4W8DA

Crystal structure of mst3 with a pyrrolopyrimidine inhibitor (pf-06454589).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
290
structure length
289
Chain Sequence
b'GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24 36 kDa subunit
publication title Discovery and preclinical profiling of 3-[4-(morpholin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl]benzonitrile (PF-06447475), a highly potent, selective, brain penetrant, and in vivo active LRRK2 kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4w8dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4w8dA01
1IAHA 1OIYA 3QYZA 3REPA 1XH4A 4B7TA 3TI1A 4X2KA 2IN6A 2W06A 3FLSA 3P0MA 4XBRA 2VNWA 4FK3A 5GJGA 1L8TA 5C9CA 3MFTA 2HXLA 2HELA 2WU6A 3A7HA 1PMEA 3QLFA 4O0TA 4D0XA 2BROA 5LCJA 5HIDA 2JDTA 3ALOA 3HA8A 3RNYA 4DCEA 5AAEA 1M7QA 1T45A 4RIYB 5HD4A 5M06A 3DAEA 3KB7A 2VZ6A 4EJNA 5CNOA 4O7TA 1DS5A 5EHOA 3R28A 3WZKA 1YHVA 1DAWA 2IZRA 5BMSA 2CNUA 4HPTE 5L6PA 2C6OA 2E9OA 3U8WA 2V55A 3R9OA 1IASA 3BQCA 3ORTA 4O0RA 2UV2A 2BZJA 1LEWA 2WTDA 3EQBA 4I0TA 4I5HA 2CHLA 1I09A 2VWYA 3PPJA 4FIGA 2F57A 1FBNA 4GVAA 3MH1A 5A6NA 4MBIA 3OWJA 4YUQA 4GJ2A 5CWZA 5M51A 1XH5A 2BCJA 4DG0E 3Q9ZA 4X2GA 3H10A 5ANJA 2Z7QA 3NVMB 1Y8GA 5A3XA 4FKOA 4CTCA 2GQGA 3MPMA 5C4LA 1VEBA 4JIAA 3H4JA 3QLGA 4NTSA 2J2IB 4J8MA 2Z8CA 3QUDA 3NUAA 3LW0A 5FG8A 2XYNA 5J9YA 2WXVA 3Q53A 3QUPA 5H2UA 4FSUA 3QGYA 5EM7A 5HO7A 2OJGA 5BVDA 1JVPP 4A4LA 5IF1A 3ZFYA 3EZRA 4FZFB 1ZWSA 5DG5A 3KVXA 3DBQA 3PPZA 4GK4A 2G1TA 1XJDA 3KRRA 3GC9A 5E8YA 1Q3DA 3TV4A 5AEPA 4DF3A 3V5TA 5GNKA 3IK3A 4RC2A 1CSNA 1B39A 3EWHA 4YNEA 4HVIA 3GQLA 5CAVA 3ORNA 4HZRA 3RHKA 3RPRA 4X2NA 4YHTA 4G16A 3ZYAA 4QYEA 4BCHA 4PMPA 1FMOE 2IZUA 3LCSA 5HGIA 5CF5A 1KWPA 1UNHA 4MHAA 5FEQA 1WFCA 4CV9A 3Q6UA 1PKDA 4FTQA 1KE6A 1H07A 3V5WA 4DFBA 2IW8A 2Y0AA 4JLCA 4WBOA 2R0IA 3C51A 2PE1A 5HE3A 2CPKE 4TTHB 2OLCA 3ZLXA 5HTIA 1OZ1A 3IDBA 5CAUA 3R22A 5B7VA 4J97A 3ZZWA 3MVHA 3FUPA 4C8BA 2A19B 5HLNA 2VWBA 2CGXA 2XJ1A 4P4CA 1ZLTA 2PVNA 3D4QA 4QQCA 5KE0A 2Y6MA 3AD4A 1URWA 3SD0A 3ZSHA 4BWXA 4EK4A 1ZOGA 3H9RA 4TRLA 5DGZA 4NJDA 2JIVA 3E93A 4IC8A 4S2ZA 3OBGA 4D2RA 5B2MA 1R3CA 3DJ5A 5DA3A 2PU8A 3WBLA 3NNUA 4X2FA 3WE4A 4RX5A 3W2QA 4YC6A 3TM0A 5BX0A 4NJ3A 3VBYA 4FTCA 5DOSA 3UO4A 4FTMA 2HOGA 1V1KA 4YZNA 3G0EA 4AGUA 3TTIA 5KUPA 1XBAA 5HU3A 1JSUA 3Q4UA 2J9MA 2YHVA 3DKOA 4FSYA 4R1VA 5JFVA 5BVNA 2WIPA 4O7ZA 5GINE 3Q9YA 3CGOA 4DITA 2VX0A 4RA4A 4YJSA 1H24A 2FSTX 4ZZMA 5AUWA 3ZC6A 5H9BA 4L9IA 3D14A 4CMUA 3UIMA 3QQKA 4IZ5A 3BHTA 5HBJA 2UVXA 5IEYA 3L9LA 2JDVA 5A14A 1XH6A 5FGKA 5L3AA 2CNVA 2IPXA 4F6WA 4U3ZA 4RGJA 3TJDA 4XLIA 5JRSA 3E64A 2JITA 2E9UA 3Q60A 4BCQA 4FL2A 4XNEA 2ITQA 4EK5A 2ONLC 5CU3A 4XOZA 4MTAA 3IPHA 3QKKA 3R6XA 3NMUF 4QRCA 4TXCA 4A4OA 4BCJA 1OPJA 3ZZEA 5AR7A 4PMTA 4U79A 4GV1A 2CGWA 2R3QA 3BYSA 3GT8A 4YR8A 3PIXA 3EFLA 4QYYA 4GH2A 4C7TA 3QWJA 4TWCA 1FQ1B 1WAKA 2XNGA 4ASEA 4WNMA 5D7AA 4E6CA 2OIBA 4PL5A 1G8SA 1GIIA 3ZEWA 3E8EA 3GP0A 3QQFA 4K1BA 5CEQA 5ACBC 4DLJA 5IQBA 2PMIA 2PHKA 3R8ZA 3UQCA 5EM5A 3QRUA 2Q83A 3FKLA 1U4DA 5T3QA 4LGHA 3C1XA 2ITPA 4O91A 2PMOX 4EOLA 2ZDUA 3FMJA 2P4IA 3HMOA 2YAKA 4E4LA 1H1RA 2FGIA 1YXUA 4C3FA 4FEUA 4KKEA 5L6OA 2VTIA 1CKJA 3HL7A 4XOYA 3FMHA 4QMLA 4IFCA 3PJ2A 3GOKA 3U55A 4Q9ZA 2VTMA 3IKAA 5ITAA 1URCA 3QXOA 4QNYA 3EQFA 3B2WA 4AOTA 1QCFA 4TYHA 4I5CA 4TYEA 5ANEA 1JKLA 5AUXA 3ZBFA 1A06A 4JAIA 4I0RA 5FEEA 4KUJA 3FHRA 4DH1A 3PY3A 3OUKA 4XX9A 4UWCA 2XBAA 3FPMA 4IX6A 4LUEA 3AT4A 2EB2A 4Z9LA 2BPMA 2B9FA 4IZAA 1OIUA 2EU9A 1IAJA 4OTHA 2V22A 2JKKA 5F4NA 4EL9A 4ENXA 2A1AB 2FO0A 1E1VA 4EZ3A 3DKCA 4N70A 4QMOA 4RPVA 3I6UA 2XKCA 2CGUA 2QONA 4FSMA 2UZWE 2CN8A 4LG4A 3ZO3A 4AFJA 2J7TA 3PXRA 3PRFA 3GB2A 3MBLA 3MESA 3EKKA 2JAMA 3ZLWA 5E8TA 3PSDA 1FVRA 3VHEA 4XMOA 4M12A 3OWKA 4DG3E 4ENYA 2QD9A 3M1SA 4LI5A 3TJCA 5CSPA 2W1EA 4R7BA 1YI4A 3ZDUA 2BR1A 2WQNA 3BLRA 3QCQA 5LVOA 2R3JA 5AP6A 5EQPA 4EH4A 2Z02A 1KV1A 2ZYBA 3FLNC 5EM6A 2OGVA 4Q5EA 3GC8A 4ANLA 4EOPA 4RFZA 2G2HA 4KS7A 5AAGA 3CE3A 2BDWA 4TYHB 3IW4A 1HCKA 3VN9A 3PVGA 5CU2A 4L7FA 1PKGA 4I24A 4XRJA 4NL0A 4RQKA 4J53A 4CZTA 4IX5A 3Q2JA 3MVMA 4GG7A 3AC3A 2QOIA 4HGTA 4BZDA 3S3IA 1U46A 3NUXA 2FA2A 3LM0A 5AR2A 4FSZA 4G1WA 4BDJA 3UP7A 3E3BX 1PXKA 4Y5HA 3S4QA 2F49A 3H9OA 4YJQA 4DH3A 4F0GA 5CXHA 4ZS0A 1BKXA 4YO6A 5L6WL 5JZNA 5DMZA 1PHKA 2R3FA 5EYKA 4GT5A 1PXNA 3CS9A 1YDSE 1TVOA 5AP2A 4NIFA 2Z60A 2I6LA 3OTVA 4JBOA 2XIRA 5DEYA 1ZYSA 3EQDA 2RL5A 5AADA 3QTSA 4C57A 4X3FA 4JR7A 3FYJX 3F5XA 4O22A 2GPHA 3IDCA 1Q24A 3QUEA 2VGPA 3FSKA 3FMDA 3G9NA 4FOBA 4QMXA 4QYFA 4WRSA 5FEDA 3A7IA 4GUEA 2PWLA 2ZV9A 4JG8A 4EONA 4XG6A 4C2WA 2I40A 1XHAA 4YNOA 2WIHA 2DS1A 4MXOA 2A4LA 3QRIA 2PZPA 5BVEA 2BRGA 4ZIMA 2C3IB 1K3AA 2WELA 4DGOA 2GHMA 2JGZA 4JOAA 5IQIA 4WOVA 3D83A 3PLSA 4HYSA 2YWPA 3MFSA 4NSTA 2HY0A 2UZOA 2XRUA 2ZB0A 1M2QA 4MD7E 5HHWA 4JDJA 3U9CA 4PNKA 5F9EA 3F3ZA 4BTMA 3UP2A 3C7QA 3C5IA 2B55A 2PMLX 4G9CA 5HG7A 3VBWA 5GIPE 2JIUA 2ETKA 4IJPA 3RK9A 2FB8A 2ITTA 3OF0A 5I3OA 4CTBA 4OR5A 2IVVA 3BYOA 2C1AA 4GS6A 1F3MC 3HV4A 3LPBA 5ANOA 1O6YA 4DAWA 4CG8A 4GJ3A 5CSXA 3VUIA 3LXNA 4ANQA 5JZJA 4MQ1A 4M67A 2P33A 4YPSA 4DH5A 3BLHA 2FYSA 4Q9SA 5EI8A 3F3UA 3GCPA 4G6NA 5DBXA 5HESA 4FTRA 2YCQA 3RMFA 3JS2A 4ZLZA 3EFWA 5AP7A 1KOBA 4DFZE 1GZOA 3KA0A 1OM1A 2C69A 5EYMA 5LVLA 3ZC5A 3LQ3A 5BNJA 1WBNA 1AD5A 5IEXA 3R7YA 2E9PA 4L45A 2F7XE 1VYWA 2J51A 3R02A 4EQUA 3FLYA 3VS2A 4KBCA 2IVSA 5I9YA 4ITIA 1HCLA 1PMNA 2H8HA 1UU7A 3KCKA 3LE6A 4IB3A 4JQ7A 5AR3A 4ANMA 3HMNA 4G3CA 3AC8A 4EBWA 1X8BA 3VUHA 3FQEA 1NXKA 4O0SA 3IGOA 4ZJIA 3B8QA 3GOPA 3FY2A 2QU6A 3G9LX 3OXIA 3QD2B 3WF8A 3JVRA 2RFDA 1ZAOA 4BDBA 1Z57A 4KBAA 2YIQA 5CEMA 1ZYLA 3AXWA 5HD7A 4XLVA 1NT2A 2PUNA 4N57A 5BVWA 3NDMA 3R2BA 4U97A 4BCIA 5CVHA 2Y9QA 3DJ6A 5EI2A 3FXZA 4GCJA 4D9TA 3MY1A 4ZLOA 3MV5A 4I1ZA 5D10A 4F7LA 3UZPA 5A4TA 3D7TA 1OIQA 3JXWA 3LJ1A 3PSBA 2PZIA 4YSMA 4I21A 4O7WA 2JKOA 1PYEA 3CXWA 4I23A 3OTUA 5EM8A 3DB6A 4RFMA 4PL4A 2XK9A 4UMRA 4FGBA 3G33A 4IZ7A 3OVVA 5AR4A 2W4KA 4AW5A 4GKHA 4EKKA 4FEQA 2UW3A 4QP6A 4ACMA 4C4HA 2QG5A 3PJ3A 3RJCA 4RIWA 4U8ZA 4FG8A 3O17A 1PRYA 4CFXA 2C0IA 3MTFA 2JBPA 2C6DA 2VWUA 3DTWA 4H39A 4LOQA 4FK6A 4AT5A 5DWRA 4YBKA 3ZCLA 5HX6A 3Q04A 5I9UA 3LCOA 2V5QA 2QR8A 4ZY6A 3DPKA 5DRDA 4ZTNA 3UOLA 4Z7HA 4S31A 4IACA 1LPUA 2YM5A 3AC2A 4KAOA 4FSWA 3VWAA 4E5AX 3DS6A 4XP3A 2CCIA 4OLIA 4JR3A 4XP0A 3U4WA 3DTCA 2C6LA 4KWPA 3BHYA 4NM0A 1UU3A 4RVKA 3V5JA 3W2SA 4ANNA 4ACHA 4IM0A 5KMJA 4YPDA 3FBVA 4O6LA 5AR8A 3PP0A 4CRLA 4GEOA 2G15A 4RWKA 4B9DA 4DH8A 3UOHA 1UU8A 4ALUA 4IANA 3LCTA 3LFFA 3W1FA 3ZDIA 5L2TA 1FVTA 5L4QA 4XG3A 5CZHA 5IDNA 5J5SA 4IAAA 3MA6A 5GJFA 4RFYA 4B6LA 4DE4A 3RCJA 2XEYA 4FA2A 3OMVA 4BTJA 4D2PA 2XUUA 4ACCA 4C4EA 4DC2A 5DFPA 4B8LA 2BKZA 3PRIA 4TNBA 1B38A 5IUIA 4I94A 2OZAA 4OTIA 4QP7A 3C4WA 4TWNA 4F9WA 2QI8A 4BI0A 1J91A 2BVAA 2ZOQA 3LXLA 3UIUA 2J5EA 4CKIA 1LR4A 3OCGA 4HCTA 4I92A 5DI1A 5HTBA 1SMHA 3AMBA 2AYPA 3FMEA 5AUYA 3LMHA 3T8OA 4YJUA 3UJGA 4A7CA 3TUDA 4BKYA 5AIRA 4C59A 5K4JA 3UNZA 4NW5A 3ZMMA 4ASDA 2EXCX 4JBQA 4DBXA 2OH4A 1H00A 3F5GA 3UPZA 2CCHA 3A7FA 4CSVA 2XNNA 5A4LA 1H1WA 3ULIA 4IIRA 1STCE 3RINA 5CI6A 4H3PA 3DKGA 4CLIA 4L68A 5M53A 3GGFA 3D9VA 3GU8A 3QYWA 4NK9A 4CVAA 4K77A 4U5JA 4D55A 4KD1A 1KE5A 3A4PA 4UWBA 4AN2A 3O8UA 3QRKA 4FV3A 3NYXA 4O2PA 3POOA 2ITVA 2Z7SA 4GU9A 4PTEA 5LVPA 3NRMA 4IVBA 4E6DA 4K6ZA 3TIYA 1WBTA 3FYKX 3ZUVA 4E5BA 1AGWA 4FTIA 5KMMA 1BI8A 3II5A 3KF4A 2CLXA 5M09A 5JGAA 3ZM9A 3EN5A 1Q41A 3EQPA 1ZYJA 4A9RA 3A7JA 1PJKA 1OIRA 3SLSA 4ANBA 2V62A 4BCOA 3F3WA 3IGGA 3OOMA 1WVYA 3T3UA 3W2PA 4XHKB 3TZ7A 4AOIA 5LMKC 2QR7A 3WF7A 4MQ2A 3OS3A 3RAIA 2PVJA 4O84A 2IW6A 3FSFA 5TR6A 5AAFA 3MB7A 2R7IA 3TIZA 2IZSA 4K8AA 3P79A 1H4LA 3FC1X 3R7OA 4O1OA 1DM2A 4KKHA 4WG3A 1PXLA 3UO5A 3N4UA 3DGKA 2WTWA 5AX9A 1H1PA 3KY2A 3ZS5A 3HAVA 1MRVA 1UKHA 2I0EA 2I0YA 2E9NA 2QOQA 3DA6A 3TZ9A 3ROCA 1QMZA 5AA8A 2OF2A 3IO7A 5E92A 4D4VA 3QTIA 4W4WA 3C4XA 5HLWA 2R0UA 4ZSGA 3KREA 5BYZA 4KIKA 4U45A 4H3BA 3VAPA 3QTUA 5DR9A 1YOJA 3VVHA 4I5MA 4L52A 4HVSA 2XCKA 5BVFA 4H3QA 4KABA 2J0IA 3V3VA 3UOJA 3MGYA 3UGCA 2CKQA 2UZUE 3L9MA 3LVPA 4NEUA 3I60A 2BTRA 2XNPA 3CKWA 3UYTA 2VO7A 5IA1A 5IUHA 3QQUA 2EXEA 1H1QA 3K5UA 3NGAA 3ZEPA 3C4FA 2VTHA 3C4CA 2P2HA 4R5SA 5DLSA 3LLTA 3GQIA 5ANIA 3HRCA 4RC4A 4UV0A 4YO4A 3DK6A 2XM9A 3ZUTA 5TE0A 2A27A 2ETRA 4MXXA 1ZOHA 2VX3A 3OEZA 3QD0A 4CG9A 2QO7A 5CLPA 2QU5A 4M68A 1P14A 4LV8A 4HVDA 4L01A 4AU8A 4IAFA 3MSSA 2ITOA 3ORPA 3DBEA 2WOUA 4UMPA 5CEKA 4WNPA 4YSJA 4JS8A 4M0YA 1V0OA 3UNJA 4BB4A 3WIKA 3PVBA 4UXLA 4F9CA 3COKA 3UOKA 2OH0E 3U6JA 3QGWA 1XBBA 3KN5A 2OJJA 4GIIA 4XCUA 2WMTA 3LFQA 4MEDA 4BI1A 3AT2A 4O7RA 3SRVA 1J1CA 3IS5A 3MFRA 5IQAA 5IQGA 3FXWA 4O7LA 2QLQA 3U6IA 4XRLA 1REJA 2WTJA 4FC0A 1DI9A 4GUBA 1J7LA 3BU6A 2X39A 4IB0A 3OW3A 3ROYA 2QC6A 4KIKB 3LQ5A 4EOSA 5I3RA 4J96A 4M84A 5JQ8A 4QP2A 2C3LA 5AM7A 4AXAA 3SKCA 4G6OA 3NR9A 2O2UA 3OCSA 4WG4A 1FGIA 5M44A 1BMKA 4QMYA 3VUKA 5IH5A 3VQHA 1H28A 3O50A 2VTNA 4CQEA 4EH2A 5EK7A 2JKQA 4PTGA 3NUPA 2OZOA 3H0YA 1FMKA 1Q61A 3QQGA 4TYJA 5M08A 1LEZA 2KULA 4C0TA 1SNUA 5HVYA 3AD5A 4E93A 4MXZA 3QQJA 4ZSAA 3H3CA 2Y8OA 3LFAA 4D2SA 2B4SB 1FGKA 3Q5ZA 3IW6A 3IW5A 4U42A 4EC9A 4U9AA 3QL8A 3EYGA 2OU7A 3H9FA 4IWPA 3MPAA 5G6VA 3MY0A 3AQVA 5FQDC 2WO6A 5E7RA 3MVLA 4UXQA 4CMOA 4MWHA 3K5VA 3QHRA 2F2CB 5JFWA 3RAWA 3FJQE 3ZUUA 4F09A 2WHBA 4QPSA 5IISA 5I9XA 2XKDA 3VS3A 4A07A 4XEYA 3SRVB 3FY0A 4BTFA 5J5TA 3OBJA 4GT3A 3K3JA 2R3IA 4O1PA 4ZSEA 2IJMA 3N4VA 2BRMA 2VTLA 4E4XA 2XVDA 1PXIA 3OT8A 4C4GA 3O23A 4FTJA 2XK6A 4EQMA 4PL3A 4N4SA 1MP8A 5E1SA 3VS6A 4L42A 5FXRA 3CPBA 1OMWA 2W1FA 4QMNA 1JNKA 4E26A 3LQ8A 3TDWA 3PYYA 4RLLA 4RQVA 1Q3WA 4FTNA 5FLFA 4TYGA 3CD3A 4E8AA 5CVFA 1ERKA 4AF3A 4UZDA 2I1MA 4WT6A 4GYGA 3E63A 2P55A 1OL1A 2HZ0A 1REKA 3HV6A 1GOLA 3RGFA 2YISA 4QP4A 5J1VA 3TV6A 1WBWA 3WF6A 5BYLA 5HCYA 5AUTA 4M14A 5K5XA 2B9JA 3NZ0A 4XG7A 5B2LA 4MWIA 3ZU7A 2HWPA 3CQUA 4J99A 1GIHA 3UIXA 3R7IA 4XG9A 4CZYB 2J4ZA 1RQQA 3BU5A 4ACDA 4FIIA 4M0ZA 3MIYA 3HRBA 4U80A 3TKUA 4AZSA 2ZM1A 3DOGA 5DR2A 5HG8A 4C4JA 2C6TA 4PDOA 2C3KA 4K18A 2J0KA 1CKIA 4DLIA 3ACKA 3SW4A 4YZBA 4RBLA 2HZ4A 3TL8A 5GZAA 4GYIA 5HTCA 1WVWA 4O27B 2ZJWA 3OCTA 2X4FA 2WMWA 2XNBA 5BUIA 3EN9A 4FL1A 3R9RA 5FWKK 3C0GA 3WILA 4EWQA 2X7FA 2GNIA 2I0VA 4OAUC 4DEGA 2Z7RA 1XO2B 4IHPA 3AD6A 5IUGA 2NO3A 2UW8A 4W9XA 5IA3A 2FSOX 4M66A 5JEBA 3NUNA 4X3JA 3DNEA 4AWIA 4D4SA 3HNGA 3MI9A 3Q2MA 2VWVA 5FTOA 4BFMA 4ALVA 3KU2A 2QVSE 1G5SA 4UYAA 4IXPA 4IZYA 5HO8A 3AC5A 3UZRA 3D0EA 3PZHA 1OL5A 1Q97A 4IAIA 3KKVA 3R83A 1TQPA 3DQWA 1M2PA 1YHSA 5LWNA 2ZV8A 4C61A 1Q99A 1OKYA 1Q8ZA 3ANRA 3KMWA 4W9WA 5HE0A 2OIQA 1G3NA 4LV5A 2WQBA 3T9IA 5FUTA 2C0TA 5HO6A 5J9ZA 1OKWA 4C36A 3RM6A 4AN9A 4NM5A 2W7XA 4LRJA 2C4GA 4NZWB 4D1XA 1A9UA 3PXZA 3SQQA 1YXTA 3L8XA 4S30A 2XIKA 4UEUA 3R0TA 3TV7A 3QF9A 4W4YA 4C37A 5A54A 1NVQA 4MX9A 3WOWA 4KIOA 2W1IA 3E3PA 2OJ9A 3HX4A 1YI3A 4AW0A 4FSRA 4BCPA 3LAUA 1YWVA 4AP7A 3GCQA 2DQ7X 3F2RA 4JDIA 3CJFA 3Q9XA 4UMTA 3C9WA 3ORZA 3PA4A 2Y4PA 3GEQA 4RMZA 2VRXA 4ZY4A 4U40A 5H8GA 2BDFA 4OTWA 2A2AA 3BBWA 3ITZA 4I4EA 4KIQA 3ZLSA 3ZSIA 4FTUA 2AC5A 2HY81 3QD3A 4QP8A 3SXSA 5CAOA 2W1DA 2X9EA 4D5KA 3RHXA 2UZBA 3BE2A 2R3MA 4EH8A 2YZLA 4BDDA 3BV3A 3DDQA 4F7SA 1IA8A 3DJ7A 4CT1A 4GMYA 4LOPA 4IWOA 3LFSA 4Q5HA 3MPTA 3JY0A 4EK8A 1OPKA 3EMGA 2FH9A 3CLYA 3ZXZA 3LLAA 3MWUA 4QTAA 4YLLA 2XRWA 3VC4A 3EH9A 3RALA 3UQFA 3IG7A 2V7AA 3NNXA 5HQ0A 2Y6OA 5AMNA 1OGUA 2XK3A 4Q2AA 3R7GA 2J90A 4QYGA 3MS9A 4I93A 1IRKA 1K9AA 3RAHA 1OECA 3KCFA 4NCTA 3TKIA 5C4KA 4QYHA 4J98A 4LM5A 3FEGA 4RT7A 4CQGA 4OUCA 3HDNA 3P4KA 4FT5A 4G3GA 5CVGA 4QT1A 5L2WA 4FKUA 1ZYDA 4RJ8A 3VUMA 4HNFA 3AGLA 4BRXA 4E20A 3RAKA 1TQIA 4OTQA 5D1JA 4BKJA 4OTPA 4RSSA 3RNIA 4DFNA 4S32A 5H3QA 4P7EA 4AX8A 1OBDA 4CXAA 3GC7A 3F7WA 5AP3A 1CKPA 2GFCA 4JQ8A 3VS1A 4AUAA 4W8DA 2F2UA 2YFXA 2IZTA 4XV1A 4IDVA 3L9PA 3DBCA 3I5ZA 4M69B 4YZMA 1F0QA 4OW8A 2VX1A 2PVFA 5JGDA 4LL0A 3FKOA 1K2PA 3TT0A 5LARA 2BZKB 3OY3A 2VTSA 1DI8A 5IKWA 4EEVA 2PPQA 3F61A 5CENA 3SV0A 4BYIA 4EYMA 3SXFA 3FPQA 4CRSA 3PXFA 4CKRA 4CFUA 1JBPE 5K0XA 3NUYA 2GNGA 3QKMA 4OTFA 4AE9A 3NUUA 3FLZA 3NIZA 3MY5A 1TQMA 4PDPA 5KO1A 1WVXA 5CY3A 2RG5A 3NWWA 2O5KA 5CQUA 3E5AA 4BVUA 2RG6A 4AACA 2P3GX 4AE6A 4C35A 1FPUA 4S34A 1Q62A 2Y4IC 4FICA 4C58A 4CNHA 1JPAA 2VWXA 3K54A 5M4FA 3DB8A 3V8WA 5IDPA 4BWPA 1OKZA 1U54A 2GCDA 1YXVA 3F5PA 4W4XA 2WMSA 3BKBA 4FSTA 4AS0A 3O7LB 4PPAA 3RBWA 4WG5A 3AOXA 4YC3A 3TG1A 4CV8A 4DEEA 4YU2A 3C13A 4J71A 4RWLA 1S9IA 4W8EA 4DGLC 4WNKA 1OI9A 4FEXA 4GFGA 3CP9A 5EKOA 2QOHA 3S1HA 5CTPA 3PE2A 1W8CA 4O7YA 4CFNA 2YZAA 1YDRE 2R3LA 2W5BA 4O0UA 5KHWA 2XZSA 4E4MA 2RFEA 4G3FA 4ZJVA 4I41A 4EHZA 1U5QA 4BGQA 3B8RA 3SDJA 3F2NA 1JSVA 3WIGA 4DFYA 2UW5A 3WZEA 4E3CA 3L1SA 3TACA 3KULA 4RJ5A 3P23A 3MVJA 3RK7A 2VGOA 5K3YA 4C4IA 1Q8UA 3ERKA 2XNEA 4EHGA 2OWBA 2OF4A 2R4BA 4IAZA 1JSTA 1CTPE 2PTKA 5IQCA 5FP5A 4CFFA 2GTNA 1XH7A 4N6YA 5IH6A 4AZEA 3CY3A 2X8EA 1U5RA 4KSQA 3ORKA 4IEBA 2QO9A 5AM6A 3LFEA 1M14A 4X0MA 3L8PA 4NH1A 1CM8A 3Q4TA 4FZ7A 3RP9A 4FIEA 2GTMA 1U54B 1DAYA 2QQ7A 4FX3A 4QQJA 2PUUA 2X7OA 3JPVA 3WF9A 4FV1A 4XUFA 3OEFX 2CNQA 3GC0A 4NFNA 3I79A 4CMTA 2PULA 3JR1A 3PDTA 3ZO4A 4RX8A 1Y91A 3FZSA 4ASZA 5LOHA 5CQWA 2RF9A 1YQJA 2VTTA 3VUGA 2F9GA 3KXXA 4BDGA 1SZMA 4BBFA 3I81A 2C5NA 1UWHA 1NVSA 4MNEB 4D1SA 4GW8A 2J50A 4NKSA 2RIOA 4R6VA 2WMXA 3V8SA 3ZH8A 3RVGA 5CAPA 2WAJA 3SW7A 2PVRA 3V51A 1JKTA 3L8VA 2WQEA 3KULB 4FF8A 3OD6X 4NM7A 4O0VA 5IA4A 4IWQA 4H36A 2IVUA 4AG8A 2OIDA 3UZTA 4GVJA 1IG1A 2FSLX 3BPRA 4I4FA 3KXZA 3RWPA 2BMCA 3PJCA 4W4VA 3KVWA 3CEKA 4IADA 4EOOA 3BGZA 3N51A 3NCGA 2J5FA 4JRVA 1KV2A 3AGMA 4R3PA 4GFOA 4F64A 1IEPA 2PK9A 3F69A 4FI1A 2WMBA 5TO8A 2PVHA 3CIKA 4MF0A 2RGPA 4FKVA 2JLDA 4FG9A 3R9HA 3UC3A 4U44A 5T6KA 4AA4A 2XBJA 3G51A 1V0BA 4XBUA 2C1BA 4QP1A 1PXMA 3LMIA 2VU3A 3KRLA 1YDTE 3LJ2A 1BL7A 2C6EA 3CGFA 4A9SA 4QTCA 3CJGA 1OKVA 4K2RA 3JUHA 4EWHA 1IA9A 4FTAA 4FV5A 3O7LD 2ITXA 3QZHA 4JRNA 2UW6A 5BYYA 3ZRKA 1XQZA 3TZMA 2ZDTA 3DDPA 2R3OA 3R8VA 4GT4A 4JNWA 4Y83A 3ZM4A 3BYVA 3VQUA 4A06A 2C68A 3SHEA 4EHVA 3C0IA 2W1GA 2VNYA 2O8YA 4OBOA 4C02A 5C26A 5K9IA 4F99A 5AV4A 1SYKA 1Y57A 3CY2A 1H0WA 3LKMA 5HLPA 4RRVA 4AZFA 2AC3A 4C2VA 4G9RA 4C3PA 3EYHA 3WI6A 1XH9A 1QPJA 3WZDA 4QD6A 1TKIA 1G8AA 3QRTA 4HJOA 5CF8A 3KN6A 4BC6A 3FLWA 2J0MB 2PVYA 3E8DA 4L53A 4TKSA 2PZYA 2GMXA 4EK6A 4OBQA 5CASA 2BFYA 2CGVA 4UY9A 2QOKA 2E2BA 2X0GA 3UO6A 4DEBA 4EHEA 1A48A 5CS6A 3TUBA 3NAXA 5JMSA 1OUYA 3I0QA 4D28A 3HUBA 3LOKA 3PY0A 1YW2A 2R7BA 4YP8A 4U3YA 3EN6A 3FKNA 4F9AA 5L2SA 3ETAA 3W8QA 3IQ7A 3QD4A 1YOMA 5GIOE 2XM8A 1OUKA 2WMRA 2B54A 3BHUA 3SVVA 3ENHA 3COHA 3L9NA 1QPDA 3AC1A 3H30A 1OITA 1MUOA 4F70A 2BTSA 3RPSA 4QTEA 2C30A 4YZCA 2XKFA 4EOQA 4AFEA 2B1PA 2NPQA 3UG2A 3EQRA 4H1MA 4YJNA 1J7UA 5CX9A 3DK7A 2GDOA 5E8ZA 5E8XA 4F0IA 4TN6A 4OTRA 2YDKA 5M07A 3DLSA 3KXHA 3LMGA 4NKAA 2VAGA 3TZ8A 2YLFA 3IOPA 4IAYA 1XWSA 3DBDA 3ZONA 4CCUA 3DY7A 3POZA 4G3DA 4AAAA 4DEDA 2XF0A 2X81A 4PUZA 4EOMA 3R7UA 3CCNA 2UZLA 1WCCA 3CQWA 2J6MA 4X3FC 5HI2A 1PF8A 4D58A 4N0SA 5L8KA 3KGAA 3SA0A 4NYEA 3SG8A 3ET7A 3TNWA 5AP5A 3WYXA 4F1OA 4F6SA 3HMMA 3TKHA 3VO3A 3V5LA 4F1MA 4FSQA 5JFXA 3D7ZA 2CKOA 5BVKA 5IQFA 5DVRA 4X6RA 4CFWA 1E1XA 1H0VA 4MD9E 3EZVA 1UNLA 4PMSA 4TZRA 4BBEA 4OBPA 2Z2WA 2X2MA 3DK3A 1P2AA 4FKRA 5BQ0A 4ID7A 3DKFA 2QNJA 4EOKA 4YJPA 2REIA 3NUSA 3EHAA 5EG3A 5HCXA 2PSQA 4ZP5A 4AW2A 2OJFE 4I6HA 4WNOA 2EWAA 3A99A 4IX4A 1Y6BA 3TCPA 4PNIA 4ZZNA 2O64A 3EKNA 5AIKA 4X2JA 2HZNA 2VTOA 2X1NA 2NRYA 2YJSA 1OL7A 4FNWA 2BHEA 3DXNA 1GJOA 4F08A 3EN7A 3HKOA 3M42A 4BDCA 2B0QA 4UZHA 2JFMA 3R04A 4E73A 3AG9A 4OT6A 4FEWA 2W4OA 4DTAA 5KKRC 3QAME 5E1EA 3UPXA 4ZXTA 4AZVA 2GNFA 3KRJA 4ZTRA 2QHNA 5E90A 4C62A 4NTTA 2XIYA 4FBXA 3NYNA 3OXTA 5ETIA 2ACXA 3R7EA 4EUTA 2GU8A 2HW7A 4XG8A 3UG1A 3N4TA 5KMLA 4FZDB 4XG4A 2HCKA 3F6XA 2BHHA 4IH8A 3DFCB 4K11A 5LCKA 3UYSA 3E8NA 5TT7A 4CFVA 2ERKA 4YJOA 2C6MA 4EI4A 5IG1A 3NSZA 3FZ1A 3TDVA 3BIZA 3R21A 5J87A 4AZTA 3IOKA 3U51A 4KINA 4HCVA 3MH0A 2WKMA 4L8MA 5IH4A 4FV4A 3MFUA 4Y8DA 5IA0A 2R3PA 3P7AA 3O8PA 2WGJA 3WARA 2XYUA 3GVUA 4Y46A 5EYDA 3FL5A 3KQ7A 1SM2A 1UKIA 3C4ZA 1JQHA 3COIA 3TXOA 3SG9A 5C8NA 4FUYA 3ATSA 2ITYA 2YEXA 3A8XA 5JT2A 4HOKA 3DAKA 1JOWB 2UW7A 1UV5A 3BWJA 4RVMA 5HNBA 2R64A 3W8LA 4C38A 3BQRA 4RJ6A 2UVZA 3F82A 4O0XA 3F88A 3OW4A 4O38A 1UWJA 3JVSA 4J8NA 2XH5A 3M2WA 2VUWA 5I9WA 4E6QA 4G17A 2HZIA 3Q52A 2IO6A 3BGQA 2BFXA 3D5UA 4V0GA 4BI2A 5HIEA 2QO2A 3OP5A 4YHJA 1XKKA 3PWDA 4ITJA 1GZKA 4HGSA 5CF4A 3E92A 2EB3A 1ZRZA 3OWPA 4DN5A 4OT5A 2PUPA 4RWIA 1JKKA 3I7CA 4L6QA 4FKLA 4F0FA 5HG9A 4QPAA 4HW7A 3QTRA 1YVJA 5I4NA 4FKPA 4FNYA 2G01A 5JFSA 1XH8A 2HENA 4JQEA 5AV1A 1SNXA 2XIXA 5HE2A 3R63A 3Q96A 5JH6A 5EOLA 4YJVA 2E9VA 2UW4A 2R3KA 3FI4A 4FV7A 3GBZA 4Y5QA 4ZSJA 3DZQA 2PVMA 2YA9A 3VS4A 5KMNA 4FT9A 3PY1A 4IWDA 4JJRA 4FKGA 4WRGA 5F20A 5HKMA 4O0WA 3PG3A 3VJOA 5J7BA 5DH3A 1OVEA 3VS0A 4II5A 3D5WA 5L2IA 3THBA 1RE8A 1WBVA 2I0HA 3DCVA 4FVQA 5HBHA 5C1QB 3C0HA 4ASXA 3FHIA 4ONAA 4GRBA 5BMMA 5HNGA 4MKCA 1NVRA 3HP5A 3UVRA 2YAAA 4A4XA 1UA2A 2QG7A 2BAKA 1QL6A 2XCHA 3K2LA 5LQFA 3HMPA 3VW8A 3DNDA 4V0GB 3KF7A 3V6SA 4LRKA 4XG2A 4E6AA 2YACA 3FZTA 2I7QA 3VULA 4MD8E 5CU4A 3R73A 1RJBA 2YDJA 4AW1A 3CSVA 3UC4A 3CQEA 5EFQA 1V0PA 3R7VA 3A62A 3A60A 5HVJA 2B53A 4A9TA 4QMWA 4TY1A 4E1ZA 2XS0A 4B0GA 3PA3A 2YIYA 3MTLA 3D5VA 4UN0C 3MJ1A 4DTKA 5JGBA 1ZMWA 4FTKA 4QQTA 1MRUA 5ANDA 4PDYA 1VJYA 3IDPA 3NW6A 4KS8A 4UWYA 3S2PA 4DYMA 5CALA 2BKKA 4PPCA 4BCFA 4DT9A 4LGDA 4Z3VA 4JG7A 4EK3A 5I9VA 4BN1A 3S0OA 4XV3A 2W1CA 2VV9A 3I5NA 3GUBA 3COMA 5EOBA 4WIHA 4LFIA 2PVLA 4MXCA 1W7HA 4YGAA 5AV2A 5EHLA 4BTKA 2W4JA 2H6DA 5HBEA 4HPUE 3G90X 1BYGA 4AA0A 3R9DA 3BRBA 3EQIA 2XJ0A 3TUCA 4MBJA 5CZIA 3ULZA 2WOTA 3QKLA 4DTBA 5C8KA 3O71A 3VS5A 5DR6A 1GNGA 3KMMA 4ANOA 4FT0A 3ZLYA 3QA8A 2DUVA 5M4IA 1BL6A 5A46A 5CSWA 4WSQA 4BGHA 5AR5A 3DXQA 2B9HA 3ALNA 4QPMA 4FV9A 1CMKE 4WUAA 2QOFA 5L2QA 2W5AA 3VJNA 5AP0A 3N9XA 1KSWA 2BDJA 2RFSA 2VD5A 4FZ6A 4JX3A 2VWIA 5JN2A 3RTPA 5EQYA 5HOAA 1R0EA 2DYLA 4DT8A 2YDIA 2ONLA 4FIHA 1H26A 4FKIA 4PX6A 2XNOA 4ACGA 2R5TA 4LUDA 3O0GA 5HG5A 3NAYA 3GI3A 3SOAA 1H27A 5FBOA 3LFDA 3BEAA 5LJJA 3W2OA 4EBVA 4MF1A 2ITUA 5E8WA 3ZFMA 4EOIA 1EH4A 3NCZA 4BCKA 4LMNA 3VHKA 2YERA 5AP4A 1GZ8A 3PA5A 5ICPA 2GS6A 3Q4ZA 4FNXA 2YIXA 4U0IA 4EH6A 4LRMA 1RW8A 3OZ6A 4YMJA 1ZMUA 4FYOA 5H8BA 4UALA 5T68A 4PP9A 5CANA 3WZJA 5IEVA 3LZBA 1MQ4A 4D2TA 5FDXA 2QCSA 4JDKA 4OTGA 5B0XA 2UUEA 4EOJA 1FVVA 2W17A 3MN3A 1PW2A 2BAQA 3HV7A 4PWNA 5EDPA 5FXQA 5HX8A 5LVMA 3HEGA 4R8QA 4WBBB 4RG0A 3KL8A 1PY5A 5CT0A 3W33A 3AT3A 1IR3A 4GKIA 3DLZA 3OHTA 4FV2A 2XIZA 5ACKA 3OOGA 4MXYA 5FXSA 2JBOA 4HGEA 4J1RA 2GNHA 3ANQA 3U4UA 2OSCA 3NW7A 2X9FA 4G5JA 4O2ZA 3WF5A 4FVRA 5CEPA 2XK7A 3A2CA 4I6QA 3RWQA 4WD5A 5KBQA 4G5PA 5ANGA 2C3JA 2B52A 1H1SA 3QTWA 5GJDA 3UODA 4M8TA 3NLBA 2XJ2A 2XB7A 2JDSA 3F9NA 4RZWA 5C03A 1XBCA 3H0ZA 2WTKC 4NWMA 5DNRA 4DH7A 4EUUA 5LMBA 1AQ1A 1VR2A 2R9SA 4L44A 2UW0A 4PPBA 3QX2A 3KK8A 4ZLYA 4YJRA 1NA7A 1Y8YA 3CD8A 3WYYA 4FT3A 4BCGA 2EUFB 5FBNC 3V5QA 4APPA 4BIEA 4F1TA 4FKSA 5H8EA 3OFMA 3EFJA 4YTIA 3E7VA 4L00A 4EYJA 5JK3A 4YTHA 2VTQA 4U43A 2XNMA 3DAJA 2WNTA 3ID6C 5E8UA 4LGGA 4HYHA 4I3ZA 3FZOA 4JT3A 5ETCA 2JEDA 5HEZA 5BVOA 4F9YA 3G6GA 2GHLA 4YTFA 3GFEA 2GHGA 3D2KA 5D9HA 3E8CA 2Q0BA 2PMNX 3U54A 5FM3A 4O86A 4MNFA 2YABA 2AUHA 5EYCA 3Q9WA 1WZYA 4ANSA 4FKWA 2HAKA 4WUNA 3NEWA 4L3JA 3SAYA 3HV5A 2WQMA 1CDKA 3QC4A 4WO5A 4JX7A 3DFAA 3LJ0A 3R9NA 2YIWA 2FVDA 2QKRA 3P7BA 1W83A 3LCKA 5EW9A 5FD2A 4ZJJA 3DU8A 1WBPA 4KB8A 3AC4A 4B99A 3FL4A 3FZPA 2VN9A 1W0XC 3VF8A 2W9FB 1JAMA 4PMMA 3VUDA 3PJ8A 4IX3A 4MK0A 2OG8A 3SXRA 5FDPA 3QZIA 3FI8A 5IA2A 2ZMDA 5DT4A 3G5DA 2EXMA 1H08A 1Q8YA 2QOBA 5DPVA 4L7SA 4M69A 2NRUA 4V05A 3PG1A 4DFXE 3RPVA 2GNLA 4X7QA 3OG7A 4KKGA 2CKEA 2GFSA 2UZVA 3G2FA 3VBVA 4CYIA 5A4EA 4WA9A 1NW1A 3LXKA 2Y4IB 4NT4A 4AGWA 2UZNA 4YTCA 4E4NA 3HGKA 2OK1A 5HU9A 5GZ8A 5FTGA 3I1AA 3PWYA 4DINA 4F4PA 3U6HA 4TYIA 3VRYA 4YLKA 4KRDA 3PTGA 3QBNA 3PVUA 2KTYA 5DEWA 4NU1A 4WKQA 2BIKB 2VTRA 3BELA 2C5XA 2WTVA 4O21A 5DYJA 4ERWA 5EKNA 4IVDA 2JD5A 3E88A 4FYNA 1P4FA 3T9TA 4K0YA 4ORKA 3O2MA 1YRPA 3Q5IA 4H1JA 4BYJA 1J3HA 3DZOA 3UTOA 1QPCA 4FKQA 1VZOA 2YLEA 4NW6A 4HVHA 1KOAA 2O65A 4QOXA 3I4BA 3CTJA 4QO9A 1T46A 4UX9A 4QMMA 5IMXA 3GU7A 3EIDA 3ZFXA 4CKJA 3DV3A 2WTIA 4IVAA 3VBQA 2QLUA 3EL7A 1ATPE 1LP4A 2OKRA 5I0BA 2ZM4A 3QTQA 4RJ4A 4ZTMA 5AA9A 4AGDA 3BX5A 4I20A 4DEIA 4U7ZA 3QCXA 5LWMA 5AJQA 1PMUA 3BLQA 3ORLA 5CSVA 3MJ2A 3V6RA 3CR0A 2ZV7A 4LMUA 1Y6AA 5CEIA 3R1SA 4MCVA 2CKPA 1M52A 3D2IA 3W2CA 5LXMA 4E5WA 2WEIA 4M97A 3W55A 1YKRA 4JXFA 4BWKA 1R1WA 3QXPA 4CD0A 5AV0A 2XA4A 5IQHA 4CCBA 3BWFA 2C5VA 3UE4A 3CBLA 2PY3A 3FZRA 3UVPA 3C50A 4ZTHA 2R2PA 4JI9A 4ZAUA 4L3PA 3DXPA 1NY3A 2OFUA 2GSFA 3EQHA 3WE8A 4DGNA 2H34A 3GU5A 4ITHA 5IU2A 4HCUA 2PVKA 4H58A 2BILB 4BDFA 3S00A 4J7BA 3RCDA 4FOCA 3GXLA 4D5HA 2BIYA 3BBTB 3HLLA 2UZDA 2X7GA 4BGGA 3LXPA 2H9VA 3EQCA 3R2YA 4BDEA 3C5UA 3W18A 3W16A 1JKSA 2C47A 2NNWB 4FMQA 3GCSA 4G34A 2W5HA 4ZY5A 2VO0A 5J79A 3UMXA 4F9BA 4H05A 2JAVA 3OT3A 1LUFA 3KXMA 3HVCA 4O0YA 4TW9A 3V8TA 2R3GA 3PPKA 2F4JA 2W96B 4KRCA 3QHWA 3MB6A 2ZAZA 3PXKA 4JIKA 4F7JA 5HVKA 3RKBA 5A6OA 2PUIA 2YN8A 4FL3A 1OPLA 5KMKA 1J1BA 4MNEA 3HECA 4YHFA 3P78A 5EHYA 1E9HA 4C4FA 2C5YA 4XV2A 2PZRA 4BZOA 3NS9A 4EJ7A 2CDZA 1BLXA 1YXSA 4R7HA 2B7AA 4JG6A 3F3VA 3TNIA 2IG7A 1FOTA 2CJMA 4O96A 5CI7A 3NYOA 1KE7A 4QMPA 5KMIA 5D12A 4Z55A 4HNIA 3ZBXA 1O9UA 4TWPA 4AQCA 2VO6A 3EB0A 5J8IA 1OB3A 4YZDA 2QOOA 2B9IA 4YLJA 4YJTA 2LAVA 3LFCA 2GS7A 1KUTA 1ZY5A 3ZXTA 3FWQA 4M7IA 1WBOA 2PYWA 4P2KA 4FTTA 3BZ3A 4O83A 3HAMA 4EH9A 4FZAB 3OXZA 4DFUA 1MQBA 1W82A 5TOZA 4FODA 3VIDA 1H25A 4MBLA 4QP9A 4O82A 5KHXA 4XYFA 4QNAA 3A4OX 5AWMA 3TEIA 5HNIX 2JFLA 5GHVA 3QZGA 4FVPA 5EW8A 4USEA 5L8LA 3A7GA 3SOCA 1JLUE 4ZMFA 3E62A 3GU4A 3KXNA 3RI1A 4DEAA 4BF2A 2BRBA 3ODZX 3UMWA 3SC1A 3E87A 4M3QA 3BE9A 3VBXA 2G2FA 2ITWA 3PIZA 3VBTA 5AX3A 3ZSGA 1SVGA 2WMUA 3EJ1A 3R00A 3R1YA 5A9UA 4FT7A 2YM8A 3A61A 2X6EA 3F66A 5C27A 2YM6A 5AUUA 3TTJA 2ITNA 3QTZA 1YHWA 2GS2A 1VYZA 4K9YA 3AMAA 5BUEA 1P5EA 2J0JA 4IM2A 2UZTA 3NYVA 4R5YA 4BDAA 4A9YA 3EOCA 4RJ7A 4G3EA 3QU0A 2WMVA 4F63A 1PXPA 2EVAA 4AOJA 3NW5A 4IVCA 3RZBA 5IMEA 3LFNA 4JVGA 2XP2A 1YXXA 2P0CA 2W1ZA 3MA3A 3PVWA 4NCTC 3JY9A 4PDSA 3V5PA 3ATTA 1JWHA 2UVYA 2ZV2A 4RJ3A 3NVKI 3LM5A 2ITZA 4QMTA 4AA5A 2QHMA 4U41A 1ZY4A 4ZZOA 1FINA 3LCDA 4IC7A 5FRIA 3EL8A 5CNNA 5FM2A 4TL0A 4Y85A 3KEXA 5KMOA 3BHVA 3SX9A 2JDOA 1OBGA 4PTCA 3L8SA 1GAGA 2O63A 3GCUA 4I0SA 4F7NA 5D41A 2YCFA 3HUCA 5DE2A 2VTPA 2F7ZE 3VS7A 4YC8A 5M4CA 3QX4A 3FMNA 3PSCA 3ORXA 4LYNA 1GY3A 2G2IA 2R3RA 5LMAA 4BHNA 5JKGA 4DFLA 4N6ZA 3V01A 4UYNA 4IDTA 5CAQA 2WQOA 3U9NA 4BZNA 5KX8A 2PE2A 3Q4CA 3PXYA 4EKLA 3D94A 4FIFA 4AN3A 3FAAA 2WD1A 3QRJA 4NIFB 4TT7A 3BI6A 5HZNA 3CKXA 4QP3A 2IWIA 5CYIA 1APME 2YIRA 3HRFA 4HGLA 5AV3A 4PRJA 2Z7LA 3HMIA 2J0LA 3NNVA 4X3FB 1GZNA 3V04A 4CT2A 3R01A 2V0DA 2X2LA 3O8TA 3LIJA 3P7CA 4MAOA 4TPTA 3BHHA 5M55A 4CFMA 4PV0A 5J7HA 1YI6A 2FSMX 3ZHPC 4GL9A 3F3TA 4RX7A 2QODA 5CSHA 3DT1A 2WMQA 4EZ5A 5JRQA 1PYXA 4HYUA 1YOLA 4OAVB 4QMQA 1Z9XA 4DA5A 3OWLA 4UBAA 4FE2A 4D2VA 4P5QA 4U81A 3MW1A 3GCVA 5LMKA 4LOOA 1I44A 5IQDA 3RZFA 3FMKA 3FMLA 1ZOEA 3IW7A 3QWKA 3I7BA 4JL9A 2UW9A 3ZRLA 2W0JA 2QURA 1ND4A 3NX8A 1XR1A 4APCA 3R1QA 3EFKA 3OY1A 4QMVA 4XJ0A 3P9JA 4ZTQA 5I5ZA 2ZM3A 4R3RA 4O81A 4EORA 2BRNA 1O6KA 4NM3A 4FTLA 3MH3A 5KZIA 2H96A 4C3RA 5KKRB 3VUTA 2PZ5A 1B6CB 5KCVA 4M15A 2C0OA 3UNKA 1RDQE 4KBKA 3QTXA 1SVEA 2O0UA 5EDQA 5HICA 5JQ5A 4ZTLA 4IW0A 4EQCA 2JKMA 3QC9A 5IZFA 2OXYA 1ZYCA 3TWJA 2R3HA 4FKTA 1W98A 4XP2A 3P1AA 4I6FA 4O7NA 2JIIA 2C6IA 3PXQA 5AFVA 2OBJA 3TNPC 4DBNA 3PIYA 3HP2A 5D11A 1UNGA 5M56A 3LFBA 3TNQB 1Q8WA 3KXGA 5AUVA 3O51A 4V01A 3W10A 4FUXA 2O3PA 2W99B 4CLJA 3GENA 1S9JA 5DIAA 1W84A 3UVQA 3G15A 4YZ9A 5G1XA 4EH5A 2LGCA 3MH2A 5DT3A 4D4YA 1PMVA 5K0KA 4Y73A 3AMYA 3QQHA 1ZMVA 5KBRA 3OC1A 4CZUA 3G6HA 2X8DA 3NNWA 2QOLA 4LQMA 2X6DA 4AT3A 4UMUA 5D7VA 2WU7A 3D15A 5E8VA 3ZO1A 2BUJA 2XK4A 5CF6A 5E4HA 4AGCA 3VF9A 4AZWA 2YCRA 2XEZA 4R1YA 3BU3A 4BIDA 4L3LA 4JBPA 4C33A 4L67A 4OGRA 3FQHA 4XS2A 5I9ZA 3PLAE 3KC3A 3D7TB 3S95A 4D0WA 2OO8X 4MH7A 2VTJA 4NUSA 2WEVA 1ZARA 3IECA 1ZXEA 4IFGA 2CLQA 4IAKA 3MYGA 2X2KA 3HV3A 1Z5MA 3QALE 1BX6A 3UIBA 3BYMA 2W9ZB 2IW9A 3TNHA 3FDNA 5DRBA 2W05A 2BZHB 2R3NA 3ORMA 4G2FA 4RIWB 4RIXA 4TWOA 3QA0A 4KSPA 4ZMEA 1WBSA 5L8JA 4FIJA 4QTBA 5EDRA 3VNTA 1OL2A 1ZZLA 3CTQA 3R8MA 5IPJA 4FV0A 2HW6A 4X6QC 2OJIA 3RK5A 4RZVA 4G31A 4E7WA 5TF9A 4FV6A 2XKEA 1KE9A 1M7NA 2F7EE 2YJRA 3HYHA 4PP7A 3Q32A 3BV2A 1BI7A 2ZB1A 3TN8A 4HYIA 4YBJA 5TKDA 3HDMA 2VO3A 4GIHA 3R8LA 2VTAA 2WMAA 4B8MA 2QKWB 4FG7A 4BIBA 2ZVAA 4RVLA 2IVTA 3IW8A 4GFMA 1UU9A 4PY1A 5CU6A 4TNDA 4UMQA 3F5UA 5K4IA 4BDKA 3A8WA 2QOCA 4R7IA 2XK8A 4IE9A 5HIBA 2GQSA 4MYGA 1YWNA 1Q4LA 3KMUA 3KK9A 1KE8A 4RVTA 4GG5A 3Q6WA 4J52A 4EZ7A 3OROA 3BYUA 4X21A 2C6KA 3RM7A 3R71A 5EH0A 3MIAA 4JDHA 2RKUA 3FQSA 3M11A 4BCNA 5DHJA 4USFA 4NFMA 2PL0A 2WFYA 3OUNB 2OZAB 4L46A 4CGAA 4UB7A 5E9EA 2VWZA 4A9UA 5DT0A 5AP1A 1PXJA 2GQRA 4Y72A 4IB5A 5JSMA 4RIXB 5IA5A 5F95A 1ZZ2A 4USDA 5EI6A 3BGPA 4GSBA 4MXAA 1PXOA 4ZEGA 4ZSLA 4CEGA 4WHZA 4BY9E 2C5OA 2GNJA 5AUZA 3VW6A 3LHJA 3R8UA 4LL5A 1F5QA 2W1HA 5KNJA 3U87A 4ZS4A 1U59A 4EH7A 3PZEA 4I5PA 2ERZE 1J7IA 3EQGA 3NIEA 3F2AA 4XV9A 4PQNA 3RPYA 4DHFA 2A0CX 2NP8A 3FI2A 3K3IA 4FEVA 3KFAA 3R8PA 4QMUA 2JDRA 2ZMCA 5FP6A 5A4QA 4K33A 4R78A 3NPCA 3P86A 3R30A 3F7ZA 4P5ZA 1SVHA 3FV8A 4QMSA 5E8SA 3FMMA 3T3VA 4EC8A 2JC6A 5ANKA 5CU0A 3B2TA 2BZIB 4IJ9A 4YURA 4IB1A 4IBMA 4R3CA 4S33A 4ZK5A 3G0FA 3Q3BA 4FGRA 3ODYX 1OL6A 3RPOA 4RIOA 4Z16A 3ZRMA 2OICA 2RSVA 2YM7A 3D5XA 3BEGA 3O96A 4RX9A 4I22A 5F94A 4F6UA 5F1ZA 4DCAA 4RWJA 4BR3A 4BDHA 4PF4A 1HOWA 3I0OA 5CT7A 5HCZA 5HE1A 4EH3A 5C01A 3P08A 4DGGA 1UVRA 2CSNA 4FR4A 3MDYA 2VWWA 2OW3A 4HZSA 4JBVA 4MVFA 1O6LA 4V04A 3ZTXA 1H01A 2WZJA 3P5KA 3PFQA 3QCSA 2HK5A 4ZTSA 3BCEA 2YITA 2CMWA 4CYJA 3PJ1A 4RC3A 3WZUA 4D4RA 3FLQA 5BUJA 2OFVA 3UBDA 3FC2A 5K5NA 2X4ZA 4HVGA 1Q8TA 3FI3A 5C8MA 2PE0A 2P2IA 4KA3A 3W32A 2YM4A 4IQ6A 5EQEA 2ETMA 3FXXA 2BRHA 4FSNA 4QMZA 3ELJA 4BHZA 5M57A 1YWRA 4G6LA 4GK3A 2Y7JA 3QZFA 3DQXA 3QFVA 3JYAA 2WTCA 1P4OA 4O7SA 2Q0NA 2YCSA 5EW3A 5FTQA 5GZ9A 4R77A 2X8IA 3ZO2A 4B4LA 2V7OA 4FKJA 2ESMA 5B2KA 3PP1A 4BDIA 2UZEA 4ALWA 4D2WA 4GU6A 4J95A 4QTDA 4C34A 3UQGA 4P90A 4D1ZA 5J1WA 3QQLA 4U6RA 4IM3A 5M4UA 4FV8A 4GK2A 4I6BA 2G9XA 4QQ5A 2WPAA 3R1NA 3KRWA 1M2RA 2SRCA 1L3RE 2OXXA 3ENMA 3IONA 3CC6A 4BKZA 3HZTA 1Q5KA 2YM3A 3OCBA 4IMYA 1MRYA 1R78A 2HXQA 3ACJA 4AT4A 4BCMA 4DGMA 3DBFA 4DG2E 5IQEA 1R39A 3GU6A 3KRXA 4RIYA 3HA6A 2YWVA 4KIPA 3UDBA 1R0PA 2DWBA 3QCYA 1M17A 2OXDA 1QPEA 5HORA 4FNZA 4KNBA 4ZOGA 3CPCA 5KZ0A 5CEOA 4ARKA 1H8FA 2WTKB 2FUMA 4BBMA 2HWOA 3GNIB 2BALA 5ETFA 2WB8A 5J95A 4OTDA 4XH6A 4BL1A 5A4CA 5BPYA 4RA5A 3W2RA 3I6WA 3PE1A 4RLKA 1WMKA 2HIWA 2OI4X 4BICA 2HYYA 4Y95A 5DN3A 3E7OA 4O7VA 4L43A 1BUHA 5LVNA 3FE3A 5E91A 3SGCA 3GFWA 3ZOSA 3EN4A 4M13A 4D9UA 2RFNA 4FTOA 3ORIA 4WSYA 3CTHA 4JAJA 5ETAA 5J9LA 2BAJA 3VRZA 3C4EA 4O6EA 4ERKA 1GIJA 4F65A 3PUPA 2CN5A 2XMYA 4Z7GA 5CXZA 4DEHA
chains in the Genus database with same CATH superfamily
1IAHA 1OIYA 3QYZA 3REPA 1XH4A 4B7TA 3TI1A 4X2KA 2IN6A 2W06A 3FLSA 3P0MA 4XBRA 2VNWA 4FK3A 5GJGA 1L8TA 5C9CA 3MFTA 2HXLA 2HELA 2WU6A 3A7HA 1PMEA 3QLFA 4O0TA 4D0XA 2BROA 5LCJA 5HIDA 2JDTA 3ALOA 3HA8A 3RNYA 4DCEA 5AAEA 1M7QA 1T45A 4RIYB 5HD4A 5M06A 3DAEA 3KB7A 2VZ6A 4EJNA 5CNOA 4JMQA 4O7TA 3O5AA 1DS5A 5EHOA 3R28A 3WZKA 1YHVA 1DAWA 2IZRA 5BMSA 2CNUA 4HPTE 5L6PA 2C6OA 2E9OA 3U8WA 2V55A 3R9OA 1IASA 3BQCA 3ORTA 4O0RA 2UV2A 2BZJA 1LEWA 2WTDA 3EQBA 4I0TA 4I5HA 2CHLA 1I09A 2VWYA 3PPJA 4FIGA 2F57A 1FBNA 4GVAA 3MH1A 5A6NA 4MBIA 3OWJA 4YUQA 4GJ2A 5CWZA 5M51A 1XMMA 1XH5A 2BCJA 4DG0E 3Q9ZA 4X2GA 3H10A 5ANJA 2Z7QA 3NVMB 1Y8GA 5A3XA 4FKOA 4CTCA 2GQGA 3MPMA 3UDTA 5C4LA 1VEBA 4JIAA 3H4JA 3QLGA 4NTSA 2J2IB 4J8MA 2Z8CA 3QUDA 3NUAA 3LW0A 5FG8A 2XYNA 5J9YA 2WXVA 3W0RA 3Q53A 3QUPA 5H2UA 4FSUA 3QGYA 5EM7A 5HO7A 2OJGA 5BVDA 2ZFYA 1JVPP 4A4LA 5IF1A 3ZFYA 3EZRA 4FZFB 1ZWSA 5DG5A 3KVXA 3DBQA 3PPZA 4GK4A 2G1TA 1XJDA 3KRRA 3GC9A 5E8YA 1Q3DA 3TV4A 5AEPA 4DF3A 3V5TA 5GNKA 3IK3A 4RC2A 1CSNA 1B39A 3EWHA 4YNEA 4HVIA 3GQLA 5CAVA 3ORNA 4HZRA 3RHKA 3RPRA 4X2NA 4YHTA 4G16A 3ZYAA 4QYEA 4BCHA 4PMPA 1FMOE 2IZUA 3LCSA 5HGIA 5CF5A 1KWPA 1UNHA 4MHAA 5FEQA 1WFCA 4CV9A 3Q6UA 1PKDA 4FTQA 1KE6A 1H07A 3V5WA 4DFBA 2IW8A 2Y0AA 4JLCA 4WBOA 2R0IA 3C51A 2PE1A 5HE3A 2CPKE 4TTHB 2OLCA 3ZLXA 5HTIA 1OZ1A 3IDBA 5CAUA 3R22A 5B7VA 4J97A 3ZZWA 3MVHA 3FUPA 4C8BA 2A19B 5HLNA 2VWBA 2CGXA 2XJ1A 4P4CA 1ZLTA 2PVNA 3D4QA 4QQCA 5KE0A 2Y6MA 3AD4A 1URWA 3SD0A 3ZSHA 1W2DA 4BWXA 4EK4A 1ZOGA 3H9RA 4TRLA 5DGZA 4NJDA 2JIVA 3E93A 4IC8A 4S2ZA 3OBGA 4D2RA 5B2MA 1R3CA 3DJ5A 5DA3A 2PU8A 3WBLA 3NNUA 4X2FA 3WE4A 4RX5A 3W2QA 4YC6A 3TM0A 5BX0A 4NJ3A 3VBYA 4FTCA 5DOSA 3UO4A 4FTMA 2HOGA 1V1KA 4YZNA 3G0EA 4AGUA 3TTIA 5KUPA 1XBAA 5HU3A 1JSUA 3Q4UA 2J9MA 2YHVA 3DKOA 4FSYA 4R1VA 5JFVA 5BVNA 2WIPA 4O7ZA 5GINE 3Q9YA 3CGOA 4DITA 2VX0A 4RA4A 4YJSA 1H24A 2FSTX 4ZZMA 5AUWA 3ZC6A 5H9BA 4L9IA 3D14A 4CMUA 3UIMA 3QQKA 4IZ5A 3BHTA 5HBJA 2UVXA 5IEYA 3L9LA 2JDVA 5A14A 1XH6A 5FGKA 5L3AA 2CNVA 2IPXA 4F6WA 4U3ZA 4RGJA 3TJDA 4XLIA 5JRSA 3E64A 2JITA 2E9UA 3Q60A 4BCQA 4FL2A 4XNEA 2ITQA 4EK5A 2ONLC 5CU3A 4XOZA 4MTAA 3IPHA 3QKKA 2NYAA 3R6XA 3NMUF 4QRCA 4TXCA 4A4OA 4BCJA 1OPJA 3ZZEA 5AR7A 4PMTA 4U79A 4GV1A 2CGWA 2R3QA 3BYSA 3GT8A 4YR8A 3PIXA 3EFLA 4QYYA 4GH2A 4C7TA 3QWJA 4TWCA 1FQ1B 1WAKA 2XNGA 4ASEA 4WNMA 5D7AA 4E6CA 2OIBA 4PL5A 1G8SA 1GIIA 3ZEWA 3E8EA 3GP0A 3QQFA 4K1BA 5CEQA 5ACBC 4DLJA 5IQBA 2PMIA 2PHKA 3R8ZA 3UQCA 5EM5A 3QRUA 2Q83A 3FKLA 1U4DA 5T3QA 4LGHA 3C1XA 2ITPA 4O91A 2PMOX 4EOLA 2ZDUA 3FMJA 2P4IA 3HMOA 2YAKA 4E4LA 1H1RA 2FGIA 1YXUA 4C3FA 4FEUA 4KKEA 5L6OA 2VTIA 1CKJA 3HL7A 4XOYA 3FMHA 4QMLA 4IFCA 3PJ2A 3GOKA 3U55A 4Q9ZA 2VTMA 3IKAA 5ITAA 1URCA 3QXOA 4QNYA 3EQFA 3B2WA 4AOTA 3P5JC 1QCFA 4TYHA 4I5CA 4TYEA 5ANEA 1JKLA 5AUXA 3ZBFA 1A06A 4JAIA 4I0RA 5FEEA 4KUJA 3FHRA 4DH1A 3PY3A 3OUKA 4XX9A 4BJJA 4UWCA 2XBAA 3FPMA 4IX6A 4LUEA 3AT4A 2EB2A 4Z9LA 2BPMA 2B9FA 4IZAA 1OIUA 2EU9A 1IAJA 4OTHA 2V22A 2JKKA 5F4NA 4EL9A 4ENXA 2A1AB 2FO0A 1E1VA 4EZ3A 3DKCA 4N70A 4QMOA 4RPVA 3I6UA 2XKCA 2XAMA 2CGUA 2QONA 4FSMA 2UZWE 2CN8A 4LG4A 3ZO3A 4AFJA 2J7TA 3PXRA 3PRFA 3GB2A 3MBLA 3MESA 3EKKA 2JAMA 3ZLWA 5E8TA 3PSDA 1FVRA 3VHEA 4XMOA 4M12A 3OWKA 4DG3E 4ENYA 2QD9A 3M1SA 4LI5A 3TJCA 5CSPA 2W1EA 4R7BA 1YI4A 3ZDUA 2BR1A 2WQNA 3BLRA 3QCQA 5LVOA 2R3JA 5AP6A 5EQPA 4EH4A 2Z02A 1KV1A 2ZYBA 3FLNC 5EM6A 2OGVA 4Q5EA 3GC8A 4ANLA 4EOPA 4RFZA 2G2HA 4KS7A 5AAGA 3CE3A 2BDWA 4TYHB 3IW4A 1HCKA 3VN9A 3PVGA 5CU2A 4L7FA 1PKGA 4I24A 4XRJA 4NL0A 4RQKA 4J53A 4CZTA 4IX5A 3Q2JA 3MVMA 4GG7A 4BJJB 3AC3A 2QOIA 4HGTA 4BZDA 3S3IA 1U46A 3NUXA 2FA2A 3LM0A 5AR2A 4FSZA 4G1WA 4BDJA 3UP7A 3E3BX 1PXKA 4Y5HA 3S4QA 2F49A 3H9OA 4YJQA 4DH3A 4F0GA 5CXHA 4ZS0A 1BKXA 4YO6A 5L6WL 5JZNA 5DMZA 1PHKA 2R3FA 5EYKA 4GT5A 1PXNA 3CS9A 1YDSE 1TVOA 5AP2A 4NIFA 2Z60A 2I6LA 3OTVA 4JBOA 2XIRA 5DEYA 1ZYSA 3EQDA 2RL5A 5AADA 3QTSA 4C57A 4X3FA 4JR7A 3FYJX 3F5XA 4O22A 2GPHA 3IDCA 1Q24A 3QUEA 2VGPA 3FSKA 3FMDA 3G9NA 4FOBA 4QMXA 4QYFA 4WRSA 5FEDA 3A7IA 4GUEA 2PWLA 2ZV9A 4JG8A 4EONA 4XG6A 4C2WA 2I40A 1XHAA 4YNOA 2WIHA 2DS1A 4MXOA 2A4LA 3QRIA 2PZPA 5BVEA 2BRGA 4ZIMA 2C3IB 1K3AA 2WELA 4DGOA 2GHMA 2JGZA 4JOAA 5IQIA 4WOVA 3D83A 3PLSA 4HYSA 2YWPA 3MFSA 4NSTA 2HY0A 2UZOA 2XRUA 2ZB0A 1M2QA 4MD7E 5HHWA 4JDJA 3U9CA 4PNKA 5F9EA 3F3ZA 4BTMA 3UP2A 3C7QA 3C5IA 2B55A 2PMLX 4G9CA 5HG7A 3VBWA 5GIPE 2JIUA 2ETKA 4IJPA 3RK9A 2FB8A 2ITTA 3OF0A 5I3OA 4CTBA 4OR5A 2IVVA 3BYOA 2C1AA 4GS6A 1F3MC 3HV4A 3LPBA 5ANOA 1O6YA 4DAWA 4CG8A 4GJ3A 5CSXA 3VUIA 3LXNA 4ANQA 5JZJA 4MQ1A 4M67A 2P33A 4YPSA 4DH5A 3BLHA 2FYSA 4Q9SA 5EI8A 3F3UA 3GCPA 4G6NA 5DBXA 5HESA 4FTRA 2YCQA 3RMFA 3JS2A 4ZLZA 3EFWA 5AP7A 1KOBA 4DFZE 1TZDA 4DHIB 1GZOA 3KA0A 1OM1A 2C69A 5EYMA 5LVLA 3ZC5A 3LQ3A 5BNJA 1WBNA 1AD5A 5IEXA 3R7YA 2E9PA 4L45A 2F7XE 1VYWA 2J51A 3R02A 4EQUA 3FLYA 3VS2A 4KBCA 2IVSA 5I9YA 4ITIA 1HCLA 1PMNA 2H8HA 1UU7A 3KCKA 3LE6A 4IB3A 4JQ7A 5AR3A 4ANMA 3HMNA 4G3CA 3AC8A 4EBWA 1X8BA 3VUHA 3FQEA 1NXKA 4O0SA 3IGOA 4ZJIA 3B8QA 3GOPA 3FY2A 2QU6A 3G9LX 3OXIA 3QD2B 3WF8A 3JVRA 2RFDA 1ZAOA 4BDBA 1Z57A 4KBAA 2YIQA 5CEMA 1ZYLA 3AXWA 5HD7A 4XLVA 1NT2A 2PUNA 4N57A 5BVWA 3NDMA 3R2BA 4U97A 4BCIA 5CVHA 2Y9QA 3DJ6A 5EI2A 3FXZA 4GCJA 4D9TA 3MY1A 4ZLOA 3MV5A 4I1ZA 4AAYA 5D10A 4F7LA 3UZPA 5A4TA 3D7TA 1OIQA 3JXWA 3LJ1A 3PSBA 2PZIA 4YSMA 4I21A 4O7WA 2JKOA 1PYEA 3CXWA 4I23A 3OTUA 5EM8A 3DB6A 4RFMA 4PL4A 2XK9A 4UMRA 4FGBA 3G33A 4IZ7A 3OVVA 5AR4A 2W4KA 4AW5A 4GKHA 4EKKA 4FEQA 2UW3A 4QP6A 4ACMA 4C4HA 2QG5A 3PJ3A 3RJCA 4RIWA 4U8ZA 4FG8A 3O17A 1PRYA 4CFXA 2C0IA 3MTFA 2JBPA 2C6DA 2VWUA 3DTWA 4H39A 4LOQA 4FK6A 4AT5A 5DWRA 4YBKA 3ZCLA 5HX6A 3Q04A 5I9UA 3LCOA 2V5QA 2QR8A 4ZY6A 3DPKA 5DRDA 4ZTNA 3UOLA 4Z7HA 4S31A 4IACA 1LPUA 2YM5A 3AC2A 4KAOA 4FSWA 3VWAA 4E5AX 3DS6A 4XP3A 2CCIA 4OLIA 4JR3A 4XP0A 3U4WA 3PFYA 3DTCA 2C6LA 4KWPA 3BHYA 4NM0A 1UU3A 4RVKA 3V5JA 3W2SA 4ANNA 4ACHA 4IM0A 5KMJA 4YPDA 3FBVA 4O6LA 5AR8A 3PP0A 4CRLA 4GEOA 2G15A 4RWKA 4B9DA 4DH8A 3UOHA 1UU8A 4ALUA 4IANA 3LCTA 3LFFA 3W1FA 3ZDIA 5L2TA 1FVTA 5L4QA 4XG3A 5CZHA 5IDNA 5J5SA 4IAAA 3MA6A 5GJFA 4RFYA 4B6LA 4DE4A 3RCJA 2XEYA 4FA2A 3OMVA 4BTJA 4D2PA 2XUUA 4ACCA 4C4EA 4DC2A 5DFPA 4B8LA 2BKZA 3PRIA 4TNBA 1B38A 5IUIA 4I94A 2OZAA 4OTIA 4QP7A 3C4WA 4TWNA 4F9WA 2QI8A 4BI0A 1J91A 2BVAA 2ZOQA 3LXLA 3UIUA 2J5EA 4CKIA 1LR4A 3OCGA 4HCTA 4I92A 5DI1A 5HTBA 2XALA 1SMHA 3AMBA 2AYPA 3FMEA 5AUYA 3LMHA 3T8OA 4YJUA 3UJGA 4A7CA 3PUFC 3TUDA 3W0SA 4BKYA 5AIRA 4C59A 5K4JA 3UNZA 4NW5A 3ZMMA 4ASDA 2EXCX 4JBQA 4DBXA 2OH4A 1H00A 3F5GA 3UPZA 2CCHA 3A7FA 4CSVA 2XNNA 5A4LA 2IF8A 1H1WA 3ULIA 4IIRA 1STCE 3RINA 5CI6A 4H3PA 3DKGA 4CLIA 4L68A 5M53A 3GGFA 3D9VA 3GU8A 3QYWA 4NK9A 4CVAA 4K77A 4U5JA 4O4EA 4D55A 4KD1A 1KE5A 3A4PA 4UWBA 4AN2A 3O8UA 3QRKA 4FV3A 3NYXA 4O2PA 3POOA 2ITVA 2Z7SA 4GU9A 4PTEA 5LVPA 3NRMA 4IVBA 4E6DA 4K6ZA 3TIYA 1WBTA 3FYKX 3ZUVA 4E5BA 1AGWA 4FTIA 5KMMA 1BI8A 3II5A 3KF4A 2CLXA 5M09A 5JGAA 3ZM9A 3EN5A 1Q41A 3EQPA 1ZYJA 4A9RA 3A7JA 1PJKA 1OIRA 3SLSA 4ANBA 2V62A 4BCOA 3F3WA 3IGGA 3OOMA 1WVYA 3T3UA 3W2PA 4XHKB 3TZ7A 4AOIA 5LMKC 2QR7A 1W2CA 3WF7A 4MQ2A 3OS3A 3RAIA 2PVJA 4O84A 2IW6A 3FSFA 5TR6A 5AAFA 3MB7A 2R7IA 3TIZA 2IZSA 4K8AA 3P79A 1H4LA 3FC1X 3R7OA 4O1OA 1DM2A 4KKHA 4WG3A 1PXLA 3UO5A 3N4UA 3DGKA 2WTWA 5AX9A 1H1PA 3KY2A 3ZS5A 3HAVA 1MRVA 1UKHA 2I0EA 2I0YA 2E9NA 2QOQA 3DA6A 3TZ9A 1VLRA 3ROCA 1QMZA 5AA8A 2OF2A 3IO7A 5E92A 4D4VA 3QTIA 4W4WA 3C4XA 5HLWA 2R0UA 4ZSGA 3KREA 5BYZA 4KIKA 4U45A 4H3BA 3VAPA 3QTUA 5DR9A 1YOJA 3VVHA 4I5MA 4L52A 4HVSA 2XCKA 5BVFA 4H3QA 4KABA 2J0IA 3V3VA 3UOJA 3MGYA 3UGCA 2CKQA 2UZUE 3L9MA 3LVPA 4NEUA 3I60A 2BTRA 2XNPA 3CKWA 3UYTA 2VO7A 5IA1A 5IUHA 3QQUA 5BV3A 2EXEA 1H1QA 3K5UA 3NGAA 3ZEPA 3C4FA 2VTHA 3C4CA 2P2HA 4R5SA 5DLSA 3LLTA 3GQIA 5ANIA 3HRCA 4RC4A 4UV0A 4YO4A 3DK6A 2XM9A 3ZUTA 5TE0A 2A27A 2ETRA 4MXXA 1ZOHA 2VX3A 3OEZA 3QD0A 4CG9A 2QO7A 5CLPA 2QU5A 4M68A 1P14A 4LV8A 4HVDA 4L01A 4AU8A 4IAFA 3MSSA 2ITOA 3ORPA 3DBEA 2WOUA 4UMPA 5CEKA 4WNPA 4YSJA 4JS8A 4M0YA 1V0OA 3UNJA 4BB4A 3WIKA 3PVBA 4UXLA 4F9CA 3COKA 3UOKA 2OH0E 3U6JA 3QGWA 1XBBA 3KN5A 2OJJA 4GIIA 4XCUA 2WMTA 3LFQA 4MEDA 4BI1A 3AT2A 4O7RA 3SRVA 1J1CA 3IS5A 3MFRA 5IQAA 5IQGA 3FXWA 4O7LA 2QLQA 3U6IA 4XRLA 1REJA 2WTJA 4FC0A 1DI9A 4GUBA 1J7LA 3BU6A 3ML1A 2X39A 4IB0A 3OW3A 3ROYA 2QC6A 4KIKB 3LQ5A 4EOSA 5I3RA 4J96A 4M84A 5JQ8A 4QP2A 2C3LA 5AM7A 4AXAA 3SKCA 4G6OA 3NR9A 2O2UA 3OCSA 4WG4A 1FGIA 5M44A 1BMKA 4QMYA 3VUKA 5IH5A 3VQHA 1H28A 3O50A 2VTNA 4CQEA 4EH2A 5EK7A 2JKQA 4PTGA 4MUQA 4AXDA 3NUPA 2OZOA 3H0YA 1FMKA 1Q61A 3QQGA 4TYJA 5M08A 1LEZA 4DHZA 2KULA 4C0TA 1SNUA 5HVYA 3AD5A 4E93A 4MXZA 3QQJA 4ZSAA 3H3CA 2Y8OA 3LFAA 4D2SA 2B4SB 1FGKA 3Q5ZA 3IW6A 3IW5A 4U42A 4EC9A 4U9AA 3QL8A 3EYGA 2OU7A 3H9FA 4IWPA 3MPAA 5G6VA 3MY0A 3AQVA 5FQDC 2WO6A 5E7RA 3MVLA 4UXQA 4CMOA 4MWHA 3K5VA 3QHRA 2F2CB 5JFWA 3RAWA 3FJQE 3ZUUA 4F09A 2WHBA 4QPSA 5IISA 5I9XA 2XKDA 3VS3A 4A07A 4XEYA 3SRVB 3FY0A 4BTFA 5J5TA 3OBJA 4GT3A 3K3JA 4LDTA 2R3IA 4O1PA 4ZSEA 2IJMA 3N4VA 2BRMA 2VTLA 4E4XA 2XVDA 1PXIA 3OT8A 4C4GA 3O23A 4FTJA 2XK6A 2AEGA 4EQMA 4PL3A 4N4SA 1MP8A 5E1SA 3VS6A 4L42A 5FXRA 3CPBA 1OMWA 2W1FA 4QMNA 1JNKA 4E26A 3LQ8A 3TDWA 3PYYA 4RLLA 4O4CA 4RQVA 1Q3WA 4FTNA 5FLFA 4TYGA 3CD3A 4E8AA 5CVFA 1ERKA 2A98A 4AF3A 4UZDA 2I1MA 4WT6A 4GYGA 3E63A 2P55A 1OL1A 2HZ0A 1REKA 3HV6A 1TFFA 1GOLA 3RGFA 2YISA 4QP4A 5J1VA 3TV6A 1WBWA 3WF6A 5BYLA 5HCYA 5AUTA 4M14A 5K5XA 2B9JA 3NZ0A 4XG7A 5B2LA 4MWIA 3ZU7A 2HWPA 3CQUA 4J99A 1GIHA 3UIXA 3R7IA 4XG9A 4CZYB 2J4ZA 1RQQA 3AKJA 3BU5A 4ACDA 4FIIA 4M0ZA 3MIYA 3HRBA 4U80A 3TKUA 4AZSA 4QEBA 2ZM1A 3DOGA 5DR2A 5HG8A 4C4JA 2C6TA 4PDOA 2C3KA 4K18A 2J0KA 1CKIA 3W0NA 4DLIA 3ACKA 3SW4A 4YZBA 4RBLA 2HZ4A 3TL8A 5GZAA 4GYIA 5HTCA 1WVWA 4O27B 2ZJWA 3OCTA 2X4FA 2WMWA 2XNBA 5BUIA 3EN9A 4FL1A 3R9RA 5FWKK 3C0GA 3WILA 4EWQA 2X7FA 2GNIA 2I0VA 4OAUC 4DEGA 2Z7RA 1XO2B 4IHPA 3AD6A 5IUGA 2NO3A 2UW8A 4W9XA 5IA3A 2FSOX 4M66A 5JEBA 3NUNA 4X3JA 3DNEA 4AWIA 4D4SA 3HNGA 3MI9A 3Q2MA 2VWVA 5FTOA 4BFMA 4ALVA 3KU2A 2QVSE 4DDIA 1G5SA 4UYAA 4IXPA 4IZYA 5HO8A 3AC5A 3UZRA 3D0EA 3PZHA 1OL5A 1Q97A 4IAIA 3KKVA 3R83A 1TQPA 3DQWA 1M2PA 1YHSA 5LWNA 2ZV8A 4C61A 1Q99A 1OKYA 1Q8ZA 2X0QA 3ANRA 3KMWA 4W9WA 5HE0A 2OIQA 1G3NA 4LV5A 2WQBA 3T9IA 5FUTA 2C0TA 5HO6A 5J9ZA 1OKWA 4C36A 3RM6A 4AN9A 4NM5A 2W7XA 4LRJA 2C4GA 4NZWB 4D1XA 1A9UA 3PXZA 3SQQA 1YXTA 3L8XA 4S30A 2XIKA 4UEUA 3R0TA 3TV7A 3QF9A 4W4YA 4C37A 5A54A 4AQKA 1NVQA 4MX9A 3WOWA 4KIOA 2W1IA 3E3PA 2OJ9A 3HX4A 1YI3A 4AW0A 4FSRA 4BCPA 3LAUA 1YWVA 4AP7A 3GCQA 2DQ7X 3F2RA 4JDIA 3CJFA 3Q9XA 4UMTA 3C9WA 3ORZA 3PA4A 2Y4PA 3GEQA 4RMZA 2VRXA 4ZY4A 4U40A 5H8GA 2BDFA 4OTWA 2A2AA 3BBWA 3ITZA 4I4EA 4KIQA 3ZLSA 3ZSIA 1G8JA 4FTUA 3BLAA 2AC5A 2HY81 3QD3A 4QP8A 3SXSA 5CAOA 2W1DA 2X9EA 4D5KA 3RHXA 2UZBA 3BE2A 2R3MA 4EH8A 2YZLA 4BDDA 3BV3A 3DDQA 4F7SA 1IA8A 3DJ7A 4CT1A 4GMYA 4LOPA 4IWOA 3LFSA 4Q5HA 3MPTA 3JY0A 4EK8A 1OPKA 3EMGA 2FH9A 3CLYA 3ZXZA 3LLAA 3MWUA 4QTAA 4YLLA 2XRWA 3VC4A 3EH9A 3RALA 3UQFA 3IG7A 2V7AA 3NNXA 5HQ0A 2Y6OA 5AMNA 1OGUA 2XK3A 4Q2AA 3R7GA 2J90A 4QYGA 3AKKA 3MS9A 4I93A 1IRKA 1K9AA 3RAHA 1OECA 3KCFA 4NCTA 3TKIA 5C4KA 4QYHA 4J98A 4LM5A 3FEGA 4RT7A 4CQGA 4OUCA 3HDNA 3P4KA 4FT5A 4G3GA 5CVGA 4QT1A 5L2WA 4FKUA 1ZYDA 4RJ8A 3VUMA 4HNFA 3AGLA 4BRXA 4E20A 3RAKA 1TQIA 4OTQA 5D1JA 4BKJA 4OTPA 4RSSA 3RNIA 4DFNA 4S32A 5H3QA 4P7EA 4AX8A 1OBDA 4CXAA 3GC7A 3F7WA 5AP3A 1CKPA 2GFCA 4JQ8A 3VS1A 4AUAA 4W8DA 2F2UA 4DDGA 2YFXA 2IZTA 4XV1A 4IDVA 3L9PA 3DBCA 3I5ZA 4M69B 4YZMA 1F0QA 4OW8A 2VX1A 2PVFA 5JGDA 4LL0A 3FKOA 1K2PA 3TT0A 5LARA 2BZKB 3OY3A 2VTSA 1DI8A 5IKWA 4EEVA 2PPQA 3F61A 5CENA 3SV0A 4BYIA 4EYMA 3SXFA 3FPQA 4CRSA 3PXFA 4CKRA 4CFUA 1JBPE 5K0XA 3NUYA 2GNGA 3QKMA 4OTFA 4AE9A 3NUUA 3FLZA 3NIZA 3MY5A 1TQMA 4PDPA 5KO1A 1WVXA 5CY3A 2RG5A 3NWWA 2O5KA 5CQUA 3E5AA 4BVUA 2RG6A 4AACA 2P3GX 4AE6A 4C35A 1FPUA 4S34A 1Q62A 2Y4IC 4FICA 4C58A 4CNHA 1JPAA 2VWXA 3K54A 5M4FA 3DB8A 3V8WA 5IDPA 1OGYA 4BWPA 1OKZA 1U54A 2GCDA 1YXVA 3F5PA 4W4XA 2WMSA 3BKBA 4FSTA 4AS0A 3O7LB 4PPAA 3RBWA 4WG5A 3AOXA 4YC3A 3TG1A 4CV8A 4DEEA 4YU2A 3C13A 4J71A 4RWLA 1S9IA 4W8EA 4DGLC 4WNKA 1OI9A 4FEXA 4GFGA 3CP9A 5EKOA 2QOHA 3S1HA 5CTPA 3PE2A 1W8CA 4O7YA 4CFNA 2YZAA 1YDRE 2R3LA 2W5BA 4O0UA 5KHWA 2XZSA 4E4MA 2RFEA 4G3FA 4ZJVA 4I41A 4EHZA 1U5QA 4BGQA 3B8RA 3SDJA 3F2NA 1JSVA 3WIGA 4DFYA 2UW5A 3WZEA 4E3CA 3L1SA 3TACA 3KULA 4RJ5A 1W2FA 3P23A 3MVJA 3RK7A 2VGOA 5K3YA 4C4IA 1Q8UA 3ERKA 2XNEA 4EHGA 2OWBA 2OF4A 2R4BA 4IAZA 1JSTA 1CTPE 2PTKA 5IQCA 5FP5A 4CFFA 2GTNA 1XH7A 4N6YA 5IH6A 4AZEA 3CY3A 2X8EA 1U5RA 4KSQA 3ORKA 4IEBA 2QO9A 5AM6A 3LFEA 1M14A 4X0MA 3L8PA 4NH1A 1CM8A 3Q4TA 4FZ7A 3RP9A 4FIEA 2GTMA 1U54B 1DAYA 2QQ7A 4FX3A 4QQJA 2PUUA 2X7OA 3JPVA 3WF9A 4FV1A 4XUFA 3OEFX 2CNQA 3GC0A 4NFNA 3I79A 4CMTA 2PULA 3JR1A 3PDTA 3ZO4A 4RX8A 1Y91A 3FZSA 4ASZA 5LOHA 5CQWA 2RF9A 1YQJA 2VTTA 3VUGA 2F9GA 3KXXA 4BDGA 1SZMA 4BBFA 3I81A 2C5NA 1UWHA 1NVSA 4MNEB 4D1SA 4GW8A 2J50A 4NKSA 2RIOA 4R6VA 2WMXA 3V8SA 3ZH8A 3RVGA 5CAPA 2WAJA 3SW7A 3W0MA 2PVRA 3V51A 1JKTA 3L8VA 2WQEA 3KULB 4FF8A 3OD6X 4NM7A 4O0VA 5IA4A 4IWQA 4H36A 2IVUA 4AG8A 2OIDA 3UZTA 4GVJA 1IG1A 2FSLX 3BPRA 4I4FA 3KXZA 3RWPA 2BMCA 3PJCA 4W4VA 4AXCA 3KVWA 3CEKA 4IADA 4EOOA 3BGZA 3N51A 3NCGA 2J5FA 4JRVA 1KV2A 3AGMA 4R3PA 4GFOA 4F64A 1IEPA 2PK9A 3F69A 4FI1A 2WMBA 5TO8A 2PVHA 3CIKA 4MF0A 2RGPA 4FKVA 2JLDA 4FG9A 3R9HA 3UC3A 4U44A 5T6KA 4AA4A 2XBJA 3G51A 1V0BA 4XBUA 2C1BA 4QP1A 1PXMA 3LMIA 2VU3A 3KRLA 1YDTE 3LJ2A 1BL7A 2C6EA 3CGFA 4A9SA 4QTCA 3CJGA 1OKVA 4K2RA 3JUHA 4EWHA 1IA9A 4FTAA 4FV5A 3O7LD 2ITXA 3QZHA 4JRNA 2UW6A 5BYYA 3ZRKA 1XQZA 3TZMA 2ZDTA 3DDPA 2R3OA 3R8VA 4GT4A 4JNWA 4Y83A 3ZM4A 3BYVA 3VQUA 4A06A 2C68A 3SHEA 4EHVA 3C0IA<