4QMVA

Mst3 in complex with pf-03814735, n-{2-[(1s,4r)-6-{[4-(cyclobutylamino)-5-(trifluoromethyl)pyrimidin-2-yl]amino}-1,2,3,4-tetrahydro-1,4-epiminonaphthalen-9-yl]-2-oxoethyl}acetamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
288
Chain Sequence
LPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 288
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmvA01
2OK1A 3CTQA 3R1NA 1R39A 4E20A 2LAVA 2R3GA 2X6DA 2F49A 1PXNA 3LPBA 5CEQA 4RA5A 1LP4A 3HZTA 5HEZA 4MXCA 4ZTRA 3LXLA 4CMUA 3EOCA 2QU6A 4ITHA 4KKHA 4DAWA 4EH8A 2W05A 3KREA 2I40A 3NUYA 3RAKA 4FKGA 4I3ZA 2F4JA 4P5QA 4YLKA 3KRLA 5LVNA 4L7FA 4RX9A 2UW7A 1E1VA 3PA4A 4R5YA 3QD4A 3E8CA 4CTBA 3TZMA 5C27A 1WBSA 3S00A 4D55A 5BMSA 3AC1A 3HV5A 3FQHA 3VHKA 1XH7A 3ACKA 1F5QA 3GP0A 3QZGA 4RIYB 4XG2A 3L1SA 5FEDA 4DLJA 4FZ6A 2CNQA 5HU9A 4L3LA 2F57A 3KMWA 3KCFA 4EOQA 4XV9A 2X4ZA 5KMLA 1IAJA 2YIQA 2HYYA 4X0MA 4IB1A 3KB7A 4CLIA 4FEWA 1W98A 4AFEA 1OMWA 4F7SA 2X9EA 1J1BA 3ROCA 1MRUA 1ZMUA 4MD9E 4IZAA 3NLBA 4I94A 3F7WA 3DTCA 1G8SA 5TKDA 3I0QA 2YM6A 3PXZA 2WIHA 4RZVA 3VBQA 4PDYA 3IOKA 3EQPA 3WBLA 3WIGA 3RK7A 3LMIA 3KVWA 4MWHA 4XP0A 4AGCA 4AZWA 3QTWA 3O71A 4FTUA 4ZJIA 3ORXA 2OGVA 4KABA 4HJOA 4NM3A 4RGJA 3SXRA 4UN0C 1JBPE 2C5YA 3VS4A 2DUVA 3VWAA 2CDZA 3LCTA 5B2LA 3QD0A 3V5WA 4UWBA 3NUNA 4WUAA 4HYIA 4N57A 3KU2A 3SOCA 1RE8A 4AT3A 3E8NA 3QZIA 3DAJA 4MH7A 5E8UA 4MK0A 3RVGA 2PE2A 3BGQA 4WNPA 3V6SA 2HZIA 4IB3A 1XO2B 3ZFYA 1F3MC 4JG7A 2PMOX 3MPTA 3MY5A 1K2PA 1QPCA 3PJ8A 4U9AA 4XP2A 2YM7A 5L8KA 5LJJA 4JNWA 1DS5A 3F5XA 4I5PA 5E90A 3DXNA 2JDSA 2F2UA 3Q4TA 5LXMA 4J97A 4UMPA 5IEYA 4B8LA 4MXXA 3F3ZA 3ZUVA 4HYUA 4IDVA 3Q4UA 3RZFA 3TZ7A 3Q60A 1OKWA 3GUBA 4QP4A 3COMA 4GYGA 3BQRA 3LFDA 4BDFA 1YW2A 4FIIA 5AP4A 4CSVA 4ZZOA 3D14A 4FF8A 3ZLXA 3ZFXA 3GFWA 1GOLA 4IJPA 1KE7A 2WU6A 5AM7A 3KEXA 3SQQA 4WD5A 1WVYA 1H1RA 2C5VA 3D2IA 4M0YA 2X2LA 4FSQA 5M08A 2WNTA 5D1JA 3ZTXA 3ZDIA 3QRIA 5EQYA 4Z9LA 5HGIA 4QMNA 3R2YA 3G33A 4FL2A 3EWHA 5J7HA 3FYKX 3EHAA 3V8SA 4O84A 2RFNA 3BEGA 2OSCA 3R7OA 1UNLA 2IWIA 3GC0A 3OZ6A 3DZQA 5IG1A 3H0YA 1KSWA 4PV0A 2PVYA 3KXGA 3O7LB 2WTWA 1H1QA 3Q6WA 1CSNA 3BU5A 2PY3A 4QYGA 3I6WA 4FTTA 5ETAA 4M66A 4TYHB 1PYXA 2VWXA 4RPVA 4CFNA 4U8ZA 1SYKA 3MY0A 3ZEWA 4FC0A 3C4EA 1G3NA 4I4EA 5I9YA 1A9UA 2W1HA 1YOJA 2DWBA 4AZVA 2W1EA 3I60A 3PFQA 4D0XA 4Y72A 4YHTA 3BGZA 3B8QA 2UW0A 3OWJA 4OTFA 4Y5QA 2ETMA 2J7TA 3R9OA 5EW3A 4E26A 2Z7QA 3F2AA 4AGDA 4TWCA 2GNHA 2OF4A 5GZAA 1OM1A 3U9CA 3DBFA 3BYMA 3MFSA 4R77A 3W18A 4L8MA 3DTWA 5ANIA 3W2PA 1PYEA 4IC7A 2I1MA 4F99A 2VTSA 3HL7A 3DXQA 3P7BA 5HO8A 5AAEA 4E73A 3C5IA 2HOGA 5B0XA 4D2TA 4RVMA 3M1SA 2FSMX 1FVRA 3KXHA 1GY3A 3R02A 4WSYA 4AOJA 2PYWA 4NYEA 3I5ZA 3EN9A 5CF4A 5M4IA 3EQRA 3HNGA 1HCKA 2CHLA 4IWPA 4F0IA 4D9UA 4YZBA 2OZAA 2XRWA 3AMYA 5DE2A 1MRVA 4RQKA 2VTAA 3TDVA 5I5ZA 3FZOA 4IB5A 4M0ZA 5BVEA 3PXFA 3FMEA 5J7BA 1FINA 3IK3A 3W2OA 3RCDA 4Y95A 3UYTA 4PUZA 2W99B 1TQIA 5CY3A 5AM6A 5TE0A 3ZXZA 5CAOA 4XBUA 2EXCX 2QD9A 4USFA 2FA2A 4GK2A 4OTQA 2JGZA 5L6WL 2PU8A 1WVXA 3EIDA 5HBEA 4BDGA 2QO9A 2ZB0A 2J0LA 2RFSA 3PVWA 4ZLYA 5CEIA 4RJ8A 5J95A 4C4EA 5DLSA 2R3IA 4NTSA 4U42A 3RWQA 4HGLA 4KS8A 2ITVA 4DH3A 5JK3A 2DS1A 4RWJA 4RJ3A 4KAOA 2A27A 4YNOA 2OZOA 1CTPE 3NNVA 3D15A 3FE3A 4GS6A 4JQ8A 4KIQA 3MBLA 2FYSA 4ZTMA 1LR4A 3BKBA 3RPVA 2QKRA 3QU0A 3OXTA 3LFQA 3JXWA 3OW3A 4O2ZA 1CKJA 5L8LA 3ALNA 2WMRA 4M69A 4NW6A 2ZVAA 2WQEA 2VTJA 4BB4A 5FBOA 2EU9A 4OGRA 4BCPA 3BU3A 4MNEB 5JMSA 4EL9A 3PLAE 4FX3A 2R3NA 2B1PA 3RK9A 5DBXA 5HG5A 2ZV7A 4AE6A 5HE1A 5JZJA 4BCGA 2VWWA 2UW9A 5JGBA 4F65A 4AZFA 5E8ZA 4CCBA 5JQ8A 2E9UA 1U4DA 3MFUA 4KIPA 2WMVA 4CFVA 3H0ZA 5CNNA 5CSXA 3V01A 3DFAA 2VWIA 4HYSA 4X3FA 4LOPA 4BDAA 3EFLA 2BRGA 4D4RA 3DXPA 1V1KA 3HYHA 3RAHA 4K2RA 2C0IA 4YC8A 5CZIA 4EJNA 4CYIA 4F0GA 4UXQA 2VV9A 4OAVB 1PJKA 2ITTA 3TIYA 3FLWA 2XNOA 4ZSGA 3KULA 3ZCLA 1Y6AA 5ANJA 4F1TA 3JY0A 5C8NA 5LWNA 4I5MA 5BMMA 5B7VA 5BNJA 2ETKA 3UJGA 3FHIA 4QPSA 4IX5A 5AP2A 3U54A 2XIRA 4WKQA 3MB6A 4DGLC 4CYJA 5HIEA 2FUMA 4FIHA 1PMEA 4J1RA 1BX6A 4KS7A 4EC8A 2EWAA 5IQHA 2P2HA 5CAVA 2YIWA 3R8VA 4PMTA 3U4UA 3TM0A 3EKKA 4BGQA 2UZNA 3NZ0A 1JSUA 1YXXA 2ITUA 3FKOA 3KXMA 4HGEA 4AGWA 5BPYA 2ITXA 3PVGA 4BKYA 3KN5A 3T3UA 3KN6A 1Q3WA 3O50A 1XBBA 3VS0A 1Y57A 5DNRA 3HRBA 3R0TA 2X2KA 2IG7A 4HCVA 2UW5A 3FMKA 3DNEA 3RTPA 3K2LA 3U6HA 4H3QA 5DOSA 5H8EA 2HIWA 2R7IA 2XNBA 4QP2A 4O96A 5EDPA 3ZC5A 3ZO2A 4BL1A 4DG3E 4O81A 3PSDA 4TKSA 3EQIA 2IJMA 2VTIA 4BDHA 4QPAA 1U59A 4U44A 4ACCA 1YKRA 2C6DA 2QONA 4I6BA 1L8TA 3KGAA 5AFVA 4ID7A 4NCTC 4FNXA 4GYIA 4KA3A 2GS7A 2QURA 3HV4A 3TKUA 4U5JA 4CNHA 3FLSA 1BKXA 1UV5A 2XIXA 3E3BX 4A06A 4WNOA 3CBLA 2REIA 2W5AA 3WOWA 3PRIA 5AX3A 3R7YA 3EZRA 2W1IA 3K5UA 3JVRA 5I3RA 4H3PA 5AR8A 4M68A 3R7EA 3VW8A 2VAGA 2C6TA 1R1WA 3FZPA 4J53A 2QU5A 3QUPA 4FT0A 4IC8A 5ANGA 3FMMA 3SGCA 4U97A 5C03A 1H0VA 1J7IA 2JKOA 3QC4A 4EONA 4FG8A 4L43A 3SG9A 3ZHPC 5ITAA 3R7UA 1OL7A 3VS1A 3RCJA 4PDPA 3WZEA 4DFLA 3W2CA 5JGDA 2BTSA 2WOTA 3UOJA 1KE8A 2E9OA 2NRUA 4WBBB 2WQOA 3E62A 4NU1A 3A60A 4D1SA 4F9YA 5HLWA 1U54B 3EN7A 4M12A 1YRPA 2WTIA 4G2FA 4CFFA 5CAPA 2A2AA 4QD6A 1YI4A 4ZIMA 2ITWA 4BHZA 4O0VA 4CMOA 4PF4A 3FJQE 2R3OA 2JDOA 2VX1A 5J9LA 3NPCA 3PXRA 2XIZA 3D9VA 3LHJA 3DPKA 4K1BA 3WZJA 1Q5KA 2QHMA 4P5ZA 5EDQA 1OVEA 3EN4A 1GNGA 5FTQA 3DJ7A 4C3FA 3PP1A 4E5AX 1ZYCA 2C68A 3R9HA 3QQFA 2HZNA 4L42A 2J2IB 3BHHA 4GG5A 3UOLA 2VTTA 3R7GA 4LMUA 4BGHA 2VNYA 4KNBA 3Q4ZA 2YM8A 4XNEA 5AMNA 4FKJA 1URWA 4F6WA 3S0OA 4O6EA 4XG6A 3OY1A 3U4WA 4CFUA 4XV2A 2VTHA 4QMQA 5AV4A 4FSWA 2CNVA 5AV3A 3C5UA 3ORLA 4D5KA 4TTHB 2P2IA 3HDMA 4YUQA 5EM8A 3WZUA 5IU2A 4KIKB 3TKHA 4LM5A 3G90X 5ACBC 1O6LA 5HE0A 1PW2A 3FI2A 5AUYA 1ZZ2A 3C1XA 3PY3A 4Y85A 3RPSA 1GZKA 5TF9A 4QMSA 3DQWA 4BCQA 3FMDA 3HUCA 5E4HA 2F7XE 2PVJA 4BI2A 4PMMA 1WBTA 2OF2A 1YOLA 5JFWA 2PVLA 2Z2WA 5KMKA 4G16A 2O0UA 3UMXA 2ZM3A 2PWLA 2KULA 3A7JA 4BCKA 4EUTA 2JAMA 4AN2A 2G01A 3W8LA 2C6KA 2JKMA 3C13A 3OOMA 4AS0A 4KRCA 4BTMA 4O83A 4DC2A 4ZY6A 4QMMA 2J0JA 4ZSAA 4JDIA 3AMBA 4AW1A 1REJA 2VTQA 3SX9A 5C26A 3FC1X 4RVLA 2YIXA 3P9JA 3LZBA 4GMYA 4QMTA 3EFWA 4AOIA 4E4LA 1LUFA 2X7FA 3HV7A 3LXKA 1WBVA 3G0EA 2BTRA 3F61A 4TNDA 5CF6A 5J1VA 1Q99A 1FQ1B 4EH4A 2QOIA 3HP2A 3OMVA 4AFJA 4DFUA 4PL4A 4TRLA 2X39A 3PE2A 4JRNA 4XUFA 3R30A 4DH8A 3F6XA 5ICPA 1WFCA 4YR8A 1PXMA 4GJ2A 5EM5A 5HNBA 4MWIA 4R1YA 2HW7A 4O0RA 4ZY4A 4FZAB 4WBOA 3FKNA 4P2KA 4D4SA 2UW3A 3R8MA 1PXIA 3S3IA 2GHGA 3ENHA 2IZSA 3FL5A 4FV1A 4YSJA 4I41A 1M52A 2NPQA 2XYUA 4JVGA 4GKIA 4OT5A 4L3JA 5KMNA 3CD8A 1OUKA 3AG9A 4RJ7A 3PSBA 3LCKA 5IH5A 3Q2JA 3GC7A 4QP6A 4YO6A 3PZEA 2PMNX 5IMEA 3IPHA 5DFPA 5EW8A 1H08A 4FKUA 4J52A 4RVKA 4L44A 5FUTA 4D58A 4YJSA 3CQEA 3EQHA 2WTKB 4MYGA 3AC4A 4JBVA 2BZHB 4G6OA 2XK8A 4O22A 3ORTA 5LOHA 4FMQA 4DH7A 3OT8A 4ZS0A 2EXEA 1I44A 3P1AA 1ZMWA 3GQLA 3HMMA 2C0OA 4RX5A 5I0BA 4WG5A 3W16A 3CLYA 3U6JA 4KBKA 2OWBA 3RWPA 4YPSA 2XK4A 3A2CA 4K0YA 3ZSHA 2GCDA 4IW0A 4NFMA 5LMBA 2WMAA 5DT4A 4HZSA 4AE9A 3LW0A 1IRKA 3R9RA 2PZ5A 2XM8A 4EOMA 1Y91A 5BYYA 2Z7LA 2IVUA 2CCHA 5KKRB 3RM7A 4WT6A 3QTXA 1W8CA 2C4GA 3VBVA 3AGMA 4UWCA 3ZBXA 3CJFA 5IDPA 5K0KA 3R7IA 5AR3A 1OGUA 3LXPA 4C7TA 4F7JA 2CGWA 4FV9A 3ZO3A 3PRFA 4ASXA 5CI7A 1F0QA 3QX4A 4BR3A 4FKQA 2VO6A 3VUTA 2XYNA 5AWMA 4NT4A 4AACA 4DEBA 4TL0A 3BLRA 3CKXA 2GQSA 3I7CA 4AX8A 2UVXA 2PVNA 1YHVA 1HCLA 2EXMA 4BDKA 5HNIX 3BYVA 2PUPA 1K3AA 4ANSA 3I79A 3DDQA 4G34A 4GK4A 4QYHA 4NM7A 1J7UA 4X2JA 3GCPA 2XEYA 5AIKA 5M55A 4HVHA 1J3HA 1YXUA 3T9TA 3SC1A 4BCJA 4J96A 4ALWA 4BCFA 5GNKA 3N4TA 3KC3A 5J87A 1WBNA 2R4BA 1QPJA 4MVFA 3GGFA 5EW9A 4AA0A 3VS2A 5EM6A 3DU8A 5EKOA 4E6AA 2GSFA 2G2IA 2ZMCA 5EI2A 4G6NA 1UU8A 4LYNA 3ZFMA 3QD2B 3ZO4A 5M57A 4XBRA 3ZOSA 3BLHA 3KA0A 3MSSA 4CQGA 3PZHA 3C4ZA 3NNUA 4ZEGA 4DEHA 5FTGA 4HW7A 3VBTA 4GT5A 1Q24A 5IH4A 2KTYA 2J4ZA 2WHBA 1FMOE 4QOXA 4II5A 3C50A 4V01A 2YEXA 3FWQA 3SA0A 2YZLA 4FKVA 3W2QA 3ZLYA 2R3HA 2P3GX 3GVUA 3OWPA 4LRJA 4TYIA 3QRUA 4EHVA 3DV3A 1OPLA 3WE4A 5CVFA 3SRVA 4V0GA 4FZ7A 3MH0A 4DN5A 5CSPA 1YWNA 3FI4A 4E7WA 2XIKA 5IEXA 4PTEA 2GNIA 3FMLA 4XG7A 5A4TA 3ZO1A 1IG1A 4ZLOA 2VRXA 2OFVA 5AUUA 5CALA 2X9FA 2YWVA 4F9WA 2XA4A 3ANQA 3PJ2A 4HYHA 4NUSA 4D9TA 3POOA 3GQIA 1ZZLA 3NYVA 3H9OA 4QMXA 5G1XA 4FTKA 3CR0A 1HOWA 4H36A 4L67A 4NM0A 2ZV2A 4S34A 3VJOA 1FVVA 4TN6A 4Z55A 2C6IA 2IVVA 3ORKA 3MESA 2HY0A 2J9MA 3GU8A 3MDYA 4R7IA 2JDRA 1V0OA 5HU3A 3C4XA 3CQWA 2YDIA 1KOBA 4JR3A 3D5UA 2H9VA 1OKZA 2JBOA 1MRYA 3R01A 4DEAA 5KHXA 3DZOA 5JH6A 5DT0A 4C59A 4F64A 3LVPA 5HE2A 3MV5A 3UOKA 3UBDA 2W4JA 2JAVA 2RIOA 4IANA 3UO5A 3KF4A 1B39A 3AC2A 1PRYA 3A4PA 5HIBA 3QA0A 3VUDA 4E1ZA 5L3AA 2VZ6A 4RSSA 1NA7A 3R21A 3EL7A 4N6ZA 4E3CA 4AT5A 1OKYA 3NIEA 1J1CA 5AAGA 2XBJA 2VWYA 4NFNA 2VGPA 4IZYA 1XBAA 2YN8A 3V04A 4USEA 4CRSA 1WBWA 3MW1A 4FK6A 3O8UA 2UW8A 3GXLA 3R8LA 3VJNA 3UP2A 3EB0A 4KBCA 4BBEA 1NT2A 2UZEA 4Z3VA 2G15A 1SZMA 5ETIA 4BHNA 4EK4A 1QPEA 4JIAA 3ZH8A 1UNHA 2NO3A 3VUGA 4PTGA 4IM0A 5FM2A 3ITZA 3BE2A 3OW4A 4MKCA 4RWIA 3HMOA 4A9TA 3LCSA 3ATSA 1ZY4A 1IR3A 4YJUA 2R64A 5EYKA 3FMJA 4LFIA 4GFOA 4UX9A 3NUAA 5FXSA 5FXRA 4NTTA 2F9GA 1JVPP 3KVXA 4BCIA 2Q83A 2UW6A 2GMXA 2GNLA 4RIXA 3E93A 2VTLA 4E8AA 4EZ5A 2PVFA 1PMVA 2XEZA 1KWPA 5CVHA 3ZC6A 2CKOA 2CGVA 4RWLA 3CSVA 4AG8A 4QMUA 5LCKA 4M97A 2VTPA 1IASA 2W0JA 4ITJA 4XCUA 5AUXA 4FL3A 3UMWA 1KOAA 2BIKB 3ZZEA 5EG3A 3B2WA 4FEUA 3F88A 4AF3A 4DH5A 1P4OA 4YLJA 2IZUA 4GVAA 2ETRA 3MJ1A 4FIEA 2PZPA 4I92A 4KB8A 5CI6A 5AP7A 4APPA 4AW5A 2QLQA 4UB7A 1GIHA 4BIDA 4DEDA 1IAHA 3L8PA 2BPMA 4FTNA 4MQ1A 4O0WA 4ERKA 2RG6A 4XH6A 1ZARA 2QOQA 1OIQA 3MB7A 4FKSA 4YLLA 3V6RA 4ARKA 5DGZA 5CEPA 2PVMA 2WMWA 3PG3A 3KRXA 2O64A 2RF9A 4GU6A 3UGCA 5LMKA 2GQGA 4FKPA 4KWPA 3UVPA 2BUJA 5BUIA 3FI3A 1XHAA 2RSVA 4GUBA 4BDJA 3JVSA 4IIRA 2ITYA 5KE0A 4OTWA 1PKDA 1JOWB 3F9NA 3PA3A 5GJGA 4RC3A 5EYCA 4U79A 5HQ0A 4EBVA 4IVBA 3GENA 3EN6A 3WYYA 3DB8A 3PPZA 4B6LA 3PWDA 4BI0A 2GHMA 2Y0AA 3A4OX 3DKGA 3FY0A 4RG0A 5IDNA 4OT6A 4NKAA 3R7VA 4DCEA 3TUCA 3TV7A 3U55A 4AXAA 3FPMA 4LUEA 4ANOA 3LM5A 3COHA 5JFXA 2BVAA 1XH9A 1ZYDA 3F5PA 2R3RA 4XOYA 4LGGA 3H9RA 3A7FA 1ZMVA 5ANOA 4AUAA 3OUNB 2BZKB 3QCQA 4GRBA 4W9WA 5D10A 5AP0A 2YCQA 1ZLTA 3QAME 4C2WA 2QG5A 2OXXA 4M13A 3CTHA 4NKSA 4RC2A 4A4LA 1WBOA 4C35A 2Y8OA 3WI6A 4O1OA 3MH2A 3Q5ZA 3UYSA 2FB8A 3C4WA 3EYHA 4FIGA 1P2AA 1FMKA 3ODYX 2JDVA 4XV3A 4USDA 3AOXA 3EZVA 4XMOA 4JG8A 2VO7A 4C4HA 2OZAB 4C2VA 5GIOE 1SM2A 2BZIB 3MVMA 4LOQA 3WZDA 1OPKA 2BCJA 2GS2A 2WFYA 3QXOA 4X7QA 3RGFA 2JBPA 2X7OA 3UE4A 3WF7A 4DGMA 4F08A 2CCIA 1WVWA 2X7GA 2XK3A 2H34A 4O7SA 3S95A 5EYDA 4XLIA 4JLCA 2QO7A 5HVJA 1R0PA 1M2RA 2OH0E 4K77A 3LJ0A 3NYXA 2R0UA 5CEKA 2R3LA 3VAPA 3OROA 3ZRLA 3TNHA 1YXVA 4FT5A 4LGHA 4WHZA 2W9FB 3IDPA 3IO7A 5DN3A 4G3FA 4ITIA 4BDEA 1QL6A 3PVUA 5CASA 4BI1A 3LFSA 4CTCA 2JKKA 4I6FA 5EDRA 5FBNC 2CSNA 3QZFA 3VS3A 5HVYA 3BCEA 2UZBA 3TZ9A 4UEUA 1H28A 4Q9ZA 3MIAA 1IEPA 4GL9A 3HMNA 4A7CA 4C3RA 4O0YA 4E4NA 2BMCA 4YTHA 3R2BA 4ZLZA 4GG7A 4JDHA 2V7OA 3KRJA 5DR9A 1Q4LA 5L2IA 3GFEA 3DKOA 2B7AA 3N4VA 2OJFE 4M69B 5IMXA 4R8QA 4ZTQA 5BVWA 3RP9A 3WILA 4S2ZA 3NNXA 4ZJJA 3E88A 3ET7A 3CEKA 3NUUA 3O0GA 4IM3A 4KKEA 5IA4A 3UZTA 4FTIA 2JIIA 3LKMA 3V8WA 3EH9A 2OH4A 4QTBA 3QKLA 2WTJA 5T6KA 4FR4A 3OWLA 4X6QC 4O82A 2WTKC 4GKHA 1PXLA 3O8PA 4JQ7A 3D7TA 4UMQA 4XRJA 4G9RA 5DHJA 5FRIA 4BBMA 4IAYA 4FSMA 4D5HA 5GINE 2PUNA 3MJ2A 1JKSA 4TYJA 4X3FB 5AP6A 3C7QA 4R1VA 2ITZA 3A7HA 2CNUA 1JKKA 3ENMA 1A06A 4RJ5A 4Y46A 2OG8A 4ZMEA 2FGIA 5JRSA 4DFNA 4EWQA 1DI9A 4XJ0A 3Q32A 2B54A 4M8TA 3C4CA 1PF8A 3KULB 4FGRA 2XB7A 2X8IA 1Q97A 3QTQA 4FTAA 4PPBA 5HG7A 5I9VA 3HX4A 3L8SA 3OCTA 1GAGA 2W1FA 4W4WA 4XG3A 4AN9A 5AA9A 5HTBA 4TWNA 4BCHA 3VBWA 5KKRC 5E92A 3PJ3A 4D28A 2BKKA 2ZMDA 4EUUA 4TXCA 5HTCA 4QTDA 2QOKA 1VZOA 2X8EA 3OG7A 1UNGA 3UZPA 2R3JA 3TUDA 1GJOA 2ONLC 5A4EA 4YZNA 4DLIA 3V5LA 3EQGA 4I21A 4PPCA 5FGKA 4BY9E 1VYZA 5H8BA 3ZYAA 5C8MA 4KIOA 3FSKA 3H9FA 3R9NA 1OITA 5TR6A 3MWUA 3GU6A 4AN3A 4QP1A 4XV1A 2BAKA 4C62A 4WO5A 3BEAA 4N70A 4ZMFA 3AT3A 4FT3A 5GZ8A 3NCZA 5EKNA 4QP9A 3CE3A 4YZ9A 2BIYA 3VS6A 5JT2A 4O1PA 1H4LA 2PVHA 5A4CA 3IOPA 4QO9A 2C6EA 5CXZA 5AR7A 3CS9A 4Q2AA 3L9MA 1H0WA 3DBCA 1E9HA 2PMIA 3QHRA 3CC6A 4Y5HA 1B6CB 5KZ0A 4JXFA 3OCGA 3R8ZA 2GNGA 2GHLA 1V0PA 3RKBA 2P55A 5AV2A 3DOGA 3H4JA 4O21A 4X21A 4BZNA 3DDPA 3A7GA 4QT1A 1S9JA 2QVSE 4HCTA 2C47A 3MI9A 4TWPA 5DRBA 3DA6A 2WAJA 4MEDA 5CEMA 4IH8A 4EH6A 4FUYA 5C01A 4LUDA 5HICA 2QI8A 2OJ9A 4FVPA 4IJ9A 3W8QA 3BBWA 5JSMA 2CKQA 4I24A 2ITOA 4BKJA 1AD5A 4BBFA 3FV8A 3IONA 3BHYA 5A54A 2AC3A 5JKGA 2UV2A 4FKTA 4HOKA 4UWYA 4KKGA 1TKIA 4EH7A 1FGIA 4M7IA 4ZSLA 2OXYA 5J5TA 1STCE 1RDQE 4JBOA 4MBJA 2X6EA 4U7ZA 2YM5A 3H30A 5E8VA 5HCYA 4BDIA 4TZRA 3PE1A 2OJJA 5FDXA 2RGPA 4O6LA 5H8GA 5HCXA 4ZJVA 5CANA 2CLQA 1ATPE 3LFEA 3EMGA 2WMSA 3O2MA 4PY1A 4F9CA 2EB2A 3SVVA 3RALA 3CCNA 2PMLX 3FSFA 3HVCA 3OBGA 4GCJA 5CNOA 5LVLA 4A9RA 5HOAA 5J9ZA 5H9BA 2W4KA 4JOAA 4C4GA 4GFMA 1FVTA 3FAAA 3H3CA 5K5XA 3IKAA 1SNXA 5DEWA 4O38A 3RHXA 4IWDA 2W5HA 1DI8A 2Y9QA 4J95A 5FXQA 2GQRA 2JIVA 5IUGA 4FV4A 3V51A 3PUPA 4ZXTA 4AQCA 4Q9SA 4CT1A 3QCXA 1URCA 2E9NA 3COIA 3GCVA 4OR5A 3BLQA 5E8SA 5HO7A 3B8RA 4FTQA 1R78A 4FTRA 2B9IA 3Q6UA 4LG4A 2FVDA 5IQIA 3FLNC 4O0TA 2B9FA 3D5VA 2CPKE 4GJ3A 3V5JA 5BVNA 5IPJA 3UQGA 2B55A 3RPRA 2C0TA 3LOKA 4HVDA 3EFJA 3QCYA 4I0TA 1NXKA 2BALA 2YITA 1Q8ZA 5DWRA 3QGYA 5AUVA 4ACGA 4NIFA 3RNYA 2C5XA 3OWKA 3T3VA 3L9PA 3DLZA 3GNIB 2X4FA 1TQPA 5L2TA 3QHWA 4MAOA 4M14A 4R3RA 4IQ6A 4OTRA 5M56A 2QNJA 4BWXA 3P78A 2YIYA 4A4XA 2OO8X 5E8WA 3TNIA 2BRMA 4QMPA 4BGGA 4XHKB 4LV8A 4ACHA 3DNDA 1ZRZA 4A9UA 5FDPA 1YI6A 4MXYA 1QCFA 1TVOA 2XVDA 4L3PA 2OXDA 4K9YA 4E5WA 3BV2A 3F7ZA 5BQ0A 2HELA 4QNYA 2PZIA 5HD4A 2UZLA 2V7AA 3KRRA 4JI9A 3TKIA 3JUHA 3V3VA 2W1CA 2Y6OA 3RK5A 3FI8A 3ZS5A 4IAAA 4ASZA 4L01A 4FTOA 2BAJA 3FZSA 4CFXA 3RHKA 2XNMA 3UC4A 4AA4A 4YO4A 3NW6A 3BGPA 2W1DA 4DEGA 4ZTSA 1GIJA 4OTDA 4GU9A 5HKMA 3BELA 3DJ6A 4G6LA 4D2PA 3FYJX 4ZY5A 2JDTA 2JLDA 4IADA 4O27B 2WD1A 1YHSA 2UZOA 3D5WA 3W32A 5HX6A 2WZJA 1JSTA 3O8TA 4FG9A 4HVSA 1ZY5A 2XNGA 1S9IA 2XJ0A 3CPCA 1OIYA 3NYNA 4I6HA 2OIBA 5CT0A 4QTEA 2X0GA 5HORA 4BDDA 4W4YA 3PPKA 1JQHA 3LCOA 4H05A 2R0IA 4W4VA 4ASEA 4RFYA 1YQJA 5DI1A 3D83A 1T46A 5HG8A 3RZBA 3W33A 2HENA 3I5NA 4U41A 4B9DA 4IWOA 4HGSA 2X1NA 4O7ZA 4BIBA 3RAWA 4R3CA 4R6VA 5EHYA 3NVMB 3ZU7A 1UWJA 5KUPA 2WEVA 4Y73A 3MH1A 4WRSA 4C4IA 5EOLA 3ATTA 4FV0A 2FH9A 4X2KA 4RA4A 2YM3A 4HGTA 4MF0A 4MBLA 1OIRA 3ANRA 5GZ9A 2ZM1A 3MVHA 2NNWB 2BROA 5D12A 2OIDA 2JFLA 3AT2A 3Q04A 4L45A 2J50A 4ACMA 2I7QA 3FQSA 2QLUA 4YP8A 5TT7A 3UO6A 5GIPE 1M17A 4HPUE 5FEQA 5EI6A 5HBJA 1YDRE 4QYEA 2XUUA 4PDSA 4TWOA 3BYOA 4Q5EA 2R3FA 3UO4A 2W1ZA 4OTHA 4Y83A 3S1HA 4D2SA 4LRMA 1UU9A 3VVHA 3OVVA 4NM5A 3NIZA 1M7QA 2BDFA 4J71A 2C3IB 4NL0A 3KK8A 4DT9A 5BUJA 3V5TA 4I6QA 3PTGA 3S4QA 5HI2A 3HMPA 2R2PA 3I81A 2WEIA 3QTUA 4BFMA 5C1QB 3GEQA 4XG9A 2WB8A 2UZDA 2ZOQA 3ORMA 3OT3A 2A0CX 4PP9A 4QYFA 4AAAA 4X2FA 4IZ5A 4H58A 4IAIA 3LFAA 2VX3A 5ACKA 4HPTE 5IQFA 4FTMA 5K5NA 3LJ1A 5LMAA 4ZAUA 3WZKA 4ZSEA 3UIBA 1OECA 4MNFA 5IQAA 1YVJA 2CN5A 1Y6BA 5CENA 4ANMA 4CV9A 2OJIA 4EOLA 5FQDC 3QBNA 5AIRA 3ODZX 4ALVA 1JWHA 1JSVA 3ORIA 3LXNA 1SNUA 1ERKA 5H2UA 4FEQA 3FBVA 4EH2A 4C37A 2XZSA 2RFEA 3NS9A 4Y8DA 2HWOA 3OP5A 3PIYA 4W8DA 3DB6A 4CVAA 3SXFA 5L4QA 3QKKA 3UOHA 2VTNA 2CKPA 1XR1A 3TNWA 3VW6A 5HE3A 4DBNA 3ETAA 2PE0A 3UTOA 2QOLA 4FI1A 4HZRA 4N4SA 1ZYJA 4I1ZA 1YHWA 3N4UA 1OI9A 2ITPA 3GB2A 5M4UA 4NW5A 5D9HA 5AAFA 3BI6A 4I5HA 4RJ4A 3HDNA 4IX4A 4U0IA 4YJOA 5BX0A 2J0MB 5I3OA 3VBXA 4B0GA 2ZV9A 3I6UA 2V62A 3QXPA 2PZRA 4CZTA 2PULA 5IH6A 3QRKA 4OLIA 4YJPA 4IAKA 2OKRA 4ZS4A 2Q0NA 4L53A 3VIDA 3G6GA 4FYNA 4YJQA 2O5KA 4V0GB 3SRVB 3WF8A 4EYJA 1G5SA 4J8NA 1JNKA 3EJ1A 5AEPA 3PXQA 1Q41A 4FNZA 5FD2A 4LV5A 5LVPA 4I23A 4NK9A 3C0HA 4QMZA 3LFBA 1W83A 2RKUA 1GZOA 4RFZA 4FOBA 4IVCA 2XCKA 3NRMA 2QCSA 2OLCA 3UVRA 3EKNA 1VR2A 3PLSA 5AR4A 2GS6A 4DGNA 3L9LA 3TNQB 4JT3A 1H25A 2F2CB 2W17A 3EQFA 4XX9A 2J5EA 4YTCA 5CAUA 5I4NA 4YU2A 4X3FC 5BVOA 2UZUE 5C4LA 4FVQA 1OPJA 3P86A 4BN1A 5HVKA 1NVSA 1WZYA 1K9AA 3P0MA 3UIXA 1XH5A 4YSMA 5E1SA 3VNTA 1Y8GA 1MQ4A 3ZSGA 4EOKA 5HX8A 2YABA 1U5RA 5EHOA 2O2UA 4YJVA 4BWKA 4YZDA 1KE6A 2GTMA 3S2PA 2W96B 5E8XA 1O9UA 3FPQA 3T8OA 5K3YA 4BIEA 4FNYA 5KO1A 4YJNA 3OEFX 3UDBA 2HZ0A 4U43A 4CFMA 4L52A 4D1ZA 5KCVA 5M4FA 2JITA 1IA8A 1YDSE 4IDTA 4HVGA 3DK6A 3QF9A 4FV7A 2BAQA 1DAYA 3P23A 4LRKA 4FIJA 4L46A 2X81A 2W7XA 2FSLX 2BFXA 4E6CA 5DA3A 3F2NA 4G1WA 3G9LX 3NAYA 4OBOA 1PXJA 4U6RA 5CEOA 2UZVA 4CD0A 1J7LA 4QMYA 1BLXA 4PRJA 3CJGA 5HNGA 1H26A 3K54A 3W2SA 5DYJA 2YLEA 3ZONA 4BCNA 3OC1A 1PY5A 2X8DA 3LM0A 3MIYA 4FSRA 2B0QA 2ERZE 5CYIA 3FLYA 3QFVA 4CKRA 4FKWA 5JRQA 4MCVA 4QP8A 4MF1A 5AR5A 5JFSA 2R7BA 4O7TA 3Q9YA 1ZXEA 4F7LA 1H1WA 3II5A 5JGAA 2PK9A 4L7SA 3FMHA 4WSQA 2AUHA 3A62A 1OUYA 2A19B 2IZTA 3R71A 3KRWA 2J51A 3ZXTA 3UIMA 4CZUA 4AZTA 4RIXB 4CKJA 2XKCA 3PY1A 4PTCA 2QOFA 3PY0A 4XLVA 4UY9A 4CCUA 2JKQA 1H27A 3SLSA 4F7NA 4JJRA 5C9CA 1QPDA 3BE9A 3B2TA 3OXIA 3NDMA 5IA5A 3UVQA 3PJCA 3NR9A 3PYYA 5AUTA 3F3UA 3D4QA 2WELA 2WQMA 3DGKA 2I0VA 4QQCA 4EH5A 1FGKA 4QQ5A 3NWWA 3EYGA 4QQJA 2VN9A 4F1OA 1XH6A 2E9PA 4NH1A 4O7VA 2PVRA 3IS5A 4TW9A 2HXQA 1JAMA 3CGFA 3GU5A 4FICA 4D4VA 1UKIA 4G31A 4H39A 2PUUA 4OTGA 5CAQA 4I0RA 5EQEA 3F82A 3Q2MA 5IEVA 4LGDA 1RW8A 4FG7A 2QKWB 4EEVA 5DRDA 1QMZA 3ROYA 3KL8A 2YHVA 4WNKA 5HZNA 5HCZA 4EH3A 1OL2A 2VUWA 4UMUA 5B2MA 4EOOA 2ZV8A 2VWZA 3KMMA 5EHLA 3LLTA 4IAZA 2IW8A 3FZTA 4G3GA 3OS3A 4JBPA 3HA8A 3NCGA 2JC6A 4FV2A 4DFXE 4G17A 4BF2A 3GCSA 3A8XA 4WRGA 2QOOA 3RPYA 2CMWA 3MPAA 5HBHA 5L2WA 4CG8A 3TN8A 2SRCA 3HKOA 2ITNA 3QALE 5LVOA 2XKEA 2YCFA 4OBQA 1GZ8A 3HAMA 1Y8YA 3BRBA 2EVAA 3CKWA 3VUHA 1UKHA 2PE1A 3DAKA 4KINA 3UZRA 2JEDA 2YERA 4EK8A 4OTIA 4WG3A 1OBDA 2XF0A 2R3PA 3E8EA 3W2RA 3IQ7A 5HLNA 5K9IA 2XJ1A 4FEXA 2WMQA 3G51A 2WMXA 4DGGA 4EWHA 4ZK5A 2W4OA 4R7BA 3HUBA 5E8YA 4R3PA 3DQXA 3GC8A 4RZWA 5CS6A 4EZ3A 4C57A 1YXSA 1O6YA 3Q9XA 4QTCA 5CSVA 4IFGA 5FG8A 5M4CA 4K8AA 3KXZA 2EUFB 3O17A 5FM3A 4F9AA 3DT1A 2E2BA 3Q4CA 4NSTA 3LCDA 5HLPA 2J0IA 3RNIA 3TJCA 3MYGA 2R3QA 2IO6A 3CIKA 3U51A 1KE5A 1YXTA 3TUBA 2BRNA 3HECA 3NYOA 4C0TA 4BDCA 4YC3A 3R1QA 4J8MA 4M15A 3VO3A 2IVTA 3VQHA 5J79A 5CU6A 2ZM4A 4XEYA 1I09A 2YM4A 4KSPA 4ORKA 4AZEA 3Q9WA 4EYMA 2FSOX 3HA6A 4JAIA 2WIPA 3TIZA 2C30A 4TY1A 5DPVA 4JX7A 5AA8A 5BUEA 5J9YA 4R7HA 5M44A 4HNIA 1R3CA 4ONAA 4F0FA 2DYLA 3FUPA 1VYWA 2F7EE 3QD3A 1YDTE 2XMYA 1PXKA 1SMHA 3QRJA 2IN6A 3E87A 3OTUA 3W1FA 1LEZA 3F3VA 4YJTA 3I1AA 1ZOGA 3SG8A 2UUEA 3TACA 2YDKA 4MQ2A 2OICA 3AQVA 4GUEA 4RIWA 1AQ1A 4QMOA 4JR7A 5E8TA 4W9XA 2GFCA 4JG6A 3VN9A 2VWUA 2J90A 4J99A 2C1BA 2LGCA 5F20A 5A3XA 4I20A 3C4FA 4AWIA 3WIKA 4D4YA 4QNAA 2OW3A 5A14A 4PMPA 3P5KA 5KMOA 4DTAA 3BWJA 4DT8A 3OEZA 4FV3A 3FZRA 3MH3A 4MX9A 5GHVA 4G3CA 4ENXA 4RLLA 3R00A 2OBJA 3U87A 3FMNA 4NCTA 4O91A 3U6IA 3HLLA 3AD5A 4C02A 4PNKA 1PMUA 2XKFA 3OUKA 3D7TB 3ZBFA 3VRYA 4EC9A 2WQNA 3Q3BA 5DVRA 3E7OA 3CY2A 4WOVA 2VTOA 5CT7A 4Q5HA 2UVYA 5CX9A 2VWVA 2BDJA 5LARA 4ANNA 5IQBA 3AGLA 1UVRA 5CU2A 4BWPA 3BU6A 2J0KA 3CP9A 3BHUA 2IW9A 4KSQA 3QGWA 5JFVA 3D94A 4EQUA 4D0WA 2Y7JA 4WNMA 3QUDA 5A46A 3MA3A 2ERKA 4CG9A 3QRTA 1VEBA 4CLJA 4BC6A 3O7LD 2FSTX 4H3BA 5CU3A 4X3JA 5DIAA 2NP8A 4DGOA 5EK7A 4QP3A 3VUIA 4BCOA 4DE4A 3RBWA 3HEGA 5IQCA 1M14A 3ALOA 3BYSA 1NY3A 3D5XA 3QCSA 3IG7A 2C69A 3LQ8A 4FL1A 4WA9A 3SKCA 4CMTA 3IW5A 5ETCA 4YZCA 5FP5A 3DKCA 3G15A 4FV6A 3P79A 1V0BA 2BKZA 1CMKE 5D7VA 3ZZWA 4AA5A 3DK3A 4IM2A 4BTKA 4D2RA 5KZIA 3BBTB 3QQJA 3QQLA 4WIHA 5CSHA 4YGAA 4NJDA 3VS7A 1R0EA 4C8BA 3E7VA 4FV8A 4LOOA 4UMTA 4ENYA 5KMMA 2YDJA 3RI1A 5ETFA 4A9SA 3DY7A 4FKLA 3RJCA 4QYYA 3A8WA 2YISA 3DLSA 4BRXA 1O6KA 1A48A 2O65A 4FGBA 5TOZA 3QYWA 1CKPA 5DG5A 4EOJA 2Y4PA 5CQUA 3TI1A 3R63A 4E93A 3OTVA 2YCRA 4RIYA 4LI5A 4A07A 2ZDUA 1U46A 4UYNA 4IB0A 4K33A 3MVLA 2GNFA 3C0GA 3OFMA 3SHEA 4TYGA 3FQEA 3DBEA 3V5QA 5KBQA 3ID6C 4DF3A 4S33A 4FT7A 3FZ1A 4O0SA 3FL4A 3MTLA 3HV3A 4O0XA 2XJ2A 3W10A 4FTJA 1JPAA 2QQ7A 3DKFA 3EQCA 1LPUA 3JYAA 1RJBA 4PQNA 2VTRA 1G8AA 3PP0A 4FV5A 2WGJA 4MHAA 4LL5A 3OOGA 3V8TA 4ZTLA 4ZZNA 4UXLA 2I0EA 1YWVA 1XJDA 2W06A 2BHEA 4IVDA 4IAFA 5I9UA 3K3JA 4W4XA 2XKDA 4E4XA 3F3WA 3GU7A 4UV0A 5BVFA 5M51A 2CGUA 3VBYA 3FEGA 4H1JA 4B7TA 2I6LA 3MY1A 3KQ7A 3TDWA 3QWJA 4GSBA 2ZYBA 3EL8A 3ZM9A 4EK5A 4YNEA 4R78A 4EHZA 2QR7A 2G1TA 3AC3A 3E3PA 2ZAZA 2Y4IB 3HV6A 3G2FA 3CGOA 4ALUA 3EQDA 4TNBA 4ZZMA 4FSYA 4TYEA 2UW4A 5KBRA 4X2NA 2A4LA 1XBCA 5F95A 4M67A 4FKIA 2JD5A 1BI7A 2IVSA 3LMGA 3SV0A 4ERWA 5KX8A 4O86A 4DBXA 2B9JA 4DTKA 3KMUA 3KF7A 5CF5A 4OBPA 2O8YA 1XQZA 4O7WA 3PIZA 3C9WA 4A4OA 2PTKA 3JR1A 3UPZA 4OAUC 1BI8A 3O23A 4FUXA 2YIRA 2HXLA 2XK7A 5EH0A 4DTBA 2AYPA 3ORPA 1L3RE 5HIDA 3R6XA 3PDTA 5HG9A 1UU3A 2YLFA 3LE6A 3QWKA 5M09A 4FT9A 5CU4A 3ORZA 4YJRA 4C33A 5AUWA 3NSZA 3QC9A 5DT3A 3VULA 4YTFA 3EFKA 2R9SA 4GIIA 4QMVA 3RM6A 4ASDA 1Z5MA 2GPHA 4EK6A 5CU0A 2WXVA 3I4BA 3PVBA 4XRLA 5TO8A 4ANBA 2GTNA 4G5JA 4NIFB 4EKKA 4EI4A 1PXPA 5HD7A 2UVZA 4O7YA 2G9XA 2GFSA 3IW7A 4AW2A 4U3YA 3KY2A 3BWFA 2YAKA 5L2SA 5L6PA 3UG2A 3F2RA 4IEBA 3CQUA 4P4CA 1REKA 5FP6A 4BTFA 2OU7A 3OBJA 3RMFA 3EN5A 3E5AA 3NMUF 3LIJA 1PXOA 4TYHA 2GU8A 2PPQA 4QP7A 3M42A 4G3EA 5IZFA 4MD7E 3GU4A 3UG1A 2C6MA 3D0EA 3TTIA 2C6OA 2V22A 4OTPA 1H07A 4UALA 3VHEA 1SVHA 5J1WA 3G5DA 1ZOHA 3M2WA 5BYZA 4AOTA 1Q61A 3MS9A 3IDCA 4UZDA 4S32A 4DFYA 5BVKA 2H6DA 2O63A 4GW8A 5I9ZA 3LFNA 2PZYA 1KV1A 1TQMA 2EB3A 2C5OA 2UZWE 3P7AA 4QRCA 5E7RA 1H00A 5DMZA 4CRLA 4DITA 4R5SA 2WTVA 4G5PA 5FWKK 3GOPA 4YBKA 4UMRA 3BX5A 3HRCA 3Q53A 1DAWA 3FY2A 3DAEA 4B99A 3TCPA 5AP1A 4XP3A 5IQEA 1ZWSA 3FLZA 3QX2A 4RBLA 3AXWA 3IGOA 4BYJA 2GNJA 1FPUA 2C5NA 2WPAA 3HMIA 5HO6A 5LCJA 5KMIA 1ZYLA 5T3QA 4EJ7A 3VC4A 4GEOA 2IPXA 4UZHA 4RIOA 4AW0A 4FODA 4AT4A 4IMYA 1WAKA 3QQUA 4LMNA 5K0XA 3QQKA 5CXHA 4MXAA 4FTCA 3LJ2A 3QLFA 5LMKC 4BZOA 1U5QA 3AD4A 4RRVA 3MGYA 1E1XA 3MTFA 4JIKA 2R3MA 2UZTA 2HK5A 4JQEA 4ANQA 2BILB 4EKLA 2BRHA 5GJFA 1KUTA 4CGAA 3H10A 3SOAA 3NVKI 3NUXA 3NEWA 3R1SA 3Q5IA 2B9HA 4FSNA 2WTDA 4CT2A 4XYFA 2QHNA 5A9UA 4CQEA 2XS0A 2NRYA 2VTMA 3WE8A 3SW7A 4HNFA 2Z7SA 4XG4A 4KRDA 2P0CA 2QR8A 4UBAA 2OI4X 2OJGA 3CY3A 3G9NA 3MN3A 5DR2A 2XNEA 4QMWA 4TPTA 2YAAA 3GC9A 2IZRA 3ELJA 4UYAA 4NZWB 1OKVA 3LFCA 3AC8A 2A1AB 2HAKA 3VF8A 5A6NA 4O7LA 4PNIA 2BDWA 3IGGA 4MTAA 3TNPC 4C61A 2XIYA 2XK6A 2BZJA 3VUMA 5HESA 2CKEA 2RL5A 5C8KA 4MNEA 2WO6A 2BR1A 1ZOEA 4M84A 4QPMA 4IVAA 2PSQA 4QTAA 3TZ8A 2HZ4A 4C4JA 3KKVA 4QQTA 2HCKA 4X2GA 3ERKA 3MA6A 4GT3A 5IKWA 3SAYA 4EBWA 1MUOA 3G6HA 1BL6A 2BRBA 3OCSA 4PWNA 5CTPA 3PIXA 3VS5A 2C1AA 4GV1A 4PX6A 2WMTA 3DS6A 5L2QA 3TXOA 5JN2A 1WCCA 3PSCA 3QKMA 1KV2A 3KCKA 5F1ZA 4FTLA 3DK7A 4OW8A 5EFQA 1YWRA 4F09A 4E6DA 1XWSA 3R73A 3LMHA 4JDKA 4P90A 2WU7A 4JL9A 4YHJA 1BMKA 5EOBA 2DQ7X 1H8FA 1H1PA 3FXWA 4K6ZA 1H24A 4N6YA 3I0OA 3TV6A 4IZ7A 4L9IA 4NEUA 4DFZE 5CQWA 3IECA 2QG7A 5J5SA 3DFCB 5EYMA 1CDKA 2HWPA 4EK3A 5IA2A 2RFDA 3UNZA 3ZDUA 2XH5A 2PUIA 3TG1A 5IA3A 3L8XA 1B38A 2ITQA 2IW6A 4YZMA 3R8PA 3UP7A 3GI3A 5IQGA 2W1GA 2WKMA 4Z7GA 5L6OA 4JBQA 4CEGA 2C3LA 3JY9A 3LQ3A 3THBA 1W0XC 2G2HA 2I0HA 3PXKA 3KFAA 2Y6MA 4RJ6A 4B4LA 2W5BA 3TEIA 3F5UA 4N0SA 1H1SA 2FO0A 4RMZA 4TT7A 4FSZA 3KXXA 4LQMA 2GDOA 2XM9A 3TT0A 3ULZA 5L8JA 5J8IA 5AADA 3UQFA 4DFBA 1IA9A 5AV0A 3IW8A 3OD6X 1OL6A 2HW6A 4JDJA 3VQUA 1PMNA 3GT8A 1PKGA 3M11A 5I9WA 2XNPA 4ZOGA 2Z60A 3QLGA 4IACA 3VF9A 3BPRA 4ZTNA 1LEWA 4EHGA 4JAJA 1VJYA 5E1EA 2CGXA 4PL5A 4J7BA 3VUKA 3WF6A 3DJ5A 4RLKA 5AJQA 2VGOA 2B52A 3NUPA 1Q3DA 2O3PA 5I9XA 2V0DA 1NVQA 4O2PA 2QOCA 3L8VA 1Q8WA 4GT4A 3HAVA 1GZNA 4OUCA 4EHEA 1WMKA 4P7EA 1UWHA 3IDBA 4YC6A 3UIUA 2G2FA 2Q0BA 1YI3A 4FOCA 4DYMA 4BCMA 5A6OA 4JRVA 1CM8A 4MXOA 1AGWA 1BYGA 3Q96A 3NAXA 3OCBA 4DH1A 4F63A 4K18A 3GCQA 3IW4A 3A99A 3OF0A 5AP3A 3LAUA 2YWPA 4D1XA 4YURA 5IUIA 2Z02A 4I22A 3C51A 4RWKA 3R28A 5T68A 2CJMA 3TV4A 4IXPA 2YACA 3QA8A 1JLUE 1U54A 4U45A 3RAIA 3ULIA 4U81A 1W82A 2XBAA 3ZUTA 5IISA 2YJSA 1M2PA 3KK9A 2OIQA 1YOMA 3CPBA 4FSUA 3AD6A 4FVRA 3FXZA 3TL8A 5F9EA 4XG8A 4FZFB 3O51A 5H3QA 2OFUA 4S30A 4DG2E 2B53A 5CF8A 3E63A 3FKLA 1XH4A 3DBDA 3N51A 1M2QA 5IF1A 1RQQA 3QTZA 3T9IA 4IFCA 3ZMMA 1OL1A 3NNWA 4I0SA 4GIHA 3ZLSA 5EQPA 1PHKA 3SDJA 4RVTA 1Q8UA 1J91A 3IW6A 5KMJA 4A9YA 2VWBA 3DCVA 4V04A 1Q8TA 3SW4A 4DA5A 1GIIA 2XP2A 3QTSA 4YPDA 4FKOA 3C0IA 3DBQA 4GH2A 2QO2A 4JX3A 5A4QA 1UU7A 3R04A 3QYZA 5JQ5A 2JFMA 2C3JA 4CZYB 4D2WA 2ACXA 3TWJA 5B2KA 2YA9A 3ZRKA 2ZDTA 1APME 4D2VA 1UA2A 2P4IA 3R9DA 3BYUA 4FSTA 5CLPA 4V05A 2E9VA 5DEYA 3F3TA 3CXWA 4K11A 2H96A 5KHWA 3ORNA 3REPA 4RT7A 4B8MA 3OXZA 5AR2A 1Z9XA 3E64A 3UC3A 1ZAOA 5K4JA 2BHHA 4PDOA 4KIKA 5CWZA 1M7NA 3ACJA 4AZSA 4F6SA 2P33A 2RG5A 3BIZA 4CKIA 3POZA 3F5GA 4FE2A 1OB3A 1BL7A 1OL5A 2PL0A 2XRUA 3MPMA 3FLQA 3WYXA 3QZHA 5FEEA 5BVDA 1OIUA 5JZNA 2C3KA 5CSWA 5CVGA 5G6VA 3SD0A 3ZM4A 3ZRMA 4APCA 4CFWA 3Q52A 3UPXA 4Z16A 4EQMA 3U8WA 4KUJA 1ZYSA 4RFMA 3R83A 4C36A 4H1MA 2J5FA 5D41A 4BDBA 3GCUA 1Q62A 3I7BA 4FIFA 4HCUA 4NJ3A 5GJDA 4O7NA 2R3KA 3E8DA 3F66A 2WOUA 2Y4IC 4S31A 3QL8A 4XOZA 1OZ1A 4O0UA 4AP7A 3UQCA 3WARA 1SVEA 3W55A 4PP7A 4BTJA 1SVGA 2V5QA 3OY3A 4E5BA 3ZEPA 4AU8A 3ZUUA 1DM2A 4KBAA 3UODA 2XK9A 4DINA 3BQCA 4XS2A 2I0YA 4ACDA 4L00A 3PJ1A 5C4KA 2VO3A 5EI8A 3QQHA 5ANKA 5IUHA 4DCAA 4F6UA 4C4FA 3P08A 4JS8A 3A61A 5F94A 1Z57A 4GVJA 1Q8YA 5D7AA 4BYIA 4J98A 5AUZA 3HP5A 4DHFA 2QODA 3D7ZA 4PPAA 4L6QA 3LLAA 1WBPA 5DR6A 3QTIA 5LVMA 4FZDB 4C3PA 4IBMA 3AC5A 4I4FA 4M3QA 1KE9A 1FBNA 2ZJWA 2V55A 2WQBA 4F70A 4U80A 4ZSJA 3FXXA 4U3ZA 4BICA 1H01A 4MBIA 5HHWA 1JKTA 2HY81 4EH9A 5AP5A 3ZLWA 2VX0A 4FK3A 4NWMA 4PMSA 3P7CA 5IA0A 5M53A 5M07A 1CKIA 4WG4A 4F1MA 3BZ3A 3GBZA 3R8UA 4C58A 3AMAA 4MXZA 4PL3A 2WMBA 3GOKA 3V5PA 3MVJA 5BYLA 1JKLA 4FA2A 3ZSIA 2CN8A 2QC6A 5M06A 4EOPA 3RPOA 2ZB1A 5IA1A 5K4IA 2YJRA 4YBJA 1FOTA 4EQCA 4YHFA 3FC2A 4CXAA 4EZ7A 4BVUA 4FNWA 3QTRA 4BZDA 2C6LA 1BUHA 1P4FA 1OBGA 3AT4A 3EQBA 2XNNA 4ZTHA 4EOIA 5LQFA 2WMUA 3MFRA 4DEIA 4I5CA 4EORA 4X6RA 4HVIA 3WF5A 5KNJA 5E91A 4DG0E 4G9CA 3PPJA 3COKA 5CZHA 3QUEA 1W84A 4FYOA 4WUNA 3U9NA 2J6MA 3FDNA 2AC5A 3O96A 5JEBA 5FLFA 2ONLA 2ESMA 2Z8CA 4IX6A 3VRZA 2QOBA 3K5VA 2H8HA 3RINA 1ND4A 4O7RA 4CV8A 1X8BA 1XH8A 2JIUA 5D11A 1W7HA 4L68A 1MP8A 3HGKA 2YZAA 3OHTA 3PWYA 4IWQA 4LL0A 3R1YA 2YCSA 4RIWB 4EOSA 1P14A 3L9NA 3P4KA 3UNJA 3WF9A 1MQBA 4RX8A 3TTJA 2VU3A 4RC4A 5A4LA 3QQGA 1NVRA 4IHPA 5LWMA 3A7IA 3NUSA 4Z7HA 3UNKA 2W9ZB 2CLXA 2Z7RA 1NW1A 3JS2A 5AX9A 5EM7A 3TJDA 2WTCA 4FBXA 2VO0A 4MD8E 1XKKA 5HTIA 3LFFA 4C34A 4AGUA 2F7ZE 4E6QA 5ANEA 4IE9A 4U40A 4FEVA 3K3IA 1P5EA 4G3DA 3LQ5A 3E92A 2XCHA 4I93A 3SXSA 4GFGA 2YFXA 5FTOA 3NW5A 4F9BA 3PG1A 4YMJA 1T45A 3MFTA 3NW7A 4GK3A 4YTIA 5IQDA 4ZP5A 5E9EA 2QOHA 3F69A 3R22A 4F4PA 3G0FA 3BHTA 3NGAA 3N9XA 5DH3A 3JPVA 3FHRA 4KD1A 2BFYA 4RQVA 2VNWA 3CTJA 3NX8A 4BKZA 2R5TA 3KXNA 3CD3A 5ANDA 3BHVA 4RX7A 4E4MA 4C38A 3PA5A 4IX3A 4W8EA 2X2MA 2PVKA 4QMLA 3Q9ZA 5F4NA 3PXYA 1EH4A 2VD5A 2B4SB 3D2KA 4FKRA 2PHKA 3BV3A 4ANLA 4DEEA 3HRFA 5AV1A
chains in the Genus database with same CATH superfamily
2OK1A 3CTQA 3R1NA 1R39A 4E20A 2LAVA 2R3GA 2X6DA 2F49A 1PXNA 3LPBA 5CEQA 4RA5A 1LP4A 3HZTA 5HEZA 2X0OA 4MXCA 4ZTRA 3LXLA 4CMUA 3EOCA 2QU6A 4ITHA 4KKHA 4DAWA 4EH8A 2W05A 3KREA 2I40A 3NUYA 3RAKA 4FKGA 4I3ZA 2F4JA 4P5QA 4YLKA 3KRLA 5LVNA 4L7FA 3UDTA 4RX9A 2UW7A 1E1VA 3PA4A 4R5YA 3QD4A 3E8CA 4CTBA 3TZMA 5C27A 1WBSA 3S00A 4D55A 5BMSA 3AC1A 3HV5A 3FQHA 3VHKA 1XH7A 3ACKA 1F5QA 3GP0A 3QZGA 4RIYB 4XG2A 3L1SA 5FEDA 4DLJA 4FZ6A 2CNQA 5HU9A 4L3LA 2F57A 3KMWA 3KCFA 4EOQA 4XV9A 2X4ZA 4AXEA 5KMLA 1IAJA 2YIQA 2HYYA 4X0MA 4IB1A 3KB7A 4CLIA 4FEWA 1W98A 4AFEA 1OMWA 4F7SA 3AKKA 2X9EA 1J1BA 3ROCA 1MRUA 1ZMUA 4MD9E 4IZAA 3NLBA 4I94A 3F7WA 3DTCA 1G8SA 5TKDA 3I0QA 2YM6A 3PXZA 2WIHA 4RZVA 3VBQA 4PDYA 3IOKA 3EQPA 3WBLA 3WIGA 3RK7A 3LMIA 3KVWA 4MWHA 4XP0A 4AGCA 4AZWA 3QTWA 3O71A 4FTUA 4ZJIA 3ORXA 2OGVA 4KABA 4HJOA 4NM3A 4RGJA 3SXRA 4UN0C 1JBPE 2C5YA 3VS4A 2DUVA 3VWAA 2CDZA 3LCTA 5B2LA 3QD0A 3V5WA 4UWBA 3NUNA 4WUAA 4HYIA 4N57A 3KU2A 3SOCA 1RE8A 4AT3A 3E8NA 3QZIA 3DAJA 4MH7A 5E8UA 4MK0A 3RVGA 2PE2A 3BGQA 4WNPA 3V6SA 2HZIA 4IB3A 1XO2B 3ZFYA 1F3MC 4JG7A 2PMOX 3MPTA 3MY5A 1K2PA 1QPCA 3PJ8A 4U9AA 4XP2A 2YM7A 5L8KA 5LJJA 4AXFA 4JNWA 1DS5A 3F5XA 4I5PA 5E90A 3DXNA 2JDSA 2F2UA 3Q4TA 5LXMA 4J97A 4UMPA 5IEYA 4B8LA 4MXXA 3F3ZA 3ZUVA 3W0SA 4HYUA 4IDVA 3Q4UA 3RZFA 3TZ7A 3Q60A 1OKWA 3GUBA 4QP4A 3COMA 4GYGA 3BQRA 3LFDA 4BDFA 1YW2A 4FIIA 5AP4A 4CSVA 4ZZOA 3D14A 4FF8A 3ZLXA 3ZFXA 3GFWA 1GOLA 4IJPA 1KE7A 2WU6A 5AM7A 3KEXA 3SQQA 4WD5A 1WVYA 1H1RA 2C5VA 3D2IA 4M0YA 2X2LA 4FSQA 5M08A 3AKJA 2WNTA 5D1JA 3ZTXA 3ZDIA 2X0QA 3QRIA 5EQYA 4Z9LA 5HGIA 4QMNA 3R2YA 3G33A 4FL2A 3EWHA 5J7HA 3FYKX 3EHAA 3V8SA 4O84A 2RFNA 3BEGA 2OSCA 3R7OA 1UNLA 2IWIA 3GC0A 3OZ6A 3DZQA 5IG1A 3H0YA 1KSWA 4PV0A 2PVYA 3KXGA 3O7LB 2WTWA 1H1QA 3Q6WA 1CSNA 3BU5A 2PY3A 4QYGA 3I6WA 4FTTA 5ETAA 4M66A 4TYHB 1PYXA 2VWXA 4RPVA 4CFNA 4U8ZA 1SYKA 3MY0A 3ZEWA 4FC0A 3C4EA 1G3NA 4I4EA 5I9YA 1A9UA 2W1HA 1YOJA 2DWBA 4AZVA 2W1EA 3I60A 3PFQA 4D0XA 4Y72A 4YHTA 3BGZA 3B8QA 2UW0A 3OWJA 4OTFA 4Y5QA 2ETMA 2J7TA 3R9OA 5EW3A 4E26A 2Z7QA 3F2AA 4AGDA 4TWCA 2GNHA 2OF4A 5GZAA 1OM1A 3U9CA 3DBFA 3BYMA 3MFSA 4R77A 3W18A 4L8MA 3DTWA 5ANIA 3W2PA 1PYEA 4IC7A 2I1MA 4F99A 2VTSA 3HL7A 3DXQA 3P7BA 5HO8A 5AAEA 4E73A 3C5IA 2HOGA 5B0XA 4D2TA 4FRFA 4RVMA 3M1SA 2FSMX 1FVRA 3KXHA 1GY3A 3R02A 4WSYA 4AOJA 2PYWA 4NYEA 3I5ZA 3EN9A 5CF4A 5M4IA 3EQRA 3HNGA 1HCKA 2CHLA 4IWPA 4F0IA 4D9UA 4YZBA 2OZAA 1TZDA 2XRWA 3AMYA 5DE2A 1MRVA 4RQKA 2VTAA 3TDVA 5I5ZA 4MUQA 3FZOA 4IB5A 4M0ZA 5BVEA 3PXFA 3FMEA 5J7BA 1FINA 3IK3A 3W2OA 3RCDA 4Y95A 3UYTA 4PUZA 2W99B 1TQIA 5CY3A 5AM6A 5TE0A 3ZXZA 5CAOA 4XBUA 2EXCX 2QD9A 4USFA 2FA2A 4GK2A 4OTQA 2JGZA 5L6WL 2PU8A 1WVXA 3EIDA 5HBEA 4BDGA 2QO9A 2ZB0A 2J0LA 2RFSA 3PVWA 4ZLYA 5CEIA 4RJ8A 5J95A 4C4EA 5DLSA 2R3IA 4NTSA 4U42A 3RWQA 4HGLA 4KS8A 2ITVA 4DH3A 5JK3A 2DS1A 4RWJA 4RJ3A 4KAOA 2A27A 4YNOA 2OZOA 1CTPE 3NNVA 3D15A 3FE3A 4GS6A 4JQ8A 4KIQA 3MBLA 2FYSA 4ZTMA 1LR4A 3BKBA 3RPVA 2QKRA 3QU0A 3OXTA 3LFQA 3JXWA 3OW3A 4O2ZA 4QDEA 1CKJA 5L8LA 3ALNA 2WMRA 4M69A 4NW6A 2ZVAA 2WQEA 2VTJA 4BB4A 5FBOA 2EU9A 4OGRA 4QEBA 4BCPA 3BU3A 4MNEB 5JMSA 4EL9A 3PLAE 4FX3A 2R3NA 2B1PA 3RK9A 1OGYA 5DBXA 5HG5A 2ZV7A 4AE6A 5HE1A 5JZJA 4BCGA 2VWWA 2UW9A 5JGBA 4F65A 4AZFA 5E8ZA 4CCBA 5JQ8A 2E9UA 1U4DA 3MFUA 4KIPA 2WMVA 4CFVA 3H0ZA 5CNNA 5CSXA 3V01A 3DFAA 2VWIA 4HYSA 4X3FA 4LOPA 4BDAA 3EFLA 2BRGA 4D4RA 3DXPA 1V1KA 3HYHA 3RAHA 4DHZA 4K2RA 2C0IA 4YC8A 5CZIA 4EJNA 4CYIA 4F0GA 4UXQA 3W0PA 2VV9A 4OAVB 1PJKA 2ITTA 3TIYA 3FLWA 2A98A 2XNOA 4ZSGA 3KULA 3ZCLA 1Y6AA 5ANJA 4F1TA 3JY0A 5C8NA 5LWNA 4I5MA 5BMMA 5B7VA 5BNJA 2ETKA 3UJGA 3FHIA 4QPSA 4IX5A 5AP2A 3U54A 2XIRA 4WKQA 3MB6A 4DGLC 4CYJA 5HIEA 2FUMA 4FIHA 1PMEA 4J1RA 1BX6A 4KS7A 4EC8A 2EWAA 5IQHA 2P2HA 5CAVA 2YIWA 4LV7A 3R8VA 4PMTA 3U4UA 3TM0A 3EKKA 4BGQA 2UZNA 3NZ0A 1JSUA 1YXXA 2ITUA 3FKOA 3KXMA 4HGEA 4AGWA 5BPYA 2ITXA 3PVGA 4BKYA 3KN5A 3T3UA 3KN6A 1Q3WA 3O50A 1XBBA 3VS0A 1Y57A 5DNRA 1TFFA 3HRBA 3R0TA 2X2KA 2IG7A 4HCVA 2UW5A 3FMKA 3DNEA 3RTPA 3K2LA 3U6HA 4H3QA 5DOSA 5H8EA 2HIWA 2R7IA 2XNBA 4QP2A 4O96A 5EDPA 3ZC5A 3ZO2A 4BL1A 4DG3E 4O81A 3PSDA 4TKSA 3EQIA 2IJMA 2VTIA 4BDHA 4QPAA 1U59A 4U44A 4ACCA 1YKRA 2C6DA 2QONA 4I6BA 1L8TA 3KGAA 5AFVA 4ID7A 4NCTC 4FNXA 4GYIA 4KA3A 2GS7A 2QURA 3HV4A 3TKUA 4U5JA 4CNHA 3FLSA 1BKXA 1UV5A 2XIXA 3E3BX 4A06A 4WNOA 3CBLA 2REIA 2W5AA 3WOWA 3PRIA 5AX3A 3R7YA 3EZRA 2W1IA 3K5UA 3JVRA 5I3RA 4H3PA 5AR8A 4M68A 3R7EA 3VW8A 2VAGA 2C6TA 1R1WA 3FZPA 4J53A 2QU5A 3QUPA 4FT0A 4IC8A 5ANGA 3FMMA 3SGCA 4U97A 5C03A 1H0VA 1J7IA 2JKOA 3QC4A 4EONA 4FG8A 4L43A 3SG9A 3ZHPC 5ITAA 3R7UA 1OL7A 3VS1A 3RCJA 4PDPA 3WZEA 4DFLA 3W2CA 5JGDA 2BTSA 2WOTA 3P5JC 3UOJA 1KE8A 2E9OA 2NRUA 4WBBB 2WQOA 3E62A 4NU1A 3A60A 4D1SA 4F9YA 5HLWA 1U54B 3EN7A 4M12A 1YRPA 2WTIA 4G2FA 1G8JA 4CFFA 5CAPA 2A2AA 4QD6A 1YI4A 4ZIMA 2ITWA 4BHZA 4O0VA 4CMOA 4PF4A 3FJQE 2R3OA 2JDOA 2VX1A 5J9LA 3NPCA 3PXRA 2XIZA 3D9VA 3LHJA 3DPKA 4K1BA 3WZJA 1Q5KA 2QHMA 4P5ZA 5EDQA 1OVEA 3EN4A 1GNGA 5FTQA 3DJ7A 4C3FA 3PP1A 4E5AX 1ZYCA 2C68A 3R9HA 3QQFA 2HZNA 4L42A 2J2IB 3BHHA 4GG5A 3UOLA 2VTTA 3R7GA 4LMUA 4BGHA 2VNYA 4KNBA 3Q4ZA 2YM8A 4XNEA 5AMNA 4FKJA 1URWA 4F6WA 3S0OA 4O6EA 4XG6A 3OY1A 3U4WA 4CFUA 4XV2A 2VTHA 4QMQA 5AV4A 4FSWA 2CNVA 5AV3A 3C5UA 3ORLA 4D5KA 4TTHB 2P2IA 3HDMA 4YUQA 5EM8A 3WZUA 5IU2A 4KIKB 3TMOA 3TKHA 4LM5A 3G90X 5ACBC 1O6LA 5HE0A 1PW2A 3FI2A 5AUYA 1ZZ2A 3C1XA 3PY3A 4Y85A 3RPSA 2XANA 1GZKA 5TF9A 4QMSA 3DQWA 4BCQA 3FMDA 3HUCA 5E4HA 2F7XE 2PVJA 4BI2A 4PMMA 1WBTA 2OF2A 1YOLA 5JFWA 2PVLA 2Z2WA 5KMKA 4G16A 2O0UA 3UMXA 2ZM3A 2PWLA 2KULA 3A7JA 4BCKA 4EUTA 2JAMA 4AN2A 2G01A 3W8LA 2C6KA 2JKMA 3C13A 3OOMA 4AS0A 4KRCA 4BTMA 4O83A 4DC2A 4ZY6A 4QMMA 2J0JA 4ZSAA 4JDIA 3AMBA 4AW1A 1REJA 2VTQA 3SX9A 5C26A 3FC1X 4RVLA 2YIXA 3P9JA 3LZBA 4GMYA 4QMTA 3EFWA 4AOIA 4E4LA 1LUFA 2X7FA 3HV7A 3LXKA 1WBVA 3G0EA 2BTRA 3F61A 4TNDA 5CF6A 5J1VA 1Q99A 1FQ1B 4EH4A 2QOIA 3HP2A 3OMVA 4AFJA 4DFUA 4PL4A 4TRLA 2X39A 3PE2A 4JRNA 4XUFA 3R30A 4DH8A 3F6XA 5ICPA 1WFCA 4YR8A 1PXMA 4GJ2A 5EM5A 5HNBA 3W0OA 4MWIA 4R1YA 2HW7A 4O0RA 4ZY4A 4FZAB 4WBOA 3FKNA 4P2KA 4D4SA 2UW3A 3R8MA 1PXIA 3S3IA 2GHGA 3ENHA 2IZSA 3FL5A 4FV1A 4YSJA 4I41A 1M52A 2NPQA 2XYUA 4JVGA 4GKIA 4OT5A 4L3JA 5KMNA 3CD8A 1OUKA 3AG9A 4RJ7A 3PSBA 3LCKA 5IH5A 3Q2JA 3GC7A 4QP6A 4YO6A 3PZEA 2PMNX 5IMEA 3IPHA 5DFPA 5EW8A 1H08A 4FKUA 4J52A 4RVKA 4L44A 5FUTA 4D58A 4YJSA 3CQEA 3EQHA 2WTKB 4MYGA 3AC4A 4JBVA 2BZHB 4G6OA 2XK8A 4O22A 3ORTA 5LOHA 4FMQA 4DH7A 3OT8A 4ZS0A 3W0QA 2EXEA 1I44A 3P1AA 1ZMWA 3GQLA 3HMMA 2C0OA 4RX5A 5I0BA 4WG5A 3W16A 3CLYA 3U6JA 4KBKA 2OWBA 3RWPA 4YPSA 2XK4A 3A2CA 4K0YA 3ZSHA 2GCDA 4IW0A 4NFMA 5LMBA 2WMAA 5DT4A 4HZSA 4AE9A 3LW0A 1IRKA 3R9RA 2PZ5A 2XM8A 4EOMA 1Y91A 5BYYA 2Z7LA 2IVUA 2CCHA 5KKRB 3RM7A 4WT6A 3QTXA 1W8CA 2C4GA 3VBVA 3AGMA 4UWCA 3ZBXA 3CJFA 5IDPA 5K0KA 3R7IA 5AR3A 1OGUA 3LXPA 4C7TA 4F7JA 2CGWA 4FV9A 3ZO3A 4F78A 3PRFA 4ASXA 5CI7A 1F0QA 3QX4A 4BR3A 4FKQA 2VO6A 3VUTA 2XYNA 5AWMA 4NT4A 4AACA 4DEBA 4TL0A 3BLRA 3CKXA 2GQSA 3I7CA 4AX8A 2UVXA 2PVNA 1YHVA 1HCLA 2EXMA 4BDKA 5HNIX 3BYVA 2PUPA 1K3AA 4ANSA 3I79A 3DDQA 4G34A 4GK4A 4QYHA 4NM7A 1J7UA 4X2JA 3GCPA 2XEYA 5AIKA 5M55A 4HVHA 1J3HA 1YXUA 3T9TA 3SC1A 4BCJA 4J96A 4O4BB 4ALWA 5GNKA 4BCFA 3N4TA 3KC3A 5J87A 1WBNA 2R4BA 1QPJA 4MVFA 3GGFA 5EW9A 4AA0A 3VS2A 5EM6A 3DU8A 5EKOA 4E6AA 2GSFA 2G2IA 2ZMCA 5EI2A 4G6NA 1UU8A 4LYNA 3ZFMA 3QD2B 3ZO4A 5M57A 4XBRA 3ZOSA 3BLHA 3KA0A 3MSSA 4CQGA 3PZHA 3C4ZA 3NNUA 4ZEGA 4DEHA 5FTGA 4HW7A 3VBTA 4GT5A 1Q24A 5IH4A 2KTYA 2J4ZA 2WHBA 1FMOE 4QOXA 4II5A 3C50A 4V01A 2YEXA 3FWQA 3SA0A 2YZLA 4FKVA 3W2QA 3ZLYA 2R3HA 2P3GX 3GVUA 3OWPA 4LRJA 4TYIA 3QRUA 4EHVA 3DV3A 1OPLA 3WE4A 5CVFA 3SRVA 4V0GA 4FZ7A 3MH0A 4DN5A 5CSPA 1YWNA 3FI4A 4E7WA 2XIKA 5IEXA 4PTEA 2GNIA 3FMLA 4XG7A 5A4TA 3ZO1A 1IG1A 4ZLOA 2VRXA 2OFVA 5AUUA 5CALA 2X9FA 2YWVA 4QDVA 4F9WA 2XA4A 3ANQA 3PJ2A 4HYHA 4NUSA 4D9TA 3POOA 3GQIA 1ZZLA 3NYVA 3H9OA 4QMXA 5G1XA 4FTKA 3CR0A 1HOWA 4H36A 4L67A 4NM0A 2ZV2A 4S34A 3VJOA 1FVVA 4TN6A 4Z55A 2C6IA 2IVVA 3ORKA 3MESA 2HY0A 2J9MA 3GU8A 3MDYA 4R7IA 2JDRA 1V0OA 5HU3A 3C4XA 3CQWA 2YDIA 1KOBA 4O4EA 4JR3A 3D5UA 2H9VA 1OKZA 2JBOA 1MRYA 3R01A 4DEAA 5KHXA 3DZOA 5JH6A 5DT0A 4C59A 4F64A 3LVPA 5HE2A 3MV5A 3UOKA 3UBDA 2XAMA 2W4JA 2JAVA 2RIOA 4IANA 3UO5A 3KF4A 1B39A 3AC2A 1PRYA 3A4PA 5HIBA 3QA0A 3VUDA 4E1ZA 5L3AA 2VZ6A 4RSSA 1NA7A 3R21A 3EL7A 4N6ZA 4E3CA 4AT5A 1OKYA 3NIEA 1J1CA 5AAGA 3W0MA 2XBJA 2VWYA 4NFNA 2VGPA 4IZYA 1XBAA 2YN8A 3V04A 4USEA 4CRSA 1WBWA 3MW1A 4FK6A 3O8UA 2UW8A 3GXLA 3R8LA 3VJNA 3UP2A 3EB0A 4KBCA 4BBEA 1NT2A 2UZEA 4Z3VA 2G15A 1SZMA 5ETIA 4BHNA 4EK4A 1QPEA 4JIAA 3ZH8A 1UNHA 2NO3A 3VUGA 4PTGA 4IM0A 5FM2A 3ITZA 3BE2A 3OW4A 4MKCA 4RWIA 3HMOA 4A9TA 3LCSA 1W2FA 3ATSA 1ZY4A 1IR3A 4YJUA 2R64A 5EYKA 3FMJA 4LFIA 4GFOA 4UX9A 3NUAA 5FXSA 5FXRA 4NTTA 2F9GA 1JVPP 3KVXA 4BCIA 2Q83A 2UW6A 2GMXA 2GNLA 4RIXA 3E93A 2VTLA 4E8AA 4EZ5A 2PVFA 1PMVA 2XEZA 1KWPA 5CVHA 3ZC6A 2CKOA 2CGVA 4RWLA 3CSVA 4AG8A 4QMUA 5LCKA 4M97A 2VTPA 1IASA 2W0JA 4ITJA 4XCUA 5AUXA 4FL3A 3UMWA 1KOAA 2BIKB 3ZZEA 5EG3A 3B2WA 4FEUA 3F88A 4AF3A 3ML1A 4DH5A 1P4OA 4YLJA 2IZUA 4GVAA 2ETRA 3MJ1A 4FIEA 2PZPA 4I92A 4KB8A 5CI6A 5AP7A 4APPA 4AW5A 2QLQA 4UB7A 1GIHA 4BIDA 4DEDA 1IAHA 3L8PA 2BPMA 4FTNA 4MQ1A 4O0WA 4ERKA 2RG6A 4XH6A 1ZARA 2QOQA 1OIQA 3MB7A 4FKSA 4YLLA 3V6RA 4ARKA 5DGZA 5CEPA 2PVMA 2WMWA 3PG3A 3KRXA 2O64A 2RF9A 4GU6A 3UGCA 5LMKA 2GQGA 4FKPA 4KWPA 3UVPA 2BUJA 5BUIA 3FI3A 4AQKA 1XHAA 2RSVA 4GUBA 4BDJA 3JVSA 4IIRA 2ITYA 5KE0A 4OTWA 1PKDA 1JOWB 3F9NA 3PA3A 5GJGA 4RC3A 5EYCA 4U79A 5HQ0A 4EBVA 4IVBA 3GENA 3EN6A 3WYYA 3DB8A 3PPZA 4B6LA 3PWDA 4BI0A 2GHMA 2Y0AA 3A4OX 3DKGA 3FY0A 4RG0A 5IDNA 4OT6A 4NKAA 3R7VA 4DCEA 3TUCA 3TV7A 3U55A 4AXAA 3FPMA 4LUEA 4ANOA 3LM5A 3COHA 5JFXA 2BVAA 1XH9A 1ZYDA 2IEWA 3F5PA 2R3RA 4XOYA 4LGGA 3H9RA 3A7FA 1ZMVA 5ANOA 4AUAA 3OUNB 2BZKB 3QCQA 4GRBA 4W9WA 5D10A 5AP0A 2YCQA 2XALA 1ZLTA 3QAME 4C2WA 2QG5A 2OXXA 4M13A 3CTHA 4NKSA 4RC2A 4A4LA 1WBOA 4C35A 2Y8OA 3WI6A 4O1OA 3MH2A 3Q5ZA 3UYSA 2FB8A 3C4WA 3EYHA 4FIGA 1P2AA 1FMKA 3ODYX 2JDVA 4XV3A 4USDA 3AOXA 3EZVA 4XMOA 4JG8A 2VO7A 4C4HA 2OZAB 4C2VA 5GIOE 1SM2A 2BZIB 3MVMA 4LOQA 3WZDA 1OPKA 2BCJA 2GS2A 2WFYA 3QXOA 4X7QA 3RGFA 2JBPA 2X7OA 3UE4A 3WF7A 4DGMA 4F08A 2CCIA 1WVWA 2X7GA 2XK3A 2H34A 4O7SA 3S95A 5EYDA 4XLIA 4JLCA 2QO7A 5HVJA 1R0PA 1M2RA 2OH0E 4K77A 3LJ0A 3NYXA 2R0UA 5CEKA 2R3LA 3VAPA 3OROA 3ZRLA 3TNHA 1YXVA 4FT5A 4LGHA 4WHZA 2W9FB 3IDPA 3IO7A 5DN3A 4G3FA 4ITIA 4BDEA 1QL6A 3PVUA 5CASA 4BI1A 3LFSA 4CTCA 2JKKA 4I6FA 5EDRA 5FBNC 2CSNA 3QZFA 3VS3A 5HVYA 3BCEA 2UZBA 3TZ9A 4UEUA 1H28A 4Q9ZA 3MIAA 1IEPA 4GL9A 3HMNA 4O4FA 4A7CA 4O0YA 4C3RA 4E4NA 2BMCA 4YTHA 3R2BA 4ZLZA 4GG7A 4JDHA 2V7OA 3KRJA 5DR9A 1Q4LA 5L2IA 3GFEA 3DKOA 2B7AA 4DDIA 3N4VA 2OJFE 4M69B 5IMXA 4R8QA 4ZTQA 5BVWA 3RP9A 3WILA 4S2ZA 3NNXA 4ZJJA 3E88A 3ET7A 3CEKA 3NUUA 3O0GA 4IM3A 4KKEA 5IA4A 3UZTA 4FTIA 2JIIA 3LKMA 3V8WA 3EH9A 2OH4A 4QTBA 3QKLA 2WTJA 5T6KA 4FR4A 3OWLA 4X6QC 4AAYA 4O82A 2WTKC 4GKHA 1PXLA 3O8PA 4JQ7A 3D7TA 4UMQA 4XRJA 4G9RA 5DHJA 5FRIA 4BBMA 4IAYA 4FSMA 4D5HA 5GINE 2PUNA 3MJ2A 1JKSA 4TYJA 4X3FB 5AP6A 3C7QA 4R1VA 2ITZA 3A7HA 2CNUA 1JKKA 4DHJA 3ENMA 1A06A 4RJ5A 4Y46A 2OG8A 4ZMEA 2FGIA 5JRSA 4DFNA 4EWQA 1DI9A 4XJ0A 3Q32A 2B54A 4M8TA 3C4CA 1PF8A 3KULB 4FGRA 2XB7A 2X8IA 1Q97A 3QTQA 4FTAA 4PPBA 5HG7A 5I9VA 3HX4A 3L8SA 3OCTA 1GAGA 2W1FA 4W4WA 4XG3A 4AN9A 5AA9A 5HTBA 4TWNA 4BCHA 3VBWA 5KKRC 5E92A 3PJ3A 4D28A 2BKKA 2ZMDA 4EUUA 4TXCA 5HTCA 4QTDA 2QOKA 1VZOA 2X8EA 3OG7A 1UNGA 3UZPA 2R3JA 3TUDA 1GJOA 2ONLC 5A4EA 4YZNA 4DLIA 3V5LA 3EQGA 4I21A 4PPCA 5FGKA 4BY9E 1VYZA 5H8BA 3ZYAA 5C8MA 4KIOA 3FSKA 3H9FA 3R9NA 1OITA 5TR6A 3MWUA 3GU6A 4AN3A 4QP1A 4XV1A 2BAKA 4C62A 4WO5A 3BEAA 4N70A 5BV3A 4ZMFA 3AT3A 4FT3A 5GZ8A 3NCZA 5EKNA 4QP9A 3CE3A 4YZ9A 2BIYA 3VS6A 5JT2A 4O1PA 1H4LA 2PVHA 5A4CA 3IOPA 4QO9A 3PUFC 2C6EA 5CXZA 5AR7A 3CS9A 4Q2AA 3L9MA 1H0WA 3DBCA 1E9HA 2PMIA 3QHRA 3CC6A 4Y5HA 1B6CB 5KZ0A 4JXFA 3OCGA 3R8ZA 2GNGA 2GHLA 1V0PA 3RKBA 2P55A 5AV2A 3DOGA 3H4JA 4O21A 4X21A 4BZNA 3DDPA 3A7GA 4QT1A 1S9JA 2QVSE 4HCTA 2C47A 3MI9A 4TWPA 5DRBA 3DA6A 2WAJA 4MEDA 5CEMA 4IH8A 4EH6A 4FUYA 5C01A 4LUDA 5HICA 2QI8A 2OJ9A 4FVPA 4IJ9A 3W8QA 3BBWA 5JSMA 2CKQA 4I24A 2ITOA 4BKJA 1AD5A 4BBFA 3FV8A 3IONA 3BHYA 5A54A 2AC3A 5JKGA 2UV2A 4FKTA 4HOKA 4UWYA 4KKGA 1TKIA 4EH7A 1FGIA 4M7IA 4ZSLA 2OXYA 5J5TA 1STCE 1RDQE 4JBOA 4MBJA 2X6EA 4U7ZA 2YM5A 3H30A 5E8VA 5HCYA 4BDIA 4TZRA 3PE1A 2OJJA 5FDXA 2RGPA 4O6LA 5H8GA 5HCXA 4ZJVA 5CANA 2CLQA 1ATPE 3LFEA 3EMGA 2WMSA 3O2MA 4PY1A 4F9CA 2EB2A 3SVVA 3RALA 3CCNA 2PMLX 3FSFA 3HVCA 3OBGA 4GCJA 5CNOA 5LVLA 4A9RA 5HOAA 5J9ZA 5H9BA 2W4KA 4JOAA 4C4GA 4GFMA 1FVTA 3FAAA 3H3CA 5K5XA 3IKAA 1SNXA 5DEWA 4O38A 3RHXA 4IWDA 2W5HA 1DI8A 2Y9QA 4J95A 5FXQA 1G8KA 2JIVA 2GQRA 5IUGA 4FV4A 3V51A 3PUPA 4ZXTA 4AQCA 4Q9SA 4CT1A 3QCXA 1URCA 2E9NA 3COIA 3GCVA 4OR5A 3BLQA 5E8SA 5HO7A 3B8RA 4FTQA 1R78A 4FTRA 2B9IA 3Q6UA 4LG4A 2FVDA 5IQIA 3FLNC 4O0TA 2B9FA 3D5VA 2CPKE 4GJ3A 3V5JA 5BVNA 5IPJA 2IF8A 3UQGA 2B55A 3RPRA 2C0TA 3LOKA 4HVDA 3EFJA 3QCYA 4I0TA 1NXKA 2BALA 2YITA 1Q8ZA 5DWRA 3QGYA 5AUVA 4ACGA 4NIFA 3RNYA 2C5XA 3OWKA 3T3VA 3L9PA 3DLZA 3GNIB 2X4FA 1TQPA 5L2TA 3QHWA 4MAOA 4M14A 4R3RA 4IQ6A 4OTRA 5M56A 2QNJA 4BWXA 3P78A 2YIYA 4A4XA 2OO8X 5E8WA 3TNIA 2BRMA 4QMPA 4BGGA 4XHKB 4LV8A 4ACHA 3DNDA 1ZRZA 4A9UA 5FDPA 1YI6A 4MXYA 1QCFA 1TVOA 2XVDA 4L3PA 2OXDA 4K9YA 4E5WA 3BV2A 3F7ZA 5BQ0A 2HELA 4QNYA 2PZIA 5HD4A 2UZLA 2V7AA 3KRRA 4JI9A 3TKIA 3JUHA 3V3VA 2W1CA 2Y6OA 3RK5A 3FI8A 3ZS5A 4IAAA 4ASZA 4L01A 4FTOA 2BAJA 3FZSA 4CFXA 3RHKA 2XNMA 3UC4A 4AA4A 4YO4A 3NW6A 3BGPA 3BLAA 2W1DA 3UDZA 4DEGA 4ZTSA 1GIJA 4OTDA 4GU9A 5HKMA 3BELA