4NJ3A 2YM4A 4AA5A 4CMOA 2VGPA 4ID7A 5HE3A 1E1XA 2FUMA 3WYYA 2UZOA 4YZBA 5HCXA 3IPHA 3ODZX 2GS6A 2J90A 1SM2A 4U79A 5IA5A 1G3NA 5HO6A 4RRVA 5HZNA 2WMTA 5GZ9A 3VS3A 4EZ7A 2P4IA 3ZU7A 5DWRA 3ZBXA 4JG6A 3VS4A 3PFQA 4KBKA 1B39A 3S2PA 4JR3A 5E91A 4O81A 2YCRA 3RCDA 4EH9A 1KE9A 3GENA 4X7QA 3EFLA 2XRWA 3RPYA 3NUXA 3PDTA 2VX0A 4J8MA 3U9NA 2NRYA 3CJGA 3NCGA 3G0FA 1VZOA 3QXOA 3MFUA 4FICA 2XYUA 1ZYJA 4MX9A 5L8JA 4R1VA 1XBBA 2F49A 4HGLA 2BRMA 5IQGA 4DEEA 4PMPA 1OL1A 4JVGA 3CCNA 3R22A 4FT0A 4PTGA 5EHYA 4EOIA 2OI4X 3OFMA 4DGGA 3TTIA 3ZO1A 1W83A 5HNIX 3SW7A 2ERKA 3E93A 3PXKA 4QMWA 4CV9A 3UNKA 1KOBA 3GCVA 1Q41A 5DE2A 1H8FA 1YDTE 2F9GA 3R0TA 4W4YA 4F0IA 5C1QB 2CNUA 4EJ7A 4D1XA 5HBEA 3CQWA 4E6QA 2BZKB 4RG0A 3UOJA 3WF5A 3AG9A 5F1ZA 3VBQA 4DGNA 5C03A 3OUNB 2WTKC 5A6OA 3HUBA 3DQWA 4GT4A 2YCQA 4QYHA 4YP8A 4O0XA 4GRBA 4QPMA 5BUEA 4IDVA 2BR1A 2YFXA 2OJFE 4LV5A 5A3XA 4XHKB 5HE1A 2BKZA 2ETKA 4EKKA 3QHRA 4WG3A 2GU8A 1OUYA 3NW7A 4HYIA 4YNEA 2X9EA 5M09A 2OK1A 4D1ZA 4AOTA 2X2KA 1MRYA 4RJ5A 3P5JC 2QQ7A 4Y85A 5AP2A 4FSYA 4Q2AA 3IDCA 4JBVA 3UYSA 1JKKA 4BKYA 3IW4A 2PMLX 3C5UA 2Q0NA 4L67A 5HESA 2CPKE 2O65A 4NSTA 2YITA 4ZZNA 3KRXA 2IWIA 4EOOA 2B52A 4I4EA 3PE2A 5L2SA 4UWCA 3KL8A 5AUZA 4BDBA 4CKJA 2VTPA 3VUGA 5BUJA 3PLSA 3NYXA 3PIXA 4FV6A 4MNEA 5AX3A 3UMWA 5LVMA 4IC8A 3PLAE 4YJTA 3UOKA 2WQEA 2QOKA 2ZV9A 4UWYA 1Q8ZA 2PUIA 3R71A 3KEXA 4BCQA 4F9BA 4FKVA 1G8SA 3EQIA 3E8DA 1Q3DA 5KMJA 4AQKA 3NDMA 3SRVA 3OF0A 5CEQA 4AZTA 2BAQA 2O64A 2IPXA 2YIQA 3DZOA 1QPCA 4KKGA 1M2PA 2YDIA 4QP1A 4EEVA 2NPQA 5I9WA 4LG4A 3WE8A 2XK7A 3POOA 2C5NA 4QT1A 1ERKA 5BQ0A 5DEYA 4YJOA 5JRSA 2AYPA 4RIWB 4NKSA 3TG1A 5FBNC 1JKTA 2IVUA 4EBVA 2C69A 3PSCA 3F2RA 3C7QA 1CTPE 4RLKA 2YZLA 4FL3A 3WZKA 1PXNA 1Q8TA 2ZB0A 3BLAA 4IJPA 4I6HA 2C5VA 2Y7JA 3FMDA 5CU6A 4BCMA 3MDYA 3IDBA 1LP4A 4LOOA 1ZMVA 3DAJA 3ZS5A 5L2QA 2B9FA 4QP6A 4KIQA 5FRIA 2VAGA 3QD4A 4A4LA 3ETAA 3P7BA 4KS8A 2JD5A 3A2CA 3ZEWA 2X7FA 4QMVA 1YHSA 4WKQA 2RFSA 4JOAA 3OROA 4EK4A 5TT7A 4MD9E 4OR5A 3ORKA 4AN2A 5LWMA 4S2ZA 4OBOA 4WD5A 4NUSA 4DFBA 2RSVA 3QTWA 5HO7A 1SMHA 3AC1A 3HMPA 2VTRA 4I5HA 5JH6A 3HAVA 2F57A 4ACHA 4QQTA 2PE2A 4APCA 3BV2A 2CHLA 2GFSA 1HOWA 3MFTA 4GK4A 2BRGA 2DYLA 4J96A 5AUXA 3W0SA 4HW7A 3AC5A 4FODA 3MH2A 4FUYA 3MSSA 4JG7A 2YCSA 2BTRA 3CR0A 3MY1A 3G6GA 4TT7A 3TXOA 4W8DA 3EFKA 4HCUA 3C4XA 2VX3A 2W1EA 3D2KA 1OVEA 4AXAA 4EH8A 3P7CA 2WTVA 4L7SA 3QUPA 5K4JA 2R3OA 4BHNA 4WG5A 3O7LB 4FKLA 5LMKA 4BJJA 1H08A 3QWJA 2O3PA 3CEKA 4PY1A 2LAVA 4BF2A 2VTHA 5FTOA 3OTUA 2Y4PA 3MA6A 3UVPA 2BDWA 3W2RA 1UU8A 3DT1A 4U6RA 4K18A 4O0VA 3MN3A 4G3EA 4D0WA 5K9IA 4UALA 4AW0A 3VF8A 2QG5A 1CKJA 5M4UA 3R9NA 3EYHA 2C5OA 4JRVA 5ANIA 3P4KA 3I0OA 3CIKA 5I4NA 2Y6MA 3SAYA 3LXLA 4KKEA 4XP3A 2GNGA 4FTCA 3BIZA 4R5YA 2VU3A 3QYZA 1W2DA 4WT6A 4EQMA 3WBLA 4DCAA 5GIPE 3AQVA 4RSSA 3CTQA 1REKA 1F0QA 4IZ5A 4ZTRA 4YLJA 3WI6A 4DH7A 3HMNA 3ZYAA 3ZO3A 4BDCA 5C8NA 1NVRA 2HK5A 4TYIA 4AZVA 4KIOA 3QKMA 3LCSA 1JOWB 5EW3A 4HNFA 2OU7A 4II5A 2ONLC 2QI8A 1Q4LA 3FLYA 5AR8A 3OCTA 5KZ0A 2Z2WA 3IOPA 4EOPA 1J1CA 3ACJA 4OTWA 4PL3A 5IG1A 2CKPA 2I7QA 2RKUA 4G9RA 3UVQA 4XV3A 4U3YA 5CNOA 4F63A 3Q4ZA 3LFAA 2EWAA 1YW2A 1A48A 3NYNA 2NRUA 4NT4A 3BL9A 4ORKA 3U54A 3VAPA 4FUXA 5D41A 2XRUA 4QP9A 1PYXA 1XQZA 1YHVA 1P4OA 4PX6A 5LARA 2V22A 5E8ZA 1PKGA 2WOTA 4QPAA 3P7AA 3K3JA 3KRWA 4FIFA 3BKBA 5CZHA 3RCJA 2QOIA 4BDFA 2PUPA 4E6CA 4IX4A 3EN5A 4K11A 2JKQA 3LFFA 4ANSA 5IA4A 5JT2A 4D4YA 4J99A 2XK6A 4BKJA 2OXYA 5I9VA 2OJ9A 5DR2A 2OXDA 4PMSA 5J9ZA 5LQFA 1PXMA 1H28A 5AP1A 2Z8CA 3L9LA 4I5CA 2BAJA 4FL1A 1H26A 1IAJA 3PJ3A 2HWPA 2OXXA 4AXCA 5ANEA 3DTCA 4JQ8A 3W0PA 3E63A 4CZUA 4M0YA 3FJQE 3E8CA 4BGQA 3DCVA 4O7NA 1X8BA 3MB7A 4QMZA 4OTFA 1H4LA 4EOSA 2E2BA 3Q6UA 1V0BA 3MBLA 2YIWA 3MJ1A 3ZXTA 4AA4A 1GZKA 4C7TA 3ULIA 3PXRA 3OCGA 3M42A 2HCKA 4FJVA 4ZSJA 2B9JA 4JX7A 4BDDA 2FO0A 3CXWA 1UU9A 3N51A 1OUKA 4F4PA 3LFSA 2GS7A 5GNKA 3KN5A 3NUAA 1TQIA 2W4KA 1WAKA 3FY0A 4RC3A 2JDTA 3Q9ZA 4UBAA 2VD5A 3PY1A 5D7AA 1ZZLA 4XG4A 5BVEA 3RMFA 4GS6A 5HIDA 3EFJA 2HZ0A 4NM7A 3ZLWA 4IM2A 4RWKA 3VS1A 5HTIA 3FMLA 4IBMA 1FMKA 4IVAA 5IH5A 5L6OA 2G2FA 4TYGA 4AE9A 5B2MA 3H0ZA 1YI4A 4J7BA 5HICA 4DF3A 3QD3A 4DDGA 1KSWA 4IC7A 2JKMA 4UXLA 4F6UA 2CNQA 1YHWA 2R3IA 1PF8A 2R4BA 2VO3A 3FSFA 3ACKA 4YTFA 4JIKA 4FGBA 2FSTX 4AT5A 4JDHA 3D0EA 3HX4A 3QD0A 4OTQA 4ZTHA 4A06A 4C4JA 4HVGA 4RIOA 1PMNA 3FDNA 4D58A 3D5XA 2NNWB 4M69A 3S4QA 1OI9A 3KK9A 3PWYA 4G3CA 4C59A 4JT3A 2C5YA 4LRMA 5CVHA 4C34A 5EFQA 1YRPA 1U5QA 3IGOA 4FKOA 4ZSAA 4CFWA 3S3IA 2IF8A 2R3KA 1OL6A 3FMKA 4IJ9A 4KBCA 1M2QA 3VBTA 4CFFA 4CXAA 1APME 1IA9A 4FTUA 4MCVA 4PNKA 4IW0A 3D14A 4FSTA 5IPJA 2W1DA 3C4EA 3SQQA 2W1IA 4I6QA 4LI5A 3KRJA 1VYZA 4IX6A 4D0XA 4AGDA 3ZEPA 3HP5A 4IX3A 4G31A 2XNEA 1GZNA 5J7HA 2ZV7A 5LVNA 1OMWA 2C0OA 3AC4A 3EN7A 3PRFA 4LL5A 4CNHA 3KKVA 1YI3A 1YWVA 2YIXA 3M11A 3NAXA 4JG8A 4YBKA 1WBWA 4O7ZA 4R5SA 3BGPA 4QDVA 4PQNA 1R3CA 4K77A 4BWXA 4W4XA 3U6IA 2XS0A 3C50A 3JY9A 5J1WA 4O7TA 3MJ2A 3MPAA 4OTIA 3ANQA 1SYKA 2WOUA 4OTRA 3NNWA 3R02A 4QQCA 5CI7A 5E8VA 4YJPA 4M3QA 4TNBA 4KS7A 1VR2A 4PRJA 3UDBA 3W18A 4DYMA 4GKHA 3A4PA 1Q62A 2H34A 2ZYBA 3PA5A 4H1MA 2VTAA 3K3IA 4MD7E 5L8KA 3LE6A 2BALA 5EOLA 4FZAB 4AN9A 3QFVA 4BN1A 4CKRA 2DWBA 5IA3A 1L3RE 3ANRA 1OIRA 2YACA 4IX5A 4L00A 4EK6A 4EL9A 3KGAA 2WEVA 4YJRA 4F7NA 3L8VA 4WNPA 3RINA 5M55A 5E8XA 4IWDA 5FEQA 4EOMA 1H1QA 5CENA 3UGCA 2VWZA 5CQWA 3BCEA 3ZO4A 1GY3A 5EYCA 3U8WA 4CMTA 4EZ3A 3FI3A 2UW3A 1MQ4A 1R0EA 3GC0A 2VTIA 4QMLA 3KB7A 3V5WA 1H0WA 3E62A 4F7LA 5JQ5A 2FSLX 2PY3A 3JVSA 5AUYA 5HG8A 3DXQA 5FEDA 3FBVA 5CY3A 3FMMA 4HGSA 4EYMA 3WF9A 3QTZA 4NZWB 3RALA 4F9YA 5HBJA 3Q5ZA 5L6PA 3QALE 4J52A 5CAOA 4I22A 4RGJA 3TKUA 3NR9A 4CCBA 2I1MA 3R8UA 2X0PA 3LKMA 3NFFB 4XBRA 3R73A 3D7TB 5CAQA 2OJJA 2ITVA 2P0CA 5D12A 3L8PA 3NUUA 2X8IA 4GV1A 1Z9XA 4ZSGA 3BQCA 3RPRA 4C58A 4KNBA 2B4SB 5AEPA 4E93A 5BNJA 3SD0A 3QTXA 1ZAOA 2O2UA 2WQNA 3FHRA 3HYHA 4AXFA 3PPZA 4NM5A 4TZRA 2UZUE 3ZLXA 4E73A 5I9ZA 2UZWE 2HOGA 4G3GA 5E8SA 2W1GA 4UMTA 1M7NA 4WO5A 4O0YA 1FQ1B 5A6NA 1OKWA 3W0QA 5CWZA 3UOLA 2Z7RA 4MWHA 1KE7A 4YHTA 3TV7A 4YHFA 3WYXA 2Z7LA 3SG9A 1XH8A 3W0MA 2WMRA 4QMMA 2X0QA 1BL6A 3LCDA 3FLQA 3BEAA 3VUDA 2JAVA 3LPBA 4AA0A 4GUEA 1Q97A 2ZMDA 2PZPA 4FTMA 3GU6A 5H8GA 4ANMA 4TY1A 5AP3A 2PVLA 2P55A 3QKKA 5I9XA 2GHMA 3D5WA 5EW9A 4QTAA 3SV0A 2X6EA 3ENMA 3BGZA 3LZBA 3MA3A 3R2BA 3FEGA 3BPRA 4PPBA 2BVAA 4GVAA 5L8LA 1NVSA 4AXDA 2VWWA 4NJDA 3FZPA 4FV4A 3LMIA 2CCHA 4YTIA 5LVOA 2C3IB 3MH3A 3IW7A 1AQ1A 2O5KA 3D2IA 4UMUA 5CU0A 4AZEA 2J0MB 4F1MA 5JK3A 4GYIA 2OIQA 4BBEA 5AP6A 5A4TA 5CASA 4AZFA 4J53A 1H1WA 1OKYA 2RFNA 3PZHA 3TJDA 2A0CX 3A7IA 4DCEA 3AKKA 3OWLA 1V0OA 3EN6A 5DH3A 4BC6A 3QRKA 3L8SA 3RI1A 4O1OA 2XANA 4BL1A 4ZTMA 1WMKA 5TR6A 5E8TA 2IZRA 3FPMA 3HRFA 4QTEA 1BI7A 5IEXA 2OZAA 3TACA 1H00A 4DTAA 3PXFA 4U44A 4A07A 2JDOA 4DGLC 3UODA 3GCUA 1R39A 4E4XA 4Y5QA 3FZ1A 5AUWA 2P3GX 4D5KA 2X2MA 3FKOA 4FV2A 1PJKA 4U80A 1Q8UA 3DBEA 3R1QA 3UP2A 4QTDA 4QP2A 4WRGA 3O23A 4FTQA 4O6LA 4DC2A 3KXZA 4MBIA 3NUPA 1PKDA 4BZNA 4FV9A 1SNXA 2QCSA 1VLRA 5FEEA 3GUBA 5EQPA 3D94A 2PVJA 3A62A 1PXKA 3IO7A 3NNVA 4RJ4A 4YGAA 4HVHA 4RFMA 2QOCA 2CGXA 2V62A 4HGTA 5J79A 4ZS0A 4MF1A 5E4HA 1VEBA 1ZRZA 4GFOA 2CN5A 3NUNA 3R7EA 3TDVA 3OVVA 3UDTA 5JGAA 4O0UA 3I5ZA 3ZFXA 2ZAZA 4IHPA 3RPVA 4C3PA 3LMGA 1VJYA 4APPA 1BLXA 5HD4A 3Q32A 3FLZA 3UE4A 3HGKA 3DK6A 4E4MA 4EH4A 4ANLA 3ZC6A 2VTOA 1V1KA 3HEGA 4WNKA 2R9SA 2W1HA 5JGDA 4ASEA 5DGZA 4M7IA 1ST0A 2IVTA 3DAEA 4R78A 3GEQA 3P1AA 4DFUA 3GT8A 4QMXA 5AWMA 3W0RA 2O63A 3HNGA 4TWNA 3G33A 3MFRA 3MIAA 4R3RA 2JIVA 2G9XA 3DJ5A 2IZSA 2VGOA 2ITUA 4IWQA 4K0YA 2WQMA 4RWIA 4CG9A 4XJ0A 3GU7A 4DFNA 3UQCA 3TIYA 3VS6A 4FV3A 3PVGA 4C8BA 5GIOE 1ZARA 3SKCA 4O0RA 4LUEA 3FXZA 2C0IA 2XBJA 4AZWA 4EI4A 3UIXA 3KULB 4Z16A 3RKBA 5AR7A 1NA7A 5CAPA 2OZOA 2WFYA 4ZSLA 1FVTA 1Q3WA 2UW5A 4L3LA 4FT9A 4XCUA 3NMUF 5BVOA 3DKGA 4YBJA 1JWHA 3BHYA 1QPJA 4P7EA 2C6DA 3M2WA 4UMRA 4PL5A 4FYOA 4P90A 2ZJWA 4EUUA 5D7VA 3IW5A 4OT6A 3UO5A 4RWJA 4BY9E 3Q9YA 1XO2B 2YAAA 3ALOA 1XJDA 3EN9A 2YWPA 3QU0A 2YIRA 1J7IA 3O8TA 3P5KA 5F20A 5TE0A 1J1BA 1QPDA 4QDEA 3DLZA 3COMA 3HUCA 4GVJA 3C4FA 3NLBA 4KD1A 3TV6A 2UW8A 4CZTA 2WMXA 3G5DA 2XAMA 3AD6A 3VBVA 1OL7A 2RG6A 3JUHA 5HEZA 3VBXA 4QYFA 5H9BA 3IW6A 1WVWA 4QNAA 4YTHA 4EJNA 5K4IA 2F2CB 4RVTA 5CSXA 3I5NA 3TTJA 4AN3A 4E4NA 4D5HA 4BVUA 3VJOA 1IEPA 4MUQA 3KA0A 5IQBA 4QQ5A 3EQGA 3HV6A 4GFMA 3K5UA 3VUTA 2XA4A 3CTJA 3F7WA 1UNHA 4HNIA 3THBA 3C4ZA 4I0SA 5HTBA 1STCE 3RAWA 3SA0A 3W33A 3MFSA 4FV7A 4WG4A 3U9CA 4TRLA 3QQKA 4DT8A 4J95A 4RZWA 2WMAA 3ZUTA 4D2SA 3PJ8A 3Q3BA 3SW4A 5KMKA 3ITZA 3PXYA 4EZ5A 2A98A 4OGRA 5AP4A 3KRLA 1BI8A 1HCLA 2GNJA 2WQBA 5AR4A 4QTBA 5HCYA 4A9YA 1ZZ2A 3UTOA 2G2IA 2YN8A 3DLSA 4BDIA 4XG7A 3QBNA 3Q53A 5HIBA 1Q8YA 2JDRA 3IOKA 4ZY5A 3CBLA 3F5UA 2O0UA 5EM5A 4BWPA 2JKOA 4DA5A 2KTYA 5HHWA 2GCDA 5FP6A 4DH8A 4DITA 1P2AA 3DBFA 3FXXA 4WBOA 5CANA 2ZDUA 1ZYDA 4HOKA 2R3GA 5HNBA 1WBVA 4OBQA 3UP7A 2FB8A 1WBNA 3VO3A 3T3VA 4EORA 2JBOA 5T3QA 4C4EA 3A8WA 4UZHA 1DAWA 3FE3A 3UDZA 3MVMA 4AP7A 4FOCA 2J6MA 4N57A 4CFMA 3FQHA 4HJOA 3ATTA 4GL9A 2VTNA 4M8TA 4BIEA 4LRKA 4CTBA 4OAUC 4N4SA 3MB6A 2QD9A 4DFYA 1BUHA 4EC8A 2GNIA 4F0FA 5JMSA 4I6BA 4FSMA 5FBOA 3G6HA 5JN2A 3BU5A 3O71A 3R01A 1YXTA 4U3ZA 4EH2A 5HNGA 2BCJA 3C13A 2WMQA 2PMIA 3FYKX 3KFAA 4QMQA 1XR1A 4M15A 2R0UA 4DHFA 3FI8A 5AUUA 2X0GA 4AFEA 3ZTXA 2ITYA 4QYEA 4F9WA 4FT5A 1H1RA 1UKIA 2RFEA 2UVZA 5M07A 5C01A 4TN6A 3F82A 3NS9A 1M2RA 3K54A 1UWJA 3NEWA 5AV1A 3LLTA 3AD5A 3HDNA 3BLQA 2CLQA 4PWNA 1KWPA 2ITQA 2XKDA 4LM5A 5DT0A 4YSMA 5LMAA 3NFGB 1XHAA 1JVPP 4IVDA 3DOGA 3WF8A 3FAAA 4AUAA 3OD6X 4D55A 5ANOA 4I21A 4GFGA 2YM3A 3EQPA 5CVFA 4BTMA 3VS7A 4GCJA 1TQPA 1YWRA 3EN4A 3SOAA 5C9CA 3ZLYA 1AD5A 2GS2A 2J50A 2JAMA 5EDRA 3GP0A 3V3VA 3IKAA 3P9JA 2QC6A 4U42A 5HE2A 3PJCA 4OAVB 3ML1A 2WNTA 4HVIA 4FF8A 3S0OA 1Q8WA 1XH7A 4G2FA 3UIMA 3H4JA 5CALA 5ICPA 5M08A 5ANKA 2E9PA 2GMXA 4KIKB 5AUVA 5AAFA 4ANBA 4B8MA 2V5QA 1H1SA 4I5PA 1PHKA 4IM0A 5FTGA 5E90A 3EZVA 3R1SA 2PVNA 4C61A 4QP7A 4ASDA 2WTJA 3U87A 3KY2A 1OITA 1Z57A 3R9HA 4NFNA 4S33A 2VWIA 3HECA 3HAMA 2QNJA 3TM0A 4F78A 1R1WA 4DLJA 3PY3A 3F66A 2XH5A 3NZ0A 3QGWA 3W1FA 4E20A 2I0HA 4JAJA 4BHZA 2YM8A 3FMEA 1ZYLA 3Q04A 3VUKA 3TNIA 4IDTA 3KXNA 4D2RA 4DE4A 3MY5A 4L8MA 4PP9A 5CF4A 4O84A 3I81A 3EZRA 2YERA 2GQSA 1H27A 4LV7A 3CC6A 3WARA 4IZ7A 2B53A 4QNYA 3TDWA 1OPKA 2XB7A 3COHA 3DXNA 4FNXA 1XWSA 2C5XA 5LVLA 1T46A 2QODA 3MS9A 3R7VA 1XMLA 1FGKA 2BROA 4U81A 4H05A 3V01A 3O96A 4X2JA 4R77A 1SVEA 5GJDA 2X4ZA 1FPUA 2XM9A 3MVHA 4IB1A 3ORMA 2PU8A 4MVFA 3JYAA 4O91A 3WF7A 4PTEA 2BTSA 2BZHB 3O2MA 4YLKA 3EHAA 3F61A 2C6MA 3F5XA 3GCPA 3VHKA 4L44A 3RJCA 4FKTA 4BCJA 3KMMA 4Y72A 1VYWA 3VVHA 3ZZWA 3I7BA 3KF7A 4C4HA 4O96A 4QD6A 4I0RA 4XV2A 4I24A 3I60A 4YHJA 2XZSA 5HVKA 5CVGA 3TNQB 3QZHA 2B54A 3TL8A 1E1VA 1JSUA 4AF3A 2OH4A 4DH3A 4E5WA 3MGYA 3HV5A 4CFXA 2PHKA 5CU3A 2PK9A 3K5VA 4X3FA 4JS8A 5DT4A 2IN6A 4FKGA 3RP9A 4IWPA 4UXQA 4TTHB 5H2UA 3WILA 2UW9A 2EB2A 5IQAA 2YCFA 2XM8A 4N6ZA 4BCNA 3DKCA 4C3RA 4BIBA 3D4QA 4PV0A 4XG2A 4USFA 1W0XC 3EQHA 3A60A 2GHGA 3NWWA 4EH6A 5DR6A 4DEBA 4EHZA 4ZMEA 2BIKB 2XNGA 2JEDA 4FSNA 4AXEA 3OBJA 3VS5A 1YOJA 4A9TA 4FZDB 5AMNA 5EHOA 3EMGA 5ACKA 4Y8DA 3KC3A 3NUSA 3R7GA 4XRJA 2GSFA 4NW6A 4MTAA 2P33A 5FGKA 2XJ2A 1H07A 3EL7A 1PXOA 3QGYA 4P4CA 4W4VA 4D28A 2QU5A 2ZB1A 4E7WA 3KCFA 2OW3A 5A9UA 3SDJA 3PXQA 3TJCA 4JBQA 3A4OX 4XRLA 5BUIA 3QRTA 1BX6A 5AAGA 1YWNA 2QKWB 5IMXA 4O7LA 3ERKA 5IF1A 1CM8A 4FIHA 4J71A 3B2TA 4JQEA 2IEWA 2SRCA 3D9VA 3AGMA 4DGMA 5IA1A 2YZAA 2VWYA 5EYKA 2ITPA 4ZJJA 4ASXA 4QEBA 1GZ8A 4IQ6A 3NAYA 1UVRA 4RIYA 4U0IA 3O50A 4G5JA 3F3ZA 3FMNA 4Z3VA 3C0GA 4ZJVA 5TOZA 4KBAA 5A4CA 5M44A 4HZRA 2XMYA 4XOYA 5FXSA 4UN0C 3TUBA 3I0QA 4JLCA 3PUPA 3CGOA 1AGWA 4K6ZA 2WTWA 3OHTA 3RAIA 1TQMA 4PDSA 2PUUA 4YTCA 2JDVA 4BBFA 2QOBA 3DFAA 2VO7A 3ZONA 5I3RA 5FM3A 4G9CA 5KX8A 4D2TA 4D2PA 5CZIA 2QKRA 1W84A 3BWJA 3GQIA 4CFUA 3KVXA 3O17A 2CSNA 4AOIA 3DK7A 3GBZA 2QHMA 2VX1A 4NM0A 5L2IA 2YM5A 4NIFB 3FZSA 4QYYA 5M53A 4PNIA 5EDPA 1B38A 3EQCA 3UIUA 3PTGA 3CS9A 2DS1A 3GC9A 4FSRA 4EHEA 5HE0A 4EH5A 4QO9A 3R7OA 1XH5A 4A7CA 5JFSA 4DHJA 3OXTA 1IR3A 3GNIB 5FWKK 4X2KA 4M67A 2VO0A 1WBTA 3EQFA 1MP8A 3P86A 4FNWA 4QMYA 5L2TA 2E9VA 4KIPA 1CKPA 4Y95A 4DHIB 5JGBA 1PY5A 1U54A 2PWLA 5HGIA 3E7OA 5IH6A 4L9IA 1IRKA 1W98A 2UW7A 2Y9QA 3EKNA 3P78A 2HZIA 3C9WA 3QLFA 3R9OA 4LL0A 5FDXA 4DEIA 4IB5A 5HVJA 4RX5A 3ZHPC 4U5JA 3SVVA 5HCZA 4DTKA 4AT4A 4FTRA 3T9IA 3O51A 2PVYA 4UEUA 2PVRA 1GIIA 4JXFA 2QR7A 4FV8A 4O1PA 5F4NA 2J0JA 3VQHA 4BI1A 3S1HA 4JQ7A 4DLIA 3OT3A 3QZFA 3MVJA 2C6LA 3RVGA 3FV8A 1DM2A 2I0VA 1F5QA 5L2WA 5DFPA 5AADA 3V5TA 2UZNA 5DYJA 5JFXA 4DBXA 4X2FA 3DV3A 4V0GB 5DHJA 4BDKA 5KBQA 3NIZA 3G9LX 1YDSE 4RIXA 5CSWA 3WZUA 3HRCA 3DU8A 1U59A 3OTVA 4O38A 3ZUVA 5I5ZA 4C2WA 3ROYA 4NYEA 2OSCA 3KK8A 3L1SA 1T45A 1MRVA 3DKFA 4O2ZA 4F65A 1DAYA 4L52A 3V5JA 4AAYA 4KSPA 1XH4A 1O6KA 5E8WA 3EKKA 3ZC5A 1TVOA 3E92A 2QURA 3E64A 1Y6BA 4KB8A 1FINA 2HENA 2OF4A 3BYOA 1OB3A 3IG7A 4QRCA 4TKSA 4C4IA 3COKA 2R3RA 2W9ZB 3FL4A 4YO6A