4W8DA

Crystal structure of mst3 with a pyrrolopyrimidine inhibitor (pf-06454589).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24 36 kDa subunit
publication title Discovery and preclinical profiling of 3-[4-(morpholin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl]benzonitrile (PF-06447475), a highly potent, selective, brain penetrant, and in vivo active LRRK2 kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4w8dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4w8dA01
2CGXA 5ICPA 3Q6WA 3EQDA 2BCJA 4AT5A 1IRKA 1PKGA 2GNLA 4QPMA 3P79A 3OS3A 2CKOA 3V8TA 4DEEA 3HAMA 1JKTA 1UU9A 3PJ1A 4YGAA 3RMFA 3W8LA 2JITA 4RC2A 5GJDA 5CU2A 5HD4A 3I6UA 3A60A 2XP2A 4DG3E 2YCQA 2WFYA 2R3RA 2VO6A 3F3UA 3QRTA 3BQCA 4J8MA 5ETAA 5G1XA 3CCNA 2PTKA 4KRCA 4LV8A 2PPQA 5EYDA 2JKMA 4QMVA 4EOKA 3VWAA 2ZM3A 4ZAUA 1H1SA 3FLSA 5BVEA 3UQCA 3U6JA 5AJQA 4MK0A 5AP5A 1S9JA 5E4HA 2C6TA 3LXLA 4I6FA 2BAQA 4JDJA 3FAAA 5JH6A 2P3GX 3FMNA 2G01A 2R64A 3F5PA 4AGUA 3UO5A 4BHZA 4CQEA 4P2KA 4EJ7A 3OOGA 3ERKA 4UMUA 2QO9A 4DEIA 5HVKA 2CN8A 4J7BA 2WTVA 4I0RA 4IWOA 3GQLA 4EC9A 4O7NA 3RK9A 5JSMA 5I9XA 1OZ1A 1U5RA 2GHGA 4G31A 3ZOSA 2JDTA 3QQGA 1GIJA 2YM8A 4FKWA 5BUIA 1KV1A 1XKKA 2PUNA 3HRCA 3QYZA 5AEPA 1B6CB 4X2GA 4FKUA 4PTGA 4I5MA 3BHHA 3LPBA 4Y85A 1APME 4L43A 2BRBA 2C6LA 1KOAA 4WUNA 4CZYB 2VTPA 4BGHA 2Z8CA 4IJ9A 3RWQA 5HG8A 4CRLA 3R2YA 3UODA 1SMHA 5IA3A 2JC6A 4AU8A 5ETCA 3CTHA 3U87A 4F70A 3F61A 4OAUC 4H1JA 3MWUA 4QYHA 1TKIA 5IEXA 1YXXA 3Q2MA 2R9SA 3ET7A 1WFCA 2H6DA 4Q5EA 4ALUA 4HW7A 3MIYA 3QZFA 4K2RA 3SRVA 3UJGA 4F99A 2BDJA 3VF8A 2W06A 2W17A 3MH0A 3SC1A 3ZLWA 2B7AA 2GS6A 4FTQA 3RJCA 1JQHA 3QBNA 2VX0A 3QL8A 4C3FA 4YSJA 3C4FA 5IEYA 3BHUA 2GQGA 3WF5A 4F0IA 3G15A 4R3RA 4R77A 3Q4TA 5A4LA 2P55A 3HX4A 2WTKC 1PF8A 4EOQA 2W1FA 4ZY5A 3DBFA 4RWLA 3LFBA 4X0MA 3SW4A 4IWPA 3UVQA 5L2SA 1JKLA 2P4IA 5IH5A 5IPJA 3ZRMA 4ZMEA 4Q9ZA 3E8EA 5IDPA 2HY0A 3CY3A 1OGUA 1VZOA 4F7JA 4DFLA 3A7GA 2E2BA 4C4HA 3TNPC 4MHAA 1HCKA 2ZJWA 2CLQA 3A7IA 3NRMA 4MH7A 1XH4A 5IA5A 4XV2A 1WVYA 5H2UA 2OIBA 4IC8A 5A14A 3PPZA 2W4JA 3UZRA 1OI9A 3NSZA 4KIKA 4AP7A 4JL9A 1Q24A 5KNJA 3C4CA 4HYIA 5M06A 4AT4A 4E6AA 4AN3A 2R2PA 2PE0A 1UWJA 2JFMA 1PKDA 2DQ7X 2X2LA 2XIYA 4XV3A 4YTIA 2QCSA 1SM2A 3R73A 1PYXA 5FBNC 4DTAA 4ENXA 4ALVA 1OITA 4TYGA 4D1XA 4KRDA 1DI8A 3CIKA 3L1SA 3KXNA 1MP8A 4ITHA 3ZXTA 2XIKA 3ZLYA 3F7WA 4FOBA 4D0WA 5C8MA 3CS9A 2ERKA 2ITPA 3PIZA 4OGRA 3ZFXA 4AS0A 3GT8A 3L9MA 2VWXA 4CT1A 4FSRA 4FGRA 4HNFA 2BDWA 3UIUA 5CT7A 3MY0A 3R7EA 4IEBA 5C1QB 4GYGA 4AT3A 3H10A 4ZJIA 5J7HA 2I0HA 2XK3A 3R04A 5K5XA 3P4KA 2Y6OA 3OY1A 3PLSA 4FTUA 4WT6A 5CZHA 4BWPA 3KGAA 3HZTA 5H3QA 4HPTE 5E8ZA 3BYOA 3BCEA 5DOSA 4YPDA 5FM3A 4GL9A 3OCGA 3UMXA 5A3XA 3VBYA 1PMUA 3WF8A 4O0TA 4TY1A 4EQMA 3CD8A 3OCTA 3TDVA 3JS2A 3IOKA 2YIXA 3F66A 3GNIB 5AR4A 4RIWB 1YXTA 3H0ZA 3H9FA 3GC0A 4IB0A 1O6KA 1OL1A 4I6HA 4NT4A 3ZHPC 1NY3A 2QOFA 4C61A 4PL3A 3SAYA 3EQFA 4EYMA 1Q3DA 4EH8A 3ZDIA 3MI9A 3F2NA 4TZRA 4MXZA 4O27B 5E8YA 5AAFA 2HWOA 4NKAA 2I40A 3QF9A 5CAPA 2BIYA 3KRWA 4RIXB 2QKRA 5LMKC 3H30A 5I3OA 4PTEA 1H4LA 5KMIA 4S32A 2W9ZB 4OBOA 2OU7A 4G3GA 3TG1A 3FMEA 3O7LB 3ORTA 4NKSA 3C4EA 4C7TA 3FEGA 3LHJA 2F2UA 3W2PA 4X3FC 2R3HA 3DDQA 3FLNC 4DGOA 2YN8A 2W9FB 4IB5A 2VWVA 2J0MB 3R6XA 4PPBA 3B8QA 3D4QA 2OXDA 4MNFA 3IECA 5FBOA 3BYSA 3EQPA 3UNKA 2AC5A 3DXNA 3UYSA 2R3OA 3C51A 3QRIA 2I1MA 3WF6A 4E26A 3LFQA 5HU3A 4F6UA 3ZTXA 2C6MA 3HRFA 4MBLA 3VW8A 3AOXA 2B9FA 2W4KA 3KU2A 3DTCA 2ZM4A 2J90A 3FZRA 4ZY6A 4ZLZA 4ZOGA 5CQWA 4E6DA 5LVOA 4YZBA 2ZOQA 3TUCA 4F9CA 5GZAA 3IS5A 5JGDA 4BDGA 5JFSA 3TNHA 5IDNA 5KBQA 3PXYA 2Q83A 3CGFA 4LL0A 1Y91A 2WMBA 3BBTB 3KMMA 3NNXA 4FSMA 4BKZA 4YLJA 4EBWA 2H8HA 4KUJA 3P9JA 4G5PA 3CJFA 3K3IA 3Q32A 3ORLA 4Q9SA 4QP7A 5BYZA 4I5HA 3D5XA 2UZEA 5HKMA 3D94A 2G2HA 2J0JA 1BLXA 3O8PA 2ONLA 4GCJA 4UMTA 4EEVA 5IQIA 3FI8A 2BDFA 4RWJA 1E1XA 3A61A 2EXEA 3IDPA 3UYTA 3RGFA 1XQZA 4X3FA 2YZLA 1M52A 1YOMA 4NFMA 4FG7A 4BCJA 5JZNA 3ZSHA 2V7AA 3G33A 1NXKA 4WO5A 4W9WA 3FZTA 5EYMA 3PY3A 3WZEA 3R9RA 2F4JA 3LXPA 2DWBA 4U79A 4FVQA 4EOSA 4Z3VA 4GT4A 2OIDA 2PUPA 4EKKA 4AX8A 3LFNA 4GRBA 2C6OA 5FTOA 1Z5MA 4RVLA 4W4YA 4E4MA 3D15A 1XH8A 4LV5A 4O22A 4QMXA 5J5TA 4Y5HA 1WBVA 5CNNA 4QRCA 3DFAA 2QHNA 5J7BA 4C2VA 3R1QA 4NSTA 4FTKA 5BVNA 1M2PA 3MBLA 3VS5A 1CMKE 2UZUE 2VWZA 3F6XA 2YHVA 2EXMA 3PSCA 4DBNA 4DLJA 4CFNA 2C6DA 3UQFA 3R83A 5K9IA 3V5LA 3KEXA 4TYEA 2EWAA 4TYJA 2JDOA 3LXNA 5FLFA 4I6BA 5CSHA 4A9UA 2FSOX 3CEKA 3I5NA 4KIQA 3KRXA 3P78A 2ZB1A 3PJCA 3D7ZA 4C4IA 5A4QA 2X1NA 5JRSA 3PXRA 2W1GA 2XK8A 3HECA 3GCQA 4U5JA 3E92A 5E1EA 5I9WA 1YHSA 3ZYAA 3S2PA 4RA5A 2HW6A 4OLIA 2J5EA 4QP6A 3OWPA 3W32A 5FGKA 2WMXA 3D5WA 1J1CA 4BGQA 3SLSA 3WI6A 3U9CA 1SZMA 4AN9A 4F9BA 1J3HA 4Z7HA 5L2IA 5CEOA 3RAKA 4YC8A 5LCJA 2R3QA 4FVRA 3QQFA 4NM7A 5AUYA 3ZU7A 4C36A 4R7BA 2OXYA 1IASA 3G90X 2WTWA 3EL7A 2BR1A 4WSYA 3NWWA 3A8WA 3HVCA 2G15A 3QUDA 3V8SA 3M11A 4I23A 4BRXA 3ZO2A 4X3JA 3FSKA 4JIKA 4E1ZA 2O0UA 2XNGA 3FBVA 4H39A 3GFEA 3T9IA 3QTQA 4QMMA 1GIHA 1H08A 1Z57A 3O0GA 3HAVA 3GFWA 4JQEA 3S3IA 4EK5A 2PVRA 3SV0A 5DVRA 3DQWA 2XA4A 2PHKA 1TQPA 2G2IA 1B39A 4WG4A 4BI0A 5CF5A 4DEHA 4AA5A 3RWPA 4C62A 2XK9A 3G9NA 4XV1A 3PXFA 5DNRA 2Y4PA 3ORNA 4PY1A 4AN2A 4EH3A 3EYGA 5L2QA 2O2UA 5BYLA 4QP1A 4O84A 4ERWA 4FT9A 4IDVA 5AIKA 2WU7A 4AOIA 5ANGA 2YLFA 3LLAA 4PNIA 1O9UA 2VD5A 4YNOA 2OKRA 3I5ZA 4ZTNA 3R8PA 3HKOA 4JI9A 4BDCA 4ZZMA 1Z9XA 4ACGA 5DMZA 5J1VA 5AR8A 4IBMA 2DS1A 4EQUA 2EVAA 3MW1A 3D7TA 5HTCA 1M7QA 2V0DA 3E7OA 5AV3A 2WTIA 2QOIA 5CY3A 5F20A 4D55A 2JKQA 4RVTA 2IZTA 5CVHA 2HWPA 5CEMA 5IQGA 4RJ8A 5DPVA 2XIXA 2ZDUA 4FKPA 5HNBA 3LW0A 3TV6A 4CTCA 5D7VA 4C33A 3ZLSA 4X2KA 1OIYA 3Q52A 5AV4A 3TT0A 3R30A 3POZA 3QU0A 4C4FA 2VTMA 3DQXA 4HVHA 1R3CA 2R3KA 4K6ZA 4TW9A 4EBVA 1STCE 2WKMA 5AM6A 5F4NA 2W4OA 4WKQA 3TV7A 4RVMA 4BKJA 1W83A 3R9OA 1OL7A 4YC3A 4L3JA 2G9XA 3BGQA 2KTYA 2IO6A 3DBDA 4I92A 2WAJA 3RNIA 2WQBA 1H1PA 4ASXA 2YITA 4HYSA 4GFGA 3QZHA 5HNGA 1PXNA 3D5VA 4KNBA 3RAHA 2XS0A 5M4UA 4FT0A 4ZTLA 2WNTA 3HA6A 4FSYA 3S1HA 3BHYA 2YM6A 4C35A 2V22A 3RP9A 4W8DA 4I5CA 5KMKA 4FG8A 4O0VA 5JQ8A 4O81A 2C6KA 4UX9A 2BZKB 4KS7A 5ACBC 5B2MA 4LMUA 5E90A 3WE4A 2X8EA 3R1NA 3JR1A 2XK6A 2OIQA 4I5PA 4M13A 3AT3A 5FXSA 2IZSA 3QD0A 4QQTA 4KKGA 4IAFA 5LARA 4IAYA 3A8XA 3WBLA 2QKWB 4R8QA 4AGDA 3QD4A 1NVSA 3R1SA 4LYNA 1WVWA 3QX4A 4M8TA 4BDDA 2YA9A 4QMNA 5CI7A 1Y8YA 3ZO3A 4MXOA 3NDMA 4TWCA 4GJ3A 4FL3A 3TIZA 3PTGA 4CNHA 3GOKA 2IVTA 5EM8A 2OGVA 4DHFA 4RIOA 3PRIA 4DCEA 4G6OA 4N6YA 2C5YA 3ORKA 1Q97A 4FZAB 1AGWA 3MA6A 3FQSA 4PV0A 3TTIA 3VW6A 4O7VA 4C8BA 4B4LA 4I4EA 2Z60A 4UZDA 4YP8A 3UG1A 1ZOHA 3V6SA 3W33A 4C34A 3NVKI 2BALA 3C4WA 4O1OA 3LVPA 3LFEA 2GQSA 3MY1A 3VBXA 5HX6A 1Q62A 2YIRA 3DK7A 3I60A 3II5A 5D7AA 3RI1A 4ACHA 4IB3A 3UP7A 3P7AA 3FYJX 2ZV7A 5AV2A 4FSZA 4F63A 5KBRA 5LXMA 4M66A 2OSCA 4ZLYA 1M17A 3KY2A 1RDQE 1ZYSA 2CDZA 2OICA 3ZUVA 4DEAA 1Q61A 2QR8A 3B8RA 4UXQA 2W1CA 3DBEA 4FBXA 2VTLA 3BZ3A 4UN0C 1YW2A 3AC2A 3OP5A 3DXQA 3R8MA 5ITAA 4FICA 4NJ3A 2WXVA 1YWVA 3KVXA 3ZCLA 4XG9A 4E5BA 3KQ7A 5FEQA 2XB7A 4L3PA 4O2PA 4F9WA 3WARA 2B9JA 1Q41A 1H25A 4XCUA 2Z7LA 3QD2B 2X8IA 5IMEA 2JDRA 1G3NA 3BE2A 1Q8UA 2FYSA 2VO3A 3C0IA 4U3YA 3MIAA 3TKHA 4LGGA 4RVKA 2X9FA 4PP9A 2XYUA 3L9PA 5ETFA 3SG9A 4HGEA 1OL6A 5AUWA 2I0VA 4FTRA 1O6YA 5C8KA 1M7NA 4IZYA 2BFYA 2A2AA 3HMIA 2IZRA 4MNEB 4OBPA 3F2RA 3H9RA 4FZ7A 4G16A 3W2OA 4AE6A 1BKXA 4NJDA 1BYGA 5EQPA 2JGZA 5LOHA 4GG5A 4B99A 3DFCB 1JSTA 2R3FA 4X7QA 5J8IA 4DH1A 4NTSA 4H36A 5KMJA 4S33A 5HCXA 4B0GA 1LEZA 3DB8A 1JSUA 4CD0A 4APCA 3CC6A 4O83A 2GSFA 5IEVA 3I0QA 3DK6A 5EH0A 4CFUA 5IUIA 1XO2B 3F5UA 1UU7A 2YCFA 5M51A 3UIXA 5AX9A 4EQCA 3PVUA 4O0XA 3ATSA 4G3CA 3DKCA 3O71A 3QYWA 4BIDA 1J7LA 4V0GB 3RAIA 3EN5A 3BU3A 4D2RA 3DGKA 4I41A 4FEVA 5H8BA 3SXSA 2C68A 1YOLA 3VULA 4J99A 4QMLA 3E64A 3KULB 3DY7A 2YFXA 5C9CA 4JQ8A 4BIEA 5B2LA 3ALNA 5KHWA 4B9DA 4PL5A 4IX6A 4HGLA 4IQ6A 4D9UA 3KMWA 4Y95A 2PMIA 2Y8OA 5JEBA 3EQHA 3UDBA 4UXLA 4K8AA 3VNTA 1ZYDA 2PVKA 2WQMA 3FPMA 4IX5A 5EHLA 5AR5A 4FV9A 5HBEA 3RK5A 5HCZA 5DFPA 5HLPA 2BKZA 3HV4A 2CNQA 3FL5A 4K1BA 3KXZA 2WOUA 2ZVAA 4L7SA 2XYNA 4H58A 2NRUA 1P2AA 1CM8A 3R63A 4UYNA 4FT5A 1BI7A 2C69A 4J97A 3UZPA 4WSQA 3BLRA 4BDHA 4NZWB 2RIOA 4UMQA 3HUBA 3E62A 4S31A 2WMAA 3ACKA 3LFFA 1NVQA 5A6OA 3DT1A 3R01A 3LLTA 2BZHB 4QMTA 1U54A 4RX7A 5HO6A 2BRGA 1OECA 2JIVA 3IW5A 3RZBA 4ORKA 5JGBA 3QCXA 3C13A 1VYZA 1WBNA 3QC4A 3GU8A 2XKDA 3PE1A 4JRVA 5B2KA 3UG2A 3UVRA 3G51A 1MRVA 1BI8A 1RW8A 1WVXA 3U6HA 4ONAA 5L6OA 3NW6A 3ORIA 3C5UA 1OB3A 3MGYA 1ZZ2A 4YJQA 1QL6A 3R7GA 4Y73A 4O0UA 4OTHA 4ZXTA 3W2CA 2JIUA 4R3PA 3BLQA 3RNYA 4EOIA 3PE2A 3VQUA 1J7UA 3UTOA 2R7BA 3HV3A 4I0SA 4EH9A 4DAWA 5AAGA 2OG8A 5L3AA 4KBKA 2GNFA 2EXCX 2XUUA 4OT5A 3DKGA 3O50A 5TO8A 4JBVA 3OEZA 4ANQA 2PZIA 2RF9A 4L68A 3W2QA 2XVDA 2UZNA 2SRCA 4CCBA 5AADA 1P5EA 2ACXA 2WQOA 2BRNA 4D5HA 2ZYBA 3QTRA 4KKHA 3EN4A 4AA0A 5GJGA 3UIMA 1UU3A 3FMJA 1PW2A 5K3YA 3SQQA 4UZHA 2OFVA 4BZDA 4HYUA 2BMCA 4OTWA 1MRUA 3H9OA 3C0GA 3DLZA 5L6WL 3QKLA 2X7OA 4IE9A 3HV5A 2YM7A 5DR2A 2XRWA 4O7LA 2QOCA 3QHRA 3JY0A 2XNBA 4ZIMA 4EWHA 4CYJA 4YLLA 2R4BA 3LQ8A 2W96B 4GYIA 4JAJA 3R7VA 3S00A 4U43A 4M7IA 4NL0A 4TL0A 4QPSA 3PP0A 4ENYA 5J79A 5DGZA 3OTUA 3JPVA 1QMZA 4GJ2A 4WG3A 4FSNA 4CKJA 5HLWA 1XH6A 3N51A 2HENA 3ODZX 3V5PA 4EUTA 3O23A 2PYWA 3EB0A 2R0IA 4MBIA 2OJ9A 5AWMA 5I3RA 2OLCA 2CCHA 3P1AA 3MESA 5C4KA 2ZV8A 5AP7A 4DT9A 4IXPA 4MD7E 4TWNA 5I5ZA 2ITOA 3QHWA 4QNYA 4IVBA 1E9HA 5CVFA 3ZXZA 2Z7QA 4XLVA 2VAGA 4QYFA 2WQNA 5EOBA 1OBDA 3HV7A 4KSPA 3DOGA 4RC4A 5EG3A 4DLIA 2C5OA 2XKFA 3RHXA 1YXVA 4I22A 1ZOGA 4FL2A 3ZBFA 3R21A 4KAOA 4EUUA 2X2KA 4EWQA 4OBQA 4ALWA 2QODA 3E7VA 4YO6A 3NUNA 4CVAA 3OFMA 5DHJA 2J51A 4RFMA 2HXQA 2VNWA 4NCTC 3FI3A 5EDPA 4XBUA 4M67A 1QPEA 3QLFA 1O6LA 4F65A 4BDFA 4QTBA 3QA0A 5J1WA 2O63A 3ELJA 4WD5A 4YJRA 4FKSA 4UWBA 1LR4A 4RFYA 4F7NA 3D5UA 4LG4A 3EFWA 3F3WA 4U45A 2LAVA 3PVGA 3BPRA 4WNPA 3LMGA 4AFJA 3LFSA 5JGAA 4OTRA 3KKVA 4EHVA 3LCOA 3F88A 4FNWA 4AXAA 3I1AA 5HEZA 5CI6A 1JAMA 1OIUA 4IAIA 3FI4A 1QPJA 2I6LA 3QUEA 4NH1A 1V0PA 3M1SA 3QRJA 5LQFA 2B52A 3EFLA 4HCVA 1H0WA 4O2ZA 4FIIA 2PULA 3PXQA 1T45A 4MCVA 3CPBA 1LPUA 2HYYA 3COMA 4IWDA 3KXMA 4KSQA 2XM8A 2WMRA 4LUEA 4RJ7A 4IX3A 4CCUA 3Q53A 4PX6A 3L8SA 3PVWA 3Q4UA 5E8XA 5F1ZA 1IAJA 3FLYA 3TJDA 3LFDA 4AUAA 1GY3A 3EYHA 4E8AA 4BDIA 3IKAA 4A9TA 2XF0A 2W1IA 2Y6MA 4EOOA 4YZNA 3SRVB 2R3LA 3D0EA 3G9LX 4CFWA 5F9EA 1G8SA 4XG6A 3HMMA 3FMMA 2PZRA 4N4SA 4XG7A 3HRBA 2XCKA 4FIHA 5E7RA 5T3QA 2Y9QA 3TKIA 4EOPA 2VRXA 4PNKA 3OROA 4P5ZA 4BDBA 4UMRA 1KE7A 3LZBA 3PA4A 3EOCA 2UW3A 4IM0A 5AP3A 3E3PA 4M15A 5FQDC 3KB7A 4AW1A 3CR0A 1OPLA 2JAMA 4L45A 3ROCA 3HL7A 3WZDA 1FVTA 2PE1A 3I81A 4YBKA 1VR2A 2R3JA 3ZONA 2PWLA 3NEWA 4IADA 4GG7A 4MXXA 4RRVA 1H1QA 4AW5A 3VUGA 4RX5A 1F3MC 2ERZE 4I21A 5J95A 5L6PA 2OBJA 2YM5A 2X0GA 3NUSA 3F3TA 5HO7A 1OKWA 3OBJA 4A9RA 2R3MA 4XP3A 5HU9A 3EIDA 2P0CA 3IG7A 3IGGA 3WZKA 3NPCA 5HESA 3R9NA 4KIKB 4IM2A 3ATTA 1PMNA 1BL6A 2GFSA 2QOLA 5ANEA 2RG5A 2AC3A 3TIYA 2QURA 3THBA 4OTQA 3QCYA 3Q9XA 5BVFA 4EH7A 4QP3A 3T3VA 5HHWA 1PXMA 4E6QA 2HIWA 4QD6A 5IA1A 1SYKA 2FSMX 2GHMA 4JS8A 4GU6A 4D9TA 4BCKA 2C0TA 4B6LA 3QUPA 2C0IA 4IJPA 1OUKA 4R1YA 2CKEA 2Y0AA 1OKVA 4C58A 5L2TA 5M09A 3GXLA 4HNIA 1KE8A 3FZPA 3SOCA 5I9YA 4FZFB 5CEIA 4GKIA 5E8TA 5KX8A 4A7CA 3UPXA 5AR2A 2R3NA 5CU4A 4ZTHA 4RIYA 3MV5A 3QALE 5H8GA 4O21A 3UIBA 3EKNA 4L8MA 4FK3A 3C4ZA 5TE0A 4B8MA 1BL7A 3C9WA 3O96A 4QQCA 4MD8E 3EHAA 3JVSA 3R8UA 5IH4A 5L4QA 2YDJA 4DFXE 1MQ4A 3G6GA 4M0YA 4YZDA 4AF3A 5BVOA 5JT2A 3VN9A 2OZOA 2CN5A 1UNHA 2PVMA 3O51A 5CVGA 4Q5HA 4I93A 3FLWA 2WTDA 4FIGA 2B53A 5HO8A 3U51A 3ZRKA 3IW6A 5CAOA 2OO8X 2HAKA 4AAAA 2PVJA 4RIXA 4D58A 2F7EE 1IEPA 5HICA 5IISA 5IUHA 1F5QA 2WMWA 3EMGA 3QZGA 5GJFA 2CNUA 2BAKA 2WTCA 5HVYA 4KWPA 2RFEA 4KBCA 3VAPA 1GZOA 1Q8ZA 3MJ2A 3P86A 4AGWA 3DLSA 2YCRA 4ZSJA 5KE0A 4WNOA 3VC4A 1YRPA 3VUIA 4U3ZA 3PJ3A 2QOOA 2XEZA 4RPVA 4XX9A 5EHYA 5AAEA 5J9YA 3NZ0A 2XNMA 3C5IA 1WBOA 3BEGA 4CMUA 4BZNA 2CKPA 4DN5A 3GUBA 3CBLA 2OZAB 5GNKA 4UWYA 5AP2A 1R78A 1FOTA 2BKKA 5JFWA 3FLQA 4OR5A 3BX5A 4MD9E 5A4EA 4L7FA 4NK9A 2KULA 4OUCA 3ZS5A 2PMNX 4J52A 2GNHA 4NIFB 5M56A 1Q8YA 2ITXA 4UALA 4G9RA 4XV9A 5HG7A 3ZSIA 1ZLTA 5DEWA 3FXXA 3ORZA 2JLDA 3HMNA 3EJ1A 5E8SA 4JBOA 3R7OA 2ITZA 4KINA 5ANIA 3FKNA 5TKDA 2W99B 1JKSA 2W5HA 5DT3A 1GIIA 3F5XA 3F7ZA 4ZJJA 4MBJA 2XM9A 4JX3A 5IU2A 3LM0A 4XJ0A 4Y8DA 4TXCA 3PVBA 2JIIA 3W2SA 4K9YA 2F9GA 2VWUA 2B0QA 4AZWA 4PTCA 3PA3A 5HZNA 2AYPA 4ZS4A 5LMKA 3UPZA 2RL5A 2W5AA 5IA4A 5IQDA 3DKOA 3RPVA 4LOQA 3A4PA 3SA0A 2FVDA 3FLZA 3RTPA 3AD4A 4FKLA 3NGAA 4RC3A 2Z02A 2OH0E 4OT6A 4TTHB 4FV5A 1OPKA 2BRHA 3NLBA 3HNGA 2O8YA 3A4OX 4CKIA 2VTIA 4QNAA 2ZV9A 3DKFA 4ZSLA 3KXHA 2XIRA 2BZIB 3KRLA 2C4GA 3ULIA 5L2WA 1OPJA 4TT7A 3AGMA 5AR3A 2CKQA 5I9UA 4AFEA 4BF2A 4NTTA 4X21A 1FQ1B 2AUHA 3NYXA 2NO3A 5D11A 1B38A 3ALOA 3U54A 2XKCA 2UUEA 3KN5A 4N0SA 4YPSA 3EQCA 4NW5A 3E8DA 3A62A 4DFZE 3NNWA 3KRRA 4MQ1A 2A27A 3VS4A 1T46A 3F2AA 2WPAA 5CS6A 4AA4A 4FEXA 1ZMWA 2F2CB 3ROYA 3R9DA 1H26A 5K4IA 4RGJA 2J0KA 5KHXA 3EH9A 4N6ZA 5KMOA 5CXHA 4NWMA 4MF1A 4G9CA 3MTFA 2Q0NA 3GCVA 2VZ6A 4H3BA 2Z7RA 5AUZA 4QMOA 3CQWA 3P7CA 1URWA 3PWYA 4L42A 3Q96A 1W84A 4E5AX 1Q5KA 4GIHA 3N9XA 3OVVA 5D41A 3AQVA 4FV3A 4I3ZA 3LCSA 3WOWA 4DEBA 1K2PA 3MVHA 3E88A 2YDKA 5LMAA 4C2WA 4QYEA 1URCA 4L53A 2IJMA 3LE6A 3GU5A 3RVGA 4AW0A 4W4VA 4GMYA 4F6SA 1W98A 5JKGA 5GHVA 4JVGA 1GOLA 3OWKA 4OTDA 2A1AB 1HOWA 4JRNA 3P23A 5CEKA 2UVXA 3HLLA 3PFQA 4CV9A 4ZTSA 3QWJA 2ETRA 1QCFA 5CSPA 3GC7A 4ZK5A 4A07A 1BUHA 5EM7A 1ZYCA 4Z16A 3DXPA 3SW7A 3K2LA 2GNIA 4L46A 4ZTQA 4UY9A 4YJUA 1A9UA 3CPCA 4R5YA 3VBVA 2X8DA 2YDIA 2YLEA 5C03A 3BHVA 4ANLA 2OJJA 4LRKA 2WMQA 2H9VA 5CF4A 3GC8A 2J4ZA 4BCMA 1W7HA 4CFFA 5D12A 4MVFA 2YJRA 3AG9A 4WBOA 3MTLA 3EZVA 4ID7A 1E1VA 4XRLA 3OTVA 4IH8A 3EQGA 4CG9A 2XMYA 1JWHA 4D28A 4D2TA 3E5AA 1ZY4A 2WO6A 1G8AA 4EK6A 3OW3A 2OH4A 3RHKA 3SXFA 4O1PA 3V8WA 3VRYA 4E4NA 3S95A 2R3PA 3REPA 4USDA 3LJ0A 2PUUA 3PJ2A 2C6IA 5BVWA 1H8FA 4QMUA 3UOKA 4BYIA 4RQVA 5IA2A 4WRSA 3SOAA 4UMPA 1FGIA 3QGWA 1NT2A 2BHEA 4IM3A 2GQRA 3F69A 1YXUA 2VTJA 3O8UA 3Q3BA 4A4OA 3KF4A 4AZVA 1A48A 1K9AA 2PK9A 2PZ5A 3FMDA 4ERKA 3OCSA 3Q04A 1ND4A 3MFRA 1Q8TA 2GU8A 4PDPA 2C6EA 2QOBA 1FPUA 2XCHA 3HUCA 3UMWA 5EQYA 4C3RA 2ITQA 4JOAA 4O7YA 2Y4IC 3FJQE 4HCTA 3ZUUA 4AOJA 2ITVA 2GS2A 3FUPA 2CGVA 2IG7A 4BCNA 3ULZA 4O7RA 2P2IA 3AC4A 4R7HA 2IVSA 4WRGA 4HOKA 5CX9A 3GQIA 3OD6X 4USEA 1M2RA 3MFTA 3ID6C 2QI8A 4TYIA 2PVLA 3D7TB 4EH6A 5LMBA 4M69B 3NCGA 4LGHA 2BAJA 3EZRA 5KZIA 3VJNA 5M44A 2G1TA 5FUTA 1REJA 1I09A 5DRBA 2VGOA 2VWYA 1ZWSA 4GEOA 1BMKA 5AX3A 3K5UA 3P0MA 4YJVA 3VS3A 3V01A 4CMTA 3JUHA 4CTBA 4E6CA 1TQIA 3NUYA 4EH5A 5HE3A 2BTRA 1R39A 4XS2A 3DNEA 1KUTA 1H07A 4FTLA 3UO6A 4APPA 5BQ0A 4I6QA 1U46A 2BROA 1P14A 4NEUA 4O7WA 4A06A 3BGZA 1KE6A 4FNXA 4C57A 4XG4A 3MSSA 4GIIA 4XG2A 3P5KA 4C0TA 4FV0A 4XP0A 3Q60A 2O64A 2R7IA 4FSUA 3PY1A 1NW1A 3JXWA 5JN2A 3QCSA 4O7TA 4PF4A 4D4YA 5KO1A 5CU3A 2C3JA 3T8OA 3GBZA 4A9SA 2B9IA 3PSDA 2IPXA 4BZOA 4DG0E 5CLPA 3GP0A 1SVEA 1PXJA 1OL2A 3W55A 2UZWE 5EDRA 4QP2A 2ETKA 2Y4IB 3PWDA 4U80A 4GT3A 3KCFA 5FG8A 4PMPA 5IA0A 2YIQA 1XBBA 3TL8A 4O0SA 3C0HA 2JKKA 1WBWA 2QC6A 4CZTA 4FEUA 5JMSA 5GIPE 1P4OA 2GDOA 2EB2A 4QT1A 4YURA 4YBJA 3ANQA 5EFQA 3HDMA 2F49A 3SHEA 1PMVA 4FK6A 1GZKA 4ITJA 1PXIA 4FF8A 3Q5ZA 4ZTRA 5HVJA 3TZ8A 3ORPA 3DBQA 4EKLA 4CGAA 4BBEA 4ZSGA 4DFUA 4JXFA 3A99A 2J6MA 4C59A 2O5KA 3EQIA 2VO0A 3PUPA 3U6IA 2BFXA 3IOPA 3QX2A 4FTNA 4JR7A 3RCJA 3MB6A 5AV0A 2XK4A 4ARKA 2QNJA 3S0OA 1FMOE 4KBAA 1NA7A 3ZC6A 3W16A 3HDNA 2UW6A 4S34A 4TRLA 5BVKA 2R3IA 4IACA 4WOVA 2PU8A 3V51A 3WYYA 4LOPA 3PSBA 2HOGA 4XG3A 3N4VA 3MPMA 2WMVA 2C1AA 3QTXA 4I24A 1YDTE 4FTMA 5M08A 2WELA 4OTPA 4EL9A 4J98A 1HCLA 1PHKA 1Q99A 5J87A 1U59A 4TNBA 3BGPA 5FRIA 4MQ2A 4ZJVA 4TYHB 5AP6A 3EQBA 2YERA 4L67A 4X6RA 3TNWA 3S4QA 4ASDA 3Q9ZA 2WEIA 3NX8A 2YAAA 3DJ6A 4LI5A 4W8EA 3PRFA 5HGIA 3IK3A 1AD5A 3V5WA 3TTJA 4D2SA 1BX6A 2C47A 5KCVA 3FC2A 3I6WA 3QZIA 1IR3A 3WIKA 4BL1A 2XNPA 2P2HA 3LCDA 4DTBA 2GCDA 4FOCA 4GVAA 1OKYA 5DEYA 2W7XA 1GZNA 1XH5A 2C3KA 3FI2A 3Q6UA 3RBWA 4QTEA 1L3RE 3VS1A 5HIEA 1XJDA 5FEEA 4CXAA 2I0YA 4IZ7A 5EKOA 4F1OA 4BBMA 4MNEA 3OWJA 4CFVA 3OHTA 4IVAA 1UNLA 1R0EA 3LJ2A 4DGNA 2I0EA 1J7IA 3L9NA 5EKNA 3G0FA 4FZ6A 4FVPA 4PPAA 1OMWA 1UNGA 3EKKA 4V04A 4DH5A 3G6HA 3BU5A 3DPKA 3COHA 3HP2A 5CWZA 3TV4A 1Y8GA 4AACA 4DBXA 1V0OA 4XUFA 4RQKA 2UW5A 3LJ1A 1EH4A 2ZMCA 1Y6AA 5LVMA 4F7LA 2PVYA 1WZYA 4KKEA 2JBOA 5FDPA 2W5BA 2E9OA 4QOXA 2ITNA 1SNXA 3U4WA 3KREA 3R0TA 3RM7A 4R3CA 4BVUA 4IAZA 3W8QA 3HP5A 1VYWA 4CYIA 3AD6A 3DAEA 2UW7A 4H1MA 3KC3A 3KULA 4DFNA 3FY0A 3BYVA 3M2WA 3ZFYA 3JYAA 4KIPA 3BQRA 4QMSA 5EYKA 4XP2A 4EK3A 2XKEA 2E9PA 3KL8A 4BN1A 4G3FA 5BNJA 1CSNA 4JG7A 2BUJA 3OY3A 4IW0A 4P5QA 4ZS0A 2HZIA 2P33A 5T68A 3TCPA 4EHGA 3OF0A 4NM3A 1P4FA 3DTWA 4XH6A 4FKIA 3EFKA 2VTNA 3UNJA 3TI1A 4ITIA 5HORA 4RZWA 3LQ3A 4QO9A 5E8UA 2YAKA 3QTUA 2W0JA 2VTAA 2VWWA 4AE9A 4YJOA 3OXZA 1FINA 4YLKA 4FIJA 4TWOA 4HVGA 2WIHA 4XMOA 3A7JA 4E4LA 3JVRA 3BLHA 1W82A 4JAIA 4BR3A 2OF4A 1UKHA 2QOKA 3FHIA 4JDKA 4XOZA 4U42A 3I0OA 4RSSA 2ZAZA 3COKA 4CSVA 3QCQA 1PMEA 3ENMA 2WU6A 4YHJA 4UB7A 4RLKA 3FQHA 4A9YA 4BCIA 2QO7A 2QHMA 3MS9A 3O7LD 5E9EA 3CXWA 3QRUA 5AR7A 5CAUA 3TM0A 2FGIA 2EUFB 3NUXA 5KKRB 4FSTA 4BIBA 3BKBA 2QLUA 2VTTA 4NM0A 2W1EA 4EK4A 2YWVA 2V62A 3D14A 2W1ZA 3CKWA 4DINA 5JRQA 3MH3A 4QMPA 4FUYA 2E9UA 5CT0A 4E93A 2XZSA 4BC6A 5EI8A 5B7VA 3Q5IA 3R1YA 4FNYA 5AP4A 3QKKA 4CLJA 3OCBA 4J71A 3TACA 3HMOA 2CCIA 3KVWA 3QKMA 3DK3A 1F0QA 5D9HA 3RPRA 3ZUTA 1J91A 4CG8A 2W1DA 4M84A 3LXKA 3NUAA 3VHEA 4JX7A 3DU8A 4Z55A 4YZ9A 1JLUE 3MVMA 2QR7A 3RPYA 1PXOA 4OTGA 4HCUA 4XBRA 5ANDA 5DBXA 3BYMA 3QTSA 4HGTA 5DT4A 4E3CA 4O0YA 4OTIA 1ATPE 4GKHA 1JSVA 4NYEA 4D1SA 5EW9A 3TEIA 4O0WA 4RA4A 2IVUA 1QPCA 3NR9A 3D2KA 4MWIA 4J96A 3QQUA 5DWRA 2RFDA 4I20A 5EM6A 2XBAA 3FL4A 3LFAA 4IAAA 5H8EA 5I9ZA 2CNVA 1UKIA 3O2MA 4QP4A 1Q3WA 4YZCA 4OAVB 1GJOA 1FGKA 2GS7A 4IVCA 2YIWA 3ZO1A 5IKWA 2G2FA 1NVRA 5LWMA 2Y7JA 4L52A 2FB8A 2XNEA 3VS6A 1K3AA 1ZZLA 2FSLX 2QOQA 3A2CA 4TN6A 4CMOA 4C3PA 1YI4A 1CKJA 5F94A 5IUGA 2PE2A 3L9LA 3SG8A 4Y83A 3U9NA 5E8WA 5KMMA 2YZAA 4IIRA 1YKRA 3UOLA 3TDWA 4R5SA 5EOLA 4EYJA 1RQQA 3IW7A 4UEUA 3VUDA 5M4IA 3HA8A 3VJOA 2ITYA 2QOHA 3LM5A 5CAVA 5BYYA 2XK7A 3CP9A 3IONA 3RPSA 4U9AA 5T6KA 3VVHA 3M42A 3BE9A 3AC8A 4O6EA 3F5GA 4U41A 5CNOA 3IW4A 5AIRA 4WNMA 3HMPA 4HPUE 4TWPA 5A4TA 1ERKA 5HCYA 4D4SA 4J53A 3VBWA 4CT2A 5TR6A 2BILB 5BUJA 4E4XA 5CSVA 4BYJA 3AMYA 4V05A 3V5JA 3AT4A 3NS9A 2QVSE 1H01A 2DYLA 3PYYA 5IQCA 4M0ZA 3FZ1A 3TUBA 3RM6A 4YJTA 4KS8A 2BZJA 3UOHA 3V3VA 3PPKA 3R71A 2OF2A 1YOJA 3DDPA 3EL8A 3KRJA 3VQHA 5HE0A 4E20A 2B54A 3QRKA 1GAGA 2CLXA 1JNKA 3IO7A 3QAME 2FSTX 3G2FA 5C27A 4DH7A 3CJGA 3A7HA 3BIZA 1TQMA 2W05A 3BI6A 3QQKA 4FZDB 4J95A 4QPAA 4D2WA 5FP5A 2YEXA 3E87A 1WMKA 4P90A 5CEPA 3RALA 5FP6A 3ZC5A 3AXWA 3DNDA 4IC7A 1H1RA 2NRYA 3UC4A 2X6EA 4RZVA 4XLIA 1XR1A 4Z9LA 5F95A 5DIAA 3ZEPA 2X2MA 4DFBA 4QYGA 4V01A 1CKPA 1QPDA 2WEVA 5GZ8A 5EK7A 5EI6A 3MVLA 3IQ7A 4PPCA 5FD2A 4LL5A 4M12A 4MEDA 4RJ3A 4BHNA 5KMNA 4BCOA 4AOTA 3K54A 3Q9WA 4X2NA 2J0LA 4RWKA 2A0CX 2DUVA 2RG6A 2ZV2A 4FEQA 4WHZA 5DG5A 5HIBA 4X2JA 3ITZA 2X7FA 4II5A 5M4CA 4CEGA 3CLYA 4FSWA 5J9ZA 4A4LA 3DAKA 4F64A 1JOWB 2J9MA 3KFAA 4YNEA 4QQJA 4G2FA 4NCTA 2FUMA 5I0BA 3PIYA 3KA0A 4FV4A 5FXRA 4Q2AA 2F57A 4P7EA 2B4SB 5A4CA 5LVPA 4I0TA 3GCUA 4ASEA 4W4WA 1SNUA 3LFCA 5LVLA 4O91A 3PZEA 2YJSA 4NW6A 5HD7A 4BTFA 4DE4A 2CGUA 3W10A 1PY5A 3DV3A 3G0EA 4ZZOA 2OXXA 2BIKB 4UV0A 3RCDA 3LQ5A 2UZTA 4ACCA 5AUVA 4FYNA 4XNEA 4LRMA 2CPKE 3PJ8A 3E93A 3AC3A 5LVNA 5K5NA 2XJ2A 2BHHA 2VNYA 2YABA 4YTCA 1V1KA 1A06A 3OBGA 3NW7A 4GK3A 3COIA 4DEGA 3N4UA 4I1ZA 5E91A 4LMNA 2OWBA 5IMXA 4MF0A 4DH3A 4BKYA 2VUWA 4BB4A 3OG7A 3GCSA 4HZRA 4FSQA 3ORXA 1KE5A 3TZ7A 4C4JA 4JG6A 4M68A 4MX9A 3NYNA 4HGSA 4XYFA 3R7YA 5A6NA 2ETMA 2WQEA 5G6VA 3ZEWA 4BI1A 4DGGA 3BWJA 1IA9A 5IH6A 3WILA 4O86A 4RJ5A 2UW8A 4MYGA 4FNZA 3RKBA 1V0BA 3NAXA 4FV6A 4GV1A 3TZ9A 4BWKA 3LIJA 4DC2A 3VUTA 1FVVA 3H3CA 4AWIA 5M07A 4EOMA 2VX1A 3GCPA 4IZAA 2CSNA 3AGLA 5LCKA 3OUKA 5CSWA 4JIAA 2PSQA 4RIWA 3PG3A 5E8VA 4D4RA 4EHEA 5A9UA 3ZH8A 3FWQA 1Y6BA 3HEGA 2X9EA 5HLNA 4BBFA 4FA2A 2OJFE 2PVNA 3NAYA 3QQJA 4LGDA 5ANJA 3SD0A 2RFNA 4QP8A 2WTKB 4FIFA 5ACKA 5IG1A 4FEWA 5IQBA 1LEWA 1YI6A 2O3PA 3OT8A 2FA2A 2FO0A 4LOOA 3GEQA 4NM5A 2UW0A 3E8CA 2VTRA 4QMQA 5FDXA 1SVHA 5AUUA 3TWJA 5D1JA 2WMUA 4KB8A 4RIYB 2IZUA 5FM2A 3FMHA 3LMHA 5DN3A 3OXTA 3C50A 1LUFA 2X4FA 2ESMA 3LOKA 2UZOA 3VS2A 1OVEA 5EQEA 3AMBA 3TZMA 1JBPE 4YR8A 3IDCA 4BTMA 4QYYA 4CV8A 2NPQA 4YMJA 4FC0A 2I7QA 1MQBA 4J8NA 4FODA 3NYVA 4HVSA 3CE3A 3LMIA 3ZRLA 4RX9A 3GGFA 4FTTA 3FMKA 4PRJA 3W18A 2C1BA 3R8ZA 2XH5A 2ITUA 4PUZA 4XOYA 4ZP5A 4W4XA 5DI1A 3F82A 2WGJA 3ZSGA 2C30A 3WF7A 3BV3A 3V04A 5AP0A 4BFMA 4F4PA 2RSVA 4K0YA 4KIOA 1PYEA 4R6VA 4RBLA 3ZDUA 5KMLA 2ONLC 2OZAA 3PXZA 2V55A 2WMSA 3CQEA 3OOMA 4H3QA 3SX9A 4FKQA 3R8LA 4DGMA 1MRYA 4NIFA 5EI2A 2JEDA 3WIGA 5C01A 4DH8A 4YU2A 5HTIA 3E63A 3R28A 4JBPA 3PY0A 3QC9A 4BCQA 3AD5A 4F09A 2VX3A 5A46A 5EYCA 5JFVA 2EU9A 4YJNA 3QWKA 4DEDA 4QTDA 3QFVA 1YHVA 4YTHA 2ZDTA 1OBGA 3VS0A 4L3LA 3ZMMA 3H4JA 2FH9A 3PZHA 4XEYA 2WZJA 1ZMVA 4JG8A 1ZARA 2BVAA 3Q9YA 3RPOA 3ZBXA 5M53A 4C02A 2IW8A 4AW2A 2JAVA 4IX4A 5CU0A 3OW4A 5HE2A 3FZOA 1GZ8A 3CGOA 3NYOA 2X7GA 3OC1A 5I9VA 4MTAA 4FTJA 2R3GA 3UGCA 4BCPA 4KABA 1WCCA 5IZFA 3DJ7A 5FTQA 3KN6A 3P08A 4UBAA 4B8LA 3PXKA 3TN8A 4C4GA 4QTAA 3ZO4A 2OW3A 3MH1A 4U40A 4ZLOA 3CTQA 5CU6A 4EZ5A 2W1HA 1YQJA 2YISA 4NUSA 3VBQA 2F7XE 3GOPA 1IA8A 3PLAE 3ZFMA 3VHKA 3FKLA 1KSWA 1H27A 5FXQA 1LP4A 4ANSA 4GU9A 5IQFA 3UQGA 4FTCA 2XEYA 2PZYA 3C4XA 3FXWA 3RINA 3VUKA 1JPAA 1XH7A 1MUOA 4YHTA 1CDKA 3NCZA 4X3FB 3ZZWA 2J2IB 4D0XA 2OFUA 2WIPA 5ANKA 4L01A 4Z7GA 4ZY4A 4O7ZA 4Y72A 3I79A 4FTAA 3MH2A 3FE3A 4QP9A 2QG7A 1ZOEA 1PJKA 5GINE 4NU1A 4PMMA 5EHOA 4PMTA 4QTCA 4FKTA 5IQEA 1L8TA 5CEQA 2X81A 3OEFX 4FKGA 1ZAOA 4D4VA 4AZSA 1DAWA 3NW5A 3CD3A 5DR6A 3DAJA 4DCAA 3DBCA 4E7WA 4JBQA 3GU7A 4FL1A 3K5VA 4RWIA 4YZMA 2NNWB 3SDJA 4JLCA 3PA5A 3AC5A 2YACA 4LQMA 4BDKA 4F1MA 3R8VA 3O17A 4EZ7A 5C8NA 4U6RA 5CENA 1M14A 4W9XA 5C26A 2B55A 4CKRA 4TPTA 5M4FA 1XH9A 2UVZA 4YJSA 3HV6A 4H3PA 2PY3A 1DS5A 3GU6A 5IF1A 4IFCA 1AQ1A 4O82A 4S2ZA 2QQ7A 4PP7A 3F3VA 4IB1A 4RJ6A 4I4FA 1VJYA 2IW6A 4O38A 4YC6A 2E9NA 3NNUA 4ACDA 4ZTMA 2X39A 3A7FA 4U8ZA 2GFCA 4MWHA 3OZ6A 5CYIA 1GNGA 1PXPA 1R0PA 2GNJA 2UW4A 4MXYA 2GNGA 2Q0BA 2C0OA 2UZVA 4LUDA 4G3EA 2YM3A 4XRJA 4EHZA 2QD9A 2C3LA 3FSFA 3EN9A 4N70A 3CTJA 2QONA 3IPHA 4IVDA 5EW8A 1J1BA 4FG9A 4YUQA 3UBDA 3IW8A 4C38A 4GFMA 3I7BA 5AA9A 4RG0A 2J50A 4LRJA 2IWIA 4AZFA 4CQGA 4S30A 4E5WA 2BPMA 1OIQA 3QTIA 5IQAA 3Q4ZA 3GI3A 4KD1A 3RAWA 3SVVA 4GS6A 2JKOA 3E3BX 4O6LA 3FC1X 3PPJA 4BTJA 5BX0A 1CTPE 4FYOA 3MPTA 2JBPA 4TKSA 3MJ1A 4ANMA 4JDIA 2VV9A 4EC8A 3TUDA 3UZTA 1OKZA 4AG8A 3W2RA 4C37A 3ZM9A 4UWCA 4D5KA 5HBJA 3R2BA 5H9BA 4IZ5A 3WF9A 2C5NA 5KZ0A 2XIZA 5K4JA 3NUUA 4JJRA 4U97A 5FTGA 2BRMA 3EWHA 4F0FA 1I44A 2C5VA 2JFLA 3F3ZA 2PUIA 1ZRZA 4F08A 4AGCA 5HX8A 3UOJA 5LWNA 4UYAA 3TKUA 4G17A 3NNVA 4RX8A 3R7UA 5CALA 1U4DA 1ZXEA 3LAUA 4M14A 2XBJA 4FT3A 2BTSA 1PRYA 5DT0A 4M97A 1DAYA 3KMUA 4FKJA 4U0IA 3MPAA 2CJMA 5K0KA 4QMYA 4R1VA 1XWSA 4M69A 4ZZNA 2R5TA 4B7TA 2WTJA 3DS6A 1ZYJA 1FMKA 1M2QA 5EW3A 4DFYA 3TNQB 3DCVA 3MN3A 4JDHA 4WIHA 4O96A 5D10A 3TNIA 2C3IB 2WB8A 2GPHA 3QTWA 3MVJA 1OM1A 4DT8A 4L44A 4RT7A 2Z2WA 1YI3A 5DA3A 4FKOA 3L8PA 5DYJA 3IDBA 2VN9A 4GUBA 4M3QA 2R0UA 2XNNA 4L00A 3FXZA 5CF8A 3CY2A 4RFZA 3NMUF 3NIZA 3G5DA 1OIRA 2O65A 4IHPA 3QQHA 5ETIA 2GTNA 2HZNA 3R9HA 2IN6A 3D83A 3GC9A 3LCTA 4HYHA 4WG5A 5HG5A 3QXOA 5HIDA 3W1FA 4U44A 4E73A 3B2TA 5M55A 4FV1A 4ASZA 2VGPA 3SKCA 3SGCA 5GZ9A 3QGYA 3MB7A 5BVDA 5M57A 2X4ZA 2OJGA 2H96A 4H05A 1YDSE 4RLLA 2C5XA 3KK8A 3BEAA 4D2PA 3AT2A 5FEDA 3KCKA 2OJIA 5BPYA 3V5QA 4ZSAA 5AFVA 1XHAA 3FPQA 4PDSA 5E1SA 4BY9E 4ZMFA 4JR3A 2JD5A 3VO3A 2A19B 4O0RA 2F7ZE 3UE4A 4CLIA 4EJNA 4P4CA 3R7IA 4IDTA 3MDYA 2X6DA 3MFUA 2IW9A 2B1PA 4ANBA 5CAQA 2PMOX 3IGOA 3GENA 1YHWA 5L8JA 5HE1A 1FVRA 2LGCA 3ENHA 4MXAA 3KXGA 3DJ5A 3P7BA 3VIDA 4L6QA 4PMSA 1S9IA 2HW7A 3EN6A 2CHLA 4BTKA 4EOLA 3FYKX 3FDNA 1JVPP 4K11A 3JY9A 4FE2A 3NVMB 3OUNB 3WYXA 3QXPA 2YM4A 4OTFA 3GB2A 3K3JA 2J7TA 3C7QA 2YCSA 2XNOA 5AUXA 5HG9A 2XJ1A 4IMYA 1REKA 2QU6A 2ZB0A 3ZZEA 4F0GA 5EDQA 3AMAA 1H0VA 3CQUA 5AUTA 3OXIA 1KWPA 3D9VA 2VTOA 3ANRA 1U5QA 4FKVA 5BMSA 3H0YA 3BWFA 4MKCA 5DLSA 3ZLXA 2PL0A 3O8TA 4PDYA 4K18A 4R78A 4IWQA 1WBSA 5HNIX 2B9HA 5L8KA 2OK1A 3KXXA 4XG8A 3DB6A 5TF9A 2UVYA 4F7SA 2OI4X 4WBBB 3FQEA 2UZLA 3UNZA 2QO2A 3WE8A 5AP1A 4ANOA 2REIA 3B2WA 4CRSA 4GK2A 4QQ5A 4TYHA 3BHTA 3DZQA 4RJ4A 5AM7A 1X8BA 5A54A 5AA8A 2EB3A 4A4XA 3I7CA 5CQUA 3FY2A 4R7IA 5HI2A 4EORA 1WBPA 3ETAA 3GU4A 1WAKA 4PWNA 1W0XC 4DITA 1RJBA 5HQ0A 5CXZA 4FV8A 3PIXA 4WA9A 5CSXA 5BMMA 1UV5A 2HCKA 4Y46A 4FMQA 4JNWA 2WD1A 5I4NA 2PVHA 3UC3A 5FWKK 5CANA 4GFOA 4FIEA 4BI2A 4DGLC 3FV8A 1H28A 3CSVA 2GTMA 3MA3A 4QMZA 3EFJA 4BDAA 4K77A 4EH4A 3D2IA 5EM5A 5ANOA 4F1TA 4FV7A 4YTFA 2ZM1A 4FTIA 4PDOA 2HELA 3TJCA 1Q4LA 3BRBA 3BBWA 5CTPA 3L8XA 1XBCA 1H00A 2ITWA 4C4EA 3LCKA 5HBHA 4ZEGA 4BCFA 3VS7A 5CZIA 3ORMA 3OT3A 5DRDA 3T9TA 3QTZA 2QG5A 2PVFA 4G34A 2YIYA 4GVJA 4MXCA 4IAKA 3UP2A 2HK5A 4ANNA 4Y5QA 1OL5A 3QQLA 2ITTA 4K33A 3U55A 5IQHA 3HYHA 4FR4A 4FT7A 4V0GA 4F9YA 5KKRC 4EI4A 3T3UA 3VF9A 1DM2A 2VWIA 3HGKA 1OUYA 4BDEA 3R00A 2IVVA 4DG2E 4PQNA 4EH2A 5DE2A 3MY5A 1SVGA 4GSBA 1ZYLA 2VO7A 3PG1A 4U7ZA 5CASA 4CFXA 4EK8A 3UVPA 2HY81 2H34A 5BUEA 1ZY5A 4FV2A 3E8NA 4I94A 4RMZA 3BYUA 2VTQA 4DYMA 3Q2JA 4BICA 1UVRA 1Q8WA 2RKUA 5AMNA 3PDTA 4DF3A 4YO4A 5J5SA 3I4BA 2GHLA 4F6WA 4D1ZA 4FUXA 3LKMA 1CKIA 2HZ4A 3L8VA 3VUMA 3Q4CA 1WBTA 3C1XA 4G1WA 2VTSA 4FGBA 2WHBA 3DZOA 4JQ7A 3RK7A 5TOZA 3R02A 4ACMA 4PL4A 4TNDA 4GK4A 4YJPA 2VTHA 5GIOE 3BU6A 4CZUA 3VUHA 2YWPA 2HZ0A 1XBAA 3QD3A 4BCGA 4YHFA 1PXKA 3RZFA 5JZJA 4X2FA 4G6LA 4LM5A 4NFNA 1YVJA 4EZ3A 4EONA 4MAOA 4O7SA 2ZMDA 3FZSA 1VEBA 4L9IA 5DH3A 4G3DA 3GVUA 4X6QC 2WOTA 3AC1A 2NP8A 1RE8A 4J1RA 2XJ0A 4IANA 4AZEA 3PP1A 1YWRA 1W8CA 2RFSA 3FHRA 4FTOA 4G5JA 4GW8A 4USFA 3F9NA 4DTKA 1H24A 2A4LA 2CMWA 3KK9A 4WUAA 1YXSA 5K0XA 1UA2A 4GT5A 5KUPA 3NUPA 2VU3A 1YDRE 3CKXA 1U54B 4GH2A 4YSMA 4HZSA 3WZUA 3BV2A 4FKRA 3MYGA 2Z7SA 5LJJA 5CF6A 1KE9A 4DA5A 3ACJA 4IFGA 1FBNA 3VRZA 3OMVA 4ZSEA 1TVOA 4BGGA 4D2VA 5HOAA 3V6RA 3DA6A 3N4TA 5JK3A 5HTBA 2UV2A 1G5SA 3SXRA 3U4UA 5TT7A 3V5TA 3OWLA 4CFMA 5JFXA 5J9LA 3WZJA 3QA8A 3UO4A 2JDVA 4N57A 3MFSA 1KV2A 3QLGA 1YWNA 5DR9A 4EOJA 5L8LA 1UU8A 4LFIA 3R22A 4XHKB 4AZTA 4BDJA 4HVDA 4U81A 3POOA 1Y57A 2JDSA 4FX3A 1IG1A 3ZM4A 1JKKA 5B0XA 1UWHA 5AV1A 3EN7A 2QLQA 3TXOA 2PMLX 1IAHA 3VBTA 3KF7A 4OW8A 4BWXA 2V5QA 2WMTA 2UZDA 3NIEA 4KA3A 4QMWA 2UW9A 2V7OA 3FKOA 2E9VA 2HXLA 3U8WA 2VWBA 3BELA 2GMXA 2J5FA 2QU5A 3FMLA 4AQCA 4WNKA 3EQRA 2UZBA 1KOBA 1H1WA 4JT3A 5JQ5A 1PXLA 4HJOA 1DI9A 2XRUA 4BCHA 5C4LA 2CGWA 1R1WA 4GUEA 4FI1A 4F9AA 2J0IA 2PZPA 1ZMUA 5E92A 4G6NA 4HVIA 3ODYX 2RGPA
chains in the Genus database with same CATH superfamily
2CGXA 5ICPA 3Q6WA 3EQDA 2BCJA 4AT5A 1IRKA 1PKGA 2GNLA 4QPMA 3P79A 3OS3A 2CKOA 3V8TA 4DEEA 3HAMA 1JKTA 1UU9A 3PJ1A 4YGAA 3RMFA 3W8LA 2JITA 4RC2A 5GJDA 5CU2A 5HD4A 3I6UA 3A60A 2XP2A 4DG3E 2YCQA 2WFYA 2R3RA 2VO6A 3F3UA 3QRTA 3BQCA 4J8MA 5ETAA 5G1XA 3CCNA 2PTKA 4KRCA 4LV8A 2PPQA 5EYDA 2JKMA 4QMVA 4EOKA 3VWAA 2ZM3A 4ZAUA 1H1SA 3FLSA 5BVEA 3UQCA 4AAYA 3U6JA 5AJQA 4MK0A 5AP5A 1S9JA 5E4HA 2C6TA 3LXLA 4I6FA 2BAQA 4JDJA 3FAAA 5JH6A 2P3GX 3FMNA 2G01A 2R64A 3F5PA 4AGUA 3UO5A 4BHZA 4CQEA 4P2KA 4EJ7A 3OOGA 3ERKA 4UMUA 2QO9A 4DEIA 5HVKA 2CN8A 4J7BA 2WTVA 4I0RA 4IWOA 3GQLA 4EC9A 4O7NA 3RK9A 5JSMA 5I9XA 1OZ1A 1U5RA 2GHGA 4G31A 3ZOSA 2JDTA 3QQGA 1GIJA 2YM8A 4FKWA 5BUIA 1KV1A 1XKKA 2PUNA 3HRCA 3QYZA 5AEPA 1B6CB 4X2GA 4FKUA 4PTGA 4I5MA 3BHHA 3LPBA 4Y85A 1APME 4L43A 2BRBA 2C6LA 1KOAA 4WUNA 4CZYB 2VTPA 4BGHA 2Z8CA 4IJ9A 3RWQA 5HG8A 4CRLA 3R2YA 3UODA 1SMHA 5IA3A 2JC6A 4AU8A 5ETCA 3CTHA 3U87A 4F70A 3F61A 4OAUC 4H1JA 3MWUA 4QYHA 1TKIA 5IEXA 1YXXA 3Q2MA 2R9SA 3ET7A 1WFCA 2H6DA 4Q5EA 4ALUA 4HW7A 3MIYA 3QZFA 4K2RA 3SRVA 3UJGA 4F99A 2BDJA 3VF8A 2W06A 2W17A 3MH0A 3SC1A 3ZLWA 2B7AA 2GS6A 4FTQA 3RJCA 1JQHA 3QBNA 2VX0A 3QL8A 4C3FA 4YSJA 3C4FA 5IEYA 3BHUA 2GQGA 3WF5A 4F0IA 3G15A 4R3RA 4R77A 3Q4TA 5A4LA 2P55A 3HX4A 4AQKA 2WTKC 1PF8A 4EOQA 2W1FA 4ZY5A 3DBFA 4RWLA 3LFBA 4X0MA 3SW4A 4IWPA 3UVQA 5L2SA 1JKLA 2P4IA 5IH5A 5IPJA 3ZRMA 4ZMEA 4Q9ZA 3E8EA 5IDPA 2HY0A 3CY3A 1OGUA 1VZOA 4F7JA 4DFLA 3A7GA 2E2BA 4C4HA 3TNPC 4MHAA 1HCKA 2ZJWA 2CLQA 3A7IA 3NRMA 4MH7A 4AXCA 1XH4A 5IA5A 4XV2A 1WVYA 5H2UA 2OIBA 4IC8A 5A14A 3PPZA 2W4JA 3UZRA 1OI9A 3NSZA 4KIKA 4AP7A 4JL9A 1Q24A 5KNJA 3C4CA 4HYIA 5M06A 4AT4A 4E6AA 4AN3A 2R2PA 2PE0A 1UWJA 2JFMA 1PKDA 2DQ7X 2X2LA 2XIYA 4XV3A 4YTIA 2QCSA 1SM2A 3R73A 1PYXA 5FBNC 4DTAA 4ENXA 4ALVA 1OITA 4TYGA 4D1XA 4KRDA 1DI8A 3CIKA 3L1SA 3KXNA 1MP8A 4ITHA 3ZXTA 2XIKA 3ZLYA 3F7WA 4FOBA 4D0WA 4DDGA 5C8MA 3CS9A 2ERKA 2ITPA 3PIZA 4OGRA 3ZFXA 4AS0A 3GT8A 3L9MA 2VWXA 4CT1A 4FSRA 4FGRA 4HNFA 2BDWA 3UIUA 5CT7A 3MY0A 3R7EA 4IEBA 5C1QB 4GYGA 4AT3A 3H10A 4ZJIA 5J7HA 2I0HA 2XK3A 3R04A 5K5XA 3P4KA 2Y6OA 3OY1A 3PLSA 4FTUA 4WT6A 5CZHA 4BWPA 3KGAA 3HZTA 5H3QA 4HPTE 5E8ZA 3BYOA 3BCEA 4BJJB 5DOSA 4YPDA 5FM3A 4GL9A 3OCGA 3UMXA 5A3XA 3VBYA 1PMUA 3WF8A 4O0TA 4TY1A 4EQMA 3CD8A 3OCTA 3TDVA 3JS2A 3IOKA 2YIXA 3F66A 3GNIB 5AR4A 4RIWB 1YXTA 3H0ZA 3H9FA 3GC0A 4IB0A 1O6KA 1OL1A 4I6HA 4NT4A 3ZHPC 1NY3A 2QOFA 4C61A 4PL3A 3SAYA 3EQFA 4EYMA 1Q3DA 3W0OA 4EH8A 3ZDIA 3MI9A 3F2NA 4TZRA 4MXZA 4DHIB 4O27B 5E8YA 5AAFA 2HWOA 4NKAA 2I40A 3QF9A 5CAPA 2BIYA 3KRWA 4RIXB 2QKRA 5LMKC 3H30A 5I3OA 4PTEA 1H4LA 5KMIA 4S32A 2W9ZB 4OBOA 2OU7A 4G3GA 3TG1A 3AKLA 3FMEA 3O7LB 3ORTA 4NKSA 3C4EA 4C7TA 3FEGA 3LHJA 2F2UA 3W2PA 4X3FC 2R3HA 3DDQA 3FLNC 4DGOA 2YN8A 2W9FB 4IB5A 2VWVA 2J0MB 3R6XA 4PPBA 3B8QA 3D4QA 2OXDA 4MNFA 3IECA 5FBOA 3BYSA 3EQPA 3UNKA 2AC5A 3DXNA 3UYSA 2R3OA 3C51A 3QRIA 2I1MA 3WF6A 4E26A 3LFQA 5HU3A 4F6UA 3ZTXA 2C6MA 3HRFA 4MBLA 3VW8A 3AOXA 2B9FA 2W4KA 2XANA 3KU2A 3DTCA 2ZM4A 2J90A 4QEBA 3FZRA 4ZY6A 4ZLZA 4ZOGA 5CQWA 4E6DA 5LVOA 4YZBA 2ZOQA 3TUCA 4F9CA 5GZAA 3IS5A 5JGDA 4BDGA 5JFSA 3TNHA 5IDNA 5KBQA 3PXYA 2Q83A 3CGFA 4LL0A 2XAOA 2X0OA 1Y91A 2WMBA 3BBTB 3KMMA 3NNXA 4FSMA 4BKZA 4YLJA 4EBWA 2H8HA 4KUJA 3P9JA 4G5PA 3CJFA 3K3IA 3Q32A 3ORLA 4Q9SA 4QP7A 5BYZA 4I5HA 3D5XA 2UZEA 5HKMA 3D94A 2G2HA 2J0JA 1BLXA 3O8PA 2ONLA 4GCJA 4UMTA 4EEVA 5IQIA 3FI8A 2BDFA 4RWJA 1E1XA 3A61A 2EXEA 3IDPA 3UYTA 3RGFA 1XQZA 4X3FA 2YZLA 1M52A 1YOMA 4NFMA 4FG7A 4BCJA 5JZNA 3ZSHA 2V7AA 3G33A 1NXKA 4WO5A 4W9WA 3FZTA 5EYMA 3PY3A 3WZEA 3R9RA 2F4JA 3LXPA 2DWBA 4U79A 4FVQA 4EOSA 4Z3VA 2NYAA 4GT4A 2OIDA 2PUPA 4EKKA 4AX8A 3LFNA 4GRBA 2C6OA 5FTOA 1Z5MA 4RVLA 4W4YA 4E4MA 3D15A 1XH8A 4LV5A 4O22A 4QMXA 5J5TA 4Y5HA 2X0QA 1WBVA 5CNNA 4QRCA 3W0SA 3W0RA 3DFAA 2QHNA 5J7BA 4C2VA 3R1QA 4NSTA 4FTKA 5BVNA 1M2PA 3MBLA 1G8KA 3VS5A 1CMKE 2UZUE 2VWZA 3F6XA 2IEWA 2YHVA 2EXMA 3PSCA 4DBNA 4DLJA 4CFNA 2C6DA 3UQFA 3R83A 5K9IA 3V5LA 3KEXA 4TYEA 2EWAA 4TYJA 2JDOA 3LXNA 5FLFA 4I6BA 5CSHA 4A9UA 2FSOX 3CEKA 3I5NA 4KIQA 3KRXA 3P78A 2ZB1A 3PJCA 3D7ZA 4C4IA 5A4QA 2X1NA 5JRSA 3PXRA 2W1GA 2XK8A 3HECA 3GCQA 4U5JA 3E92A 5E1EA 5I9WA 1YHSA 3ZYAA 3S2PA 4RA5A 2HW6A 4OLIA 2J5EA 4QP6A 3OWPA 4LV7A 3W32A 5FGKA 2WMXA 3NFGB 3D5WA 1J1CA 4BGQA 3SLSA 3WI6A 3U9CA 1ST4A 1SZMA 4AN9A 4F9BA 1J3HA 4Z7HA 3UDSA 5L2IA 5CEOA 3RAKA 4YC8A 5LCJA 2R3QA 4FVRA 3QQFA 4NM7A 5AUYA 3ZU7A 4C36A 4R7BA 2OXYA 1IASA 3G90X 2WTWA 3EL7A 2BR1A 4WSYA 3NWWA 3A8WA 3HVCA 2G15A 3QUDA 3V8SA 3M11A 4I23A 4BRXA 3ZO2A 4X3JA 3FSKA 4JIKA 4E1ZA 2O0UA 2XNGA 3FBVA 4H39A 3GFEA 3T9IA 3QTQA 4QMMA 1GIHA 1H08A 1Z57A 3O0GA 3HAVA 3GFWA 4JQEA 3S3IA 4EK5A 2PVRA 3SV0A 5DVRA 3DQWA 2XA4A 2PHKA 1TQPA 2G2IA 1B39A 4WG4A 4BI0A 5CF5A 4DEHA 4AA5A 3RWPA 4C62A 2XK9A 3G9NA 4XV1A 3PXFA 5DNRA 2Y4PA 3ORNA 4PY1A 4AN2A 4EH3A 3EYGA 5L2QA 2O2UA 5BYLA 4QP1A 4O84A 4ERWA 4FT9A 4IDVA 5AIKA 2WU7A 4AOIA 5ANGA 2YLFA 3LLAA 4PNIA 1O9UA 2VD5A 4YNOA 2OKRA 3I5ZA 4ZTNA 3R8PA 3HKOA 4JI9A 4BDCA 4ZZMA 1Z9XA 4ACGA 5DMZA 5J1VA 5AR8A 4IBMA 2DS1A 4EQUA 2EVAA 3MW1A 3D7TA 5HTCA 1M7QA 2V0DA 3E7OA 5AV3A 2WTIA 2QOIA 5CY3A 5F20A 4D55A 2JKQA 4RVTA 2IZTA 5CVHA 2HWPA 5CEMA 5IQGA 4RJ8A 5DPVA 2XIXA 2ZDUA 4FKPA 5HNBA 3LW0A 3TV6A 4CTCA 5D7VA 4C33A 3ZLSA 4X2KA 1OIYA 3Q52A 5AV4A 3TT0A 3R30A 3POZA 3QU0A 4C4FA 2VTMA 3DQXA 4HVHA 1R3CA 2R3KA 4K6ZA 4TW9A 4EBVA 1STCE 2WKMA 5AM6A 5F4NA 2W4OA 4WKQA 3TV7A 4RVMA 4BKJA 1W83A 4O4BB 3R9OA 1OL7A 4YC3A 4L3JA 2G9XA 3BGQA 2KTYA 2IO6A 3DBDA 4QDEA 4I92A 2WAJA 3RNIA 2WQBA 1H1PA 4ASXA 2YITA 4HYSA 4GFGA 3QZHA 5HNGA 1PXNA 3D5VA 4KNBA 3RAHA 2XS0A 5M4UA 4FT0A 4ZTLA 2WNTA 3HA6A 4FSYA 3S1HA 3BHYA 2YM6A 4C35A 2V22A 3RP9A 2XALA 4W8DA 4I5CA 5KMKA 4FG8A 4O0VA 5JQ8A 4O81A 2C6KA 4UX9A 2BZKB 4KS7A 5ACBC 5B2MA 4LMUA 5E90A 3WE4A 2X8EA 3R1NA 3JR1A 2XK6A 2OIQA 4I5PA 4M13A 3AT3A 5FXSA 2IZSA 3QD0A 4QQTA 4KKGA 4IAFA 5LARA 4IAYA 3A8XA 3WBLA 2QKWB 4R8QA 4AGDA 1XMMA 3QD4A 1NVSA 3R1SA 4LYNA 1WVWA 3QX4A 4M8TA 4BDDA 2YA9A 4QMNA 5CI7A 1Y8YA 3ZO3A 4MXOA 3NDMA 4TWCA 4GJ3A 4FL3A 3TIZA 3PTGA 4CNHA 3GOKA 2IVTA 5EM8A 2OGVA 4DHFA 4RIOA 3PRIA 4DCEA 4G6OA 4N6YA 2C5YA 3ORKA 1Q97A 4FZAB 1AGWA 3MA6A 3FQSA 4PV0A 3TTIA 3VW6A 4O7VA 4C8BA 4B4LA 4I4EA 2Z60A 4UZDA 4YP8A 3UG1A 1ZOHA 3V6SA 3W33A 4C34A 3NVKI 2BALA 3C4WA 3AKKA 4O1OA 3LVPA 3LFEA 2GQSA 3MY1A 3VBXA 5HX6A 1Q62A 2YIRA 3DK7A 3I60A 3II5A 5D7AA 3RI1A 4ACHA 4IB3A 3UP7A 3P7AA 3FYJX 2ZV7A 5AV2A 4FSZA 4F63A 5KBRA 5LXMA 4M66A 2OSCA 4ZLYA 1M17A 3KY2A 1RDQE 1ZYSA 2CDZA 2OICA 3ZUVA 4DEAA 1Q61A 2QR8A 3B8RA 4UXQA 2W1CA 3DBEA 4FBXA 2VTLA 3BZ3A 4UN0C 1YW2A 3AC2A 3OP5A 3DXQA 3R8MA 5ITAA 4FICA 4NJ3A 2WXVA 1YWVA 3KVXA 3ZCLA 4XG9A 4E5BA 4LDTA 3KQ7A 5FEQA 2XB7A 4L3PA 4O2PA 4F9WA 3WARA 2B9JA 1Q41A 1H25A 4XCUA 2Z7LA 3QD2B 2X8IA 4DHZA 5IMEA 2JDRA 1G3NA 3BE2A 1Q8UA 2FYSA 2VO3A 3C0IA 4U3YA 3MIAA 3TKHA 4LGGA 4RVKA 2X9FA 4PP9A 2XYUA 3L9PA 5ETFA 3SG9A 4HGEA 1OL6A 5AUWA 2I0VA 4FTRA 1O6YA 5C8KA 1M7NA 4IZYA 2BFYA 2A2AA 3HMIA 2IZRA 4MNEB 4OBPA 3F2RA 3H9RA 4FZ7A 4G16A 3W2OA 4AE6A 1BKXA 4NJDA 1BYGA 5EQPA 2JGZA 5LOHA 4GG5A 4B99A 3DFCB 1JSTA 2R3FA 4X7QA 5J8IA 4DH1A 4NTSA 4H36A 5KMJA 4S33A 5HCXA 4B0GA 1LEZA 3DB8A 1JSUA 4CD0A 4APCA 3CC6A 4O83A 2GSFA 5IEVA 3I0QA 3DK6A 5EH0A 4CFUA 5IUIA 1XO2B 3F5UA 1UU7A 2YCFA 5M51A 3UIXA 5AX9A 4EQCA 3PVUA 4O0XA 3ATSA 4G3CA 3DKCA 3O71A 3QYWA 4BIDA 1J7LA 4V0GB 3RAIA 3EN5A 3BU3A 4D2RA 3DGKA 4I41A 4FEVA 5H8BA 3SXSA 2C68A 1YOLA 3VULA 4J99A 4QMLA 3E64A 3KULB 3DY7A 2YFXA 3W0MA 5C9CA 4JQ8A 3UDTA 4BIEA 5B2LA 3ALNA 5KHWA 4B9DA 4PL5A 4IX6A 4HGLA 4IQ6A 4D9UA 3KMWA 4Y95A 2PMIA 2Y8OA 5JEBA 3EQHA 3UDBA 4UXLA 4K8AA 3VNTA 1ZYDA 2PVKA 2WQMA 3FPMA 4IX5A 5EHLA 5AR5A 4FV9A 5HBEA 3RK5A 5HCZA 5DFPA 5HLPA 2BKZA 3HV4A 2CNQA 3FL5A 4K1BA 3KXZA 2WOUA 2ZVAA 4L7SA 2XYNA 4H58A 2NRUA 1P2AA 1CM8A 3R63A 4UYNA 4FT5A 1BI7A 2C69A 4J97A 3UZPA 4WSQA 3BLRA 4BDHA 4NZWB 2RIOA 4UMQA 3HUBA 3E62A 4S31A 2WMAA 3ACKA 3LFFA 1NVQA 5A6OA 3DT1A 3R01A 3LLTA 2BZHB 4QMTA 1U54A 4RX7A 5HO6A 2BRGA 1OECA 2JIVA 3IW5A 3RZBA 4ORKA 5JGBA 3QCXA 3C13A 1VYZA 1WBNA 3QC4A 3GU8A 2XKDA 3PE1A 4JRVA 5B2KA 3UG2A 3UVRA 3G51A 1MRVA 1BI8A 1RW8A 1WVXA 3U6HA 4ONAA 5L6OA 3NW6A 3ORIA 3C5UA 1OB3A 3MGYA 1ZZ2A 4YJQA 1QL6A 3R7GA 4Y73A 4O0UA 4OTHA 4ZXTA 3W2CA 2JIUA 4R3PA 3BLQA 3RNYA 4EOIA 3PE2A 3VQUA 1J7UA 3UTOA 2R7BA 3HV3A 4I0SA 4EH9A 4DAWA 5AAGA 2OG8A 5L3AA 4KBKA 2GNFA 2EXCX 2XUUA 4OT5A 3DKGA 3O50A 5TO8A 4JBVA 3OEZA 4ANQA 2PZIA 2RF9A 4L68A 3W2QA 2XVDA 2UZNA 2SRCA 4CCBA 5AADA 1P5EA 2ACXA 2WQOA 2BRNA 4D5HA 2ZYBA 3QTRA 4KKHA 3EN4A 4AXFA 4AA0A 5GJGA 3UIMA 1UU3A 3FMJA 1PW2A 5K3YA 3SQQA 2ZFYA 4UZHA 2OFVA 1W2DA 4HYUA 2BMCA 4OTWA 4BZDA 1MRUA 3H9OA 3C0GA 3DLZA 5L6WL 3QKLA 2X7OA 4IE9A 3HV5A 2YM7A 5DR2A 2XRWA 4O7LA 2QOCA 3QHRA 3JY0A 2XNBA 4ZIMA 4EWHA 4CYJA 4YLLA 2R4BA 3LQ8A 2W96B 4GYIA 4JAJA 3R7VA 3S00A 4U43A 4M7IA 4NL0A 4TL0A 4QPSA 3PP0A 4ENYA 5J79A 5DGZA 3OTUA 3JPVA 1QMZA 4GJ2A 4WG3A 4FSNA 4CKJA 5HLWA 1XH6A 3N51A 2HENA 3ODZX 3V5PA 4EUTA 3O23A 2PYWA 3EB0A 2R0IA 4MBIA 2OJ9A 5AWMA 5I3RA 2OLCA 2CCHA 3P1AA 3MESA 5C4KA 2ZV8A 5AP7A 4DT9A 4IXPA 4MD7E 4TWNA 5I5ZA 2ITOA 3QHWA 4QNYA 4IVBA 1E9HA 5CVFA 3ZXZA 2Z7QA 4XLVA 2VAGA 4QYFA 2WQNA 3NFFB 5EOBA 1OBDA 3HV7A 4KSPA 3DOGA 4RC4A 5EG3A 4DLIA 2C5OA 2XKFA 3RHXA 1YXVA 4I22A 1ZOGA 4FL2A 3ZBFA 3R21A 4KAOA 4EUUA 2X2KA 4EWQA 4OBQA 4ALWA 2QODA 3E7VA 4YO6A 3NUNA 4CVAA 3OFMA 5DHJA 2J51A 4RFMA 2HXQA 2VNWA 4NCTC 3FI3A 5EDPA 4XBUA 4M67A 1QPEA 3QLFA 1O6LA 4F65A 4BDFA 4QTBA 3QA0A 5J1WA 2O63A 3ELJA 4WD5A 4YJRA 4FKSA 4UWBA 1LR4A 4RFYA 4F7NA 3D5UA 4LG4A 3EFWA 3F3WA 4U45A 2LAVA 3PVGA 3BPRA 4WNPA 3LMGA 4AFJA 3LFSA 5JGAA 4OTRA 3KKVA 3PFYA 4EHVA 3LCOA 3F88A 4FNWA 4AXAA 3I1AA 5HEZA 5CI6A 1JAMA 1OIUA 4IAIA 3FI4A 1QPJA 2I6LA 3QUEA 4NH1A 3TMOA 1V0PA 3M1SA 3QRJA 5LQFA 2B52A 3EFLA 4HCVA 1H0WA 4O2ZA 4FIIA 2PULA 3PXQA 1T45A 4MCVA 3CPBA 1LPUA 2HYYA 3COMA 4IWDA 3KXMA 4KSQA 2XM8A 2WMRA 4LUEA 4RJ7A 4IX3A 4CCUA 3Q53A 4PX6A 3L8SA 3PVWA 3Q4UA 5E8XA 5F1ZA 1IAJA 3FLYA 3TJDA 3LFDA 4AUAA 1GY3A 3EYHA 4E8AA 4BDIA 3IKAA 4A9TA 4QDVA 2XF0A 2W1IA 2Y6MA 4EOOA 4YZNA 3SRVB 2R3LA 3D0EA 3G9LX 4CFWA 5F9EA 1G8SA 4XG6A 3HMMA 3FMMA 2PZRA 4N4SA 4XG7A 3HRBA 2XCKA 4FIHA 5E7RA 5T3QA 2Y9QA 3TKIA 4EOPA 2VRXA 4PNKA 3OROA 4P5ZA 4BDBA 4UMRA 1KE7A 3LZBA 3PA4A 3EOCA 2UW3A 4IM0A 5AP3A 3E3PA 4M15A 4O4FA 5FQDC 3KB7A 4AW1A 3CR0A 1OPLA 2JAMA 3UDZA 4L45A 3ROCA 3HL7A 3WZDA 1FVTA 2PE1A 3I81A 4YBKA 1VR2A 2R3JA 3ZONA 2PWLA 3NEWA 4IADA 4GG7A 4MXXA 4RRVA 1H1QA 4AW5A 3VUGA 4RX5A 1F3MC 2ERZE 4I21A 5J95A 5L6PA 2OBJA 2YM5A 2X0GA 3NUSA 3F3TA 5HO7A 1OKWA 3OBJA 4A9RA 2R3MA 4XP3A 5HU9A 3EIDA 2P0CA 3IG7A 3IGGA 3WZKA 3NPCA 5HESA 3R9NA 4KIKB 4IM2A 3ATTA 1PMNA 1BL6A 2GFSA 2QOLA 5ANEA 2RG5A 2AC3A 3TIYA 2QURA 3THBA 4OTQA 3QCYA 3Q9XA 5BVFA 4EH7A 4QP3A 3T3VA 5HHWA 1PXMA 4E6QA 2HIWA 4QD6A 5IA1A 1SYKA 2FSMX 2GHMA 4JS8A 4GU6A 4D9TA 4BCKA 2C0TA 4B6LA 3QUPA 2C0IA 4IJPA 1OUKA 4R1YA 2CKEA 2Y0AA 1OKVA 4C58A 5L2TA 4BJJA 5M09A 3GXLA 4HNIA 1KE8A 3FZPA 3SOCA 5I9YA 4FZFB 5CEIA 4GKIA 5E8TA 5KX8A 4A7CA 3UPXA 5AR2A 2R3NA 5CU4A 4ZTHA 4RIYA 3MV5A 3QALE 5H8GA 4O21A 3UIBA 3EKNA 4L8MA 4FK3A 3C4ZA 5TE0A 4B8MA 1BL7A 3C9WA 3O96A 4QQCA 4MD8E 3EHAA 3JVSA 3R8UA 5IH4A 5L4QA 2YDJA 4DFXE 1MQ4A 3G6GA 4M0YA 4YZDA 4AF3A 5BVOA 5JT2A 3VN9A 2OZOA 2CN5A 1UNHA 2PVMA 4O4EA 3O51A 5CVGA 4Q5HA 4I93A 3FLWA 2WTDA 4FIGA 2B53A 5HO8A 3U51A 3ZRKA 3IW6A 5CAOA 2OO8X 2HAKA 4AAAA 2PVJA 4RIXA 4D58A 2F7EE 1IEPA 5HICA 5IISA 5IUHA 1F5QA 2WMWA 3EMGA 3QZGA 5GJFA 2CNUA 2BAKA 2WTCA 5HVYA 4KWPA 2RFEA 4KBCA 3VAPA 1GZOA 1Q8ZA 3MJ2A 3P86A 4AGWA 3DLSA 2YCRA 4ZSJA 5KE0A 4WNOA 3VC4A 1YRPA 3VUIA 4U3ZA 3PJ3A 2QOOA 2XEZA 4RPVA 4XX9A 5EHYA 5AAEA 5J9YA 3NZ0A 2XNMA 3C5IA 1WBOA 2AQXA 3BEGA 4CMUA 4BZNA 2CKPA 4DN5A 3GUBA 3CBLA 2OZAB 5GNKA 4UWYA 5AP2A 1R78A 1FOTA 2BKKA 5JFWA 3FLQA 4OR5A 3BX5A 4MD9E 5A4EA 4L7FA 4NK9A 2KULA 4OUCA 3ZS5A 2PMNX 4J52A 2GNHA 4NIFB 5M56A 1Q8YA 2ITXA 4UALA 4G9RA 4XV9A 5HG7A 3ZSIA 1ZLTA 5DEWA 3FXXA 3ORZA 2JLDA 3HMNA 3EJ1A 5E8SA 4JBOA 3R7OA 2ITZA 4KINA 5ANIA 3FKNA 5TKDA 2W99B 1JKSA 2W5HA 5DT3A 1GIIA 3F5XA 3F7ZA 4ZJJA 4MBJA 2XM9A 4JX3A 5IU2A 3LM0A 4XJ0A 4Y8DA 4TXCA 3PVBA 2JIIA 3W2SA 4K9YA 2F9GA 2VWUA 2B0QA 4AZWA 4PTCA 3PA3A 5HZNA 2AYPA 4ZS4A 5LMKA 3UPZA 2RL5A 2W5AA 5IA4A 5IQDA 3DKOA 3RPVA 4LOQA 3A4PA 3SA0A 2FVDA 3FLZA 3RTPA 3AD4A 4FKLA 3NGAA 4RC3A 2Z02A 2OH0E 4OT6A 4TTHB 4FV5A 1OPKA 2BRHA 3NLBA 3HNGA 2O8YA 3A4OX 4CKIA 2VTIA 4QNAA 2ZV9A 3DKFA 4ZSLA 3KXHA 4DDIA 2XIRA 2BZIB 3KRLA 2C4GA 3ULIA 5L2WA 1OPJA 4TT7A 3AGMA 5AR3A 2CKQA 5I9UA 4AFEA 4BF2A 4NTTA 4X21A 1FQ1B 2AUHA 3NYXA 2NO3A 5D11A 1B38A 3ALOA 3U54A 2XKCA 2UUEA 3KN5A 4N0SA 4YPSA 3EQCA 3BL7A 4NW5A 3KIOC 3E8DA 3A62A 4DFZE 3NNWA 3KRRA 4MQ1A 2A27A 3VS4A 1T46A 3F2AA 2WPAA 5CS6A 4AA4A 4FEXA 1ZMWA 2F2CB 3ROYA 3R9DA 1H26A 5K4IA 4RGJA 2J0KA 5KHXA 3EH9A 4N6ZA 5KMOA 5CXHA 4NWMA 4MF1A 4G9CA 3MTFA 2Q0NA 3GCVA 2VZ6A 4H3BA 2Z7RA 5AUZA 4QMOA 3CQWA 3P7CA 1URWA 3PWYA 4L42A 3Q96A 1W84A 4E5AX 1Q5KA 4GIHA 3N9XA 3OVVA 1OGYA 5D41A 3AQVA 4FV3A 4I3ZA 3LCSA 3WOWA 4DEBA 3VONA 1K2PA 3MVHA 3E88A 2YDKA 5LMAA 4C2WA 4QYEA 1URCA 4L53A 2IJMA 3LE6A 3GU5A 3RVGA 4AW0A 4MUQA 4W4VA 4GMYA 4F6SA 1W98A 5JKGA 5GHVA 4JVGA 1GOLA 3OWKA 4OTDA 2A1AB 1HOWA 4JRNA 3P23A 5CEKA 2UVXA 3HLLA 3P5JC 3PFQA 4CV9A 4ZTSA 3QWJA 2ETRA 1QCFA 5CSPA 3GC7A 4ZK5A 4A07A 1BUHA 5EM7A 1ZYCA 4Z16A 3DXPA 3SW7A 3K2LA 2GNIA 4L46A 4ZTQA 4UY9A 4YJUA 1A9UA 3CPCA 4R5YA 4FRFA 3VBVA 2X8DA 2YDIA 2YLEA 5C03A 3BHVA 4ANLA 2OJJA 4LRKA 2WMQA 2H9VA 5CF4A 3GC8A 2J4ZA 4BCMA 1W7HA 4CFFA 5D12A 4MVFA 2YJRA 3AG9A 4WBOA 3MTLA 3EZVA 4ID7A 1E1VA 4XRLA 3OTVA 4IH8A 3EQGA 4CG9A 2XMYA 1JWHA 4D28A 4D2TA 3E5AA 1ZY4A 2WO6A 1G8AA 4EK6A 3OW3A 2OH4A 3RHKA 3SXFA 4O1PA 3V8WA 3VRYA 4E4NA