4QMVA

Mst3 in complex with pf-03814735, n-{2-[(1s,4r)-6-{[4-(cyclobutylamino)-5-(trifluoromethyl)pyrimidin-2-yl]amino}-1,2,3,4-tetrahydro-1,4-epiminonaphthalen-9-yl]-2-oxoethyl}acetamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
288
Chain Sequence
LPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 288
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmvA01
5CZHA 4YPSA 4DFLA 1PYEA 2GS7A 3BHYA 3PWYA 5HIDA 4USEA 4RLKA 1WFCA 4YZNA 5CSPA 3FMKA 3TCPA 4FEXA 3MV5A 4FG7A 4MXZA 1OKZA 4KAOA 5A4CA 1CTPE 4EH6A 3PA5A 4XOZA 5E92A 4XMOA 1PXKA 3FL4A 4C35A 4KRDA 3UVPA 3Q9YA 4D55A 4QYEA 3LFDA 5ANGA 2JAVA 3R8VA 5CU3A 5AP6A 4Y95A 4CV9A 4HNFA 5LCJA 2F49A 4FKWA 3KMWA 4IBMA 5AR7A 3NCGA 3QZGA 3CPBA 4UWBA 4C33A 1LEZA 3ACJA 3RTPA 4ID7A 1I44A 4BCFA 5T3QA 1L3RE 3SW7A 3R02A 3V01A 2QOHA 3CQWA 3OOGA 2PE2A 1NA7A 4GW8A 4O7VA 4PMMA 4FNXA 2I0HA 2X7OA 2X4ZA 3GCUA 3AC1A 1Q8WA 1B38A 3BI6A 4FUXA 1JBPE 5EDPA 4O7WA 3U54A 3POZA 5AX9A 3WE8A 4AE9A 2X9FA 5JFWA 4YJRA 2VO7A 2GDOA 4L52A 1XH6A 3MIYA 4H3PA 4RT7A 5CSXA 1Q8UA 2VTIA 2VRXA 2JKOA 1DI8A 3QQKA 4RZWA 4V04A 3TI1A 4FK6A 2W1IA 2JBPA 4FGRA 1XKKA 1OZ1A 2XP2A 4MNFA 4J96A 4QPMA 3AC4A 4ASZA 3HV5A 1JKTA 2Q0BA 3OXTA 1PHKA 4G2FA 3KK8A 4PMTA 5AP4A 3GBZA 4EZ7A 2ZB1A 4KKEA 2WEIA 4EUTA 3BE2A 3QZIA 3LFEA 4F6UA 2WELA 1YXSA 3GI3A 4H39A 4M14A 5JH6A 5LMAA 1ZAOA 4J97A 3ZLXA 4RWKA 4R78A 4XG8A 2UZDA 3BYVA 1S9JA 3LXKA 3PP0A 4HJOA 4HCUA 5D10A 5LXMA 5HO6A 4UB7A 3OEZA 5J9YA 5AR4A 4GT4A 1PY5A 4BDIA 5D41A 3W33A 3W16A 4LUDA 4FTMA 2WZJA 4MBIA 4ZMEA 2QC6A 3ORMA 4UMRA 3ZFYA 4BVUA 3QD4A 5A4QA 2HELA 1XHAA 5LVOA 2BUJA 5AM7A 2G01A 2EVAA 3FPMA 4ZP5A 2OJ9A 5J1WA 4ANNA 2PUUA 4BCHA 4DFYA 4O7SA 4EKKA 3I6WA 2GQSA 3HUBA 3QBNA 4LGDA 3HDMA 3MFRA 3NMUF 4K18A 3LAUA 2F57A 4BC6A 5GNKA 1NXKA 3DAEA 1PXMA 1Q3WA 3RAKA 2PVNA 4Q5HA 3EL7A 2YIYA 2LAVA 5CNNA 3BCEA 2UZLA 4PV0A 3LQ8A 4ARKA 3ORXA 4O86A 3AOXA 4HYHA 3R7OA 1S9IA 5L6PA 3A4OX 2OJIA 2VTSA 5B2KA 3FI2A 5FWKK 3TT0A 4NCTA 1YOLA 3IKAA 5TOZA 3ZRKA 3F3TA 4AFJA 4CZYB 4J95A 5CVFA 1OB3A 3JPVA 2CDZA 2VX0A 4GJ2A 4CMOA 1E1VA 3S00A 2YCRA 3ACKA 2G2FA 2WTKC 3FMLA 3PXQA 3ZO4A 1PMEA 3Q53A 3ALOA 2WMTA 4HOKA 4DCEA 4Z55A 1HCKA 5T6KA 3HAMA 3NAXA 4MHAA 4O0UA 1REJA 5IQFA 4I21A 2JDOA 1V0OA 4B99A 2J90A 1WAKA 3R63A 5CSHA 4WBBB 3RK5A 4FIIA 4ACGA 3TTIA 5I4NA 5B0XA 2R5TA 4HVGA 3ZZWA 4JRNA 2ITVA 3TN8A 4BWPA 4DF3A 3UZPA 4CG9A 4LRKA 4J52A 4QQJA 4GRBA 4TYIA 3E88A 4DFUA 1ZZLA 5EG3A 5CYIA 2WTWA 3F88A 4KBAA 3E3PA 4TYJA 2OF2A 2P2IA 4L8MA 4TWPA 3D15A 4O6EA 4YZMA 3BZ3A 5JRQA 4ZMFA 5HU9A 2BR1A 3B8RA 2QI8A 2X4FA 4AG8A 2W5BA 1OIQA 1DS5A 1H26A 3NDMA 4O0YA 2PPQA 5LARA 3QLGA 5AUUA 2J4ZA 4RX7A 1OECA 1KSWA 3ITZA 2XM8A 5CASA 3R8LA 2XIKA 3I5ZA 5FRIA 4M0ZA 5A46A 4H58A 4IQ6A 4NFMA 4YLLA 2E9OA 3MH0A 2XKCA 4ZTNA 3OCGA 3IW4A 3I7CA 4O83A 4ZSEA 3O8TA 3HNGA 3LCOA 3HRCA 5CAOA 1W82A 3GENA 3O23A 3JR1A 3GC0A 4OTRA 3UMWA 4A06A 2PMIA 4MXOA 3ZO3A 1Z9XA 4BCOA 3ULZA 3EN7A 4QP3A 4TY1A 1YI4A 3NLBA 2IVUA 5IEYA 5L8KA 3MFTA 4I4FA 4AT5A 2I1MA 4MTAA 5A6OA 3DXNA 1U4DA 3S0OA 2VNYA 5HKMA 4BI2A 4DG0E 4USFA 2XIYA 3E8DA 3P23A 3IECA 4FNZA 4U42A 3RBWA 2QONA 3U51A 1GZOA 3SDJA 4ANBA 4DTBA 3A60A 2UV2A 2OH4A 3DPKA 2HYYA 3QALE 2QLQA 5IQBA 4GT3A 3RZBA 4O1OA 4ZY4A 2FSMX 1QL6A 1YXTA 3DKFA 4J8NA 4UEUA 3MJ2A 3F82A 5E1EA 1P5EA 2OG8A 2RFEA 2CNUA 4WIHA 4U7ZA 3SLSA 1TVOA 1BLXA 3O51A 4IEBA 4LG4A 4MQ1A 3F3VA 3JVRA 2G9XA 4FTAA 3MGYA 4RVMA 3SAYA 5EH0A 2QOLA 3PWDA 3N4TA 4L43A 2ZMDA 3QUEA 4FVPA 3C0GA 4BKZA 4KBKA 5HLWA 3PPZA 2QU5A 2XK9A 4S34A 4MBJA 5BUIA 4ACMA 1OGUA 4WNPA 4EOIA 2CMWA 4FSRA 3GB2A 4QP2A 3F7ZA 4FR4A 4AX8A 5CSWA 5I3RA 3E5AA 3ZMMA 1DAWA 3QQLA 2WXVA 4OTWA 3OEFX 3NNUA 3ORIA 2YEXA 4FV2A 2CPKE 4TZRA 3Q9ZA 2XKEA 5AR8A 5C8NA 4R5SA 3FLYA 3KMMA 4II5A 2GNHA 5L2IA 5AP0A 1M2QA 4XUFA 3HRFA 4ASEA 2Y4IC 2AC3A 2VTPA 3QHRA 4ZK5A 4A4XA 3UOLA 3Q5ZA 4ZEGA 4DEGA 5DIAA 4M0YA 2W7XA 3A4PA 3MH1A 5CQUA 4WUNA 5BYZA 3D9VA 4U80A 3VUMA 2RL5A 3BU5A 3EYGA 3GT8A 1YHVA 5E8VA 1WMKA 2BZJA 1BYGA 2YHVA 5IDPA 2PMNX 2BRMA 3KY2A 4UALA 5F94A 2XJ1A 4XX9A 3UZRA 1W98A 4YUQA 3HL7A 3QTXA 5AUVA 3BLHA 3U9NA 5FDPA 2WTIA 5KO1A 3KVWA 4JRVA 4DINA 5EYCA 2W4JA 3DK7A 3F5UA 3OBGA 3BYSA 4N4SA 4W8DA 4AOTA 4D1XA 4EL9A 4ACDA 2XS0A 4FKGA 4EQMA 4C36A 2QOBA 4CT1A 4F9YA 2VN9A 3NIEA 3NSZA 3M42A 4EONA 5CAUA 2YFXA 4W9WA 2PL0A 3VUKA 2XEZA 4PX6A 3L1SA 4X21A 5AP1A 5H2UA 5M08A 4BB4A 5JGAA 2R3OA 4IWPA 4OTFA 4KBCA 4E4LA 4IXPA 3G6HA 3BQCA 3TIYA 4EH2A 5BX0A 5B7VA 5CEOA 3LMHA 2JLDA 3VQHA 4JXFA 2H34A 4CSVA 4S32A 2YLFA 4QQ5A 3ALNA 4LGGA 3E63A 2PMLX 3QA8A 3WZJA 3D5VA 5DT4A 3ORLA 5K0KA 4FV7A 4JQEA 2QU6A 4WT6A 3U55A 2C3LA 4S31A 2BRHA 3QRKA 4ITHA 1UVRA 1FVRA 5DLSA 5JSMA 4JAJA 4ZY5A 1I09A 3TG1A 2JD5A 2VTMA 3NIZA 1UKHA 2BAKA 3VS4A 5HTCA 5BVOA 2YLEA 3VS7A 1KE9A 4DEDA 4FEQA 4FTLA 1ZLTA 3GC9A 4EHZA 3C4EA 5FM3A 3I81A 2C0IA 2GQGA 4N6ZA 2Z02A 4M68A 1KE6A 4BCPA 4IADA 3VUIA 1FPUA 2JDRA 5AUZA 4YZBA 3V04A 3ZBXA 1GIIA 4HZSA 3ZSHA 4TYGA 3SXFA 1H1QA 3OZ6A 4D9TA 4HW7A 4NCTC 3R30A 3NNWA 1M17A 4HYUA 3VVHA 5M57A 5AIKA 4GV1A 3GU4A 4XLIA 5EM5A 5HBHA 2QR7A 2F9GA 2VAGA 4K33A 5T68A 1M7QA 4I20A 3RK9A 2QOQA 3RPSA 3FMHA 2UZVA 2E9VA 2CJMA 4LRJA 4ZSLA 5L2WA 3ZRLA 3A7HA 3BEAA 3OY1A 3C0HA 3CCNA 4LMNA 2X2KA 4XNEA 4AAAA 3NS9A 4A9YA 2GCDA 1ZRZA 2C4GA 3GNIB 4GIHA 1H4LA 2OIDA 4I24A 1GZ8A 3QRJA 1OITA 3AT3A 5ACKA 3IGOA 4BDBA 3CGOA 1J1BA 1Y6AA 2C6IA 3C7QA 3EQBA 2PZIA 4X6RA 5LMKC 1H0VA 2J51A 4YLKA 3FMMA 4GUEA 4B0GA 5AR3A 5HIBA 4AF3A 5KE0A 1H00A 2QOOA 4GKHA 3RGFA 5HE0A 3BYUA 4G3GA 3U4UA 4U79A 3FPQA 1AGWA 3DZOA 1J7LA 5FUTA 1KV2A 4A9RA 3A8WA 3GQIA 5EW8A 1PXIA 1JWHA 4CRLA 3IDCA 4DGNA 1G5SA 5BVDA 5A4TA 1XBCA 4EOSA 4YNEA 2O2UA 5ITAA 3PVUA 3WF6A 4CFUA 5DA3A 3HMPA 4IW0A 4L3LA 4QYGA 2V5QA 4IE9A 1OBDA 5D12A 3EQFA 3V8TA 4OTDA 3BKBA 5C9CA 3OT3A 3T3UA 4YTFA 4M12A 1IAJA 1JKLA 1F0QA 4QMTA 3TV7A 3W55A 3OD6X 4M97A 4C38A 4RVKA 5H8GA 4MXCA 2RF9A 4DFBA 1W8CA 3FSFA 4QPAA 4IAFA 2YN8A 2OGVA 3OY3A 4TPTA 4PPAA 4IC7A 4OUCA 1FBNA 3QFVA 1GIHA 4F7LA 4OW8A 1MRVA 3UC4A 3R9DA 2WMRA 5CXHA 4CXAA 5DPVA 3UO6A 2J5FA 3GU6A 2OZAA 5J7HA 4GS6A 4C4FA 2YM5A 4WNKA 3CD8A 2GS6A 1M2RA 2B9HA 4JT3A 3FHIA 4F65A 4NTTA 4CNHA 5IQEA 5KKRC 4BY9E 3R0TA 3UZTA 2V22A 4FIEA 4JIKA 4WKQA 4QYHA 4DBXA 3HLLA 3VRZA 4CYIA 2C6TA 2HW7A 5D9HA 4B4LA 2IPXA 4CMTA 1W83A 3LLTA 3FI8A 4ZZNA 2UW0A 5LVMA 5HG9A 2C6OA 1OMWA 3PUPA 3ZXTA 3K3JA 4ZS4A 4AZWA 3FY2A 4U3ZA 4O81A 4RFYA 2XK3A 3PP1A 4M69B 3R7EA 2FGIA 2XYUA 3D5XA 3KFAA 3PSBA 4RIWB 4FV0A 5IA3A 4FIJA 2C5YA 3SVVA 2FO0A 4RIOA 2V62A 3AMYA 1PKDA 1IRKA 3H9RA 1HOWA 2EXCX 4KNBA 3HV4A 3GU8A 4Y83A 3W10A 1P2AA 4S30A 3F2NA 3I7BA 3SOAA 3VQUA 2C5NA 2QOKA 4FKTA 4AT4A 4L53A 2YM7A 5F1ZA 3CR0A 5I9WA 2PTKA 4AW5A 4NM0A 4BDEA 1R0PA 5C8KA 1YOMA 3FC1X 4C2VA 5D1JA 4FL2A 4H3QA 3DKGA 2R3IA 2JEDA 2IZUA 4ZSJA 3EN9A 4YJQA 2ZM1A 5EOBA 3DK3A 5GJDA 5H8EA 4GSBA 3MN3A 5FTOA 3QYWA 1XO2B 3SXSA 2QODA 3MTLA 2WMVA 4BGQA 3KU2A 3LQ5A 5CLPA 4C62A 3FDNA 3CTQA 5L6OA 3EOCA 3RK7A 1A48A 2IWIA 5D7AA 2C1BA 4YC3A 2W99B 4E1ZA 2X0GA 3NW6A 1OI9A 3FZOA 3QKKA 3UNJA 2QO2A 4GU6A 4G17A 3KC3A 5CU2A 4CLIA 2BDJA 5E4HA 2CHLA 5M56A 3G9NA 3LXNA 4RIYA 2HXQA 4XP3A 5FBNC 3NUPA 2Y4IB 1YXXA 2VZ6A 2YIQA 4JS8A 4LV5A 4RWIA 4PQNA 4W4YA 2HAKA 2EUFB 4O0TA 4FE2A 2P55A 3PE1A 5TT7A 3JS2A 4BCIA 3E87A 5CEKA 3OWJA 5ANDA 5EKNA 1JLUE 4D4SA 3ULIA 4PY1A 5AMNA 4QMNA 3EKNA 4QMUA 1FGIA 4BGHA 3W18A 2QOCA 5HNIX 2DYLA 1P4FA 3TZ8A 5EW9A 5EI6A 5HICA 4TT7A 3V6RA 1MRUA 2PSQA 3QZHA 4YJUA 3F2AA 5IA2A 3R28A 3BWFA 3T8OA 1BX6A 2VWZA 2WOTA 4FICA 4E8AA 4TL0A 5LWNA 3NW5A 3VHEA 3IOPA 5EKOA 1A9UA 4LQMA 4P5QA 3PA3A 4U81A 3PIYA 4C58A 5J7BA 3OXZA 4DC2A 3VN9A 4IVDA 2J0LA 2DS1A 4IH8A 3NPCA 5HU3A 1PXLA 4MNEA 2JITA 2OSCA 2QURA 2W9FB 3AMAA 4G3CA 4G9RA 4IACA 5GZ9A 4I1ZA 3QXPA 3TJCA 1KWPA 3CTJA 1UKIA 3UC3A 4P90A 3QCQA 4JL9A 5KCVA 1JOWB 4WA9A 3N4UA 3PXRA 4TWOA 1W0XC 3UNZA 4AZTA 5ACBC 3H3CA 4EORA 4L44A 2UZNA 3AGLA 2PVFA 2YDIA 2R0UA 2RGPA 4JAIA 3REPA 4IZ5A 2GPHA 3WZUA 4AA0A 1ZXEA 1CKIA 2XIZA 4GMYA 5KX8A 5DT3A 1ZMUA 4DGOA 4ENXA 1UNGA 1PXJA 4EWHA 4H36A 3EQGA 2VWVA 3C9WA 4WOVA 2WMBA 4FKJA 2UZWE 4FG8A 4NM3A 4WG5A 3WF8A 4F9CA 2JKMA 3F3WA 3KN5A 4FMQA 4W8EA 4YTCA 2WQNA 3AC5A 3CE3A 3P79A 4FKVA 4I94A 5AWMA 5H8BA 3AGMA 4EJNA 5M06A 2F7ZE 3SGCA 4G5JA 4UZHA 1Q3DA 4FZAB 4M7IA 3PVWA 2HENA 4YHFA 3V8WA 4F70A 2OBJA 3MW1A 3ERKA 4CV8A 4HVHA 3PLAE 5AUXA 5C4KA 2HK5A 2ITUA 4EQCA 4YC8A 2CLXA 3Q4CA 3C4CA 2B0QA 2I40A 3ZLSA 5BVWA 3MY0A 3NYOA 4A4LA 4M69A 3DTWA 4QYFA 3KXNA 4RJ4A 4O2PA 4RIWA 2YZLA 3FEGA 2XVDA 2XIRA 2QR8A 3TV6A 4CQEA 1OIUA 3GC7A 2X6DA 3V6SA 3AXWA 4I5HA 5J87A 4D9UA 1ZYJA 3L9LA 4KUJA 3R01A 2BIKB 4IX3A 5FDXA 1J7IA 2G2IA 2VTHA 4NSTA 4A9SA 3DJ7A 1XWSA 1Q8TA 3P7CA 3WIGA 2ITOA 4JOAA 3KRJA 5KMKA 3Q04A 5IKWA 4FSZA 4IVBA 3QC9A 5ANIA 4ASDA 4B8MA 5L3AA 4QTAA 4FTRA 4FSUA 3AD5A 4R3PA 4AP7A 4XP0A 2PZRA 3RALA 3I1AA 4BDHA 3E3BX 3TTJA 5BVFA 3AT4A 4KB8A 4J71A 4I0SA 2UW6A 4FKOA 4ENYA 3RKBA 4MH7A 4XH6A 2Z7QA 4AZEA 2WOUA 4RFZA 2X81A 2FSLX 4MXAA 3QCYA 5CT0A 4ONAA 5AAFA 3PLSA 3QX2A 1CSNA 1STCE 3ANRA 3AC2A 3DOGA 3MESA 4DCAA 2FSOX 5E91A 3DBEA 3HMNA 3DAKA 2YACA 3LFSA 4BDAA 5IU2A 4CKRA 1O6KA 4M67A 3EZRA 5KMJA 5KBQA 2EWAA 2FH9A 4APPA 4EH3A 4C8BA 2XKDA 3OROA 3BHTA 4LOOA 3GUBA 5CVGA 4KSQA 3FLWA 3ZH8A 2B1PA 5TF9A 3V5WA 5GIOE 3ROYA 4HPTE 2R9SA 4CGAA 4OR5A 3BBWA 4H1MA 3RWPA 4L7FA 3UG1A 2XNMA 3FXWA 5IF1A 4JDKA 2GQRA 5ETFA 4EJ7A 3FSKA 5KKRB 3QRUA 3CC6A 4HNIA 4TWCA 3R7UA 4QMXA 4FKPA 3E7VA 5HG7A 2ITZA 2B9JA 3LHJA 3ORKA 5L2QA 4RA4A 3COKA 3CJGA 2WMUA 4HYSA 2QLUA 2ZV7A 1GZKA 4C57A 2XKFA 2WIPA 5DOSA 2OO8X 3P4KA 4F9WA 2GNJA 5LVLA 5H9BA 2CN8A 3V5PA 3W1FA 3SG9A 4BTFA 1PMVA 3VW8A 4AT3A 3P08A 3TDWA 3IQ7A 4QMZA 3ZDIA 1GNGA 3OCTA 3V5TA 4U5JA 3F61A 1L8TA 3LFCA 4IZ7A 2WAJA 5DH3A 2XEYA 4O0VA 3RMFA 2GU8A 3DY7A 5AP7A 4FTNA 3PTGA 4I6BA 1IA8A 3DB6A 3ODZX 3MSSA 4IFGA 1MUOA 4U0IA 1OL7A 3UE4A 4C4JA 3HYHA 1MP8A 3D0EA 2Y6MA 4BTMA 2UW3A 3DAJA 3DS6A 4G6LA 3HMOA 1LUFA 2B55A 1BUHA 5TR6A 5AV1A 1FOTA 3TZMA 5HX8A 4ZJVA 4GFMA 3H0YA 3JYAA 5CX9A 3R1NA 3HA8A 2GTNA 1ZYDA 3CP9A 4R7BA 3B2TA 2VX3A 3U87A 2QO9A 2OW3A 4IZAA 2C47A 4MXYA 3SW4A 4QMYA 2FVDA 1FQ1B 5KNJA 2NP8A 5EYDA 3E93A 4FKRA 3NUYA 4G16A 4LOQA 4IVCA 2C1AA 4Q5EA 1WBNA 4BDDA 4RJ5A 3AG9A 4UWYA 4D2SA 3RNYA 3TZ9A 3Q4ZA 5CXZA 1PMUA 1OIYA 2XB7A 3I60A 4M3QA 2VV9A 1GJOA 3EN4A 4BZOA 3QF9A 2FA2A 4QP4A 4WG4A 5EQPA 4E5WA 2P3GX 4OBPA 3BQRA 4NKSA 4R1YA 5EDRA 5BUEA 3ENMA 1Z57A 3CKXA 3M2WA 5DVRA 4ZZOA 4B9DA 4FYNA 3EHAA 4TN6A 4F64A 2VX1A 1GAGA 3AT2A 4PTCA 4EOMA 2W96B 5JN2A 5I9YA 3QL8A 4EWQA 5HBJA 3D94A 3VUTA 3GXLA 3QQUA 4CZUA 4QP7A 3EFJA 3QHWA 4NYEA 5A9UA 1P14A 2I0EA 4N70A 2H96A 3RHXA 3OW4A 5LMKA 3LJ0A 3GCQA 3U6IA 3G5DA 3BYOA 2VWWA 4Z16A 3NCZA 3G2FA 2ZV8A 4FT0A 4W4WA 3R7IA 2NNWB 2VTAA 4ZZMA 4H05A 1Q8YA 3BIZA 4YHTA 3VS5A 1YWVA 2RFNA 2UW9A 1XBAA 4YLJA 5IISA 5LMBA 4BYJA 4GL9A 5E9EA 4HVSA 2CNQA 3EMGA 3OG7A 3FQEA 4QO9A 4QTEA 5LVNA 2XK7A 4WRSA 4YGAA 4YU2A 4FKSA 4XG7A 5HORA 4CCUA 1DI9A 4LUEA 2G1TA 2J9MA 4J53A 2PMOX 4B7TA 3SQQA 2A27A 4AACA 4MK0A 5KMMA 3L8PA 5E8SA 2W06A 3FHRA 1TQPA 4LMUA 4Q9ZA 3RNIA 2CKOA 3HDNA 4AA5A 3CQUA 5JMSA 5IQGA 2YIXA 3FJQE 3MJ1A 4YJNA 4APCA 3KL8A 3PIZA 3GEQA 3NAYA 4UYAA 4A9TA 4BDGA 5HX6A 5CWZA 4A07A 4PMPA 4RQVA 5E90A 2A2AA 2BVAA 4UV0A 2RG5A 4P2KA 2Z60A 1RDQE 2WO6A 5M55A 5HHWA 3O0GA 1KOBA 2UW5A 3FXXA 1KE8A 3K2LA 4HPUE 4TW9A 5BVKA 3ZLWA 3W8QA 3Q5IA 3W2SA 2SRCA 1OIRA 4ZLOA 3IK3A 5C01A 5GIPE 5IQCA 3VC4A 1UNHA 2OZOA 1PKGA 4F6SA 3BLQA 3G15A 1JPAA 3R1YA 4EK4A 4I93A 4F1OA 4AN3A 4I5PA 3P0MA 3LVPA 3UP2A 2R3MA 3QTQA 3BRBA 2LGCA 3NUAA 5HIEA 4RZVA 5F9EA 1PW2A 2GHGA 5A3XA 4QTBA 3HV7A 4OBOA 3QRIA 4FIFA 3F9NA 5DFPA 5ETIA 4RC2A 4FTIA 4RQKA 2W1EA 3DXPA 3P1AA 3LCKA 4WRGA 1FVVA 3RJCA 2F7XE 3R71A 3TEIA 3WF9A 4UMUA 4QNYA 5AP3A 3KF4A 4PUZA 4HZRA 3ANQA 3BGQA 5E8WA 5FP6A 4FZDB 5DWRA 5H3QA 2ZM3A 4BN1A 4GU9A 1YXUA 5CANA 1SYKA 2O8YA 3DNDA 3UODA 3ROCA 4MCVA 4FI1A 3R8PA 2RSVA 3FC2A 2OJJA 5JKGA 4BIEA 1F3MC 3EL8A 3WYYA 4EOLA 3NRMA 3VRYA 3R7GA 1OKWA 3EFLA 3PIXA 4ITJA 5A54A 2UW4A 5DMZA 5B2LA 4EOJA 1AD5A 4AZVA 2ESMA 4MXXA 1MRYA 4I23A 4ZJIA 3UNKA 2BFYA 3KA0A 5IH4A 1DAYA 3ZFMA 3SOCA 3LJ1A 5KHWA 4NW5A 4C61A 3P78A 3EN6A 4XV1A 1GOLA 4ANLA 1YDTE 2ZV2A 2JFMA 1X8BA 3D4QA 3GCSA 3LM0A 4RWLA 2YDJA 3EFKA 3FZPA 4HCTA 2HY0A 4U40A 3Q60A 5K5XA 2GMXA 2IVTA 3PZEA 3LFFA 2W4KA 3OVVA 2ZM4A 4FF8A 5CNOA 2VD5A 2J0KA 4O7YA 1Q8ZA 1WBWA 3S4QA 2PUNA 4YJPA 3NYVA 4LGHA 3MFUA 3HV6A 5AV4A 4O7RA 4E4XA 2JBOA 4DGMA 1WBPA 5K9IA 4AWIA 2CNVA 4CG8A 2OZAB 2R3QA 2R3LA 4UYNA 4TNBA 3ZCLA 1ZYLA 4GT5A 3QTRA 1J3HA 4H3BA 3ZUUA 1OVEA 2HIWA 4Y46A 5ANKA 2R64A 5L2TA 4X0MA 1SVHA 4U43A 3QQJA 3LMIA 5IH6A 1U54A 4BCGA 5KMOA 3V3VA 1V1KA 2QOFA 3FZ1A 3Q9XA 4AW1A 4YBKA 3CJFA 3ZEPA 3MY1A 3KK9A 3MIAA 4X7QA 2BKZA 4EBVA 4CKJA 3LXPA 2YM3A 3DA6A 4QYYA 1ERKA 4QMLA 4ALVA 3PRFA 1IAHA 1WCCA 1KE7A 3ZSGA 2O5KA 1XH9A 4BTKA 4OTGA 3G51A 3D7TB 2XNPA 4HGSA 2I7QA 3R1SA 1PJKA 3OHTA 4K77A 1WVWA 2E9UA 2GSFA 4F6WA 3GFEA 2A4LA 3FI4A 3KQ7A 4NZWB 4QMPA 5EQEA 3KXHA 1YOJA 3BU6A 2WB8A 5AIRA 4RVLA 5AV0A 5GHVA 4YMJA 3SC1A 4P4CA 2C68A 4JR7A 1CMKE 4GG7A 4TYHA 4XV3A 3VW6A 4AOIA 5AX3A 4YSJA 2JFLA 2VU3A 4WSQA 1OL2A 4ANMA 4XP2A 4FKUA 2WQOA 3L8VA 3PA4A 2UVYA 3PPKA 1FVTA 3ZM4A 2ZVAA 1H1RA 4BHZA 4IDVA 1H1PA 3MB7A 5M44A 3RAWA 2OIBA 2QVSE 2VUWA 3O7LD 4XG3A 4PRJA 3DDPA 3IS5A 4I6HA 3HP5A 3VO3A 5BYLA 3NVMB 4GVJA 4U97A 5HESA 5JZNA 2PZYA 3DQWA 4FGBA 3FMDA 1G3NA 4FIHA 5EM7A 3WZDA 4BI1A 1SVEA 2CCIA 2XNGA 4MKCA 5HE1A 5KUPA 5AUYA 2NPQA 2VWBA 5KZIA 4RIYB 4FV8A 2EB2A 3BGZA 3P86A 5AV2A 4GFGA 1PXNA 2IN6A 5EW3A 4DYMA 4R77A 1ZMVA 3IONA 3PXYA 4X6QC 1VYWA 2UUEA 4LL0A 3DBFA 1JVPP 4JG7A 2WPAA 1OUKA 3EQCA 5AV3A 1NY3A 2QQ7A 3Q9WA 4AUAA 4O21A 5JGBA 5FXQA 3LFQA 4DFXE 4Q2AA 3M1SA 3FZRA 2C30A 1UA2A 4YJOA 4XBRA 4Y85A 2ZYBA 3TIZA 1QPEA 4BIBA 4CCBA 2UZTA 4C7TA 3OT8A 4W4VA 1NVRA 3LE6A 5E8YA 5FXSA 3QZFA 5JQ5A 5DEWA 3H9OA 3W8LA 3F3UA 3ZUVA 3TACA 4D28A 2BDFA 2F2CB 5CF8A 3F69A 4FBXA 4C4IA 5ETAA 3DB8A 1Q41A 3QX4A 1ZOEA 4FZ7A 4IMYA 5BQ0A 4UMPA 3L9PA 3OWKA 3Q4TA 2PY3A 3LW0A 3C1XA 3O8PA 3SG8A 3R8MA 4KA3A 4MBLA 3KEXA 2HXLA 3DLSA 3LKMA 3O8UA 4FNYA 4MNEB 5FEDA 1BI8A 5JRSA 4D4YA 5CTPA 2P0CA 4IB3A 4Y8DA 4ZTQA 4FOCA 1LR4A 4EC8A 2BHHA 3DZQA 3G9LX 4GK4A 5DR9A 4QP8A 1RW8A 3PVBA 4RVTA 5FD2A 4AGWA 4C02A 4DEAA 3WF7A 2VWIA 4PDSA 4CYJA 2BZIB 2PE1A 1IASA 1YVJA 4K11A 3Q3BA 4FNWA 1QMZA 3KXXA 4FV9A 2R3GA 1P4OA 1YI6A 1SNXA 4IIRA 3T3VA 4E6QA 2ETRA 2O0UA 3OTUA 2C3KA 2OJFE 3MA6A 3GP0A 5CI6A 5E8TA 5EHLA 5HG5A 4FUYA 3UIXA 3PJ2A 3H10A 5KHXA 4Q9SA 4FODA 5K4IA 5C4LA 2YITA 4JDHA 2RIOA 4MD9E 3E8EA 5GZAA 1CKPA 4X2NA 5HNBA 2IVVA 2WMSA 5L2SA 3R7YA 2C5XA 4FSWA 5CEMA 2CKEA 2X2MA 3OS3A 1Q4LA 4GIIA 5AEPA 5IDNA 4DH8A 3QQFA 1OUYA 4FOBA 3T9TA 4PPBA 3UPZA 3FLZA 2HZ0A 3LFNA 2C6EA 5AADA 2C0TA 4CRSA 3VHKA 4YP8A 3P9JA 4XRLA 2B4SB 2BFXA 4EK5A 4Z7HA 5J79A 3ZOSA 4CFWA 2G15A 2C3IB 4JI9A 3RAHA 4TNDA 3MH2A 3MTFA 4LM5A 1OL6A 4IX6A 3ZHPC 3OOMA 3OCSA 4L3PA 4DTAA 4ZIMA 3A61A 3ORZA 3JY9A 3AMBA 3VF9A 2XBJA 2VTJA 3GU5A 4G9CA 1BL6A 3GOPA 4RRVA 4RX8A 2W1ZA 4JIAA 3D7TA 4NM5A 4EC9A 4U44A 5L8JA 3EB0A 5JZJA 3IW8A 4DLJA 2C6LA 3VBYA 2HWOA 1V0PA 4X2KA 4D58A 3ZC5A 4CQGA 3HP2A 3QUPA 3NYXA 4GK2A 4R7HA 5EYKA 3NWWA 3RPRA 2FYSA 4DLIA 3L9MA 1CM8A 2WFYA 5HCZA 5IMEA 4LYNA 4UWCA 4O2ZA 4XG4A 3UMXA 5EQYA 2GTMA 4DFNA 3B8QA 3BPRA 2YABA 4FK3A 5DR2A 4UY9A 5IA0A 4ASXA 2R3PA 2GS2A 4OLIA 1ND4A 3UG2A 2OJGA 4ZY6A 1OPKA 4E93A 1SMHA 1H01A 4IB5A 1XJDA 4FT7A 3DJ5A 4RJ3A 3R00A 1Y6BA 2BMCA 3ZONA 2OF4A 2XCHA 3COHA 4O84A 1UU8A 4C34A 1U46A 1Q99A 4OTPA 3CTHA 3O71A 3D5UA 1V0BA 2Z7RA 2ERKA 3PJCA 4FL3A 4IVAA 5I3OA 4YJSA 3TKUA 2WU7A 3PJ3A 4BR3A 4F1MA 2WTDA 2WKMA 4O0SA 5AAGA 4F1TA 1B6CB 3ZO1A 2B52A 4JBVA 4G6OA 4CKIA 4RJ7A 3MVJA 3UYTA 4L9IA 3G6GA 5BYYA 3C51A 2BROA 5AP5A 3UPXA 3QD2B 4GFOA 2WIHA 3LMGA 4RJ6A 4EOQA 5HE2A 4F7NA 3ATTA 3FI3A 2OWBA 3I79A 3RZFA 3NEWA 1O6YA 4ZLZA 3BEGA 5LJJA 3C4WA 3VBQA 5HLNA 4NM7A 2YERA 1CDKA 3FYKX 5AR2A 4BZNA 4F09A 2I0YA 2YCFA 4KKHA 4O27B 4KIKA 1H08A 3NUNA 2H9VA 5E1SA 4B8LA 3DNEA 4O0XA 5I9VA 4BI0A 4CTBA 3I5NA 4I41A 4ZSGA 2OXDA 1NVSA 2WQEA 2Y7JA 4I3ZA 5DR6A 4PNKA 1YW2A 5HEZA 4XLVA 4IM2A 2GFSA 3KN6A 3D2IA 3Q2MA 4DH5A 4KINA 2JDSA 2PVKA 2C3JA 2HY81 4ZTSA 3ZTXA 3KRWA 2HZNA 4F08A 3IDPA 4I0RA 2P33A 3FLQA 5HE3A 5HQ0A 2BCJA 2Y9QA 4O0RA 2YM8A 2QCSA 4XYFA 2WNTA 1XH5A 2ITXA 2QKRA 4FG9A 3O7LB 4NL0A 4JX3A 2OI4X 5JGDA 1H27A 2OXXA 4RC4A 5CALA 3PZHA 3RPVA 5AFVA 3O17A 3KRLA 4G3EA 4V0GA 4K8AA 5E8ZA 3ZC6A 2X7GA 1O6LA 1XH8A 3FZTA 4DT8A 4U8ZA 3NNXA 3WARA 4QMSA 4Z3VA 3RWQA 3PE2A 3GQLA 3IDBA 3PY1A 5LCKA 4QPSA 3O96A 1M7NA 3QWJA 2E9PA 2JIVA 4PP7A 5AA9A 3C4FA 2VTRA 5DE2A 2PK9A 3LFBA 4PF4A 1Y8YA 4DEBA 3QGYA 1VEBA 2I0VA 4JBOA 2EXMA 3R21A 3TUBA 3TV4A 3UVQA 3E8CA 1H24A 5AP2A 1WBOA 4K0YA 1U5RA 3F6XA 3PPJA 3NR9A 1DM2A 4M66A 2BZHB 5FQDC 3RM7A 2DUVA 2FSTX 4GK3A 5ANJA 5EDQA 1H07A 2CCHA 1TKIA 5CENA 3S95A 5IPJA 4E5BA 2Z7SA 4F0IA 3OWLA 4JDIA 4BGGA 4C4GA 4AW2A 3RHKA 4DEEA 2BAJA 4QQTA 3KRRA 2B7AA 4RG0A 3KGAA 3BE9A 3HX4A 2AC5A 3SA0A 2VTTA 3LFAA 4RBLA 3Q6UA 4LL5A 3DV3A 3GOKA 2OKRA 2QNJA 4MWHA 2Z8CA 3R9OA 3N4VA 4R8QA 3EQDA 5M07A 4FEUA 4FTCA 3ET7A 3U6HA 3ZU7A 4LRMA 2C5VA 3HKOA 4BDCA 2ZV9A 3QWKA 4MF1A 4HGTA 3GCPA 1R78A 5DGZA 3KKVA 3CEKA 3KXMA 2ITPA 2YJRA 4NT4A 1J7UA 5HOAA 2VTQA 2YDKA 3JVSA 5D11A 4AXAA 5HNGA 3NUUA 4C3PA 4AW0A 2HW6A 1PXOA 3UOKA 5HLPA 4FV3A 3UBDA 4KIPA 5FEEA 4R3RA 2NO3A 4RPVA 5AAEA 5I9XA 4I0TA 1Q62A 2VGPA 3KXGA 3UQGA 4D2RA 3QC4A 3RM6A 1XH4A 3HGKA 1ZY4A 5IEVA 4O91A 3N51A 3COIA 1NT2A 2OFUA 3Q96A 4JBQA 1OPLA 3OXIA 1URCA 3FMNA 4AOJA 2P2HA 1G8AA 4QMWA 2YIRA 4G34A 4QOXA 1NW1A 3FL5A 4FSNA 3CS9A 5CT7A 5CU0A 2XM9A 2RFSA 2QD9A 4AE6A 4YJTA 5FEQA 3RCDA 3DTCA 3F5GA 1VZOA 3RVGA 4OGRA 4AA4A 1H1WA 2VGOA 3UOHA 3MVHA 1ZMWA 4FVRA 4WNOA 5J5SA 3QA0A 4EH9A 3LLAA 2X8DA 5FG8A 5C8MA 2XA4A 4BYIA 2WHBA 4F99A 2UVXA 3FV8A 4YTIA 2OK1A 4NTSA 1QPDA 4ITIA 4PPCA 5CU6A 2DQ7X 4XG9A 4EOOA 2WU6A 1YDRE 4IAKA 2WQMA 3C50A 3I4BA 4GJ3A 4U3YA 4L45A 3Q6WA 3W32A 3ORPA 1UV5A 3OUNB 2BDWA 2A0CX 1QPJA 4FV1A 3WYXA 3VF8A 2KULA 3EJ1A 3E64A 3FYJX 4HCVA 4ALUA 3MVLA 2VTLA 5HBEA 4FKLA 1IEPA 4A7CA 3MH3A 4IAAA 3BBTB 4IWOA 5EM8A 1BKXA 3DU8A 4DH1A 4PDYA 1YWNA 4AQCA 2X9EA 5CI7A 2BTRA 4GEOA 2OFVA 5FM2A 2IW8A 3RP9A 4EZ3A 2C6MA 3PY3A 2WD1A 3PRIA 2O3PA 2XK8A 3TKHA 3GC8A 2XJ0A 4P7EA 4D0WA 1IR3A 5HCXA 4NIFA 1H25A 2CN5A 4LFIA 3KCFA 5JK3A 4J99A 3RINA 5K4JA 3QU0A 2DWBA 2J7TA 2ZDUA 2ACXA 2J0MB 3C4XA 4XV2A 1VR2A 3EKKA 4FZ6A 3R9NA 4E73A 2BZKB 4BCKA 3QKLA 3H30A 4IJ9A 1JSTA 2E2BA 4EYMA 1KV1A 3UIUA 4IAYA 2BPMA 4MAOA 2CSNA 4FTTA 4USDA 5FBOA 5FXRA 2VO6A 5IH5A 2W1GA 3ZUTA 2CGWA 3EYHA 3I0OA 3M11A 3MB6A 5E8XA 1MQ4A 4I92A 2PYWA 3SD0A 1OBGA 2X6EA 4X2GA 4PL3A 3LCTA 4CEGA 3PJ8A 4KIOA 2XZSA 2R3HA 3H4JA 5LWMA 5LOHA 3VS6A 4DH3A 2UZUE 4YSMA 3KMUA 4MX9A 4PTEA 4ANOA 4FEVA 1K2PA 5IG1A 1QPCA 3NX8A 1H8FA 4RJ8A 3DT1A 3VWAA 2IZTA 3BWJA 3R6XA 3F2RA 5FLFA 3ETAA 2O63A 2H6DA 1HCLA 5KBRA 5KMNA 2J0IA 4FSMA 4F7JA 1BL7A 2F4JA 4EK6A 2JGZA 2IW9A 3OMVA 1JAMA 4DN5A 1ZY5A 4OAVB 2XNNA 4FEWA 2IG7A 5BMMA 5IQDA 2QHNA 4C3RA 2XMYA 4L42A 2ITYA 1Y8GA 5HTIA 4FX3A 3RPOA 2EB3A 4V05A 3PG3A 5GJGA 2BILB 5M4IA 4IHPA 4O96A 3POOA 4DH7A 5I9ZA 3OC1A 3FUPA 4ORKA 2YIWA 2XUUA 4L68A 4X3FA 4TWNA 2YM6A 3DKCA 1Y91A 4ZS0A 3QXOA 5FTQA 4IM3A 2VWUA 5G6VA 1SM2A 3FBVA 3FE3A 4XJ0A 2ZAZA 4FKIA 4DE4A 2ETMA 2ONLA 2BIYA 3A8XA 4M84A 3GGFA 3K54A 2X39A 3G33A 3QQGA 4XS2A 5ANOA 4IX5A 3VIDA 2GFCA 2O65A 5TO8A 3K3IA 4IB0A 4ZJJA 5KMIA 1IA9A 5G1XA 2BTSA 5CAQA 2AUHA 2PVRA 3LCSA 4MD8E 1RJBA 5CU4A 3VJOA 4BICA 2Q83A 4FIGA 1U54B 2EXEA 4K9YA 4UMQA 4QMVA 3VUGA 3L8XA 1JKKA 2R3KA 3PXFA 3R04A 4KABA 4QP6A 4J7BA 3KB7A 3KRXA 3RI1A 3W2OA 3WIKA 3HZTA 1JKSA 2J6MA 3P7AA 1OPJA 4XHKB 3V5QA 2XRUA 3WBLA 4O1PA 1T45A 3UO5A 4L6QA 3D14A 4QMOA 3TL8A 2XRWA 2B9FA 4RWJA 4B6LA 5D7VA 4U45A 4ALWA 2VO0A 1URWA 3EZVA 4E26A 5C1QB 2PU8A 2PWLA 4IWQA 2ITNA 3VBTA 3PG1A 4JNWA 5I0BA 3D83A 4KD1A 3CLYA 5I5ZA 5J1VA 4FT5A 3VNTA 1H1SA 5BPYA 2R3RA 2W1DA 2XNOA 3GCVA 3MDYA 4HYIA 3BV3A 3II5A 4MWIA 4RFMA 4NH1A 4TYHB 4AGDA 5ICPA 3EQHA 4UN0C 2BHEA 4D0XA 4CMUA 3TNHA 4AGCA 1WZYA 3D5WA 3CY3A 3HRBA 4FSQA 3VULA 4O7TA 3RCJA 1GIJA 4IAIA 2QG7A 4FT9A 4YBJA 3HA6A 2VTNA 4MF0A 4QD6A 2W17A 1Q5KA 2X8EA 4LV8A 3R22A 3E7OA 3EQIA 3HMIA 4FTUA 5AUTA 3VBXA 5L6WL 4QNAA 2HZ4A 3LJ2A 4EYJA 1IG1A 3DKOA 3FKNA 4ANSA 1TQMA 4NWMA 1M52A 4PP9A 2BAQA 4L46A 1OL5A 3A2CA 4DHFA 4N6YA 5M4UA 3H9FA 3ID6C 2XCKA 3TWJA 4EI4A 2PUIA 4NK9A 3F3ZA 1YQJA 3KULB 3LM5A 4JR3A 5HVJA 5IA4A 4BBFA 5CEPA 2KTYA 3MFSA 3LZBA 4FSTA 4K6ZA 4TXCA 4FA2A 1RQQA 3BELA 3WZKA 1GY3A 2V7OA 5HD7A 4F9AA 4PMSA 3V5LA 4BKJA 2YM4A 4R6VA 4QMQA 4YZDA 2A1AB 2W1HA 2Y4PA 3IG7A 5F20A 3MBLA 4NFNA 4AU8A 4BHNA 4Z9LA 2J2IB 4X3JA 3F7WA 4KWPA 1YHWA 2CGVA 1SNUA 3QAME 4G6NA 4UXLA 4YC6A 2W4OA 4FSYA 3N9XA 3W2PA 2ITWA 5L8LA 3BGPA 4I5MA 4EK8A 1JSVA 5IQHA 3JXWA 3SRVB 1APME 4BCQA 3KVXA 3GU7A 4WSYA 2IW6A 2X1NA 2XJ2A 3R2BA 3CIKA 4W4XA 2REIA 4RA5A 5I9UA 4EOKA 2XIXA 5JQ8A 3HVCA 1FGKA 1A06A 4O0WA 1ZZ2A 1H28A 4EH8A 3HV3A 3OUKA 3ZSIA 1YWRA 2GNFA 3TNIA 5IEXA 1H0WA 1T46A 3FQHA 3MA3A 4WHZA 1XQZA 4U6RA 3KCKA 4FVQA 1SVGA 2WTVA 3FWQA 3ENHA 3QTWA 2XNBA 4JX7A 4BWKA 5BMSA 4E3CA 5HVKA 2YJSA 3VBWA 4L7SA 4FV4A 4JG6A 4M15A 5EK7A 4Y5HA 2YAKA 4EEVA 5F95A 1LP4A 2ZJWA 3KXZA 2OXYA 5HTBA 2WEVA 2R3FA 4DGLC 5M51A 3NW7A 2Y0AA 4E6AA 4UBAA 2PHKA 4YO6A 3FY0A 4C59A 2JDVA 4ACHA 3S1HA 3O50A 4O82A 4D1SA 4E6DA 5LVPA 3PSCA 4FL1A 3AD4A 4EOPA 2R7IA 1W7HA 2R4BA 2W5AA 5L4QA 3ELJA 3LPBA 4GYGA 4WG3A 3IW6A 4NKAA 5J9ZA 5EI8A 4JJRA 4M13A 3UIBA 5M09A 1TQIA 2UW7A 3QD3A 3NGAA 5AA8A 2ITTA 3OBJA 4MVFA 4QP1A 4G5PA 4K1BA 3C5UA 3QCXA 2QHMA 2BALA 3TKIA 2R7BA 4IJPA 5DRDA 4G31A 4U9AA 3CGFA 4FKQA 2GHLA 5CZIA 2YWVA 4XV9A 3UGCA 3A7IA 4IB1A 3R1QA 5HCYA 4ZOGA 3AC8A 4LI5A 2PVJA 3RAIA 4BWXA 5CF4A 3CY2A 1YI3A 3G0EA 4DG3E 4QP9A 3V51A 4D4RA 3MPTA 4FTOA 2AYPA 5DHJA 1OKYA 4FYOA 4ZTHA 4MD7E 2QG5A 3BHVA 4OTIA 2XNEA 3FXZA 3EH9A 1FMOE 2C69A 3C0IA 3MY5A 2PULA 5IQAA 4R1VA 3BHUA 3IPHA 3KF7A 3SKCA 3FAAA 2PUPA 5AJQA 4M8TA 1W84A 3Q52A 1NVQA 3EIDA 2XK6A 4CTCA 3LCDA 3MPMA 3CPCA 1WBSA 4BDFA 3UVRA 3S3IA 3O2MA 4EQUA 5GINE 1REKA 2Z7LA 3E92A 3C4ZA 4O38A 5DRBA 4FV6A 5DBXA 5E8UA 3HEGA 3UTOA 4D2WA 4EH7A 3AD6A 4CFFA 2JC6A 1CKJA 4EHGA 3DJ6A 4JQ8A 1YKRA 3NUSA 4DEIA 3DK6A 1YRPA 4Y5QA 5FP5A 1G8SA 4TKSA 2BRGA 1K3AA 2PVLA 2VTOA 4HVDA 3TJDA 2GNLA 2IVSA 5DNRA 3OTVA 3PJ1A 4HGLA 3TNQB 3NVKI 2X7FA 2Y8OA 4QTDA 4PDOA 4BKYA 3EWHA 4WD5A 4NW6A 5M53A 5JEBA 4GVAA 5EHOA 2PZPA 3SHEA 2QO7A 4YO4A 4ACCA 4I6QA 3R8UA 2C5OA 1KUTA 4I22A 3KULA 3UYSA 2WTJA 3F5XA 3HUCA 2OLCA 4EHEA 4JLCA 3TNWA 3W2RA 4X3FC 4L01A 2XH5A 4Y72A 4AS0A 2JIIA 3SV0A 1KE5A 2VO3A 3DFCB 5IUGA 2OU7A 3MWUA 3V5JA 2ONLC 3DFAA 4GCJA 3NZ0A 4KIQA 4L3JA 3S2PA 3Q2JA 4P5ZA 4IWDA 5J95A 4KSPA 3P5KA 3ZEWA 1XR1A 2VWYA 3EN5A 3FMJA 5AR5A 4EH5A 2HZIA 4O6LA 3SRVA 3TUCA 4GKIA 5EFQA 4FZFB 3ZXZA 3F5PA 4KIKB 3ODYX 4AGUA 3EFWA 5IZFA 5KMLA 2J0JA 4JG8A 4DTKA 2VWXA 2Q0NA 3R9HA 5ETCA 1R1WA 3VS0A 4DEHA 4IDTA 1SZMA 3WF5A 4NJDA 3ZO2A 4BDJA 2ZDTA 1R3CA 3UDBA 3IW5A 4EBWA 5JFXA 3PDTA 1M2PA 2ITQA 1R39A 4CFXA 1JNKA 2YA9A 4MEDA 3T9IA 3W2CA 2E9NA 4LOPA 3CXWA 2P4IA 4UXQA 4N0SA 5IMXA 3VBVA 4ZTRA 2IZRA 3QCSA 5HO8A 5C26A 4OTHA 5DT0A 4GUBA 3VUHA 3F66A 3JY0A 4J1RA 2PZ5A 4FTKA 3QRTA 2C6KA 3BLRA 2IJMA 4FV5A 2WTKB 3LIJA 2WQBA 1O9UA 4E20A 4EZ5A 3OP5A 4XEYA 2WMXA 4WUAA 3KREA 5HD4A 1PRYA 2BRBA 5JT2A 4IC8A 4PL4A 4J8MA 4JQ7A 5ANEA 5LQFA 4V0GB 3TXOA 4UX9A 4V01A 1ZOGA 4CFVA 4BBEA 3ZLYA 4DAWA 4QQCA 4D5HA 2IZSA 3MPAA 4BCJA 5JFVA 4QTCA 2V7AA 3THBA 4AFEA 2JKQA 5M4FA 4YR8A 5FGKA 3P7BA 3ZBFA 3ZYAA 5J5TA 5A4EA 1XBBA 4PNIA 3DGKA 3WI6A 4I6FA 3Q4UA 5IQIA 4RIXB 1OM1A 3ZRMA 3NYNA 4F9BA 1MQBA 3ORTA 3CD3A 3ZFXA 2HOGA 3DCVA 4XRJA 4BCMA 2RG6A 3IOKA 2QOIA 3QKMA 4ZTMA 3QD0A 3QQHA 1F5QA 4S33A 4EUUA 3ATSA 3UQFA 1GZNA 1UWHA 3BV2A 4GYIA 3VJNA 2Z2WA 3OF0A 3I6UA 3R73A 4RC3A 2WTCA 3W2QA 4CLJA 1UU9A 5GZ8A 5CEQA 3UP7A 2XBAA 2J50A 2ZB0A 3EQRA 2I6LA 2YAAA 3MS9A 1M14A 1Q61A 1JSUA 1WVXA 2JIUA 2JKKA 2CGXA 3FZSA 5DEYA 1Q97A 4A4OA 3TUDA 3FLSA 2UVZA 4IZYA 1PMNA 4KKGA 3WE4A 3C13A 4NJ3A 2R2PA 2G2HA 3HECA 5AM6A 5K5NA 2X8IA 1U59A 4C0TA 2VNWA 2ZMCA 1ZYSA 1KOAA 1VJYA 3GVUA 5C27A 3DBDA 4L67A 4C2WA 5GJFA 3NNVA 4UMTA 1LEWA 4XBUA 3RPYA 5CF5A 3DBCA 5IUIA 1XH7A 4I5CA 3QYZA 3E62A 4PDPA 3U9CA 3WOWA 2W1CA 4DFZE 5HO7A 4O7NA 4RLLA 5CAVA 4D2PA 3LOKA 1EH4A 3NUXA 5B2MA 3CSVA 3IW7A 4BF2A 1PF8A 4OT5A 4C37A 2WMAA 5CS6A 3G0FA 4WO5A 2B9IA 3C5IA 3R9RA 3H0ZA 4J98A 2EU9A 1WBVA 3PXKA 4EH4A 3V8SA 3MI9A 4IFCA 4OBQA 2JDTA 1RE8A 2YCQA 3QTZA 1UWJA 4YJVA 4Z7GA 2YCSA 5J8IA 2ZOQA 4OT6A 2V55A 4AN2A 5JFSA 2UZBA 4FT3A 4CT2A 4RSSA 2YZAA 2FUMA 4YZ9A 5TE0A 1UU3A 3R83A 4ANQA 4E7WA 3BU3A 2R3JA 3U4WA 4AZSA 4JVGA 1LPUA 2W5HA 4KS8A 2PE0A 2YWPA 4G1WA 1J91A 4F4PA 3I0QA 4O7LA 5BVNA 3L9NA 1ZWSA 2V0DA 4TRLA 4ZAUA 4W9XA 4S2ZA 1U5QA 2W9ZB 3IGGA 4E6CA 1VYZA 4KS7A 3TNPC 3BYMA 2YISA 1YDSE 1PYXA 2O64A 3IO7A 2WMWA 3MYGA 2W05A 2CKPA 5EHYA 5F4NA 3D2KA 4K2RA 5CVHA 3JUHA 4DA5A 2C0OA 2GNGA 4YNOA 3U8WA 2ERZE 4X2JA 3WILA 4CD0A 3BX5A 2NRUA 4G3FA 3A7JA 5HI2A 4YPDA 3TDVA 1YXVA 1ATPE 2F2UA 4QT1A 4BL1A 4D1ZA 4U41A 5EI2A 4C3FA 1BI7A 4A9UA 4DG2E 2RFDA 4G3DA 1Y57A 5E7RA 3VS3A 4TTHB 3PFQA 3LXLA 4R5YA 4MQ2A 5A14A 3G90X 4E4MA 2XYNA 3L8SA 3ZDUA 2J5EA 4OTQA 1QCFA 3R2YA 4EK3A 1WVYA 4H1JA 4ERWA 3A99A 5IA1A 4F7SA 3UJGA 5CQWA 5BVEA 4N57A 1FINA 3PSDA 3DLZA 1PXPA 4BBMA 3FLNC 4NIFB 4PTGA 2B53A 4F63A 4BDKA 4AN9A 3AC3A 2B54A 3VS2A 3EQPA 3DBQA 4DGGA 2PVMA 3FKOA 3QLFA 3B2WA 4NEUA 3SXRA 5CF6A 1OL1A 3FMEA 1E9HA 4FC0A 4R7IA 4IAZA 4ZSAA 2W0JA 4TYEA 1YHSA 3COMA 4JDJA 5A6NA 3FKLA 1BMKA 3BHHA 4BFMA 4F0FA 1E1XA 4E5AX 3TM0A 2F7EE 2HWPA 2IO6A 3DQXA 4O7ZA 4F0GA 4C4HA 3QUDA 2UW8A 4YHJA 1UU7A 4FTJA 2ETKA 5IA5A 5K0XA 4RMZA 1Q24A 4DITA 2R0IA 4O22A 3GFWA 4EKLA 2OICA 3UOJA 4CZTA 4KRCA 4XG6A 5EM6A 4BZDA 1Z5MA 4ZLYA 2UZEA 2GNIA 3ZM9A 3ZZEA 2Y6OA 5BNJA 4EHVA 2CGUA 5K3YA 2X2LA 4L00A 4BTJA 4RX9A 5CY3A 3UIMA 4WNMA 3K5VA 4RIXA 3R8ZA 4D2TA 5TKDA 3QTUA 3DXQA 1J1CA 2OIQA 3UO4A 3FQSA 5BUJA 2XF0A 3K5UA 4IX4A 1R0EA 3A7GA 4XG2A 4GG5A 3OW3A 4BRXA 1AQ1A 1B39A 3PVGA 4GH2A 3VS1A 5HGIA 2CLQA 5CSVA 3A7FA 4HVIA 3OCBA 4UZDA 2FB8A 4YZCA 4R3CA 4XOYA 4BCNA 2R3NA 1UNLA 3U6JA 5CAPA 4X3FB 4IM0A 4PL5A 5HZNA 2PVYA 5HVYA 3ZS5A 3AQVA 3HAVA 4D4VA 1FMKA 2RKUA 3QTIA 4JBPA 3VAPA 4QMMA 5FTGA 3LQ3A 2QKWB 5CEIA 1ZOHA 4XCUA 5EOLA 4NUSA 2WGJA 3VUDA 4AZFA 3R7VA 4E4NA 2HCKA 4D5KA 4YURA 4CVAA 3CBLA 3E8NA 4IANA 5DI1A 5DYJA 2A19B 3ORNA 4FTQA 4ZTLA 3DDQA 3TZ7A 4Y73A 4X2FA 3QGWA 4RGJA 5DN3A 4NU1A 5M4CA 3HMMA 2XK4A 3QTSA 1K9AA 1WBTA 4MYGA 3A62A 4I4EA 1OKVA 2GHMA 4DT9A 3D7ZA 3OFMA 1ZARA 4QRCA 4BIDA 5EYMA 2BRNA 3MVMA 3SX9A 3CKWA 1ZYCA 4D2VA 4ERKA 3WZEA 4CFMA 2BKKA 4YTHA 2NRYA 3Q32A 2H8HA 3OWPA 4ZXTA 5HG8A 5A4LA 3PYYA 5C03A 4OAUC 3PXZA 2C6DA 4PWNA 2W1FA 2OH0E 4CFNA 5KZ0A 5J9LA 5IUHA 5DG5A 2CKQA 4DBNA 2WMQA 2UZOA 4C4EA 3PY0A 4RX5A 3CQEA 4WBOA 5AUWA 1JQHA 2JAMA 3UQCA 2PVHA 4HGEA
chains in the Genus database with same CATH superfamily
5CZHA 4YPSA 4DFLA 1PYEA 2GS7A 3BHYA 3PWYA 5HIDA 4USEA 4RLKA 1WFCA 4YZNA 5CSPA 4O4BB 3FMKA 3TCPA 4FEXA 3MV5A 4FG7A 4MXZA 1OKZA 4KAOA 5A4CA 1CTPE 4EH6A 3PA5A 4XOZA 5E92A 4XMOA 1PXKA 3FL4A 4C35A 4KRDA 3UVPA 3Q9YA 4D55A 4QYEA 3LFDA 5ANGA 2JAVA 3R8VA 5CU3A 5AP6A 4Y95A 4CV9A 4HNFA 5LCJA 2F49A 4FKWA 3KMWA 4IBMA 5AR7A 3NCGA 3QZGA 3CPBA 4UWBA 4C33A 1LEZA 3ACJA 3RTPA 2IF8A 4ID7A 1I44A 4BCFA 5T3QA 1L3RE 3SW7A 3R02A 3V01A 2QOHA 3CQWA 3OOGA 2PE2A 1NA7A 4GW8A 4O7VA 4PMMA 4FNXA 2I0HA 2X7OA 2X4ZA 3GCUA 3AC1A 1Q8WA 1B38A 3BI6A 4FUXA 1JBPE 5EDPA 4O7WA 3U54A 3POZA 5AX9A 3WE8A 4AE9A 2X9FA 5JFWA 4YJRA 2VO7A 2GDOA 4L52A 1XH6A 3MIYA 4H3PA 4RT7A 5CSXA 1Q8UA 2VTIA 2VRXA 2JKOA 1DI8A 3QQKA 4RZWA 4V04A 3TI1A 4FK6A 2W1IA 2JBPA 4FGRA 1XKKA 1OZ1A 2XP2A 4MNFA 4J96A 4QPMA 3AC4A 4ASZA 3HV5A 1JKTA 2Q0BA 3OXTA 1PHKA 4G2FA 3KK8A 4PMTA 5AP4A 3GBZA 4EZ7A 2ZB1A 4KKEA 2WEIA 4EUTA 3BE2A 3QZIA 3LFEA 4F6UA 2WELA 1YXSA 3GI3A 4H39A 4M14A 5JH6A 5LMAA 1ZAOA 4J97A 3ZLXA 4RWKA 4R78A 4XG8A 2UZDA 3BYVA 1S9JA 3LXKA 3PP0A 4HJOA 4HCUA 5D10A 5LXMA 5HO6A 4UB7A 3OEZA 5J9YA 5AR4A 4GT4A 1PY5A 4BDIA 5D41A 3W33A 3W16A 4LUDA 4FTMA 2WZJA 4MBIA 4LV7A 4ZMEA 2QC6A 3ORMA 4UMRA 3ZFYA 4BVUA 3QD4A 5A4QA 2HELA 1XHAA 5LVOA 2BUJA 5AM7A 2A98A 2G01A 2EVAA 3FPMA 4ZP5A 2OJ9A 5J1WA 4ANNA 2PUUA 4BCHA 4DFYA 4O7SA 4EKKA 3I6WA 2GQSA 3HUBA 3QBNA 4LGDA 3HDMA 3MFRA 3NMUF 4K18A 3LAUA 2F57A 4BC6A 5GNKA 1NXKA 3DAEA 1PXMA 1Q3WA 3RAKA 2PVNA 4Q5HA 3EL7A 2YIYA 2LAVA 5CNNA 3BCEA 2UZLA 4PV0A 3LQ8A 2AQXA 4ARKA 3ORXA 4O86A 3AOXA 4HYHA 3R7OA 1S9IA 5L6PA 3A4OX 2OJIA 2VTSA 5B2KA 3FI2A 5FWKK 3TT0A 4NCTA 1YOLA 3IKAA 5TOZA 3ZRKA 3F3TA 4AFJA 4CZYB 4J95A 5CVFA 1OB3A 3JPVA 2CDZA 2VX0A 4GJ2A 4CMOA 1E1VA 3S00A 2YCRA 3ACKA 2G2FA 2WTKC 3FMLA 3PXQA 3ZO4A 1PMEA 3Q53A 3ALOA 2WMTA 4HOKA 4DCEA 4Z55A 1HCKA 5T6KA 3HAMA 3NAXA 4MHAA 4O0UA 1REJA 5IQFA 4I21A 2JDOA 1V0OA 4B99A 2J90A 1WAKA 3R63A 5CSHA 4WBBB 3RK5A 4FIIA 4ACGA 3TTIA 5I4NA 5B0XA 2R5TA 4HVGA 3ZZWA 4JRNA 2ITVA 3TN8A 4BWPA 4DF3A 3UZPA 4CG9A 4LRKA 4J52A 4QQJA 4GRBA 4TYIA 3E88A 4DFUA 1ZZLA 5EG3A 5CYIA 2WTWA 3F88A 4KBAA 3E3PA 4TYJA 2OF2A 2P2IA 4L8MA 4TWPA 3D15A 4O6EA 4YZMA 3BZ3A 5JRQA 4ZMFA 5HU9A 2BR1A 3B8RA 2QI8A 2X4FA 4AG8A 2W5BA 1OIQA 1DS5A 1H26A 3NDMA 4O0YA 2PPQA 5LARA 3QLGA 5AUUA 2J4ZA 4RX7A 1OECA 1KSWA 3ITZA 2XM8A 5CASA 3R8LA 2XIKA 3I5ZA 5FRIA 4M0ZA 5A46A 4F78A 4H58A 4IQ6A 4NFMA 4YLLA 2E9OA 3MH0A 2XKCA 4ZTNA 3OCGA 3IW4A 3I7CA 4O83A 4ZSEA 3O8TA 3HNGA 3LCOA 3HRCA 5CAOA 1W82A 3GENA 3O23A 3JR1A 3GC0A 4OTRA 3UMWA 4A06A 2PMIA 4MXOA 3ZO3A 1Z9XA 4BCOA 3ULZA 3EN7A 4QP3A 4TY1A 1YI4A 3NLBA 2IVUA 5IEYA 5L8KA 3MFTA 4I4FA 4AT5A 2I1MA 4MTAA 5A6OA 3DXNA 1U4DA 3S0OA 2VNYA 5HKMA 4BI2A 4DG0E 4USFA 2XIYA 3E8DA 3P23A 3IECA 4FNZA 4U42A 3RBWA 2QONA 3U51A 1GZOA 3SDJA 4ANBA 4DTBA 3A60A 2UV2A 2OH4A 3DPKA 2HYYA 3QALE 2QLQA 5IQBA 4GT3A 3RZBA 4O1OA 4ZY4A 2FSMX 1QL6A 1YXTA 3DKFA 4J8NA 4UEUA 3MJ2A 3F82A 5E1EA 1P5EA 2OG8A 2RFEA 2CNUA 4WIHA 4U7ZA 3W0RA 3SLSA 1TVOA 1BLXA 3O51A 4IEBA 4LG4A 4MQ1A 3F3VA 3JVRA 2G9XA 4FTAA 3MGYA 4RVMA 3SAYA 5EH0A 2QOLA 3PWDA 3N4TA 4L43A 2ZMDA 3QUEA 4FVPA 3C0GA 4BKZA 4KBKA 5HLWA 3PPZA 2QU5A 2XK9A 4S34A 4MBJA 5BUIA 4ACMA 1OGUA 4WNPA 4EOIA 2CMWA 4FSRA 3GB2A 4QP2A 3F7ZA 4FR4A 4AX8A 5CSWA 5I3RA 3E5AA 3ZMMA 1DAWA 3QQLA 2WXVA 4OTWA 3NFFB 3OEFX 4BJJB 3VONA 3NNUA 3ORIA 2YEXA 4FV2A 2CPKE 4TZRA 3Q9ZA 2XKEA 5AR8A 5C8NA 4R5SA 3FLYA 3KMMA 4II5A 2XALA 2GNHA 5L2IA 5AP0A 1M2QA 4XUFA 3HRFA 4ASEA 3AKJA 2Y4IC 2AC3A 2VTPA 3QHRA 4ZK5A 4A4XA 3UOLA 3Q5ZA 4ZEGA 4DEGA 5DIAA 4M0YA 2W7XA 3A4PA 3MH1A 5CQUA 4WUNA 5BYZA 3D9VA 4U80A 3VUMA 2RL5A 3BU5A 3EYGA 3GT8A 1YHVA 5E8VA 1WMKA 2BZJA 1BYGA 2YHVA 5IDPA 2PMNX 2X0PA 2BRMA 3KY2A 4UALA 5F94A 4AXEA 2XJ1A 4XX9A 3UZRA 1W98A 4YUQA 3HL7A 3QTXA 5AUVA 3BLHA 3U9NA 5FDPA 2WTIA 5KO1A 3KVWA 4JRVA 4DINA 5EYCA 2W4JA 3DK7A 3F5UA 3OBGA 3BYSA 4N4SA 4W8DA 4AOTA 4D1XA 4EL9A 4ACDA 2XS0A 4FKGA 4EQMA 4C36A 2QOBA 4CT1A 4F9YA 2VN9A 1ST0A 3NIEA 3NSZA 3M42A 2ZFYA 4EONA 5CAUA 2YFXA 4W9WA 2PL0A 3VUKA 2XEZA 4PX6A 3L1SA 4X21A 5AP1A 5H2UA 3AKLA 5M08A 4BB4A 5JGAA 2R3OA 4IWPA 4OTFA 4KBCA 4E4LA 4IXPA 3G6HA 3BQCA 3TIYA 4EH2A 5BX0A 5B7VA 5CEOA 3LMHA 2JLDA 3VQHA 4JXFA 2H34A 4CSVA 4S32A 2YLFA 4QQ5A 3ALNA 4LGGA 3E63A 2PMLX 3QA8A 3WZJA 3D5VA 5DT4A 3ORLA 5K0KA 2XAMA 4FV7A 4JQEA 2QU6A 4WT6A 3U55A 2C3LA 4S31A 2BRHA 3QRKA 4ITHA 1UVRA 1FVRA 5DLSA 5JSMA 4JAJA 4ZY5A 1I09A 3TG1A 2JD5A 2VTMA 3NIZA 1UKHA 2BAKA 3VS4A 5HTCA 1XMMA 5BVOA 2YLEA 3W0OA 3VS7A 1KE9A 4DEDA 3UDTA 3AKKA 4FEQA 4FTLA 1ZLTA 3GC9A 4EHZA 3C4EA 5FM3A 3I81A 2C0IA 2GQGA 4N6ZA 2Z02A 4M68A 1KE6A 4BCPA 4IADA 3VUIA 1FPUA 2JDRA 5AUZA 4YZBA 3V04A 3ZBXA 1GIIA 3NFGB 4HZSA 3ZSHA 4TYGA 3SXFA 1H1QA 3OZ6A 4D9TA 4HW7A 4NCTC 3R30A 3NNWA 1M17A 4HYUA 3VVHA 5M57A 5AIKA 4GV1A 3GU4A 4XLIA 5EM5A 5HBHA 2QR7A 2F9GA 2VAGA 4K33A 5T68A 1M7QA 4I20A 3RK9A 2QOQA 3RPSA 3FMHA 2UZVA 2E9VA 2CJMA 4LRJA 4ZSLA 5L2WA 3ZRLA 3A7HA 3BEAA 3OY1A 3C0HA 3CCNA 4LMNA 2X2KA 4XNEA 4AAAA 3NS9A 4A9YA 2GCDA 1ZRZA 2C4GA 3GNIB 4GIHA 1H4LA 2OIDA 4I24A 1GZ8A 3QRJA 1OITA 3AT3A 5ACKA 3IGOA 4BDBA 3CGOA 1J1BA 1Y6AA 2C6IA 3C7QA 3EQBA 2PZIA 4X6RA 5LMKC 1H0VA 2J51A 4YLKA 3FMMA 4GUEA 4B0GA 5AR3A 5HIBA 4AF3A 5KE0A 1H00A 2QOOA 4GKHA 3RGFA 5HE0A 3BYUA 4G3GA 3U4UA 4U79A 3FPQA 1AGWA 3DZOA 1J7LA 5FUTA 1KV2A 4A9RA 3A8WA 3GQIA 5EW8A 1PXIA 1JWHA 4CRLA 3IDCA 4DGNA 1G5SA 5BVDA 5A4TA 1XBCA 4EOSA 4YNEA 2O2UA 5ITAA 3PVUA 3TYKA 3WF6A 4CFUA 5DA3A 3HMPA 4IW0A 4L3LA 4QYGA 2V5QA 4IE9A 1OBDA 5D12A 3EQFA 3V8TA 4OTDA 3BKBA 5C9CA 3OT3A 3T3UA 4YTFA 4M12A 1IAJA 1JKLA 1F0QA 4QMTA 3TV7A 3W55A 3OD6X 4M97A 2XANA 4C38A 4RVKA 5H8GA 4MXCA 2RF9A 4DFBA 1W8CA 3FSFA 4JMQA 4QPAA 4IAFA 2YN8A 2OGVA 3OY3A 4TPTA 4PPAA 4IC7A 4OUCA 1FBNA 3QFVA 1GIHA 4F7LA 4OW8A 1MRVA 3UC4A 3R9DA 2WMRA 5CXHA 4CXAA 5DPVA 3UO6A 2J5FA 3GU6A 2OZAA 5J7HA 4GS6A 4C4FA 2YM5A 4WNKA 3CD8A 2GS6A 1M2RA 2B9HA 4JT3A 3FHIA 4F65A 4NTTA 4CNHA 5IQEA 5KKRC 4BY9E 3R0TA 3UZTA 2V22A 4FIEA 4JIKA 4WKQA 4QYHA 3BLAA 4DBXA 3HLLA 3VRZA 4CYIA 2C6TA 2HW7A 5D9HA 4B4LA 2IPXA 4CMTA 1W83A 3LLTA 3FI8A 4ZZNA 2UW0A 5LVMA 5HG9A 2C6OA 1OMWA 3PUPA 3ZXTA 3K3JA 4ZS4A 4AZWA 3FY2A 4U3ZA 4O81A 4RFYA 2XK3A 3PP1A 4M69B 3R7EA 2FGIA 2XYUA 3D5XA 3KFAA 3PSBA 4RIWB 4FV0A 5IA3A 4FIJA 2C5YA 3SVVA 2FO0A 4RIOA 2V62A 3AMYA 1PKDA 1IRKA 3H9RA 1HOWA 2EXCX 4KNBA 3HV4A 3GU8A 4Y83A 3W10A 1P2AA 4S30A 3F2NA 3I7BA 3SOAA 3VQUA 2C5NA 2QOKA 4FKTA 4AT4A 4L53A 2YM7A 5F1ZA 3CR0A 5I9WA 2PTKA 4AW5A 4NM0A 4BDEA 1R0PA 5C8KA 1YOMA 3FC1X 4C2VA 5D1JA 4FL2A 4H3QA 3DKGA 2R3IA 2JEDA 2IZUA 4ZSJA 3EN9A 4YJQA 2ZM1A 5EOBA 3DK3A 5GJDA 5H8EA 4GSBA 3MN3A 5FTOA 3QYWA 1XO2B 3SXSA 2QODA 3MTLA 2WMVA 4BGQA 3KU2A 3LQ5A 5CLPA 4C62A 3FDNA 3CTQA 5L6OA 3EOCA 3RK7A 1A48A 2IWIA 5D7AA 2C1BA 4YC3A 2W99B 4E1ZA 2X0GA 3NW6A 1OI9A 3FZOA 3QKKA 3UNJA 2QO2A 4GU6A 4G17A 3KC3A 5CU2A 4CLIA 2BDJA 5E4HA 2CHLA 5M56A 3G9NA 3LXNA 4RIYA 2HXQA 4XP3A 5FBNC 3NUPA 2Y4IB 1YXXA 2VZ6A 2YIQA 4JS8A 4LV5A 4RWIA 4PQNA 4W4YA 2HAKA 2EUFB 4O0TA 4FE2A 2P55A 3PE1A 5TT7A 3JS2A 4BCIA 3E87A 5CEKA 3OWJA 5ANDA 5EKNA 1JLUE 4D4SA 3ULIA 4PY1A 5AMNA 4QMNA 3EKNA 4QMUA 1FGIA 4BGHA 3W18A 2QOCA 5HNIX 2DYLA 1P4FA 3TZ8A 5EW9A 5EI6A 5HICA 4TT7A 3V6RA 3PUFC 1MRUA 2PSQA 3QZHA 4YJUA 3F2AA 5IA2A 3R28A 3BWFA 3T8OA 1BX6A 2VWZA 2WOTA 4FICA 4E8AA 4TL0A 5LWNA 3NW5A 3VHEA 3IOPA 5EKOA 1A9UA 4LQMA 4P5QA 3PA3A 4U81A 3PIYA 4C58A 5J7BA 3OXZA 4DC2A 3VN9A 4IVDA 2J0LA 2DS1A 4IH8A 3NPCA 5HU3A 1PXLA 4MNEA 2JITA 2OSCA 2QURA 2W9FB 3AMAA 4G3CA 4G9RA 4IACA 5GZ9A 4I1ZA 3QXPA 3TJCA 1KWPA 3CTJA 1UKIA 3UC3A 4P90A 3QCQA 4JL9A 5KCVA 1JOWB 4WA9A 4AXFA 3N4UA 3PXRA 4TWOA 1W0XC 3UNZA 4AZTA 5ACBC 3H3CA 4EORA 4L44A 2UZNA 3AGLA 2PVFA 2YDIA 2R0UA 2RGPA 4JAIA 3REPA 4IZ5A 2GPHA 3WZUA 4AA0A 1ZXEA 1CKIA 2XIZA 4GMYA 5KX8A 5DT3A 1ZMUA 4DGOA 4ENXA 1UNGA 1PXJA 4EWHA 4H36A 3EQGA 2VWVA 3C9WA 4WOVA 2WMBA 4FKJA 2UZWE 4FG8A 4NM3A 4WG5A 3WF8A 4F9CA 2JKMA 3F3WA 3KN5A 4FMQA 4W8EA 4YTCA 2WQNA 3AC5A 3CE3A 3P79A 4FKVA 4I94A 5AWMA 5H8BA 3AGMA 4EJNA 5M06A 2F7ZE 3SGCA 4G5JA 4UZHA 1Q3DA 4FZAB 4M7IA 3PVWA 2HENA 4YHFA 3V8WA 4F70A 2OBJA 3MW1A 3ERKA 4CV8A 4HVHA 3PLAE 5AUXA 5C4KA 2HK5A 2ITUA 4EQCA 4YC8A 2CLXA 3Q4CA 3C4CA 2B0QA 2I40A 3ZLSA 5BVWA 3MY0A 2NYAA 3NYOA 4A4LA 4M69A 3DTWA 4QYFA 3KXNA 4RJ4A 4O2PA 4RIWA 2YZLA 3FEGA 2XVDA 2XIRA 2QR8A 3TV6A 4CQEA 1OIUA 3GC7A 2X6DA 3V6SA 3AXWA 4I5HA 4O4EA 5J87A 4D9UA 1ZYJA 3L9LA 4KUJA 3R01A 2BIKB 4IX3A 5FDXA 1J7IA 2G2IA 2VTHA 4NSTA 4A9SA 3DJ7A 1XWSA 1Q8TA 3P7CA 3WIGA 2ITOA 4JOAA 3KRJA 5KMKA 3Q04A 5IKWA 4FSZA 4IVBA 3QC9A 5ANIA 4ASDA 4B8MA 5L3AA 4QTAA 4FTRA 4FSUA 3AD5A 4R3PA 4AP7A 4XP0A 2PZRA 3RALA 3I1AA 4BDHA 3E3BX 3TTJA 5BVFA 3AT4A 4KB8A 4J71A 4I0SA 2UW6A 4FKOA 4ENYA 3RKBA 4MH7A 4XH6A 2Z7QA 4AZEA 2WOUA 4RFZA 2X81A 2FSLX 4MXAA 3QCYA 5CT0A 4ONAA 5AAFA 3PLSA 3QX2A 1CSNA 1STCE 3ANRA 3AC2A 3DOGA 3MESA 4DCAA 2FSOX 5E91A 3DBEA 3HMNA 3DAKA 2YACA 3LFSA 4BDAA 5IU2A 4CKRA 1O6KA 4M67A 3EZRA 5KMJA 5KBQA 2EWAA 2FH9A 4APPA 4EH3A 4C8BA 2XKDA 4DHJA 3OROA 3BHTA 4LOOA 3GUBA 5CVGA 4KSQA 3FLWA 3ZH8A 2B1PA 5TF9A 3V5WA 5GIOE 3ROYA 4HPTE 2R9SA 4CGAA 4OR5A 3BBWA 4H1MA 3RWPA 4L7FA 3UG1A 2XNMA 3FXWA 5IF1A 4JDKA 2GQRA 5ETFA 4EJ7A 3FSKA 5KKRB 4DDIA 3QRUA 3CC6A 4HNIA 4TWCA 3R7UA 4QMXA 4FRFA 4FKPA 4AXCA 3E7VA 5HG7A 2ITZA 2B9JA 3LHJA 3ORKA 5L2QA 4RA4A 3COKA 3CJGA 2WMUA 4HYSA 2QLUA 2ZV7A 1GZKA 4C57A 2XKFA 2WIPA 5DOSA 2OO8X 3P4KA 4F9WA 2GNJA 5LVLA 5H9BA 2CN8A 3V5PA 3W1FA 3SG9A 4BTFA 1PMVA 3VW8A 4AT3A 3P08A 3TDWA 3IQ7A 4QMZA 3ZDIA 1GNGA 3OCTA 3V5TA 4U5JA 3F61A 1L8TA 3LFCA 4IZ7A 2WAJA 5DH3A 2XEYA 4O0VA 3RMFA 2GU8A 3DY7A 5AP7A 4FTNA 3PTGA 4I6BA 1IA8A 3DB6A 3ODZX 3MSSA 4IFGA 3UDSA 1MUOA 4U0IA 1OL7A 3UE4A 4C4JA 3HYHA 1MP8A 3D0EA 2Y6MA 4BTMA 2UW3A 3DAJA 3DS6A 4G6LA 3HMOA 1LUFA 2B55A 3PFYA 1BUHA 5TR6A 5AV1A 1FOTA 3TZMA 5HX8A 4ZJVA 4GFMA 3H0YA 3JYAA 5CX9A 3R1NA 3HA8A 2GTNA 1ZYDA 3CP9A 4R7BA 3B2TA 2VX3A 3U87A 2QO9A 2OW3A 4IZAA 2C47A 4MXYA 3SW4A 4QMYA 2FVDA 1FQ1B 5KNJA 2NP8A 5EYDA 3E93A 4FKRA 3NUYA 4G16A 4LOQA 4IVCA 2C1AA 4Q5EA 1WBNA 4BDDA 4RJ5A 3AG9A 4UWYA 4D2SA 3RNYA 3TZ9A 3Q4ZA 5CXZA 1PMUA 1OIYA 2XB7A 3I60A 4M3QA 2VV9A 1GJOA 3EN4A 4BZOA 3QF9A 2FA2A 4QP4A 4WG4A 5EQPA 4E5WA 2P3GX 4OBPA 3BQRA 4NKSA 4R1YA 5EDRA 5BUEA 3ENMA 1Z57A 3CKXA 3M2WA 5DVRA 4ZZOA 4B9DA 4FYNA 3EHAA 4TN6A 4F64A 2VX1A 1GAGA 3AT2A 4PTCA 4EOMA 2W96B 5JN2A 5I9YA 3QL8A 4EWQA 5HBJA 3D94A 3VUTA 3GXLA 3QQUA 4CZUA 4QP7A 3EFJA 3QHWA 4NYEA 5A9UA 1P14A 2I0EA 4N70A 2H96A 3RHXA 3OW4A 5LMKA 3LJ0A 3GCQA 4DHZA 3U6IA 3G5DA 3BYOA 2VWWA 4Z16A 3NCZA 3G2FA 2ZV8A 4FT0A 4W4WA 3R7IA 2NNWB 2VTAA 4ZZMA 4H05A 1Q8YA 3BIZA 4YHTA 3VS5A 1YWVA 2RFNA 2UW9A 1XBAA 4YLJA 5IISA 5LMBA 4BYJA 4GL9A 5E9EA 4HVSA 2CNQA 3EMGA 3OG7A 3FQEA 4QO9A 4QTEA 5LVNA 2XK7A 4WRSA 4YGAA 4YU2A 4FKSA 4XG7A 5HORA 4CCUA 1DI9A 1TFFA 4LUEA 2G1TA 2J9MA 4J53A 2PMOX 4B7TA 3SQQA 2A27A 4AACA 4MK0A 5KMMA 3L8PA 5E8SA 2W06A 3FHRA 1TQPA 4LMUA 4Q9ZA 3RNIA 2CKOA 3HDNA 4AA5A 3CQUA 5JMSA 3W0MA 5IQGA 2YIXA 3FJQE 3MJ1A 4YJNA 4APCA 3KL8A 3PIZA 3GEQA 3NAYA 4UYAA 2X0OA 4A9TA 4BDGA 5HX6A 5CWZA 4A07A 4PMPA 4RQVA 5E90A 2A2AA 2BVAA 4UV0A 2RG5A 4P2KA 2Z60A 1RDQE 2WO6A 5M55A 5HHWA 3O0GA 1KOBA 2UW5A 3FXXA 1KE8A 3K2LA 4HPUE 4TW9A 5BVKA 3ZLWA 3W8QA 3Q5IA 3W2SA 2SRCA 1OIRA 4ZLOA 3IK3A 5C01A 5GIPE 5IQCA 3VC4A 1UNHA 2OZOA 1PKGA 4F6SA 3BLQA 3G15A 1JPAA 3R1YA 4EK4A 4I93A 4F1OA 4AN3A 4I5PA 3P0MA 3LVPA 3UP2A 2R3MA 3QTQA 3BRBA 2LGCA 3NUAA 5HIEA 4RZVA 5F9EA 1PW2A 2GHGA 5A3XA 4QTBA 3HV7A 4OBOA 3QRIA 4FIFA 3F9NA 5DFPA 5ETIA 4RC2A 4FTIA 4RQKA 3BL9A 2W1EA 3DXPA 3P1AA 3LCKA 4WRGA 1FVVA 3RJCA 2F7XE 3R71A 4O4FA 3TEIA 3WF9A 4UMUA 4QNYA 5AP3A 3KF4A 4PUZA 4HZRA 3ANQA 3BGQA 5E8WA 5FP6A 4FZDB 5DWRA 5H3QA 2ZM3A 4BN1A 4GU9A 1YXUA 5CANA 1SYKA 2O8YA 3DNDA 3UODA 3ROCA 4MCVA 4FI1A 3R8PA 2RSVA 3FC2A 2OJJA 5JKGA 4BIEA 1F3MC 3EL8A 3WYYA 4EOLA 3BL7A 3NRMA 3VRYA 3R7GA 1OKWA 3EFLA 3PIXA 4ITJA 5A54A 2UW4A 5DMZA 5B2LA 4EOJA 1AD5A 4AZVA 2ESMA 4MXXA 1MRYA 4I23A 4ZJIA 3UNKA 2BFYA 3KA0A 5IH4A 1DAYA 3ZFMA 3SOCA 3LJ1A 5KHWA 4NW5A 4C61A 3P78A 3EN6A 4XV1A 1GOLA 4AAYA 4ANLA 1YDTE 2ZV2A 2JFMA 1X8BA 3D4QA 3GCSA 3LM0A 4RWLA 2YDJA 3EFKA 3FZPA 4HCTA 2HY0A 4U40A 3Q60A 5K5XA 2GMXA 2IVTA 3PZEA 3LFFA 2W4KA 3OVVA 2ZM4A 4FF8A 5CNOA 2VD5A 2J0KA 4O7YA 1Q8ZA 1WBWA 3S4QA 2PUNA 4YJPA 3NYVA 4LGHA 3MFUA 3HV6A 5AV4A 4O7RA 4E4XA 2JBOA 4DGMA 1WBPA 5K9IA 4AWIA 2CNVA 4CG8A 2OZAB 2R3QA 2R3LA 4UYNA 4TNBA 3ZCLA 1ZYLA 4GT5A 3QTRA 1J3HA 4H3BA 3ZUUA 1OVEA 2HIWA 4Y46A 5ANKA 2R64A 5L2TA 4X0MA 1SVHA 4U43A 3QQJA 3LMIA 5IH6A 3TMOA 1U54A 4BCGA 5KMOA 3V3VA 1V1KA 2QOFA 3FZ1A 3Q9XA 4AW1A 4YBKA 3CJFA 3ZEPA 3MY1A 3KK9A 3MIAA 4X7QA 2BKZA 4EBVA 4CKJA 3LXPA 2YM3A 3DA6A 4QYYA 1ERKA 4QMLA 4ALVA 3PRFA 1IAHA 1TZDA 1WCCA 1KE7A 3ZSGA 2O5KA 1XH9A 4BTKA 4OTGA 3G51A 3D7TB 2XNPA 4HGSA 2I7QA 3R1SA 1PJKA 3OHTA 4K77A 1WVWA 2E9UA 2GSFA 4F6WA 3GFEA 2A4LA 3FI4A 3KQ7A 4NZWB 4QMPA 5EQEA 3KXHA 1YOJA 3BU6A 2WB8A 5AIRA 4RVLA 5AV0A 5GHVA 4YMJA 3SC1A 4P4CA 2C68A 4JR7A 1CMKE 4GG7A 4TYHA 4XV3A 3VW6A 4AOIA 5AX3A 4YSJA 2JFLA 2VU3A 4WSQA 1OL2A 4ANMA 4XP2A 4FKUA 2WQOA 3L8VA 3PA4A 2UVYA 3PPKA 1FVTA 3ZM4A 2ZVAA 1H1RA 4BHZA 4IDVA 1H1PA 3MB7A 5M44A 3RAWA 2OIBA 2QVSE 2VUWA 3O7LD 4XG3A 4PRJA 3DDPA 3IS5A 4I6HA 3HP5A 3VO3A 5BYLA 3NVMB 4GVJA 4U97A 5HESA 5JZNA 2PZYA 3DQWA 4FGBA 3FMDA 1G3NA 4FIHA 5EM7A 3WZDA 4BI1A 1SVEA 2CCIA 2XNGA 4MKCA 5HE1A 5KUPA 5AUYA 2NPQA 2VWBA 5KZIA 4RIYB 4FV8A 2EB2A 3BGZA 3P86A 5AV2A 4GFGA 1PXNA 2IN6A 5EW3A 4DYMA 4R77A 1ZMVA 3IONA 3PXYA 4X6QC 1VYWA 2UUEA 4LL0A 3DBFA 1JVPP 4JG7A 2WPAA 1OUKA 3EQCA 5AV3A 1NY3A 2QQ7A 3Q9WA 4AUAA 4O21A 5JGBA 5FXQA 3LFQA 4DFXE 4Q2AA 3M1SA 3FZRA 2C30A 1UA2A 4YJOA 4XBRA 4Y85A 2ZYBA 3TIZA 1QPEA 4BIBA 4CCBA 1VLRA 2UZTA 4C7TA 3OT8A 4W4VA 1NVRA 3LE6A 5E8YA 5FXSA 3QZFA 5JQ5A