4Z55A

Anaplastic lymphoma kinase catalytic domain complexed with pyrazolopyrimidine derivative of ldk378
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
307
structure length
294
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title Design and synthesis of novel selective anaplastic lymphoma kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 102
structure length 294
sequence length 307
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4z55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4z55A01
2YERA 3MH3A 4DEIA 4NIFA 4A9SA 2QOIA 1GZOA 3G51A 4FKPA 1XBCA 3UOKA 2R7IA 1Y57A 1XH7A 4FV0A 3HKOA 1R0EA 3E7VA 3SGCA 3OUNB 1HCKA 3T9IA 1WBPA 3EB0A 2XNMA 4BCKA 2QNJA 3B2WA 5L6WL 4QMXA 3D83A 2I0HA 3LJ1A 4OLIA 5A4CA 5L2WA 2W1CA 4U5JA 4BCIA 3FMHA 5AR7A 4FKIA 3OC1A 4F70A 3QGWA 3QA0A 1HCLA 4EK8A 2XIXA 3C9WA 4ERKA 4FZ6A 4B4LA 1M17A 1H07A 2A19B 4K77A 3KRRA 4UWYA 2XM8A 4H3BA 3ANRA 3OF0A 4U3YA 3IO7A 3BLQA 2V55A 4O1PA 4RX9A 1CKIA 5C8NA 4BICA 3LKMA 4KBAA 2W1HA 3DU8A 2PPQA 4BVUA 4S32A 2ERZE 4C37A 3BKBA 2R3NA 1OKWA 4R8QA 4C3PA 3PZHA 4F65A 3JUHA 1YHVA 2QHMA 4MAOA 4U8ZA 4D9UA 4FSNA 2PVKA 3ZOSA 3BIZA 3MY5A 3OVVA 1FBNA 2XYNA 4FEQA 5EYCA 3QRUA 2FO0A 4IWOA 5BYYA 2C0OA 4AZSA 2WQOA 3DPKA 2R3IA 3JVSA 1PF8A 2QU6A 4MK0A 4WO5A 5DR6A 4BL1A 4Y5QA 2JIIA 2UZWE 2YCQA 3FMKA 1PXOA 4S34A 1Q99A 4BZOA 3VUHA 4RWJA 5CU0A 3K54A 2W05A 3UIMA 1O9UA 3MPTA 4M68A 3VO3A 1P4FA 3EFLA 3GC9A 1YI3A 3W2RA 4W4YA 5E1SA 2XK9A 5EI8A 1PMEA 4YUQA 5EKNA 5CAOA 1WBVA 5ETIA 1H1PA 3MS9A 5DN3A 1JOWB 4QP1A 5FXQA 2R3HA 3PPZA 3PY0A 2YA9A 4I22A 4ALUA 3TZMA 3PY3A 2CMWA 4QP8A 3IW4A 3BE2A 3F5UA 3QQHA 2BUJA 4EEVA 2JDSA 2HCKA 3RWPA 3PSBA 4OTGA 3AD4A 2OI4X 3WYYA 2WPAA 3HMNA 3UQGA 5M44A 2XKDA 3CJFA 1OITA 1WCCA 2P4IA 4O27B 5A4LA 2OICA 2WD1A 3AC5A 3FDNA 2UW3A 4XMOA 5CSHA 4BB4A 5C03A 4E4LA 2XVDA 2XCHA 2IZTA 4FV6A 3FC2A 4ZAUA 3E87A 3WARA 3E8DA 5DIAA 2UZBA 4IWPA 4AGUA 1VZOA 4KB8A 4YPSA 3WZEA 3ATSA 3MPMA 4BHNA 2QD9A 4TKSA 4GU9A 1O6KA 1R39A 4DH1A 3EKNA 4ZP5A 5AX3A 5HD4A 3AMYA 4I93A 4FIEA 4BFMA 5ETCA 5BPYA 3R8UA 4FSMA 4RIOA 1YVJA 4E5BA 2J0IA 4PQNA 1OPLA 4RWLA 5F4NA 4IZ7A 3VS1A 4FEVA 1SVGA 3OY3A 4KA3A 1PW2A 3R1YA 4NH1A 4D28A 1BX6A 1W84A 5KE0A 4RC4A 4R1YA 4FF8A 2FYSA 2R7BA 3F66A 5JSMA 3M11A 3QL8A 4CG8A 4G2FA 3ZC5A 4AS0A 2QODA 4Q5HA 3UJGA 1OPJA 4AOIA 4AX8A 4J96A 3OWJA 5H2UA 3TNPC 5M53A 1OIQA 2IZUA 2UW9A 3QTZA 3K5VA 4WBOA 4H3QA 3TG1A 4BWXA 3FL5A 4BCHA 5FP5A 3R30A 4UMUA 4DG0E 3H4JA 1KE5A 2XNOA 3BHTA 2VUWA 3MIAA 2XK8A 4F1OA 5EM7A 4D4SA 4F7LA 1EH4A 1YOLA 3SW7A 4U6RA 3V01A 3O0GA 5FTQA 4XNEA 3MV5A 4UMPA 1Q61A 4BBFA 3QCYA 4NZWB 2BMCA 4ANBA 1SVHA 2CGUA 4AA5A 4D4RA 4CFVA 1U54A 4DFLA 2QI8A 1OL5A 3A8WA 3F61A 4C4IA 2PMLX 3DKCA 5BVFA 4CKRA 1VJYA 3A7JA 4C8BA 4A9YA 2QOHA 5L8KA 1QPEA 3DNEA 4NWMA 3RM6A 4MD8E 3AD5A 4TWCA 4V0GB 5CXHA 5CAUA 3C0IA 3V5PA 1OBGA 4X2NA 3F2RA 4CMOA 4L43A 4OBOA 4PUZA 4U0IA 4Q2AA 5ANJA 3ZMMA 4E8AA 3OTUA 5IA4A 3F6XA 3PVGA 5GIPE 4Z9LA 5HG9A 1E1XA 2E9VA 4XG6A 3W18A 3NGAA 2Q83A 3KXXA 4L00A 4G6OA 4LOPA 2I6LA 3HVCA 1PXIA 5CANA 2HWPA 4BDBA 4K2RA 3U9NA 3NR9A 3QGYA 4ANMA 3NYXA 2QLUA 3WILA 3UTOA 4AF3A 2XRUA 4GJ3A 4MXXA 4TTHB 5A4EA 4UMRA 4KNBA 2WOUA 1H28A 3OG7A 1H1RA 5IQDA 4CV9A 2OSCA 3RZBA 4YP8A 5JZJA 2B54A 3ORNA 5KMIA 3DT1A 3TTJA 4IADA 2SRCA 5TOZA 4A9TA 1SNXA 2GPHA 4NM5A 2WMWA 1BI8A 4UEUA 3TL8A 3GUBA 3HUBA 4IB0A 3ZXTA 3QTXA 5FLFA 3F5PA 5IQGA 5IZFA 3EN4A 4CMUA 4CYJA 4O7LA 2WMXA 3HMOA 2JIVA 5HBJA 4I6BA 4O0SA 1UKIA 4MCVA 4HPUE 3EZVA 4MBIA 4OBPA 5EQPA 2O65A 3LFSA 4O0TA 3BWFA 4LGDA 4YU2A 4TNDA 4B7TA 2YDIA 5FEEA 1J1CA 3HA6A 4RBLA 4DCEA 4EWHA 5JT2A 1G8SA 3OWPA 3TNWA 4EBVA 3FI2A 3Q4UA 4NU1A 3JR1A 3LCOA 3W2PA 2BRGA 3ZEWA 5IEYA 4C0TA 1ZMUA 4C33A 4K11A 4I20A 4M69B 3ZH8A 3BYOA 2RIOA 5HI2A 5IQCA 4S30A 4F09A 2XIYA 2C68A 2YCSA 3LQ8A 4RJ7A 4U45A 4EUTA 4UZDA 3TUDA 1YXXA 3ET7A 5EFQA 5KCVA 4OAVB 4QP6A 5AAEA 3Q96A 4U79A 3AQVA 4YMJA 5CQWA 4G6LA 2WTWA 4O6EA 4G3CA 3EHAA 4EKKA 3OBJA 4JX3A 2W1IA 3NYNA 5HU9A 2IPXA 2ETRA 4FTOA 3BYUA 4JDKA 2JFLA 3BGZA 3LLTA 3DTWA 4FK6A 3D7TA 4CEGA 4CT1A 3C0HA 3OEZA 5LCKA 3R21A 3HRBA 1FINA 3V5LA 4AN3A 3H10A 2DYLA 2IZRA 4UALA 5JFXA 3Q6WA 4FTLA 5D9HA 2XZSA 3SXSA 3EJ1A 4QYYA 3Q32A 4RMZA 2UZVA 3FMMA 3TJCA 5K4JA 2R3OA 3C7QA 4XUFA 4EYJA 3KULB 3G0EA 5DT4A 2G9XA 1OL2A 4FZAB 4M12A 4XCUA 4JBVA 2XIZA 2R3QA 3N4TA 4FTJA 2XBAA 5JZNA 3KA0A 1IRKA 5A14A 4LQMA 4C59A 2J6MA 4U43A 3F88A 5CEMA 1XH6A 4V01A 3LMIA 1Q8TA 3BGPA 3SG8A 3EH9A 2ITXA 3AGLA 3WF6A 4XRLA 2WTJA 3VBVA 4O2ZA 4GYGA 3CQWA 4QO9A 4DYMA 3NEWA 4TZRA 5HO7A 3MESA 1BL7A 5IKWA 1Y8YA 4DFNA 3ORIA 1JAMA 4TNBA 3C4FA 3CCNA 3BRBA 3VUTA 3VW8A 3NCGA 5DMZA 2VAGA 3R63A 2PVHA 4H36A 5AP2A 3GP0A 3QFVA 2XNBA 4XJ0A 2YFXA 2YM8A 3OOMA 2ZB1A 2R4BA 4EOSA 4O82A 1WMKA 4PPAA 4CMTA 2YIWA 2VWVA 1LPUA 3DY7A 3CP9A 5FRIA 4YZNA 3VUKA 4ONAA 1PXPA 3SX9A 3CC6A 4ANOA 4O81A 3QQGA 2QONA 1IEPA 4KKEA 3NDMA 3OHTA 3PP0A 5ITAA 3ZDIA 5E7RA 3GCQA 4JQ8A 2ZM4A 4PL4A 1B39A 3PA5A 4N0SA 3PTGA 4BIEA 5M56A 4FMQA 2X4ZA 2Y7JA 3ENHA 4N6YA 3HUCA 3SXFA 1KV2A 2GNIA 1PMUA 3AC1A 3AC2A 3F7WA 3O23A 2YDKA 4FKLA 3R9HA 4GG5A 3HRFA 3LM0A 2OBJA 2W1EA 3BELA 3Q9XA 2F4JA 2PU8A 4NT4A 4BZNA 2EUFB 1QL6A 1Q3WA 2JDRA 1JWHA 1X8BA 1WVYA 3PSDA 4AQCA 2BZJA 2R9SA 4RX8A 4PMTA 2ZDTA 5L8JA 3CE3A 4O7TA 4DFUA 2HY81 3M2WA 4GEOA 4FODA 4PNKA 3VHKA 5K5NA 3UNZA 2C6IA 2YJRA 4HZSA 1XH8A 4BCOA 2Z02A 5IQIA 1URWA 4I41A 3TIZA 3PA3A 3TN8A 4HVIA 4RQKA 5AP6A 4QP2A 3OS3A 4BCMA 4YO4A 5KHXA 4M13A 2QURA 1AQ1A 3ITZA 4EK5A 1M2PA 4IC8A 1ERKA 3LZBA 3AMBA 3ZU7A 3K3JA 1TVOA 2C3LA 3ORMA 4QP7A 2WTKB 3FLWA 1UV5A 3OT8A 3OD6X 4Y72A 5E91A 5EYKA 3S1HA 4EJ7A 3PJ3A 2C47A 3NIEA 2WOTA 3EN6A 3GT8A 4JI9A 2XIKA 3D2KA 5D10A 2ESMA 1UVRA 4EC8A 2JKOA 4UWBA 5JN2A 2WTDA 1YW2A 1ZWSA 2BIKB 4JR3A 3PLAE 4IFCA 2I0VA 4KSPA 4YJOA 3VC4A 3ZRMA 4RIWA 3FSFA 4F6UA 5HNGA 2XNGA 4PDPA 3TNQB 1QPJA 2JLDA 2YHVA 2ZM1A 4BTFA 4MNEA 2R3FA 1XHAA 4IAAA 4A7CA 2ZV7A 3W8QA 3ANQA 4FZFB 1QPCA 5CEIA 2BDFA 4LRJA 2X0GA 2X8DA 2PVFA 1J7IA 4RA5A 4X3FB 2GDOA 3R1NA 3DAJA 1YHSA 4LM5A 4EUUA 4C2VA 3KL8A 3VVHA 3R6XA 3E8NA 3IW6A 3QU0A 4NM0A 4RLLA 3LJ2A 1OB3A 3A4OX 1ZYSA 3OP5A 4FSYA 3KF4A 4GRBA 5I3OA 1YXSA 3EFWA 2EXCX 4FKSA 4MXYA 4O38A 4YZCA 4ARKA 1H00A 1Q24A 2WXVA 5DEWA 3OBGA 4FI1A 3RCDA 4E4MA 4U41A 3W2SA 4BDIA 5TF9A 2QQ7A 3V04A 3QD3A 1I44A 4UYAA 5BMSA 4J53A 4I5HA 2B53A 3ZM4A 3DQWA 4L46A 2ZVAA 3WF9A 2OF4A 1LUFA 3TIYA 4HYHA 4C34A 4FSZA 1XBAA 2YISA 4D1XA 3PE2A 1YI6A 4CYIA 3S0OA 3GQIA 4RIXA 3TZ8A 4DFXE 4AT3A 5IA2A 3OMVA 1GJOA 3DK7A 4CV8A 2EXMA 5IDPA 2OIQA 2CHLA 2Y4IC 4U97A 2HENA 5M57A 3DZOA 4FK3A 4U7ZA 5DHJA 1VYWA 2OIBA 3BU5A 1V1KA 2X1NA 3I7CA 2EB3A 3AC3A 4AWIA 1R3CA 5BMMA 3U4WA 5HTIA 3MVHA 1Q8YA 2ZV9A 3SOCA 2J5EA 1WVXA 4O7NA 3CIKA 3S4QA 4HCVA 3GFWA 4AW5A 2H9VA 4DEHA 3S3IA 3FSKA 4AUAA 3ZS5A 4HYUA 1V0BA 2VZ6A 2RKUA 4PDSA 4O21A 4BDDA 1PYXA 5EHYA 4M97A 2OW3A 4FZDB 4NEUA 5CT0A 2CLQA 5AUXA 3SG9A 1UU7A 4NYEA 1OL6A 4NJDA 3F3VA 4F08A 2UVZA 2OG8A 3F2AA 4HGSA 3UP7A 3MFUA 4QQCA 4CFWA 2WMSA 4U3ZA 4CLJA 4CD0A 4ZY5A 2J0LA 4KS7A 4RFYA 4B99A 2GTNA 3Q3BA 1BUHA 2YCFA 4G3GA 4MTAA 1OIUA 3WE4A 3VUDA 4AOTA 5JEBA 2YITA 3WOWA 3W33A 4FNZA 2W1GA 3P08A 3ZFYA 3LFBA 4XV3A 2QO7A 3ZLYA 5LXMA 4RJ8A 2BHHA 4DG3E 4OTIA 2DS1A 3KKVA 2VX3A 4EZ3A 1FGIA 3D5UA 2Y4PA 1F0QA 4QYEA 4WT6A 4E26A 4XS2A 3R71A 1BMKA 4I5MA 4ANLA 5CSWA 2P55A 3L9NA 2JKMA 1OMWA 3CY2A 3IW5A 4AW0A 5HORA 4ZMEA 3FKNA 4JIKA 3RAKA 4IE9A 4FV9A 3A8XA 4ZJIA 4BI2A 4BYIA 4ZZOA 3WF5A 5I9UA 3VAPA 2QOCA 5AMNA 3RMFA 3W2CA 5HX6A 2XRWA 2YACA 4DINA 3CS9A 2P2HA 4MHAA 3G90X 4RWKA 2PULA 3LOKA 5E8XA 4JDJA 4DEBA 3I4BA 5FXRA 2UZNA 4E4XA 1H1WA 4EH6A 1ZYLA 4Y83A 3ROCA 4EC9A 3LIJA 5HLPA 2PMNX 3D15A 4H3PA 4BN1A 3EQDA 4QT1A 2IZSA 3C1XA 4N57A 4EOOA 5AUVA 1KOBA 3GU8A 4S31A 3VQHA 4ASDA 1H1QA 4D9TA 4FEUA 4M66A 2WIPA 3GU4A 4KS8A 4H58A 4MKCA 3V51A 3ZRLA 5JRQA 2FSMX 1JKSA 4O83A 1OL1A 1JKTA 5JFWA 4GKIA 2Z7QA 2PZYA 4PWNA 4DTKA 3UVPA 5TO8A 3TNHA 4G5PA 4RT7A 4PDOA 3CJGA 4DGNA 2UW7A 4TYEA 5EHOA 4PP9A 5IQHA 4IAYA 1PJKA 5E8UA 3QLGA 4JG7A 5CI6A 4FT3A 4FEXA 4D0XA 3FEGA 2GHMA 5C4KA 1U4DA 3NWWA 4IXPA 2JIUA 3MYGA 4DC2A 4IBMA 5ACBC 1A48A 5C26A 3DLZA 5DVRA 3KEXA 3QQKA 4HNIA 3BYVA 5HIDA 4CZTA 3LCTA 4O7RA 2VGOA 4O7ZA 3HRCA 2R0UA 2XUUA 2C1AA 1Q8UA 3MB6A 4AG8A 5CYIA 1WAKA 2VO7A 3ORLA 4XG9A 3UOLA 5DGZA 3UG2A 1OVEA 4OT5A 5EI6A 2VTLA 4EH2A 3O7LD 3MTLA 4W8EA 3TEIA 4C35A 5FUTA 3KVWA 3QWKA 3LFDA 4FZ7A 3FZRA 4EQCA 5JQ5A 3FQEA 1YDTE 4MF1A 3CQUA 5T6KA 4ZTRA 3P7CA 4K6ZA 4FT5A 4V05A 5AM7A 4CGAA 3Q53A 3PXFA 3PSCA 1ZY4A 2J5FA 3GEQA 2Z7SA 4XLIA 3VBQA 5G6VA 2VNWA 3OZ6A 4AFEA 5I3RA 2G15A 4MEDA 4K0YA 5C9CA 3LFEA 1YXTA 1V0PA 4GU6A 5LWNA 2XKFA 2GQSA 5F20A 2OWBA 1Q62A 1M2RA 3QYWA 4FKJA 5IH6A 3S00A 1R1WA 5CEOA 5AUZA 1H01A 2H96A 2FA2A 3ZM9A 2W4JA 3QHRA 4CSVA 3GOKA 5IU2A 2BAJA 4CZUA 4D2PA 3DBCA 4BZDA 5J87A 1JLUE 3F9NA 4MVFA 3SLSA 3DJ5A 1A06A 3LCSA 4EOIA 5IUHA 4O96A 4S2ZA 5CX9A 3COKA 3II5A 3MW1A 3QZGA 4FSQA 3LQ5A 4FSTA 5B0XA 5I9ZA 5KUPA 4Y5HA 4YC8A 3VS5A 3KXHA 3U87A 3R8PA 3U6IA 2AUHA 4AE9A 4AP7A 1J7UA 1H0VA 1W83A 3VS6A 2JEDA 2Y4IB 3SOAA 1SM2A 3IQ7A 3NAYA 4D2SA 1HOWA 2HW6A 2X7FA 3VBWA 3VN9A 3JVRA 3MVLA 2REIA 4M84A 4QMUA 1ZYCA 2P33A 4C4GA 2A4LA 5EDPA 1Q3DA 3K3IA 3PZEA 1MRVA 3UMWA 4BBEA 3C4ZA 4MXAA 2VD5A 5AV0A 4IVBA 3UZTA 4DBXA 5HEZA 3FXWA 4AGDA 1M52A 2QOBA 2P3GX 4B6LA 4FKVA 2VGPA 5HVYA 5IG1A 2PUNA 3QTRA 3RK7A 2YJSA 5HESA 4XYFA 3OCGA 4BF2A 2ZMCA 3RCJA 2G1TA 2KTYA 3MFTA 1LR4A 4FL1A 4MQ2A 3RPOA 5AA9A 3FXZA 1KV1A 5GJFA 3P78A 5IUGA 5C4LA 3ODZX 5EDRA 3VBTA 1CM8A 4FKRA 5A9UA 4NTTA 4CFUA 5JFVA 3HLLA 4IFGA 5ICPA 3JS2A 3O7LB 2JKQA 1UWJA 2IWIA 3MFSA 4QP9A 1UNLA 3A7GA 3A4PA 1H26A 2R3JA 3Q5IA 4D5KA 5TE0A 4YJVA 2HK5A 5EW9A 3T3VA 5L2IA 3D2IA 5CSXA 2ZV2A 4XG7A 2IVVA 1J7LA 2E2BA 3TCPA 5DH3A 3FE3A 5IPJA 1FMKA 4GCJA 5E9EA 2R64A 4NW5A 1OUYA 1PHKA 4DCAA 2WNTA 4OTQA 1PXLA 2JAVA 5LOHA 2AC3A 4FEWA 4RIYB 5FM2A 2CNVA 2VX0A 3AXWA 4DH7A 4E3CA 3CY3A 3TTIA 2QOFA 1OM1A 3R83A 4ACHA 3QCXA 3V6RA 3RK5A 3OCBA 4ZSAA 2VTSA 4YJQA 3QWJA 3VW6A 3GQLA 3QTSA 5AM6A 3FHRA 1Q8ZA 4LMNA 3ROYA 1O6YA 4KABA 4LYNA 4EOJA 4LV5A 4GVAA 3KRXA 1U59A 5CU3A 4YJUA 2J50A 4GL9A 3WF8A 2QOLA 4YURA 3ZO3A 1Z57A 3B2TA 2UZUE 4CFXA 4HVGA 4V0GA 4CTCA 3LQ3A 1RDQE 2O0UA 4DEGA 3RK9A 3GNIB 3OEFX 2W96B 3E8EA 3OUKA 5ETFA 3VRZA 5J79A 1URCA 4ID7A 1H25A 4QMPA 2OFVA 3VQUA 3IDCA 4OW8A 2NPQA 4YGAA 4TRLA 2XJ0A 4K33A 4V04A 2PVMA 2PVNA 4FIFA 2CKPA 3OROA 4IJPA 4GH2A 4I24A 4GT3A 1OPKA 5KMNA 5EYDA 2Y0AA 1P4OA 5HHWA 3KF7A 2B9HA 4IX4A 1XH9A 3FL4A 4NFNA 5JMSA 1FVTA 2FGIA 5M51A 5FWKK 4IHPA 3E88A 3WE8A 4ANQA 1OGUA 4A9UA 4NCTA 4EZ7A 4EHGA 5KX8A 1V0OA 1IR3A 3ENMA 4GK4A 3UOJA 1ND4A 2PSQA 4ZK5A 1SVEA 4FTAA 1LEZA 3C4EA 1XO2B 2W06A 3OXZA 4I5PA 1NXKA 2VU3A 4FICA 4FSRA 2VWYA 4ZZNA 3UDBA 4GKHA 4FV4A 4TPTA 4IB1A 2LAVA 1UNGA 3EQPA 4BDFA 4F6SA 4ORKA 4IDTA 3PRIA 4NTSA 4DTBA 3GGFA 2X9FA 4P4CA 3R2YA 2G2IA 4I4FA 3IG7A 3R7VA 3LMHA 3BZ3A 4CXAA 3ORXA 3PFQA 2W5BA 3EYHA 3BI6A 3R7GA 4PV0A 2BZIB 3QXPA 5DE2A 3U8WA 3W1FA 2BAQA 2YZLA 2EU9A 3FYKX 1ZMVA 3FI3A 5HE2A 2ITOA 3AC4A 2E9UA 4P5QA 3P9JA 3R1QA 2Q0NA 4R7IA 4M3QA 4NUSA 4UBAA 2GNHA 4DFBA 1JPAA 5CTPA 4XG8A 2WTCA 4G3EA 2GNLA 3TV6A 4M69A 5D12A 5BYZA 2PYWA 3ACKA 3LXLA 3IKAA 3CD3A 2VN9A 4O7YA 2CGXA 4F7JA 3NW7A 4XH6A 5HCZA 1M7QA 3KVXA 5CF6A 4FKGA 3CPCA 2IO6A 3EQFA 1J91A 1SZMA 4FA2A 2V62A 3SDJA 5IMEA 3UVQA 2HW7A 4JX7A 2BDJA 4JG8A 4DEDA 3HEGA 5HO8A 4CVAA 3ORTA 4G9RA 4U80A 4AXAA 4CRSA 5IQBA 3VULA 3C4XA 1OIRA 1FVVA 4MBLA 2C4GA 3NSZA 5DRDA 4WUNA 4ZTSA 4DITA 2RSVA 3NAXA 2OKRA 1FVRA 4I0TA 2VWUA 3DXNA 4FKOA 5AP1A 5KMMA 3DFAA 3AMAA 4JL9A 4BTKA 5LWMA 2X2MA 4FTMA 3BEAA 3P5KA 4L42A 4FG7A 4UN0C 4RG0A 5BVDA 3MDYA 5KMOA 4QOXA 4F9CA 3REPA 5KMLA 4D1ZA 4XV9A 3MBLA 4ZEGA 3CKWA 3SC1A 4FKQA 1PMVA 3UQCA 2FSLX 2C6DA 2GU8A 2I0EA 4KINA 4QTAA 4BKYA 5CNOA 2XF0A 1ZXEA 4PPCA 4BKJA 3POOA 5M08A 2VTTA 3DCVA 2WMAA 2YABA 4QTCA 4HVDA 5LVMA 3M42A 3ULZA 4RLKA 4YJSA 2YZAA 4EORA 3V6SA 3ZXZA 3T8OA 3GU7A 5DI1A 5C01A 5AEPA 5AV2A 3GC8A 3FJQE 3OXIA 2JGZA 4D4YA 4IZ5A 2YM3A 3TWJA 4FV8A 4W8DA 1U46A 4FNWA 3V5TA 3FI4A 3OOGA 3O96A 3GCVA 4KRDA 1SNUA 4B9DA 4NJ3A 5HCXA 3E62A 4MBJA 2DUVA 2GFCA 2OXXA 3UE4A 1IA8A 1UKHA 1YDSE 2G2FA 3C50A 4FIHA 5AIRA 4QNYA 3PY1A 4MD7E 5EH0A 2QO9A 5HOAA 4P90A 3C13A 2BRHA 3FZSA 4YZ9A 2X6DA 4RFMA 5AAGA 3KXGA 5C27A 3BU6A 3RPSA 3L8PA 1U5QA 4OTWA 3WZUA 4X2JA 3MA3A 3Q60A 3FQHA 4K8AA 4NM3A 4OAUC 3LFQA 3R28A 1K3AA 5AR8A 5J95A 1NA7A 3F3WA 3V5WA 2X6EA 3EN5A 3U55A 3ATTA 3IGGA 3LE6A 5CSVA 4FV3A 4EOQA 2CLXA 4BGHA 3UIXA 3DFCB 3LXNA 3FLYA 1DAYA 4J8MA 3PPJA 1DAWA 4TL0A 1OI9A 3TUBA 4BWPA 4QTEA 1NY3A 4OBQA 4YC3A 1ZYJA 3MGYA 2VTOA 2NO3A 5HVJA 4E73A 4ZIMA 3V8TA 4EOLA 5CALA 2UW6A 3P86A 5GINE 3PA4A 4RQVA 4Z3VA 5L2SA 3ZYAA 3BU3A 4M8TA 5CLPA 2X39A 3HP5A 5TKDA 4IVCA 3CBLA 5HGIA 1YQJA 3VJOA 3NX8A 4M0YA 3FI8A 4YPDA 3NNXA 1WBTA 1STCE 3LJ0A 4YZMA 3EZRA 5JKGA 5CU4A 1XH4A 3TDVA 2BIYA 2OJIA 4FTRA 3MH0A 5LARA 2Y9QA 4WRGA 3LVPA 2XKCA 3ODYX 3FLQA 1DI9A 3GC0A 3UIBA 4ZOGA 2YIRA 4KIQA 5HIBA 2BRBA 2OK1A 1QCFA 1UNHA 3V5JA 2J9MA 3C4CA 3VUMA 4BDHA 5HLNA 2OXDA 4R5SA 3RHXA 2Y6OA 3LLAA 2EXEA 1PYEA 2XB7A 2PE2A 2XBJA 5F95A 3F82A 3NVKI 2WGJA 3MJ2A 3FXXA 2B0QA 2F2CB 4X2GA 3RNYA 3RP9A 2VTPA 3A60A 2W4KA 3EMGA 2C5XA 2WHBA 3ALNA 2DWBA 2FUMA 1ZAOA 4TY1A 3EQBA 2VTIA 2XKEA 3L8VA 3B8RA 4FNXA 2ZAZA 3BHUA 2JDVA 4J1RA 3ZFXA 3Q4TA 4BTJA 5BX0A 4WIHA 3I81A 4JVGA 4YLKA 2WEVA 4X3FA 5HO6A 1WBWA 1T46A 3C5IA 3QC4A 3WYXA 3NW6A 4I3ZA 4A4LA 4QMLA 5JK3A 3E93A 4IAZA 5EYMA 3LXKA 1S9IA 3G6HA 1PKDA 3O8UA 3RVGA 2HAKA 5M4UA 5HIEA 2Y8OA 3CEKA 5B7VA 1GIHA 4BGGA 4HGTA 5AP7A 4E93A 3Q52A 4E6DA 2WQBA 3CXWA 3KB7A 3NMUF 3I7BA 2BZKB 3FWQA 4QMSA 1ZZLA 4QPAA 4UZHA 5D7AA 5IDNA 3OWLA 3QRTA 4LGHA 4QD6A 2YWVA 1ZZ2A 4AW2A 3MVMA 2Q0BA 3EQRA 3H0YA 4BDKA 3CR0A 3H30A 2OF2A 2UZDA 2PHKA 3RPRA 5HNBA 4FTTA 3RAHA 5AR3A 3R8LA 5BYLA 3R8ZA 4FE2A 5AFVA 2C0IA 3IS5A 4D55A 4QQ5A 3LFNA 3QX4A 2X8EA 4O0YA 1MQBA 2BHEA 4OT6A 2BTRA 3MN3A 4ITJA 4G9CA 2H6DA 4D2TA 2IG7A 2I40A 3CTJA 4YTIA 4WBBB 4USFA 4PMSA 3R01A 3QRKA 4H1MA 5FTOA 4Z7GA 5M55A 4C4FA 2WMQA 4U42A 4H1JA 4I6HA 3TKIA 3EQIA 4D2WA 4FYOA 3NYVA 4WSQA 3DK6A 4YO6A 4UWCA 1K2PA 4L3JA 5FDXA 4AGCA 2QG7A 2ZYBA 2C5YA 3U54A 4LOOA 3EFJA 4C3RA 4E4NA 3Q9WA 2YIXA 3BCEA 4DLIA 2QLQA 3ERKA 4JQ7A 3H9OA 1O6LA 3DBQA 1KE9A 4H39A 1F3MC 4Q5EA 2JDOA 5EDQA 4ZSJA 3SVVA 3CGFA 3VS2A 3H9RA 4BCNA 2PVJA 5LVLA 3TV7A 1Y6AA 2X7GA 1IG1A 3D0EA 4AGWA 3ZCLA 4EONA 5AUUA 5AV4A 3NLBA 3D5XA 5DYJA 3QHWA 5DBXA 2ITNA 3MH2A 1H08A 4RVMA 2VTMA 2ONLA 3PXZA 4C2WA 2R3PA 4AU8A 4S33A 4TYHB 5L2QA 2J4ZA 4C38A 3TXOA 4EOPA 3NNVA 2VO0A 4C4JA 1JKKA 5KKRC 4BKZA 3G9NA 4RC2A 1OKVA 4I0SA 5IA0A 3SHEA 3L8XA 3QTQA 1IASA 1WFCA 4A06A 4EJNA 2BILB 1H0WA 4QP3A 3U6HA 4RJ6A 3CLYA 4IB3A 4J7BA 1M7NA 3KCKA 4J95A 3L9LA 4PNIA 3RPYA 3OCSA 4MNFA 4CKJA 2ZB0A 3D7TB 3KXNA 3D5VA 4WNMA 3BPRA 4KAOA 4YJRA 4EI4A 2BFYA 3PVUA 3SQQA 4FT7A 2PZIA 3ZLXA 5M09A 4MWIA 4I6QA 4O6LA 5AP5A 5GIOE 2YIQA 2P0CA 2XK7A 3FLSA 4FTCA 5HNIX 3QYZA 3LFCA 5IA3A 2PE0A 4BCFA 4YLLA 4DF3A 4TW9A 3ZTXA 3HNGA 2NRYA 4HJOA 2R2PA 5DT3A 4ZS4A 2CSNA 3LPBA 2OZAB 3I6WA 5J7HA 4ANSA 2QOKA 1Q41A 2G01A 3EKKA 4IAIA 5HX8A 3EQGA 2R3MA 3C4WA 3U51A 3KREA 2J7TA 2W17A 5IH5A 4R1VA 4AZWA 3GCSA 3FKOA 4QTBA 5HE1A 4JQEA 4LOQA 3GCPA 4HGEA 4A4OA 4FTNA 3AGMA 3M1SA 4L6QA 1KE6A 4Y8DA 1ZRZA 3KRLA 3F3UA 3FPMA 4AAAA 4AN9A 2CJMA 4KWPA 4B0GA 5A54A 1DM2A 4OGRA 3VIDA 4IM0A 5ANKA 2CKOA 5I9YA 3R7IA 3ZRKA 2R5TA 4QPMA 3CSVA 3TKUA 2HOGA 1H24A 3BV3A 2OH4A 4EKLA 3L9PA 3TDWA 2XK3A 5KBQA 4FV1A 2WQEA 4EHZA 3BX5A 4UXLA 5AR2A 3QZHA 2RFSA 4WSYA 4RVKA 4FTKA 1TKIA 3THBA 4DLJA 4KKHA 5FG8A 1MQ4A 3UOHA 4E6AA 3DAKA 3DJ7A 5KZ0A 5BVNA 1W8CA 5L8LA 1JSVA 2VTAA 3BE9A 3PIYA 2OO8X 1WBNA 3O17A 3TKHA 4APCA 5LMKA 2IW9A 3HDMA 3LFAA 3VF9A 3E5AA 5A6OA 4DG2E 1Q4LA 4DA5A 4I21A 1A9UA 3QALE 4GMYA 3PJ2A 1CKPA 4MXOA 4NSTA 4E20A 5AAFA 3F5GA 4AZEA 5KMJA 5DT0A 4YJPA 4XBUA 5CEPA 3PE1A 2UUEA 4J71A 3D5WA 4U44A 4TT7A 5H8BA 3V3VA 5KO1A 4HCUA 3DJ6A 4GG7A 4A07A 1IAJA 3GU6A 3JY9A 2BKKA 3Q5ZA 3HAVA 3EN9A 4AOJA 2WIHA 3LXPA 3UODA 5K0XA 1OKZA 2WZJA 1XKKA 4WNPA 1KOAA 3VUIA 3ZSHA 4WHZA 5D1JA 4JDHA 3AG9A 2B9IA 3BYMA 5TR6A 4EH3A 1FOTA 5LMBA 3WIKA 3LAUA 3TJDA 4F9AA 3GBZA 1KWPA 2VRXA 4N6ZA 3AT2A 2GMXA 3LW0A 4XV1A 3TI1A 3WBLA 2UVYA 4RA4A 5IH4A 1AGWA 1YWRA 3HV6A 2XYUA 3RNIA 5IQAA 2PVYA 2W99B 3DDPA 2HXQA 3KY2A 5EW3A 1CSNA 4BCGA 5J1WA 1OBDA 4IB5A 5AP0A 5DOSA 4PTEA 4EWQA 1JKLA 4EK4A 3EOCA 3EYGA 4DH5A 3WZDA 5EQYA 3ZFMA 4HYIA 3R9RA 5HTBA 4PY1A 1J3HA 3I1AA 4FL2A 1GZKA 3EWHA 3QQJA 4IJ9A 3FLNC 2VTNA 4QMOA 4J99A 5ANGA 3VRYA 3P7AA 3Q4ZA 4PRJA 4KIKB 3DKGA 2C30A 1RW8A 2C5OA 1R0PA 3WZKA 4JG6A 1YOMA 2YLFA 3H3CA 3QTWA 1TQMA 2QKWB 4YHJA 2CNQA 2F7XE 4HPTE 4DEAA 4IMYA 2GS2A 1FPUA 4F6WA 4Z55A 4X2KA 3KK8A 4BDJA 5T3QA 4FR4A 2C3JA 3BGQA 2QU5A 4FC0A 3FHIA 4QMMA 5HG5A 5FDPA 3PWYA 4FNYA 2IW6A 4CZYB 2H34A 5HD7A 3R0TA 3HV7A 4RRVA 4XG4A 4QMWA 3BHYA 2B55A 2RGPA 4LMUA 4FBXA 5AJQA 3RALA 1UWHA 1WBOA 2F7EE 2J2IB 2PUUA 4O7VA 4GFGA 3G15A 4B8MA 2UW8A 4RJ5A 4CLIA 5CS6A 3V5QA 5CVFA 5GZ9A 5E8SA 4M67A 5IF1A 4JXFA 2KULA 4KKGA 4JRVA 5HZNA 3HDNA 5IA1A 3ZC6A 3A7IA 3IOKA 4OTDA 4MH7A 1GOLA 3FLZA 3NRMA 3FMDA 3NPCA 4JAIA 1KE8A 4CCUA 5J5TA 5KKRB 1YKRA 4RIYA 5GJDA 4OTFA 5HICA 5AX9A 3HMMA 2F2UA 4RIXB 4UV0A 5EQEA 3W32A 4I94A 4YTFA 1BKXA 3NZ0A 4F9WA 5EKOA 3UO4A 3UYSA 2OFUA 4EQUA 3VBYA 2VWZA 1G8AA 2B9JA 2CGWA 4IX3A 4PTGA 4BDCA 5E8ZA 4EK6A 4TN6A 2ITWA 3ETAA 1PRYA 5E92A 5DFPA 1H1SA 4HYSA 5EHLA 4BYJA 2OJJA 2QOQA 3I6UA 4F0FA 2ERKA 5GNKA 3SRVB 2XJ2A 3MH1A 3BWJA 2WFYA 2ZMDA 2C0TA 2GNFA 2XA4A 3KFAA 2G2HA 3DBEA 4E7WA 4YR8A 2JAMA 5HVKA 3BBTB 4FIIA 2WMBA 2XH5A 5GJGA 2QCSA 3O71A 1J1BA 4W4VA 4ZSEA 1KE7A 2EB2A 3CTHA 2IW8A 4L3PA 5T68A 2FB8A 2IJMA 5I4NA 3KXMA 3ORKA 4DE4A 3W55A 4GW8A 2HY0A 3NNUA 4CQGA 2OZOA 4GIIA 3T9TA 3BHVA 2WU7A 4YBKA 3MB7A 5L4QA 2RF9A 3ZDUA 2CDZA 3K5UA 3OY1A 4FVRA 4ZMFA 3KU2A 2RL5A 3WIGA 3R00A 2CCHA 2WQMA 3L1SA 3ID6C 2X8IA 2ZDUA 3I0QA 1OIYA 5IQFA 4N70A 4O0XA 4UMQA 4BDGA 2QVSE 5M4FA 2YM6A 3R22A 3IPHA 3NUXA 2W9FB 3ZHPC 4EH5A 4IDVA 2P2IA 4FYNA 4OTHA 3ZZEA 2CN8A 4IAKA 2C5VA 4NFMA 3R7UA 5HE0A 4WG3A 4GYIA 3R2BA 1YXUA 3O51A 3F2NA 1OZ1A 3JPVA 3N51A 3MVJA 1Q5KA 4MWHA 3NUYA 2XNEA 3MY1A 2AYPA 1H8FA 3SW4A 2BTSA 3A2CA 4A4XA 2C6KA 3FAAA 4FIJA 3GENA 5CQUA 2H8HA 2W5AA 4Y95A 3HA8A 4AA0A 1RE8A 4R77A 1PXKA 2UZEA 4I5CA 5DR9A 4F0GA 3R7OA 3ZUVA 1Q8WA 5EOBA 1VYZA 4FGBA 4DGMA 1NVQA 4XG3A 4XP3A 4JLCA 4X0MA 1KSWA 2A2AA 2CN5A 3GVUA 2IVUA 3TM0A 3LMGA 4BBMA 4NKSA 5L6OA 4PPBA 2O2UA 3MIYA 4FL3A 4BI0A 5J9YA 2ETKA 2OGVA 1UA2A 4GK2A 4IM2A 4QP4A 3GI3A 4I23A 5EG3A 4RZVA 4ACCA 4CFNA 2UZLA 4GUEA 2ZOQA 2GHGA 3O8PA 2CNUA 3IW7A 3DDQA 5KHWA 4IWDA 4M15A 5AV1A 2VV9A 3QZIA 5D11A 1Z9XA 4LG4A 4MX9A 4W9XA 4XX9A 2QHNA 2PTKA 3IW8A 2UW5A 3OW3A 4NK9A 4RPVA 2C1BA 3ORPA 2WEIA 4DFZE 1SYKA 4XHKB 4PMPA 3L8SA 4AACA 4CFMA 5CASA 1FQ1B 1PXMA 2C3IB 3HZTA 1GAGA 4FSUA 4JBPA 5AP4A 3COHA 3VJNA 4J98A 5AIKA 2WO6A 3VS7A 4YTHA 4DN5A 2UW0A 1XJDA 3MY0A 4DGOA 2OLCA 2ITQA 2NRUA 4BTMA 1R78A 5LCJA 2F9GA 1P5EA 4WG4A 4TWPA 1XH5A 2Z2WA 4YHFA 5H8GA 4NCTC 1YRPA 3UIUA 3UC3A 4LRMA 3COMA 4FV2A 4Y46A 1SMHA 4UXQA 3D14A 4L67A 3ZBXA 5A46A 2GQRA 4FOBA 3IDBA 2CKQA 3DXPA 1JNKA 2ZV8A 3DA6A 4NL0A 4W4WA 2R3GA 2V7AA 2JBOA 2E9NA 2OU7A 2HWOA 2X7OA 4JBQA 4ZSLA 2UVXA 1F5QA 2A27A 2XIRA 3JY0A 3PXYA 5E8TA 2HXLA 5FBNC 3R7YA 3R8VA 3Q2JA 3W8LA 3AD6A 1OECA 4GS6A 3SXRA 1MUOA 4C7TA 5HQ0A 3IDPA 4U81A 3DK3A 4IVDA 3HMIA 4EBWA 3FZTA 3DGKA 2WMVA 4PL3A 4HGLA 3RWQA 4RJ4A 3UMXA 2W9ZB 4JRNA 4WOVA 4FTUA 4EHVA 1WBSA 2YEXA 1QPDA 3R9OA 3AT4A 4JT3A 5LVOA 2R3LA 4AZFA 4ENYA 5C1QB 2C6TA 3MA6A 5CAQA 3F3ZA 4AW1A 1ZMWA 4F9YA 3NS9A 1VEBA 3HP2A 4QYGA 4BR3A 3RKBA 5EM6A 2VNYA 1K9AA 3KMWA 4AZVA 4GUBA 4YTCA 2XEYA 5JGAA 5CT7A 4E6QA 1YI4A 3MI9A 4G6NA 5JFSA 3UZPA 3HV3A 3PXQA 4CKIA 5B2KA 3RAWA 3TZ7A 3QQUA 3PDTA 2NNWB 4E5AX 2XMYA 5E8YA 5JRSA 3EIDA 1GZ8A 4J52A 3RZFA 2JKKA 4L44A 1YOJA 3NVMB 1M14A 5I0BA 3OWKA 4LV8A 2O64A 4GT5A 2YWPA 1APME 4GK3A 5H9BA 4IWQA 4WA9A 3GFEA 5CENA 2Z7LA 1FMOE 5D7VA 2RG6A 2X4FA 4GT4A 4TXCA 4NIFB 3HECA 4ZLZA 2WTVA 4Y73A 4FVPA 4O7WA 4QQJA 3DNDA 2A1AB 1CKJA 3MPAA 3Q6UA 5EOLA 3V8WA 4DFYA 4HVHA 5DWRA 1RQQA 5B2MA 4M14A 4AE6A 4EL9A 4QMQA 3AOXA 5FQDC 2UW4A 2VO3A 4XG2A 4YZDA 2YM7A 5M4IA 1JVPP 2OH0E 3QQLA 4ALWA 4YNOA 4ALVA 1OL7A 1BL6A 4EYMA 4G34A 4KBCA 5AV3A 2PZRA 3MWUA 1ZY5A 4BIDA 4U40A 3I5NA 4Q9SA 4LL5A 4GV1A 5IUIA 2VWWA 2JDTA 1P14A 3PJCA 4O84A 4RX5A 4ZZMA 4QYFA 4O0WA 3UQFA 4G16A 4I0RA 3MFRA 3NUNA 1W0XC 3W16A 3KRWA 5AADA 4DT8A 1DS5A 4USDA 1RJBA 2V22A 2C5NA 3E3PA 3LCDA 5M07A 2OJ9A 2Y6MA 4DH8A 1NW1A 3MSSA 1REJA 4BY9E 2O5KA 4QMZA 4IX6A 1L3RE 2A0CX 2GCDA 2W0JA 3I5ZA 3A61A 3C0GA 2J0KA 4ZTHA 5I9VA 3TACA 3UG1A 3ZUUA 3LM5A 2HYYA 4HVSA 4UX9A 4RGJA 4JAJA 2XK4A 3EN7A 4G31A 5LJJA 3KULA 4FSWA 4QMTA 3IK3A 2VTQA 1ZARA 3FZPA 3S95A 2VWIA 3CKXA 4C36A 4DGGA 3OFMA 4GIHA 5GZ8A 2BFXA 3QCQA 3QUEA 2LGCA 2BPMA 3D7ZA 2C6OA 1YDRE 1UU9A 2PMIA 5HBHA 5BVKA 4ZTMA 1W7HA 3QAME 4FG9A 5C8MA 3UO6A 1H27A 1YWVA 2J51A 2RFEA 5A4QA 4RC3A 1H4LA 3ZUTA 2B9FA 2DQ7X 2VO6A 4D1SA 4MQ1A 2Z60A 4F9BA 1UU3A 3ZEPA 4AZTA 5J8IA 4O1OA 5CU6A 5CF8A 1B6CB 4ZJVA 3I60A 1W98A 3G0FA 2NP8A 3QKLA 4QQTA 1CDKA 2V7OA 5FD2A 5AUWA 5DR2A 2BRMA 3R04A 5K3YA 4UY9A 3UZRA 2I0YA 5JGDA 4RJ3A 4BRXA 4QMYA 3QD4A 3IOPA 5I9XA 3QXOA 2Z8CA 3PG1A 4O0UA 2F57A 4ASEA 3QZFA 4FG8A 2WTKC 1MRUA 4G17A 3V8SA 3BHHA 4HCTA 1T45A 3PUPA 4Y85A 3R8MA 2UZTA 3QA8A 3W2OA 5CXZA 3GCUA 2ACXA 4ZTLA 2OXYA 2HELA 4CTBA 3G6GA 3LCKA 5LVNA 3U9CA 4F63A 4TYGA 1UU8A 4WUAA 5ANOA 4JR7A 4DAWA 3COIA 3QKMA 4RX7A 4TYIA 1ZYDA 2VWXA 4L9IA 4EH4A 2EWAA 5CZIA 2BZHB 4L7FA 4C4HA 2XNPA 5CEKA 3WF7A 4H05A 4ZY6A 5D41A 4ZXTA 2XEZA 2YAAA 4UB7A 1LEWA 3Q9ZA 4LUEA 3TNIA 4O91A 3FMNA 4DHFA 4WKQA 3P7BA 5EM8A 5E90A 4ITIA 2VTJA 2FSOX 2PUIA 4IANA 1YHWA 5AP3A 3A7HA 4R6VA 2BAKA 4X3FC 4F1TA 2ITPA 4P5ZA 3HMPA 3QQFA 4MXCA 2X81A 5FXSA 5AWMA 2RFNA 3PXKA 4XP0A 4AT4A 5E8VA 5A4TA 3CTQA 3FMJA 5HU3A 2W7XA 4NW6A 5EI2A 3GC7A 5DNRA 2E9PA 4F64A 5CY3A 5EK7A 5JGBA 3CQEA 3ELJA 4CCBA 4XLVA 2Z7RA 4TYHA 5AR4A 3W10A 4D2VA 1XQZA 3UBDA 2YM5A 3RJCA 2WQNA 2WU6A 1Z5MA 1BLXA 2QOOA 3C5UA 3DAEA 4D58A 5J1VA 4FTIA 4I92A 4QYHA 4BDAA 3HV5A 3E64A 4FTQA 5DG5A 1NVSA 1CTPE 4R7HA 1S9JA 4FT0A 4C3FA 4IEBA 5CZHA 4D5HA 3DV3A 3UPXA 4DTAA 4D2RA 3HV4A 3EFKA 1U54B 3NNWA 5CEQA 4MF0A 3BQCA 4F99A 2GNGA 4D0WA 4R7BA 3DS6A 1GNGA 1GZNA 3OXTA 3U4UA 4FKWA 1REKA 3E92A 4FUYA 2GNJA 3N4UA 2OIDA 5CSPA 3QLFA 4ZLOA 4FX3A 5BUIA 3RBWA 2PVRA 4BCJA 2OZAA 2WKMA 4NM7A 3PPKA 3QD2B 4L52A 4R3RA 5CNNA 2C3KA 4HOKA 3F3TA 3P1AA 3EL7A 3D4QA 4RFZA 4IIRA 4XBRA 1G3NA 2HZ0A 2WMTA 3PIXA 4IC7A 5HKMA 5L6PA 4QMVA 4ACGA 5BQ0A 2XP2A 5E4HA 3ZO1A 4N4SA 2XM9A 4QPSA 4BIBA 1GIJA 3FMEA 2XK6A 4HNFA 3R9NA 3O2MA 3WZJA 3F69A 3UYTA 3UGCA 3VS3A 4DBNA 5F9EA 4R78A 1L8TA 2HIWA 1GY3A 4CFFA 3ULIA 3HYHA 5HE3A 1Y6BA 2BRNA 2C6LA 5GZAA 1JBPE 1E9HA 3QCSA 3KRJA 2F7ZE 4PL5A 5AUYA 4L01A 1DI8A 4DEEA 2ONLC 4ZTQA 3ALOA 2C6EA 2JBPA 4EH7A 4GFOA 3G5DA 4KSQA 5E8WA 4MXZA 4BWKA 5GHVA 2W1DA 5A3XA 4G1WA 4KUJA 2IVTA 4LRKA 4IZYA 5ETAA 5BVWA 3Q4CA 3I79A 4BC6A 5CAVA 5K0KA 2IVSA 4IQ6A 5J5SA 3F7ZA 3G9LX 4FUXA 3P79A 4F4PA 2JD5A 1P2AA 3BEGA 2X2KA 2B52A 3TT0A 4AA4A 4LI5A 3D9VA 4MD9E 4C61A 4I4EA 4G3DA 2W1ZA 3VF8A 4R3PA 5HBEA 1LP4A 4TWOA 4OUCA 3E3BX 3FPQA 2ZJWA 3GU5A 3DKOA 4I1ZA 5AA8A 5BUEA 1PKGA 4KIOA 3N9XA 5DA3A 2QR8A 3AC8A 3PVWA 3QTIA 3POZA 1I09A 3HL7A 4BCQA 4L3LA 2B7AA 5ANEA 4UMTA 4DH3A 3FZ1A 4QMNA 5HG7A 4F0IA 4FKTA 5LQFA 1PY5A 3DXQA 3KXZA 3QX2A 2PVLA 2R3RA 3SKCA 4AFJA 4BHZA 4C62A 2GS7A 2I1MA 2CGVA 2XJ1A 2GFSA 2W4OA 3DQXA 3G33A 4CT2A 2PUPA 3CPBA 1BI7A 2PY3A 3EQCA 3QC9A 3S2PA 4JIAA 3UNJA 2CPKE 2VWBA 4FKUA 4GFMA 2O3PA 4BGQA 4E1ZA 3PRFA 5IEVA 3QD0A 1WVWA 3EQHA 4KD1A 3CD8A 1NVRA 3KMMA 4X21A 3PP1A 4LGGA 1JSUA 2QKRA 3WI6A 2B4SB 5K9IA 5K5XA 4KIKA 3QRJA 3NUUA 3NCZA 4HW7A 1ZOHA 5AUTA 3OW4A 5I5ZA 4L7SA 2FH9A 2YDJA 4ACMA 4YZBA 4O22A 3VS0A 3FMLA 4YNEA 2WB8A 3ZSGA 4PMMA 2BALA 2UZOA 1ZLTA 3DBDA 3RPVA 4K1BA 4A9RA 4PF4A 1FGKA 4X2FA 3RAIA 2CCIA 1B38A 2GSFA 3F5XA 3DZQA 4II5A 4DGLC 5LMKC 5CVGA 3DB8A 2GS6A 1W82A 1Y8GA 4AN2A 5DEYA 4EOMA 4C4EA 2C69A 3G2FA 3JYAA 4RVLA 2PMOX 3HGKA 4X3JA 5HG8A 3TV4A 5BNJA 5B2LA 4YJNA 3R73A 1GIIA 4K18A 4D4VA 3UPZA 5FEQA 4MYGA 2BKZA 4PX6A 3D94A 4ZTNA 1XBBA 5KMKA 4FV7A 2PK9A 4ANNA 2J0JA 4WRSA 5I9WA 3LFFA 4FOCA 4C02A 1XR1A 2WMUA 2OJFE 1M2QA 5FGKA 4RWIA 2HZIA 4YHTA 4QRCA 2XCKA 4JS8A 2B1PA 2OJGA 1JSTA 4LUDA 1MRYA 4IX5A 4QNAA 5IMXA 4O0RA 4EK3A 5HLWA 4XP2A 2BROA 4E6CA 4CG9A 4WD5A 5FEDA 3BLRA 3KCFA 5CF4A 4YSJA 3FZOA 5C8KA 3I0OA 5H8EA 2HZ4A 4ASXA 3L9MA 2QC6A 4XV2A 4F7SA 2C6MA 4O7SA 3C51A 4L68A 2FSTX 4NKAA 5BVEA 3FY0A 4BI1A 3NW5A 5ANDA 3SRVA 5KNJA 4KIPA 5FP6A 3ZBFA 4O2PA 4J97A 2YN8A 2XNNA 3DBFA 5A6NA 2W1FA 5IA5A 1QMZA 3UNKA 3DKFA 3Q9YA 3R02A 4AT5A 4O0VA 4E5WA 3QF9A 3QUPA 4F1MA 1IA9A 5IQEA 3SAYA 3A99A 5ANIA 4BDEA 2UV2A 4WNKA 3HAMA 3OTVA 1YWNA 2XS0A 3FUPA 5J9ZA 3NIZA 4JJRA 5CI7A 1OUKA 4FV5A 5JQ8A 2R0IA 3ZZWA 3Q2MA 5TT7A 4YLJA 2V0DA 3RHKA 4CRLA 1ATPE 4JBOA 2VTHA 1MP8A 3IECA 4QTDA 1TQPA 2EVAA 3A7FA 3OCTA 4IM3A 3KC3A 2YAKA 2ZM3A 3ZSIA 4EZ5A 3Q04A 4TYJA 3BQRA 3RTPA 4W4XA 4IAFA 3U6JA 4DT9A 3KQ7A 5G1XA 3FC1X 5M06A 1NT2A 4YJTA 1BYGA 2BCJA 3QKKA 3R9DA 3RGFA 5J7BA 3TZ9A 3N4VA 2ITZA 3SV0A 5J9LA 3OT3A 5M4CA 2VX1A 3FYJX 4ITHA 4USEA 5IISA 2JC6A 3BYSA 4RIWB 4ZS0A 1AD5A 5KBRA 2WELA 4IACA 3UVRA 4EOKA 3CGOA 5CWZA 2AC5A 2PWLA 4MNEB 4FIGA 2O63A 3ZO2A 5BVOA 3DTCA 2ETMA 3ACJA 1WZYA 5BUJA 2PZPA 4XRJA 5E1EA 3BBWA 4JDIA 4J8NA 5DRBA 2ITUA 4LFIA 4XOYA 5LMAA 5L3AA 4P7EA 3R7EA 5FM3A 1JQHA 4HZRA 2E9OA 4TWNA 3VWAA 4ENXA 1YXVA 4G3FA 3ORZA 4EHEA 2HZNA 2PE1A 3P23A 2GQGA 3E8CA 4K9YA 4L45A 3QBNA 5H3QA 3PVBA 4FVQA 4YSMA 3KN6A 2YLEA 3PIZA 1XWSA 2F49A 3EL8A 4P2KA 5CF5A 4RVTA 4O86A 5FTGA 5DLSA 2W5HA 4B8LA 1PXJA 3DLSA 5ACKA 4ACDA 1PXNA 4EH8A 3PG3A 4C58A 3SA0A 1Q97A 3PLSA 4GJ2A 2BVAA 3MTFA 5CU2A 4R5YA 2R3KA 4XEYA 4CNHA 4KRCA 2ITYA 3GOPA 4GVJA 5DPVA 4M0ZA 3ZLWA 4X6QC 2GTMA 3KN5A 4ZY4A 3IGOA 3NUPA 4BCPA 5JH6A 1VR2A 4KBKA 4OTPA 3FQSA 2JFMA 3UC4A 1OKYA 3NUAA 3NUSA 3E63A 2WAJA 3LHJA 4GSBA 3PJ8A 5F1ZA 4G5JA 5CVHA 1KUTA 2CKEA 5FBOA 4Z7HA 2O8YA 4PTCA 3PJ1A 4OTRA 2ITVA 4R3CA 2QG5A 3QTUA 3W2QA 3H9FA 1ZOEA 5K4IA 2YM4A 2YCRA 3FV8A 4I6FA 3KGAA 4PP7A 1TQIA 3IONA 2X9EA 5EM5A 3FBVA 3FY2A 3NYOA 3ZLSA 2BDWA 5HTCA 5HCYA 3ZO4A 3AT3A 4X7QA 3HX4A 2JITA 4PDYA 3BV2A 1E1VA 4Z16A 2PL0A 4XOZA 3RI1A 4UYNA 3KK9A 4U9AA 4RZWA 4OR5A 1PMNA 2GHLA 2FVDA 3QRIA 5EW8A 4IZAA 3UP2A 2VTRA 3RM7A 2WTIA 4CQEA 4WG5A 2I7QA 3FKLA 5IEXA 4C57A 2X2LA 4EH9A 1IAHA 2ITTA 4L8MA 3VNTA 2QR7A 3DB6A 4ERWA 2QO2A 4ZLYA 5KZIA 4RSSA 4LL0A 3B8QA 3A62A 1U5RA 2RG5A 4ZJJA 3VUGA 3E7OA 5CAPA 3BLHA 3P0MA 3JXWA 3KMUA 2IN6A 3QUDA 3H0ZA 4JNWA 3T3UA 4WNOA 3PYYA 3PXRA 5F94A 3TUCA 3VHEA 4YC6A 3VS4A 2RFDA 2WMRA 4FT9A 2J90A 3ZONA 1ZOGA 3MJ1A 4YBJA 3R1SA 4X6RA 1Y91A 3GXLA 3GB2A 2BR1A 5AR5A 4IH8A 2YIYA 3O50A 4APPA 2PZ5A 4M7IA 4W9WA 4F7NA 2V5QA 4L53A 3SD0A 4JOAA 4FGRA 2J0MB 3RINA 3PWDA 4IW0A 4IVAA 5L2TA 1G5SA 3O8TA 3P4KA 3UO5A 4EQMA 3VBXA 4ASZA 4Q9ZA 3K2LA 4ZSGA 5LVPA 3DOGA 1CMKE
chains in the Genus database with same CATH superfamily
2YERA 3MH3A 4DEIA 3PFYA 4NIFA 4A9SA 2QOIA 1GZOA 3G51A 4FKPA 1XBCA 3UOKA 2R7IA 1Y57A 1XH7A 4FV0A 3HKOA 1R0EA 3E7VA 3SGCA 3OUNB 1HCKA 3T9IA 1WBPA 3EB0A 2XNMA 4BCKA 2QNJA 3B2WA 5L6WL 4QMXA 3D83A 2I0HA 3LJ1A 4OLIA 5A4CA 5L2WA 2W1CA 4U5JA 4BCIA 3FMHA 5AR7A 4FKIA 3OC1A 4F70A 3QGWA 3QA0A 1HCLA 4QDVA 4EK8A 2XIXA 3C9WA 4ERKA 4FZ6A 4B4LA 1M17A 1H07A 2A19B 4K77A 3KRRA 4LDTA 4UWYA 2XM8A 4H3BA 3ANRA 3OF0A 4U3YA 3IO7A 3BLQA 2V55A 4O1PA 4RX9A 1CKIA 5C8NA 4BICA 3LKMA 4KBAA 2W1HA 3DU8A 2PPQA 4BVUA 4S32A 2ERZE 4C37A 3BKBA 2R3NA 1OKWA 4R8QA 4C3PA 3PZHA 4F65A 3JUHA 1YHVA 2QHMA 4MAOA 4U8ZA 4D9UA 4FSNA 2PVKA 3ZOSA 3BIZA 3MY5A 3OVVA 1FBNA 2XYNA 4FEQA 5EYCA 3QRUA 2FO0A 4IWOA 5BYYA 2C0OA 4AZSA 2WQOA 3DPKA 2R3IA 3JVSA 1PF8A 2QU6A 4MK0A 4WO5A 5DR6A 4BL1A 4Y5QA 2JIIA 2UZWE 2YCQA 3FMKA 1PXOA 4S34A 1Q99A 4BZOA 4JMQA 3VUHA 4RWJA 5CU0A 3K54A 2W05A 3UIMA 1O9UA 3MPTA 4M68A 3VO3A 1P4FA 3EFLA 3GC9A 1YI3A 3W2RA 4W4YA 5E1SA 2XK9A 5EI8A 1PMEA 4YUQA 5EKNA 5CAOA 1WBVA 5ETIA 1H1PA 3MS9A 5DN3A 1JOWB 4QP1A 5FXQA 2R3HA 3PPZA 3PY0A 2YA9A 4I22A 4ALUA 3TZMA 3PY3A 2CMWA 4QP8A 3IW4A 3BE2A 3F5UA 3QQHA 2BUJA 4EEVA 2JDSA 2HCKA 3RWPA 3PSBA 4OTGA 3AD4A 2OI4X 3WYYA 2WPAA 3HMNA 3UQGA 5M44A 2XKDA 3CJFA 1OITA 1WCCA 2P4IA 4O27B 5A4LA 2OICA 2WD1A 3AC5A 3FDNA 2UW3A 4XMOA 5CSHA 4BB4A 5C03A 4E4LA 2XVDA 2XARA 2XCHA 2IZTA 4FV6A 3FC2A 4ZAUA 3E87A 3WARA 3E8DA 5DIAA 2UZBA 4IWPA 4AGUA 1VZOA 4KB8A 4YPSA 3WZEA 3ATSA 3MPMA 4BHNA 2QD9A 4TKSA 4GU9A 1O6KA 1R39A 4DH1A 3EKNA 4ZP5A 5AX3A 5HD4A 3AMYA 4I93A 4FIEA 4BFMA 5ETCA 5BPYA 3R8UA 4FSMA 4RIOA 1YVJA 4E5BA 2J0IA 4PQNA 1OPLA 4RWLA 5F4NA 4IZ7A 3VS1A 4FEVA 1SVGA 3OY3A 4KA3A 1PW2A 3R1YA 4NH1A 4D28A 1BX6A 1W84A 5KE0A 4RC4A 4R1YA 4FF8A 2FYSA 2R7BA 3F66A 5JSMA 3M11A 3QL8A 4CG8A 4G2FA 3ZC5A 3W0OA 4AS0A 2QODA 4Q5HA 3UJGA 1OPJA 4AOIA 4AX8A 4J96A 3OWJA 5H2UA 3TNPC 5M53A 1OIQA 2IZUA 2UW9A 3QTZA 3K5VA 3UDTA 4WBOA 4H3QA 3TG1A 4BWXA 3FL5A 4BCHA 5FP5A 3R30A 4UMUA 4DG0E 3H4JA 1KE5A 2XNOA 3BHTA 2VUWA 3MIAA 2XK8A 4F1OA 5EM7A 4D4SA 4F7LA 1EH4A 1YOLA 3SW7A 4U6RA 3V01A 3O0GA 5FTQA 4XNEA 3MV5A 4UMPA 1Q61A 4BBFA 3QCYA 4NZWB 2BMCA 4ANBA 1SVHA 2CGUA 4AA5A 4D4RA 4CFVA 1U54A 4DFLA 2QI8A 1OL5A 3A8WA 3F61A 4C4IA 2PMLX 3DKCA 5BVFA 4CKRA 1VJYA 3A7JA 4C8BA 4A9YA 2QOHA 5L8KA 1QPEA 3DNEA 4NWMA 3RM6A 4MD8E 3AD5A 4TWCA 4V0GB 5CXHA 5CAUA 3C0IA 3V5PA 1OBGA 4X2NA 3F2RA 4CMOA 4L43A 4OBOA 4PUZA 4U0IA 4Q2AA 5ANJA 3ZMMA 4E8AA 3OTUA 5IA4A 3F6XA 3PVGA 5GIPE 4Z9LA 5HG9A 1E1XA 2E9VA 4XG6A 3W18A 3NGAA 2Q83A 3KXXA 4L00A 4G6OA 4LOPA 2I6LA 3HVCA 1PXIA 5CANA 2HWPA 4BDBA 4K2RA 3U9NA 3NR9A 3QGYA 4ANMA 3NYXA 2QLUA 3WILA 3UTOA 4AF3A 2XRUA 4GJ3A 4MXXA 4TTHB 5A4EA 4UMRA 4KNBA 2WOUA 1H28A 3OG7A 1H1RA 5IQDA 4CV9A 2OSCA 3RZBA 4YP8A 5JZJA 2B54A 3ORNA 5KMIA 3DT1A 3TTJA 4IADA 2SRCA 5TOZA 4A9TA 1SNXA 2GPHA 4NM5A 2WMWA 1BI8A 4UEUA 3TL8A 3GUBA 3HUBA 4IB0A 3ZXTA 3QTXA 5FLFA 3F5PA 5IQGA 5IZFA 3EN4A 4CMUA 4CYJA 4O7LA 2WMXA 3HMOA 2JIVA 1W2DA 5HBJA 4I6BA 4O0SA 3AKLA 1UKIA 4MCVA 4HPUE 3EZVA 4MBIA 4OBPA 5EQPA 2O65A 3LFSA 4O0TA 3BWFA 4LGDA 4YU2A 4TNDA 4QDEA 4B7TA 2YDIA 5FEEA 1J1CA 3HA6A 4RBLA 4DCEA 4EWHA 5JT2A 1G8SA 3OWPA 3TNWA 4EBVA 3FI2A 3Q4UA 4NU1A 3JR1A 3LCOA 3W2PA 2BRGA 3ZEWA 5IEYA 4C0TA 1ZMUA 4C33A 4K11A 4I20A 4M69B 3ZH8A 3BYOA 2RIOA 5HI2A 5IQCA 4S30A 4F09A 2XIYA 2C68A 2YCSA 3LQ8A 4RJ7A 4U45A 4EUTA 4UZDA 3TUDA 1YXXA 3ET7A 5EFQA 5KCVA 4OAVB 4QP6A 5AAEA 3Q96A 4U79A 3AQVA 4AXCA 4YMJA 5CQWA 4G6LA 2WTWA 4O6EA 4G3CA 3EHAA 4EKKA 3OBJA 4JX3A 2W1IA 3NYNA 5HU9A 2IPXA 2ETRA 4FTOA 3BYUA 4JDKA 2JFLA 3BGZA 3LLTA 3DTWA 4FK6A 3D7TA 4CEGA 4CT1A 3C0HA 3OEZA 5LCKA 3R21A 3HRBA 1FINA 3V5LA 4AN3A 3H10A 2DYLA 2IZRA 4UALA 5JFXA 3Q6WA 4FTLA 5D9HA 2XZSA 3SXSA 3EJ1A 4QYYA 3Q32A 4RMZA 2UZVA 3FMMA 3TJCA 5K4JA 2R3OA 3C7QA 4XUFA 4EYJA 3KULB 3G0EA 5DT4A 2G9XA 1OL2A 4FZAB 4M12A 4XCUA 4JBVA 2XIZA 4AQKA 2R3QA 3N4TA 4FTJA 2XBAA 5JZNA 3KA0A 1IRKA 5A14A 4LQMA 4C59A 2J6MA 3W0MA 4U43A 3F88A 5CEMA 1XH6A 4V01A 3LMIA 1Q8TA 3BGPA 3SG8A 3EH9A 2ITXA 3AGLA 3WF6A 4XRLA 2WTJA 3VBVA 4O2ZA 4GYGA 3CQWA 4QO9A 4DYMA 3NEWA 4TZRA 5HO7A 3MESA 1BL7A 5IKWA 1Y8YA 4DFNA 3ORIA 1JAMA 4TNBA 3C4FA 3CCNA 3BRBA 3VUTA 3VW8A 3NCGA 5DMZA 2VAGA 3R63A 2PVHA 4H36A 5AP2A 3GP0A 3QFVA 2XNBA 4XJ0A 2YFXA 2YM8A 3OOMA 2ZB1A 2R4BA 4EOSA 4O82A 1WMKA 4PPAA 4CMTA 2YIWA 2VWVA 1LPUA 3DY7A 3CP9A 5FRIA 4YZNA 3VUKA 4ONAA 1PXPA 3SX9A 3CC6A 4ANOA 4O81A 3QQGA 2QONA 1IEPA 4KKEA 3NDMA 3OHTA 3PP0A 5ITAA 3ZDIA 5E7RA 3GCQA 4JQ8A 2ZM4A 4PL4A 1B39A 3PA5A 4N0SA 3PTGA 4BIEA 5M56A 4FMQA 2X4ZA 4DDGA 2Y7JA 3ENHA 4N6YA 3HUCA 3SXFA 1KV2A 2GNIA 1PMUA 3AC1A 3AC2A 3F7WA 3O23A 2YDKA 4FKLA 3R9HA 4GG5A 3HRFA 3LM0A 2OBJA 2W1EA 3BELA 3Q9XA 2F4JA 2PU8A 4NT4A 4BZNA 2EUFB 1QL6A 1Q3WA 2JDRA 1JWHA 1X8BA 1WVYA 3PSDA 4AQCA 2BZJA 2R9SA 4RX8A 4PMTA 2ZDTA 5L8JA 3CE3A 4O7TA 4DFUA 2HY81 3M2WA 4GEOA 4FODA 4PNKA 3VHKA 5K5NA 3UNZA 2C6IA 2YJRA 4HZSA 1XH8A 4BCOA 2Z02A 5IQIA 1URWA 4I41A 3TIZA 3PA3A 3TN8A 4HVIA 4RQKA 5AP6A 4QP2A 3OS3A 4BCMA 4YO4A 5KHXA 4M13A 2QURA 1AQ1A 3ITZA 4EK5A 1M2PA 4IC8A 1ERKA 3LZBA 3AMBA 3ZU7A 4LV7A 3K3JA 1TVOA 2C3LA 3ORMA 4QP7A 2WTKB 3FLWA 1UV5A 3OT8A 3OD6X 4Y72A 5E91A 5EYKA 3S1HA 4EJ7A 3PJ3A 2C47A 3NIEA 2WOTA 3EN6A 3GT8A 4JI9A 2XIKA 3D2KA 5D10A 2ESMA 1UVRA 4EC8A 2JKOA 4UWBA 5JN2A 2WTDA 1YW2A 1ZWSA 2BIKB 4JR3A 3PLAE 4IFCA 2I0VA 4KSPA 4YJOA 3VC4A 3ZRMA 4RIWA 3FSFA 4F6UA 5HNGA 2XNGA 4PDPA 3TNQB 1QPJA 2JLDA 2YHVA 2ZM1A 4BTFA 4MNEA 2R3FA 1XHAA 4IAAA 4A7CA 2ZV7A 3W8QA 3ANQA 4FZFB 1QPCA 5CEIA 2BDFA 4LRJA 2X0GA 2X8DA 2PVFA 1J7IA 4RA5A 4X3FB 2GDOA 3R1NA 3DAJA 1YHSA 4LM5A 4EUUA 4C2VA 2NYAA 3KL8A 3VVHA 3R6XA 3E8NA 3IW6A 3QU0A 4NM0A 4RLLA 3LJ2A 1OB3A 3A4OX 1ZYSA 3OP5A 4FSYA 3KF4A 4GRBA 5I3OA 1YXSA 3EFWA 2EXCX 4FKSA 4MXYA 4O38A 4YZCA 4ARKA 1H00A 1Q24A 2WXVA 5DEWA 3OBGA 4FI1A 3RCDA 4E4MA 4U41A 3W2SA 4BDIA 5TF9A 2QQ7A 3V04A 3QD3A 1I44A 4UYAA 5BMSA 4J53A 4I5HA 2B53A 3ZM4A 3DQWA 4L46A 2ZVAA 3WF9A 2OF4A 1LUFA 3TIYA 4HYHA 4C34A 4FSZA 1XBAA 2YISA 4D1XA 3PE2A 1YI6A 4CYIA 3S0OA 3GQIA 4RIXA 3TZ8A 4DFXE 4AT3A 5IA2A 3OMVA 3W0NA 1GJOA 3DK7A 4CV8A 2EXMA 5IDPA 2OIQA 2CHLA 2Y4IC 4U97A 2HENA 5M57A 3DZOA 4FK3A 4U7ZA 5DHJA 1VYWA 2OIBA 3BU5A 1V1KA 2X1NA 4O4FA 3I7CA 2EB3A 3AC3A 4AWIA 1R3CA 5BMMA 3U4WA 5HTIA 3MVHA 1Q8YA 2ZV9A 3SOCA 2J5EA 1WVXA 4O7NA 3CIKA 3S4QA 4HCVA 3GFWA 4AW5A 2H9VA 4DEHA 3S3IA 3FSKA 4AUAA 3ZS5A 4HYUA 1V0BA 2VZ6A 2RKUA 4PDSA 4O21A 4BDDA 1PYXA 5EHYA 4M97A 2OW3A 4FZDB 4NEUA 5CT0A 2CLQA 5AUXA 3SG9A 1UU7A 4NYEA 1OL6A 4NJDA 3F3VA 4F08A 2UVZA 2OG8A 3F2AA 4HGSA 3UP7A 3MFUA 4QQCA 4CFWA 2WMSA 4U3ZA 4CLJA 4CD0A 4ZY5A 2J0LA 4KS7A 4RFYA 4B99A 2GTNA 3Q3BA 1BUHA 2YCFA 4G3GA 4MTAA 1OIUA 3WE4A 3VUDA 4AOTA 5JEBA 2YITA 3WOWA 3W33A 4FNZA 2W1GA 3P08A 3ZFYA 3LFBA 4XV3A 2QO7A 3ZLYA 5LXMA 4RJ8A 2BHHA 4DG3E 4OTIA 2DS1A 3KKVA 2VX3A 4EZ3A 1FGIA 3D5UA 2Y4PA 1F0QA 4QYEA 4WT6A 4E26A 4XS2A 3R71A 1BMKA 4I5MA 4ANLA 5CSWA 2P55A 1TZDA 3L9NA 2JKMA 1OMWA 3CY2A 3IW5A 4AW0A 5HORA 4ZMEA 3FKNA 4JIKA 3RAKA 4IE9A 4FV9A 3A8XA 4ZJIA 4BI2A 4BYIA 2X0OA 4ZZOA 3WF5A 5I9UA 3VAPA 2QOCA 5AMNA 3RMFA 3W2CA 5HX6A 2XRWA 2YACA 4DINA 3CS9A 2P2HA 4MHAA 3G90X 4RWKA 2PULA 3LOKA 5E8XA 4JDJA 4DEBA 3I4BA 5FXRA 2UZNA 4E4XA 1H1WA 4EH6A 1ZYLA 4Y83A 3ROCA 4EC9A 3LIJA 5HLPA 2PMNX 3D15A 4H3PA 4BN1A 3EQDA 4QT1A 2IZSA 3C1XA 4N57A 4EOOA 5AUVA 1KOBA 3GU8A 4S31A 3VQHA 4ASDA 1H1QA 4D9TA 4FEUA 4M66A 2WIPA 3GU4A 4KS8A 4H58A 4MKCA 4DDIA 3V51A 3ZRLA 5JRQA 2FSMX 1JKSA 4O83A 1OL1A 1JKTA 5JFWA 4GKIA 2Z7QA 2PZYA 4PWNA 4DTKA 3W0RA 3UVPA 5TO8A 3TNHA 4G5PA 4RT7A 4PDOA 3CJGA 4DGNA 2UW7A 4TYEA 5EHOA 4PP9A 5IQHA 4IAYA 1PJKA 5E8UA 3QLGA 4JG7A 5CI6A 4FT3A 4FEXA 4D0XA 3FEGA 2GHMA 5C4KA 1U4DA 3NWWA 4IXPA 2JIUA 3MYGA 4DC2A 4IBMA 5ACBC 1A48A 5C26A 3DLZA 5DVRA 3KEXA 3QQKA 4HNIA 3BYVA 5HIDA 4CZTA 3LCTA 4O7RA 2VGOA 4O7ZA 3HRCA 2R0UA 2XUUA 2C1AA 1Q8UA 3MB6A 4AG8A 5CYIA 1WAKA 2VO7A 3ORLA 4XG9A 3UOLA 5DGZA 3UG2A 1OVEA 4OT5A 5EI6A 2VTLA 4EH2A 3O7LD 3MTLA 4W8EA 3TEIA 4C35A 5FUTA 3KVWA 3QWKA 3LFDA 4AXFA 2XANA 4FZ7A 4I6LA 3FZRA 4EQCA 5JQ5A 3FQEA 1YDTE 4MF1A 3CQUA 5T6KA 4ZTRA 3P7CA 4K6ZA 4FT5A 4V05A 5AM7A 4CGAA 3Q53A 3PXFA 3PSCA 1ZY4A 2J5FA 3GEQA 2Z7SA 4XLIA 3VBQA 5G6VA 2VNWA 3UDZA 3OZ6A 4AFEA 5I3RA 2G15A 4MEDA 4K0YA 5C9CA 3LFEA 1YXTA 1V0PA 4GU6A 5LWNA 2XKFA 2GQSA 5F20A 2OWBA 1Q62A 1M2RA 3QYWA 4FKJA 5IH6A 3S00A 1R1WA 2IF8A 5CEOA 2XAOA 5AUZA 1H01A 2H96A 2FA2A 3ZM9A 2W4JA 3QHRA 3BL7A 4CSVA 3GOKA 5IU2A 2BAJA 4CZUA 4D2PA 3DBCA 4BZDA 5J87A 1JLUE 3F9NA 4MVFA 3SLSA 3DJ5A 1A06A 3LCSA 4EOIA 5IUHA 4O96A 4S2ZA 5CX9A 3COKA 3II5A 3MW1A 3QZGA 4FSQA 3LQ5A 4FSTA 5B0XA 5I9ZA 5KUPA 4Y5HA 4YC8A 3VS5A 3KXHA 3U87A 3R8PA 3U6IA 2AUHA 4AE9A 4AP7A 1J7UA 1H0VA 1W83A 3VS6A 2JEDA 2Y4IB 3SOAA 1SM2A 3IQ7A 3NAYA 4D2SA 1HOWA 2HW6A 2X7FA 3VBWA 3VN9A 3JVRA 3MVLA 2REIA 4M84A 4QMUA 1ZYCA 2P33A 4C4GA 2A4LA 5EDPA 1Q3DA 3K3IA 3PZEA 1MRVA 3UMWA 4BBEA 3C4ZA 4MXAA 2VD5A 5AV0A 4IVBA 3UZTA 4DBXA 5HEZA 3FXWA 4AGDA 1M52A 2QOBA 2P3GX 4B6LA 4FKVA 2VGPA 5HVYA 5IG1A 2PUNA 3QTRA 3RK7A 2YJSA 5HESA 4XYFA 3OCGA 4BF2A 2ZMCA 3RCJA 2G1TA 2KTYA 3MFTA 1LR4A 4FL1A 4MQ2A 3RPOA 5AA9A 3FXZA 1KV1A 5GJFA 3P78A 5IUGA 5C4LA 3ODZX 5EDRA 3VBTA 1G8KA 1CM8A 4FKRA 5A9UA 4NTTA 4CFUA 5JFVA 3HLLA 4IFGA 5ICPA 3JS2A 3O7LB 2JKQA 1UWJA 2IWIA 3MFSA 4QP9A 1UNLA 2A98A 3A7GA 3A4PA 1H26A 2R3JA 3Q5IA 4D5KA 5TE0A 4YJVA 2HK5A 5EW9A 3T3VA 5L2IA 3D2IA 5CSXA 2ZV2A 4XG7A 2IVVA 1J7LA 2E2BA 3TCPA 5DH3A 3FE3A 2AQXA 1FMKA 4GCJA 5IPJA 5E9EA 2R64A 4NW5A 1OUYA 1PHKA 4DCAA 2WNTA 4OTQA 1PXLA 2JAVA 5LOHA 2AC3A 4FEWA 4RIYB 5FM2A 2CNVA 2VX0A 3AXWA 4DH7A 4E3CA 3CY3A 3TTIA 2QOFA 1OM1A 3R83A 4ACHA 3QCXA 3V6RA 3RK5A 3OCBA 4ZSAA 2VTSA 4YJQA 3QWJA 3VW6A 3GQLA 3QTSA 5AM6A 3FHRA 1Q8ZA 4LMNA 3ROYA 1O6YA 4KABA 4LYNA 4EOJA 4LV5A 4GVAA 3KRXA 1U59A 5CU3A 4YJUA 2J50A 4GL9A 3WF8A 2QOLA 4YURA 3ZO3A 1Z57A 3B2TA 2UZUE 4CFXA 4HVGA 4V0GA 4CTCA 3LQ3A 1RDQE 2O0UA 4DEGA 3RK9A 3GNIB 3OEFX 2W96B 3E8EA 3OUKA 5ETFA 3VRZA 5J79A 1URCA 4ID7A 1H25A 4QMPA 2OFVA 3VQUA 3IDCA 4OW8A 2NPQA 4YGAA 4TRLA 2XJ0A 4K33A 4V04A 2PVMA 2PVNA 4FIFA 2CKPA 3OROA 4IJPA 4GH2A 4I24A 4GT3A 1OPKA 5KMNA 5EYDA 2Y0AA 1P4OA 5HHWA 3KF7A 2B9HA 4IX4A 1XH9A 3FL4A 4NFNA 5JMSA 1FVTA 2FGIA 5M51A 5FWKK 4IHPA 3E88A 3WE8A 4ANQA 1OGUA 4A9UA 4NCTA 4EZ7A 4EHGA 5KX8A 1V0OA 1IR3A 3ENMA 4GK4A 3UOJA 1ND4A 2PSQA 4ZK5A 1SVEA 4FTAA 1LEZA 3C4EA 1XO2B 2W06A 3OXZA 4I5PA 1NXKA 2VU3A 4FICA 4FSRA 2VWYA 4ZZNA 3UDBA 4GKHA 4FV4A 4TPTA 4IB1A 2LAVA 1UNGA 3EQPA 4BDFA 4F6SA 4ORKA 4IDTA 3PRIA 4NTSA 4DTBA 3GGFA 2X9FA 4P4CA 3R2YA 2G2IA 4I4FA 3IG7A 3R7VA 3LMHA 3BZ3A 4CXAA 3ORXA 3PFQA 2W5BA 3EYHA 3BI6A 3R7GA 4PV0A 2BZIB 3QXPA 5DE2A 3U8WA 3W1FA 2BAQA 2YZLA 3UDSA 2EU9A 3FYKX 1ZMVA 3FI3A 5HE2A 2ITOA 3AC4A 2E9UA 4P5QA 3P9JA 3R1QA 2Q0NA 2X0PA 4R7IA 4M3QA 4NUSA 4UBAA 2GNHA 4DFBA 1JPAA 5CTPA 4XG8A 2WTCA 4G3EA 2GNLA 3TV6A 4AXDA 4M69A 3NFGB 5D12A 5BYZA 2PYWA 3ACKA 3LXLA 3IKAA 3CD3A 2VN9A 4O7YA 2CGXA 4F7JA 3NW7A 4XH6A 5HCZA 1M7QA 3KVXA 5CF6A 4FKGA 3CPCA 2IO6A 3EQFA 1J91A 1SZMA 4FA2A 2V62A 3SDJA 5IMEA 3UVQA 2HW7A 4JX7A 2BDJA 4JG8A 4DEDA 3HEGA 5HO8A 4CVAA 3ORTA 4G9RA 4U80A 4AXAA 4CRSA 5IQBA 3VULA 3C4XA 1OIRA 1FVVA 4MBLA 2C4GA 3NSZA 5DRDA 4WUNA 4ZTSA 4DITA 2RSVA 3NAXA 2OKRA 1FVRA 4I0TA 2VWUA 3DXNA 4FKOA 5AP1A 5KMMA 3DFAA 3AMAA 4JL9A 4BTKA 5LWMA 4AXEA 2X2MA 4FTMA 3BEAA 3P5KA 4L42A 4FG7A 4UN0C 4RG0A 5BVDA 3MDYA 5KMOA 4QOXA 4F9CA 3REPA 5KMLA 4D1ZA 4XV9A 3MBLA 4ZEGA 3CKWA 3SC1A 4FKQA 1PMVA 3UQCA 2FSLX 2C6DA 2GU8A 2I0EA 4KINA 4QTAA 4BKYA 5CNOA 2XF0A 1ZXEA 4PPCA 4BKJA 3POOA 5M08A 2VTTA 3DCVA 2WMAA 2YABA 4QTCA 4HVDA 5LVMA 3M42A 3ULZA 4RLKA 4YJSA 2YZAA 4EORA 3V6SA 3ZXZA 3T8OA 3GU7A 5DI1A 5C01A 5AEPA 5AV2A 3GC8A 3FJQE 3OXIA 2JGZA 4D4YA 4IZ5A 2YM3A 3TWJA 4FV8A 4W8DA 1U46A 4FNWA 3V5TA 3FI4A 3OOGA 3O96A 3GCVA 4KRDA 1SNUA 4B9DA 4NJ3A 5HCXA 3E62A 4MBJA 2DUVA 2GFCA 2OXXA 3UE4A 1IA8A 1UKHA 1YDSE 2G2FA 3C50A 4FIHA 5AIRA 4QNYA 3PY1A 4MD7E 5EH0A 2QO9A 5HOAA 4P90A 3C13A 2BRHA 3FZSA 4YZ9A 2X6DA 4RFMA 5AAGA 3KXGA 5C27A 3BU6A 3RPSA 3L8PA 1U5QA 4OTWA 3WZUA 4X2JA 3MA3A 3Q60A 3FQHA 4K8AA 4NM3A 4OAUC 3LFQA 3R28A 1K3AA 5AR8A 5J95A 1NA7A 3F3WA 3V5WA 2X6EA 3EN5A 3U55A 3ATTA 3IGGA 3LE6A 5CSVA 4FV3A 4EOQA 2CLXA 4BGHA 3UIXA 3DFCB 3LXNA 3FLYA 1DAYA 4J8MA 3PPJA 1DAWA 4TL0A 1OI9A 3TUBA 4BWPA 4QTEA 1NY3A 4OBQA 4YC3A 1ZYJA 3MGYA 2VTOA 2NO3A 5HVJA 4E73A 4ZIMA 3V8TA 4EOLA 5CALA 2UW6A 3P86A 5GINE 3PA4A 4RQVA 4Z3VA 5L2SA 3ZYAA 3BU3A 4M8TA 5CLPA 2X39A 3HP5A 5TKDA 4IVCA 3CBLA 5HGIA 1YQJA 3VJOA 3NX8A 4M0YA 2AEGA 3FI8A 4YPDA 3NNXA 1WBTA 1STCE 3LJ0A 4YZMA 3EZRA 5JKGA 5CU4A 1XH4A 3TDVA 2BIYA 2OJIA 4FTRA 3MH0A 5LARA 2Y9QA 4WRGA 3LVPA 2XKCA 3ODYX 3FLQA 1DI9A 3GC0A 3UIBA 4ZOGA 2YIRA 4KIQA 5HIBA 2BRBA 2OK1A 1QCFA 1UNHA 3V5JA 2J9MA 3C4CA 3VUMA 4BDHA 5HLNA 2OXDA 4R5SA 3RHXA 2Y6OA 3LLAA 2EXEA 1PYEA 2XB7A 2PE2A 2XBJA 5F95A 3F82A 3NVKI 2WGJA 3MJ2A 3FXXA 2B0QA 2F2CB 4X2GA 3RNYA 3RP9A 2VTPA 3A60A 2W4KA 3EMGA 2C5XA 2WHBA 3ALNA 2DWBA 2FUMA 1ZAOA 4TY1A 3EQBA 2VTIA 2XKEA 3L8VA 3B8RA 4FNXA 2ZAZA 3BHUA 2JDVA 4J1RA 3ZFXA 3Q4TA 4BTJA 5BX0A 4WIHA 3I81A 4JVGA 4YLKA 2WEVA 4X3FA 5HO6A 2XAMA 1WBWA 1T46A 1OGYA 3C5IA 3QC4A 3WYXA 3NW6A 4I3ZA 4A4LA 4QMLA 5JK3A 3E93A 4IAZA 5EYMA 3LXKA 1S9IA 3G6HA 1PKDA 3O8UA 3RVGA 2HAKA 5M4UA 5HIEA 2Y8OA 3CEKA 5B7VA 1GIHA 4BGGA 4HGTA 5AP7A 4E93A 3Q52A 4E6DA 2WQBA 3CXWA 3KB7A 3NMUF 3I7BA 2BZKB 3FWQA 4QMSA 1ZZLA 4QPAA 4UZHA 5D7AA 5IDNA 3OWLA 3QRTA 4LGHA 4QD6A 2YWVA 1ZZ2A 4AW2A 3MVMA 2Q0BA 3EQRA 3H0YA 4BDKA 3CR0A 3H30A 2OF2A 2UZDA 2PHKA 3RPRA 5HNBA 4FTTA 3RAHA 5AR3A 3R8LA 5BYLA 3R8ZA 4FE2A 5AFVA 2C0IA 3IS5A 4D55A 4QQ5A 3LFNA 3QX4A 2X8EA 4O0YA 1MQBA 2BHEA 4OT6A 2BTRA 3MN3A 4ITJA 4G9CA 1TFFA 2H6DA 4D2TA 2IG7A 2I40A 3CTJA 4YTIA 4WBBB 4USFA 4PMSA 3R01A 3QRKA 4H1MA 5FTOA 4Z7GA 5M55A 4C4FA 2WMQA 4U42A 4H1JA 4I6HA 3TKIA 3EQIA 4D2WA 4FYOA 3NYVA 4WSQA 3DK6A 4YO6A 4UWCA