4W8DA

Crystal structure of mst3 with a pyrrolopyrimidine inhibitor (pf-06454589).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24 36 kDa subunit
publication title Discovery and preclinical profiling of 3-[4-(morpholin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl]benzonitrile (PF-06447475), a highly potent, selective, brain penetrant, and in vivo active LRRK2 kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4w8dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4w8dA01
2GFSA 4FKPA 3FMDA 1CKJA 4I5MA 4FKQA 3DJ5A 3DXNA 5CSWA 3KRJA 3F3VA 3LXNA 3BV3A 5IUIA 1CSNA 2KULA 2I0EA 5CWZA 4LGDA 4ZXTA 4W4YA 3ZLWA 4GT3A 5T3QA 3F61A 5DT4A 4ZP5A 2HY0A 2OBJA 3HV5A 4NFMA 4YC6A 4CG9A 4O0SA 1JWHA 4ZJVA 4O0TA 4LMUA 4OTWA 3U6JA 2UZWE 3CD3A 2XBJA 3BEAA 5HG9A 4JIKA 3R7UA 3OW3A 3R8PA 3RAWA 4Z55A 2BAJA 1XQZA 4IQ6A 3ZONA 4F7SA 2WTIA 4HCVA 4QD6A 4ZIMA 3A8XA 3UMWA 1YI6A 4KSQA 4IWOA 5CI6A 4YMJA 3C9WA 4DFNA 3U6IA 3AC4A 3K54A 3E63A 3C4EA 3ZRMA 3TJCA 4LGHA 1R39A 2C5OA 2HENA 5BVOA 4XHKB 5A14A 4YNEA 3LM0A 5CXZA 2O64A 4AE6A 3HV4A 4D2VA 2PUUA 4F4PA 3FEGA 2VO0A 1DAWA 2X1NA 4RIWB 3T3UA 5KZ0A 4I92A 1GZOA 3OOGA 1PXMA 4ACDA 5C4KA 3MJ2A 1KE8A 3VF8A 4R78A 4JBVA 3UZPA 4ZTSA 5DN3A 4BHZA 3LKMA 1U4DA 3FKLA 4XG9A 4RRVA 3WF8A 4D4YA 1MP8A 3UJGA 4JNWA 4CSVA 2QURA 2XA4A 5DT3A 4I21A 2XKCA 3I5ZA 3NLBA 5IEYA 3ETAA 4BI2A 2VWBA 5KMMA 3BHHA 2AC3A 2PL0A 3PPJA 2QODA 1Q8UA 5E9EA 4DFXE 5DPVA 1QPJA 3F82A 3GFWA 3ZEPA 3AOXA 4OTFA 4AP7A 4CNHA 3QAME 4EK8A 4MH7A 2W1DA 3H3CA 1Y6AA 4C57A 2BHEA 5D11A 3C4XA 4M84A 3N9XA 4G3GA 2PUPA 4CTBA 4FZDB 4FMQA 4M66A 2O0UA 4QP4A 5DBXA 3EQRA 3KXHA 4JDKA 3EYGA 3TDWA 2P0CA 4O7LA 4MK0A 1LUFA 2QO2A 3ZUTA 3CXWA 3C1XA 4F63A 4EONA 5CEKA 2IO6A 3II5A 2XIRA 4JXFA 4QMSA 4YJQA 2JEDA 4ZSJA 3ZBFA 4DCEA 5HU3A 3DQWA 2WQMA 3CGFA 3RNYA 1BI7A 4IAKA 2HXLA 5D41A 2C5YA 3F5UA 1AGWA 2E9PA 3DBCA 2W1ZA 2F9GA 4IAYA 4DFBA 3PLAE 5B2LA 4EJNA 2P55A 5IA0A 3AG9A 1H28A 3UVPA 2PVYA 4M68A 2XNOA 4X3FB 4XP3A 4A4XA 5JKGA 4G16A 4D2SA 4F9YA 4RIYA 4IVDA 4KAOA 3O0GA 2EB2A 4K33A 4XCUA 2HZIA 2JIIA 3LJ2A 1XJDA 4G3FA 3IECA 4ZZNA 2Z7LA 4RWKA 5HGIA 3EOCA 4FKWA 3FQSA 4WBOA 4RJ8A 4AZTA 4IX3A 2BCJA 3HRBA 3TEIA 4MNEB 2ZB0A 4PPBA 3VJNA 2OF2A 4KB8A 3VUGA 4AOIA 4TYJA 2WMUA 4GCJA 5EDPA 4E6QA 4OT6A 4U0IA 1J1BA 3QZHA 2FB8A 3EQIA 3FBVA 5EH0A 5FBOA 5KMLA 4U80A 3HDMA 3IONA 2W99B 2JKMA 3EN6A 5TF9A 4AQCA 1FMOE 4AWIA 3CSVA 3UIUA 4DG3E 3FYJX 4ANSA 3ROYA 3KN6A 2YLFA 1FVRA 4FVQA 2PTKA 4GH2A 2BDFA 3GI3A 2O63A 2A1AB 3PWDA 4NSTA 4QMMA 4DH3A 3VRZA 5KMOA 2YACA 5AAFA 3CS9A 4R5SA 1H01A 3NAYA 1Q8YA 4KUJA 3DAEA 3FSFA 4JX3A 3B8RA 3CEKA 4NL0A 5IQCA 4AU8A 4F1OA 2P4IA 2F57A 5J5TA 3HP2A 4IDTA 5AAEA 3EH9A 4DGGA 4A9SA 4U44A 3SD0A 2JAVA 4O81A 4GK3A 4FSRA 5DRBA 3QXOA 2B1PA 4FL2A 1K9AA 2BZIB 1H0VA 2GNGA 3BZ3A 3R73A 2UZTA 4BDAA 3G9LX 5B7VA 4XG3A 4C37A 5JGAA 2OF4A 4Q2AA 5CAPA 1CTPE 4AS0A 4CKJA 2HK5A 2W05A 4J96A 4B99A 3NUSA 4JT3A 4I1ZA 3UQFA 3SOAA 3R7EA 2GTMA 3G6HA 1H26A 4Z16A 2OG8A 4DFUA 3LCKA 2GQGA 1YOMA 3LCDA 2DWBA 4NJDA 2JC6A 3HAVA 5L2SA 1H1PA 4C62A 5DI1A 3SOCA 5BVFA 5IQHA 3FLWA 4FKVA 4M97A 3MY1A 4WRGA 3NNVA 2C30A 2J0LA 4EOOA 2UW3A 4G34A 4J99A 4UWCA 3BQCA 3E93A 3JVRA 5FXQA 3VBVA 2CN5A 5F95A 3AT2A 4ITJA 1JBPE 4FG9A 4FZ7A 3RK7A 4ZTRA 4UMQA 2PVJA 4USDA 5TOZA 3DBEA 3PJCA 4O0WA 4EHZA 4IJ9A 4NTTA 4FT5A 1SMHA 4IVCA 3HEGA 4ALVA 4IVAA 1OBGA 4EYJA 3TNIA 5EW8A 4L3LA 2YIWA 5HLPA 3QBNA 5JSMA 3R7YA 3FL5A 4C2VA 3VUTA 5AP2A 2X81A 1Q24A 4CMTA 4FEQA 3FI2A 3SC1A 1XWSA 5LMAA 3DJ7A 3F2NA 4DH8A 2GS7A 3UYSA 5H8EA 1STCE 3P4KA 3D15A 2C0TA 1F3MC 3AD4A 4O0VA 5J9YA 1OKVA 3R2BA 5DYJA 5AA8A 4TYGA 5I9XA 5GIOE 3O8UA 1B38A 3UNZA 4E1ZA 3KF4A 2BFXA 4GG5A 3ZZWA 2I7QA 4X3FC 1O6YA 3K5VA 3P7AA 1JNKA 3KN5A 3FI8A 4YPDA 4QQCA 3UNKA 2PE1A 4IAZA 4OTPA 4E5WA 5EYKA 3R7GA 5DWRA 5HCYA 1SVHA 1NA7A 3FZTA 4XG4A 3MB6A 3KXGA 1UWHA 4E6AA 3EQPA 5EHOA 5IZFA 3P7CA 2NO3A 4S32A 5M4UA 5CQUA 4HNFA 3GP0A 4TRLA 4B0GA 3IW8A 4CFXA 2HWOA 3V6SA 3DFAA 3R22A 2YERA 4M8TA 3UIBA 3FC1X 1SNXA 3Q4ZA 3PSBA 5FP5A 5FEEA 3WBLA 1GIIA 2X9FA 3GC0A 3MVMA 5T68A 3NEWA 4M12A 4RLKA 4YJSA 5K0KA 1ZOGA 4GVJA 3D83A 4Y5HA 4D0XA 3F7WA 2X39A 4LI5A 4FIGA 4PL5A 3ZC5A 1ZOEA 3BU3A 3O50A 4FTIA 3ACJA 1OUKA 4R1YA 5L4QA 1F5QA 4FTRA 4FTUA 4EK5A 2OU7A 3T3VA 4LUEA 4JAJA 4KKEA 5JN2A 4OBQA 4RWLA 4FKUA 4DFYA 1GJOA 3KMMA 4IACA 4ZSLA 3ACKA 4CVAA 4CFFA 4W4XA 4ASDA 2VZ6A 3MBLA 5EM7A 3AT3A 1MRUA 3E87A 4TT7A 5BYLA 4FEVA 1H1QA 2R3KA 2A27A 3DPKA 2CDZA 3DS6A 4ANQA 5E8TA 3EL8A 2FH9A 2WMTA 3KEXA 3HMNA 2A4LA 1JSUA 2X0GA 5AUWA 3RGFA 4CRLA 1NT2A 3I81A 3IK3A 4FIIA 5HE1A 3NYOA 5AUUA 2Y6MA 3B2TA 4FV2A 1VEBA 5EOBA 4C8BA 2PVLA 4GYIA 3BYVA 3COHA 4QP1A 5IA5A 2F2UA 4Y83A 4OTGA 4O7WA 3QD2B 1O6KA 4ZTNA 3VS2A 1ZYDA 4AW5A 3DKFA 4OAUC 1Q8TA 3OEZA 3A2CA 3OVVA 3VBWA 2YEXA 4QTDA 4AA4A 3F3ZA 5M55A 2J6MA 5FTQA 2WKMA 3W2PA 4OUCA 4CT1A 4EH6A 4NEUA 2J90A 4GJ3A 3CY3A 3TTJA 3A8WA 2VTSA 3IKAA 4EYMA 4FG7A 1Y91A 3ZEWA 2A0CX 3DOGA 2QC6A 5ACBC 4C38A 3ITZA 5B0XA 4JQEA 2OIBA 1XH4A 4OTDA 4MF1A 3DLZA 3W2OA 1H08A 3W33A 3QRTA 3VWAA 4FIEA 4FTNA 4CFVA 1JOWB 4F7NA 2V5QA 3R9RA 1JKKA 2DS1A 3QUEA 4GIIA 4NT4A 5CU2A 3C0GA 4IWQA 1A9UA 1OUYA 2VO7A 3PRFA 5EYMA 1M2QA 1QPEA 5M4IA 2Q83A 2PMNX 4OTQA 3VJOA 4AGCA 2ITYA 3VS3A 4G3EA 4QYFA 4MWHA 5EQEA 1FQ1B 1IEPA 4O2ZA 5HO7A 4BGQA 1ZLTA 4QPAA 4D9TA 3QTQA 1RW8A 2BUJA 2HZNA 3R9OA 5DR6A 2WQEA 3UYTA 4CGAA 2XNEA 3DB6A 4MHAA 5BUJA 4I6FA 3UOHA 4YC3A 3GU7A 3GT8A 3HECA 4QYYA 4EOMA 4YHTA 1IG1A 3E8NA 4P7EA 2UW8A 3QKLA 4RJ7A 5A4LA 4D5HA 2W1HA 3R0TA 5BVWA 4HJOA 3UC3A 3QU0A 4IE9A 1UU7A 2RFSA 4UYAA 3OMVA 4CCBA 5GINE 4PTGA 4IEBA 3RPSA 2WOTA 3PP1A 3R71A 4QPMA 3PDTA 1YXUA 2VRXA 5JRQA 1U59A 4EEVA 4EOJA 1UA2A 2XKEA 3PE1A 3RCDA 4FSMA 3ORMA 2R3NA 3HYHA 3Q9XA 3REPA 3DTCA 5HX6A 5K0XA 4CRSA 3BWFA 4A4OA 4AZWA 2HXQA 3MVHA 3WYYA 3SGCA 1XO2B 4NIFB 2XNNA 1PY5A 4D2TA 2XP2A 1YWRA 2XM9A 2ITQA 2F7XE 2GSFA 2ONLA 5CVFA 1Q62A 1Q61A 2X8EA 3QHRA 4C3RA 3NSZA 1FBNA 4DHFA 2I0VA 1ZWSA 5BMMA 2OJIA 3L9PA 2IW8A 4EKLA 1PMEA 4QMOA 5HBJA 3BHTA 3CTHA 4KIKB 3O8TA 5CU3A 3QYZA 3ZSGA 4G9CA 2QOLA 4C4EA 3BHUA 4FEWA 3FKNA 1YXSA 2XH5A 3DB8A 3NCGA 5IISA 4OR5A 4MQ2A 4FKTA 2QKWB 3DNDA 3RKBA 5F1ZA 5H2UA 4EHGA 4C2WA 3EN9A 2G01A 4D55A 4JRNA 2VTMA 1XH7A 4U41A 3D7TA 5EKOA 4E4LA 3R02A 4RSSA 4DGNA 3QCQA 5HNIX 1H8FA 4G6NA 4PRJA 4DEGA 3MTFA 5KMKA 4RFZA 3DGKA 3ENHA 4GFMA 4NWMA 3G2FA 3HP5A 3PSCA 4I3ZA 4XLVA 5DOSA 5AP0A 5ETCA 4AOTA 4HNIA 3QD0A 2XYNA 3POOA 2J4ZA 5AUZA 4FT3A 4L67A 3GQIA 5EOLA 2ACXA 4GKHA 1Y8GA 3QRUA 3UP2A 4PPCA 4ANLA 3DBDA 4FG8A 1R3CA 1UKIA 4O1PA 5EI8A 1KV2A 2YM8A 5JT2A 1T46A 1J91A 1IASA 3H9OA 1W98A 3R00A 4KRDA 1ZYCA 4FL3A 4ANBA 3OXTA 4WG4A 4JOAA 5AEPA 3LXKA 3QQFA 4NH1A 3OFMA 4NUSA 1WBVA 5CSVA 4O7TA 2VTPA 3KKVA 4PUZA 2XS0A 5EG3A 3GU8A 2RSVA 3V5QA 1JQHA 2WFYA 4YTIA 4V0GA 3PXFA 4EUUA 3QA0A 3GENA 3LAUA 4C58A 2F49A 4XH6A 3JVSA 3T9IA 1J7IA 4Y72A 4ERKA 3R7VA 2BZKB 4AT3A 4H3BA 2EXEA 3F5PA 4MYGA 2XIXA 3GCQA 3DV3A 3COMA 2PUIA 2PWLA 4ZS4A 2VNWA 4GT4A 3QXPA 1QL6A 3RAKA 4EL9A 3DAJA 4QQJA 2WB8A 3IO7A 1H1WA 3EQDA 4Y95A 4NM0A 2B7AA 3OWKA 3NW5A 2BIKB 3C51A 3V8WA 3UNJA 5IU2A 5EYCA 3SKCA 3R8MA 2XF0A 3HDNA 4LV8A 4ARKA 4O6LA 4QQTA 1OM1A 4AN9A 1ZYJA 2YAAA 3PY0A 4XMOA 5GJDA 5HZNA 3DK7A 2HOGA 5L2TA 3R1SA 2WAJA 2Z8CA 2GNHA 2PMLX 3BYOA 3D5VA 4NK9A 3A4OX 4TWNA 4EBVA 5K5XA 2C6IA 4F6WA 4MKCA 3NNWA 4FTTA 4QTEA 4U7ZA 2YZAA 4E6CA 1A48A 3QQUA 3Q2JA 4U40A 1H27A 4I24A 2ITXA 4D28A 5BX0A 1PKDA 2J7TA 4OLIA 4FEUA 4MEDA 3ZMMA 5C8NA 4QMZA 5H9BA 1JKLA 1G5SA 4FE2A 3GU5A 3L8PA 3I0OA 5FUTA 3DDPA 4E3CA 3ZHPC 3FDNA 5LJJA 2QOFA 4E7WA 5HBEA 3U8WA 2XEZA 4DEEA 2EUFB 5FXSA 2YM7A 3CJGA 3P86A 4L6QA 3ZC6A 2UW6A 4MVFA 1ZZ2A 5J87A 2ITNA 4I6QA 4IB5A 3D7ZA 1UNLA 4ZSEA 5JRSA 4R7IA 3WZEA 4RFYA 5IA4A 4BZDA 4DEHA 1E9HA 5FM3A 1O6LA 4LOQA 4XX9A 1YHVA 3O17A 4F0IA 3BGQA 3C4ZA 2WMBA 2PZYA 2R0UA 3EIDA 3KK9A 3ORNA 5JQ5A 2UVYA 2JKKA 4YU2A 4K1BA 2XNGA 4UX9A 3B8QA 2ZMCA 2YJSA 3D5XA 1PXJA 3CPBA 2VWYA 5FBNC 4E4NA 2CKEA 1W0XC 5CSPA 5ETFA 4BDJA 5GZ8A 2Z60A 3TDVA 5AWMA 3CCNA 2F7ZE 3ATTA 2YIRA 4H39A 3FAAA 3BCEA 3EQFA 5I9UA 5J9LA 2O3PA 4I4EA 3KCFA 4AUAA 3ELJA 4XV3A 2XK6A 2FVDA 4JG7A 2C5NA 3VVHA 3C5IA 1BKXA 5AP3A 2H9VA 4FR4A 3F3TA 3KGAA 3BI6A 3Q60A 2FYSA 5E91A 3QD4A 3S0OA 3UO5A 3MH3A 4IDVA 4U9AA 3ZOSA 4PDOA 4XYFA 3U54A 5E8YA 4FSNA 1QMZA 3SXSA 4BN1A 3ODYX 3WOWA 2QG7A 4FV4A 4RLLA 3MPTA 3NWWA 5D7AA 2JIUA 2WELA 5IEXA 2GFCA 2B9FA 5KMJA 4BBFA 3TV7A 2QU5A 5IQBA 3ZDIA 4DGOA 4DBXA 5I3RA 4GIHA 4APCA 4EQCA 3SV0A 2ZV9A 2OKRA 2HZ0A 2ETMA 5E90A 1KE6A 4CV9A 2UZNA 1OKWA 2VTTA 3TNWA 2GQSA 2LAVA 2JDRA 3QGWA 3TZ7A 4KBAA 3Q9WA 2E2BA 4N6ZA 5E8ZA 2WU6A 2PVKA 1ZMWA 5DT0A 1OI9A 2EWAA 3GOKA 4GUBA 3OWLA 3DDQA 3EZVA 3QX2A 3TV4A 4TYEA 3HLLA 3LFCA 1KUTA 3V5TA 4O7NA 3MH2A 3PXRA 1VYZA 2CKPA 4K9YA 3FKOA 3ORIA 3G9NA 4FF8A 3RINA 4B9DA 2C5VA 5FDXA 3KQ7A 4DT8A 4IM2A 1J7LA 3FQEA 4LRJA 4LRMA 4XG7A 2UUEA 3OCGA 3MVLA 4FTCA 4MBJA 4D9UA 4KS7A 1K3AA 4DBNA 3VS7A 4EH2A 1KE9A 1YI3A 3PIYA 2GNIA 4TL0A 4IX4A 2XIZA 4UALA 3WZUA 5BYYA 3P08A 5CVGA 2ZDTA 4AZFA 5CXHA 4MXZA 5IEVA 2HW6A 5LVMA 1Z57A 4M69B 5AMNA 1QPDA 5ANGA 2QR8A 5K5NA 4L68A 1APME 1Y57A 2PVHA 3O96A 2H96A 3V5LA 3ZLXA 4KIPA 1S9IA 2QQ7A 3Q4UA 2IVSA 1XBCA 3EQCA 3NR9A 3ORZA 5FQDC 3G5DA 5BVEA 3TCPA 3V5WA 5M57A 2OJFE 3UZRA 3NDMA 1PXIA 5DEWA 5IF1A 3TG1A 1REJA 5A4EA 2PZPA 4EH5A 1UNGA 1UU9A 3C0IA 5IDNA 4F9WA 5JFSA 3BLQA 4LL0A 3RWPA 2WNTA 3GVUA 4YZDA 5CT0A 1WZYA 2HIWA 2W5HA 3ZZEA 5CLPA 3W16A 3ZLSA 3LFDA 2RGPA 1W83A 4P4CA 4O7RA 4F6SA 4FTQA 1BUHA 2WZJA 4H58A 4O96A 3H9RA 4MCVA 3FMEA 4X2KA 1PRYA 4RA5A 1Z5MA 2WMAA 2BILB 2QLUA 4O83A 4FTLA 3UMXA 4RPVA 4YSMA 1W82A 1H1RA 4IM3A 2Z7SA 4QOXA 2XJ2A 4F65A 4PY1A 5FP6A 4AW1A 2GHLA 3ORXA 3FWQA 1WMKA 3RK9A 4RVMA 5CT7A 3MPAA 2G2IA 3GCUA 3VIDA 5AFVA 4DYMA 3TKUA 5KHWA 3KREA 2ERZE 5AR5A 3VUIA 3A7GA 2WPAA 3VC4A 2OXYA 3V01A 3R04A 2PPQA 4R7BA 3U55A 3RZFA 3DXQA 3R9HA 5HEZA 1B39A 2YDKA 3UIMA 3HNGA 5TE0A 2R3GA 3MB7A 4BDDA 1WVYA 3EN5A 3ORPA 2V7AA 4Z3VA 2W9FB 1ZAOA 4D1XA 3CQUA 4D4SA 2ITOA 2J2IB 3AMAA 3FSKA 1X8BA 2ITZA 4JBQA 4JR7A 4TY1A 4X6RA 5FWKK 3RK5A 3G15A 3D5UA 4G6LA 3ZO1A 4CKRA 2CNUA 4UY9A 4BDEA 3U51A 3Q32A 3D0EA 2XMYA 2XUUA 5L2QA 3PPKA 4TWCA 3UVRA 5DNRA 3H0ZA 1YHSA 1P2AA 2J5EA 3DK3A 5IA1A 5JZJA 4IJPA 3EWHA 4OBPA 4L3JA 2Z7RA 4F0GA 5EKNA 2YHVA 3MYGA 3RWQA 3M1SA 3PP0A 3JUHA 1ZOHA 3AMBA 3OBGA 5H3QA 3IG7A 3DY7A 4NW6A 5HESA 2W1FA 3FXZA 5CNOA 2VTIA 4O6EA 4JG6A 4BKYA 2OXDA 4N57A 4FZAB 5JFXA 4U5JA 3DU8A 4D5KA 3VW6A 5M06A 5CF6A 3Q2MA 4QPSA 1KWPA 1M7QA 2JD5A 3I6WA 5J7BA 5E1EA 2PE0A 1BX6A 2BAKA 4LMNA 2O5KA 4Q9ZA 2X4ZA 4JRVA 3DNEA 4B6LA 1G8SA 2UZEA 1L3RE 2UW9A 3UIXA 3NZ0A 3ODZX 3R30A 3RAHA 4FTAA 4PV0A 4CQGA 4W8DA 1TKIA 5DEYA 5HHWA 4HVIA 4I4FA 4B8MA 1SVGA 3GGFA 3DBQA 3UPZA 3FMNA 3EKNA 4A9YA 3LMIA 1PXOA 4CD0A 4TTHB 5CU4A 4W8EA 4RMZA 1OKYA 4FT0A 3LXLA 4EC8A 4GUEA 4RVTA 5F20A 3FUPA 4YSJA 4ZY5A 4PMTA 2R5TA 1JSTA 3P78A 4AT5A 4IWDA 1SVEA 2VTRA 4KBKA 5EW3A 5TR6A 3OCTA 3CGOA 4WBBB 1LEWA 4QP8A 2XIKA 3MWUA 5EDQA 5CSXA 1BI8A 2GPHA 4E8AA 5C03A 4CZUA 4RVKA 3PTGA 4K18A 4BIBA 5AUTA 3RPYA 4O86A 4V01A 5IQIA 4O0YA 2R3MA 4YLJA 3CQEA 3PVUA 5J95A 4UN0C 1M14A 2X6DA 4I0RA 1L8TA 1PW2A 5AM6A 2G9XA 5M09A 2B9JA 1SYKA 5KO1A 4E6DA 3DAKA 2XRWA 4I23A 3SRVB 2QHMA 4K2RA 1XH6A 4C02A 4D1SA 4ZY6A 4QP3A 3K3JA 4K0YA 5A9UA 4BDIA 1PXPA 4WG3A 4E93A 5CF5A 2BKKA 1CDKA 4IZ5A 4CKIA 5ANIA 2C3LA 4Z9LA 4ZS0A 3SXFA 1IA8A 4HVSA 3NVKI 3CTJA 4OTRA 4W9WA 2IN6A 3TWJA 3W10A 4BC6A 3MPMA 4FKRA 5LQFA 2AC5A 4H3PA 5KE0A 3GCVA 4E20A 2CSNA 1CKPA 2CGWA 4RC4A 4GKIA 5JK3A 1I44A 4FVPA 4HYIA 3ZYAA 2R4BA 4YTFA 1BL6A 1UVRA 4RIWA 3F66A 3FLYA 4S30A 3VQUA 4CXAA 4ZY4A 3UGCA 4UXQA 4CZTA 4Y85A 2GNLA 2YA9A 3QTXA 5CAVA 2PSQA 3MH0A 1CKIA 2IW9A 2AUHA 1M7NA 4IX6A 5K9IA 2VTOA 2XJ0A 4B4LA 5HE3A 4IVBA 4XBRA 3S1HA 1YQJA 4OTIA 2QG5A 4NYEA 4S33A 1WVXA 5IA3A 2F4JA 3U6HA 2OWBA 3Q3BA 5F4NA 3RNIA 3W8LA 2ZAZA 3NCZA 3FZ1A 3BGZA 3QWJA 2DYLA 3D2IA 3LFAA 4OBOA 4A9TA 5LMKC 4MBIA 3OY1A 4R77A 2R2PA 3IGGA 2VV9A 3W2QA 4C35A 2RL5A 3PLSA 2B54A 4L7FA 3LLTA 4BRXA 3FMLA 4XV1A 4FSWA 5DMZA 2CHLA 2WTKB 4ALWA 4ERWA 2Y4IB 4ZLZA 4ZSAA 4H1MA 2I6LA 2Z02A 3EKKA 4FUYA 5A6OA 3HA8A 4NCTC 5DR2A 3N4VA 4WNMA 2ZB1A 4UYNA 1PMVA 1WAKA 1OL2A 3I1AA 3NW7A 3AQVA 5IMXA 3RI1A 3DK6A 4R7HA 1IRKA 3NUYA 4RZVA 2C69A 1BLXA 5DHJA 4YGAA 5I5ZA 4YZBA 2B52A 4RX7A 3RHKA 3GC9A 4FKGA 4WA9A 4YLKA 3FXXA 2FGIA 3QUPA 4D2WA 3NPCA 4M67A 4DF3A 3QF9A 3TJDA 4BCMA 3N4TA 2WEIA 2UV2A 3ANRA 5IH4A 4GJ2A 1KE5A 3VAPA 2C6TA 3EN7A 4IZYA 5FEDA 4AT4A 4C0TA 1U5RA 3GCPA 4JIAA 3ZCLA 4CLIA 3HVCA 3EHAA 4YJRA 4XNEA 2R9SA 1Q99A 3RTPA 3I4BA 4YJTA 3EFWA 3TM0A 3R83A 2C5XA 1WBOA 2OJ9A 3OTVA 2A2AA 4ASEA 2R0IA 3KXXA 2JDOA 4O22A 2QU6A 1OL1A 1XR1A 3KRRA 5CI7A 3FPQA 4BTFA 2GHGA 1MUOA 4M7IA 4BYIA 4WNOA 4DC2A 4QTCA 5CEMA 1PMUA 3GU4A 1YDRE 2EXMA 3UG1A 4CCUA 1E1VA 2QR7A 4X21A 5D10A 4N70A 4UZHA 5FGKA 3EJ1A 2OO8X 4BR3A 5C9CA 5FRIA 4AN3A 4FSQA 3IOPA 2YIQA 4RIXA 4QTAA 5GHVA 2YFXA 4TNBA 5K3YA 3AD6A 3DA6A 4FNWA 5FM2A 3QQLA 2W1IA 2FSTX 2JLDA 4R3RA 4BWPA 5I9YA 4IAFA 3TKIA 3TT0A 4TNDA 4S31A 2BZHB 2KTYA 1IAHA 4JQ7A 1NVSA 4IAIA 4RJ6A 4U81A 4DG2E 1XBBA 4DEDA 4O82A 3KXZA 2J51A 2XCKA 4FIFA 5I9VA 4PNKA 4RVLA 2C0IA 3ENMA 3OD6X 4JBOA 4MQ1A 3NW6A 2C47A 3D7TB 3ERKA 3R1QA 3R2YA 1V1KA 5HTCA 2YWVA 2X9EA 1U54B 3UVQA 4ZOGA 1J3HA 2C0OA 3QTUA 4ORKA 4I5CA 1PHKA 3LVPA 3BU6A 2UZDA 4F9AA 1Q3WA 4KRCA 1T45A 5E8XA 4E4XA 3RPRA 1LP4A 3EMGA 3MSSA 4MD7E 5AIKA 2BMCA 3Q9YA 4IB3A 3WZKA 5ICPA 1Q5KA 4P90A 3SA0A 2X7GA 4FVRA 5CEQA 4GRBA 4QMYA 3R8VA 3TTIA 4AGDA 3OROA 2YDJA 3MFRA 3BELA 4TWPA 1XH9A 4L3PA 4D58A 5AUVA 4BCQA 3BPRA 2QO7A 3MFTA 3MV5A 2C6LA 4KD1A 5E8UA 4BWXA 3VUHA 4YJOA 4DEBA 3QLGA 2Q0NA 3DJ6A 5IH6A 2WIPA 2WXVA 2PUNA 2ESMA 3UP7A 3KRLA 4UBAA 5HNGA 5GZ9A 2RFDA 5CAOA 2R3FA 1FGIA 4NM5A 2XNBA 3VULA 3MN3A 4Q5HA 4AE9A 3V3VA 4FTOA 4L7SA 2CCIA 5FD2A 3TUCA 4ITHA 4PF4A 2ZYBA 4PMMA 4QTBA 5CEIA 4H3QA 3NIEA 1PKGA 2OW3A 1ZY5A 5AP6A 4F7LA 4FX3A 3I7BA 3PY3A 3LXPA 2DUVA 3MW1A 4KS8A 1Q3DA 4M0ZA 4LL5A 4D4VA 4EOIA 3NX8A 4AW0A 4BFMA 2W4KA 5FXRA 5FTOA 4FGRA 3NRMA 4IHPA 4R8QA 3Q04A 2P2IA 3VUKA 2HELA 2UZBA 4TZRA 1ZRZA 4BDCA 3BYUA 5L2IA 5M53A 3LQ3A 4M15A 3RMFA 2WTKC 2Y4IC 3NYXA 2C3JA 2J9MA 4PL3A 4FV7A 4BDKA 2C3IB 4FKOA 3C13A 5CVHA 3IS5A 4GW8A 1WCCA 4TW9A 4MF0A 5EK7A 4CZYB 4TYIA 3O2MA 4XP0A 1ZZLA 4I5HA 4JG8A 2JKQA 4PMSA 4USEA 2Y7JA 4EH7A 3CY2A 4CMOA 4DGMA 2W7XA 3AC5A 4FUXA 2BZJA 3QRIA 1YI4A 4YZCA 4WIHA 5M4CA 3WE8A 4CFNA 4BBEA 4IC8A 1YW2A 4Y8DA 4QO9A 2HAKA 4FV1A 3SG8A 5FG8A 3CC6A 3NUNA 4GG7A 2YAKA 4XOZA 5L8JA 2VWVA 4UZDA 5J7HA 3W8QA 2XB7A 3CR0A 4CTCA 4QYHA 3PRIA 5AP1A 3G51A 4PP9A 3VO3A 1P5EA 4KIQA 4AFEA 4TYHA 3QQGA 4YHJA 4GL9A 5CSHA 5EI2A 4D1ZA 3A4PA 4DH7A 3TXOA 2CPKE 4NKAA 4DN5A 5CAQA 3CQWA 3QCSA 2HW7A 4I41A 2QOCA 4O1OA 3LHJA 5BVNA 3OWJA 4JBPA 4L8MA 3ZSHA 2VWUA 4ONAA 3ZFXA 4C4IA 3BRBA 4UXLA 4ZMFA 2P2HA 5IG1A 4J52A 1BYGA 1GIHA 3OC1A 3QRKA 2BTRA 4BZOA 2JDTA 4FYNA 4MNFA 4YJPA 3BV2A 2W1EA 3MIAA 3JXWA 2Z7QA 3C50A 2W17A 2WMQA 2W1CA 4UWYA 2JGZA 4ZTLA 4ZTHA 1H07A 2YCSA 4IZAA 4J53A 2ZV2A 3HL7A 3W32A 4K11A 2CCHA 3FQHA 3LIJA 4EWHA 3KMWA 3O7LD 3AC3A 4GV1A 4HZSA 4FIJA 4CT2A 4LRKA 4I20A 4RIOA 3V8SA 4FI1A 4QMTA 4TKSA 4X2FA 4J1RA 4YLLA 3CJFA 2G1TA 5AR7A 5HKMA 3V6RA 3GNIB 3LM5A 4HPTE 3QTIA 4NM7A 4QMPA 1W84A 4AX8A 1NVRA 3F9NA 3LCTA 3LZBA 4GK4A 4EUTA 3SVVA 3M11A 2FSMX 2O65A 5GJFA 2B4SB 3E5AA 4DEIA 4BGHA 4HW7A 2I0YA 4TPTA 4QYGA 4IAAA 3PVWA 3V8TA 3MGYA 3EZRA 2XVDA 3HA6A 4HGTA 4G3CA 4IX5A 1HOWA 1NVQA 5JZNA 4X6QC 2VGPA 5FLFA 2BPMA 1UU8A 5C8KA 3GQLA 3QCYA 2B9IA 3ZRLA 4TWOA 2YN8A 5CY3A 3SX9A 4FBXA 4FGBA 4KA3A 2EVAA 4DTBA 3PZHA 1OIUA 5C1QB 4ANOA 4JI9A 5IPJA 3EFKA 1IAJA 3KRXA 3E7VA 3GU6A 4EOLA 3CD8A 3OCSA 4AGWA 3ORLA 3NGAA 4JLCA 1FVTA 4R3CA 3Q6UA 1URCA 4MXYA 4YJNA 3KULB 2X8IA 3S00A 2GQRA 2BTSA 2QNJA 3RM7A 3RVGA 2Y8OA 5HE0A 2GS6A 5LWMA 2VGOA 3VUMA 2QVSE 5HX8A 4A06A 1JKSA 3A61A 3D94A 4MXCA 4AOJA 2X6EA 5E92A 1G8AA 2IPXA 4U6RA 3BEGA 3MFUA 5GNKA 4U45A 3OT8A 3DBFA 4OGRA 4F70A 2C6DA 1YKRA 2V7OA 2WEVA 1UV5A 2WHBA 4A9UA 3L8XA 3R8LA 2BRBA 1J7UA 4FSZA 5CYIA 2JAMA 3FMKA 3NNXA 2PVFA 4RGJA 5HIEA 1PYEA 2H8HA 2Y6OA 4F1TA 2HZ4A 1OL5A 4EOPA 1HCLA 1QPCA 4EOSA 1URWA 2B53A 2Y9QA 4WG5A 4ACMA 3NUPA 3COIA 3FZOA 4AXAA 3AGLA 3FYKX 3M42A 4EC9A 2AYPA 1PXNA 1MRVA 3IW5A 3L1SA 3P7BA 2VWZA 4IWPA 2RFEA 4FT9A 1NW1A 2OZAA 3FXWA 3QKKA 2YLEA 4QMLA 2JKOA 4BF2A 4XS2A 4F1MA 3CKWA 3UQCA 2R7IA 3RJCA 2NRYA 3Q4CA 3W2CA 3DKGA 2VWWA 1GAGA 2JFLA 1LEZA 4MTAA 4GFGA 2GHMA 4BDGA 1GNGA 3GOPA 3PJ1A 2YM4A 2R3IA 4NJ3A 4I94A 4U8ZA 4AZEA 5AX9A 2CLQA 3FMMA 3IW4A 4RQVA 4EWQA 4FKSA 3CPCA 4EBWA 5AV0A 2IJMA 3SG9A 4YBKA 1TQIA 2EB3A 4FOBA 3MVJA 3WI6A 3F2RA 4I93A 4KWPA 2W5BA 5HBHA 4C4GA 4HCUA 4F08A 3TN8A 3QTWA 2I0HA 4YZMA 3NYNA 3O23A 2XJ1A 2QOOA 4R1VA 1Y8YA 5BVDA 3SHEA 5H8GA 4H05A 3R6XA 2OFVA 3A99A 4QP2A 5CF8A 2JFMA 4KABA 3TUBA 2XK9A 3D5WA 4GEOA 4M3QA 4QP9A 2E9OA 3O8PA 3OF0A 4IB0A 5AV2A 3LLAA 5L6PA 4BDFA 3QQHA 5L8KA 4KIKA 5GIPE 5CEOA 3S2PA 5M56A 4S2ZA 4L45A 3FY0A 3IQ7A 4PDPA 2NRUA 3NYVA 5KKRB 3M2WA 4G31A 2CKOA 2QI8A 3ZBXA 3EQGA 2BRGA 2UZOA 2UZLA 2QO9A 3K2LA 3PA4A 3ZDUA 3FLQA 3KVWA 3PA5A 1Z9XA 2G2HA 4YUQA 4YTHA 4IANA 1ATPE 2BALA 2OFUA 2VO3A 2WOUA 3GB2A 4GT5A 4LG4A 4EK6A 4F7JA 2JITA 2PVRA 5KCVA 1AD5A 3FPMA 3IDCA 3L8SA 5G6VA 4PL4A 2VTJA 2B9HA 4O27B 1JAMA 2VWXA 2DQ7X 2VX1A 1R0PA 1DI9A 1YXVA 4AF3A 1KE7A 3HKOA 1OITA 3LQ5A 3LJ0A 4H36A 3FHIA 2XK8A 4RJ4A 3VHEA 1RQQA 2NNWB 3PJ3A 3JR1A 2X4FA 3KL8A 4UMUA 2J50A 4A9RA 3R8UA 4DEAA 4BDBA 3TNPC 2PY3A 5EI6A 5DR9A 2ZM4A 3D9VA 4QMXA 3VBYA 4B7TA 3EQHA 2X2MA 4RIYB 3WZDA 1ZYLA 1H0WA 2W06A 2WO6A 3ALOA 4CFWA 2CNQA 4XJ0A 2VTAA 2VD5A 3KK8A 5CX9A 2XK7A 4XV2A 3LFQA 3LMGA 4QMUA 2Y4PA 4FV0A 4QT1A 4EQUA 2WQOA 1MQ4A 1OIYA 3IW6A 4RX8A 4BTKA 5HLWA 2WTVA 3RPVA 3OTUA 3KY2A 4FV8A 3KCKA 5F94A 2ITVA 5JQ8A 4IC7A 2PYWA 4DGLC 2WIHA 3KMUA 3RAIA 2RKUA 2PMOX 3FZSA 4P5QA 4U3ZA 3L9MA 3I5NA 4NW5A 4J8MA 3OCBA 3FI3A 1YRPA 2GMXA 4HGSA 4IMYA 5AUXA 1PYXA 4YHFA 3SXRA 5KMNA 4IADA 4EI4A 5D9HA 1F0QA 4G5JA 4DFLA 2G2FA 3BYMA 3MFSA 3L9LA 3QHWA 2XNMA 3QC4A 2ITWA 3TZ9A 1VZOA 2RG6A 3DQXA 3R9NA 2BHHA 3NUUA 4YZNA 4E4MA 3EN4A 5TO8A 2X7FA 2YM6A 4KKGA 1OKZA 2X2LA 3RPOA 1KSWA 3MI9A 4AZVA 4U43A 4XV9A 2WTDA 1P4FA 2C6MA 1TQMA 3NUXA 4JJRA 4D2RA 2BRMA 5CU0A 3VBXA 4WNPA 4BL1A 2CGVA 4BCOA 4PNIA 4FTKA 3PVBA 5CEPA 3BX5A 3TNQB 2IZRA 3WF7A 4JVGA 4NFNA 1ERKA 3BE9A 1JPAA 3DFCB 1UKHA 2WD1A 3CIKA 1Q8WA 4LUDA 3P0MA 4GS6A 4MXAA 3U9CA 5C26A 3N4UA 3ZS5A 3BQRA 5KBRA 5BQ0A 5K4IA 4XP2A 3V5JA 1P4OA 5FTGA 3TIYA 4F0FA 3R7IA 4PP7A 2IVTA 4N4SA 5ITAA 5CALA 4O7VA 2QD9A 3LFNA 1V0BA 3KB7A 1M2RA 4YO6A 2I40A 3CTQA 4HGEA 3FLZA 4XEYA 3HMOA 1YOJA 4EORA 3U4WA 4LGGA 1MQBA 4O0XA 2R3LA 1OIRA 2RF9A 4RC2A 5IUGA 3PJ8A 4C4FA 2O2UA 5JFVA 5DLSA 4NZWB 3MA3A 4AN2A 5HORA 5IA2A 5B2MA 1E1XA 2E9VA 4X7QA 5HVJA 4F6UA 4JDJA 4G17A 3S95A 1YOLA 3RBWA 3ROCA 3UDBA 4ID7A 2JIVA 1OL6A 4XRLA 5CANA 5KKRC 1UWJA 2PVNA 4JS8A 5AR4A 2GCDA 3D14A 5EHLA 3KC3A 4M13A 4NM3A 4BCJA 2VX3A 4MD9E 2J0KA 3ZXZA 3VS6A 3UE4A 2YDIA 3AC8A 2JDSA 2O8YA 3E64A 1ZMVA 3HRFA 3ORKA 4I6HA 4IH8A 4C33A 2PZIA 4IFGA 4V05A 5A4CA 2IZTA 2GDOA 2WTJA 1M52A 3A62A 2IZUA 3W18A 4HYUA 2YZLA 4DT9A 2XCHA 3QTSA 2CGUA 3R9DA 4FA2A 5DFPA 5M07A 5L6OA 3PXYA 2PZ5A 4Q9SA 2XK4A 2OGVA 3OT3A 5HVYA 5HOAA 5BVKA 2WMSA 5LXMA 4DCAA 2OZOA 4FV6A 2UW5A 4FIHA 2IWIA 4EH4A 4ANMA 1REKA 2QOKA 4BGGA 3OG7A 3R21A 2J0IA 3UQGA 5JMSA 3NAXA 4LOOA 2F2CB 5CQWA 2UVZA 1JVPP 5EM6A 3DZQA 3E92A 3KF7A 3VBTA 5LMBA 3LFBA 1YXTA 2VTHA 3F88A 4XRJA 3VBQA 5BUIA 4X0MA 4RWJA 4QMWA 5DIAA 3GXLA 4WHZA 1ZY4A 2ETKA 3CBLA 2YIXA 1YDTE 3HGKA 4D4RA 4W4WA 5JGBA 4JL9A 1UU3A 3MS9A 2VTQA 3MH1A 4YBJA 3QLFA 4QYEA 3ET7A 5HD7A 2ITUA 3FY2A 1WVWA 4XUFA 4U79A 2R3RA 2C6EA 3PE2A 3O51A 4GK2A 5HIBA 3Q5ZA 5EQPA 2ETRA 2OIQA 4XOYA 1M2PA 5J8IA 5LVNA 5HCZA 3BBWA 5G1XA 2BRNA 4DA5A 4FSTA 4BY9E 2GS2A 5I0BA 2X7OA 3EFLA 5C01A 4CYJA 3UG2A 2W4OA 4FNYA 3ZLYA 5HO6A 4F99A 3HMPA 4FTJA 4AACA 4F9CA 1OVEA 3AC1A 2CGXA 4EH3A 3PJ2A 1BMKA 4EQMA 4R3PA 4WD5A 4RIXB 5AX3A 3TI1A 4UMRA 2X2KA 3ZSIA 3BHYA 1XHAA 4J98A 3DXPA 5AIRA 5HE2A 4K8AA 3I0QA 4Z7GA 3R1YA 1OPKA 1Q97A 3E8EA 4FSUA 4M69A 3ATSA 3FE3A 5IQDA 4G2FA 2UZVA 2QLQA 4G1WA 4WSYA 5DA3A 4JR3A 1WBNA 4WNKA 3WZJA 3HX4A 5ANKA 3R28A 4FEXA 3MY0A 2OH0E 3FHRA 3LFEA 1OECA 2C6KA 2UZUE 4BCGA 3MTLA 4C4JA 5HLNA 3A7FA 4X2GA 1H00A 3T8OA 4HYSA 3FJQE 4JDIA 5CAUA 2HY81 5EDRA 4FT7A 4RT7A 2YJRA 4HPUE 5A4TA 1XKKA 4FOCA 4C4HA 3R63A 3DZOA 2Q0BA 3ZM9A 4RWIA 5BNJA 2ZV7A 3DCVA 2E9NA 2R64A 2XNPA 4ZJJA 3ZUUA 1K2PA 3H0YA 2XKFA 3TACA 3VS5A 3QFVA 5BMSA 1DM2A 3FI4A 5HQ0A 4HVGA 4C3FA 5A6NA 1XH5A 1GZKA 3CLYA 3LMHA 3LFSA 5AR3A 2FSLX 5AR2A 4MWIA 3OHTA 3BU5A 5LVOA 2QCSA 2PHKA 3H10A 4EKKA 3OY3A 3PWYA 3Q4TA 3IGOA 4PDSA 3KU2A 4EK4A 1R78A 2OI4X 3H30A 1IR3A 2C1BA 2R3PA 1TVOA 4L44A 4AG8A 3V04A 4S34A 4CEGA 3NNUA 4QMQA 3NMUF 3F5XA 1I09A 3QTRA 3FMHA 3FZRA 5LOHA 1Q41A 3WIGA 3TUDA 1JLUE 1MRYA 1ZMUA 3HUBA 4PWNA 1S9JA 3OUKA 5EHYA 5I3OA 3R01A 4E26A 4DAWA 3RHXA 3Q52A 4FICA 5HVKA 3HZTA 4FV9A 3DKCA 5HTBA 5I4NA 4GMYA 4X2JA 5LWNA 3ANQA 3BLRA 3EL7A 4U97A 4YJUA 3PXQA 5L6WL 4YURA 5A4QA 1PF8A 4RFMA 3KRWA 3VW8A 2R3OA 4IBMA 4FKIA 1YDSE 4IW0A 1FGKA 1WBSA 3KA0A 4G9RA 4J97A 5CF4A 5IKWA 2QOIA 4DLIA 5LMKA 3BBTB 4HYHA 5KX8A 2BFYA 3IOKA 2C3KA 5A46A 1YWVA 2YM3A 2ITPA 3EYHA 3PXKA 3FLSA 1VR2A 3G6GA 3WF9A 3ZFYA 4E5BA 4ZAUA 1VYWA 4J7BA 3OWPA 2VAGA 4MAOA 4C34A 4ZTMA 4RJ5A 3L8VA 4L01A 2YIYA 4QRCA 4NCTA 4ENYA 1LR4A 2OLCA 5TKDA 3C4WA 2GNFA 4KIOA 3WF6A 4AA0A 3JY9A 1A06A 1M17A 4WO5A 4IIRA 5GZAA 5AAGA 4EOQA 4DTKA 1V0PA 4WOVA 1GIJA 4X3FA 4TN6A 1RJBA 3VNTA 4B8LA 5CENA 5LARA 3TIZA 3S3IA 4EK3A 5J9ZA 4L43A 1O9UA 5GJGA 2H34A 4L53A 3MY5A 3MDYA 4RZWA 1OZ1A 1B6CB 1JSVA 3OZ6A 3P1AA 5M08A 3UOLA 3I79A 3QRJA 3FC2A 4WKQA 2ZM1A 2WQBA 2YISA 1RE8A 4MNEA 4BDHA 2FO0A 5H8BA 4IFCA 4TYHB 3OW4A 3JY0A 3VN9A 4DE4A 2V22A 5AADA 3ZRKA 3OS3A 3Q96A 4XG2A 5AM7A 2QOBA 3U4UA 3BWJA 1FPUA 4BI1A 1AQ1A 1DI8A 4I22A 4O91A 4QP6A 3MESA 1UNHA 3HRCA 3VS0A 3BKBA 4QNYA 3H9FA 3ID6C 1HCKA 3AD5A 2V0DA 4V04A 5DGZA 3A60A 4MXXA 2R3HA 4RX5A 4LM5A 5I9WA 5IQAA 1WBTA 3LQ8A 3O71A 3VS4A 5JEBA 3TV6A 3FV8A 5ANOA 5BPYA 5J1WA 3ULIA 2OJGA 3VS1A 1U5QA 4G6OA 1GOLA 3BYSA 3SQQA 2PK9A 3E8CA 4Y73A 1OPLA 1FINA 2H6DA 3QQJA 4O21A 3LCOA 4UMTA 3UTOA 2OXXA 3TZ8A 2A19B 1SZMA 4BTMA 3UOJA 3WYXA 4Y5QA 5E8VA 5EYDA 3SRVA 1PJKA 2CMWA 3MA6A 3QZGA 2V62A 5IUHA 3BE2A 4QQ5A 3L9NA 3UC4A 4BVUA 4BKJA 4D0WA 3P9JA 3AMYA 4CMUA 5C4LA 4RA4A 1W8CA 4P2KA 3ZO3A 1EH4A 1WBWA 3E62A 3G90X 3HV3A 5JH6A 4C59A 2VN9A 4FSYA 2JBPA 2PU8A 3E3BX 2NP8A 4BI0A 2ZV8A 4CV8A 5ETIA 3WARA 3GC8A 5BUEA 4V0GB 4F9BA 2ERKA 4I0TA 5DVRA 3U87A 4APPA 5M44A 5T6KA 4TXCA 2IW6A 4PPAA 4W4VA 5FEQA 5LCKA 5CASA 3WILA 4R5YA 3IPHA 4FZ6A 2FA2A 5CNNA 4ZK5A 4BIDA 4C36A 3K3IA 3VUDA 1H1SA 3OXZA 4UMPA 4WUNA 2OSCA 3NVMB 3PYYA 5A3XA 4G3DA 4PDYA 5HG5A 2E9UA 2XIYA 3UODA 2W4JA 2ZM3A 3DKOA 4ACHA 2R3JA 4OAVB 4GU9A 3UBDA 3HV7A 4ALUA 4ZJIA 3FL4A 4L9IA 3GC7A 4FC0A 3LW0A 4GYGA 1R1WA 3AGMA 3F5GA 4CFUA 1P14A 4GSBA 4WUAA 1V0OA 2GTNA 3QQKA 4G5PA 1R0EA 3QALE 4IXPA 2G15A 4RBLA 3LOKA 5HI2A 2VTNA 4C3PA 3O7LB 4MX9A 4CFMA 4YC8A 4QP7A 1FOTA 5ANDA 5LCJA 2ZMDA 2CLXA 3JPVA 2VU3A 4FV3A 2CJMA 3RALA 3UZTA 3HAMA 4ZLOA 4BB4A 2W9ZB 2OIDA 4ZSGA 2P33A 2XKDA 4D2PA 2WTWA 4C61A 4U42A 3NS9A 3GUBA 2JDVA 3R7OA 3QC9A 4ASZA 4ZZOA 4ZZMA 1PXKA 3LPBA 4BCIA 4BKZA 2ZOQA 2OZAB 5IH5A 4BCPA 5KUPA 1KV1A 1WFCA 2RG5A 4BCKA 5E1SA 2WGJA 5TT7A 2OK1A 3WIKA 4BYJA 5ANEA 4KINA 3AC2A 4EZ7A 4MXOA 5HU9A 5C27A 3F3WA 2WTCA 2XYUA 5L2WA 2VUWA 3BLHA 4EHVA 3C0HA 5JFWA 4GVAA 4DLJA 4F64A 4PTCA 3LFFA 1JKTA 2ONLC 3QD3A 4RC3A 3EFJA 3G0FA 3AXWA 4LQMA 5C8MA 4JQ8A 4BCNA 2VTLA 3GBZA 4O7YA 2NPQA 1NXKA 4DITA 4FK3A 2X8DA 2P3GX 2GU8A 2W96B 3KXNA 3ZUVA 3QZFA 2I1MA 3CP9A 3H4JA 3E8DA 4P5ZA 4ZEGA 4QMVA 3SW7A 4FV5A 3PA3A 3K5UA 5EFQA 1RDQE 4UB7A 3QUDA 4PTEA 3FLNC 3PVGA 3JYAA 4M0YA 3VRYA 2F7EE 4IB1A 5A54A 2BKZA 3SLSA 4BWKA 4A07A 4BHNA 4YZ9A 5IQEA 3QA8A 3OUNB 5KBQA 1H4LA 3GFEA 3OOMA 3W1FA 1FMKA 4AA5A 4H1JA 4FNZA 2XEYA 3QKMA 4E5AX 5EQYA 2WMRA 5IDPA 4GU6A 2RFNA 2QHNA 3QX4A 3ZM4A 1XBAA 4PMPA 1OB3A 2WU7A 5LVLA 5AJQA 1YHWA 5J5SA 4JAIA 1GZNA 3V5PA 4OTHA 2YITA 5HIDA 4BZNA 1U54A 1OBDA 4R6VA 2YCRA 3MIYA 4FKJA 4QNAA 3TZMA 4BTJA 4ASXA 5KHXA 3AT4A 4NU1A 3FZPA 3NUAA 3Q53A 4OT5A 3PG1A 4X3JA 2W0JA 4XLIA 5ETAA 2CNVA 3PZEA 3GCSA 4K77A 4ACGA 4KNBA 1H24A 2REIA 2YABA 2HWPA 3BIZA 3DT1A 3OEFX 5CU6A 2BRHA 4J8NA 4WT6A 1PXLA 4HVDA 3WE4A 2J5FA 2R3QA 4EOKA 4CQEA 1H25A 2XM8A 2BR1A 2XZSA 4XG8A 4W9XA 4C7TA 3D2KA 3HMMA 3B2WA 2PULA 5DE2A 2OH4A 2SRCA 4JX7A 4HGLA 2BIYA 3OXIA 5DH3A 5DRDA 4L46A 3VHKA 4L42A 4QMNA 4U3YA 4N0SA 4A7CA 4HCTA 4UV0A 3ZXTA 4L52A 4FODA 4EH8A 4KBCA 2C4GA 4NKSA 4F09A 4I6BA 1VJYA 1Y6BA 1OIQA 2IVVA 1QCFA 5HO8A 5IQFA 1ZYSA 2LGCA 3R8ZA 3KVXA 3ULZA 5I9ZA 2OJJA 3Q5IA 3IDBA 2QONA 2HYYA 2CKQA 3D4QA 3ZU7A 3S4QA 2QKRA 4DH5A 1GZ8A 2IVUA 2UW0A 2ZVAA 2VO6A 3ORTA 3ZTXA 4EH9A 4WSQA 2BDWA 3PSDA 2EU9A 4Z7HA 4XG6A 5J79A 2UW4A 4OW8A 4NTSA 4LYNA 3RP9A 2J0JA 1DS5A 1NY3A 2CN8A 4O2PA 4PX6A 4XBUA 1OPJA 5CS6A 5EW9A 3HMIA 3IDPA 4YP8A 3SAYA 4DFZE 5HICA 3TKHA 2R7BA 4BCFA 4DTAA 2VWIA 3CE3A 3HV6A 2XBAA 5ACKA 3C7QA 4RG0A 4O84A 5B2KA 5JGDA 3PPZA 3PFQA 4KSPA 2BDJA 4BIEA 3ZO4A 4J95A 5IQGA 3PXZA 5HTIA 2Y0AA 3BGPA 3DLSA 3R1NA 3EQBA 3I6UA 4N6YA 4YNOA 3F69A 3TNHA 3UPXA 2C68A 3TL8A 5LVPA 1CMKE 3KFAA 1SM2A 4YJVA 5AV4A 4YPSA 5K4JA 2W5AA 5IMEA 3GEQA 5HD4A 4RX9A 4PQNA 4ZTQA 5M51A 2VNYA 3E7OA 3EB0A 2BVAA 5KNJA 4LOPA 2VX0A 4NIFA 1CM8A 2WMXA 2QOHA 4BCHA 4FK6A 3NIZA 4Y46A 2Z2WA 4FKLA 3LCSA 1ZARA 4USFA 1DAYA 3UO6A 4YO4A 4L00A 4A4LA 4AAAA 3COKA 4K6ZA 4II5A 4X2NA 3RM6A 5E4HA 4ENXA 4J71A 3E88A 4IM0A 1YVJA 2B55A 4AW2A 2W1GA 4RJ3A 4MBLA 5AP5A 2IG7A 3KXMA 2IZSA 2OICA 4FTMA 3PIXA 3QZIA 3P79A 4FNXA 3Q9ZA 2ZDUA 4FZFB 4EZ5A 2FUMA 3FMJA 3THBA 2WMWA 5M4FA 3DTWA 3W2SA 5KMIA 5AV1A 2PVMA 3POZA 3QWKA 1ND4A 3PY1A 2RIOA 3A7JA 3QYWA 2J0MB 5DG5A 3W2RA 3QL8A 3VF9A 2BAQA 2PE2A 5HG7A 5D1JA 4YR8A 1Q4LA 4DINA 2PZRA 3A7HA 3BHVA 3C4CA 1GY3A 2HCKA 3JS2A 3LE6A 4AZSA 2WQNA 4RQKA 1YWNA 4MD8E 3RZBA 3Q6WA 1ZXEA 2GNJA 2JBOA 4ITIA 2EXCX 5EM8A 4BICA 2YM5A 4DG0E 3E3PA 2BROA 4HZRA 2QOQA 5HCXA 5KZIA 4EJ7A 4I0SA 3A7IA 5D12A 5HG8A 1BL7A 4ACCA 2C6OA 1PMNA 4EZ3A 3I60A 2V55A 4O7ZA 3F2AA 3C4FA 4I5PA 3N51A 4DH1A 3F3UA 5F9EA 4YTCA 3UOKA 3ALNA 3HUCA 4KKHA 4JDHA 3T9TA 1OL7A 3ZFMA 3PUPA 5BYZA 5AP4A 3SW4A 3IW7A 3P23A 5E7RA 3PIZA 4EHEA 4FL1A 2PMIA 5E8WA 3VQHA 4UWBA 1XH8A 1SNUA 5AR8A 3WF5A 4BBMA 3LJ1A 4E73A 5FDPA 3UO4A 5CZHA 2WMVA 4FYOA 4ZLYA 3G33A 5CTPA 5L8LA 3QTZA 4AFJA 3MJ1A 1J1CA 3V51A 4HVHA 1YXXA 5ANJA 2ITTA 2XK3A 3F7ZA 1WBPA 3OP5A 5J1VA 4O7SA 2YWPA 1KOBA 3KULA 4O0RA 3OBJA 2FSOX 2UW7A 5AV3A 3ZH8A 2C1AA 2YCFA 3QCXA 4LFIA 5EM5A 1FVVA 5L3AA 1TQPA 1KOAA 4IZ7A 2B0QA 5D7VA 4AGUA 3U9NA 3I7CA 4WRSA 4HOKA 3G0EA 4CG8A 5CZIA 4UEUA 5HNBA 3RCJA 1Q8ZA 3P5KA 4CYIA 3QGYA 3CKXA 5AP7A 5E8SA 1OGUA 2XRUA 4GFOA 5AA9A 2UVXA 4LV5A 1IA9A 1OMWA 4Q5EA 3F6XA 3ZO2A 2YCQA 1G3NA 1LPUA 3PG3A 4O0UA 5AUYA 3W55A 4CLJA 3SDJA 4O38A 2ZJWA 4ZMEA 4ANNA 1W7HA 1U46A 3C5UA 4M14A
chains in the Genus database with same CATH superfamily
2GFSA 4FKPA 3FMDA 1CKJA 4I5MA 4FKQA 3DJ5A 3DXNA 5CSWA 3KRJA 3F3VA 3LXNA 3BV3A 5IUIA 1CSNA 2KULA 2I0EA 5CWZA 4LGDA 4ZXTA 4W4YA 3ZLWA 4GT3A 5T3QA 3F61A 5DT4A 4ZP5A 2HY0A 2OBJA 3HV5A 4NFMA 4YC6A 4CG9A 4O0SA 1JWHA 4ZJVA 4O0TA 4LMUA 4OTWA 3U6JA 2UZWE 3CD3A 2XBJA 3BEAA 5HG9A 4JIKA 3R7UA 3OW3A 3R8PA 3RAWA 4Z55A 2BAJA 3ML1A 1XQZA 4IQ6A 3ZONA 4F7SA 2WTIA 4HCVA 4QD6A 4ZIMA 3A8XA 3UMWA 1YI6A 4KSQA 4IWOA 5CI6A 4YMJA 3C9WA 4DFNA 3U6IA 3AC4A 3K54A 3E63A 3C4EA 3ZRMA 3TJCA 4LGHA 1R39A 2C5OA 2HENA 5BVOA 4XHKB 5A14A 4YNEA 3LM0A 5CXZA 2O64A 4AE6A 3HV4A 4D2VA 2PUUA 4F4PA 3FEGA 2VO0A 1DAWA 2X1NA 4RIWB 3T3UA 5KZ0A 4I92A 1GZOA 3OOGA 1PXMA 4ACDA 5C4KA 3MJ2A 1KE8A 3VF8A 4R78A 4JBVA 3UZPA 4ZTSA 5DN3A 4BHZA 3LKMA 1U4DA 3FKLA 4XG9A 4RRVA 3WF8A 4D4YA 1MP8A 3UJGA 4JNWA 4CSVA 2QURA 2XA4A 5DT3A 4I21A 2XKCA 3I5ZA 3NLBA 5IEYA 3ETAA 4BI2A 2VWBA 5KMMA 3BHHA 2AC3A 2PL0A 3PPJA 2QODA 1Q8UA 5E9EA 4DFXE 5DPVA 1QPJA 3F82A 3GFWA 3ZEPA 3AOXA 4OTFA 4AP7A 4CNHA 3QAME 4EK8A 4MH7A 2W1DA 3H3CA 1Y6AA 4C57A 2BHEA 2X0OA 5D11A 3C4XA 4M84A 3N9XA 4G3GA 2PUPA 4DHZA 4CTBA 4FZDB 4FMQA 4M66A 2O0UA 4QP4A 5DBXA 3EQRA 3KXHA 4JDKA 3EYGA 3TDWA 2P0CA 4O7LA 4MK0A 1LUFA 2QO2A 3ZUTA 3CXWA 3C1XA 4F63A 4EONA 5CEKA 2IO6A 3II5A 2XIRA 4JXFA 4QMSA 4YJQA 2JEDA 4ZSJA 3ZBFA 4DCEA 5HU3A 3DQWA 2WQMA 3CGFA 3RNYA 1BI7A 4IAKA 2HXLA 5D41A 2C5YA 3F5UA 1AGWA 2E9PA 3DBCA 2W1ZA 2F9GA 4IAYA 4DFBA 3PLAE 5B2LA 4EJNA 2P55A 5IA0A 3AG9A 1H28A 3UVPA 2PVYA 4M68A 2XNOA 4X3FB 4XP3A 4A4XA 5JKGA 4G16A 4D2SA 4F9YA 4RIYA 4IVDA 4KAOA 3O0GA 2EB2A 4K33A 4XCUA 2HZIA 2JIIA 3LJ2A 1XJDA 4G3FA 3IECA 4ZZNA 2Z7LA 4RWKA 5HGIA 3EOCA 4FKWA 3FQSA 4WBOA 4RJ8A 4AZTA 4IX3A 2BCJA 3HRBA 3TEIA 4MNEB 2ZB0A 4PPBA 3VJNA 2OF2A 4KB8A 3VUGA 4AOIA 4TYJA 2WMUA 4GCJA 5EDPA 4E6QA 4OT6A 4U0IA 1J1BA 3QZHA 2FB8A 3EQIA 3FBVA 5EH0A 5FBOA 5KMLA 4U80A 3HDMA 3IONA 2W99B 2JKMA 3EN6A 1G8JA 5TF9A 4AQCA 1FMOE 4AWIA 3CSVA 3UIUA 4DG3E 3FYJX 3W0RA 4ANSA 3ROYA 3KN6A 2YLFA 1FVRA 4FVQA 4LDTA 2PTKA 4GH2A 2BDFA 3GI3A 2O63A 2A1AB 3PWDA 4NSTA 4QMMA 4DH3A 3VRZA 5KMOA 1VLRA 2YACA 5AAFA 1XMMA 3CS9A 4R5SA 1H01A 3NAYA 1Q8YA 4KUJA 3DAEA 3FSFA 4JX3A 3B8RA 1W2CA 3CEKA 4NL0A 5IQCA 4AU8A 4F1OA 2P4IA 2F57A 5J5TA 3HP2A 4IDTA 5AAEA 3EH9A 4DGGA 4A9SA 4U44A 3SD0A 2JAVA 4O81A 4GK3A 4FSRA 5DRBA 3QXOA 2B1PA 4FL2A 1K9AA 2BZIB 1H0VA 2GNGA 3BZ3A 3R73A 2UZTA 4BDAA 3G9LX 5B7VA 4XG3A 4C37A 5JGAA 2OF4A 4Q2AA 5CAPA 1CTPE 4AS0A 4CKJA 2HK5A 2W05A 4J96A 4B99A 3NUSA 4JT3A 4I1ZA 3UQFA 3SOAA 3R7EA 2GTMA 3G6HA 1H26A 4Z16A 2OG8A 4DFUA 3LCKA 2GQGA 1YOMA 3LCDA 2DWBA 4NJDA 2JC6A 3HAVA 5L2SA 1H1PA 4C62A 5DI1A 3SOCA 5BVFA 5IQHA 3FLWA 4FKVA 4M97A 3MY1A 4WRGA 3NNVA 2C30A 2J0LA 4EOOA 2UW3A 4G34A 4J99A 4UWCA 3BQCA 3E93A 3JVRA 5FXQA 3VBVA 2CN5A 5F95A 3AT2A 4ITJA 1JBPE 4FG9A 4FZ7A 3RK7A 4ZTRA 3TMOA 4UMQA 2PVJA 4USDA 5TOZA 3DBEA 3PJCA 4O0WA 4EHZA 4IJ9A 4NTTA 4FT5A 1SMHA 4IVCA 3HEGA 4ALVA 4IVAA 1OBGA 4EYJA 3TNIA 5EW8A 4L3LA 2YIWA 5HLPA 3QBNA 5JSMA 3R7YA 3FL5A 4C2VA 3VUTA 5AP2A 2X81A 1Q24A 4CMTA 4FEQA 3FI2A 3SC1A 1XWSA 5LMAA 3DJ7A 3F2NA 4DH8A 2GS7A 3UYSA 5H8EA 1STCE 3P4KA 3D15A 2C0TA 1F3MC 3AD4A 4O0VA 5J9YA 1OKVA 3R2BA 5DYJA 5AA8A 4TYGA 4O4CA 5I9XA 5GIOE 3O8UA 1B38A 3UNZA 4E1ZA 3KF4A 2BFXA 4GG5A 3ZZWA 2I7QA 4MUQA 4X3FC 1O6YA 3K5VA 3P7AA 1JNKA 3KN5A 3FI8A 4YPDA 4QQCA 3UNKA 2PE1A 4IAZA 4OTPA 4E5WA 5EYKA 3R7GA 5DWRA 5HCYA 1SVHA 1NA7A 3FZTA 4XG4A 3MB6A 3KXGA 1UWHA 4E6AA 3EQPA 5EHOA 5IZFA 3P7CA 2NO3A 4S32A 5M4UA 5CQUA 4HNFA 3GP0A 4TRLA 4B0GA 3W0MA 3IW8A 4CFXA 2HWOA 3V6SA 3DFAA 3R22A 2YERA 4M8TA 3UIBA 3FC1X 1SNXA 3Q4ZA 3PSBA 5FP5A 5FEEA 3WBLA 1GIIA 2X9FA 3GC0A 3MVMA 5T68A 3NEWA 4M12A 4RLKA 4YJSA 5K0KA 1ZOGA 4GVJA 3D83A 4Y5HA 4D0XA 3F7WA 2X39A 4LI5A 4FIGA 4PL5A 3ZC5A 1ZOEA 3BU3A 3O50A 4FTIA 3ACJA 1OUKA 4R1YA 5L4QA 1F5QA 4FTRA 4FTUA 4EK5A 2OU7A 3T3VA 4LUEA 4JAJA 4KKEA 5JN2A 4OBQA 4RWLA 4FKUA 4DFYA 1GJOA 3KMMA 4IACA 4ZSLA 3ACKA 4CVAA 4CFFA 4W4XA 4ASDA 2VZ6A 3MBLA 5EM7A 3AT3A 1MRUA 3E87A 4TT7A 5BYLA 4FEVA 1H1QA 2R3KA 2A27A 3DPKA 2CDZA 3DS6A 4ANQA 5E8TA 3EL8A 2FH9A 2WMTA 3KEXA 3HMNA 2A4LA 1JSUA 2X0GA 5AUWA 3RGFA 4CRLA 1NT2A 3I81A 3IK3A 4FIIA 5HE1A 3NYOA 5AUUA 2Y6MA 3B2TA 4FV2A 1VEBA 5EOBA 4C8BA 2PVLA 4GYIA 3BYVA 3COHA 4QP1A 5IA5A 2F2UA 4Y83A 4OTGA 4O7WA 3QD2B 1O6KA 4ZTNA 3VS2A 1ZYDA 4AW5A 3DKFA 4OAUC 1Q8TA 3OEZA 3A2CA 3OVVA 3VBWA 2YEXA 4QTDA 1TFFA 4AA4A 3F3ZA 5M55A 2J6MA 5FTQA 2WKMA 3W2PA 4OUCA 4CT1A 4EH6A 4NEUA 2J90A 4GJ3A 3CY3A 3TTJA 3A8WA 2VTSA 3IKAA 4EYMA 4FG7A 1Y91A 3ZEWA 3BLAA 2A0CX 3DOGA 2QC6A 5ACBC 4C38A 3ITZA 5B0XA 2XAMA 4JQEA 2OIBA 1XH4A 4OTDA 4MF1A 3DLZA 3W2OA 1H08A 3W33A 3QRTA 3VWAA 4FIEA 4FTNA 4CFVA 1JOWB 4F7NA 2V5QA 3R9RA 1JKKA 2DS1A 3QUEA 4GIIA 4NT4A 5CU2A 3C0GA 4IWQA 1A9UA 1OUYA 2VO7A 3PRFA 5EYMA 1M2QA 1QPEA 5M4IA 2Q83A 2PMNX 4OTQA 3VJOA 4AGCA 2ITYA 3VS3A 4G3EA 4QYFA 4MWHA 5EQEA 1FQ1B 1IEPA 4O2ZA 5HO7A 4BGQA 1ZLTA 4QPAA 4D9TA 3QTQA 1RW8A 2BUJA 2HZNA 3R9OA 5DR6A 2WQEA 3UYTA 4CGAA 2XNEA 3DB6A 4MHAA 5BUJA 4I6FA 3UOHA 4YC3A 3GU7A 3GT8A 3HECA 4QYYA 4EOMA 4YHTA 1IG1A 3E8NA 4P7EA 2UW8A 3QKLA 4RJ7A 5A4LA 4D5HA 2W1HA 3R0TA 5BVWA 4HJOA 3UC3A 3QU0A 4IE9A 1UU7A 2RFSA 3UDTA 4UYAA 3OMVA 4CCBA 5GINE 4PTGA 4IEBA 3RPSA 2WOTA 3PP1A 3R71A 4QPMA 3PDTA 1YXUA 2VRXA 5JRQA 1U59A 4EEVA 4EOJA 1UA2A 2XKEA 3PE1A 3RCDA 4FSMA 3ORMA 2R3NA 3HYHA 4FJVA 3Q9XA 3REPA 3DTCA 5HX6A 5K0XA 4CRSA 3BWFA 4A4OA 4AZWA 2HXQA 3MVHA 3WYYA 3SGCA 1XO2B 4NIFB 2XNNA 1PY5A 4D2TA 2XP2A 1YWRA 2XM9A 2ITQA 3W0QA 2F7XE 2GSFA 2ONLA 5CVFA 1Q62A 1Q61A 2X8EA 3QHRA 4C3RA 3NSZA 1FBNA 4DHFA 2I0VA 1ZWSA 5BMMA 2OJIA 3L9PA 2IW8A 4EKLA 1PMEA 4QMOA 5HBJA 3BHTA 3CTHA 4KIKB 3O8TA 5CU3A 3QYZA 3ZSGA 4G9CA 2QOLA 4C4EA 3BHUA 4FEWA 3FKNA 1YXSA 2XH5A 3DB8A 3NCGA 5IISA 4OR5A 4MQ2A 3BL9A 4FKTA 2QKWB 3DNDA 3RKBA 5F1ZA 5H2UA 4EHGA 4C2WA 3EN9A 2G01A 4D55A 4JRNA 2VTMA 1XH7A 4U41A 3D7TA 5EKOA 4E4LA 1TZDA 3R02A 4RSSA 4DGNA 3QCQA 5HNIX 1H8FA 4G6NA 4PRJA 4DEGA 3MTFA 5KMKA 4RFZA 3DGKA 3ENHA 4GFMA 4NWMA 3G2FA 3HP5A 3PSCA 4I3ZA 4XLVA 5DOSA 5AP0A 5ETCA 4AOTA 4HNIA 3QD0A 2XYNA 3POOA 2J4ZA 5AUZA 4FT3A 4L67A 3GQIA 5EOLA 2ACXA 4GKHA 1Y8GA 3QRUA 3UP2A 4PPCA 4ANLA 3DBDA 4FG8A 1R3CA 1UKIA 4O1PA 5EI8A 1KV2A 2YM8A 5JT2A 1T46A 1J91A 1IASA 2IEWA 3H9OA 1W98A 3R00A 4KRDA 1ZYCA 4FL3A 4ANBA 3OXTA 4WG4A 4JOAA 5AEPA 3LXKA 3QQFA 4NH1A 3OFMA 4NUSA 1WBVA 5CSVA 4O7TA 2VTPA 3KKVA 4PUZA 2XS0A 5EG3A 3GU8A 2RSVA 3V5QA 1JQHA 2WFYA 4YTIA 4V0GA 3PXFA 4EUUA 3QA0A 3GENA 3LAUA 4C58A 2F49A 4XH6A 3JVSA 3T9IA 1J7IA 4Y72A 4ERKA 3R7VA 2BZKB 4AT3A 4H3BA 2EXEA 3F5PA 4MYGA 2XIXA 3GCQA 3DV3A 3COMA 2PUIA 2PWLA 4ZS4A 2VNWA 4GT4A 3QXPA 1QL6A 3RAKA 4EL9A 3DAJA 4QQJA 2WB8A 3IO7A 1H1WA 3EQDA 4Y95A 4NM0A 2B7AA 3OWKA 3NW5A 2BIKB 3C51A 3V8WA 3UNJA 5IU2A 5EYCA 3SKCA 3R8MA 2XF0A 3HDNA 4LV8A 4ARKA 4O6LA 4QQTA 1OM1A 4AN9A 1ZYJA 2YAAA 3PY0A 4XMOA 5GJDA 5HZNA 3DK7A 2HOGA 5L2TA 3R1SA 2WAJA 2Z8CA 2GNHA 2PMLX 3BYOA 3D5VA 4NK9A 3A4OX 4TWNA 4EBVA 5K5XA 2C6IA 4F6WA 4MKCA 3NNWA 4FTTA 4QTEA 4U7ZA 3PUFC 2YZAA 4E6CA 1A48A 3QQUA 3Q2JA 4U40A 1H27A 4I24A 2ITXA 4D28A 5BX0A 1PKDA 2J7TA 4OLIA 4FEUA 4MEDA 3ZMMA 5C8NA 4QMZA 5H9BA 1JKLA 1G5SA 4FE2A 3GU5A 3L8PA 3I0OA 5FUTA 3DDPA 4E3CA 3ZHPC 3FDNA 5LJJA 2QOFA 4E7WA 5HBEA 3U8WA 2XEZA 4DEEA 2EUFB 5FXSA 2YM7A 3CJGA 3P86A 4L6QA 3ZC6A 2UW6A 4MVFA 1ZZ2A 5J87A 2ITNA 4I6QA 4IB5A 3D7ZA 1UNLA 4ZSEA 5JRSA 4R7IA 3WZEA 4RFYA 5IA4A 4BZDA 4DEHA 1E9HA 5FM3A 1O6LA 4LOQA 4XX9A 1YHVA 3O17A 1ST4A 4F0IA 3BGQA 3C4ZA 2WMBA 2PZYA 2R0UA 3EIDA 3KK9A 3ORNA 5JQ5A 2UVYA 2JKKA 4YU2A 4K1BA 2XNGA 4UX9A 3B8QA 2ZMCA 2YJSA 3D5XA 1PXJA 3CPBA 2VWYA 5FBNC 4E4NA 2CKEA 1W0XC 5CSPA 5ETFA 4BDJA 5GZ8A 2Z60A 3TDVA 5AWMA 3CCNA 2F7ZE 3ATTA 2YIRA 4H39A 3FAAA 3BCEA 3EQFA 5I9UA 5J9LA 2O3PA 4AQKA 4I4EA 3KCFA 4AUAA 3ELJA 4XV3A 2XK6A 2FVDA 4JG7A 2C5NA 3VVHA 3C5IA 1BKXA 5AP3A 2H9VA 4FR4A 3F3TA 3KGAA 4AXCA 3BI6A 3Q60A 2FYSA 5E91A 1W2FA 3QD4A 3S0OA 3UO5A 3MH3A 4IDVA 4U9AA 3ZOSA 4PDOA 4XYFA 3U54A 5E8YA 4FSNA 1QMZA 3SXSA 4BN1A 3ODYX 3W0PA 3WOWA 2QG7A 4FV4A 4RLLA 3MPTA 3NWWA 5D7AA 2JIUA 2WELA 5IEXA 2GFCA 2B9FA 5KMJA 4BBFA 3TV7A 2QU5A 5IQBA 3ZDIA 4DGOA 4DBXA 5I3RA 4GIHA 4APCA 4EQCA 3SV0A 2ZV9A 2OKRA 2HZ0A 2ETMA 5E90A 1KE6A 4CV9A 2UZNA 1OKWA 2VTTA 3TNWA 2GQSA 2LAVA 2JDRA 3QGWA 3TZ7A 4KBAA 3Q9WA 2E2BA 4N6ZA 5E8ZA 2WU6A 2PVKA 1ZMWA 5DT0A 1OI9A 2EWAA 3GOKA 4GUBA 3OWLA 3DDQA 3EZVA 3QX2A 3TV4A 4TYEA 3HLLA 3LFCA 1KUTA 3V5TA 4O7NA 3MH2A 3PXRA 1VYZA 2CKPA 4K9YA 3FKOA 3ORIA 3G9NA 4FF8A 3RINA 4B9DA 2C5VA 5FDXA 3KQ7A 4DT8A 4IM2A 1J7LA 3FQEA 4LRJA 4LRMA 4XG7A 2UUEA 3OCGA 3MVLA 4FTCA 2AQXA 4MBJA 4D9UA 4KS7A 1K3AA 4DBNA 3VS7A 4EH2A 1KE9A 3UDSA 1YI3A 3PIYA 2GNIA 4TL0A 4IX4A 2XIZA 4UALA 3WZUA 5BYYA 3P08A 5CVGA 2ZDTA 4AZFA 5CXHA 4MXZA 5IEVA 2HW6A 5LVMA 1Z57A 4M69B 5AMNA 1QPDA 5ANGA 3W0OA 2QR8A 5K5NA 4L68A 1APME 1Y57A 4QDVA 2PVHA 3O96A 2H96A 3V5LA 3ZLXA 4KIPA 1S9IA 2QQ7A 3Q4UA 2IVSA 1XBCA 3EQCA 3NR9A 3ORZA 5FQDC 3G5DA 5BVEA 3TCPA 3V5WA 5M57A 2OJFE 3UZRA 3NDMA 1PXIA 5DEWA 5IF1A 3TG1A 1REJA 5A4EA 2PZPA 4EH5A 1UNGA 1UU9A 3C0IA 5IDNA 4F9WA 5JFSA 3BLQA 4LL0A 3RWPA 2WNTA 3GVUA 4YZDA 5CT0A 1WZYA 2HIWA 2W5HA 3ZZEA 5CLPA 3W16A 3ZLSA 3LFDA 2RGPA 1W83A 4P4CA 4O7RA 4F6SA 4FTQA 1BUHA 2WZJA 4H58A 4O96A 3H9RA 4MCVA 3FMEA 4X2KA 1PRYA 4RA5A 1Z5MA 2WMAA 2BILB 2QLUA 4O83A 4FTLA 3UMXA 4RPVA 4YSMA 1W82A 1H1RA 4IM3A 2Z7SA 4QOXA 2XJ2A 4F65A 4PY1A 5FP6A 4AW1A 2GHLA 3ORXA 3FWQA 1WMKA 3RK9A 4RVMA 5CT7A 3MPAA 2G2IA 3GCUA 3VIDA 5AFVA 4DYMA 3TKUA 5KHWA 3KREA 2ERZE 5AR5A 3VUIA 3A7GA 2WPAA 3VC4A 2OXYA 3V01A 3R04A 2PPQA 4R7BA 3U55A 3RZFA 3DXQA 3R9HA 5HEZA 1B39A 2YDKA 4O4EA 3HNGA 3UIMA 5TE0A 2R3GA 3MB7A 4BDDA 1WVYA 3EN5A 3ORPA 2V7AA 4Z3VA 2W9FB 1ZAOA 4D1XA 3CQUA 4D4SA 2ITOA 2J2IB 3AMAA 3FSKA 1X8BA 2ITZA 4JBQA 4JR7A 4TY1A 4X6RA 5FWKK 3RK5A 3G15A 3D5UA 4G6LA 3ZO1A 4CKRA 2CNUA 4UY9A 4BDEA 3U51A 3Q32A 3D0EA 2XMYA 2XUUA 5L2QA 3PPKA 4TWCA 3UVRA 5DNRA 3H0ZA 3NFGB 1YHSA 1P2AA 2J5EA 3DK3A 5IA1A 5JZJA 4IJPA 3EWHA 4OBPA 4L3JA 2Z7RA 4F0GA 5EKNA 2YHVA 3MYGA 3RWQA 3M1SA 3PP0A 3JUHA 1ZOHA 3AMBA 3OBGA 5H3QA 3IG7A 3DY7A 4NW6A 5HESA 4O4BB 2W1FA 3FXZA 5CNOA 2VTIA 4O6EA 4JG6A 4BKYA 2OXDA 4N57A 4FZAB 5JFXA 4U5JA 3DU8A 4D5KA 3VW6A 5M06A 5CF6A 3Q2MA 4QPSA 1KWPA 1M7QA 2JD5A 3I6WA 5J7BA 5E1EA 2PE0A 1BX6A 2BAKA 4LMNA 2O5KA 4Q9ZA 2X4ZA 4JRVA 3DNEA 4B6LA 1G8SA 2UZEA 1L3RE 2UW9A 3UIXA 3NZ0A 3ODZX 3R30A 3RAHA 4FTAA 4PV0A 4CQGA 4W8DA 1TKIA 5DEYA 5HHWA 4HVIA 4I4FA 4B8MA 1SVGA 3GGFA 3DBQA 3UPZA 3FMNA 3EKNA 4A9YA 3LMIA 1PXOA 4CD0A 4TTHB 5CU4A 4W8EA 4RMZA 1OKYA 4FT0A 3LXLA 4EC8A 4GUEA 4RVTA 5F20A 3FUPA 4YSJA 4ZY5A 4PMTA 2R5TA 1JSTA 3P78A 4AT5A 4IWDA 1SVEA 2VTRA 4KBKA 5EW3A 5TR6A 3OCTA 3CGOA 4WBBB 1LEWA 4QP8A 2XIKA 3MWUA 5EDQA 5CSXA 1BI8A 2GPHA 4E8AA 5C03A 4CZUA 4RVKA 3PTGA 4K18A 4BIBA 5AUTA 3RPYA 4O86A 4V01A 5IQIA 4O0YA 2R3MA 4YLJA 3CQEA 3PVUA 5J95A 4UN0C 1M14A 2X6DA 4I0RA 1L8TA 1PW2A 5AM6A 2G9XA 5M09A 2B9JA 1SYKA 5KO1A 4E6DA 3DAKA 2XRWA 4I23A 3SRVB 4AXFA 2QHMA 4K2RA 1XH6A 4C02A 4D1SA 4ZY6A 4QP3A 3K3JA 4K0YA 5A9UA 4BDIA 1PXPA 4WG3A 4E93A 5CF5A 2BKKA 1CDKA 4IZ5A 4CKIA 5ANIA 4F78A 2C3LA 4Z9LA 4ZS0A 3SXFA 1IA8A 4HVSA 3NVKI 3CTJA 4OTRA 4W9WA 2IN6A 3TWJA 3W10A 4BC6A 3MPMA 4FKRA 5LQFA 2AC5A 4H3PA 5KE0A 3GCVA 4E20A 2CSNA 1CKPA 2CGWA 4RC4A 4GKIA 4BJJB 5JK3A 1I44A 4FVPA 4HYIA 3ZYAA 2R4BA 4YTFA 1BL6A 1UVRA 4RIWA 3F66A 3FLYA 4S30A 3VQUA 4CXAA 4ZY4A 3UGCA 4UXQA 4CZTA 4Y85A 2GNLA 2YA9A 3QTXA 5CAVA 2PSQA 3MH0A 1CKIA 2IW9A 2AUHA 1M7NA 4IX6A 5K9IA 2VTOA 2XJ0A 4B4LA 5HE3A 4IVBA 4XBRA 3S1HA 1YQJA 4OTIA 2QG5A 4NYEA 4S33A 1WVXA 5IA3A 2F4JA 3U6HA 2OWBA 3Q3BA 5F4NA 3RNIA 3W8LA 2ZAZA 3NCZA 3FZ1A 3BGZA 3QWJA 2DYLA 3D2IA 3LFAA 4OBOA 4A9TA 5LMKC 4MBIA 3OY1A 4R77A 2R2PA 3IGGA 2VV9A 3W2QA 4C35A 2RL5A 3PLSA 2B54A 4L7FA 3LLTA 4BRXA 3FMLA 4XV1A 4FSWA 5DMZA 2CHLA 2WTKB 4ALWA 4ERWA 2Y4IB 4ZLZA 4ZSAA 3AKKA 4H1MA 2I6LA 2Z02A 3EKKA 4FUYA 5A6OA 3HA8A 4NCTC 5DR2A 3N4VA 4WNMA 2ZB1A 4UYNA 1PMVA 1WAKA 1OL2A 3I1AA 3NW7A 3AQVA 5IMXA 3RI1A 3DK6A 4R7HA 1IRKA 3NUYA 4RZVA 2C69A 1BLXA 5DHJA 4YGAA 5I5ZA 4YZBA 2B52A 4RX7A 3RHKA 3GC9A 4FKGA 4WA9A 4YLKA 3FXXA 2FGIA 3QUPA 4D2WA 3NPCA 4M67A 4DF3A 3QF9A 3TJDA 4BCMA 3N4TA 2WEIA 2UV2A 3ANRA 5IH4A 4GJ2A 1KE5A 3VAPA 2C6TA 3EN7A 4IZYA 5FEDA 4AT4A 4C0TA 1U5RA 3GCPA 4JIAA 3ZCLA 4CLIA 3HVCA 3EHAA 4YJRA 4XNEA 2R9SA 1Q99A 3RTPA 3I4BA 4YJTA 3EFWA 3TM0A 3R83A 2C5XA 1WBOA 2OJ9A 3OTVA 2A2AA 4ASEA 2R0IA 3KXXA 2JDOA 4O22A 2QU6A 1OL1A 1XR1A 3KRRA 5CI7A 3FPQA 4BTFA 2GHGA 1MUOA 4M7IA 4BYIA 4WNOA 4DC2A 4QTCA 5CEMA 1PMUA 3GU4A 1YDRE 2EXMA 3UG1A 4CCUA 1E1VA 2QR7A 4X21A 5D10A 4N70A 4UZHA 5FGKA 3EJ1A 2OO8X 4BR3A 5C9CA 5FRIA 4AN3A 4FSQA 3IOPA 2YIQA 4RIXA 4QTAA 5GHVA 2YFXA 4TNBA 5K3YA 3AD6A 3DA6A 4FNWA 5FM2A 3QQLA 2W1IA 2FSTX 2JLDA 4R3RA 4BWPA 5I9YA 4IAFA 3TKIA 3TT0A 4TNDA 4S31A 2BZHB 2KTYA 1IAHA 4JQ7A 1NVSA 4IAIA 4RJ6A 4U81A 4DG2E 1XBBA 4DEDA 4O82A 3KXZA 2J51A 2XCKA 4FIFA 5I9VA 4PNKA 4RVLA 2C0IA 3ENMA 3OD6X 4JBOA 4MQ1A 3NW6A 2C47A 3D7TB 3ERKA 3R1QA 3R2YA 1V1KA 5HTCA 2YWVA 2X9EA 1U54B 3UVQA 4ZOGA 1J3HA 2C0OA 3QTUA 4ORKA 4I5CA 1PHKA 3LVPA 3BU6A 2UZDA 4F9AA 1Q3WA 4KRCA 1T45A 4DHIB 5E8XA 4E4XA 3RPRA 1LP4A 3EMGA 3MSSA 4MD7E 5AIKA 2BMCA 3Q9YA 4IB3A 3WZKA 5ICPA 1Q5KA 4P90A 3SA0A 2X7GA 4FVRA 5CEQA 4GRBA 4QMYA 3R8VA 3TTIA 4AGDA 3OROA 2YDJA 3MFRA 3BL7A 3BELA 4TWPA 1XH9A 4L3PA 4D58A 5AUVA 4BCQA 3BPRA 2QO7A 3MFTA 3MV5A 2C6LA 4KD1A 5E8UA 4BWXA 3VUHA 4YJOA 4DEBA 3QLGA 2Q0NA 3DJ6A 5IH6A 2WIPA 2WXVA 2PUNA 2ESMA 3UP7A 3KRLA 4UBAA 5HNGA 5GZ9A 2RFDA 5CAOA 2R3FA 1FGIA 4NM5A 2XNBA 3VULA 3MN3A 4Q5HA 4AE9A 3V3VA 4FTOA 4L7SA 2CCIA 5FD2A 3TUCA 4ITHA 4PF4A 2ZYBA 4PMMA 4QTBA 5CEIA 4H3QA 3NIEA 1PKGA 2OW3A 1ZY5A 5AP6A 4F7LA 4FX3A 3I7BA 3PY3A 3LXPA 2DUVA 3MW1A 4KS8A 1Q3DA 4M0ZA 4LL5A 4D4VA 4EOIA 3NX8A 4AW0A 4BFMA