4W8DA

Crystal structure of mst3 with a pyrrolopyrimidine inhibitor (pf-06454589).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase 24 36 kDa subunit
publication title Discovery and preclinical profiling of 3-[4-(morpholin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl]benzonitrile (PF-06447475), a highly potent, selective, brain penetrant, and in vivo active LRRK2 kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4w8dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4w8dA01
2BHEA 3NW7A 2PWLA 2YLEA 4NWMA 3HUCA 4QNAA 1OKWA 3FC1X 2RF9A 3OROA 4JS8A 5CVFA 3L9MA 5CVHA 4D28A 5D7VA 4ZMFA 3PLAE 1XQZA 2XJ0A 3BYSA 4LQMA 2UZWE 4KIQA 2ZB0A 2YEXA 5DRBA 3BKBA 4FIEA 3HMIA 5J95A 5IUHA 4FVQA 2X2LA 5A3XA 1GZOA 3NNUA 5C1QB 1W83A 4LOQA 1EH4A 1LR4A 2VWZA 3KK9A 4C62A 4WKQA 2R3NA 5J87A 5BVNA 4DGOA 4FKOA 4UN0C 1ZLTA 5FBNC 1Q99A 2YAAA 1UU9A 2ERZE 3OCBA 4GCJA 4IAKA 4JG8A 4MBLA 4FMQA 4LUEA 4NKSA 4QOXA 5FLFA 5DMZA 4FKIA 2XM8A 1V0OA 3CE3A 4ANQA 5EOBA 3OXIA 4QMXA 2ZV9A 3FC2A 2GNHA 2I6LA 4HCUA 3ZHPC 3RKBA 5L8KA 1K3AA 3AD4A 1JKTA 2VTMA 3SKCA 3CXWA 1JSTA 4BR3A 4XRLA 5IA1A 4N6ZA 4FGRA 3NRMA 1YWNA 1ZRZA 3HP5A 3R9OA 3TUBA 2BRHA 3RP9A 4PNKA 4FV7A 3GI3A 2WQNA 3PPKA 3LJ2A 4O22A 2WTKC 2CKOA 2PVFA 1V0PA 5E8ZA 4RC3A 2GMXA 3U6IA 1P2AA 3EQRA 2OJ9A 4RIYB 4AWIA 3PWDA 3W2SA 4FKUA 2CGUA 3A7FA 5EKNA 2F57A 3M11A 4GRBA 3BHTA 4BIEA 2PZYA 1XKKA 4I5PA 1YI4A 1GZNA 4PX6A 4BWPA 5LMBA 4O7NA 4DINA 2DWBA 4FBXA 4EH3A 4H3QA 3PE1A 3IKAA 1VZOA 1JVPP 4FV5A 4GK4A 4ZEGA 4RJ7A 2J2IB 2QU6A 5FXRA 5HIDA 2W7XA 3I6UA 2J50A 2W1EA 3QCYA 4YHFA 4BY9E 4PY1A 4IVDA 1Q3WA 3R8LA 5L2TA 3ENHA 4F1OA 2XK9A 5HO8A 2YZLA 2F7ZE 3QL8A 2E9OA 4FKSA 3FEGA 4FL1A 4FUYA 4HYUA 2XRWA 3GU5A 4BWXA 3NYOA 3PG3A 4FVRA 1E1VA 2UW7A 4NH1A 1OKVA 5EYDA 4M0ZA 4BI1A 4ARKA 1J3HA 2C3IB 5JT2A 4C38A 4QQ5A 1HCLA 4O0YA 2BKZA 1CKIA 3NUXA 4G6OA 4RC2A 4H58A 4UXLA 4GSBA 4DGNA 4AGUA 4UZHA 3CPCA 3BCEA 4PPBA 4WBBB 4XHKB 3VS4A 3FPMA 5J1WA 5IA4A 2C5OA 3E93A 1URWA 4U6RA 1O6KA 2X0GA 5IG1A 2RG6A 4FNWA 2CGXA 3PVUA 3UIXA 3V01A 4YURA 3W8LA 3L9LA 3THBA 4UY9A 4TYJA 5GJGA 4BDDA 4QQCA 1P4OA 3BE9A 3QFVA 5HQ0A 3TKUA 3L9PA 3ZFXA 2ZV2A 1BKXA 5F95A 4JNWA 4PDPA 3LPBA 4X2NA 4XS2A 1OUYA 1Y91A 1O9UA 3H30A 4CZYB 3DNDA 5AUUA 2J0LA 2J0MB 2W4OA 4QP1A 5I4NA 1ZMVA 1Q61A 3V5LA 4YMJA 5M09A 4L52A 3FLNC 4FZ6A 4AOJA 3BYVA 2WTIA 1CMKE 2W5AA 3CR0A 1OL5A 1YVJA 3FDNA 4LOOA 4PTCA 3QUDA 4A9YA 2XK6A 3OD6X 3IG7A 2ZB1A 4MF1A 4LRMA 3H3CA 3LXLA 5AV0A 2C3KA 5AIKA 5HZNA 3DPKA 3RCDA 3ZC5A 3OCSA 1MUOA 4PWNA 3BBTB 4MNEA 3ZLXA 4MQ1A 4C35A 5I9YA 3DXNA 3GCQA 5LCJA 4CFWA 4EKLA 1ZOHA 2BDJA 2HWOA 4FT7A 3NVMB 2GDOA 3H9FA 3KRLA 3I5NA 1ZYCA 4X3FA 4G34A 2OJFE 4C34A 4HJOA 2CPKE 4K9YA 3LW0A 1YQJA 1WBWA 3EN7A 3H0ZA 1OB3A 4A06A 2YJSA 2H8HA 5CAUA 1V1KA 4BDGA 2OJIA 2X6EA 3FKNA 5F20A 1H28A 4BKJA 3TI1A 4C0TA 4H05A 1M2RA 1H8FA 4TT7A 4ZZNA 4ITHA 1FOTA 2CN8A 4EOJA 4EWQA 4CKJA 1DS5A 3JR1A 4NCTA 4U8ZA 3ZDUA 2ITNA 3ZDIA 4QMYA 1UKIA 4AX8A 1RE8A 1ZAOA 4EOIA 2XP2A 3QBNA 2ITXA 3DBQA 4FG9A 3U54A 2VTJA 4B6LA 5HE3A 4LMNA 4DH5A 4IEBA 3LFNA 4K77A 3BX5A 2VTLA 3QX4A 2GCDA 3O51A 4RZWA 5EH0A 4TNDA 4CTBA 1ZYLA 3G0FA 5GHVA 3WZJA 3COMA 4X2JA 5KZ0A 4RQVA 3E87A 3COKA 3G5DA 4I5MA 2GTNA 2WELA 2HENA 3KMMA 4R5YA 3TKIA 5LVMA 3BU5A 3NS9A 3LKMA 3RPRA 2PVJA 4FEUA 2QURA 4YLJA 4FSMA 5AV1A 3LIJA 2VX3A 2JFMA 1H24A 2R3MA 2GQRA 5FDXA 3FXWA 1OPKA 3KF7A 4TYIA 2IW9A 2Y4IC 1JWHA 2VTRA 5FEQA 3TTIA 5IEYA 4V0GB 5ITAA 2YM7A 3VUGA 3C5UA 4JDJA 4UV0A 4AW2A 5DR2A 5HVYA 1XHAA 2XIXA 1QPCA 3LM5A 1L8TA 3K2LA 4AU8A 1PXMA 2BALA 3VS2A 4AF3A 4EOPA 4M97A 3F3TA 1YDRE 4QMNA 2QOQA 5CASA 4G3GA 3SV0A 4FVPA 3REPA 2BCJA 3GUBA 4J1RA 3ZC6A 4BTFA 3PJCA 4IWDA 5E8UA 1UNLA 3TIZA 5EYKA 2GFCA 3C0IA 2J9MA 3F82A 1IA9A 3TZ7A 4EQMA 4U79A 1UVRA 1NA7A 4YJRA 5JSMA 1FBNA 2H6DA 1F5QA 1PMEA 5KMIA 3QTZA 4B4LA 4PMMA 2P55A 4MWIA 3TT0A 1PKDA 2OO8X 3NNWA 2X81A 3FZSA 4CLIA 4C2VA 2ITPA 4MF0A 5H9BA 1OUKA 4Z55A 4XV2A 3R6XA 3DU8A 5CI6A 5HI2A 3GC9A 2QCSA 3EZRA 2PVKA 3ZEWA 1OVEA 2R3OA 3CD8A 3GENA 4TWCA 4CEGA 3VBXA 4ZZOA 3OEFX 1UNGA 3D7TA 4FT5A 4IFCA 4TW9A 3UVPA 3EH9A 3DK3A 4JIAA 3VIDA 2G2FA 4IJPA 3VBTA 2BHHA 2FA2A 3IW4A 4UMRA 5BYYA 2YFXA 4O7ZA 3ZLWA 4DGGA 3S2PA 4BGGA 4O83A 2X7GA 3FLQA 1JPAA 3LJ0A 3NAYA 4CV9A 5EI6A 3ORTA 4LGGA 5HE2A 3BBWA 5IPJA 3PSCA 5D12A 4DFXE 2BIYA 3R00A 3Q4TA 3CTJA 3C4EA 4PL3A 4BI2A 3GGFA 2X2KA 3HRBA 3UO6A 3GC7A 5FXQA 4YNEA 3KF4A 2OXYA 3ZLYA 4I3ZA 4ZJJA 1GIHA 2I0EA 1ZZ2A 5G1XA 2JD5A 5GJDA 3MYGA 3HP2A 3UC3A 3BQCA 5FP6A 5IH4A 1H1WA 1R78A 3EIDA 3WE4A 1QPDA 1ZYSA 2VTNA 3F66A 2HCKA 1WBNA 3P4KA 3HA8A 3NUUA 3LFQA 3DJ6A 5CY3A 3BHVA 3WBLA 4AE6A 2NNWB 3FZRA 4O0TA 4WBOA 3EFKA 1T45A 3UQCA 2F7XE 3EQHA 4IX5A 3ZFMA 2YWVA 3PIZA 3O23A 3MY5A 2BRNA 3EFLA 4IMYA 4JBPA 5AA9A 4XG8A 2ETMA 3QUPA 3QHRA 3VBQA 5JH6A 4DFBA 2C6MA 2CNUA 4D9UA 3QTUA 3T8OA 4XV3A 4FYOA 4IDTA 3MFTA 2WMSA 4ZMEA 4D55A 3B2WA 4IVCA 3BHUA 3O8TA 4BCKA 5K4IA 3DAEA 1IRKA 3CC6A 4QYEA 2OJJA 3R7OA 3WOWA 2WTKB 2OXDA 3V51A 1CSNA 2QLQA 3JVRA 5HCZA 4M7IA 2X9EA 4E4LA 4JDHA 3U9CA 3F7WA 3QTQA 5AP2A 3FMDA 4R78A 3D9VA 2ZYBA 3FXXA 5TOZA 4R5SA 3V8WA 4YZ9A 3HMPA 5CEOA 5A46A 3LAUA 3FI2A 1IAJA 4BYIA 4XLIA 5FUTA 2GNGA 4QMQA 3IPHA 3PXZA 4QP6A 4DEHA 5HHWA 1OPLA 1H08A 2C0OA 4KAOA 3ZEPA 2NP8A 3R9HA 3MBLA 4K2RA 4ENXA 4XG9A 3EYGA 2B52A 3EL8A 4JQ7A 1I44A 3TNWA 5EW9A 4I21A 3RTPA 3KRRA 3BQRA 3V6RA 4H1JA 4FTUA 4S30A 5IH5A 5CU0A 1UU8A 2JITA 2W96B 2I1MA 4EOQA 1G8AA 1PYXA 3SXRA 2R3QA 5GIOE 3W18A 1OM1A 2J7TA 5HOAA 3OMVA 3UYTA 3WZUA 2JDVA 4KBCA 5A4CA 4IADA 3GT8A 1LPUA 5DT3A 3QD0A 4QQJA 4C4JA 1APME 3II5A 5DOSA 4TWOA 2PULA 1H1PA 4ERKA 5L4QA 4IAZA 2A0CX 3R83A 1DI8A 4AZTA 4CV8A 3D5UA 5L6OA 2HOGA 3E8CA 4C3FA 4L7SA 3QCSA 4K1BA 1OI9A 4XG6A 3FMMA 3ZSIA 1O6YA 5LVLA 3VS6A 2VTHA 3OWPA 3PJ3A 3VW8A 4YJNA 4RIXA 3BEGA 3P5KA 4G6LA 4RVMA 5K0KA 3R7IA 4PL4A 4YC6A 5FTQA 4ALWA 2WTWA 4OTGA 2VV9A 4PF4A 4BZNA 2Z7QA 2W1FA 4QP3A 3FLYA 4XP3A 1SNXA 2QO7A 2O0UA 3NLBA 4JAJA 3UMXA 5CZHA 1ZOEA 4IE9A 5D7AA 4DFLA 1G8SA 4PPAA 4RMZA 4FSWA 5JEBA 4PNIA 4QP7A 4MBIA 4AOIA 3KMUA 1JLUE 4BI0A 1WBOA 3NGAA 1NXKA 2XKDA 4A9RA 2UZNA 3LFCA 3OOMA 3Q52A 3QQHA 4G2FA 4FSRA 4YJTA 3HV6A 5HVJA 4G6NA 2W9ZB 3V5WA 4BDHA 3VUKA 4E3CA 5C9CA 4JVGA 3ORIA 2A4LA 4CRSA 5J9ZA 3IW8A 5IISA 4KRCA 2BMCA 3F7ZA 5J8IA 3QZFA 3GCPA 5KE0A 5HKMA 2XNMA 5M56A 2W1DA 1URCA 2W17A 4FTIA 4HZRA 3LMIA 4FIHA 2QQ7A 5HD4A 3ZUUA 2BR1A 5J7HA 3E63A 4N6YA 1H27A 5M06A 5HLWA 5CI7A 4QMWA 4BICA 4TYEA 1XBBA 3K3JA 1OL6A 3K5UA 5L2SA 3F5GA 2EXEA 4E6AA 4W4VA 1K9AA 3PRIA 4RIYA 3QRKA 3PY1A 5BPYA 3PFQA 4UXQA 3FYJX 3OOGA 4FZAB 5L8LA 1OL1A 2DUVA 3DBDA 5CSVA 3IQ7A 1YHVA 4YBKA 2XRUA 3IW7A 5EM5A 2JKKA 3SAYA 3QTRA 5JFVA 5K5XA 3AT3A 3KVXA 4LGDA 2B9FA 4FK3A 4RA4A 3UO5A 5CSXA 3UPXA 5AAGA 3BZ3A 5BQ0A 1XWSA 3R2YA 3HDMA 5J79A 4EOLA 2X4ZA 3QA8A 4QMPA 4F7SA 3F88A 3KGAA 5JMSA 3PVWA 5CQUA 2BDWA 3FMLA 3G2FA 4QMOA 3L8VA 4QNYA 4M69B 2OLCA 2C69A 3O7LD 2OICA 4ID7A 3F2NA 3FZTA 4DG0E 3ZRKA 3HVCA 2VTPA 5D41A 3KL8A 4NYEA 2XK8A 4PDSA 5KZIA 3SD0A 2OI4X 3ZYAA 4GJ3A 3AMAA 3QGYA 4M8TA 3FI3A 3IK3A 2YITA 1SNUA 3ODYX 3TZ9A 4CT2A 1F0QA 1M7QA 3VBWA 4RA5A 2EB3A 4GK2A 4NM7A 2I7QA 3CY3A 3ETAA 1ZARA 5CSHA 5EW3A 3EYHA 1YOMA 3Q9ZA 4XEYA 3GFEA 5EFQA 3CGOA 5D1JA 5BVKA 4FYNA 5ETCA 2JAMA 4EH8A 3UVRA 4TYHB 3KVWA 3BU3A 2OK1A 2ZJWA 2EUFB 4FTNA 5HICA 1Y6BA 5CXZA 5JN2A 3KQ7A 4JDIA 3DZQA 4NFNA 4OUCA 4MYGA 5DLSA 5IQBA 2XIRA 2HYYA 3ZBFA 3AT2A 4PMSA 4APPA 2QR7A 2QO9A 4FTTA 4I22A 2JFLA 4NSTA 5AJQA 3V04A 3IDBA 1PY5A 2FYSA 2QOHA 3LLTA 4FA2A 3EKKA 4RT7A 3Q60A 5IQGA 4FSYA 3MJ2A 3UBDA 2BKKA 4USFA 2YIRA 4YC8A 3BHYA 5CAOA 4I0SA 5IMEA 2BROA 4EJNA 3OUKA 3PRFA 5FWKK 1DI9A 4M67A 2IZTA 5E90A 4ZSEA 4Y83A 1VYWA 4F99A 3ET7A 4AG8A 4YLLA 3F9NA 3BLHA 1PXIA 2NO3A 4FKLA 5TT7A 2PVLA 3OWJA 4IB5A 3P7AA 3MWUA 2PPQA 3WILA 3CS9A 3ZH8A 5CAVA 4WD5A 4WOVA 3VHKA 5BVWA 2IVSA 4FTKA 2VWUA 2PZPA 2YIXA 5GNKA 4DCEA 4DGLC 4OTRA 5TKDA 2PY3A 5DR6A 2BRMA 2Y0AA 2X8IA 3CQEA 1H07A 5ACKA 4ITJA 4WIHA 4ZY6A 4GKIA 4FZ7A 3ZZEA 5BUEA 5CEMA 4M12A 3GBZA 5E8SA 4PV0A 2BUJA 2Z7LA 3QZIA 3Q04A 2YM3A 2ZM3A 4YTHA 2YN8A 2WGJA 5EI2A 2YLFA 2UZBA 3MH1A 3C13A 3OUNB 3P9JA 3W33A 3R63A 3A99A 3OT8A 1M2PA 3QF9A 3QQJA 5CEKA 4DTBA 2GNLA 3VS0A 3LCSA 1YXSA 4H3PA 1PF8A 3PXKA 4JIKA 4QMUA 3ZXZA 3ATTA 3Q53A 3ORZA 3MV5A 3R7VA 3DTCA 3QTSA 3D0EA 3RGFA 4EHEA 4EH5A 4ANSA 3OVVA 3TNQB 4L53A 4OTDA 5CVGA 4QP9A 1JKSA 3S0OA 1H0VA 3EFWA 4QPAA 4F70A 2PMLX 3RAIA 3FMJA 4KNBA 5DI1A 4XJ0A 3VS7A 3K54A 2REIA 2H34A 1Q62A 3TL8A 4WA9A 2IW8A 4YPSA 4N0SA 1U5RA 1ZMUA 3R30A 3ALNA 4GEOA 4LRJA 5D11A 5IEVA 3DY7A 4FE2A 5CALA 4GT5A 5ANKA 1YOLA 4IHPA 3FMEA 4XP2A 4BKYA 4D2TA 3WI6A 1JQHA 3MY1A 2XYUA 1G3NA 2Z7RA 4R7IA 3EQGA 1BYGA 2XZSA 5FP5A 3UOHA 3MA6A 3W2RA 3RHKA 3KU2A 3P7CA 4BCOA 4TY1A 4R3PA 4HYIA 3ZRMA 1U46A 4C2WA 4E20A 3DAKA 2ZMDA 5CNOA 3F3WA 3JYAA 5EI8A 4F1TA 4Z3VA 4GL9A 3Q9WA 5TR6A 4U41A 3CQUA 2ITYA 4CSVA 2VGPA 3HAVA 2HXLA 4FK6A 5ANGA 4QTEA 2GHGA 4C7TA 4UBAA 3NYNA 4O21A 2Z7SA 4F08A 3AC1A 3D15A 4IAIA 4JJRA 4LL5A 5FEEA 1KWPA 3EQBA 5A14A 1Q8ZA 3D5XA 3I0QA 4XNEA 2IZSA 2R7IA 4FOBA 5H8BA 2XEZA 3K5VA 4IQ6A 2DQ7X 5AWMA 2PUNA 1U54A 3KRJA 3O2MA 2C1AA 3QQGA 4L00A 2UW4A 3TV6A 3RZBA 4FKJA 4TZRA 4QMZA 4RG0A 4OW8A 1GOLA 4BRXA 4WSQA 1R0PA 4MBJA 3DAJA 4FSQA 4IVAA 4R1VA 4B8LA 3ZZWA 2WMTA 2WU7A 5ICPA 2ZDTA 4ZS4A 4ENYA 4V05A 3A4OX 2BRBA 5AA8A 3FHIA 4WUAA 4BCFA 2UZOA 3ZS5A 2CMWA 3G9NA 4EH4A 2JBPA 1YHWA 3N51A 4O1OA 2QU5A 5M4FA 1ZZLA 2J6MA 5F1ZA 4FC0A 4FKGA 4ZLZA 1OGUA 5EDPA 4KIPA 4LGHA 2QHMA 3SA0A 2C30A 4TWNA 2J0KA 3EKNA 3C0GA 1Q3DA 4X21A 5EHLA 4E93A 1L3RE 1IA8A 5C01A 3ULIA 4CLJA 4CFFA 2BAKA 1WVXA 3TUDA 1GY3A 4PTEA 4X3JA 4GMYA 4WSYA 2BTSA 3HZTA 5AP1A 3TIYA 4P7EA 1SZMA 3LXKA 4HCVA 2WHBA 2CSNA 5CX9A 2P0CA 3NUAA 4DAWA 3VJOA 4XBRA 2CDZA 4QQTA 4YU2A 2WZJA 4BCPA 4IAAA 2IN6A 2FVDA 4IC7A 4ZSLA 2UZDA 2UZLA 5JFSA 1QPJA 3QKMA 5CTPA 3V3VA 3CP9A 1LUFA 4A9TA 3S00A 2G1TA 3D5VA 3B8RA 3QXPA 4K33A 3EQIA 2CJMA 2R3KA 2WTCA 2A27A 4N70A 3UTOA 5AFVA 4U5JA 4ALUA 4I93A 2R3HA 3UIUA 4H39A 3DXQA 5KUPA 4NM5A 3F2RA 5IDNA 4EH7A 4CFXA 5AUXA 3AC3A 4FT9A 3W16A 5KBRA 3IECA 3QWKA 3QQLA 3NDMA 3IGGA 4NK9A 2WQBA 4W9WA 3ZBXA 3Q2JA 3CGFA 4I24A 2F2UA 4BYJA 2XIYA 3R02A 2WMUA 3R71A 5ANDA 2X7OA 3DS6A 4CQEA 4F09A 5DE2A 4M68A 4A07A 4A4LA 5A54A 4APCA 3BLRA 3OS3A 4AFJA 4OTFA 3DKGA 3QD4A 3W2QA 1AGWA 3KXNA 2PMIA 2X7FA 4P90A 2VWVA 4MKCA 2XB7A 1MRVA 3ZONA 2FSLX 4G5JA 5F94A 4CXAA 4GK3A 3HV3A 3TM0A 2QVSE 4CMOA 4IX3A 4UMQA 3VN9A 3ELJA 3BYUA 4D5KA 4D2SA 3LQ8A 2BRGA 4BIBA 5HESA 2V55A 3BI6A 4QP8A 4C4EA 5HO7A 5AUWA 2PZIA 4J99A 4DE4A 4H1MA 3AC4A 4G3FA 4FKTA 3FXZA 3V8TA 5IUIA 3P1AA 4C59A 5DBXA 4TKSA 4ZXTA 2RL5A 3KA0A 1QL6A 2B53A 4FT0A 3ITZA 4MWHA 4PP9A 2CCHA 2JBOA 4NTTA 3GU6A 3MTFA 3A60A 3Q9XA 4WO5A 4XLVA 2R3JA 4RJ5A 3S3IA 3A8XA 1OIQA 3QTWA 4DH8A 3VVHA 1MP8A 4ZAUA 4ANNA 5BMSA 3Q5IA 4YP8A 3BIZA 4JQ8A 4JR7A 4NIFB 3WF9A 4DG3E 1YKRA 3T9IA 3UZTA 1XH7A 2Y4PA 3KC3A 4I20A 2W5HA 4YUQA 2VO6A 2QKRA 2EB2A 3QQKA 4R77A 3CIKA 4XG3A 4D5HA 4G9CA 4M0YA 3PXRA 4EHZA 3L1SA 1VEBA 5C03A 1OECA 3ORPA 2GNFA 5I9XA 4QP4A 3DDPA 3EN6A 4DN5A 4EKKA 4FG8A 4DC2A 2X4FA 2C68A 2HAKA 5IKWA 3WE8A 5E8XA 1DAYA 5AR3A 3ZOSA 4HPUE 3RNIA 2VX0A 2CNVA 1QCFA 2WMWA 3RM6A 5A6NA 3CSVA 1YDSE 3BLQA 3ANRA 2GHLA 3G15A 4BGQA 4QTDA 5A4TA 2ESMA 2X39A 2OZAB 5AM6A 4FZDB 3EOCA 3Q6UA 5T3QA 2I40A 3E3BX 4IDVA 4F65A 2EVAA 4UZDA 1PXLA 3R22A 3R1YA 1WVYA 5AUYA 5H8GA 4A7CA 4ZY5A 4E5WA 4L01A 4Y5QA 1OKYA 2WQMA 3NVKI 5AUZA 2X8EA 3FV8A 5KMJA 2GU8A 3F3VA 3FY0A 4ACHA 4HVHA 5CSPA 3N4VA 3I7CA 3HMMA 2IW6A 3PJ2A 4ITIA 3RMFA 3TG1A 4X3FC 3QHWA 4ASEA 1MRUA 3JVSA 3O8PA 4IIRA 3NPCA 4L45A 4RVKA 4YPDA 4ZS0A 3RNYA 4QMVA 5F4NA 2CN5A 2VO7A 3R1QA 3MTLA 5AR5A 3W2OA 3IOPA 3NNXA 4DFNA 2UZUE 2HW7A 4RX8A 4EEVA 4M13A 4O0XA 5CF5A 2QNJA 2QOOA 1A9UA 4FG7A 3E7OA 4GU6A 3PP1A 4C02A 3P78A 5E7RA 2R3RA 3TV4A 5C8KA 1H01A 4FGBA 4NCTC 4S2ZA 5EOLA 4EUUA 2V62A 3RWQA 1STCE 5BNJA 1J1BA 5AP7A 3OEZA 3ZLSA 2YA9A 1LEWA 5AR7A 3ACKA 4WNMA 5IDPA 3BE2A 5K9IA 4IW0A 3C5IA 3HDNA 2E9NA 3KRWA 2F2CB 3R9NA 3FUPA 4Y46A 2BPMA 2VZ6A 3R7YA 4HPTE 3E92A 2RFNA 3SW4A 4EZ5A 3V5TA 3CD3A 4BWKA 2LGCA 4F7JA 3E8NA 1IEPA 4FV3A 2WOTA 3UODA 1REKA 3MI9A 1KE8A 3TDVA 4Q5HA 1IR3A 4O7TA 3VBVA 3E3PA 4QMLA 4O82A 1G5SA 5HTBA 5M57A 4TWPA 1PJKA 2HZ0A 3GEQA 3O50A 5LCKA 2OIBA 2YCQA 4IWQA 5GINE 3FZ1A 4G1WA 3V5PA 3QRUA 3LFAA 1OL7A 4TYHA 1Q5KA 3AC5A 4BDCA 3DNEA 5M55A 2OSCA 3QKKA 2HW6A 3SLSA 2R3IA 2HXQA 2XVDA 4RJ4A 1SVEA 3R9DA 5L2IA 4ORKA 4G16A 1ATPE 1MQBA 2QLUA 2R3PA 4NT4A 2FB8A 3P86A 2VGOA 2ITUA 3JS2A 4M84A 3EQFA 3W10A 4QD6A 5FTGA 4R7BA 4ONAA 4XOZA 4Y5HA 4JBQA 3R8MA 3HECA 3R8VA 4FTCA 5IQEA 2ITQA 4CRLA 3LQ3A 4CZTA 1UU3A 5HIBA 3EZVA 2ITVA 4L3PA 3R2BA 4YZDA 2QKWB 2W0JA 4KSQA 2O8YA 2VTOA 5E92A 4NW6A 1WMKA 4S34A 5I9VA 5JKGA 4CCUA 2VN9A 3H4JA 3IW5A 3DCVA 3FZOA 5LJJA 2W1ZA 4JQEA 2XF0A 4FTLA 4JX3A 4B8MA 4O7SA 2Z60A 3MH3A 4I92A 1YRPA 4UMTA 3MPTA 4OBQA 2J90A 5HORA 2XJ2A 2DS1A 4X0MA 3PDTA 2OH0E 3OHTA 2YCSA 3W8QA 3C7QA 1FVTA 4D4SA 3DT1A 2B9JA 4HNFA 3T3VA 2ONLA 2QOLA 3SHEA 4WNPA 1REJA 4G3CA 4N4SA 4F9CA 4FKRA 3PXQA 2OF4A 2IVUA 2UW3A 3KB7A 4TXCA 4CG8A 5J9YA 4DEGA 5IQAA 4FTAA 4KINA 5L6WL 2H96A 2YIWA 3QWJA 3WIKA 4RQKA 3Q4CA 4KBAA 2ERKA 2CLXA 2XUUA 4C57A 2J5FA 4NL0A 3AD6A 3DA6A 4AN2A 5HGIA 4MQ2A 2ITTA 3FJQE 4RVTA 2C0IA 4O7YA 4RPVA 4JR3A 2XNEA 3MIYA 2O65A 4NJ3A 5LVOA 4BCNA 3IS5A 1SVGA 3LE6A 5I3OA 2CLQA 3FZPA 1Z9XA 3LMHA 4JG6A 2O3PA 1MRYA 1YXUA 1LP4A 5AP3A 1KE6A 1W98A 5HBHA 3SRVA 3VUTA 5JK3A 4G3EA 4MD7E 2XK3A 4KIOA 4Q5EA 5LMKA 1TQPA 1R3CA 3KMWA 4FIGA 5C8NA 4KUJA 1TQIA 5H2UA 1OBDA 4FT3A 3PTGA 2E9UA 4NUSA 4HVIA 3AMBA 1UU7A 1A48A 4X2FA 2XNOA 2AC5A 1FGIA 1PYEA 1NVSA 4K6ZA 2WU6A 4W8EA 4Y85A 5HU9A 5FTOA 4PUZA 4JI9A 5LVPA 1JNKA 2BZIB 4GYGA 4A9SA 3O7LB 3KULB 3LMGA 4D4RA 4Z9LA 3RAWA 4ASZA 2GQGA 4J53A 3WF8A 3R28A 3FYKX 1OIYA 2ZM1A 3E5AA 2R2PA 3R9RA 4I41A 1KOBA 2W4KA 3WZKA 5IF1A 3KCKA 4RJ8A 2PMOX 4U3ZA 4OAUC 4R6VA 2WAJA 1E1XA 1R0EA 4HZSA 4WNKA 5AADA 3ZM9A 4YTCA 4I1ZA 3PSDA 3CJGA 4FICA 3UNKA 2CCIA 1GNGA 4HGSA 5HX8A 2JIVA 4F9YA 3KXXA 3G33A 4ANOA 3R8ZA 2A2AA 4DEIA 3ROYA 3GB2A 4BZOA 4BHZA 1H1QA 2WMAA 2PL0A 3AD5A 3MSSA 5I3RA 4L46A 4ERWA 4RFMA 3DFCB 3HYHA 1M7NA 1YI6A 4DYMA 5AV4A 4RX7A 2XNBA 4IANA 4ZSGA 4B7TA 3HNGA 2QI8A 4IB0A 4O0SA 2Q83A 3KXZA 3P7BA 3COHA 3VS5A 3HRFA 4EBWA 5K5NA 4QMTA 2P2HA 1GZKA 2UW9A 5DEWA 3TJCA 4EL9A 2PVHA 2C0TA 2W06A 5EM8A 2WFYA 5CLPA 2Y8OA 3UG1A 2GNIA 3FE3A 1Q41A 3MVLA 2J0JA 3HRCA 3WZDA 3GVUA 5DG5A 2WMQA 3NUNA 3EB0A 4FKPA 3C50A 4FSUA 3BGZA 3L9NA 4I23A 3TZ8A 4U7ZA 1YHSA 3ORNA 4XYFA 4BFMA 2C3JA 1QPEA 2FSMX 4Z7GA 3AC2A 4EYMA 4BZDA 1TQMA 4QMMA 4JAIA 4NU1A 4TTHB 3SC1A 4BTMA 4KKGA 5A9UA 5C26A 3S4QA 2YDIA 5EG3A 1KUTA 3R21A 4ZLOA 3DB6A 3GP0A 2ZAZA 3D83A 4JXFA 4KWPA 4YC3A 1OMWA 1YXTA 4MNEB 4BBEA 5KMOA 3TUCA 4BF2A 3R01A 4AXAA 2YCRA 5IA5A 3RPSA 3AG9A 4E1ZA 5HCYA 4W4XA 4AT5A 3AGMA 4QYGA 5HEZA 4C4IA 3KXMA 2YM6A 1QMZA 2WTJA 2YCFA 3D14A 3PXFA 4WUNA 4X3FB 3DKOA 5FBOA 2VX1A 3PZHA 3JUHA 4YTIA 2XNNA 4ZIMA 4I0RA 3FQHA 4CKIA 1FMOE 3VF8A 3RPYA 5B2KA 3ZTXA 3UQFA 3TCPA 2XMYA 4YZMA 4ZTLA 1ZYDA 2IZUA 5HIEA 3OFMA 4RRVA 3DTWA 5FG8A 4QTCA 4U44A 5FXSA 2F7EE 5A4LA 1XH5A 4RWLA 4F63A 2XS0A 4P4CA 3Q4ZA 2P33A 4EOKA 3B8QA 4OTQA 5EM6A 2Y4IB 5BVOA 3U6HA 5BYZA 1PMUA 4BDIA 5EQPA 1U59A 3FBVA 2P3GX 2P2IA 1M17A 4NW5A 1S9JA 5AV2A 5GIPE 4Q2AA 1CDKA 3U9NA 2R5TA 3LCOA 4YHTA 2IG7A 3F5PA 4LRKA 5AUVA 5K3YA 2QR8A 1FQ1B 4YJOA 3DKCA 3KN5A 4RZVA 4ACDA 4F1MA 4TYGA 5CF6A 2VO0A 5AR4A 3SOAA 5C4KA 4ZP5A 5J7BA 4USDA 2BTRA 5CXHA 2VUWA 1YW2A 4BTKA 2IPXA 3SXSA 4ACMA 4EH2A 3GU8A 5KCVA 2V0DA 3AT4A 3NZ0A 2F4JA 3BEAA 3I60A 3VBYA 2JAVA 4RBLA 1SM2A 3MESA 2XK7A 3PA3A 3TDWA 3TACA 4X6RA 4DEAA 3Q3BA 2C6LA 3QA0A 5KBQA 4ANLA 2RGPA 2F9GA 3PXYA 4YBJA 4FV6A 3H0YA 3P0MA 4DFYA 2NRYA 4KSPA 5BMMA 5EQEA 2GS2A 4PDYA 3U6JA 4J96A 5BVFA 3M2WA 4OTIA 3MPMA 1YXVA 2C5VA 2PVRA 3IOKA 4LOPA 3D94A 3CCNA 3LZBA 4F4PA 2XCKA 2CGVA 2RFDA 3MY0A 2RFSA 3AGLA 1RJBA 2PTKA 2I0HA 5EDQA 5GZ9A 4RGJA 4AZSA 2XBJA 2WMVA 4KA3A 4GFMA 1KE7A 4KBKA 4U80A 1BI8A 4UB7A 4JRNA 3QQFA 4H3BA 5IU2A 4L7FA 4PL5A 5HNIX 5AIRA 3AQVA 4WRSA 3OCTA 3LCKA 2GPHA 3EN4A 3MB7A 3MGYA 4TN6A 5EYCA 3DKFA 2XYNA 4OT5A 4E4MA 2IVTA 5DVRA 4CGAA 2QOBA 5M51A 4GVAA 4OBOA 5EHYA 4ZLYA 5LWNA 2PVNA 4XOYA 3OC1A 2HWPA 3JY9A 4G3DA 3L8SA 5FM2A 1XH8A 2B54A 3R1SA 4NEUA 2R7BA 4YJPA 2OFUA 3IO7A 3HKOA 2XK4A 4FSZA 2OZOA 3VS3A 3NSZA 3OG7A 1F3MC 4BDKA 4BTJA 2JDTA 3PYYA 4JBVA 3L8XA 2YACA 3DQXA 1BX6A 4HOKA 3CQWA 4O2ZA 4O96A 4S33A 4ZTQA 4O38A 1Z57A 3HLLA 5FRIA 2XNPA 2YWPA 5HTCA 3OCGA 2B1PA 3S1HA 1W7HA 4HNIA 2PZ5A 3MN3A 5CU4A 3TV7A 3OP5A 3SVVA 4EK4A 3OY1A 4DH1A 2XNGA 1YWVA 4RWKA 3OW4A 2EU9A 1W8CA 5AP4A 3UJGA 4MH7A 5T6KA 4TPTA 4X2GA 1T46A 3LCDA 3PP0A 3TXOA 2W1CA 2OBJA 1H0WA 2YM4A 3GNIB 4MAOA 4AP7A 4C36A 4G31A 5IA3A 3PJ1A 3A7IA 5EHOA 5IEXA 2NRUA 4AACA 4EH9A 2R3FA 2KTYA 4JX7A 4MXOA 4W8DA 1TVOA 3HEGA 4GJ2A 4IH8A 1H1RA 4ASXA 2BFYA 4OBPA 2ZV7A 3IONA 4V0GA 2C1BA 4EC8A 2WXVA 3BHHA 3MFSA 4I94A 4F64A 2XA4A 3G0EA 2E2BA 3NW6A 3TEIA 1KV1A 2QODA 5CEQA 4G9RA 2W1HA 1JKLA 4EZ7A 3M42A 4FV1A 3FMHA 5E8YA 4ZSJA 5CANA 3G51A 3ZCLA 3Q9YA 2O63A 3EJ1A 4AN9A 3L8PA 4IAYA 3BRBA 1ZWSA 3EHAA 2UVZA 3A7GA 3VUMA 3TNPC 4LI5A 3DBEA 4AA4A 1M2QA 3UPZA 4UMUA 1UKHA 4F7LA 4ANBA 3KCFA 1ZXEA 3POOA 4ACGA 1WBTA 1YWRA 3OWLA 4IB3A 3ZO1A 4CYJA 5HU3A 2PYWA 2UW8A 2HIWA 4XRJA 4AGDA 4GU9A 1J1CA 3DDQA 4FIJA 5E1EA 5IMXA 3FI4A 3MDYA 4LUDA 4YZBA 5DN3A 2JKOA 5KMKA 1KSWA 3ODZX 3G9LX 3SDJA 4W4YA 4DLIA 4AUAA 1NY3A 3BGPA 3LFFA 3NUYA 5DHJA 2RSVA 1I09A 4F0GA 2YIYA 1JSVA 4FTJA 3HA6A 3JY0A 4A4OA 3C9WA 3FMKA 3UC4A 4D2WA 4USEA 2VTTA 3E64A 3QTIA 4O7WA 4YJQA 5A4EA 3FMNA 4BCJA 1OZ1A 2FO0A 2VU3A 3LQ5A 4D2PA 4EQCA 3CKXA 4K18A 3UZRA 3P79A 3LOKA 1VYZA 2ZM4A 3C4ZA 4O6EA 3FQEA 5JQ5A 4GUEA 5FEDA 2WQOA 1XJDA 4LV8A 1R39A 4U0IA 3PY3A 4J8NA 3UG2A 3NYXA 4RIXB 4FKWA 2G9XA 1U4DA 4KRDA 4UALA 5E1SA 4XH6A 5ETAA 2R9SA 3RBWA 3FI8A 1SYKA 2R3LA 3KXGA 4I5HA 5AM7A 4RWJA 3NIEA 3VAPA 1W82A 3RWPA 3MFRA 1JBPE 3NWWA 2ETKA 2YABA 5CNNA 3RI1A 3VQHA 3GU4A 4HGEA 1V0BA 3WF7A 4EK6A 4IACA 4Z7HA 4P5ZA 5HLPA 4F6WA 5IQIA 4C8BA 2GHMA 3EN5A 2V22A 3F61A 4GG5A 5AP0A 5DIAA 3W55A 4FTMA 4KIKB 4FSTA 3QRJA 3Q5ZA 2BAJA 3O0GA 3QCQA 4KS8A 4BDJA 5ANOA 3CEKA 4KD1A 5TO8A 1NVQA 4I4FA 1X8BA 4F9WA 5LXMA 5L2WA 4AOTA 5ANIA 3OY3A 3PY0A 3FPQA 3VRYA 4U43A 3JXWA 5IQHA 4RC4A 2QOKA 1SMHA 3C4CA 1VR2A 5L6PA 2JDSA 1U5QA 3F6XA 3O17A 4IZAA 2ZOQA 3I1AA 5KKRC 4EK8A 3F3UA 4DGMA 4YO6A 1W84A 1W0XC 1KE5A 4QYHA 3QZGA 1PXKA 3DLZA 4LMUA 2BVAA 3FKOA 2OH4A 4GVJA 3VULA 1LEZA 5JZNA 5G6VA 4DT8A 4E4XA 1XH6A 3OBGA 1XBCA 4DT9A 1ND4A 1RDQE 3RCJA 3W2CA 3QKLA 4RSSA 4O6LA 4A4XA 5KO1A 1Y8YA 4IX4A 2XM9A 1Q8WA 1UWHA 3CJFA 5CU2A 3F5XA 5HBEA 3WYXA 5BUJA 3PZEA 4ZOGA 4WRGA 3QALE 2YM5A 3C4XA 4WG4A 4C61A 1WBVA 1B38A 1IAHA 2Z02A 4AAAA 2PE1A 3KULA 4XCUA 3I81A 5CEPA 4J7BA 1JOWB 5CYIA 4BBMA 3LXPA 4PTGA 4GT4A 5CF4A 3GC0A 4FOCA 4BN1A 1FPUA 3OT3A 4LM5A 4RWIA 4ZTMA 4EYJA 3RAKA 3UE4A 5FD2A 4EI4A 4XMOA 5KMNA 1M52A 2QOCA 1YXXA 4PMTA 3RAHA 3ZO3A 3FKLA 4I6FA 4DTKA 5FDPA 4HYSA 4O91A 3ENMA 4GIIA 4PP7A 2C4GA 5JRQA 3SOCA 3S95A 4ZTRA 5AEPA 3DJ7A 4FV9A 2B0QA 2NPQA 4H36A 2JKQA 3TJDA 3TTJA 5K0XA 4E6DA 3DXPA 2XCHA 3QYWA 5D9HA 4EOMA 4IZYA 3OW3A 5JRSA 5LQFA 2JIUA 5ETIA 4QYYA 5HG8A 4O7LA 3BWJA 3SXFA 1UV5A 3LFSA 2E9PA 5KNJA 3NNVA 1FMKA 5BX0A 5CAQA 3T9TA 3W1FA 4BCMA 5AUTA 1FGKA 3A7JA 3C4WA 3ULZA 2F49A 3HV5A 3A2CA 4FL2A 4S32A 3NW5A 3UVQA 4DLJA 3R0TA 5HG7A 3V5QA 5C8MA 4C4FA 1GJOA 2C3LA 2QOIA 1AD5A 4AZEA 2WIHA 1XH9A 4L3LA 5E8TA 1KOAA 3P23A 5AX9A 2ACXA 3MVHA 1DAWA 1Y57A 1YI3A 3VUHA 5LVNA 2OGVA 3CTHA 3IDCA 4AW1A 3D7ZA 3NIZA 5B2LA 2C5XA 1DM2A 2C6EA 2AUHA 5E8WA 4EZ3A 3DBCA 4NM0A 3UOLA 3C4FA 3I0OA 4QYFA 3HL7A 2QOFA 5DPVA 4LL0A 4ALVA 2B7AA 4EJ7A 4OTPA 3HV7A 3D2KA 4AT3A 5IZFA 2OW3A 4O27B 1PHKA 4MXYA 4L44A 5JGDA 3F2AA 1CKPA 4U97A 3ANQA 2BAQA 3LVPA 4NZWB 4Y95A 5ACBC 1MQ4A 3IW6A 4J52A 3U55A 1PKGA 2XBAA 4G17A 1R1WA 3U87A 3RALA 4FL3A 5J5SA 4IWOA 3UMWA 4WG5A 3FHRA 2EXCX 4O0VA 3H10A 4HGLA 4RLKA 3D4QA 3UZPA 4XBUA 3ZUTA 4C3RA 4R8QA 3RK9A 1Z5MA 2C6OA 4BDEA 4C4GA 5E9EA 3HUBA 4RFYA 5GZAA 4MVFA 1BL6A 4FEWA 3ZM4A 1ZY4A 4B0GA 2X1NA 4FEXA 3ZMMA 4A9UA 1OITA 3QGWA 5EK7A 4BCHA 2G01A 3DOGA 3I6WA 4EC9A 5JZJA 1Y8GA 3UNZA 3MB6A 4CTCA 3ID6C 4DEEA 3E7VA 3UQGA 4D1SA 3LHJA 2VD5A 4D9TA 1FVRA 4IZ5A 3ORLA 5DEYA 2VWBA 4ZTNA 3UP2A 2PE0A 2OIQA 3OXTA 1JKKA 4U40A 3NEWA 5JQ8A 2YHVA 4II5A 4YSMA 4KB8A 2YAKA 5DT4A 3UYSA 1BLXA 2HK5A 2XKFA 3R73A 4CYIA 5IA2A 3KK8A 2P4IA 3T3UA 4E8AA 4BIDA 4R7HA 3ATSA 2OFVA 2Y7JA 2KULA 3JPVA 4EONA 4XG4A 4LV5A 4N57A 4IAFA 2B55A 3KY2A 2Y9QA 3RPOA 4BDBA 3D5WA 2YM8A 2UZVA 4I6BA 4XV1A 2C5NA 2WO6A 4M69A 5EKOA 1J7LA 5E4HA 3PIXA 4FEVA 4NJDA 2VWXA 2YIQA 4IM3A 2OWBA 3AXWA 4FODA 3VUIA 1RQQA 3RPVA 3N4UA 3DK6A 2PVYA 2UV2A 3I7BA 5IA0A 2PVMA 3PVGA 4G5PA 3RVGA 1AQ1A 3SGCA 1XH4A 3FL4A 3VF9A 4GW8A 3WF5A 4BHNA 2BZJA 4IM0A 3NCGA 4L68A 4ZK5A 3B2TA 4QMSA 4MXAA 2C5YA 3V8SA 2BIKB 3VWAA 3Q4UA 2W5BA 4K11A 5CS6A 5A6OA 4ZTSA 4GFOA 1KV2A 2WEIA 2FSOX 4TRLA 1ERKA 2WB8A 4MXZA 2YJRA 1OPJA 2W1GA 4DA5A 1Q24A 3UOJA 4E4NA 2CHLA 4L43A 2WOUA 1J91A 1WZYA 3O8UA 4FKQA 3G6GA 3KKVA 4DCAA 5CT7A 4IC8A 5AV3A 3ROCA 4HVDA 3EL7A 4ZTHA 4ACCA 5GZ8A 4DBXA 4ASDA 4WHZA 5TF9A 1Y6AA 2G15A 5HD7A 3PUPA 2GFSA 2J51A 4RFZA 4Y8DA 5ANEA 3U8WA 1FVVA 4DF3A 4UWCA 2RKUA 1XO2B 4BGHA 5BYLA 2JC6A 5AAEA 4MD9E 3EN9A 5JFWA 3QX2A 4C58A 5LMAA 3Q96A 3TZMA 2R3GA 5E8VA 5K4JA 2Y6OA 2PHKA 2X2MA 1WAKA 3GCUA 4Q9SA 5HE0A 3ZRLA 2PU8A 3KREA 2JKMA 4RIWB 5HX6A 3GU7A 3RK7A 2WTDA 2X9FA 5CEIA 3G90X 4D4VA 2V7AA 3KEXA 2HY81 4ANMA 3V6SA 4KKEA 1PW2A 2BFXA 4MK0A 3M1SA 4YNOA 3TKHA 2B4SB 3NYVA 5I9WA 3ZO2A 4YSJA 3LM0A 3TNIA 3MJ1A 5M07A 2SRCA 2PUUA 2ZVAA 5L2QA 3PJ8A 2CNQA 2QD9A 3PE2A 4F0FA 1NW1A 2C6TA 3IDPA 3P08A 1B39A 2XKEA 4U42A 2R64A 2QO2A 2WPAA 2RG5A 2Z8CA 3FAAA 3VS1A 4AS0A 3ZFYA 1U54B 1UNHA 3HMNA 4XUFA 1BI7A 3MFUA 4L3JA 2RFEA 1OKZA 4IZ7A 4TNBA 1PXPA 1CM8A 2W9FB 2ZMCA 3GC8A 4FV2A 4L9IA 3E8EA 1OIUA 3HV4A 3SG8A 1A06A 2Q0NA 4D1ZA 4BKZA 4CT1A 3RZFA 4D2VA 4DH3A 4K0YA 4FR4A 3LJ1A 5EYMA 3R7GA 4EWHA 1IASA 2VTSA 3UIMA 3OTVA 2VWYA 3DJ5A 3QU0A 1ZMWA 3ORMA 3AOXA 2QG5A 5FGKA 4D4YA 5AP5A 3U4WA 4PMPA 2GS7A 4NKAA 4AFEA 4DFUA 1IG1A 2ONLC 3BYOA 1H00A 2EWAA 3DLSA 3FLSA 4MHAA 5GJFA 4CFVA 4PPCA 5CQWA 3UGCA 4BB4A 4X6QC 5LARA 4BBFA 2IVVA 1J7IA 2WD1A 4WNOA 5KKRB 3CLYA 2BZKB 5E91A 4XP0A 5TE0A 5KMMA 5AP6A 4D0WA 4FF8A 3R8PA 1YDTE 4U3YA 4GH2A 4AW0A 4QT1A 2ITWA 4I6QA 2GQSA 4CFUA 3IGOA 5IQCA 4CQGA 1O6LA 3I79A 4U45A 5KHWA 4EQUA 3A4PA 3COIA 5I5ZA 2C47A 3EQPA 3I4BA 2HZIA 1Q97A 4CMTA 5B2MA 1JAMA 4JLCA 4DFZE 3HAMA 3NUSA 4D0XA 2IO6A 4HYHA 4X7QA 4E26A 5DRDA 3RJCA 2PSQA 3DBFA 2JGZA 2HELA 3GOPA 1HOWA 2JLDA 3MS9A 4FTQA 1CTPE 3GCSA 3LFBA 3CY2A 5BVDA 2Y6MA 2PK9A 5DNRA 5LMKC 1ZOGA 2YDKA 4FUXA 4AGWA 4NM3A 4D58A 3QQUA 4E7WA 5CAPA 4O7VA 2PUPA 3A7HA 4L42A 4UYAA 1Q8UA 2CKPA 4J95A 2ITZA 3EQDA 3QTXA 3BELA 3F69A 4MXXA 2JDRA 2QONA 4YJUA 2WIPA 3BWFA 4D2RA 4CVAA 5KHXA 5DH3A 4BCGA 2HY0A 1E9HA 3A8WA 4J98A 4MD8E 3OTUA 4IJ9A 2GS6A 3LLAA 4FEQA 4F0IA 5DYJA 1SVHA 4QPMA 5D10A 4YJVA 3UDBA 2C6IA 4IX6A 4XG7A 5ANJA 4BC6A 5KMLA 1WBSA 4OR5A 5L3AA 1H4LA 3MH2A 4UMPA 2G2HA 2XEYA 4JL9A 5CSWA 4GS6A 4R1YA 4DEBA 4PRJA 4RX5A 4CG9A 3N4TA 4F6SA 2G2IA 2BILB 3ZSGA 3LXNA 4J8MA 2J5EA 4XX9A 4TL0A 3UNJA 3N9XA 2W4JA 3FSKA 3MA3A 3H9RA 4AA5A 4DBNA 4E6CA 1TKIA 4V01A 4MX9A 4Z16A 2B9IA 2AYPA 2JEDA 2X8DA 3RM7A 3ZO4A 4GYIA 4AN3A 1PXJA 4RVLA 3HGKA 3SW7A 2ZDUA 1P14A 4IXPA 4IWPA 4NFMA 3OXZA 3KN6A 5BVEA 3GCVA 2E9VA 4GUBA 2OJGA 4OT6A 4Q9ZA 3E62A 4IFGA 4P5QA 4F7NA 5IH6A 4FV0A 4UYNA 4YZNA 5HVKA 2H9VA 3CKWA 4QP2A 3ACJA 3D2IA 4X2KA 4QTBA 4U81A 3TWJA 3GQIA 3NX8A 4E73A 5DR9A 4M14A 4AZWA 3PA4A 4Y72A 4KIKA 4MEDA 4YZCA 5HTIA 5I0BA 3AC8A 3PLSA 4OTWA 4IBMA 4LYNA 4BCIA 5IQFA 5ETFA 3ZU7A 2I0YA 3DGKA 4EORA 4OGRA 1YOJA 4EK5A 4YTFA 4J97A 4K8AA 3R8UA 4DHFA 2CGWA 2V5QA 3ORXA 1NT2A 4I4EA 5CU6A 4OLIA 2JIIA 4DTAA 4FV4A 2PE2A 3QZHA 1WBPA 4Y73A 3MW1A 4HGTA 4RJ3A 1BL7A 3GXLA 2QHNA 5B0XA 4ZZMA 4O1PA 1GAGA 4UEUA 4JT3A 2R4BA 4O0RA 1XBAA 3F5UA 3QD2B 2YISA 3RK5A 2VO3A 3BU6A 1PXOA 3KRXA 4EUTA 3VO3A 3QRIA 2FGIA 1XR1A 2J0IA 3MH0A 4L8MA 2OXXA 4ZY4A 4CMUA 4B99A 5FM3A 3DB8A 4W4WA 5LWMA 2LAVA 2HZNA 3WZEA 2OIDA 4XG2A 4EHVA 4L67A 4AZVA 4RX9A 4GT3A 4FNYA 2Z2WA 2YZAA 4GIHA 4FKVA 1GIIA 4FZFB 1P5EA 1WCCA 4W9XA 4B9DA 3VQUA 3E8DA 2VRXA 4JG7A 3OBJA 3W2PA 4D1XA 3PA5A 5IUGA 4XV9A 3PIYA 2GTMA 3BGQA 5DWRA 1RW8A 4GKHA 2ZV8A 4C3PA 2XKCA 1GIJA 3E88A 4FIIA 3EFJA 5HG5A 3MPAA 3ORKA 3LFEA 3LFDA 1UA2A 4HW7A 4DG2E 4PDOA 5L8JA 4YR8A 3HMOA 3Q2MA 4O86A 1VJYA 1Q4LA 2PMNX 4MNFA 2UW6A 1OIRA 4WT6A 1BUHA 5T68A 2WNTA 3BV3A 3G6HA 4S31A 4RJ6A 2W99B 3CPBA 3ZSHA 4EK3A 3QLFA 4KABA 2VNYA 2GNJA 4J71A 5FQDC 4BCQA 4RIOA 3R04A 5C27A 3UOKA 4BDAA 1PMNA 4IB1A 4WG3A 4M3QA 4BL1A 4HVSA 3NCZA 4CKRA 4GG7A 5HO6A 2WEVA 3QAME 1M14A 3F3ZA 4R3RA 5HG9A 3MVJA 2OU7A 1CKJA 4CD0A 5DT0A 3U4UA 4EHGA 5DFPA 4FV8A 5JGBA 4AA0A 5HNBA 5HE1A 2R0UA 4DH7A 5J1VA 1K2PA 1S9IA 2FSTX 4NIFA 4RLLA 4CFNA 2UUEA 2WTVA 3SX9A 4UWYA 1P4FA 4QTAA 3PPZA 3O71A 2B9HA 5CU3A 2XJ1A 2C6KA 3OWKA 4LFIA 5CZIA 3O96A 2PUIA 1PMVA 3MVMA 3FLZA 2UVXA 4MCVA 4AQCA 4CZUA 4QPSA 4AT4A 3AMYA 3FL5A 4HCTA 2ETRA 2UZTA 1UWJA 5EQYA 3VJNA 4E5BA 1H25A 4FI1A 4E5AX 5J5TA 3C1XA 4YJSA 3VHEA 4UX9A 4M15A 4V04A 1NVRA 3ZUVA 3Q6WA 3D7TB 3NMUF 3VNTA 3WYYA 2HZ4A 3VC4A 5JFXA 1FINA 2OZAA 5IQDA 5LOHA 5AAFA 4F6UA 4CNHA 2O5KA 1BMKA 1B6CB 5DA3A 3DFAA 4AZFA 5AR2A 3WF6A 2WQEA 3PVBA 5KX8A 4FIFA 4I0TA 2UZEA 1WFCA 3POZA 4JBOA 5CENA 3UIBA 3QLGA 2PZRA 3EMGA 2W05A 2YERA 2GSFA 4U9AA 3PWYA 3R1NA 2I0VA 3A62A 3HX4A 3QXOA 4YGAA 3R7UA 4AGCA 4O84A 2W1IA 3QC9A 5BUIA 3VRZA 2DYLA 1PXNA 1WVWA 4UWBA 3GOKA 3TN8A 2VNWA 2WMRA 5CF8A 1Q8TA 4O81A 4BVUA 5I9ZA 2VTAA 3QYZA 2RIOA 2J4ZA 1GZ8A 2IZRA 3FLWA 2WMBA 4QRCA 1ZY5A 3DZOA 2JDOA 4FTRA 4PQNA 4HVGA 3QD3A 2OKRA 3DV3A 3NAXA 4JRVA 3UO4A 1OBGA 2CKEA 2O64A 4YHJA 5I9UA 2UVYA 4FNZA 4R3CA 3GQLA 4DITA 5J9LA 3SQQA 2QC6A 2OG8A 3OZ6A 4JOAA 2XIKA 4P2KA 3I5ZA 5AR8A 1Q8YA 4C4HA 5F9EA 2O2UA 5M4CA 2FUMA 4QO9A 5EDRA 1PRYA 1KE9A 3QRTA 2IJMA 2YDJA 2VAGA 3PPJA 2IWIA 2FH9A 2VWIA 5H3QA 3VUDA 3BPRA 4KKHA 3QC4A 5M53A 2VWWA 3BV2A 3KXHA 2QG7A 4I5CA 5AX3A 4C33A 4OAVB 4ZSAA 3FSFA 3LCTA 1JSUA 5EW8A 3RINA 2OF2A 3A61A 5HCXA 2C6DA 4EOOA 3FWQA 5HNGA 2AC3A 1HCKA 4F9AA 3SRVB 5M44A 4O0WA 2V7OA 4EH6A 4FTOA 2BZHB 4DEDA 2UW5A 5JGAA 3MIAA 2VTQA 4KS7A 3U51A 3W32A 2XIZA 5CT0A 1OL2A 3DK7A 3FQSA 3K3IA 4YLKA 3WIGA 5EM7A 5HLNA 4L6QA 3ERKA 3H9OA 4EOSA 4IM2A 3UP7A 5M08A 2Q0BA 4I6HA 4E6QA 5DGZA 3OF0A 3C51A 4FX3A 1J7UA 2A1AB 1H26A 3NR9A 2UW0A 2WKMA 3PG1A 3C0HA 3PSBA 4CFMA 4ZJVA 2X6DA 3QUEA 5A4QA 3WARA 2R0IA 2BDFA 3SG9A 4FNXA 4C37A 4CCBA 3TNHA 4OTHA 4ZJIA 4O7RA 4RIWA 4NTSA 2ITOA 1ZYJA 2WMXA 4GV1A 3RHXA 5AMNA 3VW6A 5C4LA 4EBVA 4F9BA 2A19B 4FSNA 3Q32A 4MXCA 4O2PA 2XH5A 2EXMA 4AE9A 4AW5A 4JDKA 3NUPA 4IVBA 5CWZA 4O0UA 3QCXA 1H1SA 4LG4A 3DQWA 3ZXTA 3BYMA 2CKQA 3CBLA 3EQCA 3EWHA 5H8EA 3GFWA 4MTAA 5B7VA 3ALOA 2VTIA 5M4IA 3R7EA 4BDFA 5HBJA 4M66A 4GFGA 3V5JA 3CTQA 3FY2A 4YO4A 5M4UA 3KFAA
chains in the Genus database with same CATH superfamily
2BHEA 3NW7A 2PWLA 2YLEA 4NWMA 3HUCA 4QNAA 1OKWA 3FC1X 2RF9A 3OROA 4JS8A 5CVFA 3L9MA 5CVHA 4D28A 5D7VA 4ZMFA 3PLAE 1XQZA 2XJ0A 3BYSA 4LQMA 2UZWE 4KIQA 2ZB0A 2YEXA 5DRBA 3BKBA 4FIEA 3HMIA 5J95A 5IUHA 4FVQA 2X2LA 5A3XA 1GZOA 3NNUA 5C1QB 1W83A 4LOQA 1EH4A 1LR4A 2VWZA 3KK9A 4C62A 4WKQA 2R3NA 5J87A 5BVNA 4DDIA 4DGOA 4FKOA 4UN0C 1ZLTA 5FBNC 1Q99A 2YAAA 1UU9A 2XANA 2ERZE 3OCBA 4GCJA 4IAKA 4JG8A 4MBLA 4FMQA 4LUEA 4NKSA 4QOXA 5FLFA 5DMZA 4FKIA 2XM8A 1V0OA 3CE3A 4ANQA 5EOBA 3OXIA 4QMXA 2ZV9A 3FC2A 2GNHA 2I6LA 4HCUA 3ZHPC 3RKBA 5L8KA 1K3AA 3AD4A 1JKTA 2VTMA 3SKCA 3CXWA 1JSTA 4BR3A 1W2DA 4XRLA 5IA1A 4N6ZA 4FGRA 3NRMA 1YWNA 1ZRZA 3HP5A 3R9OA 3TUBA 2BRHA 3RP9A 4PNKA 4FV7A 3GI3A 2WQNA 3PPKA 3LJ2A 4O22A 2WTKC 2CKOA 2PVFA 1V0PA 5E8ZA 4RC3A 2GMXA 3U6IA 1P2AA 3EQRA 1TFFA 2OJ9A 4RIYB 4AWIA 3PWDA 3W2SA 4FKUA 2CGUA 3A7FA 5EKNA 2F57A 3M11A 4GRBA 3BHTA 4BIEA 2PZYA 1XKKA 4I5PA 1YI4A 1GZNA 4PX6A 4BWPA 5LMBA 4O7NA 4DINA 2DWBA 4FBXA 4EH3A 4H3QA 3PE1A 3IKAA 1VZOA 1JVPP 4FV5A 4GK4A 4ZEGA 4RJ7A 2J2IB 2QU6A 5FXRA 5HIDA 4AXFA 2W7XA 3I6UA 2J50A 2W1EA 3QCYA 4YHFA 4BY9E 4PY1A 4IVDA 1Q3WA 3R8LA 5L2TA 3ENHA 4F1OA 2XK9A 5HO8A 2YZLA 2F7ZE 3QL8A 2E9OA 4FKSA 3FEGA 4FL1A 4FUYA 4HYUA 2XRWA 3GU5A 4BWXA 3NYOA 3PG3A 4FVRA 1E1VA 2UW7A 4NH1A 1OKVA 5EYDA 4M0ZA 4BI1A 4ARKA 1J3HA 2C3IB 5JT2A 4C38A 4QQ5A 1HCLA 4O0YA 2BKZA 1CKIA 3NUXA 4G6OA 4RC2A 4H58A 4UXLA 4GSBA 4DGNA 4AGUA 4UZHA 3CPCA 3BCEA 4PPBA 4WBBB 4XHKB 3VS4A 3FPMA 5J1WA 5IA4A 2C5OA 3E93A 1URWA 4U6RA 1O6KA 2X0GA 5IG1A 2RG6A 4FNWA 2CGXA 3PVUA 3UIXA 3V01A 4YURA 3W8LA 3L9LA 3THBA 4UY9A 4TYJA 5GJGA 4BDDA 4QQCA 1P4OA 3BE9A 3QFVA 5HQ0A 3TKUA 3L9PA 3ZFXA 2ZV2A 1BKXA 5F95A 4JNWA 4PDPA 3LPBA 4X2NA 4XS2A 1OUYA 1Y91A 1O9UA 3H30A 4CZYB 3DNDA 5AUUA 2J0LA 2J0MB 2W4OA 4QP1A 5I4NA 1ZMVA 1Q61A 3V5LA 4YMJA 5M09A 4L52A 3FLNC 4FZ6A 4AOJA 3BYVA 2WTIA 1CMKE 2W5AA 3CR0A 1OL5A 1YVJA 3FDNA 4LOOA 4PTCA 3QUDA 4A9YA 2XK6A 3OD6X 3IG7A 2ZB1A 4MF1A 4LRMA 3H3CA 3LXLA 5AV0A 2C3KA 5AIKA 5HZNA 3DPKA 3RCDA 3ZC5A 3OCSA 1MUOA 4PWNA 3BBTB 4MNEA 3ZLXA 4MQ1A 4C35A 5I9YA 3DXNA 3GCQA 5LCJA 4CFWA 4EKLA 1ZOHA 2BDJA 2HWOA 2X0OA 4FT7A 3NVMB 2GDOA 3H9FA 3KRLA 3I5NA 1ZYCA 4X3FA 4G34A 2OJFE 4C34A 4HJOA 4O4BB 2CPKE 4K9YA 3LW0A 1YQJA 1WBWA 3EN7A 3H0ZA 1OB3A 4A06A 2YJSA 2H8HA 5CAUA 1V1KA 4BDGA 2OJIA 2X6EA 3FKNA 5F20A 1H28A 4BKJA 3TI1A 4C0TA 4H05A 1M2RA 1H8FA 4TT7A 4ZZNA 4ITHA 1FOTA 2CN8A 4EOJA 4EWQA 4CKJA 1DS5A 3W0NA 3JR1A 4NCTA 4U8ZA 3ZDUA 2ITNA 3ZDIA 4QMYA 1UKIA 4AX8A 1RE8A 1ZAOA 4EOIA 2XP2A 3QBNA 2ITXA 3DBQA 4FG9A 3U54A 2VTJA 4B6LA 5HE3A 4LMNA 4DH5A 4IEBA 3LFNA 4K77A 3BX5A 2VTLA 3QX4A 2GCDA 3O51A 4RZWA 5EH0A 4TNDA 4CTBA 1ZYLA 3G0FA 5GHVA 3WZJA 3COMA 4X2JA 5KZ0A 4RQVA 3E87A 3COKA 3G5DA 4I5MA 2GTNA 2WELA 2HENA 3KMMA 4R5YA 3TKIA 5LVMA 3BU5A 3NS9A 3LKMA 3RPRA 2PVJA 4FEUA 2QURA 4YLJA 4FSMA 5AV1A 3LIJA 2VX3A 2JFMA 1H24A 2R3MA 2GQRA 5FDXA 3FXWA 1OPKA 3KF7A 4TYIA 2IW9A 2Y4IC 1JWHA 2VTRA 5FEQA 3TTIA 5IEYA 4V0GB 5ITAA 2YM7A 3VUGA 3C5UA 4JDJA 4UV0A 4AW2A 5DR2A 5HVYA 1XHAA 2XIXA 1QPCA 3LM5A 2AEGA 1L8TA 4DHIB 3K2LA 4AU8A 1PXMA 2BALA 3VS2A 4AF3A 4EOPA 4M97A 3F3TA 1YDRE 4QMNA 2QOQA 5CASA 4G3GA 3SV0A 4FVPA 3REPA 2BCJA 3GUBA 4J1RA 3ZC6A 4BTFA 3PJCA 4IWDA 5E8UA 1UNLA 3TIZA 4AXEA 5EYKA 2GFCA 3C0IA 2J9MA 3F82A 1IA9A 3TZ7A 4EQMA 4U79A 1UVRA 1NA7A 4YJRA 5JSMA 1FBNA 2H6DA 1F5QA 1PMEA 5KMIA 3QTZA 4B4LA 4PMMA 2P55A 4MWIA 3TT0A 1PKDA 2OO8X 3NNWA 2X81A 3FZSA 4CLIA 4C2VA 2ITPA 4MF0A 5H9BA 1OUKA 4Z55A 4XV2A 3R6XA 3DU8A 5CI6A 5HI2A 3GC9A 2QCSA 3EZRA 2PVKA 3ZEWA 1OVEA 2R3OA 3CD8A 3GENA 4TWCA 4CEGA 3VBXA 4ZZOA 3W0MA 3OEFX 1UNGA 3D7TA 4FT5A 4IFCA 4TW9A 3UVPA 3EH9A 3DK3A 4JIAA 3VIDA 2G2FA 4IJPA 3VBTA 2BHHA 2FA2A 3IW4A 4UMRA 5BYYA 4DHJA 2YFXA 4O7ZA 3ZLWA 4DGGA 3S2PA 4BGGA 4O83A 2X7GA 3FLQA 1JPAA 3LJ0A 3NAYA 4CV9A 5EI6A 3ORTA 4LGGA 5HE2A 3BBWA 5IPJA 3PSCA 5D12A 4DFXE 2BIYA 3R00A 3Q4TA 3CTJA 3C4EA 4PL3A 4BI2A 3GGFA 2X2KA 3HRBA 3UO6A 3GC7A 5FXQA 4YNEA 3KF4A 2OXYA 3ZLYA 4I3ZA 4ZJJA 1GIHA 2I0EA 1ZZ2A 5G1XA 2JD5A 5GJDA 3MYGA 3HP2A 3UC3A 3BQCA 5FP6A 5IH4A 1H1WA 1R78A 3EIDA 3WE4A 1QPDA 1ZYSA 2VTNA 3F66A 2HCKA 1WBNA 3P4KA 3HA8A 3NUUA 3LFQA 3DJ6A 5CY3A 3BHVA 3WBLA 4AE6A 2NNWB 3FZRA 4O0TA 4WBOA 3EFKA 1T45A 3UQCA 2F7XE 3EQHA 4IX5A 3ZFMA 2YWVA 3PIZA 3O23A 3MY5A 2BRNA 3EFLA 4IMYA 4JBPA 5AA9A 4XG8A 3AKLA 2ETMA 3QUPA 3QHRA 3VBQA 5JH6A 4DFBA 2C6MA 2CNUA 4D9UA 3QTUA 3T8OA 4XV3A 4FYOA 4IDTA 3MFTA 2WMSA 4ZMEA 4D55A 3B2WA 4IVCA 3BHUA 3O8TA 4BCKA 5K4IA 3DAEA 1IRKA 3CC6A 4QYEA 2OJJA 3R7OA 3WOWA 2WTKB 2OXDA 3V51A 1CSNA 2QLQA 3JVRA 5HCZA 4M7IA 2X9EA 4E4LA 4JDHA 3U9CA 3F7WA 3QTQA 5AP2A 3FMDA 4R78A 3D9VA 2ZYBA 3FXXA 5TOZA 4R5SA 3V8WA 4YZ9A 3HMPA 5CEOA 5A46A 3LAUA 3FI2A 1IAJA 4BYIA 4XLIA 5FUTA 2GNGA 4QMQA 3IPHA 3PXZA 4QP6A 4DEHA 5HHWA 1OPLA 1H08A 2C0OA 4KAOA 3ZEPA 2NP8A 3R9HA 3MBLA 4K2RA 4ENXA 4XG9A 3EYGA 2B52A 3EL8A 4JQ7A 1I44A 3TNWA 5EW9A 4I21A 3RTPA 3KRRA 3BQRA 3V6RA 4H1JA 4FTUA 4S30A 5IH5A 5CU0A 1UU8A 2JITA 2W96B 2I1MA 4EOQA 1G8AA 1PYXA 3SXRA 2R3QA 5GIOE 3W18A 1OM1A 2J7TA 5HOAA 3OMVA 3UYTA 3WZUA 2JDVA 4KBCA 5A4CA 4IADA 3GT8A 1LPUA 5DT3A 3QD0A 4QQJA 4C4JA 1APME 3II5A 5DOSA 4TWOA 2PULA 1H1PA 4ERKA 5L4QA 4IAZA 2A0CX 3R83A 1DI8A 4AZTA 4CV8A 3D5UA 5L6OA 2HOGA 3E8CA 4C3FA 4L7SA 3QCSA 4K1BA 1OI9A 4XG6A 3FMMA 3ZSIA 1O6YA 5LVLA 3VS6A 2VTHA 3OWPA 3PJ3A 3VW8A 4YJNA 4RIXA 3BEGA 3P5KA 4G6LA 4RVMA 5K0KA 3R7IA 4PL4A 4YC6A 5FTQA 4ALWA 2WTWA 4OTGA 4FJVA 2VV9A 4PF4A 4BZNA 2Z7QA 2W1FA 4QP3A 3FLYA 4XP3A 1SNXA 4FRFA 2QO7A 2O0UA 3NLBA 4JAJA 3UMXA 5CZHA 1ZOEA 4IE9A 5D7AA 4DFLA 1G8SA 4PPAA 4RMZA 4FSWA 5JEBA 4PNIA 4QP7A 4MBIA 4AOIA 3KMUA 1JLUE 4BI0A 1WBOA 3NGAA 1NXKA 2XKDA 4A9RA 2UZNA 3LFCA 3OOMA 3Q52A 3QQHA 4G2FA 4FSRA 4YJTA 3HV6A 5HVJA 4G6NA 2W9ZB 3V5WA 4BDHA 3VUKA 4E3CA 5C9CA 4JVGA 3ORIA 2A4LA 4CRSA 5J9ZA 3IW8A 5IISA 4KRCA 2BMCA 3F7ZA 5J8IA 3QZFA 3GCPA 5KE0A 5HKMA 2XNMA 5M56A 2W1DA 1URCA 2W17A 4FTIA 4HZRA 3LMIA 4FIHA 2QQ7A 5HD4A 3ZUUA 2BR1A 5J7HA 3E63A 4N6YA 1H27A 5M06A 5HLWA 5CI7A 4QMWA 4BICA 4TYEA 1XBBA 3K3JA 1OL6A 3K5UA 5L2SA 1OGYA 3F5GA 2EXEA 4E6AA 4W4VA 1K9AA 3PRIA 4RIYA 3QRKA 3PY1A 5BPYA 3PFQA 4UXQA 3FYJX 3OOGA 4FZAB 5L8LA 1OL1A 2DUVA 3DBDA 5CSVA 3IQ7A 1YHVA 4YBKA 2XRUA 3IW7A 5EM5A 2JKKA 3SAYA 3QTRA 5JFVA 5K5XA 3AT3A 3KVXA 4LGDA 2B9FA 4FK3A 4RA4A 3UO5A 5CSXA 3UPXA 5AAGA 3BZ3A 5BQ0A 1XWSA 3R2YA 3HDMA 5J79A 4EOLA 2X4ZA 3QA8A 4QMPA 4F7SA 3F88A 3KGAA 5JMSA 3PVWA 5CQUA 2BDWA 3FMLA 3G2FA 4QMOA 3L8VA 4QNYA 4M69B 2OLCA 2C69A 3O7LD 2OICA 4ID7A 3F2NA 3FZTA 4DG0E 3ZRKA 3HVCA 2VTPA 5D41A 3KL8A 4NYEA 2XK8A 4PDSA 5KZIA 3SD0A 2OI4X 3ZYAA 4GJ3A 3AMAA 3QGYA 4M8TA 3FI3A 3IK3A 2YITA 1SNUA 3ODYX 3TZ9A 4CT2A 1F0QA 1M7QA 3VBWA 4RA5A 2EB3A 4GK2A 4NM7A 2I7QA 3CY3A 3ETAA 1ZARA 5CSHA 5EW3A 3EYHA 1YOMA 3Q9ZA 4XEYA 3GFEA 5EFQA 3CGOA 1XMLA 5D1JA 5BVKA 4FYNA 5ETCA 2JAMA 4EH8A 3UVRA 4TYHB 3KVWA 3BU3A 2OK1A 2ZJWA 2EUFB 4FTNA 5HICA 1Y6BA 5CXZA 5JN2A 3KQ7A 4JDIA 3DZQA 4NFNA 4OUCA 4MYGA 5DLSA 5IQBA 2XIRA 2HYYA 3ZBFA 3AT2A 4PMSA 4APPA 2QR7A 2QO9A 4FTTA 4I22A 2JFLA 4NSTA 5AJQA 3V04A 3IDBA 1PY5A 2FYSA 2QOHA 3LLTA 4FA2A 3EKKA 4RT7A 3Q60A 5IQGA 4FSYA 2A98A 3MJ2A 3UBDA 2BKKA 1W2FA 4USFA 2YIRA 4YC8A 3BHYA 5CAOA 4I0SA 5IMEA 2BROA 4EJNA 3OUKA 3PRFA 5FWKK 1DI9A 4M67A 2IZTA 5E90A 4ZSEA 4Y83A 1VYWA 4F99A 3ET7A 4AG8A 4YLLA 3F9NA 3BLHA 1PXIA 2NO3A 4FKLA 5TT7A 2PVLA 3OWJA 4IB5A 3P7AA 3MWUA 2PPQA 3WILA 3CS9A 3ZH8A 5CAVA 4WD5A 4WOVA 3VHKA 5BVWA 2IVSA 4FTKA 2VWUA 2PZPA 2YIXA 5GNKA 4DCEA 4DGLC 4OTRA 5TKDA 2PY3A 5DR6A 2BRMA 2Y0AA 2X8IA 3CQEA 1H07A 5ACKA 4ITJA 4WIHA 4ZY6A 4GKIA 4FZ7A 3ZZEA 5BUEA 5CEMA 4M12A 3GBZA 5E8SA 4PV0A 2BUJA 2Z7LA 3QZIA 3Q04A 2YM3A 2ZM3A 4YTHA 2YN8A 2WGJA 1TZDA 5EI2A 2YLFA 2UZBA 3MH1A 3C13A 3OUNB 3P9JA 3W33A 3R63A 3A99A 3OT8A 1M2PA 3QF9A 3QQJA 5CEKA 4DTBA 2GNLA 3VS0A 3LCSA 1YXSA 4H3PA 1PF8A 3PXKA 4JIKA 4QMUA 3ZXZA 3ATTA 3Q53A 3ORZA 3MV5A 3R7VA 3DTCA 3QTSA 3D0EA 3RGFA 4EHEA 4EH5A 4ANSA 3OVVA 3TNQB 4L53A 4OTDA 5CVGA 4QP9A 1JKSA 2IEWA 3S0OA 1H0VA 3EFWA 4QPAA 4F70A 2PMLX 3RAIA 3FMJA 4KNBA 5DI1A 4XJ0A 3VS7A 3K54A 2REIA 2H34A 1Q62A 1G8JA 3TL8A 4WA9A 2IW8A 4YPSA 4N0SA 1U5RA 1ZMUA 3R30A 3ALNA 4GEOA 4LRJA 5D11A 5IEVA 3P5JC 3DY7A 4FE2A 5CALA 4GT5A 5ANKA 1YOLA 4IHPA 3FMEA 4XP2A 4BKYA 4D2TA 3WI6A 1JQHA 3MY1A 2XYUA 1G3NA 2Z7RA 4R7IA 3EQGA 1BYGA 2XZSA 5FP5A 3UOHA 3MA6A 3W2RA 3W0QA 3RHKA 3KU2A 3P7CA 4BCOA 4TY1A 4R3PA 4HYIA 3ZRMA 1U46A 4C2WA 4E20A 3DAKA 2ZMDA 5CNOA 3F3WA 3JYAA 5EI8A 4F1TA 4Z3VA 4GL9A 3Q9WA 5TR6A 4U41A 3CQUA 2ITYA 4CSVA 2VGPA 3HAVA 2HXLA 4FK6A 5ANGA 4QTEA 2GHGA 4C7TA 4UBAA 3NYNA 4O21A 2Z7SA 4F08A 3AC1A 3D15A 4IAIA 4JJRA 4LL5A 5FEEA 3W0OA 1KWPA 3EQBA 5A14A 1Q8ZA 3D5XA 3I0QA 4XNEA 2IZSA 2R7IA 4FOBA 5H8BA 2XEZA 3K5VA 4IQ6A 2DQ7X 5AWMA 2PUNA 1U54A 3KRJA 3O2MA 2C1AA 3QQGA 4AQKA 4L00A 2UW4A 3TV6A 3RZBA 4FKJA 4TZRA 4QMZA 4RG0A 4OW8A 1GOLA 4BRXA 4WSQA 1R0PA 4MBJA 3DAJA 4FSQA 4IVAA 4R1VA 4B8LA 3ZZWA 2WMTA 2WU7A 5ICPA 2ZDTA 4ZS4A 4ENYA 4V05A 3A4OX 2BRBA 5AA8A 3FHIA 4WUAA 4BCFA 2UZOA 3ZS5A 2CMWA 3G9NA 4EH4A 2JBPA 1YHWA 3N51A 4O1OA 2QU5A 5M4FA 1ZZLA 2J6MA 5F1ZA 4FC0A 4FKGA 4ZLZA 1OGUA 5EDPA 4KIPA 4LGHA 2QHMA 3SA0A 2C30A 4TWNA 2J0KA 3EKNA 3C0GA 1Q3DA 4X21A 5EHLA 4E93A 1L3RE 1IA8A 5C01A 3ULIA 4CLJA 4CFFA 2BAKA 1WVXA 3TUDA 1GY3A 4PTEA 4X3JA 4GMYA 4WSYA 2BTSA 3HZTA 5AP1A 3TIYA 4P7EA 1SZMA 3LXKA 4HCVA 2WHBA 4F78A 2CSNA 5CX9A 2P0CA 3NUAA 4DAWA 3VJOA 4XBRA 2CDZA 4QQTA 4YU2A 2WZJA 4BCPA 4IAAA 2IN6A 2FVDA 4IC7A 4ZSLA 2UZDA 2UZLA 5JFSA 1QPJA 3QKMA 5CTPA 3V3VA 3CP9A 1LUFA 4A9TA 3S00A 3AKKA 2G1TA 3D5VA 3B8RA 3QXPA 4K33A 3EQIA 2CJMA 2R3KA 2WTCA 2A27A 4N70A 3UTOA 5AFVA 4U5JA 4ALUA 4I93A 2R3HA 3UIUA 4H39A 3DXQA 5KUPA 4NM5A 3F2RA 5IDNA 4EH7A 4CFXA 5AUXA 3AC3A 4FT9A 3W16A 5KBRA 3IECA 3QWKA 3QQLA 3NDMA 3IGGA 4NK9A 2WQBA 4W9WA 3ZBXA 3Q2JA 4AAYA 3CGFA 4I24A 2F2UA 4BYJA 2XIYA 3R02A 2WMUA 3R71A 5ANDA 2X7OA 3DS6A 4CQEA 3BL7A 4F09A 5DE2A 4M68A 4A07A 4A4LA 5A54A 4APCA 3BLRA 3OS3A 4AFJA 3W0PA 4OTFA 3DKGA 3QD4A 3W2QA 1AGWA 3KXNA 2PMIA 2X7FA 4P90A 2VWVA 4MKCA 2XB7A 1MRVA 3ZONA 2FSLX 4G5JA 5F94A 4CXAA 4GK3A 3HV3A 3TM0A 2QVSE 4CMOA 4IX3A 4UMQA 3VN9A 3ELJA 3BYUA 4D5KA 4D2SA 3LQ8A 2BRGA 4BIBA 5HESA 2V55A 3BI6A 4QP8A 4C4EA 5HO7A 5AUWA 2PZIA 4J99A 4DE4A 4H1MA 3AC4A 4G3FA 4FKTA 3FXZA 3V8TA 5IUIA 3P1AA 4C59A 5DBXA 4TKSA 4ZXTA 2RL5A 3KA0A 1QL6A 2B53A 4FT0A 3ITZA 4MWHA 4PP9A 2CCHA 2JBOA 4NTTA 3GU6A 3MTFA 3A60A 3Q9XA 4WO5A 4XLVA 2R3JA 4RJ5A 3S3IA 3A8XA 1OIQA 3QTWA 4DH8A 3VVHA 1MP8A 4ZAUA 4ANNA 5BMSA 2ZFYA 3Q5IA 4YP8A 3BIZA 4JQ8A 4JR7A 4NIFB 3WF9A 4DG3E 1YKRA 3T9IA 3UZTA 1XH7A 2Y4PA 3KC3A 4I20A 2W5HA 4YUQA 2VO6A 2QKRA 2EB2A 3QQKA 4R77A 3CIKA 4XG3A 4D5HA 4G9CA 4M0YA 3PXRA 4EHZA 3L1SA 1VEBA 5C03A 1OECA 3ORPA 2GNFA 5I9XA 4QP4A 3DDPA 3EN6A 4DN5A 4EKKA 4FG8A 4DC2A 3TYKA 2X4FA 3TMOA 2C68A 2HAKA 5IKWA 3WE8A 5E8XA 1DAYA 5AR3A 3ZOSA 4HPUE 3RNIA 2VX0A 2CNVA 1QCFA 2WMWA 3RM6A 5A6NA 3CSVA 1YDSE 3BLQA 3ANRA 2GHLA 3G15A 4BGQA 4QTDA 5A4TA 2ESMA 4JMQA 2X39A 2OZAB 5AM6A 4FZDB 3EOCA 3Q6UA 5T3QA 2I40A 3E3BX 4IDVA 4F65A 2EVAA 4UZDA 1PXLA 3R22A 3R1YA 1WVYA 5AUYA 5H8GA 4A7CA 4ZY5A 4E5WA 4L01A 4Y5QA 1OKYA 2WQMA 3NVKI 5AUZA 2X8EA 3FV8A 5KMJA 2GU8A 3F3VA 3FY0A 4ACHA 4HVHA 5CSPA 3N4VA 3I7CA 3HMMA 2IW6A 3PJ2A 4ITIA 3RMFA 3TG1A 4X3FC 3QHWA 4ASEA 1MRUA 3JVSA 3O8PA 4IIRA 3NPCA 4L45A 4RVKA 4YPDA 4ZS0A 3RNYA 4QMVA 5F4NA 2CN5A 2VO7A 3R1QA 3MTLA 5AR5A 3W2OA 3IOPA 3NNXA 4DFNA 2UZUE 2HW7A 4RX8A 4EEVA 4M13A 4O0XA 5CF5A 2QNJA 2QOOA 1A9UA 4FG7A 3E7OA 4GU6A 3PP1A 4C02A 3P78A 5E7RA 2R3RA 3TV4A 5C8KA 1H01A 4FGBA 1ST0A 4NCTC 4S2ZA 5EOLA 4EUUA 2V62A 3RWQA 1STCE 5BNJA 1J1BA 5AP7A 3OEZA 3ZLSA 2YA9A 1LEWA 5AR7A 3ACKA 4WNMA 5IDPA 3BE2A 5K9IA 4IW0A 3C5IA 3HDNA 2E9NA 3KRWA 2F2CB 3R9NA 3FUPA 4Y46A 2BPMA 2VZ6A 3R7YA 4HPTE 3E92A 2RFNA 3SW4A 4EZ5A 3V5TA 3CD3A 4BWKA 2LGCA 4F7JA 3E8NA 1IEPA 4FV3A 2WOTA 3UODA 1REKA 3MI9A 1KE8A 3TDVA 4Q5HA 1IR3A 4O7TA 3VBVA 3E3PA 4QMLA 4O82A 1G5SA 5HTBA 5M57A 4TWPA 1PJKA 2HZ0A 3GEQA 3O50A 5LCKA 2OIBA 2YCQA 4IWQA 5GINE 3FZ1A 4G1WA 3V5PA 3QRUA 3LFAA 1OL7A 4TYHA 1Q5KA 3AC5A 4BDCA 3DNEA 5M55A 2OSCA 3QKKA 2HW6A 4BJJB 3SLSA 2R3IA 2HXQA 2XVDA 4RJ4A 1SVEA 3R9DA 5L2IA 4ORKA 4G16A 1ATPE 1MQBA 2QLUA 2R3PA 4NT4A 2FB8A 3P86A 2VGOA 2ITUA 3JS2A 4M84A 3EQFA 3W10A 4QD6A 5FTGA 4R7BA 4ONAA 4XOZA 4Y5HA 4JBQA 3R8MA 3HECA 3R8VA 4FTCA 5IQEA 2ITQA 4CRLA 3LQ3A 4CZTA 1UU3A 5HIBA 3EZVA 2ITVA 4L3PA 3R2BA 4YZDA 2QKWB 2W0JA 4KSQA 2O8YA 2VTOA 5E92A 4NW6A 1WMKA 4S34A 5I9VA 5JKGA 4CCUA 2VN9A 3H4JA 3IW5A 3DCVA 3FZOA 5LJJA 2W1ZA 3VONA 4JQEA 2XF0A 4FTLA 4JX3A 4B8MA 4O7SA 2Z60A 3MH3A 4I92A 1YRPA 4UMTA 3MPTA 4OBQA 2J90A 5HORA 2XJ2A 2DS1A 4X0MA 3PDTA 2OH0E 3OHTA 2YCSA 3W8QA 3C7QA 1FVTA 4D4SA 3DT1A 2B9JA 4HNFA 3T3VA 2ONLA 2QOLA 3SHEA 4WNPA 1REJA 4G3CA 4N4SA 4F9CA 4FKRA 3PXQA 2OF4A 2IVUA 2UW3A 3KB7A 4TXCA 4CG8A 5J9YA 4DEGA 5IQAA 4FTAA 4KINA 5L6WL 2X0PA 2H96A 2YIWA 3QWJA 3WIKA 4RQKA 3Q4CA 4KBAA 2ERKA 2CLXA 2XUUA 4C57A 2J5FA 4NL0A 3AD6A 3DA6A 4AN2A 5HGIA 4MQ2A 2ITTA 3FJQE 4RVTA 2C0IA 4O7YA 4RPVA 4JR3A 2XNEA 3MIYA 2O65A 4NJ3A 5LVOA 4BCNA 3IS5A 1SVGA 3LE6A 5I3OA 2CLQA 3FZPA 1Z9XA 3LMHA 4O4DA 4JG6A 2O3PA 1MRYA 1YXUA 1LP4A 5AP3A 1KE6A 1W98A 5HBHA 3SRVA 3VUTA 3NFFB 5JK3A 3PFYA 4G3EA 4MD7E 2XK3A 4KIOA 4Q5EA 5LMKA 1TQPA 1R3CA 3KMWA 4FIGA 5C8NA 4KUJA 1TQIA 5H2UA 1OBDA 4FT3A 3PTGA 2E9UA 4NUSA 4HVIA 3AMBA 1UU7A 1A48A 4X2FA 2XNOA 2AC5A 1FGIA 4O4FA 2XAOA 1PYEA 1NVSA 4K6ZA 2WU6A 4W8EA 4Y85A 5HU9A 5FTOA 4PUZA 4JI9A 5LVPA 1JNKA 2BZIB 4GYGA 4A9SA 3O7LB 3KULB 3LMGA 4D4RA 4Z9LA 3RAWA 4ASZA 2GQGA 4J53A 3WF8A 3R28A 3FYKX 1OIYA 2ZM1A 3E5AA 2R2PA 3R9RA 4I41A 1KOBA 2W4KA 3WZKA 5IF1A 3KCKA 4RJ8A 2PMOX 4U3ZA 4OAUC 4R6VA 2WAJA 1E1XA 1R0EA 4HZSA 4WNKA 5AADA 3ZM9A 4YTCA 4I1ZA 3PSDA 3CJGA 4FICA 3UNKA</