4Z55A

Anaplastic lymphoma kinase catalytic domain complexed with pyrazolopyrimidine derivative of ldk378
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
307
structure length
294
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design and synthesis of novel selective anaplastic lymphoma kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords ALK tyrosine kinase receptor
total genus 102
structure length 294
sequence length 307
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4z55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4z55A01
3WZEA 3Q4ZA 3NAXA 2BDJA 3V01A 5M07A 3KULB 3V5LA 3SX9A 4TL0A 3F2RA 3GI3A 2R5TA 5EI6A 3FMDA 5FEDA 1A06A 4AP7A 2O5KA 2OSCA 3OCTA 4CRLA 3DKCA 3QGYA 3TM0A 1YHVA 1KE5A 4RG0A 1DAWA 4AW2A 1OL6A 1OL1A 2PK9A 2YCSA 4FL2A 4CV8A 5FXQA 3AGLA 3QCXA 4X2GA 4IAKA 4C57A 2R3KA 5K0KA 2WNTA 1L8TA 3U4WA 3QLGA 1BI7A 4BDEA 3EMGA 5M4UA 2IPXA 3FZPA 5ACKA 4FT7A 3BHTA 3FE3A 4NU1A 4I5PA 4DFYA 5AAGA 3R2YA 1IAJA 5CX9A 4FT3A 5E8ZA 3E7OA 4OR5A 4QQ5A 3DBCA 2BR1A 2YITA 3A7GA 3PJ2A 4EHEA 2BAJA 4D1ZA 5CAQA 4XG8A 4X6QC 4BCQA 4TYEA 3OMVA 4OTDA 4JL9A 5ANIA 5D11A 1H1RA 4S34A 5HLPA 3BU3A 3RPOA 4DEDA 3VW6A 4J71A 3OP5A 4FEQA 5KZ0A 4F9CA 1QCFA 2B52A 3ULZA 4WNKA 3KKVA 3LE6A 2YJSA 2OU7A 3PXQA 4JI9A 4TWCA 3F61A 3DXPA 4FKWA 4J95A 5CNOA 2BTRA 3KREA 1JKLA 2IZUA 4PL5A 3WZUA 1K3AA 3PA5A 1SNUA 3ZLYA 2W1ZA 5DE2A 1SM2A 2HYYA 1ZWSA 3GNIB 4BI1A 3MIAA 2FA2A 1GOLA 1CKPA 3FY0A 3RWPA 4OTHA 1P4FA 3HA8A 2Y0AA 3R83A 5FXRA 4HCTA 4MK0A 4D58A 3QD0A 3EN5A 2C68A 4MXOA 3P79A 4U80A 4AX8A 5EM7A 3TIZA 5A9UA 4H1MA 2XNPA 4U8ZA 5DHJA 2YACA 3FPMA 5AEPA 5IUHA 3CPCA 3KK9A 3PJ8A 3ZS5A 4W8EA 4F1OA 3QX2A 3N4UA 4D9UA 5CAOA 3VF9A 5A6OA 3FKLA 2Z60A 2BHEA 2C5NA 2GFCA 4RFMA 3AC8A 1B38A 4EK3A 5I5ZA 3OF0A 3UG2A 4E20A 4ZY4A 2A2AA 3MJ2A 4LI5A 3QUPA 4O0YA 5CT0A 4HGTA 5AWMA 4FBXA 4QQTA 3G51A 4O6EA 4MCVA 4UMRA 4JXFA 5CASA 4CEGA 4PPAA 2R3IA 5L6WL 4USDA 4F7SA 4CLIA 2X2KA 4EOMA 3NW6A 4FTRA 4QTEA 2X8IA 4CG8A 1QMZA 4WT6A 2B54A 3VBWA 3O96A 5CTPA 2ITNA 3D7TB 4CSVA 3KXHA 5HO8A 2ZDTA 5AV3A 4MNEA 5FTQA 3RTPA 4ZLOA 5CU0A 4L8MA 2BIYA 4YHFA 3IOPA 4NT4A 3H4JA 2CCHA 1PKDA 4AW5A 3U9CA 1OKZA 3AG9A 1R3CA 4C4FA 3GU7A 4HVIA 3NX8A 4GYGA 4J1RA 4PP9A 3LMIA 1FMOE 1SNXA 4KRDA 5E7RA 2VD5A 4AFJA 3W2SA 4BVUA 1UWJA 2WQMA 2C6MA 4EHVA 4G34A 3L8VA 3S1HA 4M15A 4U7ZA 2R3PA 3R71A 2BCJA 2OZOA 3NSZA 4BCHA 4MBIA 4JR7A 4H3QA 5JZNA 4CYIA 4E7WA 3P78A 4JX7A 4JJRA 4DH1A 4EOJA 3RPRA 3OWLA 2BKZA 4CT1A 2C4GA 3UPXA 2O64A 4O81A 4IJPA 3QXOA 4AS0A 3EWHA 2WO6A 3EFLA 4EORA 1Y57A 2ITQA 4IM2A 4G9RA 2C30A 5IISA 4LOPA 4O7SA 1YDTE 5IQIA 4V05A 4GFMA 3V8WA 2OZAB 4O84A 4NSTA 3UE4A 4FOCA 4J98A 3UBDA 3CQEA 4LOOA 3FWQA 5EHOA 5DVRA 4YP8A 4FTLA 4UB7A 4RIWB 2ZM3A 3VW8A 2NP8A 5IEXA 1JKTA 2JC6A 1UNLA 2F7XE 4K2RA 3RCJA 3NWWA 4WHZA 3UQFA 3WIGA 3IW5A 3AMYA 4IX5A 3NUXA 5CEIA 1Q99A 4BDDA 5JRQA 4EJ7A 4WKQA 4CKRA 4L6QA 4ASZA 2WMUA 1XR1A 1YWNA 4O7RA 3JVRA 1VYZA 1VZOA 3D5XA 1ERKA 3LLTA 1VR2A 3EKNA 4NK9A 2XJ2A 2QG7A 5E8TA 3ZFYA 4L67A 1FBNA 3E8DA 4ZSJA 3RZFA 4BCFA 3I1AA 1GIHA 2XRUA 4ZP5A 4F09A 5BNJA 2W1HA 3AD6A 4YJOA 3RK7A 3DXNA 5HCZA 3SQQA 1QPJA 5G6VA 4NUSA 1YXXA 4NTSA 4WD5A 4ZIMA 4ZY6A 3A4OX 3BWFA 3ZZWA 4ANQA 3R9OA 3ZC6A 3UP7A 3S00A 3GENA 2J0JA 4JG8A 5B7VA 3FMMA 3W2PA 2I40A 3UC3A 1BLXA 3DKGA 2W5HA 4IAAA 4O22A 5G1XA 3TWJA 2UW5A 2JGZA 5JMSA 4FYNA 4U43A 5BMMA 4GIHA 2GCDA 1KV1A 2XA4A 2RFEA 4RIYA 5DNRA 3BV2A 3I60A 3EFWA 4MXYA 3PVBA 3MTFA 2E9PA 2AC5A 2ETRA 3OCSA 5CS6A 4E3CA 3FKOA 3EFKA 4QNYA 3ZXZA 1CDKA 3QQFA 4WO5A 4BCGA 5C4LA 5E8SA 4CT2A 3K5VA 1UNHA 2QOFA 2HWPA 3DY7A 4UWYA 3SOCA 1Q3WA 5DOSA 2QOCA 3O71A 4U9AA 2ZV9A 4BDCA 3TV7A 3OTVA 2BROA 2F7EE 2ZV8A 3BYMA 3D15A 3EIDA 4DLIA 3MSSA 4FODA 5BVKA 1JVPP 1OECA 4R7HA 5EDPA 2ZV7A 1BL6A 5HG8A 3FMJA 1OUKA 3REPA 2PMLX 4W9WA 3L8XA 1H24A 3IGOA 1PXLA 5TO8A 5IH4A 5K4IA 1JSVA 3LW0A 1YOMA 1H27A 3BYOA 2WTCA 4R5YA 5IZFA 2WMTA 1WMKA 1BX6A 5C01A 3MH2A 5BVDA 4NKAA 1QPEA 2PVRA 1G3NA 1W7HA 3D83A 3HYHA 3IW4A 3KA0A 3F5GA 4Y83A 5EYDA 5HD4A 4F9YA 3MFUA 3R1NA 1YI4A 4P90A 4IADA 4YLKA 2VO7A 3HZTA 5CT7A 5IQCA 5HVYA 3GEQA 2IWIA 4AA0A 3ODZX 3Q9YA 2BILB 3RBWA 4MVFA 4IDTA 3RM6A 4Z16A 2XNEA 3F69A 3LQ5A 5KMJA 5IUGA 4FKVA 3DJ6A 4OW8A 4EOLA 2EVAA 2VWWA 4FT0A 2J51A 4NTTA 1PMNA 5F4NA 3CSVA 4CZYB 4F7LA 3AOXA 5I9YA 4X3FB 4NWMA 1RJBA 4ZMFA 1SVEA 2XP2A 3VF8A 2GNJA 2RL5A 3RNYA 5DWRA 4G3FA 4JG7A 4G31A 2Z02A 2R7IA 3TACA 3ANQA 3UIUA 4ZZNA 5C26A 1JWHA 4QTDA 5LWMA 5K5XA 5AA9A 4BY9E 2OK1A 3UP2A 4MD7E 4EH6A 4J8MA 4R3CA 3ATSA 4PV0A 1KV2A 1M17A 1ZMWA 2JBOA 5DG5A 4E5WA 4Y85A 4FEUA 4AN9A 1WZYA 3R63A 4BC6A 2H6DA 5EK7A 5HD7A 5BVOA 5C27A 1V0OA 5FP5A 5EQPA 2A0CX 3D7TA 1W98A 3ORMA 4FIFA 2YM5A 2R3RA 3IS5A 3OROA 3Q04A 3B8QA 4JG6A 1PHKA 5HBEA 3A62A 4AACA 4BWPA 4EONA 4FE2A 4MF0A 5TE0A 4L44A 3DQWA 4KAOA 5GNKA 5CQUA 5JT2A 4ZEGA 3NGAA 4G5JA 3BI6A 3UNJA 1OKWA 5D10A 4IBMA 2OF4A 2WOUA 2JKMA 3PVGA 3FLYA 4IB0A 4TWPA 3QCYA 3KXXA 2IZRA 4BGHA 2QOIA 1XO2B 1KE8A 3MW1A 4N4SA 3VUKA 3U6HA 4BDKA 2ZYBA 4LL5A 1RQQA 2GTNA 3TJDA 4GH2A 3CS9A 3ENHA 4QQCA 3VUMA 5EQEA 5M4FA 5JRSA 2OIBA 2BZJA 4C0TA 1OPLA 2LAVA 4CMOA 3A7HA 5DYJA 2YM8A 4HGSA 3ORNA 2VZ6A 4F0FA 3UZPA 5LCKA 2QC6A 5LMBA 3BBWA 5DIAA 1PMEA 3W2QA 3I0QA 3E3BX 3LCSA 4XS2A 4HCVA 3D5WA 4XLIA 3ROCA 3MDYA 3TNWA 3DBFA 2OJIA 4YZCA 4I0SA 5E1EA 1G8AA 1OZ1A 3FQSA 3PPZA 4YC6A 2OJGA 2OWBA 2B9JA 3P23A 5A54A 5L8LA 2YIRA 4QTAA 3UIMA 1JBPE 2BRNA 4L9IA 1P4OA 2VNWA 5GINE 4AQCA 3UQCA 3R8UA 3D2IA 3QUEA 2JIIA 3ORPA 3U55A 2PHKA 5B2KA 2FUMA 3NIZA 1UU9A 4A9UA 3I4BA 4O83A 3E88A 2GQSA 1V0BA 4R3PA 4CGAA 4TYHA 3O7LB 3FBVA 4KA3A 4BIBA 4S32A 3UIXA 2UW4A 3MB6A 4UYNA 1OB3A 4YTHA 3QC9A 3DB6A 1UU8A 2UZOA 4G6NA 1NW1A 5EW9A 4CKIA 4DFUA 2GQGA 5A6NA 4C62A 4MNFA 4HNFA 3KU2A 4IHPA 3O17A 1X8BA 4YJRA 3UZTA 3QCSA 2PVHA 4E6AA 2EWAA 3HL7A 2GDOA 3LXNA 4FTNA 3G90X 4AN2A 2BMCA 2J4ZA 3F9NA 3CD3A 2DS1A 3F66A 2EUFB 4RQKA 4GUEA 4DC2A 2X9EA 1SYKA 1H26A 3TZMA 4JBVA 5EQYA 3ID6C 2Y9QA 2PL0A 4TZRA 4PMPA 2F2UA 3C5UA 3WF8A 1PRYA 5BYZA 4RWIA 2WTJA 2XCKA 2X9FA 4ANLA 2B55A 2IZTA 3AD4A 2ZM4A 2F4JA 3I6WA 4JIAA 1Q97A 2W4JA 3E8CA 4RJ7A 4E4MA 5HG9A 5DEYA 1OKVA 3UO6A 1XKKA 5GHVA 2V5QA 3AXWA 2XIYA 4CCBA 3QU0A 1YWRA 1UNGA 5EH0A 5HX6A 4BBMA 4I0TA 1M7QA 4YC8A 5IU2A 3LXKA 4DA5A 4FKUA 5ETCA 4RFYA 4OBQA 1PJKA 4M13A 2H34A 5IDPA 2GFSA 4RWKA 2YIYA 3GC0A 3MFSA 4QP1A 4ID7A 4TYJA 3ZUUA 3TI1A 4JBOA 3RZBA 3R28A 1YHWA 4ZLZA 4ALWA 1R0PA 4BZNA 4HPTE 3G6HA 4UALA 4PTCA 3MY0A 3UG1A 3MESA 3HLLA 4BWKA 2XBJA 4Z55A 1I44A 1KOBA 3HP5A 3R02A 4CD0A 3O8TA 2XK6A 4WUAA 4YGAA 3PXYA 2CKEA 5CALA 2RGPA 3DDPA 2YM6A 3ZO3A 4HYHA 4CKJA 4IFCA 3UMWA 4O1PA 3RAKA 4F0IA 4ACCA 2GNLA 1AGWA 4AA4A 4EZ5A 1ZYSA 3JR1A 3S0OA 4OTWA 3MY1A 1YHSA 1ZZLA 4QMLA 2YISA 2QU6A 5LVLA 3BLQA 5FD2A 3SVVA 4NM7A 3EQCA 2GNHA 3S4QA 2W1IA 3DV3A 1Q24A 4PTEA 4USEA 3KN5A 4RJ8A 4W4YA 1RDQE 3PSDA 3WYYA 3DFAA 2GPHA 2IW8A 2HW7A 2PE0A 5B0XA 4C34A 3E8EA 4XYFA 2E9OA 2WMQA 2CCIA 1IA8A 2W5BA 4FT5A 2P55A 5I9WA 1VEBA 5DR9A 4G6OA 4GVAA 2C3IB 4WOVA 3ZU7A 4YTFA 2UUEA 3KVWA 4KINA 3DTCA 2YZAA 2QG5A 3GCSA 3ZEWA 2P2IA 2VX0A 4UBAA 3QZHA 5ANDA 4BCMA 3MY5A 2W05A 3KMUA 3NUYA 4XX9A 3SW4A 4TY1A 2XYUA 4HPUE 4MH7A 2QCSA 5AR3A 5D1JA 3R8ZA 3Q53A 4GT3A 3RCDA 4AW1A 2VWBA 4BDHA 4BL1A 5CEMA 4KUJA 2VWVA 3EN7A 4N57A 2OJJA 3VUGA 3PPJA 1PMUA 4I4EA 3AC5A 5CVHA 4HYUA 4GSBA 4PP7A 2ZMCA 1YWVA 4FR4A 2BIKB 3EJ1A 3QLFA 4UWBA 4HVHA 2E9NA 2HCKA 2Q0NA 4DEHA 3UOLA 5AV0A 3VS3A 1MQ4A 2WMXA 5EYKA 2WMBA 4JQ8A 5IH5A 5J9LA 3V5WA 4DBXA 5AR4A 3TXOA 4FV3A 4QMOA 4LRKA 4EH7A 2YM3A 4MKCA 4NEUA 2JITA 1KWPA 5KBRA 4F6WA 5FGKA 2QO9A 3UNZA 2J2IB 3BE2A 5HO7A 3TN8A 2UVYA 3OTUA 3OG7A 4PX6A 3DBQA 5T6KA 2RIOA 3A2CA 1DM2A 3NUNA 2Z7SA 2VN9A 3SHEA 3THBA 4DG3E 4MWIA 5HE3A 2C5OA 3CQUA 2W17A 4XG4A 4DGMA 3L9MA 1Q61A 2OH0E 4MYGA 2PZRA 4ASDA 5JFXA 3TKUA 4I23A 3DLSA 4O1OA 4FOBA 3E92A 3IDCA 5GJDA 3C7QA 2XZSA 2ZM1A 2WMSA 2DQ7X 2Z2WA 1BUHA 3A61A 3C50A 3PG1A 3FZOA 5HNBA 4FKTA 2PYWA 2YFXA 4FTJA 2CJMA 3HMOA 1ZOEA 3TNIA 4WSQA 1Q62A 4EYJA 5AUXA 4J53A 1FGKA 1ZOHA 2WB8A 3BV3A 4CV9A 2I0EA 3HV3A 2CGUA 3LJ0A 3DB8A 3K3IA 4XRJA 5FP6A 5HE2A 2H8HA 3GU5A 1GZ8A 4E26A 3C4WA 3MPMA 2R7BA 1J7IA 4OTGA 3QX4A 2B4SB 1RW8A 3R7GA 1JAMA 3FLQA 3Q4TA 4IJ9A 2PVYA 3PE2A 1ZMUA 5HI2A 4H58A 2ZOQA 3NYNA 3DZQA 3PE1A 3QTZA 4O96A 4QP8A 1NY3A 4L3LA 4A7CA 3NYVA 3DAEA 2BHHA 4HZRA 4YJTA 5ICPA 3NEWA 5CWZA 4EH5A 2E9VA 3MVMA 5ANKA 3BRBA 4YUQA 3L8SA 2FSOX 1YOLA 4DN5A 2R3MA 3UVRA 5CEOA 4O0UA 4FV4A 4PWNA 2VU3A 4I4FA 2Y6MA 5LVNA 3LJ1A 5H3QA 2IVUA 4G3GA 2O2UA 3ORKA 2J9MA 4GRBA 5AX3A 2C6DA 5HORA 4IX3A 5GIOE 3BLRA 4RRVA 3WZDA 5AIKA 2BFXA 5J1VA 4XG2A 5E8YA 3TIYA 4HVSA 3M1SA 3QTQA 3ZRMA 3B2WA 5DT3A 3R8LA 4O0VA 4QOXA 4HNIA 3EQPA 4IFGA 4OTPA 4G3DA 3T9TA 3QTIA 2HY81 1J7UA 3EYHA 4OBOA 1R39A 3IKAA 3UTOA 3EN4A 4CNHA 4QYGA 4L46A 3DJ5A 4FKQA 1HCLA 3Q52A 4JOAA 4YMJA 1VYWA 3OZ6A 2EB2A 4OT5A 3U87A 3QQHA 2BPMA 4GL9A 5ITAA 3Q9ZA 5F1ZA 2EXEA 4XV1A 1KE7A 2A1AB 3TUDA 3KRXA 2JDOA 4XH6A 3OXZA 4BDJA 2V7AA 3SW7A 1APME 5CAPA 4I20A 3FPQA 4O7ZA 4EQUA 4TWOA 2VAGA 2PUPA 1E1XA 3QD4A 3ZEPA 2ITXA 3QA8A 3UODA 4V01A 4HCUA 4RZWA 3R8MA 3TTJA 4CTBA 2WFYA 4WUNA 3W55A 3NUAA 3CY2A 2EXCX 1H25A 3FMNA 5KZIA 1SVGA 2GU8A 3PA4A 1QPDA 2ITVA 2YDKA 5J8IA 4UN0C 1MQBA 3QUDA 3RKBA 4Q9SA 1XH6A 4K8AA 4M0YA 2XKCA 5EM6A 5KKRB 3RAHA 5IQAA 2VTOA 3KMMA 2GHMA 4AGCA 2G1TA 4GK3A 3LXLA 1FVRA 2X81A 3HV7A 3F3WA 3OOMA 4S31A 4PTGA 3QTSA 4FI1A 4IXPA 1OIYA 5AP2A 5HOAA 2PVLA 1PF8A 5A4LA 4ZJJA 4YJPA 4H36A 4IB5A 2OFUA 4L68A 5CLPA 2XNNA 3NDMA 4FV0A 3R1SA 5ANJA 1O6YA 5E92A 3OWJA 2OGVA 2QU5A 2XCHA 2YERA 2W06A 3ZFXA 3R7YA 3MWUA 2CNVA 5E90A 2XEZA 3O8PA 4M14A 2X4FA 4FC0A 4UWCA 3MGYA 4EUUA 3VHEA 4UMUA 3RPYA 4L3JA 4QP4A 1NT2A 2B7AA 4I24A 3V5JA 5IDNA 4AG8A 3P5KA 4PY1A 3ZUVA 2YM4A 2R0IA 4P4CA 3ZXTA 5IKWA 3IW8A 2VNYA 2OBJA 4K6ZA 4ACGA 3NCGA 1Q41A 4FX3A 4ASEA 4FA2A 3SG9A 4X2KA 1UA2A 4BR3A 3LJ2A 4ANMA 1OITA 4EOIA 4GK4A 3UYSA 2XK3A 3K5UA 3SXFA 3V6SA 3UDBA 2YA9A 4FKLA 4JBQA 2XNOA 4AA5A 3BKBA 4F6SA 3G15A 5FDPA 1WBNA 4A4XA 1XH7A 4IB1A 4W4WA 2HZ4A 2J7TA 5C8NA 4RWLA 4MD8E 2CDZA 2R3NA 5ETIA 3GB2A 4AW0A 4E73A 4U79A 5JGDA 4ONAA 4RC2A 4C59A 3OW3A 5L6OA 3JUHA 3PUPA 5CSWA 4AFEA 2XNBA 2VTNA 5HEZA 2CSNA 4CQEA 5HVKA 4N6YA 3CEKA 1H08A 4JDJA 2RG5A 4EZ7A 3CXWA 3OXTA 4YJUA 4QPAA 2W96B 4YURA 3CR0A 3G9NA 3TJCA 5M44A 3QFVA 1I09A 1LPUA 4IVAA 4I5HA 4R6VA 1ND4A 2QVSE 5A14A 1ZLTA 3FI3A 4YPDA 4XRLA 4ZTHA 3ZLXA 4ANOA 4YSJA 4LV8A 3C0GA 4IW0A 2R0UA 5FEQA 3TCPA 1FOTA 2R3GA 1PXPA 4RC4A 4WSYA 3IDBA 4RBLA 2ETKA 4BKJA 3FMLA 3D14A 5CZHA 2I1MA 3O23A 2BTSA 2ITTA 1LR4A 4ALVA 1W0XC 3H3CA 4GVJA 3E87A 4FV1A 4ACDA 2UZEA 4FSYA 4GFOA 2VTPA 5H8BA 4XUFA 4F99A 3NCZA 4D5HA 4D1XA 2UVXA 5BMSA 4R3RA 1R0EA 3L9PA 4FK3A 3AC4A 3KRLA 5CI7A 3ZH8A 4I6BA 5CF8A 2B0QA 3P9JA 4Q5EA 1TKIA 4R77A 5CENA 3K54A 4O0XA 4X3JA 5C8MA 4F7NA 2WU6A 3NS9A 4NCTA 1BMKA 1FQ1B 4QP6A 5GZ9A 3LMHA 2O65A 5DBXA 3W10A 2WU7A 3SDJA 2X6EA 3U9NA 5KMOA 1J1CA 3D4QA 1OM1A 4Q5HA 3QRKA 1E1VA 2B53A 1A9UA 3IPHA 4KKEA 5FWKK 5GJFA 3FQEA 3VBTA 4AGWA 4EOKA 3FDNA 5TT7A 1Q8YA 4TPTA 3QTUA 2UW0A 1OBGA 2XIXA 5BYYA 4OAUC 3I81A 5JGBA 1WAKA 3DLZA 3DK6A 2VGPA 3ZZEA 4RJ3A 3ROYA 3W2OA 2CKPA 2LGCA 4PPBA 5CXHA 3M42A 4HVDA 2BZKB 3TDVA 3CPBA 4R5SA 3ZO4A 2QO7A 2YAAA 2ZJWA 3P7AA 2RF9A 3IK3A 5CYIA 1ZXEA 2WKMA 4V0GA 5LMKC 1XBCA 4TKSA 2WQBA 5JFVA 3G5DA 3MH3A 4IE9A 4AZSA 4ITIA 4BGGA 5AMNA 1M2RA 1U4DA 3IECA 4ARKA 4JR3A 4LMUA 3FYJX 4D2TA 1P2AA 2J0KA 3MTLA 4OTIA 3FAAA 4D0XA 1OKYA 3VUHA 4C8BA 1H00A 4MQ2A 2XM9A 3VBYA 2KULA 3CIKA 4X3FA 4XG9A 3OBGA 5A4QA 2ZDUA 5L2SA 4KIKA 4M67A 1UKHA 5J7HA 5K0XA 2VTRA 4F63A 4IANA 2H96A 2PULA 5EW3A 4D2VA 2W4OA 5KKRC 3PFQA 4EH2A 2C0IA 4QP2A 4ANSA 4LQMA 4FVPA 4LL0A 5AAEA 3MB7A 4KIQA 1T45A 3FQHA 3CP9A 1JKKA 4RQVA 2JFMA 2QKRA 4WG4A 3C4CA 5HIBA 4ANBA 4ZSAA 3HUCA 3PP1A 3SA0A 1K2PA 3V51A 2X6DA 3FLSA 5M56A 4LGHA 1MRYA 2CGXA 4GEOA 1H8FA 3C1XA 5IQFA 2XS0A 4Z7GA 5AUTA 5BVFA 3F3UA 4QMNA 5HG5A 4WNOA 2XRWA 3LXPA 4D4SA 3KMWA 3V3VA 1BKXA 1TQMA 4KNBA 3K2LA 1XQZA 3TZ9A 3BEAA 5LXMA 2FVDA 4O2PA 2HOGA 4R8QA 4AGDA 4IX6A 5IA3A 3NVMB 5EI2A 4ZTNA 3I5ZA 1YI3A 3QWKA 3FYKX 3GU8A 4AGUA 4QYFA 2HK5A 3LQ8A 4X2FA 2WTIA 1K9AA 4RX5A 3QAME 3QCQA 3EL7A 1IRKA 1ATPE 1WBSA 3R00A 2IG7A 4GJ2A 1AD5A 3VN9A 2R3HA 4JNWA 3F88A 1HOWA 3H9RA 3HV5A 3MA3A 4H3BA 3GU6A 4TNDA 3ZDUA 4LGGA 4MF1A 5L6PA 5JQ5A 4KBCA 3BCEA 3ANRA 5A4TA 2QONA 2JD5A 3CGOA 1IEPA 4EL9A 4FMQA 3CY3A 4OTFA 3KN6A 4F7JA 4DEBA 1JPAA 5EM8A 4MD9E 2WPAA 3ETAA 1H28A 1Y6BA 4LUDA 1AQ1A 4FZFB 5CY3A 3ZYAA 5IEYA 2R3OA 3HKOA 3MFTA 1HCKA 1OVEA 2IW9A 5JZJA 3OVVA 4IQ6A 5I9UA 4U45A 4BYIA 3WZKA 4CZUA 1CKIA 1O6LA 2RFNA 5M4CA 2YHVA 3Q96A 2ITZA 3WF5A 4GFGA 2ZMDA 5D12A 3CKWA 2WOTA 3VC4A 3VS5A 3PRIA 4I41A 4DEGA 2QHMA 4NH1A 2WQNA 5HU9A 3FI4A 3FJQE 3MI9A 4XHKB 5EYMA 2R2PA 3I7CA 5FEEA 5FRIA 4OUCA 3EQDA 3DXQA 3KRWA 2A19B 5I3OA 1FMKA 3SC1A 3TEIA 4C61A 2OFVA 4FVRA 3T3VA 1ZYDA 4RT7A 5D7AA 4FNYA 4D9TA 5D7VA 3FLZA 3BLHA 4XG6A 1WBVA 1ZMVA 2ACXA 2IJMA 1F0QA 4KBAA 5E8WA 3LAUA 3OS3A 2YCQA 5HE0A 4FKSA 1O6KA 5M08A 4C38A 2YCRA 3EQHA 1L3RE 3E62A 2X0GA 4XOYA 4O7VA 4QNAA 4C4IA 5AM6A 5IMXA 1Y91A 3FXWA 1DI8A 3A7JA 4RIWA 3F7ZA 4A07A 1H07A 2UZLA 2R64A 3ERKA 3BHHA 4PNIA 3RI1A 2PZYA 4TYGA 3QTRA 4GT4A 2UZNA 4CFUA 4IB3A 4CFVA 4PDYA 4BCOA 4M97A 2J90A 3EL8A 3BHVA 4FK6A 2EB3A 4HGLA 4KS7A 3Q32A 2OXYA 4GK2A 4C4GA 4EK8A 3QRUA 3R1QA 3NAYA 3ET7A 3F5XA 3D0EA 4FSZA 4U44A 3WE8A 3UO4A 4U5JA 3KXMA 5ANOA 5LVMA 3HDNA 4EC8A 4ALUA 3POZA 1GJOA 3L9LA 4FKJA 5FXSA 4C3FA 3LCDA 4DEIA 2E9UA 5AP6A 5H8EA 4OAVB 4FIHA 1LP4A 3I6UA 4S33A 4ZXTA 5T3QA 4K11A 2RKUA 3ORTA 2XNGA 2P0CA 2P3GX 2YEXA 3CJGA 3QD3A 4BIEA 5D41A 1XH5A 4UYAA 4RX7A 3OC1A 3V5PA 4K0YA 3TNHA 3ZO2A 3DA6A 4RX8A 1Q8TA 1GZOA 2V7OA 4R1YA 1YDRE 3VVHA 5C1QB 3ZBFA 3UVQA 1Y8GA 3DKFA 5I9XA 2WAJA 3LIJA 5CSHA 2P33A 3N4TA 4FG9A 4ENYA 4LM5A 4ZZMA 4L45A 3ODYX 4AF3A 2ERKA 2ZB0A 5JK3A 3IDPA 5IH6A 1KOAA 2RFDA 3QKKA 3FEGA 4YJNA 2BZHB 3CCNA 4D1SA 1MRVA 4DFZE 3ZMMA 4F1TA 5FM3A 4O7LA 4PPCA 4KB8A 3OUKA 4EH3A 2HW6A 2JLDA 2C69A 2YIQA 4L53A 3FUPA 4WA9A 3F5UA 4FT9A 2ZV2A 4NFNA 2YZLA 4IWQA 3Q6WA 2V22A 3KK8A 3FY2A 3IW6A 3MBLA 4KWPA 4RC3A 4BB4A 4M3QA 4ASXA 4RSSA 4YNEA 4OGRA 4XP3A 4D4YA 1RE8A 5J5TA 4UMQA 4BTMA 1TQIA 3RHXA 3CD8A 1YQJA 2JAMA 3RWQA 5HX8A 4FSMA 5IG1A 1F5QA 1R78A 4JQEA 4E6CA 4YR8A 5JN2A 2GNIA 2OJFE 4MWHA 3LFAA 3HUBA 4DYMA 4QMZA 5CSPA 2IVTA 4FKRA 1OL7A 4RPVA 3DK7A 3MS9A 4B6LA 5ANEA 4U40A 4E5BA 3W32A 3FZ1A 4GUBA 1XHAA 3KGAA 2I6LA 4K1BA 2FGIA 3FZRA 1XH8A 4FZAB 5IQHA 4IVBA 2XNMA 4GCJA 3BYUA 2UZDA 1R1WA 4OBPA 3SXRA 3G2FA 4BCKA 3EHAA 3POOA 5DN3A 3T9IA 4ZTMA 2WTVA 1WVWA 3PXZA 3ZONA 3HGKA 1IA9A 2OICA 4A9YA 2GTMA 1QL6A 3BWJA 2XB7A 3W33A 1JSTA 5H9BA 3OT8A 5FTGA 3TG1A 4QMWA 3VUIA 1A48A 2CLXA 3FZSA 5AP1A 4B9DA 3K3JA 3KCFA 4FKPA 5EHLA 4WBBB 4FV9A 4P2KA 2GHLA 3AD5A 3NNXA 4XG7A 5M06A 4QYEA 5KHWA 3HRCA 4AZTA 5DPVA 3SLSA 4F4PA 4M84A 2XIRA 3GCVA 5AR2A 3MVLA 4QP9A 4DEAA 3R0TA 2XIKA 3PYYA 3RK5A 3A4PA 4QO9A 4IVDA 1OPJA 5DLSA 3R6XA 3TT0A 3EB0A 3DDQA 2WELA 4MAOA 4FZ7A 2BKKA 3AMBA 2B1PA 3P86A 2YLFA 4GKIA 3Q5IA 3OBJA 2OLCA 2X2LA 4RIXA 1NXKA 1Q8ZA 3LFCA 4TRLA 4ZJVA 2UW3A 3P08A 2X8EA 4I93A 2QOHA 2WEIA 4L7FA 4GMYA 5EHYA 3VS4A 4DG0E 2UZBA 3S2PA 3FI2A 2QO2A 4ZSEA 5AX9A 4RIXB 2CNQA 5I4NA 4YTIA 2XKEA 3CTJA 2VWXA 4U3YA 3BQCA 3AC1A 3CC6A 3ZLWA 4BCJA 1M7NA 5J87A 1U5RA 1LEZA 4O7TA 3M11A 4C33A 2AUHA 4O0TA 2JKQA 2OXDA 1Q4LA 4NM5A 2I0HA 5HTIA 3UOJA 4PUZA 4FTKA 3DCVA 2VV9A 4JLCA 2P2HA 3VO3A 3VAPA 3GVUA 2C6IA 2HELA 2C1AA 3V5QA 4L00A 4ZTRA 3EFJA 3L8PA 2PMNX 4P5ZA 1XBAA 4XMOA 1JOWB 2ITUA 4JS8A 4OLIA 3Q6UA 4IC7A 5J9ZA 4TYIA 3C0IA 4KIKB 3QRTA 4BIDA 3SRVB 3LHJA 3VQHA 4EKKA 1CTPE 3B2TA 3G0FA 5HG7A 5C9CA 5L2TA 1NVRA 2W4KA 2VWZA 2HWOA 2X7GA 4BKZA 1IR3A 1UU3A 5AUYA 4C37A 1FVVA 1M2QA 1ZARA 3DNEA 4O0RA 3R9NA 2YLEA 2PVFA 3VHKA 2OF2A 3E8NA 1Y8YA 2PZPA 3C13A 2SRCA 4FEVA 3JY9A 2PPQA 1Q5KA 1REJA 2YCFA 3F3ZA 4G3EA 4D2SA 4GU6A 3DNDA 3LFFA 4WBOA 2OO8X 1XH4A 2XKDA 3F2NA 3QYZA 4RVLA 3UVPA 4D2PA 5IQDA 3HMPA 3KCKA 3AQVA 4BTKA 3NPCA 1OPKA 1NVQA 2WEVA 3NLBA 1BI8A 3ORXA 4JIKA 1YW2A 4OTRA 2Y7JA 5FBNC 2WIHA 5HHWA 2OI4X 2QOBA 4LMNA 4IZ7A 1REKA 5HBHA 4X2NA 5HVJA 3F7WA 4K77A 2WQEA 2UZWE 4YZDA 4EKLA 3FI8A 4Y46A 4BDGA 5A46A 4C7TA 3PSCA 4QMYA 4PDOA 4TNBA 4IWPA 4G16A 5HNGA 4QMQA 3DKOA 4X2JA 4ZTQA 2E2BA 5KCVA 4B99A 1PYXA 3H0ZA 3R30A 4AOIA 5CF6A 4MBLA 4ZS4A 4EJNA 4TWNA 4O7WA 4RJ6A 1NVSA 1XJDA 3LFSA 1YDSE 4E93A 5GZAA 3KEXA 3PJCA 4KSPA 5HLWA 4HYSA 4R7IA 3RPSA 4F64A 4YSMA 1YXVA 4DFXE 4A9TA 3ALNA 1IG1A 3MJ1A 4IACA 2GS2A 2OKRA 4F9WA 3PTGA 3MH0A 2QD9A 4X0MA 3RGFA 4PMTA 4CFMA 5BUEA 4ERKA 4QMMA 4JX3A 3BHUA 5IA0A 1GNGA 1PXKA 2HZIA 3IONA 3EH9A 4PL3A 4CFWA 4FTMA 5TR6A 2PVNA 1PY5A 4FSRA 5CVGA 3DPKA 3TNPC 4D4RA 3TV4A 5JKGA 2WXVA 4RFZA 3NUUA 5CSVA 1PXOA 3ZCLA 3ZDIA 1P5EA 3A7FA 2HXQA 2WD1A 4M69A 5CSXA 3BYVA 2HY0A 3QXPA 3RMFA 3BU6A 3GU4A 4BBFA 2WMAA 3FV8A 3LCTA 4G6LA 2CN5A 5LVPA 3R9DA 2JDVA 1UWHA 2XMYA 4UMPA 3E3PA 4BDIA 1KUTA 2PVMA 1OIRA 3N51A 2HXLA 3HX4A 3VRZA 3NW7A 4RVKA 1FINA 3R01A 3EQIA 3O50A 4UZDA 2OH4A 3DBDA 5AUVA 5E9EA 4LGDA 4UZHA 4H1JA 3GFEA 3H30A 3OWPA 2YWPA 4CFNA 4RZVA 2OG8A 2Y4PA 3PY1A 4I22A 3QKLA 3NNWA 3AC2A 2R3QA 1OBDA 4CQGA 3DGKA 4ZOGA 4EHZA 5AUZA 4CFXA 4NIFB 2QR7A 2V0DA 3W18A 4YJSA 2C5XA 3QQUA 3R73A 4DH3A 4O86A 3R9RA 4WRGA 2PZ5A 3QKMA 4P5QA 3ZOSA 5TF9A 3VUTA 1MP8A 3BELA 5AAFA 4Z7HA 2JBPA 1PXJA 3F6XA 2R3JA 4M69B 3UGCA 5L8JA 4C3PA 5HIEA 3TZ8A 1YRPA 3IGGA 3Q3BA 3QQJA 3R8PA 3V8SA 4DFLA 2AYPA 3MPTA 3TL8A 4BHNA 5J1WA 4AZVA 2OXXA 5EDRA 1P14A 2FB8A 1YXSA 3KB7A 3PVUA 5FM2A 2PUNA 4I6FA 3BIZA 4IAIA 3VNTA 5CAVA 5CXZA 3TKIA 2BAQA 3KRJA 2VX1A 3P1AA 1UV5A 2W99B 1G5SA 4F65A 3IOKA 2A4LA 3FLWA 3LCKA 1Z9XA 2FH9A 3OUNB 3UJGA 5CEPA 4EQMA 4QD6A 3WOWA 5BYLA 3E5AA 4DINA 2HENA 2G2FA 4DGGA 3N9XA 3SKCA 1YVJA 2UZUE 5B2LA 5DT4A 4TXCA 3BGZA 5FG8A 3Q9XA 2BRBA 2WQOA 3F3TA 3GBZA 4UMTA 5CQWA 4IC8A 4ZMEA 3DU8A 5HNIX 5M51A 3OT3A 3W2RA 2I0YA 4HYIA 4EWHA 4FTOA 5CU3A 5GJGA 4G9CA 3UIBA 3VRYA 1ZOGA 4FV5A 2VWUA 2NNWB 5I9VA 4AXAA 3PP0A 5HCXA 5AP4A 1ZRZA 2W1GA 3KY2A 3VS7A 3PPKA 4B8LA 4DT8A 3LOKA 3HRFA 4NJ3A 5IMEA 3R7IA 1GZKA 1W84A 4AE9A 3UZRA 3GCQA 1Y6AA 2ONLC 4ZK5A 3RK9A 4BDBA 4DCAA 4G1WA 5EW8A 4BHZA 3LFQA 4IM0A 4X6RA 1URWA 4TT7A 2CKQA 4WIHA 3U4UA 2VTMA 1PXMA 4UV0A 1GZNA 5B2MA 3QQLA 3U6JA 2ITYA 4E6DA 5HO6A 4L7SA 4QPSA 5AJQA 2HZ0A 3COIA 3QZFA 3HNGA 2BDFA 3ZUTA 4V04A 4DGNA 3O51A 4FKGA 4FL3A 4QP7A 5AR8A 3HEGA 2R3LA 4JAIA 5CEKA 4C2WA 2C3KA 2WMWA 4DFBA 5JFSA 1KE6A 2ZB1A 5AV1A 2XUUA 1U54A 3CQWA 4FICA 4FTCA 3W16A 2JKKA 4AU8A 4ACHA 3AC3A 1DAYA 2XK9A 4O7NA 5F95A 3EQRA 3LLAA 4IDVA 4GG7A 4BCPA 5IQBA 4L01A 1ZY4A 3U51A 4D5KA 1W83A 3FHIA 4RIYB 4A9RA 4GV1A 4Q9ZA 1PMVA 4ZTLA 3R21A 4W4XA 4OT6A 2IZSA 4C2VA 3O2MA 3OHTA 2J0LA 4QQJA 3FXZA 2QLQA 2UW9A 1OUYA 3BE9A 3C4XA 3ZHPC 4L43A 4EQCA 1FPUA 4XBUA 4AT5A 4U97A 3GFWA 3C9WA 4AWIA 1WFCA 4KIOA 2VO6A 4IEBA 3EQBA 3ZTXA 4AT3A 4O2ZA 5DR2A 2WMRA 4NJDA 5IF1A 4R78A 4PL4A 4I0RA 5DRDA 4KABA 2PU8A 2X8DA 3QZIA 1FGIA 3OFMA 2VTQA 5ETAA 1YXUA 3BHYA 5IQEA 3D5VA 4U41A 5L2IA 4UEUA 2W1EA 1G8SA 4FIJA 3ULIA 3MA6A 4ZSLA 3U8WA 3NW5A 4E5AX 1ZZ2A 3OCGA 4EZ3A 2XK4A 3ZFMA 3ZO1A 3R7OA 4HW7A 3LPBA 4RWJA 3EZRA 3UC4A 3DTWA 3JS2A 5EOBA 3FSKA 4YLLA 4B4LA 3H9OA 5AV2A 2BAKA 4FSTA 2WMVA 3GCPA 3KF4A 3QQKA 5D9HA 2Y4IB 2YIXA 2P4IA 4F0GA 4M7IA 3GCUA 3NUSA 4A9SA 4FIGA 3SG8A 5CZIA 3CKXA 4J7BA 2C6EA 3FSFA 4PF4A 2BRHA 4QTBA 4BCIA 4FEXA 4XOZA 2IW6A 3FMHA 5AP0A 4QP3A 4IAZA 1CSNA 4AUAA 5AP3A 2XM8A 2W0JA 4AZEA 2EXMA 4F1MA 3GP0A 5EM5A 3AT4A 3BBTB 5CU2A 2FSLX 4XLVA 1YOJA 3MVHA 1F3MC 3SV0A 1H4LA 4C4JA 5AR5A 4EH8A 4H05A 3I0OA 3EN6A 1UU7A 4KBKA 4K18A 4IH8A 4IVCA 4ZTSA 4RA5A 4EBVA 2PSQA 4I5MA 5M57A 4UX9A 2Y6OA 4AN3A 3PZEA 3JXWA 4MXCA 1U5QA 4FV8A 2CNUA 4DTAA 2C1BA 2BUJA 4IWDA 5EOLA 1ZYCA 4DCEA 3MIYA 3LQ3A 3W2CA 3OEFX 3WIKA 3PDTA 4XBRA 3UOHA 1M2PA 3ZRLA 4D0WA 4D2WA 4AAAA 1H01A 1H1PA 2ESMA 1ZYJA 2BALA 2WTWA 3I7BA 4IM3A 4XV9A 4NW5A 5EG3A 3Q5ZA 2B9IA 3DS6A 2J0MB 5KMMA 3DZOA 3M2WA 3MYGA 3IQ7A 2NRUA 3V5TA 3V8TA 2UW8A 3RPVA 3ELJA 1GIIA 4H3PA 2OZAA 3H0YA 2DWBA 2Y4IC 4FTUA 2C0TA 1BL7A 3A60A 4BTJA 3OWKA 4CFFA 3EQFA 4E4XA 4QPMA 4WG5A 3UYTA 3NMUF 1SMHA 4R7BA 4YHTA 4A4LA 2QOKA 5K5NA 3QGWA 4W4VA 4XV2A 3PXFA 5LJJA 2Z7QA 3Q4CA 4F08A 2YWVA 5DFPA 3MFRA 4WG3A 1UVRA 5AP5A 3RVGA 3SD0A 3ZSIA 3DJ7A 1MUOA 3G9LX 5AM7A 5HU3A 2CKOA 4IZ5A 3OD6X 5KO1A 3VWAA 4Y73A 5I0BA 5JH6A 3LKMA 3FL4A 4MX9A 1LEWA 3DFCB 4XP2A 5BX0A 1B6CB 3IG7A 3VULA 1T46A 2VO3A 3QHWA 4FGBA 5HTCA 4DHFA 5BPYA 3W8LA 3EYGA 2UZTA 4KRCA 1B39A 3F82A 4NFMA 2CPKE 3KFAA 5CEQA 1H1WA 2UW6A 5K4JA 3GOPA 4XJ0A 2BVAA 4Y95A 3PLAE 4EWQA 3W1FA 4IX4A 1OIQA 1Q8WA 4WNPA 3QL8A 1CKJA 3QF9A 1JQHA 4R1VA 1Q8UA 4X7QA 4BFMA 5KUPA 4PDPA 3ACKA 3EZVA 4AE6A 1GAGA 4FSQA 4WRSA 2GMXA 4O21A 2EU9A 3LFBA 3OY3A 3QBNA 4TW9A 5LWNA 3UNKA 5CF5A 4G17A 2C5VA 5F20A 3LM5A 4U6RA 3P4KA 3HMIA 2F7ZE 2C5YA 4LUEA 3FZTA 2XBAA 5ETFA 4E4LA 3E7VA 3FHRA 4C02A 5FUTA 4UY9A 2CN8A 3DAKA 2GNGA 5IUIA 2OJ9A 3L9NA 3R04A 4BI0A 1QPCA 4I94A 4J97A 4JDHA 4QMUA 4EOOA 4ZZOA 2PTKA 1OL5A 2VWIA 2GNFA 3KULA 3WE4A 4NKSA 2PE1A 4BZDA 5AV4A 4FZ6A 3FC2A 3AT2A 3TUCA 3KXGA 1TQPA 3BZ3A 3DBEA 4FG8A 3CGFA 4W8DA 5DH3A 2CMWA 5L2QA 1OL2A 4FV6A 3ACJA 3Q2MA 3WBLA 3NNUA 5EDQA 3G6GA 3QTXA 4B8MA 2Y8OA 3PLSA 2DUVA 4W9XA 4FV2A 5E8VA 5BUJA 2X2MA 4PDSA 4XEYA 5FQDC 2OW3A 1JNKA 3F5PA 4CVAA 4YPSA 3O8UA 3NUPA 1URCA 4I1ZA 5ACBC 4BDFA 5IQGA 4IIRA 3PVWA 5HBJA 3P7CA 3OW4A 4PRJA 3SRVA 2O0UA 2ZAZA 2QQ7A 2B9FA 3KL8A 2W1CA 3COMA 4YZMA 4KIPA 4MHAA 3KC3A 5DA3A 3S95A 4E6QA 3A7IA 4EBWA 2G9XA 3QD2B 2ZVAA 4BBEA 4DTBA 5CVFA 5KE0A 2R9SA 4E1ZA 2JDSA 2RFSA 3V04A 2VTHA 4M66A 4APPA 3MVJA 4Y5HA 4F6UA 1CMKE 2IVSA 3MV5A 3O0GA 4XCUA 4C3RA 4CRSA 4U3ZA 2GSFA 4GKHA 4YZBA 3PG3A 3SOAA 1S9IA 3HV6A 2QNJA 4M68A 4I6HA 5I3RA 3E63A 4JT3A 3TZ7A 1U54B 1NA7A 3R2BA 2VTIA 2VTLA 4I3ZA 4EH4A 4DH5A 4EI4A 3AT3A 5AFVA 3NVKI 3OXIA 4B0GA 1SVHA 3Q2JA 1YXTA 2VTSA 4G5PA 4O0SA 5A3XA 5JGAA 1JSUA 4RJ4A 4TYHB 4WNMA 3QRIA 4RGJA 3ZC5A 2YJRA 5A4EA 4JRNA 4UXLA 2JAVA 3TV6A 4D2RA 2PE2A 4H39A 5DT0A 3R8VA 5KX8A 3C4FA 4N6ZA 4IMYA 1UKIA 3IW7A 3P0MA 4FSWA 1Q3DA 1XH9A 4JAJA 4MXXA 1XWSA 3Q4UA 3CJFA 3U54A 5AADA 3VS2A 3VS0A 3A8WA 1SZMA 2C6OA 2J50A 4KKGA 2QOLA 3HVCA 3CTQA 2UZVA 4QYHA 4DT9A 2F57A 2PY3A 2JIUA 4O38A 4RVMA 3GC9A 3ORZA 3CTHA 1IAHA 4XV3A 2F2CB 5GZ8A 3QHRA 5E4HA 2JEDA 3ALOA 1LUFA 2XJ1A 4HVGA 2JDRA 5LMKA 2O63A 4DGOA 4S30A 2JIVA 2ONLA 3V6RA 2WHBA 5HZNA 4ZS0A 4CLJA 4E8AA 2WIPA 3LFEA 1PW2A 3DAJA 3JY0A 3PY3A 5HGIA 2HZNA 2X39A 5HCYA 3FL5A 2WZJA 4LV5A 3IO7A 3CLYA 3QA0A 2QKWB 4FSUA 4GIIA 3RAIA 4N0SA 5EKOA 3ZRKA 5LCJA 2CHLA 4BCNA 1E9HA 3PXRA 3GT8A 1MRUA 4C35A 4C4HA 5J9YA 4UXQA 3PIZA 4GG5A 2FYSA 3II5A 4CCUA 5J7BA 3ORLA 4PMMA 3ZSHA 2ITPA 3NYOA 4FIEA 5DI1A 5E8UA 5I9ZA 4MXZA 4JDKA 3SXSA 4LFIA 2KTYA 3KXNA 4YBJA 5E91A 2ERZE 4O27B 3NR9A 2GS6A 3WARA 4YLJA 4HJOA 4YHJA 3SGCA 4RLKA 2IO6A 5BVWA 4QTCA 5TKDA 4F70A 3D9VA 4HOKA 5DGZA 5AA8A 3RNIA 4DF3A 2FO0A 4CTCA 2VTAA 5L2WA 5HLNA 4FVQA 3RAWA 1JKSA 2XH5A 4PNKA 2C3LA 1TVOA 2VX3A 4QMPA 4ITHA 5HESA 1DS5A 4JBPA 5LQFA 3BEGA 1STCE 3PSBA 3ZSGA 4HGEA 3GQIA 2O8YA 1FVTA 2JFLA 1BYGA 3RINA 3EKKA 4BGQA 4ANNA 3QTWA 5EYCA 2C0OA 4YNOA 1W82A 2VO0A 2UV2A 4FIIA 2PUUA 2J5FA 4QMVA 5HTBA 3U6IA 2W9FB 4O0WA 5CU6A 2I7QA 2G01A 4DH8A 3KF7A 3T3UA 3T8OA 2YAKA 3GXLA 2GHGA 5CNNA 5AP7A 3BQRA 3ORIA 3H10A 2XVDA 3C4ZA 5TOZA 3C4EA 3NIEA 4MEDA 3FMKA 2XKFA 3BU5A 3DOGA 3KVXA 3VJOA 4AZWA 1U46A 4NM0A 5EI8A 3COHA 4QMTA 5H8GA 4BTFA 2G2HA 2UVZA 2IN6A 1PXIA 5HE1A 5JQ8A 3Q9WA 3LVPA 1J7LA 4Q2AA 4YBKA 4BN1A 2VUWA 4EH9A 3D7ZA 5DR6A 3HRBA 4FYOA 4M0ZA 1S9JA 2C47A 5KMIA 1PXNA 2DYLA 2PVJA 2QI8A 4IWOA 3I79A 4RX9A 3R9HA 4K33A 4EOSA 2J5EA 4EC9A 1ZY5A 2XK7A 4FTIA 1H1QA 1J3HA 4DE4A 3RP9A 4E4NA 5KMLA 3VUDA 2FSTX 4L3PA 4K9YA 3MN3A 3HAMA 4YZ9A 3R7EA 4EK6A 1DI9A 5CAUA 5EKNA 4FZDB 4KSQA 3RM7A 1V0PA 4FNWA 4IAYA 3EN9A 4RVTA 4APCA 3PA3A 3TNQB 2GS7A 3QWJA 3QYWA 4KKHA 3DK3A 5BVEA 4ORKA 4DBNA 1H1SA 2J0IA 4BYJA 4EYMA 1M52A 3JPVA 4YO4A 3C5IA 3QZGA 4ZSGA 5AR7A 2C6KA 4FG7A 5KHXA 3W8QA 2XF0A 1ZYLA 2PWLA 1CM8A 1OMWA 2C6LA 3E93A 3TKHA 4LG4A 4FF8A 5LMAA 3ENMA 2V55A 1M14A 2ITWA 3PZHA 3OEZA 1H0VA 4ZJIA 4V0GB 2BDWA 4QT1A 2RG6A 2Q83A 5IA1A 4MTAA 4JQ7A 5CI6A 2GQRA 2REIA 5CANA 3UOKA 2VTJA 2RSVA 2XEYA 4CMUA 2VRXA 4EK5A 4O7YA 3UO5A 3C51A 4MQ1A 3MH1A 4F9BA 3A8XA 2ITOA 3VIDA 5IA5A 4BZOA 4LOQA 3WF6A 4NL0A 3HA6A 4J99A 2HIWA 2AC3A 5C4KA 3PJ1A 2I0VA 3HECA 3ZM9A 5E8XA 5GIPE 4D55A 4JRVA 2PMIA 4NIFA 4DEEA 5J5SA 3ZBXA 4BRXA 2OIQA 4FL1A 4PMSA 3N4VA 3GC8A 3PWDA 3ZM4A 4II5A 3HAVA 3OCBA 2V62A 4NZWB 3HP2A 4USFA 5IEVA 4RA4A 2XYNA 3Q60A 4NM3A 2PVKA 1WBPA 3NNVA 4FUYA 2VWYA 5HKMA 4X3FC 1V1KA 2VGOA 4DTKA 3KRRA 2YM7A 5H2UA 5LARA 5CU4A 4FEWA 4QMXA 1J91A 1VJYA 2QOOA 1KSWA 2A27A 2NRYA 2Z7LA 3A99A 3G33A 4GW8A 3PIYA 4M12A 2W1DA 2JKOA 3TTIA 3WF9A 2XIZA 4P7EA 1W8CA 3KXZA 3HMMA 4Z3VA 3LFDA 3NYXA 3VJNA 2C6TA 3GC7A 5KBQA 2XK8A 4KS8A 2XJ0A 4ACMA 3HV4A 2PUIA 3VBXA 4C36A 4D28A 4J8NA 4AOJA 3P7BA 1WVYA 2JDTA 4MXAA 5J95A 4FKOA 1XBBA 3VBQA 4RMZA 3PY0A 4XG3A 1WBOA 4FTAA 3TDWA 2C3JA 2X7FA 3OY1A 5K9IA 5T68A 3S3IA 3WZJA 3WYXA 4AT4A 4Y72A 1WVXA 3DT1A 4ZAUA 5FDXA 4EOPA 2HAKA 5ANGA 2X7OA 3F3VA 3PRFA 4U81A 4ITJA 3BPRA 3C0HA 2Q0BA 3FC1X 4NYEA 2W9ZB 5L4QA 2NPQA 3QALE 1OGUA 2YABA 5DEWA 3DQXA 4MNEB 1YI6A 2WGJA 4TTHB 2WTKC 4AZFA 4C4EA 3KQ7A 3ITZA 4QRCA 4YC3A 4FV7A 4S2ZA 3VS1A 4B7TA 2BRGA 4I21A 1JLUE 4NCTC 3WILA 1OIUA 4EHGA 4YU2A 3G0EA 3D2KA 4FNZA 4BDAA 4MBJA 5L3AA 4FGRA 4D4VA 4QYYA 4ZLYA 4FTQA 4PQNA 5BUIA 5AUWA 5KMNA 5JSMA 2UW7A 3D5UA 3GUBA 4J96A 3TUBA 3R22A 3VS6A 3GGFA 2F49A 3GOKA 2O3PA 4IZAA 3FMEA 4DFNA 2W5AA 3RHKA 4U42A 3I5NA 3JVSA 3PXKA 3QRJA 4FSNA 4DITA 2J6MA 3CBLA 3NZ0A 3F2AA 2G15A 4XP0A 4RLLA 3VQUA 4EOQA 4YO6A 5F9EA 1Z57A 4I6QA 2QR8A 3EQGA 4EK4A 5FBOA 3RALA 4BF2A 3COKA 3LZBA 4XNEA 4TN6A 4A4OA 5J79A 5C03A 1IASA 5BQ0A 3L1SA 1KE9A 5IA4A 2PMOX 2NO3A 1WBWA 4YTCA 2CLQA 2OIDA 4J52A 4N70A 5IA2A 4BWXA 3ATTA 1PYEA 4BI2A 1O9UA 2B9HA 2R3FA 3HMNA 1OI9A 3MPAA 4CXAA 3BYSA 2W7XA 4IAFA 3LMGA 1PKGA 4L42A 3H9FA 5C8KA 5HQ0A 3QQGA 2VTTA 3SAYA 2WTKB 3FXXA 5BVNA 4KD1A 4FUXA 4DLJA 4DAWA 4G3CA 4GU9A 4JDIA 2CGVA 3WF7A 4DH7A 4EEVA 3QC4A 5K3YA 5LOHA 4ERWA 2WTDA 3EOCA 3LM0A 2X4ZA 2QOQA 4BKYA 3R7UA 5AUUA 5EFQA 2FSMX 5KNJA 5DMZA 2YDIA 4CZTA 3HDMA 3PWYA 4U0IA 5KMKA 3WI6A 3PIXA 2YN8A 2CGWA 2G2IA 2R4BA 3BX5A 3D94A 3O7LD 2BFYA 3FLNC 4NW6A 4CYJA 4F9AA 5DRBA 3E64A 2F9GA 5JEBA 4ZY5A 1GY3A 4GYIA 4I5CA 4O6LA 1YKRA 4M8TA 4X21A 4EUTA 4YJVA 3GQLA 5M09A 3R7VA 4GT5A 4LRJA 3VBVA 3BGQA 4Y8DA 2QLUA 4ENXA 2YDJA 4O91A 1GIJA 4RIOA 5E1SA 2IVVA 2Z8CA 4Y5QA 3LCOA 3RJCA 4BICA 4CG9A 5JFWA 4Z9LA 4O82A 4YJQA 3FKNA 3UMXA 5M53A 3OOGA 4FKIA 2X1NA 4FTTA 4CMTA 3BGPA 5M4IA 5FTOA 2PZIA 2QURA 3CE3A 1J1BA 5M55A 3ZLSA 5L8KA 4LRMA 5HIDA 5HICA 4HZSA 4OTQA 1WBTA 4DGLC 5LVOA 4GJ3A 2H9VA 4LYNA 4I92A 2BZIB 3JYAA 1H0WA 4GS6A 2QODA 3NRMA 5FLFA 4G2FA 3B8RA 2YIWA 3AGMA 4IZYA 1U59A 3R1YA 4RJ5A 4C58A 2ETMA 2QHNA 1ZAOA 5IPJA 4A06A 1Z5MA 3AMAA 5A4CA 5CF4A 4FNXA 1EH4A 3UPZA 4DG2E 4YZNA 2BRMA 3LFNA 5AIRA 4QMSA 5F94A 3UQGA 2Z7RA 1WCCA 4JVGA 3PJ3A 4AOTA 2W1FA 4L52A
chains in the Genus database with same CATH superfamily
3WZEA 3Q4ZA 3NAXA 2BDJA 3V01A 5M07A 3KULB 3V5LA 3SX9A 4TL0A 3F2RA 3GI3A 2R5TA 5EI6A 3FMDA 5FEDA 1A06A 4AP7A 2O5KA 2OSCA 3OCTA 4CRLA 3DKCA 3QGYA 3TM0A 1YHVA 1KE5A 4RG0A 1DAWA 4AW2A 1OL6A 1OL1A 2PK9A 2YCSA 4FL2A 4CV8A 5FXQA 3AGLA 3QCXA 4X2GA 4IAKA 4C57A 2R3KA 5K0KA 2WNTA 1L8TA 3U4WA 3QLGA 1BI7A 4BDEA 3EMGA 5M4UA 2IPXA 3FZPA 5ACKA 4FT7A 2X0QA 3BHTA 3FE3A 4NU1A 4I5PA 4DFYA 1G8KA 5AAGA 3R2YA 1IAJA 4I6LA 5CX9A 4FT3A 5E8ZA 3E7OA 4OR5A 4QQ5A 3DBCA 2BR1A 2YITA 3A7GA 3PJ2A 4EHEA 2BAJA 4D1ZA 5CAQA 4XG8A 4X6QC 4BCQA 4TYEA 3OMVA 4OTDA 4JL9A 5ANIA 5D11A 1H1RA 4S34A 5HLPA 3BU3A 3RPOA 4DEDA 3VW6A 4J71A 3OP5A 4FEQA 5KZ0A 4F9CA 1QCFA 2B52A 3ULZA 4WNKA 3KKVA 3LE6A 2YJSA 2OU7A 4F78A 3PXQA 4JI9A 4TWCA 3F61A 3DXPA 4FKWA 4J95A 5CNOA 2BTRA 3KREA 1JKLA 2IZUA 4PL5A 3WZUA 1K3AA 3PA5A 1SNUA 3ZLYA 2W1ZA 5DE2A 1SM2A 2HYYA 1ZWSA 3GNIB 4BI1A 3MIAA 2FA2A 1GOLA 1CKPA 3FY0A 3RWPA 4OTHA 1P4FA 3HA8A 2Y0AA 3R83A 5FXRA 4HCTA 4MK0A 4D58A 3QD0A 3EN5A 2C68A 4MXOA 3P79A 4U80A 4AX8A 5EM7A 3TIZA 5A9UA 4H1MA 2XNPA 4U8ZA 5DHJA 2YACA 3FPMA 5AEPA 5IUHA 3CPCA 3KK9A 3PJ8A 3ZS5A 4W8EA 4F1OA 3QX2A 3N4UA 4D9UA 5CAOA 3VF9A 5A6OA 3FKLA 2Z60A 2BHEA 2C5NA 2GFCA 4RFMA 3AC8A 1B38A 4EK3A 5I5ZA 3OF0A 3UG2A 4E20A 4ZY4A 2A2AA 3MJ2A 4LI5A 3QUPA 4O0YA 5CT0A 4HGTA 5AWMA 4FBXA 4QQTA 3G51A 4O6EA 4MCVA 4UMRA 4JXFA 5CASA 4CEGA 4PPAA 2R3IA 5L6WL 4USDA 4F7SA 4CLIA 2X2KA 4EOMA 3NW6A 4FTRA 4QTEA 2X8IA 4CG8A 1QMZA 3AKJA 4WT6A 2B54A 3VBWA 3O96A 5CTPA 2ITNA 3D7TB 4CSVA 3KXHA 5HO8A 2ZDTA 5AV3A 4MNEA 5FTQA 3RTPA 4ZLOA 5CU0A 4L8MA 2BIYA 4YHFA 3IOPA 4NT4A 3H4JA 2CCHA 1PKDA 4AW5A 3U9CA 1OKZA 3AG9A 1R3CA 4C4FA 3GU7A 4HVIA 3NX8A 4GYGA 4J1RA 4PP9A 3LMIA 1FMOE 1SNXA 4KRDA 5E7RA 2VD5A 4AFJA 3W2SA 4BVUA 1UWJA 2WQMA 2C6MA 4EHVA 4G34A 3L8VA 3S1HA 1W2CA 4M15A 4U7ZA 2R3PA 3R71A 2BCJA 2OZOA 3NSZA 4BCHA 4MBIA 4JR7A 4H3QA 5JZNA 4CYIA 4E7WA 3P78A 4JX7A 4JJRA 4DH1A 4EOJA 3RPRA 3OWLA 2BKZA 4CT1A 2C4GA 3UPXA 2O64A 4O81A 4IJPA 3QXOA 4AS0A 3EWHA 2WO6A 3EFLA 4EORA 1Y57A 2ITQA 4IM2A 4G9RA 2C30A 5IISA 4LOPA 4O7SA 1YDTE 5IQIA 4V05A 4GFMA 3V8WA 2OZAB 4O84A 4NSTA 3UE4A 4FOCA 4J98A 3UBDA 3CQEA 4LOOA 3FWQA 5EHOA 5DVRA 4YP8A 4FTLA 4UB7A 4RIWB 2ZM3A 3VW8A 2NP8A 5IEXA 1JKTA 2JC6A 1UNLA 2F7XE 4K2RA 3RCJA 3NWWA 4WHZA 3UQFA 3WIGA 3IW5A 3AMYA 4IX5A 3NUXA 5CEIA 1Q99A 4BDDA 5JRQA 4EJ7A 4WKQA 4CKRA 4L6QA 4ASZA 2WMUA 1XR1A 1YWNA 4O7RA 3JVRA 1VYZA 1VZOA 3D5XA 1ERKA 3LLTA 1VR2A 3EKNA 4NK9A 2XJ2A 2QG7A 5E8TA 3ZFYA 4L67A 1FBNA 3E8DA 4ZSJA 3RZFA 4BCFA 3I1AA 1GIHA 2XRUA 4ZP5A 4F09A 5BNJA 2W1HA 3AD6A 4YJOA 3RK7A 3DXNA 5HCZA 3SQQA 1QPJA 5G6VA 4NUSA 1YXXA 4NTSA 4WD5A 4ZIMA 4ZY6A 3A4OX 3BWFA 3ZZWA 4ANQA 3R9OA 3ZC6A 3UP7A 3S00A 3GENA 2J0JA 4JG8A 5B7VA 3FMMA 3W2PA 2I40A 3UC3A 1BLXA 3DKGA 2W5HA 4IAAA 4O22A 5G1XA 3TWJA 2UW5A 3W0NA 2JGZA 5JMSA 4FYNA 4U43A 5BMMA 4GIHA 2GCDA 3BL7A 1KV1A 2XA4A 2RFEA 4RIYA 5DNRA 3BV2A 3I60A 3EFWA 4MXYA 3PVBA 3MTFA 2E9PA 2AC5A 2ETRA 3OCSA 5CS6A 4E3CA 3FKOA 3EFKA 4QNYA 3ZXZA 1CDKA 3QQFA 4WO5A 4BCGA 5C4LA 5E8SA 4CT2A 3K5VA 1UNHA 2QOFA 4DDGA 2HWPA 3DY7A 4UWYA 3SOCA 1Q3WA 5DOSA 2QOCA 3O71A 4U9AA 2ZV9A 4BDCA 3TV7A 3OTVA 2BROA 2F7EE 2ZV8A 3BYMA 3D15A 3EIDA 4DLIA 3MSSA 4FODA 5BVKA 1JVPP 1OECA 4R7HA 5EDPA 2ZV7A 1BL6A 5HG8A 3FMJA 1OUKA 3REPA 2PMLX 4W9WA 3L8XA 1H24A 3IGOA 1PXLA 5TO8A 5IH4A 5K4IA 1JSVA 3LW0A 1YOMA 1H27A 3BYOA 2WTCA 4R5YA 5IZFA 2WMTA 1WMKA 1BX6A 5C01A 3MH2A 5BVDA 4NKAA 1QPEA 2PVRA 1G3NA 1W7HA 3D83A 3HYHA 3IW4A 3KA0A 3F5GA 4Y83A 5EYDA 5HD4A 4F9YA 3MFUA 3R1NA 1YI4A 4P90A 4IADA 4YLKA 2VO7A 3HZTA 5CT7A 5IQCA 5HVYA 3GEQA 2IWIA 4AA0A 3ODZX 3Q9YA 2BILB 3RBWA 4MVFA 4IDTA 3RM6A 4Z16A 2XNEA 3F69A 3LQ5A 5KMJA 5IUGA 4FKVA 3DJ6A 4OW8A 4EOLA 2EVAA 2VWWA 4FT0A 2J51A 4NTTA 1PMNA 5F4NA 3CSVA 4CZYB 4F7LA 3AOXA 5I9YA 4X3FB 4NWMA 1RJBA 1ST4A 4ZMFA 1SVEA 2XP2A 3VF8A 2GNJA 2RL5A 3RNYA 5DWRA 4G3FA 4JG7A 4G31A 2Z02A 2R7IA 3TACA 3ANQA 3UIUA 4ZZNA 5C26A 1JWHA 4QTDA 5LWMA 5K5XA 5AA9A 4BY9E 2OK1A 3UP2A 4MD7E 4EH6A 4J8MA 2X0PA 4R3CA 3ATSA 4DHJA 4PV0A 1KV2A 1M17A 1ZMWA 2JBOA 5DG5A 4E5WA 4Y85A 3W0MA 4FEUA 4AN9A 1WZYA 3R63A 4BC6A 2H6DA 5EK7A 5HD7A 5BVOA 5C27A 1V0OA 5FP5A 5EQPA 2A0CX 3D7TA 1W98A 3ORMA 4FIFA 2YM5A 2R3RA 3IS5A 3OROA 3Q04A 3B8QA 4JG6A 1PHKA 5HBEA 3A62A 4AACA 4BWPA 4EONA 4FE2A 4MF0A 5TE0A 4L44A 3DQWA 4KAOA 5GNKA 5CQUA 5JT2A 4ZEGA 3NGAA 4G5JA 3BI6A 3UNJA 1OKWA 5D10A 4IBMA 2OF4A 2WOUA 2JKMA 3PVGA 3FLYA 4IB0A 4TWPA 3QCYA 3KXXA 2IZRA 4BGHA 2QOIA 1XO2B 1KE8A 3MW1A 4N4SA 3VUKA 3U6HA 4BDKA 3BLAA 2ZYBA 4LL5A 1RQQA 2GTNA 3TJDA 4GH2A 3CS9A 3ENHA 4QQCA 3VUMA 5EQEA 5M4FA 5JRSA 2OIBA 2BZJA 4C0TA 1OPLA 2LAVA 4CMOA 3A7HA 5DYJA 2YM8A 4HGSA 3ORNA 2VZ6A 4F0FA 3UZPA 5LCKA 2QC6A 5LMBA 3BBWA 5DIAA 4AXDA 1PMEA 3W2QA 3I0QA 3E3BX 3LCSA 4XS2A 4HCVA 3D5WA 4XLIA 3ROCA 3MDYA 3TNWA 3DBFA 2OJIA 4YZCA 4I0SA 5E1EA 1G8AA 1OZ1A 3FQSA 3PPZA 4YC6A 2OJGA 2OWBA 2B9JA 3P23A 5A54A 5L8LA 2YIRA 4QTAA 3UIMA 1JBPE 2BRNA 4L9IA 1P4OA 2VNWA 5GINE 4AQCA 3UQCA 3R8UA 3D2IA 3QUEA 2JIIA 3ORPA 3U55A 2PHKA 5B2KA 2FUMA 3NIZA 1UU9A 4A9UA 3I4BA 4O83A 3E88A 2GQSA 1V0BA 4R3PA 4CGAA 4TYHA 3O7LB 3FBVA 4KA3A 4BIBA 4S32A 3UIXA 2UW4A 3MB6A 4UYNA 1OB3A 4YTHA 3QC9A 3DB6A 1UU8A 2UZOA 4G6NA 1NW1A 5EW9A 4CKIA 4DFUA 2GQGA 4QEBA 5A6NA 4C62A 4MNFA 4HNFA 3KU2A 4IHPA 3O17A 1X8BA 4YJRA 4DHIB 3UZTA 3QCSA 2PVHA 4E6AA 2EWAA 3HL7A 2GDOA 3LXNA 4FTNA 3G90X 4AN2A 2BMCA 2J4ZA 3F9NA 3UDZA 3CD3A 2DS1A 3F66A 2EUFB 4RQKA 4GUEA 4DC2A 2X9EA 1SYKA 1H26A 3TZMA 4JBVA 3AKKA 5EQYA 3ID6C 2Y9QA 2PL0A 4TZRA 4PMPA 2F2UA 3C5UA 3WF8A 1PRYA 5BYZA 4RWIA 2WTJA 4O4EA 2XCKA 2X9FA 4ANLA 2B55A 2IZTA 3AD4A 2ZM4A 2F4JA 3I6WA 4JIAA 1Q97A 2W4JA 3E8CA 4RJ7A 4E4MA 5HG9A 5DEYA 1OKVA 1TZDA 3UO6A 1XKKA 5GHVA 2V5QA 3AXWA 2XIYA 4CCBA 3QU0A 1YWRA 1UNGA 5EH0A 5HX6A 4BBMA 4I0TA 1M7QA 4YC8A 5IU2A 3LXKA 4DA5A 4FKUA 5ETCA 4RFYA 4OBQA 1PJKA 4M13A 2H34A 5IDPA 2GFSA 4RWKA 2YIYA 3GC0A 3MFSA 4QP1A 4ID7A 4TYJA 3ZUUA 3TI1A 4JBOA 3RZBA 3R28A 1YHWA 4ZLZA 4ALWA 1R0PA 4BZNA 4HPTE 3G6HA 4UALA 4PTCA 3MY0A 3UG1A 3MESA 3HLLA 4BWKA 2XBJA 4Z55A 2XAOA 1I44A 1KOBA 3HP5A 3R02A 4CD0A 3O8TA 2XK6A 4WUAA 4YGAA 3PXYA 2CKEA 5CALA 2RGPA 3DDPA 2YM6A 3ZO3A 4HYHA 4CKJA 4IFCA 3UMWA 4O1PA 3RAKA 4F0IA 4ACCA 2GNLA 1AGWA 4AA4A 4EZ5A 1ZYSA 3JR1A 3S0OA 4OTWA 3MY1A 1YHSA 1ZZLA 4QMLA 2YISA 2QU6A 5LVLA 3BLQA 5FD2A 3SVVA 4NM7A 3EQCA 2GNHA 3S4QA 2W1IA 3DV3A 1Q24A 4PTEA 4USEA 3KN5A 4RJ8A 4W4YA 1RDQE 3PSDA 3WYYA 3DFAA 2GPHA 2IW8A 2HW7A 2PE0A 5B0XA 4C34A 3E8EA 4XYFA 2E9OA 2WMQA 2CCIA 1IA8A 2W5BA 4FT5A 2P55A 5I9WA 1VEBA 5DR9A 4G6OA 4GVAA 2C3IB 4WOVA 3ZU7A 4YTFA 2UUEA 3KVWA 4KINA 3DTCA 2YZAA 2QG5A 3GCSA 3ZEWA 3W0PA 2P2IA 2VX0A 4UBAA 3QZHA 5ANDA 4BCMA 3MY5A 2W05A 3KMUA 3NUYA 4XX9A 3SW4A 4TY1A 2XYUA 4HPUE 4MH7A 2QCSA 5AR3A 5D1JA 3R8ZA 3Q53A 4GT3A 3RCDA 4AW1A 2VWBA 4BDHA 4BL1A 5CEMA 4KUJA 2VWVA 3EN7A 3O5AA 4N57A 2OJJA 3VUGA 3PPJA 1PMUA 4I4EA 3AC5A 5CVHA 4HYUA 4GSBA 4PP7A 2A98A 2ZMCA 1YWVA 4FR4A 2BIKB 3EJ1A 3QLFA 4UWBA 4HVHA 2E9NA 2HCKA 2Q0NA 4DEHA 3UOLA 5AV0A 3VS3A 1MQ4A 2WMXA 5EYKA 2WMBA 4JQ8A 5IH5A 5J9LA 2ZFYA 3V5WA 4DBXA 5AR4A 3TXOA 1W2DA 4FV3A 4LRKA 4QMOA 4EH7A 2YM3A 4MKCA 4NEUA 2JITA 1KWPA 5KBRA 4F6WA 5FGKA 2QO9A 3UNZA 2J2IB 3BE2A 5HO7A 3TN8A 1W2FA 2UVYA 3OTUA 3OG7A 4PX6A 3DBQA 5T6KA 2RIOA 3A2CA 1DM2A 3NUNA 2Z7SA 2VN9A 3SHEA 3THBA 4DG3E 4MWIA 5HE3A 2C5OA 3CQUA 2W17A 4XG4A 4DGMA 3L9MA 1Q61A 2OH0E 4MYGA 2PZRA 4ASDA 5JFXA 3TKUA 4I23A 3DLSA 4O1OA 4FOBA 3E92A 3IDCA 5GJDA 3C7QA 2XZSA 2ZM1A 2WMSA 2DQ7X 2Z2WA 1BUHA 3A61A 3C50A 3PG1A 3FZOA 5HNBA 4FKTA 2PYWA 2YFXA 4FTJA 2CJMA 3HMOA 1ZOEA 3TNIA 4WSQA 1Q62A 4EYJA 5AUXA 4J53A 1FGKA 1ZOHA 2WB8A 3BV3A 4CV9A 2I0EA 3HV3A 2CGUA 3LJ0A 3DB8A 3K3IA 4XRJA 5FP6A 5HE2A 2H8HA 3GU5A 1GZ8A 4E26A 3C4WA 3MPMA 2R7BA 1J7IA 4OTGA 3QX4A 4JMQA 2B4SB 1RW8A 3R7GA 1JAMA 3FLQA 3Q4TA 4IJ9A 4O4CA 2PVYA 3PE2A 1ZMUA 5HI2A 4H58A 2ZOQA 3NYNA 3DZQA 3PE1A 3QTZA 4O96A 4QP8A 1NY3A 4L3LA 4A7CA 3NYVA 3DAEA 2BHHA 4HZRA 4YJTA 5ICPA 3NEWA 5CWZA 4EH5A 2E9VA 3MVMA 5ANKA 3BRBA 4YUQA 3L8SA 2FSOX 1YOLA 4DN5A 2R3MA 3UVRA 5CEOA 4O0UA 4FV4A 4PWNA 2VU3A 4I4FA 2Y6MA 5LVNA 3LJ1A 5H3QA 2IVUA 4G3GA 2O2UA 3ORKA 2J9MA 4GRBA 5AX3A 2C6DA 5HORA 4IX3A 5GIOE 3BLRA 4RRVA 3WZDA 5AIKA 2BFXA 5J1VA 4DHZA 4XG2A 5E8YA 3TIYA 4HVSA 3M1SA 3QTQA 3ZRMA 3B2WA 3TYKA 5DT3A 4O4FA 3R8LA 4O0VA 4QOXA 4HNIA 3EQPA 4IFGA 4OTPA 4G3DA 3T9TA 3QTIA 2HY81 1J7UA 3EYHA 4AXFA 4OBOA 1R39A 3IKAA 3UTOA 3EN4A 4CNHA 4QYGA 4L46A 3DJ5A 4FKQA 1HCLA 3Q52A 4JOAA 4YMJA 1VYWA 3OZ6A 2EB2A 4OT5A 3U87A 3QQHA 2BPMA 4GL9A 5ITAA 3Q9ZA 3VONA 5F1ZA 2EXEA 4XV1A 1KE7A 2A1AB 3TUDA 3KRXA 2JDOA 3BL9A 4XH6A 3OXZA 4BDJA 2V7AA 3SW7A 1APME 5CAPA 4I20A 3FPQA 4O7ZA 4EQUA 4TWOA 2VAGA 2PUPA 1E1XA 3QD4A 3ML1A 3ZEPA 2ITXA 3QA8A 3UODA 4V01A 4HCUA 4RZWA 3R8MA 3TTJA 4CTBA 2WFYA 4WUNA 3W55A 3NUAA 3CY2A 2EXCX 1H25A 3FMNA 5KZIA 1SVGA 2GU8A 3PA4A 1QPDA 2ITVA 2YDKA 5J8IA 4UN0C 1MQBA 3QUDA 3RKBA 4Q9SA 1XH6A 4K8AA 4M0YA 2XKCA 5EM6A 5KKRB 3RAHA 5IQAA 2VTOA 3KMMA 4AQKA 2GHMA 4AGCA 2G1TA 4GK3A 3LXLA 1FVRA 2X81A 3HV7A 3F3WA 3OOMA 4S31A 4PTGA 3QTSA 4FI1A 4IXPA 1OIYA 5AP2A 5HOAA 2PVLA 1PF8A 5A4LA 4ZJJA 4YJPA 4H36A 4IB5A 2OFUA 4L68A 5CLPA 2XNNA 3NDMA 4FV0A 3R1SA 5ANJA 1O6YA 5E92A 3OWJA 2OGVA 2QU5A 2XCHA 2YERA 2W06A 3ZFXA 3R7YA 3MWUA 2CNVA 5E90A 2XEZA 3O8PA 4M14A 2X4FA 4FC0A 4UWCA 3MGYA 4EUUA 3VHEA 4UMUA 3RPYA 4L3JA 4QP4A 1NT2A 2B7AA 4I24A 3V5JA 5IDNA 4AG8A 3P5KA 4PY1A 3ZUVA 2YM4A 2R0IA 4P4CA 3ZXTA 5IKWA 3IW8A 2VNYA 2OBJA 4K6ZA 4ACGA 3NCGA 1Q41A 4FX3A 4ASEA 4FA2A 3SG9A 4X2KA 1UA2A 4BR3A 3LJ2A 4ANMA 1OITA 4EOIA 4GK4A 3UYSA 2XK3A 3K5UA 3SXFA 3V6SA 3UDBA 2YA9A 4FKLA 4JBQA 2XNOA 4AA5A 3BKBA 4F6SA 3G15A 5FDPA 1WBNA 4A4XA 1XH7A 4IB1A 4W4WA 2HZ4A 2J7TA 5C8NA 4RWLA 4MD8E 2CDZA 2R3NA 5ETIA 3GB2A 4AW0A 4E73A 4U79A 5JGDA 4ONAA 4RC2A 4C59A 3OW3A 5L6OA 3JUHA 3PUPA 5CSWA 4AFEA 2XNBA 2VTNA 5HEZA 2CSNA 4CQEA 5HVKA 4N6YA 3CEKA 1H08A 4JDJA 2RG5A 4EZ7A 3CXWA 3OXTA 4YJUA 4QPAA 2W96B 4YURA 3CR0A 3G9NA 3TJCA 5M44A 3QFVA 1I09A 1LPUA 4IVAA 4I5HA 4R6VA 1ND4A 2QVSE 5A14A 1ZLTA 3FI3A 4YPDA 4XRLA 4ZTHA 3ZLXA 4ANOA 4YSJA 4LV8A 3C0GA 4IW0A 2R0UA 5FEQA 3TCPA 1FOTA 2R3GA 1PXPA 4RC4A 4WSYA 3IDBA 4RBLA 2ETKA 4BKJA 3FMLA 3D14A 5CZHA 2I1MA 3O23A 2BTSA 2ITTA 1LR4A 4ALVA 1W0XC 3H3CA 4GVJA 3E87A 2NYAA 4FV1A 4ACDA 2UZEA 4FSYA 4GFOA 2VTPA 5H8BA 4XUFA 4F99A 3NCZA 4D5HA 4D1XA 2UVXA 5BMSA 4R3RA 1R0EA 3L9PA 4FK3A 3AC4A 3KRLA 5CI7A 3ZH8A 4I6BA 5CF8A 2B0QA 3P9JA 4Q5EA 1TKIA 4R77A 5CENA 3K54A 4O0XA 4X3JA 5C8MA 4F7NA 2WU6A 3NS9A 4NCTA 1BMKA 1FQ1B 4QP6A 5GZ9A 3LMHA 2O65A 5DBXA 4O4DA 3W10A 2WU7A 3SDJA 2X6EA 3U9NA 5KMOA 1J1CA 3D4QA 1OM1A 4Q5HA 3QRKA 1E1VA 2B53A 1A9UA 3IPHA 4KKEA 5FWKK 5GJFA 3FQEA 3VBTA 4AGWA 4EOKA 3FDNA 5TT7A 1Q8YA 4TPTA 3QTUA 2UW0A 1OBGA 4BJJB 2XIXA 5BYYA 4OAUC 3I81A 5JGBA 1WAKA 3DLZA 3DK6A 2VGPA 3ZZEA 4RJ3A 3ROYA 3W2OA 2CKPA 2LGCA 4PPBA 5CXHA 3M42A 4HVDA 2BZKB 3TDVA 3CPBA 4R5SA 3ZO4A 2QO7A 2YAAA 2ZJWA 3P7AA 2RF9A 3IK3A 5CYIA 1ZXEA 2WKMA 4V0GA 5LMKC 1XBCA 4TKSA 2WQBA 5JFVA 3G5DA 3MH3A 4IE9A 4AZSA 4ITIA 4BGGA 5AMNA 1M2RA 1U4DA 3IECA 4ARKA 4JR3A 4LMUA 3FYJX 4D2TA 1P2AA 2J0KA 3MTLA 4OTIA 3FAAA 4D0XA 1OKYA 3VUHA 4C8BA 1H00A 4MQ2A 2X0OA 2XM9A 3VBYA 2KULA 3CIKA 4X3FA 4XG9A 3OBGA 5A4QA 2ZDUA 5L2SA 4KIKA 4M67A 1UKHA 5J7HA 5K0XA 2VTRA 4F63A 4IANA 2H96A 2PULA 5EW3A 4D2VA 2W4OA 5KKRC 3PFQA 4EH2A 3UDSA 2C0IA 4QP2A 4ANSA 4LQMA 4FVPA 4LL0A 5AAEA 3MB7A 4KIQA 3TMOA 1T45A 3FQHA 3CP9A 1JKKA 4RQVA 2JFMA 2QKRA 4WG4A 3C4CA 5HIBA 4ANBA 4ZSAA 3HUCA 3PP1A 3SA0A 1K2PA 3V51A 2X6DA 3FLSA 5M56A 4LGHA 1MRYA 2CGXA 4GEOA 1H8FA 3C1XA 5IQFA 2XS0A 4Z7GA 5AUTA 5BVFA 3F3UA 4QMNA 5HG5A 4WNOA 2XRWA 3LXPA 4D4SA 3KMWA 3V3VA 1BKXA 1TQMA 4KNBA 3K2LA 1XQZA 3TZ9A 3BEAA 5LXMA 2FVDA 4O2PA 2HOGA 4R8QA 4AGDA 4IX6A 5IA3A 3NVMB 5EI2A 4ZTNA 3I5ZA 1YI3A 3QWKA 3FYKX 3GU8A 4AGUA 4QYFA 2HK5A 3LQ8A 4X2FA 2WTIA 1K9AA 4RX5A 3QAME 3QCQA 3EL7A 1IRKA 1ATPE 1WBSA 3R00A 2IG7A 4GJ2A 1AD5A 3VN9A 2R3HA 4JNWA 3F88A 1HOWA 3H9RA 3HV5A 3MA3A 4H3BA 3GU6A 4TNDA 3ZDUA 4LGGA 4MF1A 5L6PA 5JQ5A 4KBCA 3BCEA 3ANRA 5A4TA 2QONA 2JD5A 3CGOA 1IEPA 4EL9A 4FMQA 3CY3A 4OTFA 3KN6A 4F7JA 4DEBA 1JPAA 5EM8A 4MD9E 2WPAA 3ETAA 1H28A 1Y6BA 4LUDA 1AQ1A 4FZFB 5CY3A 3ZYAA 5IEYA 2AEGA 5BV3A 2R3OA 3HKOA 3MFTA 1HCKA 1OVEA 2IW9A 5JZJA 3OVVA 4IQ6A 5I9UA 4U45A 2XAMA 4BYIA 3WZKA 4CZUA 1CKIA 1O6LA 2RFNA 5M4CA 2YHVA 3Q96A 2ITZA 3WF5A 4GFGA 2ZMDA 5D12A 3CKWA 2WOTA 3VC4A 3VS5A 3PRIA 4I41A 4DEGA 2QHMA 4NH1A 2WQNA 5HU9A 3FI4A 3FJQE 3MI9A 4XHKB 5EYMA 2R2PA 3I7CA 5FEEA 5FRIA 4OUCA 3EQDA 3DXQA 3KRWA 2A19B 5I3OA 1FMKA 3SC1A 3TEIA 4C61A 2OFVA 4FVRA 3T3VA 1ZYDA 4RT7A 5D7AA 4FNYA 4D9TA 5D7VA 3FLZA 3BLHA 4XG6A 1WBVA 1ZMVA 2ACXA 2IJMA 1F0QA 4KBAA 5E8WA 3LAUA 3OS3A 2YCQA 5HE0A 4FKSA 1O6KA 3PUFC 5M08A 4C38A 2YCRA 3EQHA 1L3RE 3E62A 2X0GA 4XOYA 4O7VA 4QNAA 4C4IA 1XMLA 5AM6A 5IMXA 1Y91A 3FXWA 1DI8A 3A7JA 4RIWA 3F7ZA 4A07A 1H07A 2UZLA 2R64A 3ERKA 3BHHA 4PNIA 3RI1A 2PZYA 4TYGA 3QTRA 4GT4A 2UZNA 4CFUA 4IB3A 4CFVA 4PDYA 4BCOA 4AXEA 4M97A 2J90A 3EL8A 3BHVA 4FK6A 2EB3A 4HGLA 4KS7A 3Q32A 2OXYA 4GK2A 4C4GA 4EK8A 3QRUA 3R1QA 3NAYA 3ET7A 3F5XA 3D0EA 4FSZA 4U44A 3WE8A 3UO4A 4U5JA 3KXMA 5ANOA 5LVMA 3HDNA 4EC8A 4ALUA 3POZA 1GJOA 3L9LA 4FKJA 5FXSA 4C3FA 3LCDA 4DEIA 2E9UA 5AP6A 5H8EA 4OAVB 4FIHA 1LP4A 3I6UA 4S33A 4ZXTA 5T3QA 4K11A 2RKUA 3ORTA 2XNGA 2P0CA 2P3GX 2YEXA 3CJGA 3QD3A 4BIEA 5D41A 1XH5A 3P5JC 4UYAA 4RX7A 3OC1A 3V5PA 4K0YA 3TNHA 3ZO2A 3DA6A 4RX8A 3NFFB 1Q8TA 1GZOA 2V7OA 4R1YA 1YDRE 3VVHA 5C1QB 3ZBFA 3UVQA 1Y8GA 3DKFA 5I9XA 4FRFA 2WAJA 3LIJA 5CSHA 2P33A 3N4TA 4FG9A 4ENYA 4LM5A 2AQXA 4ZZMA 4L45A 3ODYX 4AF3A 2ERKA 2ZB0A 5JK3A 2XARA 3IDPA 5IH6A 1KOAA 2RFDA 3QKKA 3FEGA 4YJNA 2BZHB 3CCNA 4D1SA 1MRVA 4DFZE 3ZMMA 4F1TA 5FM3A 4O7LA 4PPCA 4KB8A 3OUKA 4EH3A 2HW6A 2JLDA 2C69A 2YIQA 4L53A 3FUPA 4WA9A 3F5UA 4FT9A 2ZV2A 4NFNA 2YZLA 4IWQA 3Q6WA 2V22A