4Z55A

Anaplastic lymphoma kinase catalytic domain complexed with pyrazolopyrimidine derivative of ldk378
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
307
structure length
294
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords ALK tyrosine kinase receptor
publication title Design and synthesis of novel selective anaplastic lymphoma kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 294
sequence length 307
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4z55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4z55A01
3RPRA 4F6UA 1J7IA 3PVGA 1OI9A 4TT7A 5K3YA 5EHYA 3CJFA 2IVTA 3POZA 4FNWA 1OIQA 4FV6A 5CENA 3MS9A 2PVHA 3B8QA 4MF0A 5L6OA 2G1TA 3FXWA 4F1MA 5E8SA 4ASEA 3GVUA 4O84A 2OIDA 2RFSA 4JDJA 4QMTA 2W4JA 5LJJA 2Y4IB 3P5KA 4DH3A 2C4GA 2ZVAA 3Q3BA 4J7BA 2LAVA 4QMVA 4DGOA 4E6DA 3SXRA 4EHEA 2PMOX 3D7TA 4UXQA 4IDTA 1YXTA 3CGOA 4U79A 5AMNA 3UPXA 3P7BA 4C4JA 4C58A 5CEIA 4M66A 1O6YA 5ICPA 3NRMA 5AR3A 3U9NA 4AFEA 3Q5ZA 2G01A 4O0YA 3BV3A 5HEZA 4C36A 4B9DA 4TPTA 1AGWA 4FV9A 4Y8DA 2B9HA 3OS3A 5BPYA 3UC4A 5L2WA 3EQHA 4DN5A 5CU2A 2ITNA 4YJNA 3NMUF 3FKOA 3ITZA 5A54A 1E1VA 2AYPA 1A48A 3SV0A 5FP6A 2X4ZA 4YTCA 3EOCA 1P4FA 5DNRA 4V05A 2UZTA 4IB5A 2VWIA 4QO9A 4IHPA 1VYWA 3IK3A 3JVRA 3R7YA 3VHKA 3FJQE 4R3CA 4L00A 2BDWA 3HAVA 2Y4PA 4BWPA 1YWNA 4MNEB 3E93A 2GNIA 3FSKA 2QHNA 3MA6A 2X7GA 3R8LA 3RAHA 1OPLA 4BVUA 4LMNA 4Q5EA 3PE1A 5AV1A 3F3UA 3UDBA 1BI8A 1UWJA 3HV6A 3MDYA 4RIXB 2IW9A 2HY0A 3FY0A 3QAME 3VUMA 4XG6A 4E26A 4IZ7A 4FKTA 4OBOA 3AMBA 2XK3A 5KKRB 4LG4A 2V0DA 3P7CA 4DH1A 2EXMA 3FLYA 3VJNA 3AOXA 2GHGA 3ORTA 4XJ0A 4BYIA 3JUHA 4FMQA 3LM5A 2WMQA 4L3PA 5HNBA 1OPKA 2YLEA 4C8BA 3OXIA 3MVMA 2GHMA 1Y8YA 4FV2A 4NK9A 5IMEA 3F3VA 5JGBA 4IM2A 3FI8A 4DFZE 2JBOA 5KMKA 2XK4A 2WTCA 3OCSA 4FIFA 4AW2A 3C50A 4ZY4A 2W7XA 4UB7A 5KX8A 2R9SA 4W4YA 5EQPA 3PJCA 3COHA 1M17A 3C9WA 4YO4A 1Q62A 2X7OA 3FI4A 2GDOA 4V01A 2CKPA 4QMYA 4BCFA 2WQEA 4WG3A 4EQUA 2HCKA 4RVTA 2X2KA 4UWBA 2EVAA 2X6DA 1YXSA 1I09A 4AOJA 3PXYA 2CPKE 4LMUA 3ZU7A 4ZOGA 2AUHA 1ZY4A 4B6LA 2P4IA 3A99A 5E8ZA 3QA8A 3R02A 4EK6A 3IECA 3OBGA 1WBOA 4N4SA 2WU6A 5AP7A 4NUSA 2UW4A 3C4XA 3BYMA 4PPAA 4FKPA 4GT5A 2IW8A 5JN2A 2W1GA 4O2ZA 2GNGA 4ASXA 4L67A 4AA5A 4DFLA 4NM5A 4PMMA 4AAAA 3MFRA 5IF1A 4H1JA 4KD1A 2JDOA 2Y4IC 1MQ4A 3R63A 3I6UA 2H6DA 3RPYA 2PVJA 4BTKA 1XBBA 5CQWA 3V51A 3AT3A 2C6DA 3PXRA 2J0LA 5GIOE 4USDA 5JT2A 1OMWA 5DPVA 3R9HA 4ZTMA 1LUFA 3RAIA 2R3LA 3KXMA 3HV5A 3V6SA 3LJ2A 2YIYA 4NM3A 5M4IA 1JQHA 2W4OA 3FMDA 1H0VA 3SXFA 2PE0A 4AN2A 1UA2A 4NTTA 4L53A 5AV0A 2HENA 4EJ7A 5HORA 5CT0A 2ACXA 2XZSA 4WUNA 4R7IA 3WF9A 2F49A 5C01A 4KKEA 2OFUA 3FZOA 3COIA 3D4QA 5EI6A 2E9NA 4R5SA 4RC3A 2ZV8A 3ORMA 2H8HA 2OXYA 2YABA 3VQHA 4CVAA 3LCKA 3QRTA 3HYHA 1U5QA 4FL1A 2X6EA 1FMKA 4GFOA 3RNIA 3ZCLA 1XH7A 2YCFA 1PJKA 3LCOA 5FGKA 4E73A 4FTRA 3PLAE 3P4KA 3HEGA 5KMOA 3H9OA 4B99A 3U4UA 5LMBA 2IO6A 4Y85A 4RZWA 5L8LA 3EL8A 3D9VA 3KL8A 3KRLA 4AGUA 1IEPA 3HKOA 2QLUA 4FG7A 4F64A 5KMLA 3N4TA 3QRUA 2WO6A 1RQQA 4X6RA 2XJ0A 4E6QA 4FNXA 4EC8A 4O82A 5HIBA 2ITZA 1ZYDA 3QQHA 4FSUA 3K54A 5E91A 4EK3A 3HV3A 3PTGA 4PNIA 3LPBA 5KKRC 4G6NA 3GU5A 5E8WA 2QOFA 4EUTA 3C4WA 3FZPA 4Z7GA 1RW8A 4BIEA 4FZ7A 4HVHA 1PMEA 3V5LA 4LM5A 2O3PA 2FH9A 4WA9A 3UQGA 2JFLA 5EYMA 3UZTA 4GH2A 3KXNA 3QQKA 3QRJA 1STCE 4LI5A 4JR3A 1FGKA 3W1FA 4YU2A 4YBJA 3A8WA 4D5KA 2CNUA 4DCAA 4HNFA 4M3QA 3KN5A 5HLWA 3U55A 4CEGA 4PDOA 1OECA 3QALE 4QMWA 5DHJA 3TNPC 5CVFA 3BQCA 4QPMA 5LMKC 2EWAA 4OUCA 4R5YA 1YHWA 4ZTNA 4D55A 4D0WA 1XO2B 4O0SA 3UP2A 2XNEA 3CEKA 2VD5A 3M11A 4EOLA 3RK5A 3H9FA 4U45A 3R73A 2VTTA 3AGMA 3OOGA 5IMXA 5FBNC 4F0GA 5IA2A 3PJ1A 2YDKA 2ITYA 4R3RA 4V0GA 5EW9A 4NCTA 3WIKA 4M68A 4MQ2A 3EN7A 4BCNA 3E92A 4C4HA 5CF4A 1H26A 3SG8A 3MYGA 1ATPE 1URCA 3EFKA 4U44A 4XV2A 4GK4A 5AP1A 4GCJA 4L44A 3PXFA 1WVYA 4N70A 2WMWA 3BHVA 3K2LA 4EH4A 4ARKA 2GNLA 4E5BA 3NAXA 4YZDA 4UV0A 1JPAA 4PY1A 5C4LA 2O5KA 2YM8A 3ZZEA 4IFGA 2A1AB 4YSJA 1CM8A 4IAYA 1WMKA 3QZFA 3VNTA 4NIFA 2SRCA 5CI6A 4LGGA 3VIDA 3FE3A 1J3HA 4YSMA 4ZZMA 3TZ9A 5M4UA 2OJGA 5DWRA 4O0VA 3FEGA 1PKGA 4KIKA 4YLLA 4YMJA 3BYVA 5HE2A 4BTFA 2WQBA 5CEPA 4AZTA 3ZXZA 2CLQA 2GCDA 2O2UA 2X0GA 5GJDA 5IQAA 2OG8A 2CKEA 4YHJA 2W1IA 3LZBA 4I1ZA 3FI2A 4LV8A 4XEYA 1YXXA 4CZTA 5EDRA 5M51A 1G8AA 1JSUA 2XIKA 4NH1A 3UMXA 4F63A 2VWUA 3UOJA 1OIRA 2W5BA 2PYWA 3NEWA 1H1WA 4LQMA 2BDJA 2RFDA 4FSWA 5I9YA 5KNJA 4ITJA 1S9JA 4D1SA 3BLHA 2WNTA 3ZLWA 1ZYJA 2PVNA 4W4WA 3CQEA 3DB6A 3ETAA 3QUPA 4E4LA 3DXQA 1JAMA 2C5OA 1YVJA 4A7CA 1KUTA 4GJ3A 1REJA 3ORNA 4U41A 3SQQA 3ROCA 3RPOA 2BTRA 2HW6A 3H9RA 2OZAB 1WBWA 3IONA 3PA5A 3F5XA 4I93A 4NSTA 5B0XA 3EZVA 2FGIA 5IG1A 3QGYA 3R1NA 3F2AA 3ZRMA 2OGVA 5CEKA 2VWBA 5KBQA 2XKDA 1JLUE 3I0OA 3RPVA 3NYOA 4C7TA 2R3JA 3BLRA 3O96A 3OTUA 2ONLA 3MJ1A 4M8TA 3A61A 3TWJA 5C8KA 3EYGA 3TJDA 4A4XA 3IG7A 3QL8A 2P0CA 4D1XA 5L8KA 2F2CB 1BL6A 2PY3A 2R3QA 2XNOA 2ZV9A 3EN5A 3GOKA 4KBAA 4TN6A 4CKIA 4IC8A 5LVLA 4ZJVA 3KMUA 5HVJA 4DT8A 3QYZA 4KBKA 2E9OA 2JFMA 3EFWA 3PUPA 4BDDA 3DXPA 5AA9A 3DBDA 4ERWA 4OLIA 4LOOA 1FBNA 4WHZA 1OM1A 4C3RA 4RWLA 1APME 2BILB 2BDFA 5D7VA 3FZSA 4F6SA 3AT4A 2EB3A 3PJ3A 4JX7A 3ZHPC 3BHHA 3RWQA 2BIKB 4EI4A 5IUIA 2J90A 4FKSA 4O0RA 1KOAA 2CMWA 2BIYA 3FL5A 5HU3A 1XH4A 4CZYB 2GNJA 4EBWA 3QX2A 3SRVB 4ENXA 5CQUA 5DE2A 5F9EA 3EHAA 4UWCA 2XEYA 2XB7A 2J2IB 2WEIA 3ACJA 4RX8A 3FDNA 4XG9A 3Q04A 4AOTA 4IJPA 4U97A 4JBVA 4IZ5A 1H28A 1SZMA 4IWDA 3EN9A 3LAUA 3PG1A 3HV4A 4YLKA 3WE8A 1OKWA 2B9JA 2WTVA 4I0TA 3K3IA 4FV7A 4GG7A 4FUXA 3LQ8A 3HMPA 3KMWA 2NNWB 4PMPA 1NA7A 3DDQA 3I7BA 4KKGA 4XG7A 3HV7A 5EM7A 2YLFA 4RVMA 4PP9A 3IOPA 4FI1A 1TQIA 5L8JA 3ORPA 3ORIA 5M57A 4JBPA 2R7BA 4ID7A 1LPUA 4LOPA 3R8ZA 3O23A 5FRIA 4EOIA 5JFSA 4IADA 4Y73A 3HDMA 2UZEA 5AP0A 2WMRA 5AR2A 4O0UA 5EFQA 2PMLX 3TIYA 2WMTA 4FT0A 4BBEA 1NY3A 3SLSA 4CZUA 2R3GA 3ZLYA 5J7BA 2GQSA 2W9ZB 4QOXA 4O27B 2YM7A 3VN9A 4ACCA 2E9VA 4J71A 3MA3A 3TTJA 2J6MA 4M15A 2RKUA 3HA6A 3QTZA 3P7AA 3EYHA 3SHEA 2B55A 4FNYA 2EB2A 2JITA 4JX3A 3QWJA 3GUBA 2XK8A 1I44A 5HVKA 1F5QA 1XH5A 3LVPA 3OXTA 1OGUA 4RA4A 2J4ZA 3W2RA 1UV5A 1OL1A 3DLSA 4ANQA 1P14A 2ZYBA 3LFCA 4CCUA 5B2MA 3QHRA 4X3FB 3WF8A 5LWNA 1PW2A 1NVRA 1PMUA 2VX0A 4RLLA 4UMQA 4YZMA 1OKYA 4NYEA 5BVDA 2BRMA 4IANA 3R8PA 4N6ZA 4C38A 3DAJA 4FKWA 5E8XA 3FZRA 3HP5A 2XBJA 3L1SA 3QKLA 4OR5A 5JKGA 4IX4A 3R30A 1J7UA 3V01A 3C0GA 2J5EA 4YJUA 2Z02A 4EKKA 5HU9A 2JIIA 5AUVA 4AG8A 1T45A 3QZGA 1YOMA 3KVXA 5EDPA 5H8EA 3TV7A 5EOLA 1A06A 5AR7A 2A2AA 3FQSA 5CSXA 2F7XE 3AD5A 4DITA 3S95A 2XK6A 5BMSA 5HX8A 1ZLTA 3TNQB 4GU9A 2J51A 5J95A 3M1SA 3BGPA 4EZ3A 1GZNA 2VNYA 4AXAA 2QURA 4IXPA 4MWIA 4GW8A 2UZWE 3OY3A 2VO6A 4ASZA 4IH8A 4FIJA 2PMNX 1FQ1B 1UKIA 4FV1A 4QYFA 3L9NA 3SKCA 4RX7A 4USEA 3H3CA 3UOKA 2JD5A 4BCKA 5JK3A 5DR2A 3UOHA 5J9ZA 4UZHA 1Y8GA 5IA1A 3Q4CA 4DBXA 2GS2A 5AR8A 4EQMA 3AC4A 4ZJIA 4AQCA 3R01A 3GQLA 3H10A 3OWKA 3MH1A 1BI7A 4IFCA 4K2RA 3TACA 4BL1A 4D5HA 4EHGA 1OBDA 3VWAA 4UN0C 3E8NA 5BUJA 3L9PA 1OIYA 2QKWB 5A6OA 4IVDA 4QYYA 4CV8A 1Q97A 2UVYA 2W1EA 3QUDA 2P55A 2UUEA 2X81A 5HCXA 4NKAA 2VWVA 3NS9A 2KTYA 4ANLA 3PSCA 4FKJA 2XUUA 3ZEWA 1QPCA 3HNGA 3AD4A 2BAKA 4BIDA 3OT3A 1GZKA 4MAOA 2X2LA 5ETFA 4IWQA 3PP0A 4YJVA 4UXLA 4USFA 3SAYA 5DEWA 4Q2AA 2UZDA 4M69A 4X2FA 2GS7A 2EXEA 3DA6A 4FEXA 1Y6AA 2YISA 3F7WA 3MB7A 1PXPA 2XCKA 1L3RE 1M2QA 4OW8A 5CY3A 3UGCA 2XYUA 4FVQA 4ZP5A 5ANGA 5M4CA 3DGKA 4FV5A 5H3QA 4M7IA 3ATTA 2C5YA 2OF2A 3BGZA 1Y57A 3RCJA 5HESA 3RTPA 2QOIA 1DI9A 3L8SA 3OFMA 3O71A 4FYOA 3KULB 4UX9A 3O8UA 2BRBA 2OXXA 5GZ8A 2HZNA 3OT8A 2WQNA 4E1ZA 5CU0A 2QOKA 5AX3A 1JVPP 1GZ8A 3M2WA 4ZK5A 2OH0E 2A0CX 4L46A 3P78A 3RNYA 3D15A 4QP7A 3GENA 4EH9A 3E87A 4C2WA 3AMAA 5GZAA 4OTWA 5LCJA 2RFEA 4MXXA 2F7EE 4IB0A 3BZ3A 5HO8A 5IH4A 2V62A 2WTKB 5EKOA 4ZS4A 5I0BA 3P9JA 3N9XA 3NUUA 4QYHA 5DBXA 2GU8A 3GU6A 4TYHB 5HVYA 4C62A 4FVRA 4C2VA 5DFPA 3NW6A 5CZIA 3GU7A 4B7TA 3DTWA 4C0TA 3A7HA 4X3FC 2B4SB 2JKKA 1O9UA 3JY0A 3MESA 4QT1A 3T9TA 4DBNA 2VTJA 2E9UA 4KS8A 2HW7A 3VQUA 4D9UA 5AV2A 3R7EA 2OSCA 4NW6A 5BVFA 3MN3A 5LQFA 3V8TA 2W99B 4RIWA 5E90A 4QMPA 3OHTA 5KZIA 3A2CA 2CGUA 3D7ZA 1KOBA 3QLGA 4HGTA 5FEQA 3ENHA 3VRZA 3OTVA 3VO3A 1RE8A 3ULZA 5EDQA 3CPCA 3F6XA 2W05A 2BZHB 4FZFB 2FUMA 1TQMA 4ACHA 5M07A 2J7TA 2OF4A 2VTIA 4HVDA 4F70A 2PUPA 5AP5A 3BHYA 5F20A 4TYIA 2JDRA 2X4FA 4QP3A 3TIZA 4O0TA 4G6LA 2ITUA 3HUBA 4GT3A 2C0OA 3F7ZA 3KRRA 4ZTHA 5HLNA 4FSRA 5HIDA 4N6YA 2HXQA 5J8IA 3QXPA 4C37A 3II5A 3UBDA 3LCSA 5K4JA 1Q41A 3FAAA 4JRNA 2B7AA 4OBQA 2QOBA 5AADA 1YQJA 1LEZA 2BZIB 2C5XA 4X0MA 4LGHA 5EW3A 4JG7A 3NIEA 4U3ZA 2HZ0A 3IKAA 3MH2A 2PSQA 3Q4TA 4XV1A 5HE0A 4BGQA 5IQGA 4K9YA 3C4EA 3DU8A 3QZIA 4NW5A 4BC6A 5D41A 3O51A 1ERKA 4DH8A 3KRWA 4BDGA 5HNIX 4QMOA 1PYXA 3QKKA 5KMJA 2ITTA 2QOOA 1YDSE 5KZ0A 2UVZA 3KCKA 3K5VA 4G3DA 4QNAA 2BALA 2WB8A 1PXIA 3Q60A 5FTQA 4CV9A 2W4KA 5IEXA 4MWHA 2OJ9A 3L8PA 2H9VA 1WBTA 2PZIA 4KB8A 1R78A 5A46A 3CSVA 1VR2A 2W06A 1R0EA 3QA0A 4IB3A 4UZDA 4BTJA 4DEAA 5IKWA 4DEIA 4M0YA 3W2PA 1SNUA 4FIHA 3CTQA 5CZHA 4I4EA 4G34A 4XBUA 1VEBA 3OY1A 3R1QA 3LQ3A 1BX6A 4JAJA 2FSLX 4FODA 2WIPA 3F3ZA 4X3JA 3ZFMA 2BRNA 1TQPA 4O96A 5F94A 1SVEA 2ZOQA 3VULA 5HD7A 4EJNA 4FE2A 4IX6A 3COKA 3UQFA 5D1JA 2HELA 4GRBA 4JIAA 3DBCA 3GEQA 5EHLA 2QU5A 4L52A 4DEDA 4RSSA 3NPCA 2F9GA 3QYWA 4RA5A 3TDWA 4LFIA 4TWNA 3R04A 4A06A 4BHNA 4M14A 5BVNA 1PMVA 2IVUA 2OIBA 2UZBA 4TW9A 5CS6A 5AUZA 4BCPA 4FT7A 4XV3A 1FVRA 3KGAA 3OWJA 3QTRA 4YPDA 5GZ9A 1CTPE 5CX9A 3TXOA 4ZTRA 4HGEA 4L8MA 4KSQA 4CYIA 5HGIA 4FSTA 4EKLA 2QNJA 3FZ1A 3IW4A 5K4IA 4FEQA 4I24A 5FXRA 2CDZA 5EQYA 2WTKC 4AN9A 4BCMA 4BKYA 4I5MA 1M7NA 4FV4A 1Q8TA 4I5CA 2C30A 2W0JA 4FTQA 4F9CA 3DPKA 3KVWA 3PG3A 2HY81 2QHMA 3QCXA 4LUDA 5AIKA 2WAJA 3RPSA 2GTMA 2YHVA 3C13A 4FSNA 3ODYX 3TKIA 4Y5QA 4FKIA 3R8UA 2CNVA 4CG9A 4L3JA 5JH6A 3BEGA 3LMGA 4U43A 4DTBA 3DFCB 4MD9E 2W5HA 5EI2A 3RALA 1IG1A 4HCVA 4EOPA 2VWZA 4R77A 2XS0A 1E1XA 2XKEA 1ZARA 4J8NA 3EN6A 5EYCA 1L8TA 2UZLA 4FTUA 4BHZA 3A62A 3ODZX 3D2IA 2NRUA 2BVAA 4WRGA 5T3QA 2Z7LA 2YIRA 4S32A 2PPQA 3BYUA 4FSZA 2OO8X 1WFCA 3QD3A 5ANEA 4TWCA 3R2YA 5EM6A 4APPA 4C3PA 1GIIA 4UMRA 2BZJA 3PPZA 3G9LX 2C6OA 2CN5A 2VWXA 2Y7JA 4MNFA 1ZMVA 4A9UA 4PV0A 2W1FA 2GQRA 2PVLA 5E8UA 5IISA 3OWPA 3FLWA 3NDMA 1ZOGA 3AG9A 3LXKA 3AXWA 2QOLA 3IPHA 3L8XA 1OIUA 4ZSJA 1WCCA 1ZWSA 4BBFA 4EYMA 1GAGA 4W4VA 3ULIA 4PDPA 3BYSA 4WG5A 1IASA 4F9BA 3TT0A 5CNOA 2ITOA 4G3EA 2OBJA 2C3LA 3BKBA 4LRKA 3E88A 3VBVA 3GCQA 5K5NA 2RG5A 3SA0A 5IQFA 1NW1A 3A7JA 3QQFA 4RIYA 3QTXA 4TL0A 2IZUA 5CALA 4I5HA 5C9CA 4MXCA 2QOHA 1UNHA 2BAQA 2C47A 1R3CA 2UVXA 4U80A 3PA4A 2C6MA 3LMIA 4QRCA 2J9MA 4DYMA 2YN8A 3MSSA 4RRVA 4EEVA 1U54A 1LEWA 4ONAA 5ANOA 5GJFA 1MRVA 1ZMWA 4BCIA 4UMTA 3CD3A 1JKTA 3LFBA 3Q52A 4WD5A 3QD0A 2VGOA 2B54A 2C1AA 2ETMA 5FEEA 3ZONA 5HBHA 1Q8ZA 3PJ2A 4NU1A 4U42A 4AW0A 3LFEA 5LARA 5BVKA 1SNXA 2F57A 3TG1A 4AX8A 4RVLA 1OITA 4I6FA 4JQ8A 4BDJA 2W1DA 4BDBA 4W8DA 4S30A 5LVMA 2JEDA 3PPKA 4FTAA 4WT6A 3RHKA 4PNKA 4BY9E 2FSMX 3VS7A 1EH4A 3ACKA 3GCPA 1ZYSA 3KF7A 4FTOA 5LCKA 2PUNA 1OZ1A 3OZ6A 3EWHA 1B6CB 5AX9A 1MRUA 3R0TA 5ACKA 1X8BA 2WD1A 5EHOA 3UNZA 3Q32A 4HW7A 2VNWA 4J97A 4D28A 2VU3A 4HOKA 2O0UA 3CCNA 3MW1A 1WBPA 3HL7A 4JR7A 4RMZA 3O7LD 4E4MA 2Z8CA 3FLZA 3V5WA 2I7QA 1ZYLA 3HAMA 4N57A 4FL3A 3NUAA 2BKZA 4GKIA 3DKFA 3OC1A 4FBXA 4BZNA 4HZSA 5C8NA 4BDEA 1JNKA 5CAQA 4ALUA 2HZIA 1H4LA 2VTPA 3GCUA 2ZDUA 4BCGA 4GUEA 4R1VA 3BHTA 4L9IA 3OBJA 3OROA 4GS6A 3QCQA 4CFUA 3I81A 3R8MA 4CTBA 3D14A 3VS6A 2C5NA 3DK6A 1OL7A 2XA4A 5HLPA 5HG7A 3QC4A 2OZAA 3C1XA 3LFFA 2XM9A 2R64A 3CIKA 2GMXA 4AZSA 3QTUA 3KY2A 4AZWA 3AC5A 4FX3A 4PDYA 3R71A 2QVSE 1KE5A 4MBLA 4QTBA 4XMOA 5BX0A 1AD5A 5KHWA 5BYZA 4M0ZA 4FKOA 2Q0BA 4FG9A 2BPMA 2GSFA 3GU4A 1LP4A 4RWJA 1RJBA 3VUKA 4BDFA 3KC3A 3MPTA 4CGAA 5K5XA 1W84A 1J1CA 4EWQA 1KWPA 1GIHA 3ALNA 3EKNA 3L8VA 3GBZA 3Q2MA 1JKLA 4KBCA 4ZY5A 3F2RA 5AAGA 3UO5A 2CJMA 2GQGA 2QU6A 3FXZA 3U6JA 3PIZA 5M08A 3GNIB 3GU8A 4EHVA 2KULA 2QONA 2Y8OA 2O8YA 3BBTB 4JL9A 3PSDA 4AP7A 4CFWA 4DGLC 5IA3A 4QQ5A 4FKQA 3U54A 1Q8WA 3D7TB 5FTOA 2HZ4A 5C03A 4CFMA 3FV8A 4ANBA 4U5JA 3S2PA 4ZSAA 4Z7HA 3F3WA 4AOIA 2VO7A 3WZUA 2WGJA 2XJ1A 4G3FA 4OTPA 4TKSA 3OW3A 4TY1A 3VUGA 2RGPA 4P2KA 5JFWA 4O7TA 4Y72A 3FMKA 3AC3A 4O6EA 4U3YA 3E7VA 3PDTA 3ZFXA 4G16A 4E5AX 1DAYA 3F82A 2QQ7A 5AIRA 4FA2A 5CU6A 3H30A 5CASA 2W1ZA 4FSMA 2YA9A 4J53A 4QD6A 4DH5A 2IZSA 1PXNA 2OJJA 4BFMA 5A4CA 3S4QA 2ZM3A 3HZTA 4RC2A 3UODA 2XVDA 4PL3A 4UEUA 2W1HA 4GIIA 4G5PA 3O7LB 5C8MA 2P2HA 5CSWA 4RQKA 2UW9A 5K9IA 2Y9QA 3KEXA 1U5RA 3G90X 3AMYA 4C4EA 4TWPA 5HD4A 4I92A 4R78A 3EZRA 3RM6A 3VS0A 4CCBA 4ACGA 3TKUA 4EH7A 2CKQA 2OXDA 3HGKA 4WOVA 2XM8A 4E5WA 4UWYA 4C57A 2DQ7X 4O21A 2IVSA 3DKOA 2JIVA 2CCIA 3R9NA 3WOWA 3ZM4A 5FDXA 2PZPA 4X2KA 3Q9WA 5FXQA 3UVQA 2XIYA 5LVPA 3NR9A 2PULA 4IM3A 5FUTA 3V5QA 4R1YA 5I3OA 2ITVA 4ZJJA 2OK1A 4D1ZA 1URWA 3UJGA 1BL7A 1H01A 1OUKA 3ZOSA 4GT4A 1GIJA 5HI2A 5IQCA 2ZB1A 2ERZE 3GB2A 3Q5IA 4F99A 2FB8A 2P33A 2I1MA 2Z7RA 5LVNA 3P1AA 3VS2A 4B8LA 4HCUA 2YAKA 5M06A 5DR9A 4E20A 4EHZA 1XH6A 3DB8A 2PK9A 4FVPA 1YXVA 4KRCA 3DDPA 3KREA 4RGJA 4L42A 4MBIA 2BTSA 4GIHA 3AT2A 2B9FA 3DT1A 4TRLA 3QLFA 3UIUA 1BKXA 5AWMA 3F2NA 3KRXA 5EK7A 3BIZA 4FEUA 2ZM1A 4AFJA 1QPEA 4M13A 3G0FA 2OWBA 4C34A 2BCJA 2RL5A 3MFSA 3QFVA 4X2NA 4UMUA 3RVGA 2HIWA 3DNEA 3VUIA 3GC9A 4LGDA 5AEPA 2BHHA 3TTIA 4KSPA 3MTFA 3QX4A 3DAEA 3N51A 3F5UA 2A19B 3PJ8A 2IN6A 5M4FA 3CP9A 2VN9A 3NGAA 3BEAA 3NW7A 2FO0A 3C51A 4E4XA 5E1EA 5ITAA 3CGFA 2GTNA 3R7GA 1Q8YA 3PY0A 3MGYA 3QWKA 3E7OA 4I6BA 3KXXA 4II5A 5HO7A 5I3RA 4D9TA 3Q2JA 3LJ1A 3RI1A 1XBAA 5DEYA 1V0OA 4RJ6A 5ANKA 2VTMA 2ZDTA 4IAIA 5GHVA 2PE1A 1W0XC 3I1AA 2C6LA 4M84A 2PTKA 1Q8UA 3WZDA 4DTKA 1DAWA 2UW3A 4FKLA 2YM3A 4AF3A 3K5UA 4QMZA 4G9RA 4KIOA 5EYDA 2OICA 3GCVA 3UG1A 4I20A 4YURA 3JYAA 2CGVA 5L6WL 5IA4A 5J79A 2JC6A 3DBQA 5LXMA 3FLSA 4MXYA 2QOCA 3U9CA 2C0TA 4F9WA 3NW5A 2WTJA 4XOYA 4NJDA 5DG5A 3IGGA 4LL0A 1NVSA 4MEDA 4GKHA 2C5VA 4HYIA 5BUIA 5I4NA 4OTFA 5TR6A 4XUFA 3QQGA 4G31A 2F4JA 5AUYA 4IDVA 3V04A 1G8SA 5EQEA 4J95A 4NT4A 3ZUVA 1BLXA 4UALA 2CSNA 3BU3A 3I60A 4HVGA 3QTQA 1YWRA 3QD2B 5LOHA 4Z16A 2VTRA 3V5PA 3VBWA 2Y6MA 1Z5MA 4HZRA 5HZNA 3TEIA 2UZNA 4CTCA 5K0KA 1VJYA 2PVYA 2YDJA 3CC6A 3C5UA 3QU0A 2DWBA 4WIHA 5E8VA 3TN8A 3WARA 4XBRA 3DZOA 4FEVA 3BQRA 1ZOEA 3MB6A 3BBWA 3HMOA 3TNWA 4A9RA 5L2IA 1O6KA 4O0XA 5A4QA 3HRBA 2Z2WA 4UMPA 4YZNA 5E7RA 1XH9A 4BWKA 1M7QA 2PVMA 2I40A 3U51A 2OJFE 1Q3WA 3R9DA 4GG5A 4K33A 4QPSA 2ITPA 4ZTQA 4DFYA 1KSWA 1YW2A 3W2CA 4RJ8A 1Q5KA 4RLKA 3V8SA 5IQHA 2ZJWA 1KE7A 4KIPA 4HGLA 2HK5A 2R0IA 4RJ4A 2YZAA 4K1BA 2PUIA 5AM6A 4CQGA 4HPTE 4EOKA 4PPBA 4C3FA 5M44A 3V5JA 3PIXA 3DKGA 4O7ZA 1CKIA 4DAWA 2WQOA 4OTRA 4E93A 1H07A 3IDBA 4P5QA 4GFGA 5D11A 2PHKA 3DBFA 3I5ZA 4FICA 4HGSA 1HOWA 2XP2A 4JDIA 2BRHA 3UOLA 3LHJA 4YJOA 2B53A 3U87A 4CFNA 5HE1A 3F88A 4BZDA 2ZV7A 3QF9A 3NNXA 3BWJA 4IC7A 4IWOA 3D2KA 4UY9A 2Q0NA 2YCSA 3OEFX 2ITWA 5F4NA 1KE8A 4AT5A 5L2SA 5AP2A 3PWDA 2QR8A 3HRFA 3OCTA 1QMZA 5CF8A 5DOSA 4I41A 4DINA 4I21A 4TTHB 2C68A 3IDPA 3NYXA 2G2IA 4BYJA 5DA3A 3F61A 2I0VA 4RIOA 5IQBA 4RBLA 3GT8A 4YJQA 5C27A 4BIBA 4RX5A 4BBMA 3DOGA 5J9YA 3BYOA 3DQWA 3VBTA 4DEEA 3MJ2A 1MP8A 4ZS0A 3UMWA 4J99A 4JT3A 3EB0A 3ZS5A 3ID6C 2E9PA 3ERKA 4GK2A 4H3PA 4KA3A 4L43A 4LRMA 4V0GB 5E8YA 4Z55A 2WFYA 3IQ7A 3RK9A 5I9UA 3IW6A 5AAFA 2R3IA 3DQXA 3C4ZA 3CQWA 3EQCA 2X8IA 3MIAA 4QMUA 3LXLA 4RZVA 3NUNA 4TXCA 4ALVA 3IW5A 1DS5A 3DK3A 2BROA 3DK7A 4O1PA 4XRJA 4O6LA 4DA5A 3MV5A 1ZAOA 4YJTA 3ZRLA 2C0IA 3WILA 3R2BA 5IEYA 5A3XA 4M97A 4ACDA 2QCSA 4P7EA 4E3CA 3N4UA 4NJ3A 4IX3A 2Q83A 5E9EA 3HMMA 4IBMA 4NIFB 4O2PA 3PXKA 2IZRA 2WZJA 4Q5HA 2XYNA 4YZCA 3RAKA 4KIKB 5ETAA 5I5ZA 5A6NA 4GUBA 5B2KA 1JBPE 4LL5A 4FTLA 3CY2A 5KE0A 3L9MA 4O0WA 4ZMEA 3U8WA 1OL2A 2XMYA 2J0KA 3CE3A 3FKNA 4K6ZA 4XYFA 4O83A 3LJ0A 3R00A 3PWYA 4WNPA 3RHXA 2HWOA 3KXGA 4IE9A 3ZSGA 4DLJA 2JDVA 5IH6A 4AGCA 5IA5A 3ORXA 3MPMA 1CKPA 3LCDA 3UPZA 5D9HA 4FL2A 4U8ZA 5JQ5A 4XHKB 3LLTA 5G6VA 5A14A 4WUAA 4YJRA 2J0MB 3CQUA 5CEQA 3Q9YA 4GU6A 5AP4A 4RWIA 4F7NA 5JZJA 3RZBA 3EQIA 2J0IA 2UZUE 3JVSA 4GMYA 3DLZA 4DH7A 3PPJA 4RJ3A 4GYIA 4U7ZA 4YTIA 3VVHA 4K77A 1ZZLA 2PZYA 4NM0A 5K0XA 1P4OA 4O7NA 3KRJA 3FUPA 4MX9A 1B38A 3W33A 1YKRA 1CDKA 3FYKX 3EH9A 2CHLA 4P5ZA 2O64A 3E5AA 4O7VA 4IAFA 4KINA 4FKUA 4FV3A 4FTNA 4B8MA 2IG7A 4QTAA 3FI3A 4W9XA 5IQIA 3OCBA 4IMYA 4C02A 5IA0A 1NVQA 3FY2A 2QKRA 3MVLA 3QQUA 4CMUA 3FL4A 5IQDA 4MYGA 3L9LA 2B0QA 2VO3A 2FVDA 4W4XA 5JQ8A 2Y0AA 3EFLA 3ZLSA 4BCOA 3G2FA 4PL5A 4AZEA 3EIDA 4QMXA 5KMIA 3FSFA 2F7ZE 4GYGA 2BHEA 3RM7A 4QP8A 5J1VA 2BKKA 4MVFA 3OVVA 1OVEA 1HCLA 2I0YA 5D7AA 3UO4A 2VWYA 2WQMA 1YXUA 4L7FA 5FM3A 4IAKA 1FMOE 5KUPA 2QLQA 2OU7A 3GI3A 4F65A 1YHVA 4F9YA 4BRXA 3EMGA 3CBLA 5IUHA 4TNBA 2XJ2A 4YZ9A 4HVSA 3OUKA 3Q4UA 4O86A 3GC8A 2XKCA 4IAZA 3GC0A 3KA0A 1HCKA 4MNEA 5JGAA 5BYLA 4K0YA 4XRLA 5DI1A 3O50A 3VS5A 3BPRA 3P23A 5JFXA 4O1OA 5HTIA 4EZ5A 1GY3A 4BKZA 4I23A 5M53A 4RIXA 3ZUTA 4WNOA 5EYKA 3F9NA 2GNHA 2YZLA 4R8QA 3TZ7A 4DFUA 3KKVA 4O7RA 4DTAA 1PY5A 4MXAA 4JNWA 4N0SA 3LMHA 4PTEA 1XWSA 3FXXA 4BR3A 2OKRA 4IX5A 4OTHA 1OKVA 2ZM4A 4FGBA 4OTDA 4QMLA 4BKJA 5HCZA 4H1MA 3NVKI 5IPJA 4PTCA 4FC0A 3VJOA 1W7HA 4BF2A 4CRLA 2C3JA 3JR1A 3VW6A 1FVTA 3G9NA 2WPAA 4PF4A 2WEVA 4ZZNA 2VTHA 3NNWA 2WMSA 2I0HA 4FSQA 2W96B 4L7SA 4AT3A 5L2TA 4YTHA 3G6GA 3B8RA 1UNLA 3GOPA 4JDKA 4XLIA 2YAAA 4YBKA 5A4LA 2BR1A 2JDTA 4C4GA 2XK9A 5LMKA 4LRJA 4F09A 3E8DA 5FXSA 4A9SA 2LGCA 5IQEA 2H96A 3V8WA 3JS2A 4M67A 5CXHA 4EONA 4ZXTA 4FZAB 4FZDB 4XP3A 4F08A 3JPVA 2UW7A 4CKJA 1RDQE 4D2SA 4W9WA 2F2UA 3QCSA 2VGPA 3HECA 1DM2A 1YI6A 3CKXA 1XR1A 3LFAA 3QTWA 4WBOA 4AA4A 3U6HA 4FZ6A 4JAIA 1SMHA 3PRIA 4QMSA 4E8AA 1PXOA 3IOKA 5GJGA 4EOQA 2E2BA 2VRXA 4JIKA 1JSTA 1FGIA 2QO7A 2CLXA 3B2WA 4B4LA 5JRQA 2ITXA 5TT7A 2JKOA 4RPVA 1S9IA 4AGWA 4AW5A 4FOBA 4ERKA 4F0IA 3BCEA 5D12A 3TNIA 5E8TA 2YIXA 3F69A 3VF9A 3UP7A 4BDCA 4AS0A 3W2OA 2FA2A 3FYJX 3R7VA 5T6KA 3R9OA 3WYYA 4DLIA 1OL6A 2YM4A 3CTHA 3NX8A 4AE6A 3UG2A 2OIQA 3Q9ZA 3R6XA 4QP4A 5AR4A 4CMTA 1H1SA 2UW0A 4HYSA 4JG6A 3QCYA 1OB3A 2XNMA 3GQIA 3MY5A 3W10A 3S0OA 4CQEA 2J5FA 3FMNA 1Y91A 3NUXA 1P2AA 2ONLC 4L68A 3DS6A 3NUYA 3SG9A 4JJRA 3UZPA 3AGLA 3FZTA 3A7IA 4JVGA 4YNOA 3RKBA 3F3TA 3PA3A 5CAUA 3FWQA 2IJMA 5DT3A 3D5VA 1TKIA 3OEZA 4IW0A 3ZTXA 1KV2A 4ZMFA 3F66A 2YCQA 4OTQA 4P90A 5I9ZA 4X6QC 4F7SA 2C6IA 2PZ5A 3ALOA 2JAMA 4BCJA 2JKQA 3FLQA 4MD7E 5FWKK 4G3GA 5LWMA 5HIEA 2YJRA 3T9IA 4G1WA 5JRSA 4NZWB 4E4NA 3EQPA 4PTGA 1VZOA 3FMEA 3O17A 5ETCA 1WAKA 3ELJA 3VS3A 4H05A 1OL5A 4X2JA 3FMMA 4CYJA 4WG4A 3CKWA 2HYYA 3FPMA 3R7OA 1H24A 3SD0A 3MI9A 4UBAA 4JXFA 1GZOA 2W17A 2QOQA 3R7UA 4RFMA 4M69B 4H36A 4JG8A 4FTMA 4MBJA 4F0FA 4RJ5A 3PZEA 5AV3A 5JGDA 2ZAZA 3THBA 3OCGA 5CAVA 1W83A 2X2MA 2WMVA 3A7FA 3PY3A 5DR6A 4F7JA 1IR3A 4O7YA 3GP0A 3MY0A 5LMAA 2X39A 2WTDA 2HAKA 2R3RA 3G6HA 3HMNA 4QP1A 4FGRA 3CS9A 3D94A 3PVWA 5EM8A 2CGWA 4RVKA 5TO8A 1KE6A 3FQHA 4GL9A 4RFZA 1BUHA 3DTCA 4A4LA 1H8FA 4EOOA 4ZZOA 5J9LA 2IW6A 4CT1A 3ZO3A 3BELA 4IZAA 3O8TA 4O22A 3A8XA 4CD0A 4XG2A 4EBVA 4E7WA 3T3VA 4HCTA 2ETRA 3ZO1A 2G2HA 2O65A 2UV2A 3EQBA 1YDTE 3HLLA 1CKJA 4ANSA 3MH0A 2WOUA 3BE9A 5FLFA 5EH0A 4DF3A 4PDSA 3NVMB 4WO5A 3ZZWA 2XNPA 2YIQA 3MH3A 3UYSA 4CXAA 2YWPA 3DFAA 3F5PA 5L3AA 4LUEA 3ZH8A 4I0SA 3RP9A 4BWXA 4GK3A 3ORKA 3ZFYA 4QMQA 4QYGA 5F95A 1JSVA 3DJ5A 4P4CA 5DRDA 3W2QA 5CTPA 3W8QA 4AW1A 2X9EA 4I4FA 5L4QA 3BU6A 4YZBA 4OT5A 1UVRA 2HWPA 1YOLA 3ATSA 3PE2A 4RIWB 1K2PA 4AGDA 3S3IA 3SC1A 2P3GX 5AM7A 2VTAA 3BE2A 3MTLA 4GEOA 4FTTA 3RK7A 5CU4A 4OT6A 1Q24A 4EH8A 5AFVA 3KCFA 2VTLA 1OKZA 3JXWA 3DCVA 3DY7A 4JBOA 4EC9A 2QODA 2RG6A 4DG0E 1JOWB 5A4EA 4KS7A 4YHFA 5DT0A 3A7GA 4YGAA 2XIXA 4E6AA 4PX6A 4BI2A 4Q9ZA 4WSYA 2JBPA 2WMXA 4DEHA 1SM2A 4TNDA 2C6EA 2YJSA 3QRKA 1WBNA 2OZOA 3R22A 4JQEA 4WRSA 5DIAA 5DMZA 4FIGA 3NUPA 4IJ9A 5IU2A 4PUZA 2WMBA 4PMTA 2AC5A 2YEXA 4J8MA 1UU7A 3ZRKA 4S34A 2YCRA 4D4VA 4NL0A 3BHUA 2YERA 3ROYA 4QQTA 5JMSA 4F1OA 4WSQA 2VTQA 4QP2A 3S1HA 4BDAA 4PQNA 3UZRA 2YDIA 1JKKA 4FYNA 4D2TA 3D5UA 3NUSA 4HJOA 4ZTSA 4XNEA 4FKRA 4J1RA 4MXZA 5CU3A 4ANNA 2BUJA 5HG5A 4ZEGA 4C4FA 3TJCA 4WNMA 2PVKA 2XNNA 3LXPA 3ZMMA 3BGQA 5BQ0A 3KU2A 3ORZA 3NNVA 4GFMA 2X1NA 1UKHA 2R0UA 2R4BA 3DKCA 3HRCA 3IW7A 4KWPA 3OOMA 2VUWA 1H00A 2VAGA 4YC3A 3P79A 5CAPA 3VUTA 3QKMA 2VTSA 4BZOA 4YO6A 2R3KA 4BCQA 3MWUA 4XV9A 5KHXA 1SVHA 4NTSA 3R7IA 5HTBA 4ZTLA 3CR0A 1QCFA 1IAHA 4RG0A 4PWNA 4O7SA 4U81A 5TF9A 1YOJA 1V1KA 4NWMA 4X2GA 3ZLXA 5IZFA 2O63A 1BYGA 2R3HA 3FQEA 3TL8A 3LFSA 3FMJA 5DN3A 5CSHA 4TZRA 3LFDA 2VTNA 3T3UA 3W18A 4RQVA 2YWVA 3G15A 4FV8A 1Z9XA 4EH5A 1G5SA 4W8EA 4DHFA 1K9AA 2OFVA 3PIYA 4BCHA 4YPSA 4C59A 2V22A 3NNUA 4MD8E 3W2SA 2OLCA 4H39A 4D4RA 4D2VA 1Z57A 2ERKA 5E92A 4EH6A 4R3PA 3VUDA 3SW4A 2OW3A 5AJQA 1M14A 3QZHA 4DG3E 3TV6A 4FT3A 3HDNA 1H27A 3IS5A 4IVCA 4CG8A 3GFEA 3HVCA 3KB7A 4CLJA 1O6LA 1J7LA 3LKMA 4O7WA 2WTIA 3ZO4A 3SRVA 3C0HA 4IEBA 5FG8A 4NFNA 5CVGA 2W1CA 4QTEA 5KO1A 4EK5A 4AZFA 4LV5A 4U9AA 1QPJA 4LOQA 3FLNC 3DBEA 4DC2A 5FDPA 1ZXEA 1IAJA 4I6HA 4U0IA 4OAVB 3AD6A 5HBEA 4FNZA 1FINA 1IA8A 1PYEA 5KBRA 4CSVA 1KE9A 2FSTX 3ZYAA 3WI6A 3KMMA 1XQZA 3HMIA 3ZSIA 3KQ7A 3Q6WA 5HCYA 5JZNA 2IWIA 4YNEA 4ZLYA 2UW8A 1UU3A 2R3PA 1YDRE 3E3BX 2WMAA 4C61A 5IUGA 4TYGA 5EW8A 4Y5HA 1PHKA 3V6RA 2CGXA 3KXHA 4UYNA 4RC4A 4A9YA 3TV4A 2P2IA 4BDIA 3GC7A 4AZVA 3ZBXA 2BZKB 2HOGA 1U4DA 1T46A 5A9UA 1AQ1A 5FTGA 3EJ1A 4K8AA 5I9XA 5J1WA 4D4YA 1U46A 2FYSA 5CANA 1CSNA 2GFSA 4IWPA 3EQRA 3MFUA 1R1WA 3PFQA 4MHAA 3I7CA 3UQCA 4MXOA 2C3IB 3E64A 3ET7A 5J5SA 2XKFA 1R39A 4KIQA 3G5DA 3PZHA 4RJ7A 5EKNA 3OMVA 5J5TA 3TUCA 5CT7A 4I94A 3PLSA 2V5QA 3QGWA 3LIJA 4I22A 4X3FA 5AUXA 3ZDIA 3TDVA 5FP5A 5AUTA 5CEMA 3SOCA 5H9BA 4IIRA 5DT4A 4YUQA 4RIYB 4F7LA 4YJSA 3RGFA 4IVBA 2DUVA 2ETKA 2OJIA 4IQ6A 3FC1X 2EUFB 4QNYA 2XNBA 2BRGA 3UO6A 2I0EA 1UWHA 3I4BA 4PMSA 5TOZA 3QXOA 4QQCA 3TI1A 2QD9A 3SX9A 4ZSEA 4JQ7A 1M2RA 3DJ7A 3NCGA 5B2LA 1U54B 1ND4A 4MF1A 3HX4A 5H8BA 3HUCA 3FMLA 3W32A 4QP6A 5AV4A 2V7AA 3OXZA 4IAAA 3UTOA 4JDHA 3RCDA 5ETIA 2VO0A 4MKCA 1PXJA 2WELA 4BI0A 2X7FA 4EH2A 4XP0A 3UYTA 3EFJA 4ZY6A 2YM5A 3R1SA 1PXLA 5TKDA 4RFYA 3WF5A 1OPJA 5BVWA 3VBQA 2JKMA 3R9RA 4GVAA 1YI3A 4R7BA 2BFXA 4S2ZA 3OWLA 1DI8A 4FK6A 1PXMA 4HNIA 3RMFA 3OD6X 3AC1A 5G1XA 2XIRA 1JKSA 3K3JA 2ZV2A 4YJPA 3BRBA 1XH8A 5M09A 3ZBFA 1ZMUA 4IB1A 3SDJA 3FKLA 4QQJA 1W82A 3QQLA 5KCVA 5D10A 3LM0A 3UIMA 1ZYCA 4HYUA 4L01A 4C4IA 3PVBA 4K11A 5DYJA 4PRJA 2WMUA 3E63A 4FTIA 1OUYA 3QRIA 4F4PA 1Q4LA 5IDPA 2GS6A 4MH7A 3HA8A 5EM5A 1NT2A 3IW8A 3D5WA 4H3QA 3BI6A 2NRYA 3TKHA 2WKMA 2WTWA 3JY9A 3WIGA 4BI1A 2CN8A 1XBCA 2R7IA 5AA8A 2XRWA 5BMMA 2JGZA 2C1BA 4DG2E 3ENMA 1U59A 2RSVA 4AWIA 1H1PA 2C6TA 4IZYA 4KABA 4AE9A 4DGGA 3UNJA 2PU8A 4FIIA 5CNNA 3WE4A 4E6CA 4CRSA 2X8EA 1J91A 3D0EA 3CD8A 4L3LA 3UVPA 4S33A 3C4CA 4O81A 3AC8A 4KKHA 1H08A 3E3PA 2DS1A 3G51A 3QHWA 4PPCA 4BN1A 3SW7A 3REPA 3ZDUA 3KULA 5L2QA 4ANMA 4NM7A 1JWHA 3LFNA 2PZRA 1H25A 4IACA 3SVVA 5BNJA 5L6PA 3ZM9A 3KFAA 1M2PA 4OTGA 3F5GA 4S31A 2VX1A 3E62A 3MFTA 3PYYA 4DE4A 3ANQA 4KNBA 1XKKA 2GPHA 1Q3DA 4XG4A 4ALWA 5CXZA 5LVOA 2G15A 3C7QA 3GCSA 1QL6A 5IDNA 4G3CA 4DFBA 1M52A 4EQCA 1MUOA 4TYHA 3V5TA 4MTAA 1SVGA 4I3ZA 1ZZ2A 3QBNA 3E8EA 2WU7A 3UIXA 4OBPA 2CNQA 2UW6A 1ZOHA 3QTSA 4QMNA 5CSVA 5E4HA 4ZAUA 4ITHA 3OP5A 4EL9A 2PL0A 3ZO2A 4ACMA 1E9HA 3ZUUA 4WBBB 3WZKA 5HQ0A 5I9VA 3IGOA 3PXQA 2IVVA 4FKVA 3FC2A 4XP2A 4A4OA 5HG9A 4BGHA 3VS1A 4D2PA 4Q9SA 4TYJA 1NXKA 2GNFA 3CTJA 2YIWA 5TE0A 1MQBA 2G2FA 4FSYA 3ZSHA 4EH3A 2A4LA 3S00A 2PVRA 3A4PA 3EL7A 2V55A 3MIYA 4JI9A 3WF6A 3LOKA 2RFNA 2XIZA 5KMMA 2PE2A 2XRUA 3NIZA 4XOZA 2QR7A 3WZEA 4DEBA 3NZ0A 4RX9A 3NLBA 5HX6A 3WBLA 1MRYA 4RT7A 1J1BA 4XH6A 1Q99A 4J52A 2Z60A 3LFQA 5DVRA 3NYNA 3VUHA 4LYNA 3I79A 4EORA 3O8PA 2WHBA 3RZFA 5M55A 4WKQA 2W9FB 5HTCA 1GJOA 2QI8A 4I6QA 5M56A 3V3VA 3EQDA 3RAWA 3UNKA 3RWPA 4QPAA 4KAOA 1G3NA 4CNHA 5FQDC 2J0JA 2NO3A 3U4WA 5ANDA 1IA9A 2BAJA 5IH5A 3BX5A 3I0QA 1R0PA 3W8LA 5CSPA 3QTIA 5J7HA 2I6LA 3Q96A 3QD4A 1P5EA 3HP2A 4TYEA 4FT5A 4B0GA 3G0EA 4GV1A 2CCHA 5CLPA 5BVEA 3VRYA 4O91A 4QYEA 2H34A 4GSBA 4G9CA 5FBOA 4D0XA 3P0MA 1PRYA 1FPUA 2GFCA 3R8VA 3RINA 3OG7A 3TUBA 4BB4A 4JBQA 3NYVA 4MK0A 4JLCA 2R3MA 4HYHA 3PVUA 2BFYA 3KK9A 1FOTA 3ZXTA 3DV3A 4PL4A 3SXSA 4X7QA 5FD2A 3VBYA 4DGMA 2BMCA 3PXZA 4GJ2A 3C5IA 3COMA 2HXLA 4A9TA 4CFFA 1WBSA 1H0WA 4K18A 4DFNA 3MVHA 5BYYA 2R3FA 2UW5A 3I6WA 3KXZA 5HO6A 1PF8A 5ACBC 3VBXA 4CT2A 4HVIA 2XF0A 2ITQA 2VTOA 5DLSA 5CF5A 3BWFA 2EXCX 3T8OA 2VWWA 3A4OX 1CMKE 3KF4A 2C3KA 1UU8A 2UZVA 4RWKA 4U6RA 4YP8A 3SGCA 2XEZA 4ZSGA 2W5AA 4G17A 3Q9XA 5JSMA 5AAEA 3C4FA 3MY1A 3PSBA 4D58A 2A27A 5C4KA 3OW4A 4OTIA 4FTJA 4AUAA 3FHRA 5GIPE 2VV9A 1XJDA 4FIEA 3LCTA 3UC3A 3TUDA 2WXVA 3CY3A 3KN6A 2QG5A 1VYZA 4M12A 2XNGA 2YFXA 2R5TA 3CPBA 3GXLA 3UIBA 4FTKA 3D83A 4FUYA 4ITIA 2ZB0A 3DZQA 3NSZA 3R28A 4FT9A 1KV1A 4ZIMA 2PWLA 4CLIA 4WNKA 1Q61A 5H8GA 3W16A 3MPAA 3O2MA 2UZOA 3PRFA 3LW0A 2YM6A 2RIOA 4JRVA 4QTCA 5JFVA 4CMOA 1UNGA 1W8CA 2QC6A 5CI7A 4Z3VA 5CF6A 5CEOA 4FOCA 4XG8A 4Y46A 4F1TA 2YITA 3NAYA 2B1PA 4X21A 3KK8A 5HKMA 5C26A 5CYIA 3Q4ZA 4NKSA 4UYAA 3QQJA 2JIUA 5CWZA 5EG3A 4BDHA 4H3BA 5HBJA 1SYKA 4DGNA 3AQVA 3R1YA 5FM2A 4EOMA 5HG8A 4QP9A 3OF0A 3H0ZA 4QMMA 2WIHA 4FR4A 4EK4A 2GHLA 5FEDA 4YTFA 2QO9A 3C0IA 2OH4A 4ORKA 1QPDA 4OAUC 1IRKA 1B39A 4HPUE 5AP3A 5HICA 3TNHA 2R3OA 1XHAA 4YC8A 2NP8A 4A07A 3VAPA 3VC4A 4BICA 2IZTA 3O0GA 2XBAA 3DAKA 2R3NA 1TVOA 3QC9A 5HNGA 2QG7A 2WOTA 4CFVA 1F3MC 4FK3A 4YC6A 3H0YA 4Y83A 5I9WA 4CKRA 4BTMA 2VX3A 3DJ6A 4DCEA 4AT4A 4DT9A 2C69A 4XLVA 3EN4A 1ZRZA 3DNDA 5DRBA 3DXNA 1F0QA 1W98A 2B52A 2J50A 2Z7QA 4NFMA 4Y95A 3BV2A 4H58A 2REIA 3U6IA 1V0PA 2JAVA 5BUEA 3VS4A 4IM0A 2RF9A 2VZ6A 3CXWA 3E8CA 4J96A 1Y6BA 3FPQA 4NCTC 3N4VA 4ANOA 3ANRA 3D5XA 4R7HA 2X8DA 3FHIA 4FKGA 4J98A 4F9AA 5IEVA 3LLAA 3TZMA 4QTDA 2DYLA 3I5NA 5H2UA 4Z9LA 3PY1A 3WYXA 2ESMA 3UVRA 4D2WA 3ZC6A 4ENYA 1WVWA 4D2RA 5E1SA 2PMIA 3B2TA 4EWHA 2EU9A 3H4JA 2OI4X 3FBVA 4DFXE 4CFXA 2QO2A 2V7OA 4YHTA 2XH5A 3R21A 3IDCA 2YACA 4KUJA 4G6OA 5EI8A 1ZY5A 3BU5A 5ANJA 4AACA 4EOJA 3CLYA 1YWVA 2C6KA 5DGZA 4ZSLA 3FMHA 4I5PA 3TM0A 2FSOX 1V0BA 3RBWA 3ZC5A 4EOSA 4EUUA 2XCHA 5GNKA 4XG3A 1H1RA 4ZLOA 3AC2A 1H1QA 2ZMCA 5KMNA 4FV0A 4AA0A 4G5JA 2G9XA 5HE3A 4OGRA 3R83A 3EQFA 3PP1A 4APCA 4L45A 4AN3A 1K3AA 3P08A 5C1QB 2R2PA 3G33A 3MVJA 1WBVA 4FG8A 5HHWA 3LQ5A 3WF7A 5DH3A 4F6WA 4BDKA 5EOBA 4EYJA 4JOAA 5AR5A 2JLDA 1LR4A 2Z7SA 5CVHA 2JDSA 4BGGA 3NCZA 1PXKA 4ZLZA 3GGFA 4KRDA 4FEWA 3NWWA 4U40A 3OUNB 1YI4A 4R6VA 4G2FA 2PUUA 1OBGA 1WVXA 3IO7A 4MCVA 3TZ8A 3LE6A 4IVAA 1YHSA 5GINE 5F1ZA 4ASDA 4AU8A 4XX9A 2AC3A 3P86A 4O38A 5ANIA 5CAOA 5AUUA 2Y6OA 4GVJA 1PMNA 1GNGA 3EKKA 4TWOA 5T68A 5AP6A 4YLJA 2PVFA 3Q53A 4FF8A 4YR8A 4I0RA 4MQ1A 3GFWA 2XK7A 3VW8A 4V04A 1GOLA 4EZ7A 4C33A 4XCUA 2B9IA 5J87A 3CJGA 1REKA 4JS8A 4L6QA 3RJCA 2IPXA 3VHEA 1WZYA 4C35A 4D4SA 4O7LA 3MBLA 5AUWA 1A9UA 5JEBA 3Q6UA 3SOAA 4PP7A 4FTCA 5BVOA 2CKOA 4NEUA 5HOAA 1FVVA 3POOA 3WZJA 3M42A 1YRPA 1PKDA 3EQGA 2X9FA 4EK8A 5A4TA 3QUEA 5B7VA 4DEGA 1BMKA 3BLQA 3LXNA 3TCPA 3W55A 1UU9A 3ZEPA 2ZMDA 3A60A 3UE4A 3VF8A 3ORLA 2NPQA 4XS2A
chains in the Genus database with same CATH superfamily
3RPRA 4F6UA 1J7IA 3PVGA 1OI9A 4TT7A 5K3YA 5EHYA 3CJFA 2IVTA 3POZA 4FNWA 1OIQA 4FV6A 5CENA 3MS9A 2PVHA 3B8QA 4DHZA 4MF0A 5L6OA 2G1TA 3FXWA 4F1MA 5E8SA 4ASEA 3GVUA 4O84A 2OIDA 2RFSA 4JDJA 4QMTA 2W4JA 5LJJA 2Y4IB 3P5KA 4DH3A 2C4GA 2ZVAA 3Q3BA 4J7BA 2LAVA 4QMVA 4DGOA 4E6DA 3SXRA 4EHEA 2PMOX 3D7TA 4UXQA 4IDTA 1YXTA 3CGOA 4U79A 5AMNA 3UPXA 3P7BA 4C4JA 4C58A 5CEIA 4M66A 2ZFYA 1O6YA 5ICPA 3NRMA 5AR3A 3U9NA 4AFEA 3Q5ZA 2G01A 4O0YA 3BV3A 5HEZA 4C36A 4B9DA 4TPTA 1AGWA 4FV9A 4Y8DA 2B9HA 3OS3A 5BPYA 3UC4A 5L2WA 3EQHA 4DN5A 5CU2A 2ITNA 4YJNA 3NMUF 3FKOA 3ITZA 5A54A 1E1VA 2AYPA 1A48A 3SV0A 5FP6A 2X4ZA 4YTCA 3EOCA 1P4FA 5DNRA 4V05A 2UZTA 4IB5A 2VWIA 4QO9A 4IHPA 1VYWA 3IK3A 3JVRA 3R7YA 3VHKA 3FJQE 4R3CA 4L00A 2BDWA 3HAVA 2Y4PA 4BWPA 1YWNA 4MNEB 3E93A 2GNIA 3FSKA 2QHNA 3MA6A 2X7GA 3R8LA 3RAHA 1OPLA 4BVUA 4LMNA 4Q5EA 3PE1A 5AV1A 3F3UA 3UDBA 1BI8A 1UWJA 3HV6A 3MDYA 4RIXB 2IW9A 2HY0A 3FY0A 3QAME 3VUMA 4XG6A 4E26A 4IZ7A 4FKTA 4QDVA 4OBOA 3AMBA 2XK3A 5KKRB 4LG4A 2V0DA 3P7CA 4DH1A 2EXMA 3FLYA 3VJNA 3AOXA 2GHGA 3ORTA 4XJ0A 4BYIA 3JUHA 4FMQA 3LM5A 2WMQA 4L3PA 5HNBA 4AAYA 1OPKA 2YLEA 4C8BA 3W0OA 3OXIA 3MVMA 2GHMA 1Y8YA 4FV2A 4NK9A 5IMEA 3F3VA 5JGBA 4IM2A 3FI8A 4DFZE 2JBOA 5KMKA 2XK4A 2WTCA 3OCSA 4FIFA 4AW2A 3C50A 4ZY4A 2W7XA 4UB7A 5KX8A 2R9SA 4W4YA 5EQPA 3PJCA 3COHA 1M17A 3C9WA 4YO4A 1Q62A 2NYAA 2X7OA 3FI4A 2GDOA 4V01A 2CKPA 4QMYA 4BCFA 2WQEA 4WG3A 4EQUA 2HCKA 2X0OA 4RVTA 2X2KA 4UWBA 2EVAA 2X6DA 1YXSA 1I09A 4AOJA 3PXYA 2CPKE 4LMUA 3ZU7A 4ZOGA 2AUHA 1ZY4A 4B6LA 2P4IA 3A99A 5E8ZA 3QA8A 3R02A 4EK6A 3IECA 3OBGA 1WBOA 4N4SA 2WU6A 5AP7A 4NUSA 2UW4A 3C4XA 3BYMA 4PPAA 4FKPA 4GT5A 2IW8A 5JN2A 2W1GA 4O2ZA 2GNGA 4ASXA 4L67A 4AA5A 4DFLA 4NM5A 4PMMA 4AAAA 3MFRA 5IF1A 4H1JA 4KD1A 2JDOA 2Y4IC 1MQ4A 3R63A 3I6UA 2H6DA 3RPYA 2PVJA 4BTKA 1XBBA 5CQWA 3V51A 3AT3A 2C6DA 3PXRA 2J0LA 5GIOE 4USDA 5JT2A 1OMWA 5DPVA 3R9HA 4ZTMA 1LUFA 3RAIA 2R3LA 3KXMA 3HV5A 3V6SA 3LJ2A 2YIYA 4NM3A 5M4IA 1JQHA 2W4OA 3FMDA 1H0VA 3SXFA 2PE0A 4AN2A 1UA2A 4NTTA 4L53A 5AV0A 2HENA 4EJ7A 5HORA 5CT0A 2ACXA 2XZSA 4WUNA 4R7IA 3WF9A 1OGYA 2F49A 5C01A 4KKEA 2OFUA 3FZOA 3COIA 3D4QA 5EI6A 2E9NA 4R5SA 4RC3A 2AQXA 4AXFA 2ZV8A 3ORMA 2H8HA 2OXYA 2YABA 3VQHA 4CVAA 3LCKA 3QRTA 3HYHA 1U5QA 4FL1A 2X6EA 1FMKA 4GFOA 3RNIA 3ZCLA 1XH7A 2YCFA 1PJKA 3LCOA 5FGKA 4E73A 4FTRA 3PLAE 3P4KA 3HEGA 5KMOA 3H9OA 4B99A 3U4UA 5LMBA 2IO6A 4Y85A 4RZWA 5L8LA 3EL8A 3D9VA 3KL8A 3KRLA 4AGUA 1IEPA 3HKOA 2QLUA 4FG7A 4F64A 5KMLA 3N4TA 3QRUA 2WO6A 1RQQA 4X6RA 2XJ0A 4E6QA 4FNXA 4EC8A 4O82A 5HIBA 2ITZA 1ZYDA 3QQHA 4FSUA 3K54A 5E91A 4EK3A 3HV3A 3PTGA 4PNIA 3LPBA 5KKRC 4G6NA 3GU5A 5E8WA 2QOFA 4EUTA 3C4WA 3FZPA 4Z7GA 1RW8A 4BIEA 4FZ7A 4HVHA 1PMEA 3V5LA 4LM5A 2O3PA 2FH9A 4WA9A 4O4EA 3UQGA 2JFLA 5EYMA 3UZTA 4GH2A 3KXNA 3QQKA 3QRJA 1STCE 4LI5A 4JR3A 1FGKA 3W1FA 4YU2A 4YBJA 3A8WA 4D5KA 2CNUA 4DCAA 4HNFA 4M3QA 3KN5A 5HLWA 3U55A 4CEGA 4PDOA 1OECA 3QALE 4QMWA 5DHJA 3TNPC 5CVFA 3BQCA 4QPMA 5LMKC 2EWAA 4OUCA 3UDZA 4R5YA 1YHWA 4ZTNA 4D55A 4D0WA 1XO2B 4O0SA 3UP2A 2XNEA 3CEKA 2VD5A 3M11A 4EOLA 3RK5A 3H9FA 4U45A 3R73A 2VTTA 3AGMA 3OOGA 5IMXA 5FBNC 4F0GA 5IA2A 3PJ1A 2YDKA 2ITYA 4R3RA 4V0GA 5EW9A 4NCTA 3WIKA 4M68A 4MQ2A 3EN7A 4BCNA 3E92A 4C4HA 5CF4A 1H26A 3SG8A 3MYGA 1ATPE 1URCA 3EFKA 4U44A 4XV2A 4GK4A 5AP1A 4GCJA 4L44A 3PXFA 1WVYA 4N70A 2WMWA 3BHVA 3K2LA 4EH4A 4ARKA 2GNLA 4E5BA 3NAXA 4YZDA 4UV0A 1JPAA 4PY1A 5C4LA 2O5KA 2YM8A 3ZZEA 4IFGA 2A1AB 4YSJA 1CM8A 4IAYA 1WMKA 3QZFA 3VNTA 4NIFA 2SRCA 5CI6A 4LGGA 3VIDA 3FE3A 1J3HA 4YSMA 4ZZMA 3TZ9A 5M4UA 2OJGA 5DWRA 4O0VA 3FEGA 1PKGA 4KIKA 4YLLA 4YMJA 3BYVA 5HE2A 4BTFA 2WQBA 5CEPA 4AZTA 3ZXZA 2CLQA 2GCDA 2O2UA 2X0GA 5GJDA 5IQAA 2OG8A 2CKEA 4YHJA 2W1IA 3LZBA 4I1ZA 3FI2A 4LV8A 4XEYA 1YXXA 4CZTA 5EDRA 5M51A 1G8AA 1JSUA 2XIKA 4NH1A 3UMXA 4F63A 2VWUA 3UOJA 1OIRA 2W5BA 2PYWA 3NEWA 1H1WA 4LQMA 2BDJA 2RFDA 4FSWA 5I9YA 5KNJA 4ITJA 1S9JA 4D1SA 3BLHA 2WNTA 3ZLWA 1ZYJA 2PVNA 4W4WA 3CQEA 3DB6A 3ETAA 3QUPA 4E4LA 3DXQA 3ML1A 1JAMA 2C5OA 1YVJA 4A7CA 1KUTA 4GJ3A 1REJA 3ORNA 4U41A 3SQQA 3ROCA 3RPOA 2BTRA 2HW6A 3H9RA 2OZAB 1WBWA 3IONA 3PA5A 3F5XA 4I93A 4NSTA 5B0XA 3EZVA 2FGIA 5IG1A 3QGYA 3R1NA 3F2AA 3ZRMA 2OGVA 5CEKA 2VWBA 5KBQA 2XKDA 1VLRA 1JLUE 3I0OA 3RPVA 3NYOA 4C7TA 2R3JA 3BLRA 3O96A 3OTUA 2ONLA 3MJ1A 4M8TA 3A61A 3TWJA 5C8KA 3EYGA 3TJDA 4A4XA 3IG7A 3QL8A 2P0CA 4D1XA 5L8KA 2F2CB 1BL6A 2PY3A 2R3QA 2XNOA 2ZV9A 3EN5A 3GOKA 4KBAA 4TN6A 4CKIA 4IC8A 5LVLA 4ZJVA 3KMUA 5HVJA 4DT8A 3QYZA 4KBKA 2E9OA 2JFMA 3EFWA 3PUPA 4BDDA 3DXPA 5AA9A 3DBDA 4ERWA 4OLIA 4LOOA 1FBNA 4WHZA 1OM1A 4C3RA 4RWLA 1APME 2BILB 2BDFA 5D7VA 3FZSA 4F6SA 3AT4A 2EB3A 3PJ3A 4JX7A 3ZHPC 3BHHA 3RWQA 2BIKB 4EI4A 5IUIA 2J90A 4FKSA 4O0RA 1KOAA 2CMWA 2BIYA 3FL5A 5HU3A 1XH4A 4CZYB 2GNJA 4EBWA 3QX2A 3SRVB 4ENXA 5CQUA 5DE2A 5F9EA 3EHAA 4UWCA 2XEYA 2XB7A 2J2IB 2WEIA 3ACJA 4RX8A 3FDNA 4XG9A 3Q04A 4AOTA 4IJPA 4U97A 4JBVA 4IZ5A 1H28A 1SZMA 4IWDA 3EN9A 3LAUA 3PG1A 3HV4A 4YLKA 3WE8A 1OKWA 2B9JA 2WTVA 4I0TA 3K3IA 4FV7A 4GG7A 4FUXA 3LQ8A 3HMPA 3KMWA 2NNWB 4PMPA 1NA7A 3DDQA 3I7BA 4KKGA 4XG7A 3HV7A 5EM7A 2YLFA 4RVMA 4PP9A 3IOPA 4FI1A 1TQIA 5L8JA 3ORPA 3ORIA 5M57A 4JBPA 2R7BA 4ID7A 1LPUA 4LOPA 3R8ZA 3O23A 5FRIA 4EOIA 5JFSA 4IADA 4Y73A 3HDMA 2UZEA 5AP0A 2WMRA 5AR2A 4O0UA 5EFQA 2PMLX 3TIYA 2WMTA 4FT0A 4BBEA 1NY3A 3SLSA 4CZUA 2XAOA 2R3GA 3ZLYA 5J7BA 2GQSA 2W9ZB 4QOXA 4O27B 2YM7A 3VN9A 4ACCA 2E9VA 4J71A 3MA3A 3TTJA 2J6MA 4M15A 2RKUA 3HA6A 3QTZA 4QEBA 3P7AA 3EYHA 3SHEA 2B55A 4FNYA 2EB2A 2JITA 4JX3A 3QWJA 3GUBA 2XK8A 1I44A 5HVKA 1F5QA 1XH5A 3LVPA 3OXTA 1OGUA 4RA4A 2J4ZA 3W2RA 1UV5A 1OL1A 3DLSA 4ANQA 4I6LA 1P14A 2ZYBA 3LFCA 4CCUA 5B2MA 3QHRA 4X3FB 3WF8A 5LWNA 1PW2A 1NVRA 1PMUA 2VX0A 4RLLA 4UMQA 4YZMA 1OKYA 4NYEA 5BVDA 2BRMA 4IANA 3R8PA 4N6ZA 4C38A 3DAJA 4FKWA 5E8XA 3FZRA 3HP5A 2XBJA 3L1SA 3QKLA 4OR5A 5JKGA 4IX4A 3R30A 1J7UA 3V01A 3C0GA 2J5EA 4YJUA 2Z02A 4EKKA 5HU9A 2JIIA 5AUVA 4AG8A 1T45A 3QZGA 1YOMA 3KVXA 5EDPA 5H8EA 3TV7A 5EOLA 1A06A 5AR7A 2A2AA 3FQSA 5CSXA 2F7XE 3AD5A 4DITA 3S95A 2XK6A 5BMSA 5HX8A 1ZLTA 3TNQB 4GU9A 2J51A 5J95A 3M1SA 3BGPA 4EZ3A 2AEGA 1GZNA 2VNYA 3P5JC 4AXAA 2QURA 4IXPA 4MWIA 4GW8A 2UZWE 3OY3A 2VO6A 4ASZA 4IH8A 4FIJA 2PMNX 1FQ1B 1UKIA 4FV1A 4QYFA 3L9NA 3SKCA 4RX7A 4USEA 3H3CA 3UOKA 2JD5A 4BCKA 5JK3A 5DR2A 3UOHA 5J9ZA 4UZHA 1Y8GA 5IA1A 3Q4CA 4DBXA 3AKJA 2GS2A 5AR8A 4EQMA 3AC4A 4ZJIA 4AQCA 3R01A 3GQLA 3H10A 3OWKA 3MH1A 1BI7A 4IFCA 4K2RA 3TACA 4BL1A 4D5HA 4EHGA 1OBDA 3VWAA 4UN0C 3E8NA 5BUJA 3L9PA 1OIYA 2QKWB 5A6OA 3W0SA 4IVDA 4QYYA 4CV8A 1Q97A 2UVYA 2W1EA 3QUDA 2P55A 2UUEA 2X81A 5HCXA 4NKAA 2VWVA 3NS9A 2KTYA 4ANLA 3PSCA 4FKJA 2XUUA 3ZEWA 1QPCA 3HNGA 3AD4A 2BAKA 4BIDA 3OT3A 1GZKA 4MAOA 2X2LA 5ETFA 4IWQA 3PP0A 4YJVA 4UXLA 4USFA 3SAYA 5DEWA 4Q2AA 2UZDA 4M69A 4X2FA 2GS7A 2EXEA 3DA6A 4FEXA 1Y6AA 2YISA 3F7WA 3MB7A 1PXPA 2XCKA 1L3RE 1M2QA 4OW8A 2IF8A 5CY3A 3UGCA 2XYUA 4FVQA 4ZP5A 5ANGA 5M4CA 3DGKA 4FV5A 5H3QA 4M7IA 3ATTA 2C5YA 2OF2A 3BGZA 1Y57A 3RCJA 5HESA 3RTPA 2QOIA 1DI9A 3L8SA 3OFMA 3O71A 4FYOA 3KULB 4UX9A 3O8UA 2BRBA 2OXXA 5GZ8A 2HZNA 3OT8A 2WQNA 4E1ZA 5CU0A 2QOKA 5AX3A 1JVPP 1GZ8A 4AQKA 3M2WA 4ZK5A 2OH0E 2A0CX 4L46A 4DDIA 3P78A 3RNYA 3D15A 4QP7A 3GENA 4EH9A 3E87A 4C2WA 3AMAA 5GZAA 4OTWA 5LCJA 2RFEA 4MXXA 2F7EE 4IB0A 3BZ3A 5HO8A 5IH4A 2V62A 2WTKB 5EKOA 4ZS4A 5I0BA 3P9JA 3N9XA 3NUUA 4QYHA 5DBXA 2GU8A 3GU6A 4TYHB 5HVYA 4C62A 4FVRA 4C2VA 5DFPA 3NW6A 5CZIA 3GU7A 4B7TA 3DTWA 4C0TA 3A7HA 4X3FC 2B4SB 2JKKA 1O9UA 3JY0A 3MESA 4QT1A 3T9TA 4DBNA 2VTJA 2E9UA 4KS8A 2HW7A 3VQUA 4D9UA 5AV2A 3R7EA 2OSCA 4NW6A 5BVFA 3MN3A 5LQFA 3V8TA 2W99B 4RIWA 5E90A 4QMPA 3OHTA 5KZIA 3A2CA 2CGUA 3D7ZA 1KOBA 3QLGA 4HGTA 5FEQA 3ENHA 3VRZA 3OTVA 3VO3A 1RE8A 3ULZA 5EDQA 4AXDA 3CPCA 3F6XA 2W05A 2BZHB 4FZFB 2FUMA 1TQMA 4ACHA 5M07A 2J7TA 2OF4A 2VTIA 4HVDA 4F70A 2PUPA 5AP5A 3BHYA 5F20A 4TYIA 2JDRA 2X4FA 4QP3A 3TIZA 4O0TA 4G6LA 2ITUA 3HUBA 4GT3A 2C0OA 3F7ZA 3KRRA 4ZTHA 5HLNA 4FSRA 5HIDA 4N6YA 2HXQA 5J8IA 3QXPA 4C37A 3II5A 3UBDA 3LCSA 5K4JA 1Q41A 3FAAA 4JRNA 2B7AA 4OBQA 2QOBA 5AADA 1YQJA 1LEZA 2BZIB 2C5XA 4X0MA 4LGHA 5EW3A 4JG7A 3NIEA 4U3ZA 3BL9A 3PFYA 2HZ0A 3IKAA 3MH2A 2PSQA 3Q4TA 4XV1A 5HE0A 4BGQA 5IQGA 4K9YA 3C4EA 3DU8A 3QZIA 4NW5A 4BC6A 5D41A 3O51A 1ERKA 4DH8A 3KRWA 4BDGA 5HNIX 4QMOA 1PYXA 3QKKA 5KMJA 2ITTA 2QOOA 1YDSE 5KZ0A 2UVZA 3KCKA 3K5VA 4G3DA 4QNAA 2BALA 2WB8A 1PXIA 3Q60A 5FTQA 4CV9A 2W4KA 5IEXA 4MWHA 2OJ9A 3L8PA 2H9VA 1WBTA 2PZIA 4KB8A 1R78A 5A46A 3CSVA 1VR2A 2W06A 1R0EA 3QA0A 4IB3A 4UZDA 4BTJA 4DEAA 5IKWA 4DEIA 3UDTA 4M0YA 3W2PA 1SNUA 4FIHA 3CTQA 5CZHA 4I4EA 4G34A 4XBUA 1VEBA 3OY1A 3R1QA 3LQ3A 1BX6A 4JAJA 2FSLX 4FODA 2WIPA 3F3ZA 3PUFC 4X3JA 3ZFMA 2BRNA 1TQPA 4O96A 5F94A 1SVEA 2ZOQA 3VULA 5HD7A 4EJNA 4FE2A 4IX6A 3COKA 3UQFA 5D1JA 2HELA 4GRBA 4JIAA 3DBCA 3GEQA 5EHLA 2QU5A 4L52A 4DEDA 4RSSA 3NPCA 2F9GA 3QYWA 4RA5A 3TDWA 4LFIA 4TWNA 3R04A 4A06A 4BHNA 4M14A 5BVNA 1PMVA 2IVUA 2OIBA 2UZBA 4TW9A 5CS6A 5AUZA 4BCPA 4FT7A 4XV3A 1FVRA 3KGAA 3OWJA 3QTRA 4YPDA 5GZ9A 1CTPE 5CX9A 3TXOA 4ZTRA 3UDSA 4HGEA 4L8MA 4KSQA 4CYIA 5HGIA 4FSTA 4EKLA 2QNJA 3FZ1A 3IW4A 5K4IA 4FEQA 4I24A 5FXRA 2CDZA 2XALA 2WTKC 5EQYA 4AN9A 4BCMA 4BKYA 4I5MA 1M7NA 4FV4A 1Q8TA 4I5CA 2C30A 2W0JA 4FTQA 4F9CA 3DPKA 3KVWA 3PG3A 2HY81 2QHMA 3QCXA 4LUDA 5AIKA 2WAJA 3RPSA 2GTMA 2YHVA 3C13A 4FSNA 3ODYX 3TKIA 4Y5QA 4FKIA 3R8UA 2CNVA 3TYKA 4CG9A 4L3JA 5JH6A 3BEGA 3LMGA 4U43A 4DTBA 3DFCB 4MD9E 2W5HA 5EI2A 3RALA 1IG1A 4HCVA 4EOPA 2VWZA 4R77A 2XS0A 1E1XA 2XKEA 1ZARA 4J8NA 3EN6A 5EYCA 1L8TA 2UZLA 4FTUA 4BHZA 3A62A 3ODZX 3D2IA 2X0QA 2NRUA 2BVAA 4WRGA 5T3QA 2Z7LA 2YIRA 4S32A 2PPQA 3BYUA 4FSZA 2OO8X 1WFCA 3QD3A 5ANEA 4TWCA 3R2YA 5EM6A 4APPA 4C3PA 1GIIA 4UMRA 2BZJA 3PPZA 3G9LX 2C6OA 2CN5A 2VWXA 2Y7JA 4MNFA 1ZMVA 4A9UA 4PV0A 2W1FA 2GQRA 2PVLA 5E8UA 5IISA 3OWPA 3FLWA 3NDMA 1ZOGA 3AG9A 3LXKA 3AXWA 2QOLA 3IPHA 3L8XA 1OIUA 4ZSJA 1WCCA 1ZWSA 4BBFA 4EYMA 4F78A 1GAGA 4W4VA 3ULIA 4PDPA 3BYSA 4WG5A 1IASA 4F9BA 3TT0A 5CNOA 2ITOA 4G3EA 2OBJA 2C3LA 3BKBA 4LRKA 3E88A 3VBVA 3GCQA 5K5NA 2RG5A 3SA0A 4LDTA 5IQFA 1NW1A 3A7JA 3QQFA 4RIYA 3QTXA 4TL0A 2IZUA 5CALA 4I5HA 5C9CA 4MXCA 2QOHA 1UNHA 2BAQA 2C47A 1R3CA 2UVXA 4U80A 3PA4A 2C6MA 3LMIA 4QRCA 2J9MA 4DYMA 2YN8A 3MSSA 4RRVA 4EEVA 1U54A 3BLAA 1LEWA 4ONAA 5ANOA 5GJFA 1MRVA 1ZMWA 4BCIA 4UMTA 3CD3A 1JKTA 3LFBA 3Q52A 4WD5A 3QD0A 2VGOA 2B54A 2C1AA 2ETMA 5FEEA 3ZONA 5HBHA 1Q8ZA 3PJ2A 4NU1A 4U42A 4AW0A 3LFEA 5LARA 5BVKA 1SNXA 2F57A 3TG1A 4AX8A 4RVLA 1OITA 4I6FA 4JQ8A 4BDJA 2W1DA 4BDBA 4W8DA 4S30A 5LVMA 2JEDA 3PPKA 4FTAA 4WT6A 3RHKA 4PNKA 4BY9E 2FSMX 3VS7A 1EH4A 3ACKA 3GCPA 1ZYSA 3KF7A 4FTOA 5LCKA 2PUNA 1OZ1A 3OZ6A 3EWHA 1B6CB 5AX9A 1MRUA 1G8KA 3R0TA 5ACKA 1X8BA 2WD1A 4AXCA 5EHOA 3UNZA 3Q32A 4HW7A 2VNWA 4J97A 4D28A 2VU3A 4HOKA 2O0UA 3CCNA 3MW1A 1WBPA 3HL7A 4JR7A 4RMZA 3O7LD 4E4MA 2Z8CA 3FLZA 3V5WA 2I7QA 1ZYLA 3HAMA 4N57A 4FL3A 3NUAA 2BKZA 4GKIA 3DKFA 3OC1A 4FBXA 4BZNA 4HZSA 5C8NA 1TZDA 4BDEA 1JNKA 5CAQA 4ALUA 2HZIA 1H4LA 2VTPA 3GCUA 2ZDUA 4BCGA 4GUEA 4R1VA 3BHTA 4L9IA 3OBJA 3OROA 4GS6A 3QCQA 4CFUA 3I81A 3R8MA 4CTBA 3D14A 3VS6A 2C5NA 3DK6A 1OL7A 2XA4A 5HLPA 5HG7A 3QC4A 2OZAA 3C1XA 1W2FA 3W0NA 3LFFA 2XM9A 2R64A 3CIKA 2GMXA 4AZSA 3QTUA 3KY2A 4AZWA 3AC5A 4FX3A 4PDYA 3R71A 2QVSE 1KE5A 4MBLA 4QTBA 4XMOA 5BX0A 1AD5A 5KHWA 5BYZA 4M0ZA 4FKOA 2Q0BA 4FG9A 2BPMA 2GSFA 3GU4A 1LP4A 4RWJA 1RJBA 3VUKA 4BDFA 3KC3A 3MPTA 4CGAA 5K5XA 1W84A 1J1CA 4EWQA 1KWPA 1GIHA 3ALNA 3EKNA 3L8VA 3GBZA 3Q2MA 1JKLA 4KBCA 4ZY5A 3F2RA 5AAGA 3UO5A 2CJMA 2GQGA 2QU6A 3FXZA 3U6JA 3PIZA 5M08A 3GNIB 3GU8A 4EHVA 2KULA 2QONA 2Y8OA 2O8YA 3BBTB 4JL9A 3PSDA 4AP7A 4CFWA 4DGLC 5IA3A 4QQ5A 4FKQA 3U54A 1Q8WA 3D7TB 5FTOA 2HZ4A 5C03A 4CFMA 3FV8A 4ANBA 4U5JA 3S2PA 4ZSAA 4Z7HA 3F3WA 4AOIA 2VO7A 3WZUA 2WGJA 2XJ1A 4G3FA 4OTPA 4TKSA 3OW3A 4TY1A 3VUGA 2RGPA 4P2KA 5JFWA 4BJJA 4O7TA 4Y72A 3FMKA 3AC3A 4O6EA 4U3YA 3E7VA 3PDTA 3ZFXA 4G16A 4E5AX 1DAYA 3F82A 2QQ7A 5AIRA 4FA2A 5CU6A 3H30A 5CASA 2W1ZA 4FSMA 2YA9A 4J53A 4QD6A 4DH5A 2IZSA 1PXNA 2OJJA 4BFMA 5A4CA 3S4QA 3W0RA 2ZM3A 3HZTA 4RC2A 3UODA 2XVDA 4PL3A 4UEUA 2W1HA 4GIIA 4G5PA 3O7LB 5C8MA 2P2HA 5CSWA 4RQKA 2UW9A 5K9IA 2Y9QA 3KEXA 1U5RA 3G90X 3AMYA 4C4EA 4TWPA 5HD4A 4I92A 4R78A 3EZRA 3RM6A 3VS0A 4CCBA 4ACGA 3TKUA 4EH7A 2CKQA 2OXDA 3HGKA 4WOVA 2XM8A 4E5WA 4UWYA 4C57A 2DQ7X 4O21A 2IVSA 3DKOA 2JIVA 2CCIA 3R9NA 3WOWA 3ZM4A 5FDXA 2PZPA 4X2KA 3Q9WA 5FXQA 3UVQA 2XIYA 5LVPA 3NR9A 2PULA 4IM3A 5FUTA 3V5QA 4R1YA 5I3OA 2ITVA 4ZJJA 2OK1A 4D1ZA 1URWA 3UJGA 1BL7A 1H01A 1OUKA 2XARA 3ZOSA 4GT4A 1GIJA 5HI2A 5IQCA 2ZB1A 2ERZE 3GB2A 3Q5IA 4F99A 2FB8A 2P33A 2I1MA 2Z7RA 5LVNA 3P1AA 3VS2A 4B8LA 4HCUA 2YAKA 5M06A 5DR9A 4E20A 4EHZA 1XH6A 3DB8A 2PK9A 4FVPA 1YXVA 4KRCA 3DDPA 3KREA 4RGJA 4L42A 4MBIA 2BTSA 4GIHA 3AT2A 2B9FA 3DT1A 4TRLA 3QLFA 3UIUA 1BKXA 5AWMA 3F2NA 3KRXA 5EK7A 3BIZA 4FEUA 2ZM1A 4AFJA 1QPEA 4M13A 3G0FA 2OWBA 4C34A 2A98A 2BCJA 2RL5A 3MFSA 3QFVA 4X2NA 4UMUA 1TFFA 3RVGA 2HIWA 3DNEA 3VUIA 3GC9A 4LGDA 5AEPA 2BHHA 3TTIA 4KSPA 3MTFA 3QX4A 3DAEA 3N51A 3F5UA 2A19B 3PJ8A 2IN6A 5M4FA 3CP9A 2VN9A 3NGAA 3BEAA 3NW7A 2FO0A 3C51A 4E4XA 5E1EA 5ITAA 3CGFA 2GTNA 3R7GA 1Q8YA 3PY0A 3MGYA 3QWKA 3E7OA 4I6BA 3KXXA 4II5A 5HO7A 5I3RA 4D9TA 3Q2JA 3LJ1A 3RI1A 1XBAA 5DEYA 1V0OA 4RJ6A 5ANKA 2VTMA 2ZDTA 4IAIA 5GHVA 2PE1A 1W0XC 3I1AA 2C6LA 4M84A 2PTKA 1Q8UA 3WZDA 4DTKA 1DAWA 2UW3A 4FKLA 2YM3A 4AF3A 3KIOC 3K5UA 4QMZA 4G9RA 4KIOA 5EYDA 2OICA 3GCVA 3UG1A 4I20A 4YURA 3JYAA 2CGVA 5L6WL 5IA4A 5J79A 2JC6A 3DBQA 5LXMA 3FLSA 4MXYA 2QOCA 3U9CA 2C0TA 4F9WA 3NW5A 2WTJA 4XOYA 4NJDA 5DG5A 3IGGA 4LL0A 1NVSA 4MEDA 4GKHA 2C5VA 4HYIA 5BUIA 5I4NA 4OTFA 5TR6A 4XUFA 3QQGA 4G31A 2F4JA 5AUYA 4IDVA 3V04A 1G8SA 5EQEA 4J95A 4NT4A 3ZUVA 1BLXA 4UALA 2CSNA 3BU3A 4JMQA 3I60A 4HVGA 3QTQA 1YWRA 3QD2B 5LOHA 4Z16A 2VTRA 3V5PA </