1BL7A

The complex structure of the map kinase p38/sb220025
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MAP KINASE P38)
publication title Structural basis of inhibitor selectivity in MAP kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bl7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bl7A01
2XKEA 3GC0A 3P78A 4GG5A 3ET7A 5E92A 4D55A 2SRCA 2UW8A 3L9MA 3R7IA 3CS9A 4NUSA 4ACMA 4M12A 3RAHA 3GCUA 4A9UA 2GNGA 4TN6A 3VUGA 4IVDA 4YP8A 5J8IA 3EZRA 2B0QA 4KB8A 2V22A 2W5HA 2C0TA 3H9OA 3C9WA 4W9WA 2PYWA 2O5KA 1WBOA 2VWXA 4BDEA 4HVIA 2B55A 4IAYA 1KV2A 4QP7A 3UOHA 3PLAE 4G31A 3MTFA 1V0PA 2BZJA 5M07A 3QTIA 4DFYA 5CQWA 2BHHA 3VHEA 2WTDA 3FZ1A 3UVQA 4FV9A 5HZNA 1TQIA 2VTIA 5ANJA 4DLIA 4EH6A 2R3FA 2ZB0A 3NLBA 4F6SA 3LQ3A 2OJIA 3DKCA 2H8HA 4QMSA 5HBHA 2R3LA 2PZ5A 2YAAA 4FEQA 3NMUF 4IIRA 4AGUA 2WMUA 4ZTNA 5AIKA 3MY5A 4F1OA 4UMQA 2C47A 2VV9A 4I0TA 4J99A 5C4KA 3FXXA 3CJGA 3FMDA 3ENHA 5KUPA 4XOZA 5AJQA 2WQEA 4YJPA 1YDRE 2HZIA 4RWLA 4TZRA 4QMNA 5JZJA 3FI4A 3VBWA 4KRDA 2KULA 3CGFA 4C59A 2VNYA 2YDKA 4KKGA 3RPOA 1BL7A 4L67A 3R8PA 2B9HA 4G1WA 4UMPA 3GUBA 1VYZA 2OU7A 2WMVA 3L1SA 2QR8A 2V62A 5EFQA 1IRKA 4AS0A 4ZTMA 3FAAA 2XNGA 3WZJA 4X21A 4CTCA 4AGWA 5DVRA 4FEWA 1YRPA 3GP0A 1RW8A 4GIIA 3UO6A 3SG8A 4O0WA 1WVWA 5KMLA 1FMOE 1U46A 4ZSJA 3E63A 3D4QA 5AX9A 1URCA 2VWVA 5AM7A 5EYMA 4FV5A 3A99A 2W1DA 4I6HA 5FG8A 3VW6A 4GVJA 4HZRA 1FINA 1ERKA 2WU6A 4FT7A 4YLKA 5CAQA 3H4JA 1OGUA 4QP9A 5H9BA 3ZUTA 3GENA 1O9UA 4MYGA 4L53A 4QP3A 1YVJA 2XA4A 5K4IA 4I0RA 3DAKA 4FSUA 5EHOA 4C61A 3RAWA 3BLRA 5CT7A 5A4EA 5IQFA 4LOOA 5H8GA 3TJCA 5K0KA 5TR6A 5AUUA 2FO0A 5FGKA 3UVRA 5CEMA 3DJ6A 3EKKA 4WIHA 2Y4PA 2GQGA 3DZOA 5AA9A 4S34A 3NUAA 4MXCA 4LMUA 5L2WA 1U54A 2F7EE 5BUEA 4ZTQA 2JIUA 2UZOA 3SC1A 4YO6A 2W1FA 5CAUA 4RIOA 3RM7A 3C0GA 2EB3A 1V0OA 1XH8A 3F3ZA 5TKDA 2WEIA 2YJRA 2ZV2A 1IAJA 3KU2A 3POOA 3PWDA 4FTMA 1RE8A 4CYJA 3D7TB 2O0UA 2FB8A 3MVMA 3QZIA 2XK4A 3ZO1A 5A54A 5LMKC 1TQMA 4NM3A 5KMIA 2OK1A 3VIDA 4FKQA 5ANEA 3DLZA 1Q97A 4D0WA 2WHBA 2PL0A 3ATSA 3O23A 2R0IA 2X2KA 5FBNC 3RPRA 2BTRA 5HTIA 2UV2A 4QD6A 5IEYA 1R0EA 2X2LA 2FSLX 3VW8A 4O6EA 2OIQA 2WTVA 4AFJA 4DEHA 5BPYA 3BBTB 4GS6A 1M7QA 4YJSA 4EC9A 2DQ7X 3UMWA 1FVVA 4E7WA 2IZUA 1FGIA 3AXWA 1R3CA 4KBKA 2F9GA 2OKRA 4IVBA 2PK9A 4EOPA 4QYGA 4OTDA 2E9OA 2VTAA 5E8YA 4I0SA 4XX9A 4QTCA 1Q8ZA 4JRVA 2WMAA 1K9AA 1ZMWA 3NCZA 4HJOA 3FQHA 4IJPA 2JFMA 4PMSA 2PVHA 1IA9A 4G5PA 5DE2A 2ZDTA 3GOKA 3OY3A 2B52A 2RFSA 3KULA 5AV2A 4YURA 4M14A 3D5WA 2UZEA 3BU5A 4FZ7A 2HK5A 2R4BA 4F6UA 5CU4A 1H28A 3QC4A 4YHFA 4JNWA 2QVSE 4AGCA 3F5PA 3OFMA 2J0JA 1JWHA 4BKYA 5HICA 2WTKB 2HZNA 1XJDA 3I5ZA 4Z9LA 5FP6A 3W8LA 4JAIA 5HO6A 3I5NA 4FNYA 4BL1A 5E8VA 4EOJA 5LXMA 2R3QA 4C58A 3KQ7A 4NZWB 4PPBA 4RFZA 3TTIA 5IMEA 3CTJA 4OTRA 3IPHA 3V04A 5BQ0A 3HMNA 4ZSLA 3CIKA 3QUDA 3R2YA 2YDJA 2I0HA 4YZNA 3IQ7A 4B7TA 3QUEA 4I92A 4ACCA 2PSQA 3ZRLA 2IVVA 3DB6A 3HECA 4WNPA 3OXIA 3TJDA 4ANQA 3R04A 3QGYA 5IUIA 5C27A 5ACKA 5IQAA 5IUHA 4ZSAA 3F5UA 1MUOA 4RVTA 4S31A 2WTKC 2WMTA 2BRNA 2PVFA 1H24A 3PVUA 4L42A 2PZPA 5HOAA 1WCCA 3U6JA 2OF4A 3BHVA 5IMXA 2BIYA 2X6DA 4ITHA 5AR5A 3VUMA 4DEDA 4YJVA 4EH8A 5JFSA 3TV6A 4BWPA 3HP2A 4OTPA 4QYFA 3E8EA 4RPVA 1H0WA 2VGOA 3GU8A 4JVGA 5C01A 2CKQA 5CWZA 5L2IA 4ZTRA 4F70A 4NSTA 5IISA 4WA9A 4QMZA 3WF5A 4HYIA 1ZARA 2RFEA 3BHHA 3KKVA 4IZYA 4PTEA 3C0HA 3NW5A 4MNEB 4YPSA 3RBWA 5EDPA 3NNUA 3DA6A 4JR3A 4MXZA 4EYMA 3EFKA 4DG3E 2CLQA 3OUKA 4RMZA 2XK8A 1G8SA 2JKKA 2ITWA 4JAJA 4AZWA 4I93A 2WZJA 2X81A 3ZOSA 2NO3A 3W10A 1OPLA 3C51A 5DBXA 1UNGA 3LHJA 2CLXA 4FGRA 1H1SA 3QBNA 2CCIA 2EUFB 5EW9A 3ZMMA 3ETAA 2GS6A 2J0LA 4PUZA 3FXWA 2QOQA 2ZV8A 5HESA 4CXAA 1ZYSA 2PHKA 2R3NA 4KIOA 3TKUA 3U6IA 5GIPE 3W16A 1Y8GA 1Y57A 4LYNA 5CI6A 4R3RA 2V5QA 4AAAA 4AX8A 3OW4A 3R63A 4GT5A 1SVEA 5DMZA 3R9HA 3UG1A 4GMYA 4IZ7A 3BYOA 2UZDA 5LMKA 1J91A 2PZIA 5D12A 5E1EA 4FG9A 3QA0A 4A07A 3MH1A 4E8AA 3OROA 4JQEA 1ZRZA 5J9ZA 4IE9A 2WIPA 5AR2A 4AE6A 4BR3A 4JDKA 4L3PA 1PMEA 1H07A 3DBFA 4UXQA 3TTJA 1YWRA 5ANGA 3QKKA 3FMHA 4O0SA 4NFNA 5DEWA 2HIWA 3OP5A 1O6LA 4I5PA 2UVXA 5AP7A 4DGOA 5AP4A 5LWMA 4FK6A 4G16A 5CS6A 2P0CA 1OL7A 2B9IA 3KCFA 4FKVA 4Q9SA 4LM5A 4PNIA 4ZK5A 2WO6A 3VS3A 1Q99A 3D7TA 3HA8A 4QQTA 4FEVA 3EQFA 3LAUA 1VYWA 5I3OA 5CF8A 5L8LA 4IJ9A 4K2RA 2QQ7A 1PKGA 3CPBA 3W2OA 3ZM4A 4BIBA 1QL6A 1BLXA 2R9SA 4OAVB 1LP4A 3G0EA 4AZSA 5FEDA 3GGFA 4B99A 4U7ZA 5IU2A 5ETFA 4FKSA 3QRKA 4RLLA 4E5WA 3UBDA 4RT7A 5FTGA 3MFRA 3LJ2A 4CFWA 4O1OA 3OEZA 4BF2A 4C3RA 4FEUA 4HVGA 2Z7SA 3N9XA 2GSFA 3E5AA 1TKIA 4IWDA 3CY3A 4MF1A 4UMRA 5J5SA 5EQEA 3JY0A 2YM3A 4E6QA 3RINA 2C6EA 4PPCA 4L7FA 5CY3A 2OW3A 1KE6A 4F99A 5C8KA 3UPZA 3GU7A 2RG6A 3LLAA 5HNGA 4BBEA 5JFVA 2OI4X 2GNIA 3HYHA 4HOKA 3UO5A 5M44A 5K4JA 5IA1A 4C37A 3EHAA 3Q53A 3QCSA 1XBCA 1YXVA 1H27A 3PXRA 1BX6A 5HLNA 4A9SA 3LE6A 4JQ7A 4NWMA 1FMKA 3DT1A 2VTSA 3CKWA 5CZIA 3VN9A 4FZAB 1ZYDA 4U0IA 4OTWA 3HMPA 4FSQA 1U59A 2I1MA 4JOAA 4IEBA 2BTSA 4GUBA 5EQYA 3FL5A 3T3VA 5J1WA 3GT8A 3AC3A 3FXZA 3G15A 2R3PA 3BGZA 3COMA 3DLSA 4C2WA 1P2AA 5GIOE 4ZY4A 3PFQA 5A4CA 4YR8A 3MY1A 1CMKE 2OG8A 3PVGA 2CKEA 3PJ3A 4G17A 5LVPA 3U8WA 3KK9A 1QPCA 4M13A 3UYTA 2W1ZA 4QQJA 4EOMA 4QTAA 3KRLA 3R73A 4YZDA 4FSTA 3KVXA 3GVUA 4LL5A 3S95A 3PG1A 4IAZA 2X0GA 3TZMA 3FL4A 3DGKA 3HV3A 3HX4A 4BZNA 3IW4A 2C6OA 5HNIX 2PMNX 5GZ9A 3Q9ZA 4YC6A 2R2PA 5BMMA 2ITVA 4BIEA 4O21A 4F7SA 3R30A 2GQRA 1KOAA 1IA8A 2YWPA 3A7FA 4O38A 4C4FA 3ZLYA 5KE0A 2A1AB 4KSPA 3O8UA 4I5MA 1Z5MA 3TT0A 4F9WA 2E2BA 4G2FA 2LGCA 2R3IA 2CN5A 2ERZE 2JDSA 4I20A 3C4FA 5AR4A 1OPJA 2W1EA 5AR3A 3LFQA 4X2KA 3AOXA 4MNEA 1J1BA 3EYGA 5CVFA 3U6HA 2XBAA 4GJ3A 5F4NA 1OBDA 1CSNA 1PW2A 1ZYJA 4IDVA 5ETCA 3FV8A 5M4FA 4ORKA 4OT6A 4F7NA 4USFA 3FMMA 3ORLA 5F20A 4GH2A 1U5RA 4I21A 2CNQA 3RJCA 3H0ZA 3ITZA 3ZONA 3ORZA 1H8FA 4C4EA 4CKRA 4C62A 2VX1A 4W9XA 3LCKA 5K9IA 3MN3A 4MQ2A 3E8DA 3AC4A 3AT2A 2FGIA 5E1SA 1OIUA 2QNJA 4I4FA 3O17A 2QO7A 4CYIA 3Q2JA 1PXOA 3CQUA 3W8QA 3F82A 4OTIA 1U4DA 4FV3A 5EYKA 3HUCA 4AW1A 4PY1A 5HCYA 2YCQA 5GJDA 3SA0A 3W2PA 4IAFA 3RGFA 3RHKA 2YITA 4ZZMA 1WFCA 3TXOA 3ZH8A 2YEXA 4AA5A 1FVTA 3DDQA 2Y4IB 1Y91A 5I9UA 4GYIA 4WBOA 2PZYA 2HWPA 4ERKA 2C3LA 2WB8A 3GU5A 2X8IA 3QQKA 3FYJX 3ZSIA 3PJ8A 4UY9A 4D1SA 1GJOA 4BDIA 3T9TA 2W06A 4HVHA 2QG7A 4PL5A 5ETAA 2G01A 3O8PA 5HHWA 3V5QA 1RQQA 4YJQA 5D10A 4FKGA 2A4LA 4QP2A 4C3PA 2W1HA 3C4EA 4CMTA 3I6WA 3PXFA 2BVAA 3AQVA 4KKHA 4GCJA 3BWJA 1XH7A 4M0YA 4QP4A 4TNBA 2Y4IC 5M56A 5E9EA 4NKAA 4CFMA 4BYIA 4O7YA 3OWJA 1DM2A 3CD8A 4FTOA 4K1BA 1GOLA 4XG8A 5KKRB 5L6PA 3N4VA 3GB2A 5IQDA 2WTCA 4FKPA 1J3HA 4J53A 5CSWA 4MAOA 4QMMA 4AZEA 5HG5A 3QF9A 5BUIA 2XNBA 1OITA 1CKJA 2GNFA 1XH9A 1ZZLA 4D28A 5LVNA 3QYWA 1OKWA 4EBWA 3TDWA 4RX7A 3COIA 4TYGA 3VS1A 4MD7E 5F94A 3TV7A 4G3DA 4R7BA 1DI9A 1XWSA 3TV4A 1I09A 3Q9YA 1SZMA 3IW7A 4WSQA 3F2NA 3LCDA 3FMLA 3HEGA 4M66A 2IW9A 5KKRC 1BYGA 1OECA 2AYPA 3OHTA 3RAKA 5G6VA 3HZTA 4TW9A 3KCKA 4EZ5A 2DUVA 2VWUA 4LI5A 4BTFA 3V8WA 1CM8A 4IB1A 4U81A 3NUSA 5ANOA 4PP7A 2VTLA 4F7LA 4DA5A 1QPDA 2F4JA 3DS6A 3P7BA 3CSVA 4BDFA 5I5ZA 5HNBA 3LFAA 4J7BA 4P90A 1VJYA 3HMMA 4V04A 4A4LA 4ALVA 2OJFE 3G5DA 5EM5A 3P7CA 3MVJA 2JEDA 3ENMA 4XV2A 4PMTA 2X8EA 4JS8A 1BI8A 3EQCA 1CTPE 3HRCA 4ZJVA 2ZYBA 2OZOA 2YLFA 4MNFA 3VO3A 2XNEA 2PUUA 1XQZA 4HW7A 2CJMA 3EMGA 4HCTA 4V01A 1SVGA 1WZYA 1H1PA 2OSCA 3QQHA 2BR1A 3JUHA 4A06A 4FYOA 2GQSA 2C3IB 3F7ZA 3I1AA 4H1JA 4DFNA 4IZAA 1SNXA 4IDTA 4EOQA 2PZRA 3GQIA 2YIYA 3QZFA 2BZIB 4FEXA 4WUAA 3EQRA 2VZ6A 3KXNA 4HYUA 3BPRA 2R3MA 5AP2A 5HCZA 2X7GA 3ZSGA 4JG6A 3SG9A 3C50A 4E4LA 3A61A 2Q0NA 2X6EA 5HGIA 4I6BA 3BHTA 3FI2A 4NCTC 5LWNA 4E3CA 3D5VA 4CMOA 4QMVA 4MD9E 4I94A 2C6DA 3NVKI 2JDVA 5DR9A 4Q9ZA 3RK7A 4JT3A 2X4ZA 2IJMA 1OL1A 3ODYX 3PTGA 2VAGA 2ZVAA 3DXQA 3R9RA 3H9FA 4WG4A 2RKUA 5LMAA 4M0ZA 5AWMA 2PVYA 1KOBA 3DCVA 1BI7A 3EFJA 3V8SA 4FKWA 2ZDUA 2X9FA 3IOKA 3NNVA 4FVPA 4TXCA 3QYZA 3O0GA 2G2HA 3C13A 4J95A 4XCUA 2W4JA 3DK7A 3RWQA 1PXNA 2PVKA 2UW4A 2XK3A 1YKRA 3QXOA 4FTIA 5JZNA 3A4OX 1WBNA 2XP2A 4QTBA 3UVPA 1ATPE 2R7BA 3MPTA 4RZVA 4KSQA 3ZYAA 4NT4A 2W9FB 2I0VA 4F9YA 5L2SA 4GKHA 3CY2A 3SX9A 4YZMA 3UIXA 3EL7A 3DZQA 4PX6A 3D7ZA 5KNJA 3BEGA 3CXWA 2OFUA 4AN2A 4ACDA 4EHGA 5FP5A 3RKBA 3ZO3A 3LJ0A 3E3PA 2GU8A 2P33A 4RA5A 3CQWA 1PXIA 3EFLA 3AMAA 2VX0A 4TT7A 5J7BA 5JQ5A 3W2RA 4EK6A 1ZLTA 2RGPA 1H0VA 3HMIA 2DYLA 3QQGA 2WQBA 3EKNA 3LJ1A 3I7BA 3FMNA 3V3VA 4TYJA 4IWOA 3DTCA 4JG8A 4CQEA 2WMQA 4MD8E 4MXOA 2C3KA 5GHVA 2ZMCA 1OUYA 3FMKA 3ZFMA 5EHLA 3Q4UA 3UP2A 3Q6WA 3EJ1A 4FC0A 3AMBA 4Y46A 5JRQA 3PA3A 5JK3A 2B53A 2B4SB 3VBTA 4DH7A 2ONLC 2IVUA 1Y6BA 4I4EA 3G0FA 3NYXA 3V6SA 4XV3A 4FNZA 2ITNA 1JSVA 3O71A 3LQ8A 5C03A 3WZKA 3RMFA 3QCQA 3I0QA 2I7QA 4DG0E 4M97A 4DEEA 2C0OA 1CKIA 3F6XA 4M67A 1VR2A 5JT2A 2IZRA 3FZSA 4IAIA 4QMLA 5BYYA 4DG2E 3UOJA 4ZMFA 2C1AA 3IKAA 4FTRA 3FLZA 1OL6A 2HXLA 4JJRA 2XZSA 3MVHA 3FEGA 4FODA 4FV1A 2Z02A 4IACA 3P0MA 3R22A 3TG1A 3MPMA 3OT8A 2QOOA 5HI2A 4FV2A 4LOQA 5D7VA 4BCFA 4C8BA 4DEAA 3PJ1A 2WQOA 5LVMA 3ZEPA 4O7NA 4K18A 3N51A 1Q8WA 4GVAA 4CV8A 4Y5HA 2XMYA 5CF5A 3R28A 3FMEA 2BRBA 4MKCA 3VAPA 5FXRA 2G1TA 4ANMA 2CN8A 4BBFA 5LCKA 5J5TA 5IA0A 3QRTA 1DAWA 3MFUA 4LUDA 5AV0A 4CKIA 5IPJA 3D14A 5FRIA 4EK4A 2WKMA 3SRVB 3MH2A 4EOKA 3C4ZA 3NW7A 4C4IA 5I9YA 1Q4LA 1KE9A 4FUXA 4CT1A 2KTYA 2IG7A 5HE1A 2BFXA 4XG2A 3R8ZA 3E88A 4BICA 2E9PA 3OCBA 2JITA 4BCPA 3BQRA 4LRJA 1UWJA 5C8NA 3FHIA 3RI1A 1WBWA 4JQ8A 4ZMEA 4NCTA 3V5WA 2BILB 4PTCA 4O6LA 5HVYA 2YM8A 4AOTA 4PF4A 4EL9A 4OTGA 4ZP5A 4XG6A 1KSWA 4HZSA 3TKHA 4M3QA 4IANA 5KCVA 4BWXA 5LJJA 4MBJA 3R2BA 4RFMA 4TYEA 4EQCA 5FDPA 2F2CB 3FY2A 3BX5A 1YXXA 4RIWB 3O51A 4RBLA 4RQKA 4AFEA 5EHYA 3GOPA 3WE4A 4CV9A 5M4UA 2VTTA 4FV8A 3QCXA 3S2PA 3EH9A 3SAYA 5TO8A 5I9ZA 1UNHA 2F2UA 4ENYA 2JAVA 1Q41A 2X7FA 4MVFA 4F7JA 3BHYA 4EHVA 2C5VA 4K0YA 3BIZA 3Q32A 4NU1A 3G9LX 3CLYA 4JLCA 5TF9A 3TDVA 1GIHA 2I0EA 2ITPA 1V0BA 3MPAA 1GZ8A 5IH5A 4N70A 3MDYA 2CGVA 3ZSHA 2BDWA 1OL2A 2ZM4A 4QMXA 2IN6A 2QU5A 3U9CA 5I3RA 3FBVA 4RJ3A 1URWA 4CNHA 3QCYA 2UVYA 2BCJA 3NVMB 2H96A 5CSXA 3WF6A 3RNIA 4F1TA 1L8TA 3V6RA 4YBKA 2UW0A 4FNWA 5EKOA 2QOKA 4GU6A 3ROCA 4BBMA 4QMUA 4IAAA 5IF1A 1Q8YA 2C3JA 2E9NA 3PIYA 5BVNA 2J90A 3KRJA 2ONLA 4GFOA 3P1AA 3QFVA 5DRDA 5M53A 3ZUUA 5EDQA 1QCFA 4RC3A 3WI6A 1W7HA 4RQVA 4Y8DA 3VUDA 3PJCA 4RZWA 4D1XA 4BN1A 4QYYA 3RWPA 4WOVA 1Q3DA 2OH4A 2PPQA 3LFNA 4O86A 2YAKA 2YZLA 3P23A 3D0EA 3UE4A 5DHJA 4FIHA 5HIEA 3O7LB 4BTMA 2VTRA 3BHUA 4GFGA 5IA2A 3NGAA 1GNGA 3KMUA 3PXZA 4LMNA 3U55A 1OB3A 4L52A 4JBQA 4NK9A 2R3KA 3ZUVA 3UGCA 4FOCA 5J87A 2UZBA 4OBQA 4EBVA 2HW6A 4RC2A 3DBCA 4YTFA 1M52A 4IADA 2QKWB 3LOKA 4OT5A 4D2VA 1A06A 2X1NA 4XP0A 3W55A 5IDPA 4JX3A 4EOOA 2QOCA 1PYEA 5ACBC 4FKOA 4IM0A 3F3UA 4BI2A 3IO7A 2WMRA 4RJ7A 4WRSA 1JKTA 1OIQA 3M1SA 4LL0A 4RWKA 5DNRA 3FQSA 4O0RA 5A3XA 5CSPA 5EQPA 1V1KA 3BYUA 5IA5A 2Q83A 4ZS4A 4U3YA 3UPXA 1M14A 5FUTA 5HE2A 4EOIA 3VS5A 1J7IA 4D1ZA 2BMCA 3AC8A 3I60A 3C5IA 4CLJA 4TWPA 2HAKA 2HYYA 4X2FA 3B8RA 2YM6A 3I81A 3P86A 4IC7A 4JX7A 4NEUA 3VRYA 1Q5KA 4E4XA 4PDYA 4UN0C 3A8WA 2YHVA 3ORMA 4TNDA 3COKA 3Q9XA 3NIEA 5A46A 4C4JA 3ZU7A 4YLLA 4FG7A 5A6NA 4BZDA 2VD5A 4FTCA 4AN3A 4U43A 5IH6A 2C6IA 3FLSA 4CFFA 4ZAUA 4I22A 4LV5A 4FIEA 1YW2A 4FSMA 4WO5A 2YCRA 3MS9A 1GZKA 4EQMA 3CPCA 2FUMA 4IQ6A 1YXSA 4ZJIA 2IPXA 1PJKA 3VS2A 3SRVA 1IAHA 4PPAA 5AP5A 3NSZA 5CAOA 4ZOGA 3WF9A 4P4CA 1YOMA 3EQPA 2YLEA 3GCPA 5BNJA 2XK9A 4ZTLA 5EDRA 2FH9A 2VUWA 4O83A 3NDMA 5KHWA 3HUBA 4UB7A 3G2FA 3MSSA 4PL3A 3ZDUA 4C4GA 4FTTA 2YABA 4XNEA 2FSMX 2ZV9A 3NR9A 3W2CA 1LEWA 2IZTA 4FBXA 3ZCLA 4L44A 3ZRMA 4P5QA 4DITA 4QQCA 2YIRA 2BKKA 1ZMUA 1SM2A 5B2MA 3OVVA 1JLUE 4R8QA 3P5KA 4PNKA 1PXPA 3WF7A 4HGSA 3G33A 4FIFA 3ORIA 3PXYA 5ANKA 4AOIA 2ITXA 3A7IA 1W98A 2BRGA 4CTBA 3F2AA 3GU4A 4NJ3A 4NM5A 4LRKA 5DN3A 3LXLA 3PE1A 3VJOA 3GNIB 2O64A 3WF8A 3D83A 4EOSA 4RIWA 5EM6A 4YO4A 1ZOEA 4RIXB 4ZLZA 4AW0A 5DT0A 2PMIA 3DPKA 3EN6A 3CD3A 2OJ9A 1U5QA 3MJ1A 2FVDA 4QMPA 5IG1A 4Y5QA 4J8MA 1GZNA 4IB5A 4EH9A 3LM0A 4FSWA 2HXQA 4BIDA 4H39A 3R1SA 1ZYCA 5E91A 4YGAA 2WD1A 2XIZA 3I6UA 3BYVA 4M7IA 3W32A 2C6TA 4IB3A 3TI1A 3WZDA 3KRWA 4ZSEA 5BVEA 4V0GB 3DNDA 4CLIA 4RX5A 3OG7A 4RRVA 4IH8A 4WD5A 3SXFA 5HTBA 4FR4A 3FZPA 3MW1A 3G6HA 1CKPA 3SOAA 1QMZA 4IC8A 4QT1A 2UW5A 4FTNA 4RSSA 4DT9A 4H58A 3CKXA 5E4HA 2F7XE 3JVSA 3PVWA 4R3PA 3OMVA 2J0IA 3P79A 2F7ZE 4CRSA 1R0PA 2EU9A 3BV2A 3QZHA 4O7LA 4G6LA 3KVWA 3PXKA 3VF8A 3ORKA 3QLFA 2PE0A 4LOPA 2GNLA 3LFFA 3R8VA 3BBWA 2ERKA 1HCKA 2C5YA 2WMXA 3SKCA 4AW5A 3JY9A 5L6OA 4KA3A 5GZ8A 1OI9A 2UZWE 1T45A 5HG9A 5B2KA 3ULZA 4D4YA 5FDXA 2XJ0A 5BX0A 2XUUA 3GC7A 3FPQA 2WQNA 3T3UA 2WOUA 3TCPA 4U9AA 5AV3A 4JXFA 4KS7A 2C1BA 3TNHA 4WNOA 4H36A 1YI6A 1M17A 2AC3A 2QCSA 4TKSA 5M4IA 5HIDA 1UWHA 2G9XA 2YJSA 3TIYA 4E20A 3QLGA 4XG4A 1WAKA 4QYEA 5FXSA 2VTJA 2UZTA 1GAGA 5AR8A 4R6VA 3HP5A 3DBEA 3R6XA 5HBEA 3Q9WA 1ZWSA 4GT3A 2OICA 3DKOA 3GFWA 1H1RA 3PLSA 3V51A 5BUJA 2GTNA 3D5XA 3PRIA 3CEKA 4Z16A 4OAUC 4QQ5A 4XG7A 1LEZA 5DR6A 5IQHA 1BKXA 1OKYA 5I9XA 4HCUA 4FMQA 3A8XA 2NP8A 5DRBA 4YZCA 4YC8A 4ZIMA 4EK5A 5AIRA 3CC6A 4LG4A 5LVOA 4ANNA 3T9IA 4KIPA 3OF0A 3OUNB 4CD0A 4ASXA 4BVUA 5FQDC 3HKOA 4QOXA 4FZ6A 3DTWA 1K3AA 5AUWA 5IEXA 3PPKA 4X6QC 1A9UA 4Y73A 4D2WA 5CLPA 1H25A 4OGRA 2ZV7A 1UKHA 4G3FA 3TZ9A 3F9NA 5AP0A 3VQHA 2GTMA 3OY1A 5DGZA 3U4WA 2Z2WA 4O2ZA 4WNKA 1ZY5A 3FMJA 3FZRA 1UU9A 3CE3A 4R7HA 4X2GA 3TUCA 2O3PA 2OXDA 3IGGA 2J5EA 3DOGA 5EOLA 5F1ZA 5HCXA 5KZ0A 3V5PA 3FZTA 4LGDA 4EHZA 4EUUA 3AG9A 3UG2A 1W82A 4MTAA 3F88A 2WFYA 5DYJA 5M08A 4TTHB 5EI6A 2XRWA 3IGOA 3PG3A 3UIMA 3VS4A 2ITOA 4BCMA 4DAWA 1NT2A 3KGAA 2WMBA 3OS3A 3IS5A 2R7IA 2GFSA 5M4CA 2WMSA 4U41A 3MESA 4U44A 4UZDA 4BZOA 4Y83A 3MB6A 3OT3A 4PV0A 4N0SA 3E87A 1Q61A 3F69A 4NIFB 5AADA 1WMKA 4C7TA 2RIOA 1PXMA 3L8VA 3KA0A 2XH5A 3E64A 3E8NA 3R9DA 3UP7A 3TNQB 4IX4A 4D4SA 1Z57A 2CNVA 3I0OA 4CCUA 3A60A 3OZ6A 2C5OA 4NFMA 2VTNA 4S2ZA 3C4XA 4U45A 1JQHA 1SNUA 3TIZA 3ANRA 4K6ZA 4X2NA 5JFWA 5DI1A 3UZTA 3M11A 3RK9A 5FBOA 1WBPA 1GZOA 2BAJA 3FJQE 4RIXA 4G6OA 3EQHA 2NRYA 3UJGA 2Y6OA 2F57A 4K8AA 4WRGA 2PE2A 5HLWA 1YXTA 5K5XA 4ZZOA 4R1YA 4IAKA 4DGMA 3NAYA 3ORPA 5LARA 3H3CA 4L46A 2VO6A 2Y9QA 4BYJA 3SQQA 5H8EA 3HAMA 4L3JA 4H05A 4IWPA 4C57A 2P2HA 4DCEA 2UZVA 2XJ2A 3O7LD 3O96A 5CZHA 1ZOGA 4NM0A 3ZXZA 2J4ZA 2V0DA 3SVVA 3O8TA 3D94A 1KE5A 1BUHA 3MYGA 4IFGA 4ASDA 4ITJA 3F3TA 4JG7A 5A4QA 1AQ1A 3UZRA 4V0GA 4E6CA 2UW9A 2HZ0A 4CFVA 2WMWA 4MHAA 5J9YA 2RL5A 4CZUA 5HO7A 2CCHA 5DIAA 4YTCA 3VWAA 3MTLA 4N6YA 5E90A 1G8AA 4L3LA 3BU6A 4DBXA 3AT3A 3ALNA 4C02A 1OM1A 5HO8A 4UZHA 3RTPA 5KBQA 4XH6A 2IVTA 3SOCA 4X7QA 4Q5EA 2B9FA 3R8UA 4E93A 4BY9E 3DDPA 2IO6A 3HVCA 3NYOA 1P5EA 3FY0A 4FYNA 3W2SA 4DFXE 4F09A 4FV4A 3OW3A 2I40A 4MBLA 4O96A 4EORA 3IW5A 3UIBA 5JN2A 2YISA 3L9NA 5JGBA 3SHEA 4EH7A 4WG3A 2P55A 3MFTA 3IDCA 2AC5A 2XBJA 2QOLA 3OWLA 2P4IA 1W0XC 5CNNA 4C38A 4E26A 5A4TA 4EKKA 4ZY5A 3Q4ZA 1A48A 1SMHA 3LFBA 4O7SA 2EXMA 5DEYA 5L2QA 4FIGA 2ETRA 4O1PA 3EQGA 4FSYA 2XNMA 4Z7GA 2PULA 4L6QA 4O2PA 4YNOA 2PU8A 4FZDB 2VX3A 4EI4A 3S3IA 5ITAA 2EVAA 1YOLA 3MIAA 5DT3A 5CALA 1E1XA 2QC6A 3QTZA 1Q24A 2QHMA 5DR2A 3IOPA 2IWIA 2A2AA 3ALOA 4II5A 5HG8A 4YHJA 3LCOA 4F0GA 2RF9A 2BZKB 3ID6C 4BKZA 4GIHA 4DE4A 3MIYA 4I41A 1PMUA 1OKZA 1IASA 3KC3A 4FTKA 4JDIA 1YHWA 3LXKA 4S33A 3RCDA 4B9DA 3A62A 5D41A 3ZRKA 3B8QA 3TUBA 4E4MA 2GDOA 4DINA 3OTUA 2HY0A 3PIXA 4B8MA 4QP1A 4NYEA 3NAXA 4FSNA 4JIKA 2C6MA 3E7VA 4QPAA 5HORA 3RAIA 2GHMA 3W1FA 4GG7A 4L43A 5CX9A 4OBPA 2I6LA 4BGGA 1JVPP 4JBVA 3ORTA 1DS5A 4IZ5A 4IWQA 2VTPA 5LCJA 5CSVA 4ANSA 4EH2A 1PMNA 3AD6A 5C26A 1OKVA 3EN4A 4MWIA 4OTFA 4PDSA 3OOGA 4XLVA 4DN5A 3ZBXA 4PWNA 1UKIA 3AD4A 4A9YA 2HY81 3D15A 3DJ5A 5CENA 4XG3A 3TZ7A 4BDCA 4GKIA 3PZHA 4D2SA 4BI0A 3RALA 3ORXA 3ZFXA 3E7OA 2PUIA 4FICA 4N4SA 5CU6A 2ZJWA 4ONAA 2J7TA 4F4PA 1WBVA 1WBSA 2XKCA 2DWBA 2GS7A 5ICPA 1MRVA 3QD3A 4FF8A 4X2JA 3PP1A 5E8ZA 3UODA 4ALWA 1XR1A 4FKRA 2GMXA 3A7JA 2YCSA 3IECA 4L01A 4M84A 3OTVA 5CNOA 4CQGA 4NIFA 3CJFA 2R3RA 2YDIA 4DFBA 4F9CA 3K54A 3CBLA 4FVRA 3QC9A 2CPKE 4PTGA 2UVZA 4NJDA 2YM5A 4K11A 3II5A 3ZLWA 2EXEA 2Y6MA 3BELA 3DB8A 4F1MA 4CG8A 1VZOA 4DFUA 3Q6UA 2JD5A 3P08A 4ZLOA 3SGCA 3ORNA 3VQUA 2GCDA 2HELA 4ASZA 2BAKA 2VGPA 2WXVA 2YN8A 3C1XA 3KXHA 4O27B 3TZ8A 5EKNA 4AZFA 2VO3A 3KXGA 4CMUA 2J0MB 4HNFA 4X0MA 3KL8A 2C69A 4AT5A 1TQPA 3H10A 3B2WA 2C5NA 1JPAA 2ITUA 5J95A 3UYSA 2G15A 5AA8A 4EUTA 1H01A 3P7AA 4G9RA 1E1VA 5DG5A 2CHLA 3HV6A 5DFPA 1J7UA 4HCVA 4O7RA 2G2FA 3MBLA 5DPVA 1NVRA 1O6YA 4AG8A 3NNXA 4FT9A 4ARKA 4BHZA 5AUYA 2OWBA 4TY1A 4JIAA 5HVJA 3VBVA 3Q52A 3TACA 5IQBA 4AOJA 3VS0A 1H08A 2Z7QA 4GV1A 2V7AA 5KHXA 3QD4A 3VS6A 1S9JA 4I3ZA 4EWQA 4X6RA 3QRUA 2Y7JA 4D5KA 4O0YA 1PKDA 3HDMA 5L6WL 4DBNA 4F9BA 2C5XA 3OXTA 4MF0A 3BGQA 3U51A 4O0TA 3GCSA 4KIQA 1FGKA 2H6DA 4MH7A 2GHLA 4IX6A 2CDZA 4FTAA 2JKOA 4J1RA 2HOGA 4FA2A 5AFVA 2WNTA 3VUKA 5AUTA 3AGMA 4L9IA 4AE9A 3GCVA 4U40A 5EI2A 3OCTA 4TRLA 3RK5A 4GL9A 4IVAA 3HRFA 2OJGA 3RPVA 4QMTA 3R71A 5KX8A 1M2QA 2BFYA 2XS0A 4LFIA 2VU3A 2O63A 4G3EA 5FLFA 5J1VA 4UX9A 1YDTE 3H9RA 2W1GA 2YWVA 1MRUA 3ERKA 5C1QB 1PXKA 4IHPA 4C33A 5K5NA 4KS8A 4XV9A 3EN7A 3IW8A 4X3FB 4IX5A 4FL3A 4W4XA 4QP8A 4Y85A 5CTPA 3V5TA 2PVNA 1OZ1A 2PWLA 2VWIA 3PXQA 4JRNA 3BYMA 4ZXTA 3R9OA 3S0OA 4XRLA 2XB7A 2BHEA 4BGQA 4XRJA 3BWFA 2ACXA 1IG1A 3MGYA 4FTLA 3PWYA 3LVPA 5L8JA 3VJNA 1JKKA 2ZAZA 2ZM3A 3OWKA 4BDDA 4D58A 4E5BA 3ZM9A 4RG0A 4D0XA 3VBQA 3SLSA 3NYNA 3HRBA 4DGNA 4O82A 2XCHA 5CU3A 3RZFA 3AT4A 4L00A 2QO2A 2Y0AA 5C9CA 4EZ7A 5L4QA 3KREA 4DF3A 1WVXA 1REJA 3A2CA 4J71A 4ENXA 4UXLA 4X3FC 4ACHA 4BCIA 5F9EA 1JAMA 4RX8A 5EM7A 4AU8A 3REPA 4RGJA 5HG7A 5BYLA 3ZDIA 4AZTA 2QONA 3CGOA 5I0BA 3ZXTA 3ULIA 4PL4A 3NX8A 3RP9A 2G2IA 1XKKA 5EG3A 3LPBA 2XK6A 3DQWA 3TM0A 3NUNA 5T6KA 4NKSA 3Q4TA 3PPZA 3I79A 3EOCA 1BL6A 2X7OA 2VO0A 2J5FA 4E73A 3V8TA 1B39A 3PY1A 3OCGA 2HCKA 3WZUA 5ANDA 4APPA 4W8EA 3BU3A 3DKGA 1QPEA 3OBJA 4ALUA 3FLWA 4FZFB 2WEVA 2UW3A 2QKRA 4LUEA 1YHVA 5ETIA 5T68A 2XEYA 5CI7A 5AAGA 3QHRA 3QRJA 2ITYA 5M57A 3L9PA 2QD9A 4YUQA 5T3QA 2CKOA 2C0IA 5B2LA 5E8SA 3UTOA 1R39A 3OBGA 5D7AA 3U4UA 2C68A 3LW0A 3P9JA 4H3QA 3QQFA 4F64A 4UWYA 1YWNA 1IR3A 3DAJA 3GQLA 4HVDA 5CYIA 4DH3A 4L8MA 5J7HA 1LPUA 5EH0A 4GT4A 4U6RA 4O7ZA 2JBPA 5C8MA 2CGWA 5EW3A 2UUEA 3D5UA 1LR4A 5KZIA 3Q5IA 2PTKA 5CQUA 3ACKA 5FEQA 4X3JA 3ATTA 4BKJA 2W0JA 4ZSGA 4FTQA 4YC3A 3D9VA 3UQCA 3QXPA 3QWKA 4YMJA 4QTDA 1DAYA 2C4GA 4RJ8A 4YTIA 1WVYA 2RFDA 5CEKA 4GRBA 4UV0A 4ZZNA 1B38A 3VRZA 3JPVA 3QHWA 2ZMDA 3POZA 5HE3A 2HENA 3WILA 5FM2A 5AEPA 2YA9A 1UV5A 3EQBA 4USEA 3FUPA 3CCNA 1XHAA 2BIKB 2XYNA 3MH3A 2PVJA 3PIZA 4OLIA 1H00A 5CXZA 2OJJA 5A9UA 1PHKA 4DTAA 3GBZA 4B0GA 5CANA 1FQ1B 5HLPA 2GNJA 5FD2A 3VUIA 1OIRA 2O2UA 4O84A 1XO2B 3ANQA 3SDJA 4UYNA 1K2PA 3D2KA 3BI6A 3NUPA 4EEVA 4XP3A 3GFEA 3AGLA 4W8DA 2W4OA 3FKOA 1PMVA 1OVEA 1ZY4A 3F5XA 5IQEA 4JBOA 4BDBA 1P14A 1YXUA 4DEGA 2QODA 3NYVA 3M2WA 4GK4A 2EXCX 4A9TA 2WIHA 4BDJA 3FSFA 4PDPA 4GJ2A 4GSBA 1OL5A 3FYKX 5EI8A 4FV7A 3SW7A 1YHSA 5DH3A 5BVOA 4YSJA 2VTMA 4TWCA 4XBUA 3PDTA 4DFZE 3RPSA 4KUJA 4BCJA 4U97A 4CZTA 3LM5A 5AV1A 1KV1A 4MBIA 3QD0A 3R83A 3DU8A 5CEPA 5HTCA 4FG8A 3W18A 3O2MA 4IM3A 4XBRA 4X3FA 1JNKA 4EK3A 3QTWA 4F0IA 3JXWA 2PVMA 4P7EA 1ZYLA 4XP2A 3TUDA 5DWRA 2GHGA 4I5HA 4DEIA 2QOIA 4XHKB 4ERWA 4EQUA 4FGBA 3FLQA 3V5JA 1TVOA 2J0KA 3PUPA 3BRBA 4UWBA 4RLKA 4F65A 4D4VA 1Y8YA 3T8OA 5CT0A 3PVBA 3A4PA 3TNIA 2OGVA 5AP3A 3EQDA 5JRSA 3RNYA 3BLQA 4F6WA 1HOWA 3NWWA 4O7TA 5HBJA 3L9LA 4A7CA 2YM4A 3KMWA 2XVDA 3B2TA 1FOTA 3BZ3A 4EWHA 5ANIA 3QA8A 4NTSA 4YJRA 4BCQA 2QLQA 3MWUA 3KXMA 4KRCA 3FQEA 4CFUA 3R9NA 4K9YA 5AUVA 3Q60A 2Q0BA 1PY5A 3EL8A 3LZBA 4MCVA 3I7CA 5I4NA 1Y6AA 4XYFA 5JKGA 3VBYA 5JSMA 4BDAA 1UA2A 3FC2A 3BQCA 4FKJA 4CKJA 2Z7RA 3DNEA 4NL0A 2AUHA 3H0YA 3QD2B 4E5AX 3IDBA 1YDSE 3CR0A 2GPHA 2DS1A 4HNIA 3HV5A 2VO7A 4Z55A 3MJ2A 4FNXA 3RHXA 4O0VA 4ZS0A 5FEEA 5DOSA 2OF2A 4FT0A 2YIWA 5CF4A 3K5VA 4R77A 2QURA 4UYAA 4OUCA 4GYGA 3KN6A 4J98A 3WBLA 1YOJA 4PP9A 5CF6A 4BRXA 2W5BA 4CEGA 2BALA 2WAJA 4YTHA 3UNKA 3DK6A 3S1HA 3EFWA 2XYUA 5HD4A 4HYHA 2CMWA 4IB0A 2J2IB 4IM2A 4YNEA 4YJNA 3DY7A 3QAME 4S32A 5M51A 2JIVA 4FL2A 4GK2A 2WELA 4LQMA 2W1CA 3OOMA 4GFMA 3EZVA 2XJ1A 3DXPA 1MQ4A 3QQLA 2BUJA 2P3GX 2R3JA 4UBAA 2JGZA 3C4WA 4YJUA 2R64A 1STCE 1CDKA 2XEZA 4YPDA 3FSKA 2VWWA 2W99B 3G6GA 1JOWB 1AD5A 3PA4A 3QQJA 2VWBA 4W4VA 4CFXA 1MP8A 2LAVA 2O65A 3QKLA 4ID7A 4FT3A 4MX9A 4IXPA 4KWPA 4R1VA 4UMTA 5IQGA 4E6DA 3LQ5A 4AN9A 4D2TA 3EYHA 4PRJA 4BDHA 3FI3A 4B8LA 5D11A 1AGWA 4YLJA 2JLDA 2WTJA 4RA4A 2NRUA 3VS7A 4QP6A 3SXSA 3TWJA 1X8BA 5HKMA 3PJ2A 4JDJA 5DT4A 3F7WA 2XF0A 2CNUA 1PYXA 1I44A 3U87A 5LQFA 3OWPA 2VN9A 3QALE 3WARA 4N57A 2B7AA 4CFNA 3F5GA 3AC1A 1O6KA 5E8WA 5BVFA 4OBOA 2XM8A 3UC4A 2PVRA 2X2MA 5BYZA 5KMMA 1Q8UA 3KY2A 2R3OA 4E1ZA 4G34A 5E8UA 1JSUA 4XMOA 2X9EA 3LLTA 3U54A 2BAQA 2J6MA 1SYKA 3BCEA 3HLLA 5E7RA 5EK7A 2VWYA 4ANLA 1OUKA 5LMBA 4ZLYA 1NY3A 2UW7A 2W5AA 5L2TA 2FSOX 4S30A 3QZGA 4HGTA 4R7IA 4AACA 1GIIA 3W2QA 5FTQA 4J97A 4FSZA 4RVLA 5CAVA 1NVSA 2QR7A 4I23A 5HX6A 3HAVA 3WIGA 5KO1A 2WTWA 3QWJA 4J52A 3G90X 5AV4A 4PMMA 4CT2A 3MY0A 4A9RA 4XS2A 1P4FA 2ITTA 2JDTA 1T46A 4KABA 2QOBA 3LFCA 4M69B 4RX9A 2J9MA 5IA4A 3OCSA 3GC9A 2ZM1A 4RWJA 1QPJA 3MVLA 4RIYB 3QU0A 4TWNA 5DA3A 2WTIA 4FKLA 4E6AA 3HNGA 2O8YA 3PY3A 5CEQA 3GCQA 4ZY6A 4FTUA 4BC6A 4FIIA 3NPCA 3ZHPC 4EJNA 3PRFA 3HDNA 3E92A 5AR7A 3QTSA 3MFSA 2R3HA 4KAOA 3O50A 1FVRA 5J9LA 4KINA 4TYIA 3WYXA 5IQIA 3ZS5A 3R02A 5KBRA 2YIXA 2A0CX 3EB0A 3DBQA 3TNWA 3UOKA 4EH5A 2XNPA 5JQ8A 2WU7A 3MV5A 2OZAB 5HU3A 2YACA 4BWKA 3U9NA 4C36A 3ZC5A 3IONA 3SXRA 4EK8A 3DFCB 4QPSA 3LFEA 3QX2A 2Y8OA 3C5UA 4NW5A 4CCBA 4R3CA 4LGGA 3GI3A 1JKLA 5HD7A 4U79A 3EQIA 1MQBA 4IFCA 5IEVA 3IDPA 5KMOA 3SD0A 4W4WA 3M42A 4FOBA 2WOTA 4E4NA 5HU9A 3TN8A 2W1IA 4AZVA 3G51A 3QQUA 4KBCA 5J79A 3JYAA 4HGLA 4QO9A 2JDRA 3FHRA 4RVKA 4W4YA 3R1QA 4C35A 4G5JA 1H4LA 5HX8A 1ND4A 1E9HA 2BRHA 4XLIA 5BVDA 4AF3A 5IZFA 2A27A 3F66A 3L8XA 5L8KA 2OXYA 3BGPA 4JI9A 4PDOA 1WBTA 4NH1A 1FBNA 1KE8A 4H1MA 4I5CA 2FYSA 2REIA 3L8SA 4M68A 5LVLA 4EZ3A 3R7GA 3NNWA 3UC3A 1IEPA 3OXZA 1ZXEA 2IW6A 5M06A 5FTOA 1Q3WA 4ANBA 3SV0A 3ZO2A 4C4HA 3UNZA 4ZTHA 2FA2A 3ODZX 3PY0A 5F95A 4AA0A 3LMHA 4BCOA 3E3BX 3CQEA 3NUUA 3P4KA 4A4OA 1YI3A 5EM8A 1PXJA 1YWVA 4R78A 3JVRA 2UW6A 2W4KA 2BDJA 1OMWA 2UZNA 2FSTX 4QMYA 3LCSA 4CZYB 1HCLA 1UU8A 2IZSA 4NTTA 4QTEA 1M7NA 1OBGA 4C0TA 4DLJA 3THBA 4FVQA 1S9IA 4MWHA 2VRXA 3OC1A 2QI8A 3ZLSA 3R1YA 3UNJA 5K0XA 3IG7A 3I4BA 3FLNC 2JFLA 3QL8A 4WSYA 4XEYA 4AP7A 4AT3A 4ZJJA 3HL7A 4UALA 5FXQA 4NM7A 3UDBA 2BKZA 2XCKA 3N4UA 4FE2A 4MXYA 2NNWB 2HWOA 5TE0A 5D1JA 4OW8A 5AAFA 1GY3A 2E9VA 4LV8A 2ITQA 3DV3A 5FWKK 4GW8A 3V01A 5C4LA 3ACJA 3KK8A 5H8BA 3PE2A 5IQCA 3R21A 3HV4A 4DYMA 3JR1A 3NRMA 2JC6A 3VULA 2UZUE 3Q04A 4Y95A 3R7EA 2UZLA 1H1QA 3BKBA 3PPJA 4IW0A 4L7SA 4HGEA 4QPMA 4TWOA 2W17A 3LFSA 2OIBA 3R00A 1W84A 4U3ZA 4RFYA 4O0XA 2C6KA 4FK3A 3R7YA 2JKQA 3KN5A 3QX4A 3WYYA 2PMOX 4KIKB 4C3FA 3JS2A 3HV7A 2BROA 3QTXA 5I9VA 4FKUA 4QNAA 2Z60A 3S00A 4WT6A 2PVLA 4CGAA 5CEIA 3DJ7A 2PY3A 2X39A 3DK3A 2GNHA 3F3WA 2CGUA 4QMWA 3PA5A 2X8DA 4FUYA 1M2RA 2OH0E 3NUYA 1REKA 4M69A 4XUFA 3UO4A 5GJFA 4K33A 1EH4A 1DI8A 4RIYA 3PSBA 4YJTA 4KBAA 5E8TA 3UQGA 3KMMA 4EJ7A 4NW6A 4FX3A 3UOLA 3KRXA 4KD1A 4LGHA 1UNLA 4QRCA 5AUXA 4BFMA 4YU2A 5LOHA 3LMIA 1RDQE 4YBJA 3RPYA 3QUPA 2R5TA 2ZB1A 1F3MC 5HQ0A 5HEZA 4M15A 4BGHA 1JSTA 4B6LA 2E9UA 2YIQA 5IDNA 4LRMA 3QTRA 2RFNA 4D5HA 4EOLA 2XIYA 5JGDA 4U8ZA 1NVQA 3EN9A 4UEUA 3HA6A 1JBPE 3SW4A 3D2IA 5AUZA 4FV0A 4ZEGA 4DFLA 3KF7A 2QOFA 4MK0A 2OZAA 3BV3A 5HIBA 3K3IA 4TL0A 4UMUA 3NEWA 4FT5A 5AP6A 3ZO4A 5IUGA 2XIKA 3R8LA 2CKPA 3R01A 2OLCA 4RJ6A 4I6FA 3WZEA 4D4RA 4D2RA 1NXKA 5G1XA 4APCA 5A14A 2OFVA 5EOBA 4QMQA 2ETMA 2VNWA 1XH6A 2PE1A 4QNYA 3HGKA 3KXXA 1BMKA 1G5SA 3AC2A 4DGLC 2HZ4A 4IX3A 2BPMA 4TYHB 3K2LA 3VUHA 3LMGA 4MQ1A 4ASEA 4G3CA 3IK3A 3F3VA 5EW8A 5GINE 4CG9A 3CTHA 4U80A 3K5UA 1J1CA 4BDKA 4DGGA 2XIRA 3FLYA 3MH0A 4MXAA 2WGJA 2Z8CA 1LUFA 5K3YA 3PSCA 4F63A 3BYSA 2GS2A 2YZAA 2XIXA 4HPTE 4O7VA 3DKFA 5TT7A 5AP1A 5CVHA 4L68A 1P4OA 2R3GA 3R0TA 3ZLXA 2C30A 3FKNA 4BCHA 3OEFX 3A7HA 3C4CA 4PMPA 3LFDA 5JGAA 1XH5A 3DFAA 4N6ZA 3VBXA 3VF9A 2J50A 5KMNA 1KUTA 5IH4A 2RG5A 3BLHA 4JR7A 2OO8X 3HMOA 2IVSA 3ROYA 4U42A 3AD5A 5GJGA 3RVGA 2F49A 5BVWA 5GNKA 4JDHA 3KFAA 3ZEWA 4QYHA 1W83A 3Q2MA 1M2PA 3PSDA 4C2VA 4YZ9A 4DTBA 4O0UA 4EH3A 4AUAA 4UWCA 3FC1X 5JMSA 3IW6A 2W9ZB 4FKTA 2QO9A 1Q62A 4FI1A 4XJ0A 3Q5ZA 4F08A 4YHTA 3VC4A 4L45A 4EH4A 1JKSA 3NW6A 3UIUA 2H34A 4O22A 4FL1A 5I9WA 2HW7A 3RZBA 3E62A 4CRLA 5AMNA 2B9JA 3R7UA 5AM6A 1XBBA 3LXNA 3VNTA 4R5SA 3RCJA 4Z7HA 1B6CB 1SVHA 2CSNA 4WG5A 4JL9A 3UZPA 3ZZEA 4OTHA 3DQXA 3QGWA 3MI9A 4IBMA 2OXXA 1PF8A 4XOYA 3VVHA 2VTQA 4MXXA 4GK3A 3WE8A 4DH5A 4EONA 3N4TA 3H30A 4WKQA 3FPMA 1J7LA 3G9NA 3A7GA 5GZAA 4BHNA 5KMKA 2VTHA 3KF4A 4O7WA 5B7VA 2W96B 3TKIA 2XK7A 5AX3A 2PUPA 3GU6A 3R7VA 3LIJA 3QTQA 3UQFA 1Z9XA 4BCNA 2QG5A 4RC4A 2RSVA 4GUEA 2Z7LA 1F0QA 3GC8A 5M55A 3FKLA 4DCAA 2WPAA 2BRMA 3ZC6A 3PZEA 4USDA 4U5JA 3BEAA 4D9UA 2XM9A 3MA6A 4B4LA 4FV6A 2PMLX 4G6NA 2EWAA 3FWQA 2IW8A 1OIYA 3UMXA 4KIKA 2R0UA 4XV1A 5IKWA 1ZOHA 4WBBB 3EIDA 5CVGA 3MB7A 3DXNA 4J8NA 2JKMA 3WIKA 1F5QA 4RWIA 3GEQA 5BMSA 2B1PA 5EYCA 3VHKA 2P2IA 2YERA 4KKEA 4R5YA 4V05A 4O91A 1G3NA 5BVKA 5HVKA 3EN5A 5KMJA 1ZMVA 3S4QA 4BI1A 4AXAA 3FDNA 2XKFA 2V55A 1YQJA 3DAEA 3EWHA 4AA4A 4ANOA 4HVSA 1H26A 3OD6X 3Q96A 5E8XA 4C34A 3QRIA 3ZZWA 3L8PA 4XG9A 5AAEA 3R1NA 4IMYA 4WNMA 3ZBFA 4AT4A 2EB2A 2PUNA 4EKLA 4Q2AA 1OPKA 2W05A 5CU2A 3WOWA 2VTOA 2QLUA 3W33A 3COHA 2JBOA 2W7XA 1APME 2YM7A 3LKMA 5D9HA 3VUTA 4DT8A 1ZAOA 4WHZA 3F2RA 4DH8A 4AQCA 1VEBA 5B0XA 5H2UA 1ZZ2A 2QOHA 4MEDA 3ZTXA 4BDGA 2ZOQA 4BCKA 2B54A 4DHFA 5CASA 1NW1A 2ESMA 4FTJA 2JIIA 4I24A 4I6QA 3R7OA 3V5LA 4F9AA 4KNBA 5M09A 2X4FA 4GEOA 5FM3A 4YSMA 4H3BA 1H1WA 4AWIA 4DTKA 5CAPA 4ITIA 2YCFA 1NA7A 1L3RE 2OIDA 3MA3A 4BB4A 3QKMA 2GFCA 2BDFA 3RM6A 4OTQA 3NIZA 1Q8TA 5JFXA 1U54B 3AMYA 3KB7A 3KEXA 4YZBA 4J96A 4DEBA 3FI8A 3K3JA 3LCTA 3Q4CA 4G9CA 4Q5HA 1YI4A 2V7OA 3NUXA 2VWZA 4K77A 2QHNA 2I0YA 2J51A 4QMOA 4TYHA 1UVRA 2XRUA 2YFXA 3NZ0A 3PP0A 2CGXA 3BE9A 5H3QA 4AGDA 4DH1A 4Z3VA 3C0IA 4H3PA 4JBPA 3F61A 1UU7A 5TOZA 3LXPA 4EC8A 5CEOA 4O81A 2BZHB 4RVMA 4OR5A 4ACGA 5L3AA 3NCGA 5JH6A 4AW2A 4BTJA 4A4XA 3TEIA 4F0FA 1UU3A 2C6LA 3BE2A 4P2KA 1KE7A 3CTQA 2OBJA 4I1ZA 4YJOA 3ZFYA 4D9TA 4EYJA 4GU9A 4ZTSA 3E8CA 3R8MA 1MRYA 1XH4A 3FE3A 3FZOA 5EYDA 5HE0A 3CP9A 4M8TA 4HPUE 4CSVA 2ETKA 1W8CA 4BTKA 1GIJA 5A6OA 3QTUA 1RJBA 1PXLA 3TNPC 4FKIA 3DBDA 1KWPA 1XBAA 3NS9A 4P5ZA 4BCGA 3ELJA 4TPTA 5A4LA 5DLSA 4CVAA 5CXHA 4WUNA 3PYYA 4RJ5A 5CSHA 4PQNA 1PRYA 4RJ4A 3KXZA 3Q3BA 4G3GA 2QU6A 3AC5A 3KULB 2XNOA 2XNNA 3C7QA 4FIJA 4EHEA 1FPUA 2A19B 4Y72A 2JDOA 4D2PA 3E93A 4IVCA 1R78A 5CU0A 2WQMA 3KRRA 2XKDA 2ITZA 2H9VA 3GXLA 3TL8A 5JEBA 1R1WA 5IA3A 4HYSA 4FSRA 2JAMA 2NPQA 4DC2A
chains in the Genus database with same CATH superfamily
2XKEA 3GC0A 3P78A 4GG5A 3ET7A 5E92A 4D55A 2SRCA 2UW8A 3L9MA 3R7IA 3CS9A 4NUSA 4ACMA 4M12A 3RAHA 3GCUA 4A9UA 2GNGA 4TN6A 3VUGA 4IVDA 4YP8A 5J8IA 3EZRA 2B0QA 4KB8A 2V22A 2W5HA 2C0TA 3H9OA 3C9WA 4W9WA 2PYWA 2O5KA 1WBOA 2VWXA 4BDEA 4HVIA 2B55A 4IAYA 1KV2A 4QP7A 3UOHA 3PLAE 4G31A 3MTFA 1V0PA 2BZJA 5M07A 3QTIA 4DFYA 5CQWA 2BHHA 3VHEA 2WTDA 3FZ1A 3UVQA 4FV9A 5HZNA 1TQIA 2VTIA 5ANJA 4DLIA 4EH6A 2R3FA 2ZB0A 3NLBA 4F6SA 3LQ3A 2NYAA 2OJIA 3DKCA 2H8HA 4QMSA 5HBHA 2R3LA 2PZ5A 2YAAA 4FEQA 3NMUF 4IIRA 4AGUA 2WMUA 4ZTNA 5AIKA 3MY5A 4F1OA 4UMQA 2C47A 2VV9A 4I0TA 4J99A 5C4KA 3FXXA 3CJGA 3FMDA 3ENHA 5KUPA 4XOZA 5AJQA 2WQEA 4YJPA 1YDRE 2HZIA 4RWLA 4TZRA 4QMNA 5JZJA 3FI4A 3VBWA 4KRDA 2KULA 3CGFA 4C59A 2VNYA 2YDKA 4KKGA 3RPOA 1BL7A 4L67A 3R8PA 2B9HA 4G1WA 4UMPA 3W0QA 3GUBA 1VYZA 2OU7A 2WMVA 3L1SA 2QR8A 2V62A 5EFQA 1IRKA 4AS0A 4ZTMA 3FAAA 2XNGA 3WZJA 4X21A 4CTCA 4AGWA 5DVRA 4FEWA 1YRPA 3GP0A 1RW8A 4GIIA 3UO6A 3SG8A 4O0WA 1WVWA 5KMLA 1FMOE 1U46A 4ZSJA 3E63A 3D4QA 5AX9A 1URCA 2VWVA 5AM7A 5EYMA 4FV5A 3A99A 2W1DA 4I6HA 5FG8A 3VW6A 4GVJA 4HZRA 1FINA 1ERKA 2WU6A 4FT7A 4YLKA 5CAQA 3H4JA 1OGUA 4QP9A 5H9BA 3ZUTA 3GENA 1O9UA 4MYGA 4L53A 4QP3A 1YVJA 2XA4A 5K4IA 4I0RA 4FJVA 3DAKA 4FSUA 5EHOA 4C61A 3RAWA 3BLRA 5CT7A 5A4EA 5IQFA 4LOOA 5H8GA 3TJCA 5K0KA 5TR6A 5AUUA 2FO0A 5FGKA 3UVRA 5CEMA 3DJ6A 3EKKA 4WIHA 2Y4PA 2GQGA 3DZOA 5AA9A 4S34A 3NUAA 4MXCA 4LMUA 5L2WA 1U54A 2F7EE 5BUEA 4ZTQA 2JIUA 2UZOA 3SC1A 4YO6A 2W1FA 5CAUA 4RIOA 3RM7A 3C0GA 2EB3A 1V0OA 1XH8A 3F3ZA 5TKDA 2WEIA 2YJRA 2ZV2A 1IAJA 3KU2A 3POOA 3PWDA 4FTMA 1RE8A 4CYJA 3D7TB 2O0UA 2FB8A 3MVMA 3QZIA 2XK4A 3ZO1A 5A54A 5LMKC 1TQMA 4NM3A 5KMIA 2OK1A 3VIDA 4FKQA 5ANEA 3DLZA 1Q97A 4D0WA 2WHBA 2PL0A 3ATSA 3O23A 2R0IA 2X2KA 5FBNC 3RPRA 2BTRA 5HTIA 2UV2A 4QD6A 5IEYA 1R0EA 2X2LA 2FSLX 3VW8A 4O6EA 2OIQA 2WTVA 4AFJA 4DEHA 5BPYA 3BBTB 4GS6A 1M7QA 4YJSA 4EC9A 2DQ7X 3UMWA 1FVVA 4E7WA 2IZUA 1FGIA 3AXWA 1R3CA 4KBKA 2F9GA 2OKRA 3AKLA 4IVBA 2PK9A 4EOPA 4QYGA 4OTDA 2E9OA 2VTAA 5E8YA 4I0SA 4XX9A 4QTCA 1Q8ZA 4JRVA 2WMAA 1K9AA 1ZMWA 3NCZA 4HJOA 3FQHA 4IJPA 2JFMA 4PMSA 2PVHA 1IA9A 4G5PA 5DE2A 2ZDTA 3GOKA 3OY3A 2B52A 2RFSA 3KULA 5AV2A 4YURA 4M14A 3D5WA 2UZEA 3BU5A 4FZ7A 2HK5A 2R4BA 4F6UA 5CU4A 1H28A 3QC4A 4YHFA 4JNWA 2QVSE 4AGCA 3F5PA 3OFMA 2J0JA 1JWHA 4BKYA 5HICA 2WTKB 2HZNA 1XJDA 3I5ZA 4Z9LA 5FP6A 3W8LA 4JAIA 5HO6A 3I5NA 4FNYA 4BL1A 5E8VA 4EOJA 5LXMA 2R3QA 4C58A 3KQ7A 4NZWB 4PPBA 4RFZA 3TTIA 5IMEA 3CTJA 4OTRA 3IPHA 3V04A 5BQ0A 3HMNA 4ZSLA 3CIKA 3QUDA 3R2YA 2YDJA 2I0HA 4YZNA 3IQ7A 4B7TA 3QUEA 4I92A 4ACCA 2PSQA 3ZRLA 2IVVA 3DB6A 3HECA 4WNPA 3OXIA 3TJDA 4ANQA 3R04A 3QGYA 5IUIA 5C27A 5ACKA 5IQAA 5IUHA 4ZSAA 3F5UA 1MUOA 4RVTA 4S31A 2WTKC 2WMTA 2BRNA 2PVFA 1H24A 3PVUA 4L42A 2PZPA 5HOAA 1WCCA 3U6JA 2OF4A 3BHVA 5IMXA 2BIYA 2X6DA 4ITHA 5AR5A 3VUMA 4DEDA 4YJVA 4EH8A 5JFSA 3TV6A 4BWPA 3HP2A 4OTPA 4QYFA 3E8EA 3TYKA 4RPVA 1H0WA 2VGOA 3GU8A 4JVGA 5C01A 2CKQA 5CWZA 5L2IA 4ZTRA 4F70A 4NSTA 5IISA 1TZDA 4WA9A 4QMZA 3WF5A 4HYIA 1ZARA 2RFEA 3BHHA 3KKVA 4IZYA 4PTEA 3C0HA 3NW5A 4MNEB 4YPSA 3RBWA 5EDPA 3NNUA 3DA6A 4JR3A 4MXZA 4EYMA 3EFKA 4DG3E 2CLQA 3OUKA 4RMZA 2XK8A 1G8SA 2JKKA 2ITWA 4JAJA 4AZWA 4I93A 2WZJA 2X81A 3ZOSA 2NO3A 3W10A 1OPLA 3C51A 5DBXA 1UNGA 3LHJA 2CLXA 4FGRA 1H1SA 3QBNA 2CCIA 2EUFB 5EW9A 3ZMMA 3ETAA 2GS6A 2J0LA 4PUZA 3FXWA 2QOQA 2ZV8A 5HESA 4CXAA 1ZYSA 2PHKA 2R3NA 4KIOA 3TKUA 3U6IA 5GIPE 3W16A 1Y8GA 1Y57A 4LYNA 5CI6A 4R3RA 2V5QA 4AAAA 4AX8A 3OW4A 3R63A 4GT5A 1SVEA 5DMZA 3R9HA 3UG1A 4GMYA 4IZ7A 3BYOA 2UZDA 5LMKA 1J91A 2PZIA 5D12A 5E1EA 4FG9A 3QA0A 4A07A 2X0OA 3MH1A 4E8AA 3OROA 4JQEA 1ZRZA 5J9ZA 4IE9A 2WIPA 5AR2A 4AE6A 4BR3A 4JDKA 4L3PA 1PMEA 1H07A 3DBFA 4UXQA 3TTJA 1YWRA 5ANGA 3QKKA 3FMHA 4O0SA 4NFNA 5DEWA 2HIWA 3OP5A 1O6LA 4I5PA 2UVXA 5AP7A 4DGOA 5AP4A 5LWMA 4FK6A 4G16A 4O4FA 4AXCA 5CS6A 2P0CA 1OL7A 2B9IA 3KCFA 4FKVA 4Q9SA 4LM5A 4PNIA 4ZK5A 2WO6A 3VS3A 1Q99A 3D7TA 3HA8A 4QQTA 4FEVA 3EQFA 3LAUA 1VYWA 5I3OA 5CF8A 5L8LA 4IJ9A 4K2RA 2QQ7A 1PKGA 3CPBA 3W2OA 3ZM4A 4BIBA 1QL6A 1BLXA 2R9SA 4OAVB 1LP4A 3G0EA 4AZSA 5FEDA 3GGFA 4B99A 4U7ZA 5IU2A 5ETFA 4FKSA 3QRKA 4RLLA 4E5WA 3UBDA 4RT7A 5FTGA 3MFRA 3LJ2A 4AQKA 4CFWA 4O1OA 3OEZA 4BF2A 4C3RA 4FEUA 4HVGA 2Z7SA 3N9XA 2GSFA 3E5AA 1TKIA 4IWDA 3CY3A 4MF1A 4UMRA 5J5SA 1VLRA 3JY0A 5EQEA 2YM3A 4E6QA 3RINA 2C6EA 4PPCA 4L7FA 5CY3A 2OW3A 1KE6A 4F99A 5C8KA 3UPZA 3GU7A 2RG6A 3LLAA 3NFGB 5HNGA 4BBEA 5JFVA 2OI4X 2GNIA 3HYHA 4HOKA 3UO5A 5M44A 5K4JA 5IA1A 4C37A 3EHAA 3Q53A 3QCSA 1XBCA 1YXVA 1H27A 3PXRA 1BX6A 5HLNA 4A9SA 3LE6A 4JQ7A 4NWMA 1FMKA 3DT1A 2VTSA 3CKWA 5CZIA 3VN9A 4FZAB 1ZYDA 4U0IA 4OTWA 3HMPA 4FSQA 1U59A 2I1MA 4JOAA 4IEBA 2BTSA 4GUBA 5EQYA 3FL5A 3T3VA 5J1WA 3GT8A 3AC3A 3FXZA 3G15A 2R3PA 3BGZA 3COMA 3DLSA 4C2WA 1P2AA 5GIOE 4ZY4A 3PFQA 5A4CA 4YR8A 3MY1A 1CMKE 2OG8A 3PVGA 2CKEA 3PJ3A 4G17A 5LVPA 3U8WA 3KK9A 1QPCA 4M13A 3UYTA 2W1ZA 4QQJA 4EOMA 4QTAA 3KRLA 3R73A 4YZDA 4FSTA 3KVXA 3GVUA 4LL5A 3S95A 3PG1A 4IAZA 2X0GA 3TZMA 3FL4A 3DGKA 3HV3A 3HX4A 4BZNA 3IW4A 2C6OA 5HNIX 2PMNX 5GZ9A 3Q9ZA 4YC6A 2R2PA 5BMMA 2ITVA 4BIEA 4O21A 4F7SA 3R30A 2GQRA 1KOAA 1IA8A 2YWPA 3A7FA 4O38A 4C4FA 3ZLYA 5KE0A 2A1AB 4KSPA 3O8UA 4I5MA 1Z5MA 3TT0A 4F9WA 2E2BA 4G2FA 2LGCA 2R3IA 2CN5A 2ERZE 2JDSA 4I20A 3C4FA 5AR4A 1OPJA 2W1EA 5AR3A 1TFFA 3LFQA 4X2KA 3AOXA 4MNEA 1J1BA 3EYGA 5CVFA 3U6HA 2XBAA 4GJ3A 5F4NA 1OBDA 1CSNA 1PW2A 1ZYJA 4IDVA 5ETCA 3FV8A 5M4FA 4ORKA 4OT6A 4F7NA 4USFA 3FMMA 3ORLA 5F20A 4GH2A 1U5RA 4I21A 2CNQA 3RJCA 3H0ZA 3ITZA 3ZONA 3ORZA 1H8FA 4C4EA 4CKRA 4C62A 2VX1A 4W9XA 3LCKA 5K9IA 3MN3A 4MQ2A 3E8DA 3AC4A 3AT2A 2FGIA 5E1SA 2ZFYA 1OIUA 2QNJA 4I4FA 3O17A 2QO7A 4CYIA 3Q2JA 1PXOA 3CQUA 3W8QA 3F82A 4OTIA 1U4DA 4FV3A 5EYKA 3HUCA 4AW1A 4PY1A 5HCYA 2YCQA 5GJDA 3SA0A 3W2PA 4IAFA 3RGFA 3RHKA 2YITA 4ZZMA 1WFCA 3TXOA 3ZH8A 2YEXA 4AA5A 1FVTA 3DDQA 2Y4IB 1Y91A 5I9UA 4GYIA 4WBOA 2PZYA 2HWPA 4ERKA 2C3LA 2WB8A 3GU5A 2X8IA 3QQKA 3FYJX 3ZSIA 3PJ8A 4UY9A 4D1SA 1GJOA 3PFYA 4BDIA 4DHIB 3T9TA 2W06A 4HVHA 2QG7A 4PL5A 5ETAA 2G01A 3O8PA 5HHWA 3V5QA 1RQQA 4YJQA 5D10A 4FKGA 2A4LA 4QP2A 4C3PA 2W1HA 3C4EA 4CMTA 3I6WA 3PXFA 2BVAA 3AQVA 4KKHA 4GCJA 3BWJA 1XH7A 4M0YA 4QP4A 4TNBA 2Y4IC 5M56A 5E9EA 4NKAA 4CFMA 4BYIA 4O7YA 3O5AA 3OWJA 1DM2A 3CD8A 4FTOA 4K1BA 1GOLA 4XG8A 5KKRB 5L6PA 3KIOC 3N4VA 3GB2A 5IQDA 2WTCA 4FKPA 1J3HA 4J53A 5CSWA 4MAOA 4QMMA 4AZEA 5HG5A 3QF9A 5BUIA 2XNBA 1OITA 1CKJA 2GNFA 1XH9A 1ZZLA 4D28A 5LVNA 3QYWA 1OKWA 4EBWA 3TDWA 4RX7A 3COIA 4TYGA 3VS1A 4MD7E 5F94A 3TV7A 4G3DA 4R7BA 1DI9A 1XWSA 3TV4A 1I09A 3Q9YA 1SZMA 3IW7A 4WSQA 3F2NA 3LCDA 3FMLA 3HEGA 4M66A 2IW9A 5KKRC 1BYGA 1OECA 2AYPA 3OHTA 3RAKA 5G6VA 3HZTA 4TW9A 3KCKA 4EZ5A 2DUVA 2VWUA 4LI5A 4BTFA 3V8WA 4AXDA 1CM8A 4IB1A 4U81A 3NUSA 5ANOA 4PP7A 2VTLA 4F7LA 4DA5A 1QPDA 2F4JA 3DS6A 3P7BA 3CSVA 4BDFA 5I5ZA 5HNBA 3LFAA 4J7BA 4P90A 1VJYA 3HMMA 4V04A 4A4LA 4ALVA 2OJFE 3G5DA 5EM5A 3P7CA 3MVJA 2JEDA 3ENMA 4XV2A 4PMTA 2X8EA 4JS8A 1BI8A 3EQCA 1CTPE 3HRCA 4ZJVA 2ZYBA 2OZOA 2YLFA 4MNFA 4O4DA 3VO3A 2XNEA 2PUUA 1XQZA 4HW7A 2CJMA 3EMGA 4HCTA 4V01A 1SVGA 1WZYA 1H1PA 2OSCA 3QQHA 2BR1A 3JUHA 4A06A 4FYOA 2GQSA 2C3IB 3F7ZA 3I1AA 4H1JA 4DFNA 4IZAA 1SNXA 4IDTA 4EOQA 2PZRA 3GQIA 2YIYA 3QZFA 2BZIB 4FEXA 4WUAA 3EQRA 2VZ6A 3KXNA 4HYUA 3BPRA 2R3MA 5AP2A 5HCZA 2X7GA 3ZSGA 3AKKA 4JG6A 3SG9A 3C50A 4E4LA 3A61A 2Q0NA 2X6EA 5HGIA 4I6BA 3BHTA 3FI2A 4NCTC 5LWNA 4E3CA 3D5VA 4CMOA 4QMVA 4MD9E 4I94A 2C6DA 3NVKI 2JDVA 5DR9A 4Q9ZA 3RK7A 4JT3A 2X4ZA 2IJMA 1OL1A 3ODYX 3PTGA 2VAGA 2ZVAA 3DXQA 3R9RA 4F78A 3H9FA 4WG4A 2RKUA 5LMAA 4M0ZA 5AWMA 2PVYA 1KOBA 3DCVA 1BI7A 3EFJA 3V8SA 4FKWA 2ZDUA 2X9FA 3IOKA 3NNVA 4FVPA 4TXCA 3QYZA 3O0GA 2G2HA 3TMOA 3C13A 4J95A 4XCUA 2W4JA 3DK7A 3RWQA 1PXNA 2PVKA 2UW4A 2XK3A 1YKRA 3QXOA 4FTIA 5JZNA 3A4OX 1WBNA 2XP2A 4QTBA 3UVPA 1ATPE 2R7BA 3MPTA 4RZVA 4KSQA 3ZYAA 4NT4A 2W9FB 2I0VA 4F9YA 5L2SA 4GKHA 3CY2A 3SX9A 4YZMA 3UIXA 3EL7A 3DZQA 4PX6A 3D7ZA 5KNJA 3BEGA 3CXWA 2OFUA 4AN2A 4ACDA 4EHGA 5FP5A 3RKBA 3ZO3A 3LJ0A 3E3PA 2GU8A 2P33A 4RA5A 3CQWA 1PXIA 3EFLA 3AMAA 2VX0A 4TT7A 5J7BA 5JQ5A 3W2RA 4EK6A 1ZLTA 2RGPA 1H0VA 3HMIA 2DYLA 3QQGA 2WQBA 3EKNA 3LJ1A 3I7BA 3FMNA 3V3VA 4TYJA 4IWOA 3DTCA 4JG8A 4CQEA 2WMQA 4MD8E 4MXOA 2C3KA 5GHVA 2IF8A 2ZMCA 1OUYA 3FMKA 3ZFMA 5EHLA 3Q4UA 3UP2A 3Q6WA 3EJ1A 4FC0A 3AMBA 4Y46A 5JRQA 4AXFA 3PA3A 5JK3A 2B53A 2B4SB 3VBTA 4DH7A 2ONLC 2IVUA 1Y6BA 4I4EA 3G0FA 3NYXA 3V6SA 4XV3A 4FNZA 2ITNA 1JSVA 3O71A 3LQ8A 5C03A 3WZKA 3RMFA 3QCQA 3I0QA 2I7QA 4DG0E 4M97A 4DEEA 2C0OA 1CKIA 3F6XA 4M67A 1VR2A 5JT2A 2IZRA 3FZSA 4IAIA 4QMLA 5BYYA 4DG2E 3UOJA 4ZMFA 2C1AA 3IKAA 4FTRA 3FLZA 1OL6A 2HXLA 4JJRA 2XZSA 3MVHA 3FEGA 4FODA 4FV1A 2Z02A 4IACA 3P0MA 3R22A 3TG1A 3MPMA 3OT8A 4BJJB 2QOOA 5HI2A 4FV2A 4LOQA 5D7VA 4BCFA 4C8BA 4DEAA 3PJ1A 2WQOA 5LVMA 3ZEPA 4O7NA 4K18A 3N51A 1Q8WA 4GVAA 4CV8A 4Y5HA 4DHJA 2XMYA 5CF5A 3R28A 3FMEA 2BRBA 4MKCA 3VAPA 5FXRA 2G1TA 4ANMA 2CN8A 4BBFA 5LCKA 5J5TA 5IA0A 3QRTA 1DAWA 3MFUA 4LUDA 5AV0A 4CKIA 5IPJA 3D14A 5FRIA 4EK4A 2WKMA 3SRVB 3MH2A 4EOKA 3C4ZA 3NW7A 4C4IA 5I9YA 1Q4LA 1KE9A 4FUXA 4CT1A 2KTYA 2IG7A 5HE1A 2BFXA 4XG2A 3R8ZA 3E88A 4BICA 2E9PA 3OCBA 2JITA 4BCPA 3BQRA 4LRJA 1UWJA 5C8NA 3FHIA 3RI1A 1WBWA 4JQ8A 4ZMEA 4NCTA 3V5WA 3W0PA 2BILB 4PTCA 4O6LA 5HVYA 2YM8A 4AOTA 4PF4A 4EL9A 4OTGA 4ZP5A 4XG6A 1KSWA 4HZSA 3TKHA 4M3QA 4IANA 5KCVA 4BWXA 5LJJA 4MBJA 3R2BA 4RFMA 4TYEA 4EQCA 5FDPA 2F2CB 3FY2A 3W0SA 3BX5A 1YXXA 4RIWB 3O51A 4RBLA 4RQKA 4AFEA 5EHYA 3GOPA 3WE4A 4CV9A 5M4UA 2VTTA 4FV8A 3QCXA 3S2PA 3EH9A 3SAYA 5TO8A 5I9ZA 1UNHA 2F2UA 4ENYA 2JAVA 1Q41A 2X7FA 4MVFA 4F7JA 3BHYA 4EHVA 2C5VA 4K0YA 3BIZA 3Q32A 4NU1A 3G9LX 3CLYA 4JLCA 5TF9A 3TDVA 1GIHA 2I0EA 2ITPA 1V0BA 3MPAA 1GZ8A 5IH5A 4N70A 3MDYA 2CGVA 3ZSHA 2BDWA 1OL2A 2ZM4A 4QMXA 2IN6A 2QU5A 3U9CA 5I3RA 3UDTA 3FBVA 4RJ3A 1URWA 4CNHA 3QCYA 2UVYA 2BCJA 3NVMB 2H96A 5CSXA 3WF6A 3RNIA 4F1TA 1L8TA 3V6RA 4YBKA 2UW0A 4FNWA 5EKOA 2QOKA 4GU6A 3ROCA 4BBMA 4QMUA 4IAAA 5IF1A 1Q8YA 2C3JA 2E9NA 3PIYA 5BVNA 2J90A 3KRJA 2ONLA 4GFOA 3P1AA 3QFVA 5DRDA 5M53A 3ZUUA 5EDQA 1QCFA 4RC3A 3WI6A 1W7HA 4RQVA 4Y8DA 3VUDA 3PJCA 4RZWA 4D1XA 4BN1A 4QYYA 3RWPA 4WOVA 1Q3DA 2OH4A 2PPQA 3LFNA 4O86A 2YAKA 2YZLA 3P23A 3D0EA 3UE4A 5DHJA 4FIHA 5HIEA 3O7LB 4BTMA 2VTRA 3BHUA 4GFGA 5IA2A 3NGAA 1GNGA 3KMUA 3PXZA 4LMNA 3U55A 1OB3A 4L52A 4JBQA 4NK9A 2R3KA 3ZUVA 3UGCA 4FOCA 5J87A 2UZBA 4OBQA 4EBVA 2HW6A 4RC2A 3DBCA 4YTFA 1M52A 4IADA 2QKWB 3LOKA 4OT5A 4D2VA 1A06A 2X1NA 4XP0A 3W55A 5IDPA 4JX3A 4EOOA 2QOCA 1PYEA 5ACBC 4FKOA 4IM0A 3F3UA 4BI2A 3IO7A 2WMRA 4RJ7A 4WRSA 1JKTA 1OIQA 3M1SA 4LL0A 4RWKA 5DNRA 3FQSA 4O0RA 5A3XA 5CSPA 5EQPA 1V1KA 3BYUA 5IA5A 2Q83A 4ZS4A 4U3YA 3UPXA 1M14A 5FUTA 5HE2A 4EOIA 3VS5A 1J7IA 4D1ZA 2BMCA 3AC8A 3I60A 3C5IA 4CLJA 4TWPA 2HAKA 4BJJA 2HYYA 4X2FA 3B8RA 2YM6A 3I81A 3P86A 2XAOA 4IC7A 4JX7A 4NEUA 3VRYA 1Q5KA 4E4XA 4PDYA 4UN0C 3A8WA 2YHVA 3ORMA 4TNDA 3COKA 3Q9XA 3NIEA 5A46A 4C4JA 3ZU7A 4YLLA 4FG7A 5A6NA 4BZDA 2VD5A 4FTCA 4AN3A 4U43A 5IH6A 2C6IA 3FLSA 1G8KA 4CFFA 4ZAUA 4I22A 4LV5A 4FIEA 1YW2A 4FSMA 4WO5A 2YCRA 3MS9A 1XMLA 1GZKA 4EQMA 3CPCA 2FUMA 4IQ6A 1YXSA 4ZJIA 2IPXA 1PJKA 3VS2A 3SRVA 1IAHA 4PPAA 5AP5A 3NSZA 5CAOA 4ZOGA 3WF9A 4P4CA 1YOMA 3EQPA 2YLEA 1XMMA 3GCPA 5BNJA 3NFFB 2XK9A 4ZTLA 5EDRA 2FH9A 2VUWA 4O83A 3NDMA 5KHWA 3HUBA 4UB7A 3G2FA 3MSSA 4PL3A 3ZDUA 4C4GA 4FTTA 2YABA 4XNEA 2FSMX 2ZV9A 3NR9A 3W2CA 1LEWA 2IZTA 4FBXA 3ZCLA 4L44A 3ZRMA 4P5QA 4DITA 4QQCA 2YIRA 2BKKA 1ZMUA 1SM2A 5B2MA 3OVVA 1JLUE 4R8QA 3P5KA 4PNKA 1PXPA 3WF7A 4HGSA 3G33A 4FIFA 3ORIA 3PXYA 5ANKA 4AOIA 2ITXA 3A7IA 1W98A 2BRGA 4CTBA 3F2AA 3GU4A 4NJ3A 4NM5A 4LRKA 5DN3A 3LXLA 3PE1A 3VJOA 3GNIB 2O64A 3WF8A 3D83A 4EOSA 4RIWA 4QEBA 5EM6A 4YO4A 1ZOEA 4RIXB 4ZLZA 4AW0A 5DT0A 2PMIA 3DPKA 3EN6A 3CD3A 2OJ9A 1U5QA 3MJ1A 2FVDA 4QMPA 5IG1A 4Y5QA 4J8MA 1GZNA 4IB5A 4EH9A 3LM0A 4FSWA 2HXQA 4BIDA 4H39A 3P5JC 3R1SA 1ZYCA 5E91A 4YGAA 2WD1A 2XIZA 3I6UA 3BYVA 4M7IA 3W32A 2C6TA 4IB3A 3TI1A 3WZDA 3KRWA 4ZSEA 5BVEA 4V0GB 3DNDA 4CLIA 4RX5A 3OG7A 4RRVA 4IH8A 4WD5A 3SXFA 5HTBA 4O4BB 4FR4A 3FZPA 3MW1A 3G6HA 1CKPA 3SOAA 1QMZA 4IC8A 4QT1A 2UW5A 4FTNA 4RSSA 4DT9A 4H58A 3CKXA 5E4HA 2F7XE 3JVSA 3PVWA 4R3PA 3OMVA 2J0IA 3P79A 2F7ZE 4CRSA 1R0PA 2EU9A 3BV2A 3QZHA 4O7LA 4G6LA 3KVWA 3PXKA 3VF8A 3ORKA 3QLFA 2PE0A 4LOPA 2GNLA 3LFFA 3R8VA 3BBWA 2ERKA 1HCKA 2C5YA 2WMXA 3SKCA 4AW5A 3JY9A 5L6OA 4KA3A 5GZ8A 1OI9A 2UZWE 1T45A 5HG9A 5B2KA 3ULZA 4D4YA 5FDXA 2XJ0A 5BX0A 2XUUA 3GC7A 3FPQA 2WQNA 3T3UA 2WOUA 3TCPA 4U9AA 5AV3A 4JXFA 4KS7A 2C1BA 3TNHA 4WNOA 4H36A 1YI6A 1M17A 2AC3A 2QCSA 4TKSA 5M4IA 4DDGA 5HIDA 1UWHA 2G9XA 2YJSA 3TIYA 4E20A 3QLGA 4XG4A 1WAKA 4QYEA 5FXSA 2VTJA 2UZTA 1GAGA 5AR8A 4R6VA 3HP5A 4O4EA 3DBEA 3R6XA 5HBEA 3Q9WA 1ZWSA 4GT3A 2OICA 3DKOA 3GFWA 1H1RA 3PLSA 3V51A 5BUJA 2GTNA 3D5XA 3PRIA 3CEKA 4Z16A 4OAUC 4QQ5A 4XG7A 1LEZA 5DR6A 5IQHA 1BKXA 1OKYA 5I9XA 4HCUA 4FMQA 3A8XA 2NP8A 5DRBA 4YZCA 4YC8A 4ZIMA 4EK5A 5AIRA 3CC6A 4LG4A 5LVOA 4ANNA 3T9IA 4KIPA 3OF0A 3OUNB 4CD0A 4ASXA 4BVUA 5FQDC 3HKOA 4QOXA 4FZ6A 3DTWA 1K3AA 5AUWA 5IEXA 3PPKA 4X6QC 1A9UA 4Y73A 4D2WA 5CLPA 1H25A 4OGRA 2ZV7A 1UKHA 4G3FA 3TZ9A 3F9NA 5AP0A 3VQHA 2GTMA 3OY1A 5DGZA 3U4WA 2Z2WA 4O2ZA 4WNKA 1ZY5A 3FMJA 3FZRA 1UU9A 3CE3A 4R7HA 4X2GA 3TUCA 2O3PA 2OXDA 3IGGA 2J5EA 3DOGA 5EOLA 5F1ZA 5HCXA 5KZ0A 3V5PA 3FZTA 4LGDA 4EHZA 4EUUA 3AG9A 3UG2A 1W82A 1W2FA 3F88A 2WFYA 4MTAA 5DYJA 4TTHB 5M08A 5EI6A 2XRWA 3IGOA 3PG3A 3UIMA 3VS4A 2ITOA 4BCMA 4DAWA 1NT2A 3KGAA 2WMBA 3OS3A 3IS5A 2R7IA 2GFSA 5M4CA 2WMSA 4U41A 3MESA 4U44A 4UZDA 4BZOA 4Y83A 3MB6A 3OT3A 4PV0A 4N0SA 3E87A 1Q61A 3F69A 4NIFB 5AADA 1WMKA 4C7TA 2RIOA 1PXMA 3L8VA 3KA0A 2XH5A 3E64A 3E8NA 3R9DA 3UP7A 3TNQB 4IX4A 4D4SA 1Z57A 2CNVA 3I0OA 4CCUA 3A60A