4Z55A

Anaplastic lymphoma kinase catalytic domain complexed with pyrazolopyrimidine derivative of ldk378
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
307
structure length
294
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design and synthesis of novel selective anaplastic lymphoma kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords ALK tyrosine kinase receptor
total genus 102
structure length 294
sequence length 307
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4z55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4z55A01
4Q9SA 3IGOA 3BYVA 2OJGA 4K0YA 4AN2A 4QP9A 4DFXE 3R6XA 3PXZA 3RHKA 2BFYA 3NUSA 3R8MA 3VF8A 3IOPA 2BZKB 2IVTA 2BROA 3BE2A 4GU9A 4IH8A 4NEUA 4JDJA 3Q5ZA 4RGJA 5CNOA 4ZEGA 4FV3A 4L53A 4HCVA 3C50A 3BBWA 3OMVA 4HYIA 2JITA 5K4IA 1RDQE 2IW9A 4APPA 4D2RA 3EQHA 2PVHA 5CF4A 4EC8A 3LFAA 4YGAA 3W32A 4ALUA 5HNBA 4JBQA 4PRJA 1E1XA 2PZRA 3FLWA 4YJUA 3MFSA 3EFKA 3DK6A 4WRGA 4IC7A 5M51A 4KINA 4W8EA 1FVVA 3KU2A 1LP4A 5E1SA 4E93A 4FKPA 2DQ7X 4O0YA 4RJ4A 3W2OA 4IWDA 3BHTA 4FSNA 3SG8A 5HBJA 5FUTA 4CLIA 2CJMA 3P9JA 5M44A 4EWQA 4TRLA 4JG6A 1J7IA 4HGTA 2OZAB 1TKIA 3O8TA 4DTAA 2P55A 3LOKA 4J53A 1P4FA 5JEBA 3ZRKA 2VTSA 4FTJA 5HD4A 2PVJA 4EOJA 4Y85A 5L2TA 3SOCA 4FL1A 3VS2A 2W5BA 2XEZA 3JVSA 4IC8A 4IAZA 3RAHA 2I0HA 2WFYA 3ROCA 3HUCA 2OIQA 2PZPA 5DEWA 3OEZA 3ANQA 1SVEA 4FKOA 3JS2A 3R63A 4R1YA 3RTPA 2HYYA 3KL8A 3PY1A 3LFEA 5DGZA 3C5IA 4FZDB 2VTAA 4GH2A 2ZDUA 3FMLA 2DUVA 4JG8A 2OF2A 4PDSA 2JBPA 2OO8X 2QURA 3PWYA 2B54A 5CT0A 4UMPA 5E8XA 5AP5A 3ZH8A 4DEEA 4HYHA 3F7WA 1R3CA 4IX5A 5I9VA 2NP8A 5HNIX 4HCTA 5CAVA 3Q9WA 4M13A 3RPOA 4HYUA 1BUHA 2XIRA 3JVRA 5DT3A 1NT2A 4BI2A 2R3QA 2UW7A 3W18A 5F9EA 3I0QA 1Q62A 5AP3A 3B2TA 3JR1A 2CN5A 4J98A 4FTQA 3BEAA 3FLNC 4O7YA 4BR3A 2ITVA 4EH4A 3KA0A 3ODZX 3FQEA 5L6OA 5LCJA 1YDRE 5LVNA 5IQCA 3TV4A 4GW8A 3P0MA 3UVRA 1OPJA 4TYHA 1PMUA 5FRIA 4BFMA 3TTJA 4L52A 3VS3A 1WBTA 3QGWA 4WUAA 2WMQA 3MVMA 2JEDA 4C4GA 4C59A 3PIYA 4QYGA 5EI6A 4BKJA 3D5VA 3FC1X 4O0UA 3DJ5A 3L8PA 1YWNA 2Z7RA 3R83A 4CMUA 1URWA 2J0MB 4GV1A 4C02A 2VTRA 2B55A 3QZFA 4CFXA 2HW7A 4BGGA 2I0VA 2IW6A 4XX9A 2YA9A 3TNWA 4QTBA 3NWWA 4U42A 1FINA 3V8WA 2F57A 1Q41A 3F5XA 4XG3A 4YSJA 3IOKA 1E9HA 4H1JA 4O27B 3EYGA 3H9RA 4LOPA 3VBWA 2Y9QA 5JRSA 1IEPA 3RPVA 4E73A 1ZLTA 4FIFA 2OF4A 4WG5A 4GMYA 4RSSA 3IW8A 4L45A 4C38A 1M52A 2QNJA 1WBWA 3HEGA 1F0QA 3PP1A 4AGWA 4EK5A 4EOLA 2OGVA 4E4LA 5A14A 1DAWA 2A27A 2YM5A 3NRMA 4FV9A 2R64A 5KE0A 3KC3A 1UU9A 4AX8A 3VJNA 5CNNA 2XK4A 3U55A 3LFCA 2WXVA 1PXLA 3C1XA 4KBAA 2BAKA 4ZY6A 2Z02A 2GDOA 3OY3A 3GCSA 4OTRA 4ZXTA 3NCZA 1YI4A 3ODYX 4G17A 2XNBA 4PMMA 1UV5A 3POZA 4D55A 2BPMA 4AGUA 5IPJA 3U4UA 4D4YA 4FKUA 3ZONA 3PXFA 5HLWA 3REPA 3TTIA 4J71A 4OTGA 2C6OA 2UZNA 2E2BA 4KIOA 2W1DA 3ZHPC 1JKLA 2PVKA 4D2WA 2PMNX 4JBVA 3FPQA 2C1BA 3C4WA 3HRBA 3QTRA 4GJ3A 4O0XA 4Y83A 3D7TA 3E7OA 3HMPA 1J7UA 3QZHA 3TNQB 3VUTA 3GFEA 3TDVA 3ITZA 4MF1A 1WVXA 5CAQA 4QMUA 2C6IA 4ALVA 2XKCA 5BX0A 2B0QA 4QQ5A 5FD2A 5EM6A 2QOKA 3EKNA 3KF7A 3QWJA 2QKRA 4EBWA 2RFSA 3FKOA 4M15A 3IGGA 4M97A 4AG8A 3QXOA 4F6WA 2XNPA 1UNLA 4JDKA 2PWLA 4YTHA 5FEDA 4D5KA 5JMSA 5GIPE 1UWHA 2WHBA 2GQGA 2VNWA 5DFPA 1OL1A 1Y8YA 4JX3A 1XJDA 2HIWA 3KN6A 2A2AA 4I4EA 1NA7A 4S33A 4X2KA 4ZMFA 3KXZA 3E5AA 3NNWA 4AFJA 3QHRA 3OUNB 3DY7A 4KAOA 4BIDA 5AUUA 2UW4A 1DAYA 3K3JA 4DEAA 3FL5A 3IW6A 1R39A 4MXYA 4NL0A 2E9OA 4B9DA 5AV0A 5H3QA 3BLQA 5CF6A 4OTQA 4YHFA 2R3OA 4AT5A 3AC1A 1Q3DA 4XMOA 4DH7A 3UBDA 2C69A 3NEWA 1UKIA 2JGZA 4LI5A 5E8VA 4APCA 1H1SA 5AV2A 1PF8A 4YNOA 2XIKA 4ZSAA 3QYZA 3P5KA 3DNEA 4AGCA 1ATPE 2OJFE 3OZ6A 4FF8A 5FM3A 3ZRMA 5DOSA 4R1VA 4GG7A 5A6OA 3BKBA 1ZY5A 4K77A 4YZNA 4TNDA 5E8ZA 3DTWA 5JFXA 4WSYA 3EQGA 3TUCA 3AT3A 3H30A 2GTNA 2WTKB 2C5YA 4G6LA 3P79A 3EH9A 4DINA 3C4ZA 1PMVA 4FZAB 3AD4A 2CHLA 3HV7A 5HLPA 3OWJA 2R3IA 5CF5A 2J5FA 3IDBA 5EI2A 3AXWA 5KMKA 4U8ZA 5KMJA 3CKXA 3U6IA 4EH3A 2CGXA 3LJ2A 4FTTA 4ARKA 3QTXA 4USEA 3OVVA 1QPJA 2BHEA 2IVSA 4TKSA 3V3VA 4E7WA 3OWLA 4K8AA 3RAIA 4ZSLA 3FY0A 3SG9A 4KSQA 2QOQA 2C3LA 4GT3A 1NY3A 5AJQA 4RWIA 2PE0A 4FE2A 4FTUA 5ANGA 2V22A 4MXOA 4XV2A 4MBLA 3FL4A 5J9LA 1JBPE 3NZ0A 1SM2A 4LOQA 2FUMA 3QTSA 2B9HA 5IA5A 4KS8A 3T8OA 3ALNA 5HBHA 4ZJIA 2WTVA 3F6XA 4MNEA 3RKBA 3TUDA 3E3BX 2BRGA 2IWIA 4PF4A 3C4EA 4NSTA 4QYFA 3GGFA 3EQRA 4O6LA 5HCYA 4FSQA 3L9LA 4D1XA 3EFJA 3KXNA 3ORIA 3DFAA 3LXKA 4I3ZA 4AOTA 3NPCA 2BDWA 3CCNA 3NW7A 4LMUA 4I1ZA 1ZYCA 3GC7A 2BZJA 3DBCA 4OTDA 4GRBA 4AE9A 2B9IA 4CG8A 5CASA 3ZSGA 1DS5A 3QRIA 1H1QA 4XLIA 4D9TA 3NUPA 3CD3A 4TY1A 4U81A 3F5UA 4QYYA 5AR8A 3RJCA 5JGDA 3MH1A 3V5LA 2PPQA 2W06A 3L8VA 1RW8A 4BTJA 2VX1A 2WMTA 5HIBA 3OY1A 4I23A 5DH3A 4EZ7A 2EB3A 1PYXA 2ZV8A 4GU6A 4FKQA 4ENYA 2O65A 5HIDA 4GFOA 3RHXA 2X0GA 3IECA 2ONLC 4IW0A 4ZSGA 2G9XA 2X6EA 3V6SA 2VN9A 1KV2A 5M4FA 3I81A 4HPTE 4H05A 4QP4A 3UG2A 3IO7A 3PFQA 4C0TA 3BU6A 4FEUA 3SQQA 3ZBXA 3UO5A 3P4KA 3DLZA 3QGYA 2VNYA 2R3KA 5ACBC 3R7IA 3UNKA 5BVFA 5DYJA 2WTDA 4UWYA 2OZAA 3NUYA 5EDRA 4ZZOA 4PL4A 4YPSA 2Y4PA 1OGUA 3B8RA 3CJGA 1H1RA 3IDPA 3NCGA 5J8IA 5J5SA 4AF3A 4WOVA 3PXQA 2Y6MA 3BV3A 2GNFA 2ITUA 4RLLA 3P7BA 3PJ8A 4RJ7A 4M69B 3CJFA 4GT5A 3RALA 4ERKA 5BYZA 2W1CA 1W8CA 3R1NA 4F64A 4PDOA 4FG7A 4IZ7A 4U7ZA 3MFRA 5DVRA 3TI1A 2X81A 4GKHA 5E9EA 4I5CA 4QD6A 2OICA 2Z7SA 3GI3A 4XP0A 4BDKA 4CSVA 3FZTA 1CKJA 5KHWA 3KXGA 3MIAA 3DOGA 3OP5A 1WBVA 4YU2A 3UOJA 3E62A 5AWMA 3UZPA 4RLKA 5F4NA 4D4SA 4BDEA 3NS9A 4JAJA 3R73A 4O1PA 4RWKA 3NDMA 3ZDIA 2W7XA 3UDBA 1KWPA 4EORA 4X2FA 3R9DA 4RC2A 4E3CA 4FZ6A 3LMGA 4BN1A 4NH1A 3OCSA 3R7EA 5HHWA 3S00A 5LVOA 2JKQA 3I7CA 3G9LX 5M4UA 4A07A 4PPCA 2HELA 3UP2A 5EDQA 3ZLSA 4AXAA 2NNWB 4J1RA 4KRCA 4BCMA 4UALA 2WTWA 3QZIA 4FEQA 4IB5A 5DRBA 3CTHA 2XK9A 2VO0A 2BZIB 2B1PA 1IA8A 3HMNA 4JQ7A 3DXQA 2WELA 2JKMA 2XK7A 3WIGA 1FMKA 5I9XA 4MD8E 4OUCA 4TL0A 1ZYLA 3RK7A 3QYWA 5J95A 3MFTA 2X2LA 1EH4A 3OOMA 5BMMA 3GENA 4H1MA 3QTWA 3RAWA 5JZJA 4CV9A 5BVEA 2EUFB 3QD4A 2W05A 1H26A 4CD0A 1GZKA 3D5WA 4ZTMA 3A7JA 4AWIA 2WMXA 1SNUA 2W1HA 4P7EA 4Q2AA 2WOTA 5EH0A 4AA4A 4XRLA 4RC4A 2W1EA 4DG3E 3COMA 3CKWA 3NMUF 3M42A 2YAAA 1JSTA 1APME 1U46A 3O8UA 3Q6WA 4YJTA 4EL9A 4F7JA 3QHWA 4H3BA 2PSQA 3ZFYA 3HGKA 3ORTA 2YM4A 5H8EA 5HCXA 3I5ZA 5IQFA 3KK8A 3PTGA 4C33A 2GQSA 4XHKB 1U4DA 3MJ2A 5BQ0A 1A06A 2I0YA 2WO6A 4AAAA 4ZK5A 2I6LA 4ACGA 1ZMWA 2R0IA 2AUHA 4UYNA 4HCUA 5AR3A 4FTOA 3TNIA 4NYEA 5HLNA 4BDDA 3FMKA 4ZTSA 1GOLA 4GFMA 1XO2B 2XKDA 2OJJA 2PE2A 4YP8A 4U44A 3K54A 4DH5A 4EH7A 4Y46A 4FGRA 5AP6A 5L4QA 5ANDA 3TM0A 1CM8A 4U3YA 4TWNA 2GMXA 4X6QC 4G9CA 5ANEA 2WEVA 4RX8A 2OXDA 2QODA 3PVWA 1Q61A 2AC3A 5ANOA 4O7RA 3W8QA 3NW6A 4M69A 3RVGA 3QTQA 4B99A 5AX9A 3QQHA 1B38A 3R71A 3MESA 3H3CA 3DGKA 2C68A 3TACA 5JQ8A 3HRFA 3FEGA 2XJ2A 3OD6X 3WZKA 4BDAA 3BWJA 5TO8A 1MQBA 4DYMA 2VTHA 2QU5A 5AR7A 5FG8A 5FDPA 3ZM9A 3EQCA 4OTIA 2C5XA 3FXXA 3GXLA 2XCKA 3VUDA 4YZCA 4U5JA 4CQGA 3EN5A 5EI8A 1GZ8A 1IG1A 1ZZ2A 3FPMA 5M57A 2O3PA 5JFVA 3NYVA 1UU7A 2RSVA 4GUEA 4ENXA 3RINA 3LHJA 4ACCA 2W9FB 3S3IA 5AAEA 4ZSJA 5AV1A 3E93A 4A9UA 2GFSA 4FV2A 2BTRA 4JS8A 2QONA 4FYNA 4AZTA 2XM9A 1W7HA 5IEVA 4O82A 1YQJA 5HTCA 4O86A 4FL3A 4A9TA 1YXSA 5KBQA 5HVYA 3TZ9A 5JFSA 5J1WA 1BMKA 5I9UA 3VVHA 3N9XA 4EUTA 1IRKA 3DZQA 3MIYA 4YO6A 3UMXA 4O7SA 2OXYA 3DXNA 4MK0A 4S32A 4AUAA 2J90A 2VWIA 3FYJX 4J8NA 5LCKA 3W2RA 4BCFA 5H9BA 5EKNA 1NXKA 5AR5A 4TNBA 1Y57A 4TYJA 5HX6A 4JRNA 4AOJA 4FNZA 3ZUVA 4Z16A 4YJNA 5D1JA 5KZIA 3GT8A 3VUGA 1YKRA 2YZAA 4BICA 4CEGA 4QP7A 4G3DA 2XA4A 3EYHA 4ZTNA 4EOSA 1UA2A 2WNTA 2YIWA 5FXQA 3ZOSA 3LFFA 2ITZA 4E8AA 1LR4A 2CDZA 2X7GA 5EQYA 4P2KA 1Q8TA 4EOQA 3QQGA 4N0SA 4GIHA 2BALA 3UNZA 4DT8A 1OPKA 4OLIA 5CYIA 3FAAA 3PZEA 4MHAA 5AM7A 3SV0A 2QU6A 5AR2A 3BYUA 4IZAA 1QMZA 1YW2A 2PYWA 4BDJA 5HESA 3KKVA 2QD9A 3F3TA 2XYUA 3KVWA 1T45A 4MXAA 4IWOA 3FMHA 4NK9A 1IASA 4PMSA 2ITXA 4FOBA 2WTKC 2E9UA 1TQIA 4A9YA 5HORA 3D2KA 4D9UA 3WZDA 5HX8A 2H34A 4XV9A 4BDCA 4QP6A 3MTFA 3KB7A 3KGAA 4QMVA 4JR3A 5AIRA 3KEXA 3LFSA 3OC1A 2R0UA 3LIJA 3GC8A 4PUZA 2IVUA 2AC5A 3HDNA 5AM6A 1NVSA 1WFCA 3A61A 4FK6A 1K2PA 2RG5A 3BCEA 4ZTQA 1UVRA 3FUPA 3HV3A 1KE9A 2HZNA 4YJQA 3TG1A 4G34A 3QQLA 4F6UA 3UC3A 4ITIA 3ZTXA 3CS9A 4OGRA 4ANOA 4KIKB 2G2FA 4PDYA 3GB2A 1JAMA 4EONA 5ITAA 2OFVA 5HO8A 4RIWA 5L8KA 4KWPA 3CBLA 4F0FA 2YN8A 4IEBA 3BI6A 2UW3A 3COKA 3EN9A 4IX6A 4X3FC 5M07A 3VQHA 1JWHA 3QD2B 4O21A 3AT4A 2B4SB 5C8MA 5CAUA 3QRKA 4FUXA 3FZSA 5DI1A 1WCCA 2ITNA 3OXZA 4QYHA 4PMPA 5CWZA 1ND4A 5LVMA 4J97A 3TWJA 4B7TA 2R3FA 3MVLA 3R8ZA 2OJIA 2WMAA 2HXQA 5J7BA 4ONAA 5M09A 4FTCA 5BMSA 5AP1A 1U5QA 2FGIA 5CU4A 1XBAA 4FMQA 2VWWA 4WBBB 1IR3A 4CZTA 2XBAA 1H1PA 4D4RA 3FZPA 3QC9A 3VC4A 2RKUA 4IB0A 2X39A 4LG4A 3I0OA 5CENA 4ASZA 2XYNA 3KMMA 1Y6AA 4BCPA 3QA0A 3BHYA 2WD1A 3LLTA 2JBOA 4DHFA 3MJ1A 4BBFA 1FBNA 4YJPA 2ZB1A 5HI2A 3CGFA 2BVAA 2FSOX 4QMSA 1UWJA 2QOLA 4QMYA 5A3XA 3GU8A 2GNGA 4XP2A 4ANNA 1BLXA 1XKKA 2UZDA 3LZBA 4QYEA 3PSDA 5I5ZA 4UZDA 1CSNA 4O22A 3BHVA 3VULA 2YACA 3EN6A 4UMQA 4LFIA 2PZIA 2WMBA 2W17A 3TV7A 1K3AA 5FEQA 3R22A 2G01A 3CLYA 1VYWA 4BZNA 4R8QA 4C4EA 2PMIA 4QNYA 5JH6A 2VRXA 2ITPA 2GS2A 5FGKA 1JVPP 4QMWA 5C26A 3QXPA 2ZJWA 3A7FA 3OOGA 4PP7A 4FL2A 4YBJA 2G2HA 3R1SA 4XP3A 4FVPA 4FSZA 2LGCA 3VRZA 2XUUA 3BYOA 1V1KA 4JI9A 3CPCA 1ERKA 4GYGA 4XG2A 4N6YA 3WE4A 5JGBA 2YCFA 4C4IA 4IWQA 2I7QA 4Z7GA 3ULZA 2JD5A 4JDHA 4YNEA 4R7BA 3R7YA 3A7IA 4WD5A 4FKVA 3CY2A 4XOYA 3W16A 4RIYA 3SKCA 3GUBA 2X1NA 5AAFA 4BCJA 1YXVA 1ZOHA 4CFVA 3DKFA 5IH6A 3OTUA 2C5VA 3WZUA 1FOTA 2CLQA 3TZ7A 4IVDA 1HOWA 5T6KA 1IAJA 3P7CA 3NVKI 4D1SA 4L3PA 3QUEA 5M06A 4MXZA 4G9RA 2IG7A 2RFEA 3FI8A 4TYEA 5DRDA 5L6PA 2WMVA 4YBKA 3SD0A 1XWSA 4KA3A 2CPKE 4IZ5A 2BILB 5L2QA 2R3PA 4F9BA 1E1VA 4C37A 3MPAA 2XJ1A 2V5QA 4MYGA 5CSHA 5HG9A 3V8TA 4BCHA 2QI8A 5KMIA 3KCKA 1GZOA 2WU6A 3NIEA 2W4KA 1GAGA 4QO9A 3A8WA 4LMNA 4P90A 4I21A 3E63A 3KMWA 1YOJA 3HKOA 4XCUA 4X3FB 4NM7A 4NW5A 3R01A 4O91A 2X9FA 4IX3A 5AIKA 4GS6A 1LUFA 3NYNA 2QR7A 2QOIA 3C13A 4IDTA 2R3HA 3AOXA 3TL8A 2ITTA 3JYAA 3EFLA 3Q04A 4EHGA 2BUJA 3R28A 5EOBA 2OBJA 4D2VA 4BYIA 5J79A 3LCSA 3OBJA 2UVXA 3G0FA 2PULA 3HMMA 1SVGA 1KE5A 2ESMA 2HZ0A 3LFBA 4BDIA 5GIOE 2UW0A 4YC6A 3U51A 3NYXA 3UE4A 4C3FA 4HOKA 3GCVA 2PMOX 5CXHA 1VJYA 1Y91A 3UIMA 2Q83A 4LUDA 4I6FA 4BKYA 5LMKA 2YM8A 4EK8A 1TQMA 2WAJA 5AV3A 4Y8DA 1URCA 3BGZA 5HE1A 3Q4UA 3TIZA 3ELJA 4BCNA 3ATTA 2QOFA 4GSBA 4FEWA 4RJ8A 2OWBA 4CKJA 3KF4A 3R02A 4KABA 5EYCA 2XIYA 5J87A 3HA6A 2HENA 5L2WA 4HGEA 2CGWA 1QPDA 3R30A 4QMOA 4EZ3A 2WQBA 3HRCA 5ANKA 3IPHA 4FT5A 5CSWA 2A19B 4DBNA 3RCJA 5J9YA 4FNYA 4A4OA 3G15A 4PPBA 3DKOA 4L00A 4TWCA 3VRYA 3VUMA 2YABA 2UW6A 3WZEA 3EOCA 2W1GA 3GU4A 5FEEA 5A54A 2W96B 3EQFA 3FKLA 4FTAA 4IXPA 4U45A 2JKOA 2R3JA 3CY3A 2JAMA 2XKFA 2PVNA 4P5ZA 1GY3A 2P2IA 2RGPA 3C4XA 4IMYA 4K2RA 3LCDA 2A1AB 3MWUA 3QLFA 3KCFA 4AZFA 4A7CA 3W55A 4B4LA 2XS0A 4FVQA 5IQIA 3HMIA 2I40A 3R21A 4C62A 2XB7A 4AW2A 2IJMA 2B53A 2E9NA 3UQGA 2WMSA 4DCAA 3F3ZA 2DS1A 3ZU7A 3GC9A 2GPHA 3QKLA 4ID7A 2HWPA 2HY81 5KKRB 3RP9A 4QQJA 5TKDA 5F1ZA 3AC5A 4A4XA 5HO7A 2CKQA 3QKMA 4BB4A 4EOKA 3HNGA 2PZ5A 4LRKA 3TIYA 5EM5A 2OJ9A 4IADA 4C36A 3SW7A 5IEYA 3VHEA 1KE8A 3ORNA 4PL5A 4X3FA 3O7LD 4ASDA 1JNKA 3MDYA 4ITHA 3D5XA 5D12A 3SOAA 4YURA 5FDXA 3CEKA 4K33A 5ETAA 1O6YA 3G51A 4RX9A 5FP6A 4AN3A 2YDJA 4Z55A 1STCE 3LXLA 5GJDA 3Q9XA 4MAOA 4D2TA 4KB8A 3E88A 5C8KA 4CKRA 3II5A 2FSLX 4JVGA 4RZWA 4H39A 5AX3A 3TDWA 5HVKA 3FYKX 4QTEA 1BKXA 4HYSA 1XH5A 2XM8A 5C4LA 4QRCA 1CKPA 3V5JA 4A06A 3ZDUA 4EOOA 1YXUA 1R0PA 1Q97A 5IA2A 4I94A 4BRXA 3ZUUA 5I9ZA 4M84A 5EKOA 5CSPA 1VZOA 4FYOA 4JG7A 4IVBA 4G1WA 4MD7E 2CNVA 3KFAA 2ZB0A 3VS1A 4RVKA 3IKAA 4I93A 4IHPA 3UMWA 2CKOA 3LMIA 5HOAA 4C4FA 5LARA 5CXZA 4BBEA 4LUEA 1M14A 5A4CA 4YPDA 2FSTX 3D83A 3LLAA 4V0GB 5E91A 4QTAA 5DIAA 4L9IA 3Q53A 4RVMA 3WYXA 1Q8ZA 4MBIA 4NM3A 4MQ1A 5CQUA 4XS2A 4BYJA 3DB6A 3BEGA 3KULB 3E87A 3S95A 5BUIA 4C3RA 4FIIA 3LFNA 3VW8A 4JIKA 2OKRA 4DGGA 4FV0A 3ENHA 4TW9A 4F1TA 3IW5A 4FEXA 4FKIA 4O2ZA 2XNGA 4E4MA 3HZTA 5EK7A 3A62A 5IQDA 4ITJA 3ERKA 3UNJA 2BKZA 2XRUA 1JKTA 4AT4A 2X8IA 4DH3A 3PG3A 1R78A 3DAKA 5B0XA 4AQCA 3QKKA 4NT4A 3ZXZA 5HTIA 1FGKA 1WBNA 4RWJA 1DI9A 4XYFA 1U54B 4UXQA 5GJGA 5DG5A 5JQ5A 4ZS0A 3Q9YA 3BU3A 4R7HA 2VX0A 2VTTA 5IISA 3ZM4A 2HZ4A 4G31A 3U9NA 4BI0A 2VWUA 3EQBA 5AA8A 4CFMA 3A4OX 2FSMX 4EC9A 2WEIA 3NYOA 4EOMA 3HP2A 2JIUA 4DC2A 4FG9A 1PYEA 4R77A 2JKKA 3C9WA 4ZZNA 2WQOA 5TF9A 3CGOA 3NUUA 3Q4CA 4OBOA 3VN9A 4E4XA 3PPKA 4E6QA 3PLAE 4NFMA 4OR5A 4ACDA 4ZMEA 4ZTRA 4OAUC 4ZTHA 4EYMA 4K6ZA 5IG1A 5LVPA 4QPSA 4P5QA 5K3YA 1OKWA 4D28A 5DMZA 2VGOA 4UMRA 2VUWA 4MF0A 4JNWA 3DTCA 4DBXA 3O23A 4RQVA 4XG7A 3GC0A 5M53A 3SVVA 2YJSA 1S9IA 2PUIA 5FTGA 4I22A 4JX7A 3Q4TA 1J91A 2QCSA 4LRMA 4PWNA 3PVBA 2PVMA 3RGFA 4CFFA 3ATSA 3GNIB 4AE6A 1H00A 4TT7A 3RMFA 4WRSA 5BVKA 1OITA 3SAYA 3VS5A 3FSKA 4QNAA 4C58A 1KOBA 2J0LA 3NSZA 4I4FA 4NUSA 5L2SA 5BUEA 3C7QA 4FX3A 1KE7A 3QRTA 4BHZA 3F2AA 1W82A 3D94A 3I1AA 4EHEA 1WZYA 3VJOA 3U6JA 3FLQA 3C0GA 3MH3A 5G6VA 2UV2A 3VAPA 5KCVA 3N4UA 3TKHA 3AD5A 4OAVB 4B8MA 1M7QA 3IW7A 5M55A 5CVHA 4C8BA 3KREA 4JOAA 1PKGA 1XBBA 2Y6OA 4F09A 4YC3A 3P23A 5D11A 3V01A 1PMNA 2QVSE 2C6KA 3MTLA 3QCSA 3VBTA 5LMKC 5K0KA 2F2CB 3UP7A 5K0XA 1RE8A 3RPRA 4DFUA 2JDSA 5J9ZA 5EHOA 2GNJA 3MY1A 4BWPA 5M4CA 4V0GA 3GCPA 3FQSA 2UZLA 4WUNA 2VAGA 1P2AA 3EIDA 3O7LB 4G5JA 4PL3A 2QOOA 4Z3VA 2EXEA 1OVEA 4DH8A 4GKIA 3MH2A 2EXCX 3V6RA 3KULA 4PMTA 5EM7A 1WVYA 2H6DA 2X2KA 5C4KA 5M08A 4JQ8A 4FT0A 5JKGA 3VBYA 2CGVA 4F9AA 5DT4A 3EB0A 3NGAA 3NUXA 3OT3A 3LQ5A 5EW9A 1H4LA 3LJ0A 3ZXTA 4Q5EA 3LQ3A 3ZRLA 1OPLA 2WZJA 2PK9A 3PA3A 1QL6A 2SRCA 4FSYA 4IQ6A 4QMQA 4CFNA 3NUAA 2FH9A 2BRBA 4N6ZA 2H9VA 4L68A 5C9CA 3O0GA 2OW3A 5HE0A 3PUPA 1A48A 3H9OA 2V7AA 2J50A 3MFUA 4D2PA 3BHUA 4G3EA 2XZSA 2ETRA 3K3IA 3BYMA 2J51A 5FTOA 4CCBA 4DEHA 3E8EA 3Q60A 3CR0A 3EWHA 2OH4A 3TKUA 2FO0A 1JSUA 5CEOA 4OTWA 5AUWA 2YITA 3KRLA 4QMXA 4FC0A 1Q3WA 2WGJA 3SX9A 4TTHB 3N4VA 2IVVA 1OL2A 3TJDA 1CKIA 1L8TA 4IDVA 4XG6A 2V0DA 3IK3A 5A6NA 3OG7A 5LMAA 3W2QA 3QAME 1O6LA 4ZZMA 4CMTA 1PXOA 3D14A 4JXFA 2P3GX 3SHEA 2O2UA 5DE2A 5IA4A 1OL5A 3FHRA 3QTZA 3ZUTA 4EJNA 4PNIA 5GNKA 3FI2A 4AA5A 4CTBA 4MWIA 4K9YA 3ENMA 4PTGA 3RNIA 3ZLXA 2X7FA 3DCVA 5CI6A 4AZWA 1H0VA 3ZS5A 2GU8A 3Q6UA 4WSQA 4WIHA 3FZOA 4GL9A 4QMLA 2YISA 2QR8A 4NCTC 5B2LA 4CQEA 2JIIA 3Q2JA 5AAGA 4PX6A 4XEYA 4IFGA 3FMMA 3UODA 4ACMA 5CANA 2X8DA 4R5SA 3CQUA 2ITOA 3OTVA 4CKIA 5CTPA 4RVLA 3BIZA 4HJOA 5DR2A 4BDBA 1NVRA 3UC4A 1ZMVA 3OCBA 3KXMA 3OCTA 1OUYA 3R8PA 3ZCLA 5GZAA 5K5XA 4ANLA 1G5SA 3AMBA 3V8SA 3O2MA 4PQNA 3BGQA 1W0XC 3LM0A 4O6EA 1WBSA 2XK3A 3UQFA 4MBJA 5FWKK 1GJOA 4IAAA 5FTQA 5CI7A 5E8YA 2W1IA 4N4SA 2LAVA 3HECA 1V0PA 2R2PA 5JGAA 5BYYA 4GK4A 3DK7A 2QLUA 3ORXA 4OT5A 1J1BA 1YI6A 4YHTA 2B52A 4C3PA 3EHAA 4C61A 2RFDA 4U40A 3WF9A 2QO2A 4EK4A 2CKPA 1U5RA 1O9UA 3OT8A 1Q5KA 2JFMA 3PE2A 4FV6A 3B8QA 2GNIA 1DM2A 3DJ7A 4FZ7A 4KD1A 4QMMA 4RZVA 3VS4A 1PRYA 3ULIA 1YXTA 2VV9A 4D2SA 4BTFA 3PZHA 3O51A 3F3VA 3ZYAA 1AD5A 4RT7A 3WIKA 5KMNA 4KBCA 4YUQA 5AUYA 3SRVB 2IPXA 3VBVA 2PTKA 4BKZA 2R3GA 1OBGA 5HTBA 5F20A 3VF9A 5HNGA 5J1VA 1GIHA 3PXYA 1REKA 4NCTA 1M17A 2ITWA 5FP5A 5DR9A 2VTPA 3I6UA 4AZVA 1ZYDA 3COIA 4U79A 2ETMA 4UY9A 4GJ2A 4GVAA 3ZO1A 4U97A 2KTYA 1KE6A 1H08A 2YDKA 3IDCA 4HNFA 1QCFA 4FTLA 5E8TA 2AYPA 4BDFA 4FV1A 4Q5HA 3DQWA 2C47A 3WOWA 4EK6A 5KNJA 3A7GA 1S9JA 3CTJA 3QTIA 4OBQA 3WYYA 3UTOA 1OBDA 4IM2A 4Y73A 5B2KA 4RIXB 2R4BA 2FB8A 3COHA 2RFNA 3FE3A 3DBEA 3BRBA 3GCUA 3OXIA 1K9AA 3K2LA 2E9PA 4ALWA 3LJ1A 3WF5A 1YXXA 3DU8A 4OTFA 4UWCA 4GUBA 4FGBA 3C4CA 5FM2A 5I4NA 1BL6A 3RM7A 2YCSA 3PXRA 4AN9A 4EZ5A 3EKKA 3EMGA 4UV0A 4O83A 3ZSIA 3BLRA 3DB8A 2B9FA 4RJ6A 4MQ2A 4K1BA 4LL0A 4FA2A 5L3AA 2QG7A 3TNHA 2YZLA 5BVWA 4R7IA 4DGNA 4IJPA 2Y7JA 4TYGA 3FI4A 3MH0A 5AUZA 3AC8A 4GK3A 2X4ZA 4NJ3A 4F9WA 4L7FA 4S2ZA 1OKYA 4KRDA 2X8EA 3DA6A 3UOKA 3EN4A 3SA0A 2BRMA 1PY5A 3LM5A 4NZWB 5DT0A 3D5UA 3Q32A 5IQGA 2WQNA 2EU9A 3WF8A 3LFQA 5CY3A 4B8LA 1B39A 2Z7LA 2F7EE 3NVMB 3RK5A 3F61A 4UN0C 5F94A 4X0MA 2YIRA 4QMTA 3SLSA 4CCUA 3GFWA 4XH6A 3KRXA 3R8LA 4BTKA 2V62A 4OT6A 5G1XA 5JZNA 4PTCA 5IQAA 4RX7A 4L43A 1OIQA 2B7AA 5HQ0A 4DEDA 3QCYA 4J7BA 5CEPA 5TE0A 3CE3A 3D4QA 3TCPA 4BCQA 2REIA 4D0XA 4DLJA 1UKHA 3MY0A 4FG8A 3TJCA 3GCQA 4AW1A 1YOMA 4IZYA 1TVOA 4DLIA 5AP0A 4O7NA 4FKRA 1GIJA 4DN5A 4H36A 4CV8A 2NPQA 4RMZA 5B2MA 3NNXA 3ZEWA 3KRRA 5IQHA 4EI4A 4Z7HA 5HICA 3UOHA 4ZJJA 2FYSA 3WI6A 4XG8A 4C7TA 3UOLA 4CYIA 4O7WA 4U80A 1BL7A 3R2YA 3D2IA 3PRIA 1ZYJA 2JAVA 2UW9A 4F0GA 3DV3A 4WHZA 3DAJA 4F1MA 5HU9A 5E4HA 4EH8A 3P7AA 5EW8A 4FKTA 5KMLA 1M2RA 5GJFA 2V7OA 5IEXA 4NWMA 5T68A 3QA8A 4JAIA 3JY9A 4W9XA 4L01A 2XK8A 4WA9A 5JN2A 2C3JA 3W2PA 2YWPA 2CLXA 3HX4A 5DN3A 2RG6A 2J0KA 2WIPA 5HD7A 1FPUA 5HU3A 4G16A 4YC8A 3GEQA 2ZV2A 4EOIA 4D0WA 1Z57A 5FBOA 3RBWA 4WKQA 3OBGA 1YDTE 2OZOA 3HL7A 2YIYA 4O0TA 1Q99A 5AP7A 1MRUA 3DLSA 3QUDA 2W99B 5CS6A 1IAHA 3NX8A 3O17A 3VUIA 4Z9LA 4DFZE 4F9CA 4CYJA 5LOHA 3A8XA 5LJJA 2C6EA 2UZWE 2R3LA 3H0YA 1FVTA 3BZ3A 3BWFA 3QWKA 4YJVA 3ZFMA 4RBLA 4DGMA 3M2WA 4BCGA 2C3KA 2J0JA 5DNRA 3GP0A 4WG3A 4TYHB 4E5BA 4J96A 3ORPA 4XG9A 2WMRA 4NKAA 4FTMA 3SDJA 4F65A 4QQTA 1UU8A 4D58A 2Y4IC 2YCRA 3R7UA 3SXSA 5LWNA 2Q0NA 2CCIA 2PE1A 4Y5HA 2C0OA 4BIBA 2ERKA 5BVOA 4M14A 4XJ0A 2XNMA 5E90A 1ZWSA 3IQ7A 5HG5A 3R2BA 4WNKA 4DG2E 3OS3A 2ITYA 2PL0A 4DA5A 1CMKE 3E3PA 5CSXA 3ANRA 4DEBA 5IUGA 4RVTA 2BTSA 2GHGA 4AS0A 2XEYA 2EB2A 5A4QA 5A4TA 2BIYA 3PYYA 4LGGA 4EK3A 4EQCA 4FIGA 3WF6A 3PJ2A 4I0TA 3TT0A 3G6GA 3HV5A 4IWPA 1WVWA 4XV1A 1RJBA 3EL7A 4PP9A 2YJRA 2F4JA 3AMAA 3M1SA 2BRNA 1H25A 2J9MA 1L3RE 2H96A 4V05A 4Y5QA 5DEYA 2UZTA 4J99A 3GOPA 4O7ZA 4FV4A 5BVDA 4O2PA 4DFYA 2O63A 3WZJA 4M3QA 4P4CA 4R3RA 3UPXA 2WQEA 4XV3A 5LQFA 5KBRA 3MGYA 3BQCA 5H8GA 3PP0A 4E6AA 3Q96A 4BC6A 4CTCA 1U59A 4N70A 5CF8A 2XMYA 4PTEA 3W8LA 3D0EA 4W8DA 2VTQA 5CQWA 5CU3A 5CU0A 3PLSA 3QU0A 1GZNA 4J8MA 2OIBA 4CZUA 5H2UA 3LXNA 4HZRA 2GQRA 4WNPA 4HVGA 3AMYA 4X3JA 1H27A 1LPUA 2BMCA 4IX4A 4O0WA 5CU6A 2CGUA 5DHJA 5AP4A 3UVQA 3GVUA 5EG3A 4LOOA 3PE1A 4JQEA 4ACHA 2OLCA 3LPBA 2JLDA 3KRJA 2XIZA 2WU7A 3ORKA 3BE9A 3D7TB 5KX8A 3JPVA 2IZRA 1Z9XA 3H9FA 4WO5A 5EFQA 5CSVA 2J6MA 2X2MA 1MP8A 4G6OA 4GK2A 3BX5A 3FXWA 1J3HA 2PVRA 2VWXA 3R1YA 3R9NA 4BVUA 4C35A 5IF1A 1OKZA 2YLEA 4YLLA 2VTJA 4CMOA 4AU8A 4DT9A 5IQEA 4OW8A 4AGDA 4E5WA 2VWZA 4FIEA 4FSTA 4IAKA 2W9ZB 3CQWA 4UWBA 4BF2A 3AD6A 4JIAA 5KZ0A 1YWVA 2YHVA 1OECA 2R3NA 3GU5A 4K18A 3MV5A 4O7TA 5K4JA 3UIUA 4RFMA 4G6NA 4U3ZA 3FHIA 4ZY4A 3D15A 2HY0A 2UZVA 3EL8A 2C1AA 2WTIA 4AT3A 2ZAZA 5HEZA 2W4OA 2X6DA 3NAXA 3L1SA 3UQCA 1Q4LA 3N51A 2XIXA 2ETKA 2GFCA 4NW6A 4FTRA 5ETCA 3T3UA 4QMZA 4BDHA 4UZHA 3Q2MA 4EUUA 5H8BA 4YO4A 4I5PA 1HCLA 4L7SA 4CT1A 4YLJA 4OTPA 3U8WA 2JDTA 3UGCA 1KOAA 4FZFB 3OWPA 2C5OA 4FSUA 4YJSA 3G90X 2OSCA 2I0EA 3P78A 4KKHA 4NM5A 3S2PA 2VWBA 4ANQA 3LMHA 5GZ8A 3ZO2A 1ZAOA 2BRHA 2UZBA 4DF3A 3L8SA 4R3PA 1OB3A 2ZM1A 3G0EA 4IM0A 2XNNA 3EN7A 5IA1A 4U6RA 1H24A 2C6TA 3QRUA 4RWLA 1XH4A 5CX9A 3CIKA 4EBVA 4A9SA 1PXIA 2WTCA 2Z8CA 3O71A 3P86A 4EQMA 1OMWA 3FMNA 3S0OA 4MCVA 3BGPA 3VWAA 3DBFA 3VNTA 2YLFA 3ALOA 4DH1A 4XLVA 2XK6A 1WBPA 3EZVA 3D7ZA 4M67A 4D5HA 5J7HA 3NIZA 3CPBA 4FKJA 3LE6A 2VO3A 2W0JA 3R7OA 3RWPA 5FBNC 5IUHA 2PMLX 3CD8A 3TZMA 4X7QA 5F95A 4QPMA 1XBCA 4ZOGA 2VTLA 2F7XE 3FQHA 5A9UA 5J5TA 3QCXA 2GNHA 2X9EA 2P2HA 3CQEA 2WPAA 3TKIA 3UIXA 2J0IA 3VS0A 5CEQA 1BYGA 3KRWA 4HPUE 3QX2A 4EWHA 4UYAA 4FV8A 4YJRA 4XOZA 4II5A 3LFDA 1ZOGA 4IVAA 4MNEB 3KY2A 3MVHA 1OI9A 3MSSA 2CMWA 3RI1A 2PY3A 3C4FA 4AW0A 3MB6A 4AP7A 4U9AA 4TYIA 1MRVA 4RFZA 4DEGA 4BY9E 3GQLA 2WIHA 3V51A 4Q9ZA 4FSRA 4RIWB 1FGIA 3QZGA 4QPAA 3GQIA 3VQUA 3NR9A 3ZEPA 2BR1A 3HDMA 3BELA 3MY5A 5TOZA 4F9YA 4RRVA 1Q8UA 2EVAA 4IAYA 1G3NA 1OZ1A 3DKCA 5ACKA 4QMNA 4FSMA 2ZYBA 2QHMA 3PG1A 4JT3A 2VTIA 3PPJA 1H28A 4KS7A 3F3WA 4H58A 2CSNA 4F1OA 3DK3A 4AFEA 4FBXA 3FLYA 2P33A 1OL6A 4L67A 3LVPA 4L44A 2CNQA 2NO3A 2VX3A 2XF0A 3FC2A 3PIXA 2IZSA 2Y4IB 3AGMA 3F2NA 4LV8A 3QD3A 5E7RA 4BL1A 1CTPE 1Q24A 2DWBA 4JR7A 3QQKA 4TWOA 4DG0E 3QCQA 4DFBA 1M7NA 2ITQA 4EH9A 3ORLA 2NRYA 4J95A 2C6MA 5AUTA 5JFWA 4U41A 3PJ1A 4PPAA 5KMMA 4MKCA 2OIDA 4BHNA 1NW1A 2ZMDA 2C6DA 3OF0A 1ZMUA 5EM8A 3V5TA 3GU6A 5C8NA 3UZTA 4USFA 3NNVA 3F9NA 4ZIMA 2C30A 3I4BA 4IVCA 4L46A 4OTHA 4C2WA 3FZ1A 4DEIA 5CAOA 3O96A 4BCKA 4CFUA 5EQEA 4EOPA 2C5NA 3G33A 3EZRA 1NVQA 1W83A 2VZ6A 4KSPA 5EW3A 3OUKA 1XH6A 3VO3A 4ZLOA 4W9WA 1YHWA 4GYIA 3F88A 2Z2WA 5HCZA 3PIZA 4E26A 4W4VA 1VR2A 3M11A 1F3MC 5FXSA 4JBPA 2YEXA 3FWQA 5BVNA 2YIXA 5AV4A 4LGDA 5JSMA 3ZFXA 4B0GA 5IMXA 1YI3A 2BCJA 3FI3A 3W2CA 5JK3A 3ZC5A 2WOUA 4KBKA 3B2WA 4QP8A 3PSCA 3RZFA 5EYKA 3R1QA 3AG9A 3E7VA 3LQ8A 4FKLA 5HE3A 2XBJA 4I5HA 3R8UA 3BBTB 4FI1A 2OK1A 4TN6A 3OWKA 5HIEA 4S31A 1H07A 4M0YA 2BIKB 3DJ6A 4O0RA 1Z5MA 4S34A 3A7HA 2EWAA 4HNIA 4OBPA 4LGHA 4I92A 3WBLA 1IA9A 4HGLA 1T46A 3QL8A 1R1WA 3PPZA 5AP2A 4RQKA 1J1CA 2WQMA 4G3CA 2OXXA 5DBXA 4GCJA 3F5GA 5IMEA 3P1AA 4Y72A 3R9OA 2F2UA 3TEIA 4BGHA 3ACKA 3V5PA 2J4ZA 1ZYSA 3FDNA 4IANA 3HMOA 3VUKA 4MEDA 4M8TA 4C4HA 1QPEA 4HZSA 2ZDTA 3I7BA 4X2GA 3FMEA 4IIRA 3F3UA 4FT3A 4EKLA 5KHXA 3HV6A 4CRSA 2NRUA 5KO1A 1WAKA 4ZLYA 3LCTA 1DI8A 5AADA 2V55A 1XH9A 4FICA 3KMUA 5L6WL 3K5UA 5JT2A 1J7LA 4BDGA 4MX9A 4ZJVA 5AA9A 3DS6A 2WMUA 2PUUA 3ET7A 1UNHA 3ETAA 4G2FA 2OG8A 3T9IA 3HLLA 3OXTA 1OL7A 2DYLA 2E9VA 3L9PA 2R3MA 3DBQA 4I24A 2QO9A 5CZHA 3L8XA 4EQUA 4YTFA 5LXMA 1F5QA 4LYNA 3EJ1A 4XUFA 5GINE 3S4QA 4H3PA 1YWRA 4QOXA 2OH0E 4CLJA 2OU7A 2VTNA 4C34A 5GHVA 2GTMA 2Q0BA 4ZTLA 2P0CA 4NU1A 4BI1A 3QBNA 5DA3A 4QP3A 3PJCA 2R5TA 4KKEA 5HBEA 3RM6A 3PRFA 3E8NA 2JDOA 3KXHA 4HVDA 3ID6C 1YRPA 3E8CA 2XNEA 4XBRA 2QQ7A 3OW4A 3QF9A 4ERWA 1JPAA 1M2QA 4RJ5A 5I3OA 4YTIA 1LEWA 3TV6A 4CZYB 3PA5A 3MA6A 4YHJA 3E64A 3CSVA 3BV2A 5AFVA 3R00A 2XP2A 1B6CB 3MVJA 3THBA 2XH5A 2KULA 3CXWA 4EH6A 1Q8YA 3SXFA 2FA2A 1V0OA 4MTAA 4BIEA 3MBLA 3VS7A 3HYHA 2VO6A 4LQMA 5D7AA 2JDRA 5D9HA 5LVLA 3LCKA 3AGLA 2PVYA 3LCOA 3PWDA 3QUPA 3T9TA 3W1FA 1Y6BA 5IQBA 3OHTA 3QQFA 5IDPA 4UEUA 4FIJA 2HCKA 4EHZA 3P08A 4FUYA 2R7BA 4GEOA 4HVSA 5L2IA 2YDIA 2QG5A 2ZM4A 4G3GA 3PDTA 2GCDA 4QQCA 4RIYB 3R04A 4BCIA 2HZIA 2GHMA 2J5EA 2YM6A 2O0UA 3A99A 3I60A 4KNBA 3FLZA 4U43A 3ROYA 2IN6A 2YM7A 4I20A 3MW1A 3OW3A 3RK9A 3CTQA 3W2SA 5CALA 4FTNA 4NFNA 3DDQA 5BUJA 5EHLA 3MN3A 3TXOA 5BNJA 3HAVA 1BI7A 4GVJA 4F7NA 3PVGA 2JFLA 2YIQA 3UO6A 4F08A 1I44A 3C5UA 1CDKA 1YHVA 2VTOA 3L9NA 4IFCA 4O1OA 5E8SA 3RPSA 5HE2A 3T3VA 2UVZA 4DE4A 4CFWA 3QRJA 4BZOA 3FMDA 4V01A 3WE8A 3BU5A 3C0IA 4FTIA 4QTDA 4R3CA 2XCHA 5IKWA 3MYGA 2IO6A 2YCQA 4B6LA 4EJ7A 4J52A 4MXCA 1H01A 1OM1A 2CCHA 2C4GA 2HWOA 3UG1A 2C6LA 1W98A 3N4TA 4HGSA 4QP2A 4RC3A 3IG7A 2XJ0A 3OEFX 4M7IA 4E20A 3FZRA 4RA4A 4ASEA 5GZ9A 4E5AX 2G2IA 2Z7QA 4F7LA 4R78A 3F2RA 4M12A 3KQ7A 2ZV9A 5CVGA 5C27A 4FNXA 4ORKA 4NIFB 5EDPA 3UYSA 5KUPA 3ZZWA 2JC6A 3A60A 3FBVA 3Q3BA 4CXAA 5BPYA 1FVRA 4YZMA 3MPMA 1FQ1B 2R9SA 3R8VA 3VHKA 4AACA 1VEBA 3O8PA 4ANBA 2ZMCA 3HVCA 3Q5IA 3I6WA 4O38A 5FQDC 5B7VA 2VO7A 3WARA 4AZEA 4O7LA 1BX6A 4RIOA 3RCDA 4I6HA 3QD0A 4DAWA 4XNEA 4IB3A 4F99A 4F7SA 3FJQE 3PVUA 4BGQA 4AA0A 4F6SA 1MUOA 3SC1A 5DWRA 2HK5A 2A4LA 2ZV7A 3FLSA 1JLUE 1XH7A 1JOWB 4K11A 2ZOQA 4UXLA 2F9GA 3LAUA 5HO6A 1ZARA 3ZZEA 4I6BA 1G8SA 4V04A 2C3IB 4EEVA 1W84A 4I5MA 3ZO4A 4IAIA 4DGLC 3ZO3A 3EQPA 4FVRA 1YVJA 2XKEA 3IONA 3OFMA 5D10A 2PZYA 5CEIA 2H8HA 3A4PA 3E92A 3GBZA 4MWHA 2UVYA 2W5HA 3KK9A 3ORZA 4FV7A 2UZUE 1FMOE 4MD9E 2WMWA 4MH7A 5HG8A 4DFNA 4KIKA 4UB7A 3JUHA 5IDNA 3TNPC 1KUTA 2GS6A 4ZP5A 1Y8GA 1TQPA 1P14A 3IW4A 3FV8A 3A2CA 4X2NA 2W4JA 4ZSEA 5CEKA 5L8LA 4XRJA 5ETIA 4EH2A 4W4YA 4I0RA 4DITA 3WILA 2RF9A 5D7VA 4W4XA 2R7IA 3I5NA 1H0WA 2PU8A 4R5YA 4S30A 2UZEA 3QALE 1GIIA 5HG7A 2ERZE 2O8YA 3QFVA 4QT1A 4CGAA 4L6QA 4FKWA 1SZMA 2ZM3A 3DNDA 4O81A 5D41A 5BYLA 4M66A 4QTCA 4DFLA 3AT2A 5AUVA 3KXXA 3VW6A 3TUBA 5IA0A 2W1ZA 4PDPA 1QPCA 5DR6A 4I41A 1WBOA 2QHNA 2QLQA 1YHSA 5L8JA 3TN8A 4A9RA 4YZDA 4YJOA 4DTBA 4CG9A 5FLFA 4CRLA 1XHAA 4XG4A 2WTJA 4GG5A 4WNOA 4HVHA 3FKNA 5LMBA 2GS7A 4FIHA 1GNGA 4WT6A 5FXRA 4CVAA 3FSFA 2C0TA 2CNUA 4NTSA 5EHYA 4QMPA 5M56A 2WB8A 5AR4A 2FVDA 4YSMA 1JQHA 3BYSA 2XNOA 3NLBA 4TPTA 5E8UA 1ZRZA 4YTCA 3SW4A 2XRWA 3RAKA 2YERA 4KIPA 2X4FA 3V04A 1WMKA 2ZVAA 2C0IA 5CVFA 3QTUA 2I1MA 3AC4A 3DPKA 2XVDA 2BDFA 5KMOA 2PUPA 5IH4A 3U54A 4I6QA 3H10A 1PHKA 5A4EA 3MI9A 4NIFA 3DZOA 3QLGA 3O50A 2O5KA 5E92A 4DGOA 5ANJA 5JRQA 4WG4A 3KVXA 1PXNA 4FOCA 4F63A 2A0CX 2Z60A 3DFCB 3PY3A 2QO7A 2B9JA 4ZLZA 3GOKA 5AUXA 3AC2A 4R6VA 4G5PA 3UPZA 4L8MA 3R7GA 5CT7A 3R9HA 4C57A 3U9CA 1JKKA 4GIIA 1RQQA 5HVJA 3FMJA 4TWPA 1VYZA 1SMHA 3WF7A 3VBQA 3GU7A 1PW2A 1XQZA 2BKKA 3HUBA 2PUNA 3RWQA 2VTMA 1AGWA 4FKSA 3D9VA 5ANIA 2ONLA 4FR4A 4X21A 2YAKA 4JJRA 2YM3A 5I9WA 1A9UA 3OCGA 1P4OA 2PVLA 4LV5A 4RFYA 5IZFA 3SGCA 3KN5A 4F70A 3V5QA 4M68A 1ZY4A 3IS5A 4JBOA 2PVFA 4FT7A 4FSWA 5HKMA 1XR1A 1UNGA 3EQDA 3C51A 3SXRA 4DTKA 2UZOA 2Y8OA 2IZTA 4NJDA 3R7VA 5K5NA 3MB7A 5CU2A 3DXPA 3L9MA 4WNMA 3QQJA 4WBOA 1AQ1A 4RG0A 1KV1A 4AZSA 5IUIA 3CC6A 4L42A 5I3RA 4FEVA 1V0BA 2IZUA 3EQIA 5CZIA 3W33A 4BWKA 1U54A 4ASXA 3ZC6A 5C1QB 1PXMA 3HP5A 2YWVA 2G1TA 1MRYA 4ZY5A 1JSVA 3BPRA 2F7ZE 3EFWA 3H4JA 5E1EA 1Q8WA 3I79A 4JRVA 3UJGA 5KKRC 1KSWA 3OROA 2GSFA 3LW0A 4MNFA 4DCEA 3QX4A 4IM3A 1M2PA 1PXJA 3DKGA 4UBAA 1YDSE 4W4WA 2BFXA 3NUNA 5A4LA 3TZ8A 5LWMA 4RJ3A 4TZRA 4IBMA 1SYKA 3QC4A 5HZNA 3K5VA 2J2IB 4TXCA 5C03A 4ZAUA 3NNUA 4BCOA 1SVHA 4USDA 4EHVA 3NW5A 5CEMA 3RNYA 1MQ4A 1I09A 1LEZA 3W10A 3U87A 1PXKA 1O6KA 4FV5A 3F7ZA 2UUEA 2CN8A 4NM0A 3VUHA 1REJA 3G2FA 4ZS4A 2Y0AA 4PV0A 3G5DA 4O96A 1HCKA 1BI8A 2CKEA 4E4NA 3ZLYA 2W1FA 3POOA 1ZXEA 4EKKA 3F5PA 4O84A 2GNLA 2O64A 5A46A 4MVFA 4AOIA 4D4VA 2GHLA 4KIQA 2P4IA 4EYJA 3UIBA 3UZRA 4YZ9A 3UVPA 3PY0A 4EH5A 5E8WA 3HAMA 3U4WA 1ZZLA 2HXLA 2UW5A 4GFGA 4H3QA 3FY2A 5AMNA 2QOHA 5IU2A 1OUKA 4Y95A 2J7TA 3VIDA 4HW7A 2QOCA 2BHHA 3UYTA 4E6DA 2WKMA 2X7OA 3BQRA 3Q52A 4RX5A 3RPYA 1OIYA 2ACXA 4L3JA 2VD5A 1PMEA 4MXXA 4CNHA 2W5AA 1OKVA 2BAQA 2RL5A 2R3RA 4E6CA 3ZBFA 2RIOA 4RA5A 4BBMA 5AEPA 4QP1A 4O0SA 2VWYA 5DLSA 5I0BA 5M4IA 3JY0A 4JL9A 3C0HA 1P5EA 4IJ9A 4O7VA 1PKDA 2IW8A 4HVIA 2VGPA 3E8DA 4ANSA 3BLHA 3DAEA 3ORMA 3U6HA 4PY1A 4FT9A 4FKGA 3R0TA 5ICPA 4LRJA 2F49A 4UMUA 4N57A 3DDPA 4CT2A 1PJKA 5K9IA 2BDJA 2VU3A 4NTTA 4GT4A 3UO4A 4PNKA 4YR8A 4YLKA 2HW6A 4LM5A 5DPVA 3AC3A 4L3LA 4KKGA 3MPTA 4YMJA 5EYMA 5C01A 2UW8A 3JXWA 4UX9A 2VWVA 2BAJA 2OI4X 5EOLA 3DT1A 1X8BA 4E1ZA 5IH5A 3PJ3A 3Q9ZA 2JDVA 3G9NA 1H1WA 3RZBA 4IAFA 3MS9A 4BTMA 2HAKA 3BHHA 5ETFA 2PHKA 3H0ZA 4FTKA 4NKSA 4A4LA 4ANMA 5I9YA 1G8AA 3VS6A 4UMTA 3PA4A 3PSBA 4XBUA 2QKWB 3SRVA 4FODA 4O0VA 1YOLA 1XH8A 4RPVA 3ACJA 2EXMA 4AW5A 4YZBA 3NAYA 5TR6A 2OFUA 2YFXA 1UU3A 2JIVA 1OIUA 1JKSA 1OIRA 4FK3A 1R0EA 4C4JA 4LL5A 1H8FA 3F69A 4KUJA 4F0IA 4JLCA 4G3FA 5TT7A 3MA3A 3DQXA 4BZDA 4X6RA 3VBXA 3ZSHA 3F82A 3Q4ZA 3ZLWA 2G15A 3LKMA 5IA3A 3AQVA 1PXPA 5EYDA 2HOGA 3S1HA 5CLPA 4C2VA 4D1ZA 3F66A 3QQUA 3FXZA 3ZMMA 4BWXA 5EQPA 3G6HA 4JDIA 4M0ZA 4RIXA 4FNWA 1ZOEA 5HGIA 3HV4A 2QC6A 3PXKA 4X2JA 3CP9A 4IACA 3V5WA 3R9RA 3DBDA 1SNXA 2BZHB 4U0IA 3HA8A 4IB1A 3LXPA 4I0SA 4IE9A 2QOBA 4F4PA 5CAPA 5T3QA
chains in the Genus database with same CATH superfamily
4Q9SA 3IGOA 3BYVA 2OJGA 4FRFA 4K0YA 4QP9A 4AN2A 4DFXE 3R6XA 3PXZA 3RHKA 2BFYA 3NUSA 3R8MA 3VF8A 3IOPA 2BZKB 2IVTA 2BROA 3BE2A 4GU9A 4IH8A 4NEUA 4AXCA 4JDJA 3Q5ZA 4RGJA 5CNOA 4ZEGA 4FV3A 4L53A 4HCVA 3C50A 3BBWA 3OMVA 4HYIA 2JITA 5K4IA 1RDQE 2IW9A 4APPA 4D2RA 3EQHA 2PVHA 5CF4A 4EC8A 3LFAA 4YGAA 3W32A 4ALUA 5HNBA 4JBQA 4PRJA 1E1XA 2PZRA 3FLWA 4YJUA 3MFSA 3EFKA 3DK6A 4WRGA 4IC7A 5M51A 4KINA 4W8EA 1FVVA 3KU2A 1LP4A 5E1SA 4E93A 4FKPA 2DQ7X 4O0YA 4RJ4A 3W2OA 4IWDA 3BHTA 4FSNA 3SG8A 5HBJA 5FUTA 4CLIA 2CJMA 3P9JA 5M44A 4EWQA 4TRLA 4JG6A 1J7IA 4HGTA 4QDVA 2OZAB 1TKIA 3O8TA 4DTAA 2P55A 3LOKA 4J53A 1P4FA 5JEBA 3ZRKA 2VTSA 4FTJA 5HD4A 2PVJA 4EOJA 4Y85A 5L2TA 3SOCA 4FL1A 3VS2A 2W5BA 2XEZA 3JVSA 4IC8A 4IAZA 3RAHA 2I0HA 2WFYA 3ROCA 3HUCA 2OIQA 2PZPA 5DEWA 3OEZA 3ANQA 1SVEA 4FKOA 3JS2A 4F78A 3R63A 4R1YA 3RTPA 2HYYA 3KL8A 3PY1A 3LFEA 5DGZA 3C5IA 4FZDB 2VTAA 4GH2A 2ZDUA 3FMLA 2DUVA 4JG8A 2OF2A 4PDSA 2JBPA 2OO8X 2QURA 3PWYA 2B54A 5CT0A 4UMPA 5E8XA 5AP5A 3ZH8A 4DEEA 4HYHA 3F7WA 1R3CA 4IX5A 5I9VA 2NP8A 5HNIX 1W2FA 4HCTA 5CAVA 3Q9WA 4M13A 3RPOA 4HYUA 1BUHA 2XIRA 3JVRA 5DT3A 1NT2A 4BI2A 2R3QA 2UW7A 3W18A 5F9EA 3I0QA 1Q62A 5AP3A 3B2TA 3JR1A 2CN5A 4J98A 4FTQA 3BEAA 3FLNC 4O7YA 4BR3A 2ITVA 4EH4A 3KA0A 3ODZX 3FQEA 5L6OA 5LCJA 1YDRE 5LVNA 5IQCA 3TV4A 4GW8A 3P0MA 3UVRA 1OPJA 4TYHA 1PMUA 5FRIA 4BFMA 3TTJA 4L52A 3VS3A 1WBTA 3QGWA 4WUAA 2WMQA 3MVMA 2JEDA 4C4GA 4C59A 3PIYA 4O4FA 4QYGA 5EI6A 3D5VA 3FC1X 4BKJA 4O0UA 3DJ5A 3L8PA 1YWNA 2Z7RA 3R83A 4CMUA 1URWA 2J0MB 4GV1A 4C02A 2VTRA 2B55A 3QZFA 4O4CA 2HW7A 4BGGA 2I0VA 4CFXA 2IW6A 4XX9A 2YA9A 3TNWA 4QTBA 3NWWA 4U42A 1FINA 3V8WA 2F57A 1Q41A 3F5XA 4XG3A 4YSJA 3IOKA 1E9HA 4H1JA 4O27B 3EYGA 3H9RA 4LOPA 3VBWA 2Y9QA 5JRSA 1IEPA 3RPVA 4E73A 1ZLTA 4FIFA 2OF4A 4WG5A 4GMYA 4RSSA 3IW8A 4L45A 4C38A 1M52A 2QNJA 1WBWA 3HEGA 1F0QA 3PP1A 4AGWA 4EK5A 4EOLA 2OGVA 4E4LA 5A14A 1DAWA 2A27A 2YM5A 3NRMA 4FV9A 2R64A 5KE0A 3KC3A 1UU9A 4AX8A 3VJNA 5CNNA 2XK4A 3U55A 3LFCA 2WXVA 1PXLA 3C1XA 4KBAA 2BAKA 4ZY6A 2Z02A 2GDOA 3OY3A 3GCSA 4OTRA 4ZXTA 3NCZA 1YI4A 3ODYX 4G17A 2XNBA 4PMMA 1UV5A 3POZA 4D55A 2BPMA 4AGUA 5IPJA 3U4UA 4D4YA 4FKUA 3ZONA 3PXFA 5HLWA 3REPA 3TTIA 4J71A 4OTGA 2C6OA 2UZNA 2E2BA 4KIOA 2W1DA 3ZHPC 1JKLA 2PVKA 4D2WA 2PMNX 4JBVA 3FPQA 2C1BA 3C4WA 3HRBA 3QTRA 4GJ3A 4O0XA 4Y83A 3D7TA 3E7OA 3HMPA 1J7UA 3QZHA 3TNQB 3VUTA 3GFEA 3TDVA 3ITZA 4MF1A 1WVXA 5CAQA 4QMUA 2C6IA 4ALVA 2XKCA 5BX0A 2B0QA 4QQ5A 5FD2A 5EM6A 3W0OA 2QOKA 3EKNA 3KF7A 3QWJA 2QKRA 4EBWA 2RFSA 3FKOA 4M15A 3IGGA 4M97A 4AG8A 3QXOA 4F6WA 2XNPA 1UNLA 4JDKA 2PWLA 4YTHA 5FEDA 4D5KA 5JMSA 5GIPE 1UWHA 2WHBA 2GQGA 2VNWA 5DFPA 1OL1A 1Y8YA 4JX3A 1XJDA 2HIWA 3KN6A 2A2AA 4I4EA 1NA7A 4S33A 4X2KA 4ZMFA 3KXZA 3E5AA 3NNWA 4AFJA 3QHRA 3OUNB 3DY7A 4KAOA 4BIDA 5AUUA 2UW4A 1DAYA 3K3JA 4DEAA 3FL5A 3IW6A 1R39A 4MXYA 4NL0A 2E9OA 4B9DA 5AV0A 5H3QA 3BLQA 5CF6A 4OTQA 4YHFA 2R3OA 4AT5A 3AC1A 1Q3DA 4XMOA 4DH7A 3UBDA 2C69A 3NEWA 1UKIA 2JGZA 4LI5A 5E8VA 4APCA 1H1SA 5AV2A 1PF8A 4YNOA 2XIKA 4ZSAA 3QYZA 3P5KA 3DNEA 4AGCA 1ATPE 2OJFE 3OZ6A 4FF8A 5FM3A 3ZRMA 5DOSA 4R1VA 4GG7A 5A6OA 3BKBA 1ZY5A 4K77A 4YZNA 4TNDA 5E8ZA 3DTWA 5JFXA 4WSYA 3EQGA 3TUCA 3AT3A 3H30A 2GTNA 2WTKB 2C5YA 4G6LA 3P79A 3EH9A 4DINA 3C4ZA 1PMVA 4FZAB 3AD4A 2CHLA 3HV7A 5HLPA 3OWJA 2R3IA 5CF5A 2J5FA 3IDBA 5EI2A 3AXWA 5KMKA 4U8ZA 5KMJA 3CKXA 3U6IA 4EH3A 2CGXA 3LJ2A 2ZFYA 4FTTA 4ARKA 3QTXA 4USEA 3OVVA 1QPJA 2BHEA 2IVSA 4TKSA 3V3VA 4E7WA 3OWLA 4K8AA 3RAIA 4ZSLA 3FY0A 3SG9A 4KSQA 2QOQA 2C3LA 4GT3A 1NY3A 5AJQA 4RWIA 2PE0A 4FE2A 4FTUA 5ANGA 2V22A 4MXOA 4XV2A 4MBLA 3FL4A 5J9LA 1JBPE 3NZ0A 1SM2A 4LOQA 2FUMA 3QTSA 2B9HA 5IA5A 4KS8A 3T8OA 3ALNA 5HBHA 4ZJIA 2WTVA 3F6XA 4MNEA 3RKBA 3TUDA 3E3BX 2BRGA 2IWIA 4PF4A 3C4EA 4NSTA 4QYFA 3GGFA 3EQRA 4O6LA 5HCYA 4FSQA 3L9LA 4D1XA 3EFJA 3KXNA 3ORIA 3DFAA 3LXKA 4I3ZA 4AOTA 3NPCA 2BDWA 3CCNA 3NW7A 4LMUA 4I1ZA 1ZYCA 3GC7A 2BZJA 3DBCA 4OTDA 4GRBA 4AE9A 2B9IA 4CG8A 5CASA 3ZSGA 1DS5A 3QRIA 1H1QA 4XLIA 4D9TA 3NUPA 3CD3A 4TY1A 4U81A 3F5UA 4QYYA 4DDIA 5AR8A 3RJCA 5JGDA 3MH1A 3V5LA 2PPQA 1ST0A 2W06A 3L8VA 1RW8A 4BTJA 2VX1A 2WMTA 5HIBA 3OY1A 4I23A 5DH3A 4EZ7A 2EB3A 1PYXA 2ZV8A 4GU6A 4FKQA 4ENYA 2O65A 5HIDA 4GFOA 3RHXA 2X0GA 3IECA 2ONLC 4IW0A 4ZSGA 2G9XA 2X6EA 3V6SA 2VN9A 1KV2A 5M4FA 2XALA 3I81A 4HPTE 4H05A 4QP4A 3UG2A 3IO7A 3PFQA 4C0TA 3BU6A 4FEUA 3SQQA 3ZBXA 3UO5A 3P4KA 3DLZA 3QGYA 2VNYA 2R3KA 5ACBC 3R7IA 3UNKA 5BVFA 5DYJA 2WTDA 4UWYA 2OZAA 3NUYA 5EDRA 4ZZOA 4PL4A 4YPSA 2Y4PA 1OGUA 3B8RA 3CJGA 1H1RA 3IDPA 3NCGA 5J8IA 5J5SA 4AF3A 4WOVA 3PXQA 2Y6MA 3BV3A 2GNFA 2ITUA 4RLLA 3P7BA 3PJ8A 4RJ7A 4M69B 3CJFA 4GT5A 3RALA 4ERKA 5BYZA 2W1CA 1W8CA 3R1NA 4F64A 4PDOA 4FG7A 3AKJA 4IZ7A 4U7ZA 3MFRA 5DVRA 3TI1A 2X81A 4GKHA 5E9EA 4I5CA 4QD6A 2OICA 2Z7SA 3GI3A 4XP0A 4BDKA 4CSVA 3FZTA 1CKJA 5KHWA 3KXGA 3MIAA 3W0SA 3DOGA 3OP5A 1WBVA 4YU2A 3UOJA 3E62A 5AWMA 3UZPA 4RLKA 5F4NA 4D4SA 4BDEA 3NS9A 4JAJA 3R73A 4O1PA 4RWKA 3NDMA 3ZDIA 2W7XA 3UDBA 1KWPA 4EORA 4X2FA 3R9DA 4RC2A 4E3CA 4FZ6A 3LMGA 4BN1A 4NH1A 3OCSA 3R7EA 5HHWA 3S00A 5LVOA 2JKQA 3I7CA 3G9LX 5M4UA 4A07A 4PPCA 2HELA 3UP2A 5EDQA 3ZLSA 4AXAA 2NNWB 4J1RA 4KRCA 4BCMA 4UALA 2WTWA 3QZIA 4FEQA 4IB5A 5DRBA 3CTHA 2XK9A 2VO0A 2BZIB 3W0PA 2B1PA 1IA8A 3HMNA 4JQ7A 3DXQA 4LV7A 2WELA 2JKMA 2XK7A 3WIGA 1FMKA 5I9XA 4MD8E 4OUCA 4TL0A 1ZYLA 3RK7A 3QYWA 5J95A 3MFTA 2X2LA 1EH4A 3OOMA 5BMMA 3GENA 4H1MA 3QTWA 3RAWA 5JZJA 4CV9A 5BVEA 2EUFB 3QD4A 2W05A 1H26A 4CD0A 1GZKA 3D5WA 4ZTMA 3A7JA 4AWIA 2WMXA 1SNUA 2W1HA 4P7EA 4Q2AA 2WOTA 5EH0A 4AA4A 4XRLA 4RC4A 2W1EA 4DG3E 3COMA 3CKWA 3NMUF 3M42A 2YAAA 1JSTA 1APME 1U46A 3O8UA 3Q6WA 4YJTA 4EL9A 4F7JA 3QHWA 4H3BA 2PSQA 3ZFYA 3HGKA 3ORTA 2YM4A 5H8EA 5HCXA 3I5ZA 5IQFA 3KK8A 3PTGA 4C33A 2GQSA 4XHKB 1U4DA 3MJ2A 5BQ0A 1A06A 2I0YA 2WO6A 4AAAA 4ZK5A 2I6LA 4ACGA 1ZMWA 2R0IA 2AUHA 4UYNA 4HCUA 5AR3A 4FTOA 3TNIA 4NYEA 5HLNA 4BDDA 3FMKA 4ZTSA 1GOLA 4GFMA 1XO2B 2XKDA 3BL7A 2OJJA 2PE2A 4YP8A 4U44A 3K54A 4DH5A 4EH7A 4Y46A 4FGRA 5AP6A 5L4QA 5ANDA 3TM0A 1CM8A 4U3YA 4TWNA 2GMXA 4X6QC 4G9CA 5ANEA 2WEVA 4RX8A 2OXDA 2QODA 3PVWA 1Q61A 2AC3A 5ANOA 4O7RA 3W8QA 3NW6A 4M69A 3RVGA 3QTQA 4B99A 5AX9A 3QQHA 1B38A 3R71A 3MESA 3H3CA 3DGKA 2C68A 3TACA 5JQ8A 3HRFA 3FEGA 2XJ2A 3OD6X 3WZKA 4BDAA 3BWJA 5TO8A 1MQBA 4DYMA 2VTHA 2QU5A 5AR7A 5FG8A 5FDPA 3ZM9A 3EQCA 4OTIA 4FJVA 2C5XA 3FXXA 3GXLA 2XCKA 3VUDA 4YZCA 4U5JA 4CQGA 3EN5A 5EI8A 1GZ8A 1IG1A 1ZZ2A 2AQXA 3FPMA 2O3PA 5JFVA 3NYVA 5M57A 1UU7A 2RSVA 4GUEA 4ENXA 3RINA 3LHJA 4ACCA 2W9FB 3S3IA 5AAEA 4ZSJA 5AV1A 3E93A 4A9UA 2GFSA 4FV2A 2BTRA 4JS8A 2QONA 4FYNA 4AZTA 2XM9A 1W7HA 5IEVA 4O82A 1YQJA 5HTCA 4O86A 4FL3A 4A9TA 1YXSA 5KBQA 5HVYA 3TZ9A 5JFSA 5J1WA 1BMKA 5I9UA 3VVHA 3N9XA 4EUTA 1IRKA 3DZQA 3MIYA 4YO6A 3UMXA 4BJJA 4O7SA 2OXYA 3DXNA 4MK0A 4S32A 4AUAA 2J90A 2VWIA 3FYJX 4J8NA 5LCKA 3W2RA 4BCFA 5H9BA 5EKNA 1NXKA 5AR5A 4TNBA 1Y57A 4TYJA 5HX6A 4JRNA 4AOJA 4FNZA 4O4EA 3ZUVA 4Z16A 4YJNA 5D1JA 5KZIA 3GT8A 3VUGA 1YKRA 2YZAA 4BICA 4CEGA 4QP7A 4G3DA 2XA4A 3EYHA 4ZTNA 4EOSA 1UA2A 2WNTA 2YIWA 5FXQA 3ZOSA 3LFFA 2ITZA 4E8AA 1LR4A 2CDZA 2X7GA 5EQYA 4P2KA 1Q8TA 4EOQA 3QQGA 4N0SA 4GIHA 2BALA 3UNZA 4DT8A 1OPKA 4OLIA 5CYIA 3FAAA 3PZEA 4MHAA 5AM7A 3SV0A 2QU6A 5AR2A 3BYUA 4IZAA 1QMZA 1YW2A 2PYWA 4BDJA 5HESA 3KKVA 2QD9A 3F3TA 2XYUA 3KVWA 1T45A 4MXAA 3P5JC 4IWOA 3FMHA 4NK9A 1IASA 4AXFA 4PMSA 2ITXA 4FOBA 2WTKC 2E9UA 1TQIA 4A9YA 5HORA 3D2KA 4D9UA 3WZDA 5HX8A 2H34A 4XV9A 4BDCA 4QP6A 3MTFA 3KB7A 3KGAA 4QMVA 4JR3A 5AIRA 3KEXA 3LFSA 3OC1A 2R0UA 3LIJA 3GC8A 4PUZA 2IVUA 2AC5A 3HDNA 5AM6A 1NVSA 1WFCA 3A61A 4FK6A 1K2PA 2RG5A 3BCEA 4ZTQA 1UVRA 3FUPA 3HV3A 1KE9A 2HZNA 4YJQA 3TG1A 4G34A 3QQLA 4F6UA 3UC3A 4ITIA 3ZTXA 3CS9A 4OGRA 4ANOA 4KIKB 2G2FA 4PDYA 3GB2A 1JAMA 4EONA 5ITAA 2OFVA 5HO8A 4RIWA 5L8KA 4KWPA 3CBLA 4F0FA 2YN8A 4IEBA 3BI6A 2UW3A 3COKA 3EN9A 4IX6A 4X3FC 5M07A 3VQHA 1JWHA 3QD2B 4O21A 3AT4A 2B4SB 5C8MA 5CAUA 3QRKA 4FUXA 3FZSA 5DI1A 1WCCA 2ITNA 3OXZA 4QYHA 4PMPA 5CWZA 1ND4A 5LVMA 4J97A 3TWJA 4B7TA 2R3FA 3MVLA 3R8ZA 2OJIA 2WMAA 2HXQA 5J7BA 4ONAA 5M09A 4FTCA 5BMSA 5AP1A 1U5QA 2FGIA 5CU4A 1XBAA 4FMQA 2VWWA 4WBBB 1IR3A 4CZTA 2XBAA 1H1PA 4D4RA 3FZPA 3QC9A 3VC4A 2RKUA 4IB0A 2X39A 4LG4A 3I0OA 5CENA 4ASZA 2XYNA 3KMMA 1Y6AA 4BCPA 3QA0A 3BHYA 2WD1A 3LLTA 2JBOA 4DHFA 3MJ1A 4BBFA 1FBNA 4YJPA 2ZB1A 5HI2A 3CGFA 2BVAA 2IF8A 2FSOX 4QMSA 1UWJA 2QOLA 4QMYA 5A3XA 3GU8A 2GNGA 4XP2A 4ANNA 1BLXA 1XKKA 2UZDA 3LZBA 4QYEA 3PSDA 5I5ZA 4UZDA 1CSNA 4O22A 3BHVA 3VULA 2YACA 3EN6A 4UMQA 4LFIA 2PZIA 2WMBA 2W17A 3TV7A 1K3AA 5FEQA 3R22A 2G01A 3CLYA 1VYWA 4BZNA 4R8QA 4C4EA 2PMIA 4QNYA 5JH6A 2VRXA 2ITPA 2GS2A 5FGKA 1JVPP 4QMWA 5C26A 3QXPA 2ZJWA 3A7FA 3OOGA 4PP7A 4FL2A 4YBJA 2G2HA 3R1SA 4XP3A 4FVPA 4FSZA 2LGCA 3VRZA 2XUUA 3BYOA 1V1KA 3W0RA 4JI9A 3CPCA 1ERKA 4GYGA 4XG2A 4N6YA 3WE4A 5JGBA 2YCFA 4C4IA 4IWQA 2I7QA 4Z7GA 3ULZA 2JD5A 4JDHA 4YNEA 4R7BA 3R7YA 3A7IA 4WD5A 4FKVA 3CY2A 4XOYA 3W16A 4RIYA 3SKCA 3GUBA 2X1NA 5AAFA 4BCJA 1YXVA 1ZOHA 4CFVA 3DKFA 5IH6A 3OTUA 2C5VA 3WZUA 1FOTA 2CLQA 3TZ7A 4IVDA 1HOWA 5T6KA 1IAJA 3P7CA 3NVKI 4D1SA 4L3PA 3QUEA 5M06A 4MXZA 4G9RA 2IG7A 2RFEA 3FI8A 4TYEA 5DRDA 5L6PA 2WMVA 4YBKA 3SD0A 1XWSA 4KA3A 3VONA 2CPKE 4IZ5A 2BILB 5L2QA 2R3PA 4F9BA 1E1VA 4C37A 3MPAA 2XJ1A 2V5QA 4MYGA 5CSHA 5HG9A 3V8TA 4BCHA 2QI8A 5KMIA 3KCKA 1OGYA 1GZOA 2WU6A 3NIEA 2W4KA 1GAGA 4QO9A 3A8WA 4LMNA 4AXDA 4P90A 4I21A 3E63A 3KMWA 1YOJA 3HKOA 4XCUA 4X3FB 4NM7A 4NW5A 3R01A 4O91A 2X9FA 4IX3A 5AIKA 4GS6A 1LUFA 3NYNA 2QR7A 2QOIA 3C13A 4IDTA 2R3HA 3AOXA 3TL8A 2ITTA 3JYAA 3EFLA 3Q04A 4EHGA 2BUJA 3R28A 5EOBA 2OBJA 4D2VA 4BYIA 5J79A 3LCSA 3OBJA 2UVXA 3G0FA 2PULA 3HMMA 1SVGA 1KE5A 2ESMA 2HZ0A 3LFBA 4BDIA 5GIOE 2UW0A 4YC6A 3U51A 2XANA 3NYXA 3UE4A 4C3FA 4HOKA 3GCVA 2PMOX 5CXHA 1VJYA 1Y91A 3UIMA 2Q83A 4LUDA 4I6FA 4BKYA 5LMKA 2YM8A 1XMLA 4DHZA 4EK8A 1TQMA 2WAJA 5AV3A 4Y8DA 1URCA 3BGZA 5HE1A 3Q4UA 3TIZA 3ELJA 4BCNA 3ATTA 2QOFA 4GSBA 4FEWA 4RJ8A 2OWBA 4CKJA 3KF4A 3R02A 4KABA 5EYCA 2XIYA 5J87A 3HA6A 2HENA 5L2WA 4HGEA 2CGWA 1QPDA 3R30A 4QMOA 4EZ3A 2WQBA 3HRCA 5ANKA 3IPHA 4FT5A 5CSWA 2A19B 4DBNA 3RCJA 5J9YA 4FNYA 4A4OA 3G15A 4PPBA 3DKOA 4L00A 4TWCA 3VRYA 3VUMA 2YABA 2UW6A 3WZEA 3EOCA 2W1GA 3GU4A 5FEEA 5A54A 2W96B 3EQFA 3FKLA 4FTAA 4IXPA 4U45A 2JKOA 2R3JA 3CY3A 2JAMA 2XKFA 2PVNA 4P5ZA 1GY3A 2P2IA 2RGPA 3C4XA 4IMYA 4K2RA 3LCDA 2A1AB 3MWUA 3QLFA 3KCFA 4AZFA 4A7CA 3W55A 3W0QA 4B4LA 2XS0A 4FVQA 5IQIA 3HMIA 2I40A 3R21A 4C62A 2XB7A 1TFFA 4AW2A 2IJMA 2B53A 2E9NA 3UQGA 2WMSA 4DCAA 3F3ZA 2DS1A 3ZU7A 3GC9A 2GPHA 3QKLA 4ID7A 2HWPA 2HY81 5KKRB 3RP9A 4QQJA 5TKDA 5F1ZA 3AC5A 4A4XA 4BJJB 5HO7A 2CKQA 3QKMA 4BB4A 4EOKA 3HNGA 3PUFC 2PZ5A 4LRKA 3TIYA 5EM5A 2OJ9A 2NYAA 4IADA 4C36A 3SW7A 5IEYA 3VHEA 1KE8A 3ORNA 4PL5A 4X3FA 3O7LD 4ASDA 1JNKA 3MDYA 4ITHA 3D5XA 5D12A 3SOAA 4YURA 5FDXA 3CEKA 4K33A 5ETAA 1O6YA 3G51A 4RX9A 5FP6A 4AN3A 2YDJA 4Z55A 1STCE 3LXLA 5GJDA 3Q9XA 4MAOA 4D2TA 4KB8A 3UDZA 3E88A 5C8KA 4CKRA 3II5A 2FSLX 4JVGA 4RZWA 4H39A 5AX3A 3TDWA 5HVKA 3FYKX 1VLRA 4QTEA 1BKXA 4HYSA 1XH5A 2XM8A 5C4LA 4QRCA 1CKPA 3V5JA 4A06A 3ZDUA 4EOOA 1YXUA 1R0PA 1Q97A 5IA2A 4I94A 4BRXA 3ZUUA 5I9ZA 4M84A 5EKOA 5CSPA 1VZOA 4FYOA 4JG7A 4IVBA 4G1WA 4MD7E 2CNVA 3KFAA 2ZB0A 3VS1A 4RVKA 3IKAA 4I93A 4IHPA 3UMWA 2CKOA 3LMIA 5HOAA 4C4FA 5LARA 5CXZA 4BBEA 4LUEA 1M14A 5A4CA 4YPDA 2FSTX 3D83A 3LLAA 4V0GB 5E91A 4QTAA 4DHJA 5DIAA 4L9IA 3Q53A 4RVMA 3WYXA 1Q8ZA 4MBIA 4NM3A 4MQ1A 5CQUA 4XS2A 4BYJA 3DB6A 3BEGA 3KULB 3E87A 3S95A 5BUIA 4C3RA 4FIIA 3LFNA 3VW8A 4JIKA 2OKRA 4DGGA 4FV0A 3ENHA 4TW9A 4F1TA 3IW5A 4FEXA 4FKIA 4O2ZA 2XNGA 4E4MA 3HZTA 5EK7A 3A62A 5IQDA 4ITJA 3ERKA 3UNJA 2BKZA 2XRUA 1JKTA 4AT4A 2X8IA 4DH3A 3PG3A 1R78A 3DAKA 5B0XA 4AQCA 3QKKA 4NT4A 3ZXZA 5HTIA 1FGKA 1WBNA 4RWJA 1DI9A 4XYFA 1U54B 4UXQA 5GJGA 5DG5A 5JQ5A 4ZS0A 3Q9YA 3BU3A 4R7HA 2VX0A 1G8KA 2VTTA 5IISA 3ZM4A 2HZ4A 4G31A 3U9NA 4BI0A 2VWUA 3EQBA 5AA8A 4CFMA 3A4OX 2FSMX 4EC9A 2WEIA 3NYOA 4EOMA 3HP2A 2JIUA 4DC2A 4FG9A 1PYEA 4R77A 2JKKA 3C9WA 4ZZNA 4DHIB 2WQOA 5TF9A 3CGOA 3NUUA 3Q4CA 4OBOA 3VN9A 4E4XA 3PPKA 4E6QA 3PLAE 3TYKA 4NFMA 4OR5A 4ACDA 4ZMEA 4ZTRA 4OAUC 4ZTHA 4EYMA 4K6ZA 5IG1A 5LVPA 4QPSA 4P5QA 5K3YA 1OKWA 4D28A 5DMZA 2VGOA 4UMRA 2VUWA 4MF0A 3BL9A 4JNWA 3DTCA 4DBXA 3O23A 4RQVA 4XG7A 3GC0A 5M53A 3SVVA 4AXEA 2YJSA 1S9IA 2PUIA 5FTGA 4I22A 4JX7A 3Q4TA 1J91A 2QCSA 4LRMA 4PWNA 3PVBA 2PVMA 3RGFA 4CFFA 3ATSA 3GNIB 4AE6A 1H00A 4TT7A 3RMFA 4WRSA 5BVKA 1OITA 3SAYA 3VS5A 3FSKA 4QNAA 4C58A 1KOBA 2J0LA 3NSZA 4I4FA 4NUSA 5L2SA 5BUEA 3C7QA 5BV3A 4FX3A 1KE7A 3QRTA 4BHZA 3F2AA 1W82A 3D94A 3I1AA 4EHEA 1WZYA 3VJOA 3U6JA 3FLQA 3C0GA 3MH3A 5G6VA 2UV2A 3VAPA 5KCVA 3N4UA 3TKHA 3AD5A 2X0QA 4OAVB 4B8MA 1M7QA 3IW7A 5M55A 5CVHA 4C8BA 3KREA 4JOAA 1PKGA 1XBBA 2Y6OA 4F09A 4YC3A 3P23A 5D11A 3V01A 1PMNA 2QVSE 2C6KA 3MTLA 3QCSA 3VBTA 5LMKC 5K0KA 2F2CB 3UP7A 5K0XA 1RE8A 3RPRA 4DFUA 2JDSA 5J9ZA 5EHOA 2GNJA 3MY1A 4BWPA 5M4CA 4V0GA 3GCPA 3FQSA 2UZLA 4WUNA 2VAGA 1P2AA 3EIDA 3O7LB 4G5JA 4PL3A 2QOOA 4Z3VA 2EXEA 1OVEA 4DH8A 4GKIA 3MH2A 2EXCX 3V6RA 3KULA 4PMTA 5EM7A 1WVYA 2H6DA 2X2KA 5C4KA 5M08A 4JQ8A 4FT0A 5JKGA 3VBYA 2CGVA 4F9AA 5DT4A 3EB0A 3NGAA 3NUXA 3OT3A 3LQ5A 5EW9A 1H4LA 3LJ0A 3ZXTA 4Q5EA 3LQ3A 3ZRLA 1OPLA 2WZJA 2PK9A 3PA3A 1QL6A 2SRCA 4FSYA 4IQ6A 4QMQA 4JMQA 4CFNA 3NUAA 2FH9A 2BRBA 4N6ZA 2H9VA 4L68A 5C9CA 3O0GA 2OW3A 5HE0A 3PUPA 1A48A 3H9OA 2V7AA 2J50A 3MFUA 4D2PA 3BHUA 4G3EA 2XZSA 2ETRA 3K3IA 3BYMA 2J51A 5FTOA 4CCBA 4DEHA 3E8EA 3Q60A 4QEBA 3CR0A 3EWHA 2OH4A 3TKUA 2FO0A 1JSUA 5CEOA 4OTWA 5AUWA 2YITA 3KRLA 4QMXA 4FC0A 1Q3WA 2WGJA 3SX9A 4TTHB 3N4VA 2IVVA 1OL2A 3TJDA 1CKIA 1L8TA 4IDVA 4XG6A 2V0DA 3IK3A 5A6NA 3OG7A 5LMAA 3W2QA 3QAME 1O6LA 4ZZMA 4CMTA 1PXOA 3D14A 4JXFA 2P3GX 3SHEA 2O2UA 5DE2A 5IA4A 1OL5A 3FHRA 3QTZA 3ZUTA 4EJNA 4PNIA 5GNKA 3FI2A 4AA5A