1BL7A

The complex structure of the map kinase p38/sb220025
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (MAP KINASE P38)
publication title Structural basis of inhibitor selectivity in MAP kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bl7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bl7A01
1BL7A 5DOSA 3VS2A 4RWIA 4F1TA 5GZ9A 1GZ8A 4DC2A 3VN9A 3MS9A 3ZBXA 2ONLC 3TNWA 5M55A 3TZ7A 5AP1A 2A2AA 3ZRKA 5HBEA 3PSDA 4R77A 4B8LA 5TT7A 5J5SA 5HG8A 4FK6A 4F7LA 2YLEA 2ZM1A 4RFZA 3LM0A 3FI3A 3EN5A 1DAWA 2WKMA 4R1YA 3ZTXA 2QOHA 2IJMA 2YIRA 4QMTA 3R7UA 4O2ZA 3QALE 3VS1A 4CT2A 5KX8A 4BDIA 1APME 3NRMA 1FBNA 4JG7A 5E92A 3VBWA 4EORA 4EK4A 4EQCA 3C51A 3RK5A 1NVQA 2QR8A 4QMNA 4DH7A 4AW5A 2E2BA 2UW6A 4OBQA 5D12A 2JD5A 3BBTB 4XLIA 2XNMA 3UYTA 4C3RA 3WIKA 3R63A 4OAUC 5KZ0A 4TRLA 3ZM4A 5TR6A 5AA9A 1Y91A 2YACA 3IDBA 3F5UA 4FV0A 5L2QA 4GUBA 2NP8A 2F2UA 1T46A 3MH1A 2C3LA 3CQUA 2OI4X 4GMYA 3AD6A 5EKOA 2F7XE 5EHYA 4UZHA 3MVHA 3GFWA 4RFYA 4B9DA 3DFAA 4IACA 3O7LD 4HVHA 3BI6A 4FKIA 2BRHA 3ORPA 3BLHA 3DKCA 4M97A 2FUMA 3MI9A 5M06A 2VTQA 4IH8A 4O38A 4F4PA 4FEWA 4DH1A 4MXCA 2IZTA 2W7XA 4PP7A 4RGJA 2XK8A 4IVAA 1WCCA 4LRJA 5EI8A 5BUIA 3IQ7A 2QOFA 4USFA 2BDWA 4UB7A 5E91A 3C4EA 4W4VA 5KMIA 3LFEA 4P90A 5JSMA 2OXYA 4ZSJA 3C0GA 1BL6A 1MP8A 3C0IA 3VWAA 2WB8A 1WAKA 3QYWA 2ZVAA 4FVQA 3RAWA 4E8AA 5IA2A 3GC0A 4AOIA 5AFVA 4DEAA 4FR4A 3R0TA 4MX9A 4GYGA 2KULA 4FV7A 1TQIA 4DT8A 3I81A 1YWNA 3ID6C 2BTSA 5L2IA 3L8XA 4EK3A 4L00A 4C4EA 3OW3A 2VWIA 3SRVB 3ITZA 4DT9A 2VN9A 4EOMA 4CVAA 4BN1A 1ZWSA 4L01A 4IZ5A 3Q32A 3ZC5A 5JFWA 4BFMA 4G3GA 5ANGA 4F9AA 3DTCA 4IBMA 5KBQA 2FVDA 4TYGA 4II5A 2UZBA 4Z7GA 5DWRA 3R8LA 1H1SA 3EMGA 4MD7E 4XG4A 3HUCA 5BMMA 3W33A 5HX6A 3KA0A 3KXXA 3UPXA 5IMEA 3JR1A 3OVVA 3Q4ZA 1QPCA 4L53A 4MYGA 1OGUA 2X7OA 4O22A 3WBLA 1R0PA 1B6CB 3CQWA 5TOZA 4DFNA 3SDJA 2XS0A 3QRUA 4O0UA 2B52A 2YM3A 1JAMA 1YXTA 2W1CA 4ZAUA 4P5ZA 3DJ6A 4HYIA 4QQJA 1UKHA 3KU2A 3NUUA 2IWIA 4S33A 1VEBA 5AR8A 4BZNA 2WMRA 3W55A 2UW3A 4EOLA 4PDSA 3UGCA 4K1BA 3AOXA 2YAAA 3D94A 1F5QA 2WMBA 3I79A 4EBWA 4CKJA 2E9NA 3WYXA 1HCLA 1J7LA 5HOAA 3D5VA 4KSPA 5ANJA 1URCA 4G5JA 4E73A 3QTWA 3QQLA 4X7QA 4CLIA 4NW6A 4RIOA 2PUNA 1MUOA 3A7FA 3OEZA 5M4CA 4NEUA 1W82A 3ZONA 1LUFA 2V5QA 2Y0AA 2O5KA 4MXYA 2OGVA 5HGIA 5IUGA 5E4HA 1W98A 3MH3A 2PVJA 5FDPA 5HORA 4JVGA 4XBRA 1VYWA 1ZYDA 3CPBA 2R3OA 3O8PA 4AA4A 5CANA 4XG6A 3QRJA 5C1QB 3FZPA 4AA5A 3W2OA 1WBSA 1PW2A 5F20A 3EHAA 4MKCA 5LJJA 2RKUA 2W1HA 1KE8A 5K0XA 2BFYA 4QP6A 1OKZA 2DS1A 4S2ZA 3OY3A 5F95A 3G0FA 3MV5A 3R8ZA 4EH8A 1JSVA 1RW8A 3UZTA 4MHAA 3QZGA 5FTGA 4MWHA 5C4LA 3NMUF 5GINE 3BGQA 1AD5A 4JIKA 4ZIMA 3RHKA 3ZLWA 2WMAA 3DNDA 1JSUA 5L2TA 2CKOA 3COIA 4BDKA 4DA5A 3FQHA 3PRIA 5DHJA 4FICA 4HNFA 2WQOA 4XV2A 1FOTA 4FKLA 2FSTX 4O7YA 3FXXA 4D55A 1SVHA 2H96A 3AC8A 3GVUA 4BI1A 3FDNA 2E9VA 5K5XA 3C50A 2QOCA 4MF0A 5DEWA 5HX8A 4UMUA 4K2RA 3JVRA 4OTPA 3G15A 1FMKA 4WUNA 2CLXA 5IUIA 3QKLA 5TO8A 2V0DA 3ZLSA 5H8BA 4EOKA 2I6LA 2A1AB 3PVGA 3R8MA 2YDIA 1PXKA 1JVPP 3K54A 5HD7A 2V55A 4O0TA 2UZLA 3D7ZA 2EWAA 1M52A 5LVOA 4KIQA 1SMHA 5CEOA 3BYOA 3F3ZA 3P7CA 4D9UA 4EOQA 4F1MA 4RLKA 3VRZA 3PVBA 3E7OA 2QOQA 4UWBA 3GFEA 3VW8A 2O3PA 2IZSA 4FKRA 3H0ZA 2W4KA 1TKIA 4ENXA 4QMQA 3A8WA 5KMKA 3AG9A 5FWKK 3CE3A 3EQBA 5AP4A 5BYLA 4IIRA 4ANNA 3L8SA 3FZTA 5CSHA 3WZUA 4YJUA 4CYJA 4IM3A 1UA2A 2FA2A 1H00A 4X2FA 5FP5A 4J98A 3QD0A 4UMTA 2BKKA 4IAFA 4PDPA 3KREA 4ACHA 4H3QA 1O9UA 1R3CA 1PXJA 3POZA 3MFRA 4DAWA 4WG4A 3R21A 3OF0A 4G1WA 3DK3A 4EOJA 2J4ZA 4CTCA 3T3UA 4FNXA 2I0VA 5I9ZA 3R9RA 3OW4A 4WT6A 4CFFA 3UVRA 3BKBA 4WHZA 3LIJA 3NNVA 1Z5MA 4BWXA 2UW8A 2B4SB 5CU6A 5IU2A 2JKMA 3EYGA 1OPKA 4ID7A 5BVOA 5IDPA 3LJ1A 2AC5A 5IZFA 5IH6A 1OIRA 4GSBA 1LEZA 3DAEA 2QODA 3GC7A 3FMJA 5FBNC 4P4CA 4DFXE 4Z3VA 4E6DA 4YTFA 3OCTA 4CLJA 1H26A 4I4EA 4RRVA 3U6JA 2JAMA 4OAVB 1Q4LA 1Q8WA 2REIA 5JMSA 3O50A 5FRIA 4LL5A 3DPKA 5HNIX 5H8EA 5AX3A 4DH8A 4H36A 2JDOA 2GPHA 1YRPA 4QPSA 3BWFA 4RA5A 3MY1A 4XS2A 2VWXA 3Q2MA 4IAKA 4PV0A 5JQ5A 5ACKA 5T3QA 3QZHA 4J95A 3C4FA 3HRCA 2BRGA 5AM7A 3Q9ZA 4UWCA 4DITA 3ZZEA 4EC8A 2C6LA 3HECA 3PSBA 1YXVA 3CS9A 3FY2A 2P55A 5FGKA 2WTCA 4HCTA 3SHEA 4F70A 4N57A 4AN2A 2GNHA 3BHTA 3W2PA 3L8VA 5A54A 4O7ZA 1ZMWA 2BRNA 2ERZE 1JKKA 2BDJA 4CEGA 4DGMA 4I20A 2XVDA 4FSZA 4KIKA 3Q60A 3R83A 3R1YA 2CGUA 3Q9XA 4WNKA 4W4WA 3G33A 3LCOA 4F6UA 4FODA 4G16A 4FKSA 4AN3A 3R04A 4BI2A 4HNIA 2WU6A 5AAGA 3H30A 5HLPA 3POOA 5KZIA 3GOKA 1GZNA 3MH2A 4ENYA 4F99A 3ZO1A 1ZOGA 4BCFA 5DR6A 5A4TA 2PVMA 2ITVA 4AWIA 3UOJA 4RQKA 3R8VA 3C9WA 3CXWA 3NLBA 3PIXA 4FSTA 4D28A 4OT6A 3OWPA 3Q5ZA 4G3CA 2ZAZA 5KMLA 3ATTA 4J53A 4CTBA 3PIZA 2R2PA 3EFKA 3CCNA 3WF8A 4O86A 5EQPA 4QMSA 3A8XA 4I6HA 5AUWA 4A4LA 1U54A 3EL7A 4AT4A 2F49A 2CGWA 3NVMB 5FM2A 3G5DA 4E4XA 3PA3A 4USEA 5F9EA 3C5UA 3HP2A 3CR0A 1U5RA 4CZUA 4I6BA 1JKSA 4GG7A 5EG3A 5HE0A 3OFMA 3PA5A 3COMA 3TDWA 4I5CA 2A0CX 5DMZA 4IB3A 2IVTA 4EHVA 1Q97A 2IW6A 3LXLA 3VHKA 3N4UA 4YZDA 4O7NA 4RX7A 1IAJA 5DRDA 3ETAA 2O0UA 4D2RA 3DLZA 3EQGA 1GAGA 3PXRA 2WTJA 4PY1A 2WOUA 4CCUA 4DFYA 4DN5A 4KKEA 2FO0A 4G34A 4YPDA 5CT0A 2W1IA 2F7ZE 3RPYA 4TWNA 2PVHA 4WNOA 4NCTC 3ZC6A 3TKUA 4DEHA 4EK6A 5JFSA 1K3AA 1ZARA 1ZYJA 1MRUA 5E8ZA 4QMVA 3VS6A 3FMLA 4M67A 3COHA 3EQPA 4R5SA 5TF9A 2YEXA 4AE6A 2J0LA 5HIEA 4P2KA 3I7BA 2QHMA 2FSOX 3MB7A 5DT4A 2PUIA 2BZJA 3H9RA 2WQBA 4QRCA 5AP7A 2RG5A 2QO2A 4YU2A 3DDQA 5AV1A 5ETIA 1OPJA 1Q8TA 5FP6A 3PA4A 4FNWA 2C69A 4LRKA 5LXMA 2XUUA 2OJGA 3ORNA 5KO1A 4OW8A 4MH7A 3AXWA 2X8IA 3PG1A 3VBXA 3HV4A 2J51A 1ERKA 4K9YA 4WRGA 1S9JA 2C0TA 2YJRA 3OWKA 4D1ZA 3ORTA 3CY2A 3ZUVA 1PXMA 4AUAA 1YXSA 1UKIA 1NA7A 2UZVA 3HKOA 4IC8A 4FSWA 4MBJA 5HCYA 4BCKA 2YWPA 1WFCA 3DKFA 3V8WA 3CKWA 5HLNA 2O63A 2X7FA 3I4BA 1WBVA 4EWHA 4FV1A 2WEVA 3UZPA 3UG2A 1JQHA 2OZAA 4WSQA 2CGXA 4BICA 3GBZA 2B54A 5I3RA 5IUHA 2JDSA 4B4LA 4QNYA 1CMKE 2ZB0A 4BTFA 4ZS4A 2XK4A 2XZSA 3PXYA 3PJ2A 3TT0A 2XK9A 4KRCA 4ZMEA 3PPKA 1OUYA 4IB0A 1ZOHA 3QQUA 4DYMA 4DF3A 3P1AA 3QRIA 3ZLYA 4F7NA 3BE2A 4JDJA 3VRYA 4O96A 4HJOA 3BEAA 3PWDA 3QC9A 3RGFA 5L2SA 4R78A 4IAAA 3ULIA 3V5WA 4I0RA 4QMWA 2JDVA 2PTKA 3FLNC 5C8NA 2G2IA 2ZV9A 4DE4A 4EJ7A 1BI8A 2VO6A 1QCFA 2JKKA 4Q2AA 4TW9A 3PYYA 4JOAA 4TNDA 3PJ8A 4PTCA 4A9YA 4BZDA 3NAXA 2ITPA 4M69B 3KK9A 1XH9A 1J3HA 3E63A 2GNGA 3HMPA 4L3PA 2BILB 5AV4A 4BTKA 4WBBB 3DA6A 2Y8OA 3EKKA 4ANLA 1OPLA 3CD3A 2GMXA 1I44A 2QO7A 3GU5A 4L6QA 5D41A 3EB0A 1FGIA 3QYZA 4PRJA 2QLQA 4ZSGA 4DG0E 4L52A 3W2RA 2XM9A 3UIBA 3O17A 1HCKA 1RJBA 2UZDA 2WMTA 3MFUA 1ZYSA 5EW8A 4UMPA 4Y46A 4QQCA 2A27A 3JUHA 1WVYA 4LYNA 4U5JA 3OBGA 5IQBA 5HG9A 4PDYA 4IQ6A 1RE8A 3V6SA 4FTTA 4HGTA 2YCSA 4ZTSA 1PXPA 3FL5A 1WVXA 2WXVA 3R8PA 3NEWA 3LQ3A 4FA2A 5HE3A 5ACBC 1IAHA 2H8HA 3EN6A 4FV8A 3BYMA 4KRDA 5LVNA 2ITZA 5BUEA 4NK9A 5IKWA 1WBNA 3BU6A 3F2NA 3JS2A 3CGFA 2BAKA 4BDBA 1PHKA 1ZZ2A 2W5HA 4ZXTA 4MTAA 5HTIA 2C3KA 2QOOA 1M2QA 1G8SA 4NT4A 3VF9A 1GZKA 4U6RA 3RNIA 5CVFA 3ROYA 4QYHA 1H0VA 3AD4A 2OU7A 3GP0A 4IDVA 4MXXA 5HVYA 1IASA 4GK4A 4OR5A 4IJ9A 4CQGA 3II5A 4ACDA 4O0XA 5CXZA 3UTOA 3D9VA 5LARA 5KMNA 2WTWA 3CJGA 3E3BX 4AGDA 3ZH8A 3HUBA 4UV0A 3W16A 4FX3A 5C27A 2OKRA 1GIJA 3WZEA 1OBDA 2BR1A 4GIHA 4YC6A 4BIBA 4EH7A 2PULA 3ROCA 3WOWA 2H34A 4RIWB 4YP8A 4O2PA 1MQBA 3UIMA 4QP3A 1CKJA 3BE9A 3H3CA 4A4OA 4HGEA 2XK7A 3RK7A 5J9ZA 1AGWA 2ITYA 2RF9A 2OJ9A 5CX9A 1P4OA 3W2CA 4EK5A 2EU9A 3NCGA 3G2FA 4G3DA 4F08A 4GG5A 4RVMA 4BTMA 3HV6A 3UE4A 5JFVA 2LGCA 2VRXA 4ZOGA 3IG7A 4OTGA 4UWYA 4Z55A 2AUHA 4JI9A 5BVWA 4A4XA 2I0EA 2Z8CA 3PZEA 5LVLA 4JBPA 4HYUA 1YQJA 3BV3A 3Q4UA 3BGPA 4C4FA 2VWVA 1KE6A 3LXNA 2GNJA 1Q5KA 2UZTA 3CBLA 2G01A 3TG1A 2QU5A 2CMWA 2YHVA 4CMTA 2X8EA 3IECA 3A99A 4M13A 3R6XA 1H8FA 3R00A 3UOLA 5M08A 3ORKA 1UU9A 3WF6A 5AP6A 3R7EA 4U7ZA 4RZVA 1T45A 3FLYA 4CMOA 3MWUA 4DBXA 3ALOA 2Y9QA 3U87A 2VNYA 5DNRA 3SXFA 4AXAA 3HZTA 3MESA 5BUJA 3BRBA 3MFSA 4BHNA 2ZV7A 2W1FA 1YOJA 5IEYA 4CFWA 2GQSA 3IOKA 4R1VA 5EW9A 2VO7A 4YZCA 3NAYA 1SVGA 1XQZA 3QA0A 3PG3A 3A61A 4QYGA 4MF1A 1H1WA 3R2BA 5ETAA 3RM6A 3RINA 4BKZA 4D4VA 5DT3A 3ZHPC 2UZWE 3UQGA 3I0QA 1UNGA 1DS5A 1KE9A 3FZRA 4GT5A 4QYEA 3KXZA 4FKTA 3UOKA 4DGOA 3P79A 3VUKA 4AZSA 3F7WA 5IQFA 3CKXA 4FUYA 5EM8A 5F1ZA 4YJNA 4CZYB 3F2AA 4RIYA 4LGHA 4JR3A 4RWKA 5FEEA 2QG7A 2W4OA 5CYIA 1CTPE 5A4EA 5AJQA 2WTIA 4I94A 2RG6A 5AUYA 5JQ8A 5CEIA 1HOWA 4O7TA 1TVOA 5HVJA 1M14A 2QU6A 4OUCA 4TWOA 3O71A 4FSMA 3LMIA 3W1FA 3E87A 1PRYA 3OXZA 2XRWA 2YZLA 1REKA 3LFDA 4GU6A 2CKPA 3U4UA 2Z2WA 4J71A 3D4QA 5I9WA 3AC1A 4QTEA 1SNUA 4NTSA 3T8OA 4RFMA 5EM7A 4QP4A 2PY3A 1V0BA 1OL6A 2GDOA 3PY1A 4MQ1A 4M12A 4BGQA 4ITHA 1XH5A 3SC1A 3AC2A 3BBWA 3MFTA 5BVKA 1ZY4A 4E6CA 2HZIA 4AFEA 3DK6A 3LM5A 2W17A 3D7TB 3V5PA 4PMPA 3F2RA 2YFXA 4E5AX 4RMZA 4ORKA 4L43A 3NDMA 3LFCA 5AV3A 2VTMA 5I9YA 1YI6A 2VX1A 3PWYA 4GJ2A 3ZSIA 1QPEA 4LRMA 1E9HA 2Q0BA 2FSLX 4WD5A 1ND4A 3L9PA 4P5QA 4U41A 2VGPA 1LR4A 3NW7A 4UYNA 1UU8A 2UZOA 3Q6WA 4YSMA 4ANBA 4QTDA 3NCZA 5L6OA 1L3RE 1BI7A 5HHWA 2DYLA 3UO4A 4C38A 4GU9A 3QFVA 3C4XA 2AC3A 3RMFA 4FTLA 2DQ7X 3TV7A 4BL1A 3F3VA 1Y8YA 1YI3A 2JEDA 2VX3A 3Q04A 5M07A 2VTAA 4FT3A 4XRLA 4Y5QA 4ZLOA 3R1QA 4JRVA 2VGOA 3DJ7A 5AX9A 3P4KA 5EW3A 5FTOA 4A9UA 3PFQA 5C8KA 3FYKX 4AW2A 3JY9A 4QMYA 4GCJA 4I5HA 1Q41A 3ORZA 4W8EA 4QMPA 3ORXA 3PJ1A 4HZRA 3G90X 2PL0A 1WBOA 2QD9A 3O96A 4DEIA 5J5TA 3FZOA 4XOYA 5HLWA 3F3WA 3HRFA 1YVJA 3UZRA 3KL8A 5CQWA 5AEPA 4FUXA 2UUEA 2CJMA 2XCHA 1PXIA 3MDYA 1SM2A 4HYSA 2XKEA 4IX6A 4JAIA 4L46A 4EUTA 4HVDA 2R0IA 4FKPA 4IC7A 4RC2A 3TL8A 2FH9A 3QKMA 4F0GA 2XKCA 1XH4A 5EK7A 4DCAA 4X2GA 2XJ1A 1JNKA 3EZRA 4APPA 1CKIA 4DLJA 4FEUA 3GCPA 2R3HA 4KKHA 3SGCA 3KGAA 5E1SA 2W4JA 4ZP5A 4MQ2A 5M09A 2WHBA 3N51A 4KB8A 3OS3A 3GCQA 4QPMA 3LQ8A 2XJ0A 5AA8A 2CKQA 3SLSA 3MPMA 2PPQA 3FLSA 3FPQA 3QTRA 3HMMA 5JGBA 2EUFB 3HAMA 3A2CA 2O2UA 5A9UA 5EYMA 4O1OA 3VBYA 2R3KA 2J90A 2Z7QA 2ZMCA 5A3XA 3QCYA 3EKNA 5HO6A 4JX3A 2VWWA 3DBEA 3RWPA 5DEYA 2AYPA 1B39A 2UW5A 5CVHA 4TTHB 3ZXTA 4I5PA 4FT0A 4LM5A 1OVEA 2VTLA 4X6RA 3VULA 4ZLYA 2ACXA 2R3RA 4JLCA 5AR2A 2YM5A 4V01A 3SW4A 4E7WA 5IA0A 4ALUA 4R3RA 4ZTNA 4GK2A 2ONLA 4MAOA 4NSTA 4A06A 3E88A 3PJCA 4IZ7A 1KE7A 1YHVA 3A7IA 4EJNA 2WZJA 2IG7A 1JKLA 3SG9A 3FPMA 1OUKA 5JGDA 2QG5A 2ITNA 3IK3A 3RNYA 2RL5A 3MY5A 3ORMA 4DFUA 3FMHA 2YAKA 3F82A 4HCUA 4AW0A 3WZDA 3V8TA 1H08A 3L8PA 4Z7HA 2R3IA 3O7LB 4L7SA 2C30A 2QOBA 3C4CA 4CG9A 2OICA 2QOKA 4JQEA 5CTPA 3OD6X 1OIUA 4O0SA 4PL5A 4BDEA 4B6LA 3QTIA 4XP2A 4EH6A 3QQHA 4X2KA 3EQRA 4X3FB 2GHMA 5JRQA 3KKVA 3R9DA 4C59A 5EQEA 2XJ2A 4XG3A 4EK8A 3RPSA 3PXZA 4R5YA 4I0SA 3O2MA 1I09A 1M7QA 5CU4A 4XP3A 2XEYA 4O0YA 5HEZA 5HI2A 4JXFA 5CVGA 4JAJA 5BQ0A 3TV4A 4EQMA 4UX9A 1ZYCA 4YGAA 3FI2A 4ACGA 4C0TA 1BKXA 1ZOEA 3E8EA 2RFSA 3LQ5A 3OHTA 4NJDA 4ASDA 4EOSA 1VJYA 5LMKC 5IQAA 3F5GA 3DB6A 3QF9A 4BDAA 4FOBA 3VHEA 5FUTA 3HMIA 4E4MA 4MD8E 2OBJA 2VTSA 3E62A 5CS6A 4D9TA 3NPCA 2JKOA 3QU0A 3QTXA 4YJOA 3GOPA 5KMMA 2R3MA 3QRTA 4FTUA 3L9LA 4KBAA 5BVEA 3ZO4A 3NW5A 5L8LA 2YJSA 3E93A 4ZJJA 4FTMA 5FXRA 1PXOA 2R0UA 4BCIA 4IX3A 3N4TA 4FVPA 2BZKB 1F0QA 2OLCA 3FBVA 3MJ2A 2VNWA 3OZ6A 4BCHA 4X3FC 4DTAA 4GIIA 4JT3A 4KAOA 3UNZA 2QLUA 2FB8A 3ZU7A 3UOHA 2QOIA 3JPVA 4AGWA 1U4DA 2YDKA 4E5WA 3ORLA 5EI6A 3AT2A 2HIWA 5ITAA 3FLQA 2WQNA 3A62A 2R3GA 3PXFA 2EB3A 3BHYA 4UMQA 3MW1A 5L8JA 2VTTA 4GUEA 4LL0A 3WILA 2ZYBA 4BCOA 4FNYA 5E8TA 3UDBA 3N4VA 4V0GB 5HICA 4OTWA 3VS7A 4F7JA 4FKJA 3LLAA 3VS5A 4JIAA 1R1WA 1IEPA 4LOQA 4BKJA 4RBLA 3NNWA 3RP9A 5HU3A 4MXAA 4E26A 4EYJA 2RFEA 3BCEA 3ZYAA 2PZRA 4FZFB 5L3AA 4OTIA 4JRNA 4CFMA 4YZ9A 5GJGA 2G2HA 5TE0A 1K2PA 5AUZA 3WE4A 2Y4PA 5IQCA 3PLAE 3MTFA 3DK7A 1H1QA 3IW4A 5E8VA 4IDTA 4DEGA 5B2LA 4RX8A 5J1WA 4QTBA 2JDRA 3PP0A 2OFUA 5C26A 4LQMA 1U59A 3DCVA 5CU3A 3OY1A 2RGPA 1OL2A 3GB2A 2XK6A 3SRVA 1V0OA 4CRSA 3AC5A 4E3CA 4FT7A 2UW9A 5HIDA 4MD9E 3WYYA 4FE2A 2C0IA 5TKDA 3BHVA 1GOLA 1KOAA 4D58A 2XIRA 2VTRA 3LCSA 4S30A 3LPBA 3I6UA 2VU3A 2OG8A 1GNGA 2I0HA 3CP9A 3EH9A 5M57A 4FL3A 3TZMA 2EXEA 3FC2A 4ZSAA 4CGAA 3E8DA 3AGMA 3F3UA 4EL9A 1OMWA 1PY5A 3OT3A 5DR9A 4AOTA 1PYEA 2WU7A 4RIXB 2BROA 2GNIA 3GGFA 3NUNA 4U0IA 3BIZA 3F69A 3JYAA 4XP0A 5LMAA 5CENA 3GU4A 5E1EA 5GHVA 4S34A 1ZLTA 3TM0A 3RHXA 3PPZA 2PUPA 4DGNA 3ZMMA 3H0YA 1WVWA 2PE2A 2V62A 3FMKA 3NR9A 2GS6A 5KE0A 5DN3A 4DH3A 2QURA 3Q3BA 4RJ3A 5IA5A 3AGLA 4C61A 3KVWA 1ZY5A 4TYHB 3HA8A 3DT1A 3CPCA 3ZRMA 5JEBA 3VNTA 4O7WA 2B53A 2XP2A 2IPXA 4DEBA 1J1CA 1OKYA 3L1SA 5EFQA 4FTAA 3AT4A 4FV9A 2Y6OA 3UVQA 4FV4A 5ANKA 4PTGA 2VTHA 4FTRA 3QZFA 1Q3DA 2HOGA 2CKEA 3FWQA 4JBVA 3GCSA 4BB4A 4C62A 2I40A 3NNXA 4QP9A 3FKLA 4RWLA 4TYIA 4DLIA 5BVDA 4DFBA 4Y72A 5DR2A 3DKGA 3THBA 1LEWA 2XA4A 4FTNA 2A4LA 3AQVA 1YXXA 3E8CA 1NY3A 3DU8A 3QTQA 4HPTE 3ANQA 4OBOA 5GIOE 1ZRZA 3KMMA 4FKVA 3UC3A 2WMSA 2R5TA 3G9NA 3P78A 5DFPA 4AAAA 4J99A 4IM0A 4DG3E 2X7GA 3MH0A 4FF8A 4KIPA 2OIBA 4BDCA 2XIKA 4D1SA 1QMZA 2OSCA 3I0OA 4K33A 3Q96A 2JBPA 3DXNA 3ORIA 2FYSA 4H1MA 3S2PA 4KINA 3LE6A 5E8XA 3FHIA 2HW7A 4U3ZA 4RVLA 3R73A 4D4YA 1XH6A 3QWKA 4RC4A 5GJFA 3VS0A 2DUVA 4IE9A 2GSFA 2G15A 4NYEA 3KXHA 2HW6A 1YDTE 1RDQE 5J9LA 3I1AA 3U55A 3M11A 5EHLA 1JBPE 4UALA 4MBIA 2YM7A 5C03A 4I22A 2YIYA 4V05A 4NL0A 5CF8A 3C1XA 2CHLA 3BGZA 3JY0A 3EN9A 3FXWA 4DBNA 3P7AA 1BYGA 2R4BA 4YJVA 1FGKA 2ETMA 2OXDA 2Y4IB 4FV6A 5KMOA 4QP7A 4IWOA 1XBBA 4C02A 3GQLA 3K5UA 2F9GA 4W9WA 2OIQA 3BQRA 3UYSA 3LFFA 3P86A 4L8MA 4YPSA 2I7QA 1OI9A 4CD0A 2CCIA 4Y8DA 4GT3A 4BF2A 4EH3A 2OO8X 3IPHA 4ZZOA 2VWZA 4I41A 4K11A 3QC4A 4D2WA 3DDPA 2X4ZA 3QQJA 4PX6A 2OZAB 4ZK5A 3RVGA 4GKHA 4H3BA 5IISA 3NIEA 3NVKI 5AUXA 2HXLA 4G17A 4B7TA 5C4KA 3B8RA 4TXCA 5EYCA 4RJ4A 4RT7A 4BBFA 2WGJA 4JG8A 4XG8A 5IDNA 4H05A 3UMXA 2WMUA 3GI3A 3QRKA 3OCSA 2XBJA 1YXUA 5I9VA 3OOMA 4M14A 4FKUA 3BYVA 5GZ8A 4YHFA 4G6LA 2ZDTA 3WIGA 5J1VA 1YDRE 2UZUE 1CKPA 3IOPA 4F0FA 2YABA 3DY7A 3JXWA 4YUQA 3BU5A 3LFBA 3W2QA 3F7ZA 2C1BA 4FG8A 2OJJA 2ZOQA 3QCXA 4D1XA 4YO4A 1IA9A 3MY0A 2PVYA 4FOCA 4GV1A 3A7HA 2BRBA 1IG1A 3A7GA 5AV0A 1P2AA 3BQCA 5T6KA 4AGCA 2WTKB 3KFAA 5IQEA 2HZNA 4R7BA 4C4HA 3DBDA 1JWHA 4XEYA 3CSVA 4R6VA 3IW5A 4C36A 4DFZE 3IW8A 1A06A 3FY0A 2NRYA 4HVSA 4JBQA 3PE2A 3DQXA 4H1JA 3IW7A 4G9RA 3CGOA 4Q9SA 2HCKA 4FV5A 3FSKA 5CF6A 3ALNA 4PNIA 2XNGA 4MNFA 4LG4A 5K4JA 4G2FA 2HZ4A 4EI4A 3FE3A 3V6RA 5B7VA 1W84A 5HTBA 2BDFA 3QD3A 2ZM3A 4M0ZA 2RFNA 3EFWA 4CNHA 3UODA 3V5TA 5CEPA 3SQQA 1V0PA 2JIIA 5IQHA 5CI6A 3L9NA 3Q2JA 1Q24A 2P4IA 1BX6A 2X2KA 2EB2A 1MQ4A 2XH5A 1WBPA 2BZHB 3CC6A 3PZHA 3S1HA 2GFSA 5CAPA 3FLWA 3R1NA 4TKSA 3OUNB 4XMOA 4FTOA 2W05A 3WE8A 3EQCA 3CJFA 5D7AA 4NCTA 3V01A 2VWUA 4FSUA 2QKWB 3MPTA 4K8AA 4EH2A 4FTJA 4IAYA 3ZUUA 2P33A 4OLIA 2JFMA 3CTJA 2J6MA 4K6ZA 3U51A 3UVPA 1YWRA 5K5NA 3GT8A 3KCFA 4OT5A 3ZO3A 4O21A 4G6NA 5E9EA 3CTQA 3VUTA 4CYIA 5LWNA 4FTQA 3SX9A 5E8UA 4ITJA 4NM3A 5I0BA 5HO8A 2RSVA 2QCSA 4KIOA 3HAVA 3LFAA 4FEQA 3OC1A 4YLJA 2JKQA 3HX4A 4TNBA 4AN9A 2CDZA 4M84A 1XJDA 4B8MA 4C57A 1R39A 2GNFA 4N0SA 4FSRA 4HPUE 2V7OA 4U80A 1PXNA 2R7BA 5FBOA 3DAKA 3MYGA 4XG7A 1TQPA 3CEKA 4XG9A 3D5XA 4NM0A 4G5PA 4ZY4A 4F09A 5FEDA 2X8DA 2ZM4A 2E9UA 3HNGA 4RX5A 1VYZA 3EYHA 4QPAA 3R30A 3S0OA 4IFCA 2CCHA 5EM6A 2PYWA 3ODZX 5J7BA 3ENMA 4FI1A 2QVSE 2C3JA 3DXQA 4PQNA 1GJOA 1WBWA 2JLDA 3RCDA 2YIWA 5L2WA 1H0WA 4IVBA 2GS7A 4ANOA 2EXCX 4RZWA 5HIBA 3G0EA 3RAIA 1H01A 1XBCA 2OJFE 3DZQA 3TZ8A 1L8TA 4QNAA 3OXTA 3FMDA 3D2IA 4G9CA 5LCJA 4KBCA 4RG0A 4YMJA 4AP7A 1P14A 4ZTHA 1NVRA 1PXLA 2Z7LA 2JDTA 4RLLA 1GIIA 5D7VA 5ANEA 3PSCA 5HG7A 5BYZA 3DOGA 4L45A 2P0CA 3FEGA 3IKAA 3QUPA 4GVAA 3FXZA 4BZOA 1P5EA 5CNNA 1KV1A 5EKNA 4F63A 3R7OA 3W8QA 3FHRA 3TTIA 3BEGA 4JDHA 4DINA 4CKRA 4A9SA 2A19B 4IX4A 2HK5A 2EVAA 3CQEA 1M7NA 1WBTA 4O83A 5BYYA 2O65A 1E1XA 3SXSA 5AADA 4LV8A 4YHTA 3Q4CA 2NO3A 1R0EA 3QTUA 5CAUA 3QKKA 4BCMA 4X2JA 1Q61A 1GZOA 1XH7A 2CPKE 2W5AA 3QTZA 4WA9A 4B0GA 4FMQA 4NIFB 3IDPA 3ODYX 5I5ZA 3FMNA 3P08A 3UIUA 4BWPA 3U54A 4R7IA 5CSWA 3KULB 1OKVA 2XF0A 2WMWA 4M8TA 4RIYB 4YO6A 1XO2B 4EOIA 4I92A 4FZAB 3HL7A 3BZ3A 3E92A 1PJKA 2R3NA 3KRRA 5DE2A 2PVNA 4EWQA 2W1DA 3NYVA 5H8GA 4FZ7A 4ITIA 4H3PA 2W99B 3RPVA 3V5QA 5H3QA 2C6DA 4GK3A 4ARKA 2IVVA 4IWQA 1TQMA 2ZJWA 4GW8A 4F0IA 4WNMA 2B1PA 5HKMA 1KE5A 3QBNA 3FUPA 4APCA 4GKIA 5HD4A 1E1VA 2PVRA 5CAOA 2C6TA 1Y6AA 3K2LA 2CNVA 3Q9YA 4YZMA 2R3FA 1OECA 4YC8A 4M69A 4N70A 2J50A 3WF7A 5CSPA 4NFNA 4LFIA 3I5NA 1NVSA 1DI8A 4YJTA 3R7IA 2J5FA 3LFSA 4E6AA 3DBFA 4GEOA 1SYKA 4N6YA 2XIZA 4BY9E 3UP7A 5EHOA 2UVXA 1U5QA 3KB7A 4MNEB 4C4IA 4I23A 1PMNA 2WO6A 2Y6MA 1Q99A 3S00A 1YDSE 1ZZLA 2C68A 4U79A 4R7HA 2X1NA 4WO5A 4TN6A 3A60A 4GH2A 1FINA 3O51A 2YCQA 4ZLZA 3VQUA 4I3ZA 4XV3A 4DTKA 5GIPE 3OP5A 1W0XC 3VUMA 3EQFA 5E8SA 4NZWB 3BU3A 1H1PA 3H4JA 4PPBA 5HCZA 5HG5A 4AZFA 2DWBA 2C47A 3B8QA 4BGGA 3KXGA 5CF5A 3KVXA 4CRLA 3NYXA 2CNUA 2XIXA 4FT9A 2IVUA 3F5PA 4BDJA 4DTBA 4OTDA 4C4JA 3W18A 2WIHA 4N6ZA 2XYUA 2C5VA 2ZB1A 3RBWA 3RAKA 3VBVA 3WI6A 3QXOA 3R9OA 4L3LA 5IEVA 3R22A 2ZV2A 3PY0A 5CF4A 2CNQA 4YJPA 3F66A 1H27A 3EQDA 3FQSA 2HWOA 2OH0E 4X0MA 1OB3A 1YOLA 5B2KA 4RSSA 5EOLA 2V22A 2Y7JA 4ZMFA 3R7GA 3TKIA 4O7RA 5IMXA 3HVCA 3LLTA 3WZJA 3G6GA 4PP9A 3V5LA 4O27B 5LQFA 2PZPA 4NKAA 3KY2A 4U81A 4BCGA 4BGHA 5DGZA 3HYHA 2IW8A 1YKRA 4F6SA 5IF1A 4GRBA 4RIWA 4YHJA 3ZEPA 1DAYA 2UW0A 3GUBA 3SW7A 3U6HA 2I0YA 4K0YA 1NXKA 3TV6A 3IGOA 2X6DA 2ITOA 3DKOA 4FIEA 4MVFA 3EN4A 2WPAA 4U8ZA 3TJCA 4FSNA 3HRBA 5HE1A 5FLFA 5J8IA 3VUIA 3RZBA 4KKGA 3TCPA 5LOHA 2YCRA 1FVTA 4G6OA 2YM4A 3OCBA 3ZUTA 1IA8A 4CXAA 4GVJA 3DS6A 4U44A 4XHKB 5CNOA 3E7VA 4PMSA 4EZ3A 2GHLA 2X6EA 2GQGA 3KRWA 4MEDA 4FKGA 5HE2A 5CZHA 3LOKA 4AG8A 5FTQA 2F7EE 3TIZA 4BI0A 4YJRA 2UW4A 4YR8A 1J7IA 4K77A 3VIDA 4W4YA 4QT1A 5AV2A 5AP0A 4UMRA 5ICPA 2WMXA 4TT7A 5CEQA 4ERWA 3KCKA 3LKMA 3I7CA 4O6LA 4TZRA 2OK1A 3CLYA 5DVRA 4EZ5A 4FIIA 4OGRA 2J9MA 4C2VA 4M3QA 1V1KA 2YCFA 4C3FA 3EQIA 4NKSA 1JLUE 2QONA 5E8WA 4C3PA 5CQUA 5M4UA 4R3CA 5EI2A 2FGIA 3NX8A 1ZYLA 5H2UA 5DA3A 3R9HA 1CDKA 5D11A 3SOCA 2Z60A 3OXIA 3PY3A 3FC1X 3LXPA 3DJ5A 2XNEA 4HGSA 5D10A 3HGKA 4YBKA 1LP4A 3KXNA 1JOWB 2F4JA 2JITA 1GIHA 4IXPA 4ZY6A 2VX0A 2J7TA 1O6KA 4D2SA 3EN7A 3SV0A 2BHEA 3C7QA 4D0WA 2BKZA 4I6FA 4F9WA 3GU6A 3GU8A 4PUZA 4QP1A 2JAVA 4RJ6A 4JNWA 5D9HA 2HYYA 3M2WA 4H39A 4BTJA 3KRJA 4NTTA 4CCBA 3DNEA 5H9BA 4EH5A 5FD2A 2YDJA 3F3TA 4QOXA 5LMBA 4XH6A 5GNKA 2W9FB 4YZBA 3HMOA 3KMWA 2HY81 2X4FA 2EXMA 3D2KA 3A7JA 3L9MA 4C33A 1S9IA 2SRCA 4JQ7A 4BBEA 2P3GX 4GT4A 3DAJA 4QYYA 4XG2A 5IH4A 2PMNX 3D83A 2QR7A 4DG2E 2ITQA 2OZOA 1B38A 2PMLX 1UWJA 2R3JA 5K0KA 4EONA 3D7TA 4FGRA 5HTCA 3TACA 4EKKA 4TY1A 4D5HA 5J95A 5M53A 5ANDA 3UIXA 4PNKA 1U46A 5KHXA 2QNJA 4J96A 4FT5A 3IGGA 3PP1A 3REPA 4XCUA 2YM8A 3ERKA 2JIVA 5AAFA 3O8UA 3MB6A 4K18A 3DB8A 2BFXA 4AA0A 2VTIA 3D0EA 4B99A 4E4NA 4EZ7A 5M44A 2HWPA 2C5XA 4O84A 4GS6A 2XM8A 4PDOA 4XYFA 3FLZA 3LJ2A 2BZIB 4Y95A 4NW5A 4UEUA 4EEVA 3FV8A 4AZVA 1Q3WA 3G6HA 3NYNA 4HCVA 4KNBA 2GCDA 2QC6A 3MIAA 4QMLA 5AMNA 4ZSLA 4F1OA 3RKBA 4E4LA 2BMCA 3AMAA 5CSXA 3PTGA 4FYOA 2XIYA 4IM2A 3EWHA 4BC6A 1OBGA 2XNBA 1H24A 5HCXA 4KA3A 2WAJA 3QAME 3KRLA 4QMOA 4FKWA 5AR5A 4FYNA 5EDPA 3VF8A 1PMUA 2CSNA 5CU2A 3VJNA 4ASEA 2ITUA 1QPJA 1Q8ZA 1REJA 3R71A 5A6NA 3R02A 5JGAA 2HAKA 3R01A 4M68A 4X2NA 3FZSA 4IB1A 3FZ1A 3V5JA 1IR3A 5JKGA 3A4OX 4KD1A 3ATSA 1JSTA 5K4IA 3MGYA 3T9IA 4Y5HA 2VWBA 2WOTA 3OTVA 2YZAA 1XBAA 4IVDA 3FI4A 3TIYA 5IG1A 1UWHA 3QZIA 5KBRA 2OF2A 4CFXA 4GL9A 4PPCA 3ZO2A 2YLFA 2P2HA 4E5BA 2NPQA 2UZEA 2VTJA 3KN5A 3P7BA 5HZNA 3K3IA 3VBQA 2RIOA 4ANSA 4WKQA 5CY3A 2J0KA 4LI5A 4D5KA 2BRMA 2XB7A 4XX9A 3TEIA 3F5XA 5IA1A 3RZFA 5KKRB 5L6PA 4EC9A 4EOPA 1EH4A 2QI8A 4IWDA 4HVGA 4LOOA 3SAYA 3QUDA 1XH8A 4DHFA 4NH1A 1M2PA 5CT7A 5EDQA 4FKQA 3KF7A 2YISA 4P7EA 4DH5A 4J8MA 2R3LA 4KSQA 2E9PA 2HZ0A 5E7RA 2H6DA 3DQWA 5CZIA 1FQ1B 4ZEGA 4JJRA 3O23A 5J7HA 4LGGA 3OG7A 5IQDA 4R8QA 4Q5HA 3ZFYA 4JL9A 1UNHA 1DI9A 4LMNA 3AD5A 2BAJA 4BBMA 3KRXA 4PTEA 4OTHA 2UVYA 2ZV8A 4X21A 5CSVA 3QGYA 4JX7A 5GJDA 3V51A 5CXHA 5EQYA 5HNGA 4NUSA 5KUPA 3C4ZA 5M56A 2UZNA 5LMKA 3QLFA 2VTNA 5BPYA 3QQGA 5CEKA 2WD1A 1H25A 2R9SA 3K3JA 3W32A 3LZBA 4FL2A 3OT8A 4RPVA 4PMMA 5KKRC 5FM3A 4GJ3A 4MCVA 2B9FA 3F88A 2OJIA 3BLRA 2WIPA 3VC4A 5CAQA 3P9JA 3TNPC 2KTYA 2XNNA 4XBUA 5EYKA 3P0MA 3SD0A 3MPAA 4FK3A 4AGUA 4AZTA 2IVSA 2X81A 2OIDA 2BIKB 3TZ9A 4C58A 1WZYA 5A4CA 2C6KA 2ESMA 4X3FA 5M4FA 4L44A 3K5VA 4U9AA 5B2MA 2X9FA 2XYNA 1KUTA 5DLSA 5HO7A 2GS2A 5L8KA 1GY3A 2W1EA 4EKLA 3COKA 2C6OA 3FYJX 4CQEA 1OKWA 4ANMA 2BVAA 4O91A 2W5BA 5AR4A 3ZZWA 4FC0A 4U40A 3C13A 2J5EA 3DBCA 3LCDA 1LPUA 3FAAA 3DV3A 3QUEA 3VS3A 5CI7A 4FBXA 1PF8A 4ZTLA 3ZRLA 1NW1A 2JC6A 2XEZA 4LUEA 3OUKA 1OL5A 2PK9A 4GFGA 3GXLA 4JG6A 2Z7SA 4HW7A 2QHNA 4WBOA 5DRBA 2PHKA 1W83A 1KWPA 3QTSA 5IQGA 2YITA 5DYJA 3AMYA 4JR7A 2WNTA 4KIKB 4OTFA 5IA3A 3GEQA 4YZNA 4QMUA 4QP2A 3LMHA 3PDTA 2HELA 4TYEA 3LAUA 3QCQA 5CAVA 3D14A 3IW6A 3MVJA 1YHSA 1YOMA 4I1ZA 4YTHA 5JRSA 1XWSA 5G1XA 3SVVA 4KUJA 1IRKA 3WARA 3QHWA 2YN8A 1ZAOA 3BYUA 3SKCA 2RFDA 2NRUA 4BCQA 3NWWA 5AUTA 4O0WA 4GFMA 5EYDA 3GNIB 4O82A 1P4FA 5BNJA 3MIYA 2IW9A 2UVZA 2F57A 4V0GA 5L6WL 2C0OA 5DI1A 3OWJA 3HDNA 3AC3A 4M0YA 3SXRA 4FKOA 2PE1A 3MVMA 1U54B 5DT0A 4V04A 3ULZA 3O8TA 1MRVA 1A9UA 3SA0A 4JDKA 4D4SA 4L7FA 3KF4A 3PVUA 4IB5A 4QTCA 4C7TA 2F2CB 4FIFA 3ACJA 3HDMA 4TL0A 3WF9A 4FGBA 1PKGA 3EOCA 4TWCA 4CV9A 2VAGA 3FQEA 5HNBA 1YHWA 3KQ7A 3CIKA 3QWJA 4IAIA 4ZS0A 2B9JA 5FXQA 2YM6A 2OW3A 1PKDA 3GU7A 2GTMA 2HENA 3LMGA 3MBLA 2PSQA 4PPAA 3R2YA 5AWMA 2WEIA 3W2SA 4HOKA 4A9TA 2BCJA 4FV3A 2B9HA 3B2TA 5FDXA 5I9XA 3M1SA 3FJQE 3VJOA 4BCNA 3RAHA 4O81A 4CV8A 1OM1A 4C34A 3CTHA 1BLXA 4YTCA 4BKYA 2VD5A 3U9NA 2GHGA 2VZ6A 2P2IA 2CN8A 4HVIA 1W7HA 5BVNA 3CY3A 4ACCA 1H4LA 4DGLC 2C6MA 4S31A 5JFXA 5M4IA 3IONA 2JBOA 4ACMA 4KBKA 2PZYA 3Q9WA 2CN5A 4FV2A 3GENA 3OTUA 3MN3A 5HESA 2BIYA 4OTQA 4L68A 1H1RA 5KMJA 3GCUA 3RPRA 1Z57A 3ZBFA 4KWPA 4X6QC 4XV1A 4YBJA 4RIXA 4RVTA 3UMWA 3MA6A 3ZEWA 4Y85A 5JN2A 3NS9A 1BUHA 3OBJA 2PVFA 3AT3A 3S4QA 1UVRA 4LMUA 1XKKA 2BAQA 5JZJA 4HYHA 3QA8A 3ZOSA 4CFNA 5C8MA 4OTRA 5AIKA 4IADA 2QKRA 2ITTA 3ACKA 3RPOA 4F7SA 3TNQB 2J0IA 3KXMA 2OXXA 3OEFX 2OFVA 4M66A 3NGAA 2WTVA 2XCKA 4I21A 4A07A 4DEEA 3NNUA 4CMUA 5IQIA 2PMOX 1M17A 4RC3A 3W8LA 3BX5A 4TYHA 1PMEA 4G3FA 3LCTA 3MSSA 4I6QA 3TKHA 4FIGA 2R7IA 3HV3A 3BHHA 5DBXA 2IZUA 4E93A 3O0GA 2ERKA 4ONAA 4AZEA 4AQCA 3E5AA 4YJSA 2W1ZA 4WG3A 3VS4A 4L3JA 3PXKA 3EL8A 3BPRA 4O1PA 5ANIA 3ZS5A 5EOBA 4LGDA 3BELA 4FEXA 3BV2A 1FVVA 4G31A 5IH5A 5JH6A 5A46A 3IS5A 4U45A 3PIYA 3Q53A 4AZWA 1VR2A 1OL1A 3OROA 3B2WA 1K9AA 4AX8A 2Y4IC 1QPDA 2XMYA 3ZXZA 3IDCA 4DFLA 5CU0A 1WMKA 4FL1A 4TYJA 4AACA 3UQFA 4WIHA 3QD2B 4Y83A 5C01A 4NU1A 3VUDA 5HBHA 4C2WA 3SG8A 4M15A 3AC4A 2J0JA 3U9CA 4AFJA 4BWKA 2HXQA 3Q6UA 3I5ZA 5DH3A 4D4RA 4CG8A 3ZDUA 4JDIA 4O7VA 4IJPA 4NWMA 2WQMA 4AW1A 5ANOA 5A4QA 5LWMA 1Q8YA 4RX9A 5T68A 5IEXA 2ETKA 2QOLA 3UPZA 1M2RA 4E20A 3BYSA 5EDRA 2R3QA 4F9CA 3G9LX 3MJ1A 5BX0A 3R9NA 5I3OA 4ALVA 5KHWA 5M51A 3DXPA 3UNKA 3ZSGA 1G3NA 5AUVA 3D15A 3QQKA 2R64A 3UBDA 5CLPA 5FEQA 2YA9A 4L67A 3T3VA 4UBAA 2ITWA 1YWVA 1XR1A 2J2IB 2YIXA 2BHHA 4AT5A 4YC3A 1FPUA 4I0TA 4YLKA 4E1ZA 1UV5A 1Y6BA 4S32A 2ZMDA 4YJQA 2G1TA 3ENHA 3KK8A 3TXOA 2I1MA 3Q52A 4D2TA 4L9IA 4BDFA 2C3IB 4D2PA 1SVEA 2YWVA 5JT2A 5FQDC 3FSFA 4IAZA 4NFMA 4CSVA 5E90A 3S3IA 2IN6A 3S95A 4ZZMA 3G51A 3ZLXA 2PVKA 4FIHA 4C4GA 4F9BA 5BMSA 4LOPA 4ANQA 2BPMA 5G6VA 3F61A 4WNPA 2GQRA 4BIDA 4F6WA 5DPVA 5F4NA 3R8UA 4C37A 4J8NA 2XKDA 3BWJA 4A9RA 3PUPA 4PL3A 2W06A 2WTKC 3NIZA 1ZMUA 4ALWA 1SZMA 3VQHA 4ZZNA 5FXSA 1H07A 1BMKA 2BUJA 4NM7A 4DCEA 3GQIA 3EJ1A 3PVWA 4FG7A 4ERKA 3ZFXA 4FIJA 3U4WA 2YERA 3V8SA 3OMVA 4CZTA 3UQCA 5AR7A 3PJ3A 2NNWB 3LCKA 2O64A 3F6XA 4QD6A 4UN0C 3ELJA 3RK9A 1Y57A 4WSYA 4ZTQA 4FG9A 4FZDB 3VVHA 3WF5A 4IZAA 3NUAA 3VBTA 1FVRA 4C8BA 3EZVA 4PF4A 4EBVA 1H28A 4UXQA 3QHRA 3QLGA 3P5KA 4PWNA 4XNEA 3AMBA 4N4SA 3KMUA 4XLVA 4CFVA 3DLSA 5ETCA 2GFCA 2PZ5A 3Q4TA 5CALA 3QGWA 3QQFA 4XV9A 1X8BA 3R7YA 4AT3A 2GNLA 3C5IA 2VO3A 3TUBA 3UO5A 5C9CA 2GU8A 4AF3A 2O8YA 1G5SA 2E9OA 2IZRA 4DEDA 5BVFA 2C5YA 2C4GA 1J1BA 3EFJA 3FMEA 2B55A 5EH0A 4AS0A 4UXLA 3FMMA 4I5MA 4J52A 4Y73A 3RJCA 4ASXA 2W0JA 3P23A 4BYIA 5HU9A 3RCJA 5IPJA 3PRFA 5K3YA 3NUPA 1VZOA 2QQ7A 3EQHA 3LFNA 2WMQA 4Q5EA 4WUAA 2LAVA 4FEVA 1KSWA 5LVMA 4EH4A 3M42A 3NW6A 2WFYA 1PMVA 3OOGA 4PL4A 4U97A 4YNOA 2UV2A 4J97A 4BDHA 3TN8A 3UO6A 4EHZA 5I9UA 3ZFMA 3ANRA 5CASA 5CWZA 4CFUA 1CM8A 5J79A 3EIDA 3NUXA 3HV7A 4H58A 1MRYA 1AQ1A 2C6IA 3VUHA 3LHJA 3R1SA 5A4LA 1JKTA 3LVPA 4J7BA 4KS8A 4QMZA 4X3JA 3RWQA 3NSZA 5AIRA 5DIAA 4IW0A 4O7LA 4CT1A 1O6LA 4IFGA 1R78A 1QL6A 2JGZA 4IHPA 3FKOA 5CEMA 3FI8A 4AE9A 4XUFA 3PXQA 4DGGA 2XBAA 1OL7A 2ETRA 5AP5A 4A7CA 5JK3A 3DFCB 3W10A 4USDA 2CLQA 2OH4A 3ZCLA 1CSNA 2C1AA 4RJ7A 2XNOA 2VTOA 3QL8A 1STCE 4EH9A 3LXKA 4W8DA 2PMIA 2V7AA 2W96B 2B9IA 2ZDUA 4RA4A 4W9XA 4I24A 3R7VA 2VUWA 4MXOA 3QD4A 4IEBA 3ZDIA 3D5UA 3HP5A 1KOBA 2OWBA 3PE1A 4ZY5A 4EOOA 2FSMX 2C5NA 2X2MA 3IO7A 4IVCA 5LVPA 1URWA 3HV5A 3E64A 4L42A 4QQTA 3UP2A 4ZTMA 3TUCA 3ZM9A 1OITA 4EQUA 3C0HA 3GCVA 4EHEA 4YTIA 3HLLA 3TTJA 3TUDA 5AUUA 3H9FA 3GC9A 4FTIA 3H9OA 2VO0A 2GTNA 2CGVA 2G9XA 3MTLA 4XRJA 5HVKA 5DG5A 4U42A 4BYJA 5AAEA 4FZ6A 4NJ3A 5AP2A 3ET7A 3H10A 3SOAA 3EFLA 4FNZA 3CD8A 2J0MB 4BHZA 1Q8UA 4J1RA 3PLSA 4I93A 4JQ8A 4R3PA 1Y8GA 2HY0A 2WELA 4UY9A 4F64A 4YNEA 3TWJA 4WOVA 4Q9ZA 3F9NA 2Z02A 2B0QA 5L4QA 1DM2A 3VO3A 4TPTA 1G8AA 4F9YA 2WQEA 4IX5A 2IO6A 5HBJA 5IA4A 3DBQA 4RQVA 1YI4A 3HEGA 3VAPA 4MK0A 3RALA 2Z7RA 4O0VA 2PUUA 1UNLA 4U43A 3TJDA 3E3PA 4EYMA 3LFQA 2PWLA 3PPJA 4HZSA 1Z9XA 4RJ5A 4QMMA 5E8YA 4ASZA 4EHGA 3OWLA 4I4FA 4JBOA 4CKIA 5AR3A 2WMVA 3TI1A 3QCSA 4YURA 5AP3A 5J87A 3T9TA 3VW6A 5I4NA 3NUSA 4NIFA 1J91A 4LUDA 2YIQA 2W1GA 3QX4A 2Q83A 3KN6A 2XNPA 1W8CA 4IANA 1OIYA 2PE0A 3KULA 4MWIA 4MXZA 4G3EA 3UC4A 1FMOE 2X39A 3D5WA 4F65A 3HA6A 5F94A 4EUUA 3LW0A 2Q0NA 4Z9LA 4BCPA 4AOJA 1OIQA 3RTPA 4Z16A 2X9EA 4ZTRA 4TWPA 1OZ1A 2OF4A 3UNJA 2H9VA 3DGKA 2XRUA 3DTWA 5HQ0A 2C6EA 3U8WA 2VV9A 2VTPA 4W4XA 4LV5A 4YLLA 1PYXA 3DZOA 4BDGA 4ZJVA 4IMYA 4D2VA 1UU7A 4BR3A 4QQ5A 3MVLA 2QO9A 2W9ZB 4QTAA 4IWPA 3I6WA 3MA3A 3N9XA 4RWJA 5K9IA 4NM5A 3I60A 3FL4A 3NZ0A 3QX2A 4ZSEA 4BCJA 5A6OA 3HMNA 1JPAA 2XK3A 4PMTA 4QYFA 3KEXA 5KNJA 4M7IA 3R28A 3BLQA 4GFOA 4KABA 1RQQA 2PU8A 4ZJIA 3RI1A 3NUYA 5D1JA 2C5OA 3V3VA 1ZMVA 3WZKA 4FSQA 3TDVA 3LJ0A 4AU8A 4GYIA 3TNIA 3RM7A 3ZSHA 3E8NA 2WTDA 4BRXA 4FTCA 4XJ0A 4C35A 5J9YA 2X2LA 1NT2A 4O6EA 3V04A 4MNEA 4O7SA 3NYOA 1O6YA 4XOZA 2VWYA 4RJ8A 4BVUA 1A48A 3C4WA 1XHAA 5FG8A 3U6IA 4OBPA 1SNXA 5EM5A 4U3YA 1YW2A 4MBLA 4WG5A 2PVLA 4JS8A 4UYAA 1UU3A 4O0RA 3OCGA 1Q62A 1ZXEA 4QO9A 5ETFA 2XKFA 3A4PA 3KC3A 3Q5IA 4BDDA 4FSYA 1J7UA 2BALA 4QP8A 4E6QA 2PZIA 2R3PA 2BTRA 4UZDA 4QMXA 4BIEA 4IZYA 3JVSA 5A14A 3FKNA 2UW7A 3VUGA 5JZNA 3TNHA 5GZAA 2B7AA 4FTKA 3UJGA 1F3MC 3GC8A 2G2FA 2X0GA 2JIUA 4FVRA 4YSJA 1KV2A 4RVKA 4HGLA 2JFLA 5B0XA 5KCVA 3BHUA 4WRSA 4D0XA 4KS7A 1ATPE 3UG1A 2ITXA 3QXPA 5AM6A 5LCKA
chains in the Genus database with same CATH superfamily
1BL7A 5DOSA 3VS2A 4RWIA 4F1TA 5GZ9A 1GZ8A 4DC2A 3VN9A 3MS9A 3ZBXA 2ONLC 3TNWA 5M55A 3TZ7A 5AP1A 2A2AA 3ZRKA 5HBEA 3PSDA 4R77A 4B8LA 5TT7A 5J5SA 5HG8A 4FK6A 4F7LA 2YLEA 2ZM1A 4RFZA 3LM0A 3FI3A 3EN5A 1DAWA 2WKMA 4R1YA 3ZTXA 2QOHA 2IJMA 2YIRA 4QMTA 3R7UA 4O2ZA 3QALE 3VS1A 4CT2A 5KX8A 4BDIA 1APME 3NRMA 1FBNA 4JG7A 5E92A 3VBWA 4EORA 4EK4A 4EQCA 3C51A 3RK5A 1NVQA 2QR8A 4QMNA 4DH7A 4AW5A 2E2BA 2UW6A 4OBQA 5D12A 2JD5A 3BBTB 4XLIA 2XNMA 3UYTA 4C3RA 3WIKA 3R63A 4OAUC 5KZ0A 4TRLA 3ZM4A 5TR6A 5AA9A 1Y91A 2YACA 3IDBA 3F5UA 4FV0A 5L2QA 4GUBA 2NP8A 2F2UA 1T46A 3MH1A 2C3LA 3CQUA 2OI4X 4GMYA 3AD6A 5EKOA 2F7XE 5EHYA 4UZHA 3MVHA 3GFWA 4RFYA 3W0RA 4B9DA 3DFAA 4IACA 3O7LD 4HVHA 3BI6A 4FKIA 2BRHA 3ORPA 3BLHA 3DKCA 4M97A 2FUMA 3MI9A 5M06A 2VTQA 4IH8A 4O38A 4F4PA 4FEWA 4DH1A 4MXCA 2IZTA 2W7XA 4PP7A 4RGJA 2XK8A 4IVAA 1WCCA 4LRJA 5EI8A 5BUIA 3IQ7A 2QOFA 4USFA 2BDWA 4UB7A 5E91A 3C4EA 4W4VA 5KMIA 3LFEA 4P90A 5JSMA 2OXYA 4ZSJA 3C0GA 1BL6A 1MP8A 3C0IA 3VWAA 2WB8A 1WAKA 3QYWA 2ZVAA 4FVQA 3RAWA 4E8AA 5IA2A 3GC0A 4AOIA 5AFVA 4DEAA 4FR4A 3R0TA 4MX9A 4GYGA 2KULA 4FV7A 1TQIA 4AXCA 4DT8A 3I81A 1YWNA 3ID6C 2BTSA 5L2IA 3L8XA 4EK3A 4L00A 4C4EA 3OW3A 2VWIA 3SRVB 3ITZA 4DT9A 2VN9A 4EOMA 4CVAA 4BN1A 1ZWSA 4L01A 4IZ5A 3Q32A 3ZC5A 5JFWA 4BFMA 4G3GA 5ANGA 4F9AA 3DTCA 4IBMA 5KBQA 2FVDA 4TYGA 4II5A 2UZBA 4Z7GA 5DWRA 3R8LA 1H1SA 3EMGA 4MD7E 4XG4A 3HUCA 5BMMA 3W33A 5HX6A 3KA0A 3KXXA 3UPXA 5IMEA 3JR1A 3OVVA 3Q4ZA 1QPCA 4L53A 4MYGA 1OGUA 2X7OA 4O22A 3WBLA 1R0PA 1B6CB 3CQWA 5TOZA 4DFNA 3SDJA 2XS0A 3QRUA 4O0UA 2B52A 2YM3A 1JAMA 1YXTA 2W1CA 3NFFB 4ZAUA 4P5ZA 3DJ6A 4HYIA 4QQJA 1UKHA 3KU2A 3NUUA 2IWIA 4S33A 1VEBA 5AR8A 4BZNA 2WMRA 3W55A 2UW3A 4EOLA 4PDSA 3UGCA 4K1BA 3AOXA 2YAAA 3D94A 1F5QA 2WMBA 3I79A 4EBWA 4CKJA 2E9NA 3WYXA 1HCLA 1J7LA 5HOAA 3D5VA 4KSPA 5ANJA 1URCA 4G5JA 4E73A 3QTWA 3QQLA 4X7QA 4CLIA 4NW6A 4RIOA 2PUNA 1MUOA 3A7FA 3OEZA 5M4CA 4NEUA 1W82A 3ZONA 1LUFA 2V5QA 2Y0AA 2O5KA 4MXYA 2OGVA 5HGIA 5IUGA 5E4HA 1W98A 3MH3A 2PVJA 5FDPA 5HORA 4JVGA 4XBRA 1VYWA 1ZYDA 3CPBA 2R3OA 3O8PA 4AA4A 5CANA 4XG6A 3QRJA 5C1QB 3FZPA 4AA5A 3W2OA 1WBSA 1PW2A 5F20A 3EHAA 4MKCA 5LJJA 2RKUA 2W1HA 1KE8A 5K0XA 2BFYA 4QP6A 1OKZA 2DS1A 4S2ZA 3OY3A 5F95A 3G0FA 3MV5A 3R8ZA 4EH8A 1JSVA 1RW8A 3UZTA 4MHAA 3QZGA 5FTGA 4MWHA 5C4LA 3NMUF 5GINE 3BGQA 1AD5A 4JIKA 4ZIMA 3RHKA 3ZLWA 2WMAA 3DNDA 1JSUA 5L2TA 2CKOA 3COIA 4BDKA 3AKKA 4DA5A 3FQHA 3PRIA 5DHJA 4FICA 4HNFA 4FJVA 2WQOA 4XV2A 1FOTA 4FKLA 2FSTX 4O7YA 3FXXA 4D55A 1SVHA 2H96A 3AC8A 3GVUA 4BI1A 3FDNA 2E9VA 5K5XA 3C50A 2QOCA 4MF0A 5DEWA 5HX8A 4UMUA 4K2RA 3JVRA 2A98A 4OTPA 3G15A 1FMKA 4WUNA 2CLXA 5IUIA 3QKLA 5TO8A 2V0DA 3ZLSA 5H8BA 1W2FA 4EOKA 2I6LA 2A1AB 3PVGA 3R8MA 2YDIA 1PXKA 1JVPP 3K54A 5HD7A 2V55A 4O0TA 2UZLA 3D7ZA 2EWAA 1M52A 5LVOA 4KIQA 1SMHA 5CEOA 3BYOA 3F3ZA 3P7CA 4D9UA 4EOQA 4F1MA 4RLKA 3VRZA 3PVBA 3E7OA 2QOQA 4UWBA 3GFEA 3VW8A 2XANA 2O3PA 2IZSA 4FKRA 3H0ZA 2W4KA 1TKIA 4ENXA 4QMQA 3A8WA 5KMKA 3AG9A 5FWKK 3CE3A 3EQBA 5AP4A 5BYLA 4IIRA 4ANNA 3L8SA 3FZTA 5CSHA 3WZUA 4YJUA 4CYJA 4IM3A 1UA2A 2FA2A 1H00A 4X2FA 5FP5A 4J98A 3QD0A 4UMTA 2BKKA 4IAFA 4PDPA 3KREA 4ACHA 4H3QA 1O9UA 1R3CA 1PXJA 3POZA 3MFRA 4DAWA 4WG4A 3R21A 3OF0A 4G1WA 3DK3A 4EOJA 2J4ZA 4CTCA 3T3UA 4FNXA 2I0VA 5I9ZA 3R9RA 3OW4A 4WT6A 4CFFA 3UVRA 3BKBA 4WHZA 3LIJA 3NNVA 1Z5MA 4BWXA 2UW8A 2B4SB 5CU6A 5IU2A 2JKMA 3EYGA 1OPKA 4ID7A 5BVOA 5IDPA 3LJ1A 2AC5A 5IZFA 5IH6A 1OIRA 4GSBA 1LEZA 3DAEA 2QODA 3GC7A 3FMJA 5FBNC 4P4CA 4DFXE 4Z3VA 4E6DA 4YTFA 3OCTA 4CLJA 1H26A 4I4EA 4RRVA 3U6JA 2JAMA 4OAVB 1Q4LA 1ST4A 1Q8WA 2REIA 5JMSA 3O50A 5FRIA 4LL5A 3DPKA 5HNIX 5H8EA 5AX3A 4DH8A 4H36A 2JDOA 2GPHA 1YRPA 4QPSA 3BWFA 4RA5A 3MY1A 4XS2A 2VWXA 3Q2MA 4IAKA 4PV0A 5JQ5A 5ACKA 5T3QA 3QZHA 4J95A 3C4FA 3HRCA 2BRGA 5AM7A 3Q9ZA 4UWCA 4DITA 3ZZEA 4EC8A 4F78A 2C6LA 3HECA 3PSBA 1YXVA 3CS9A 3FY2A 2P55A 5FGKA 2WTCA 4HCTA 3SHEA 4F70A 4N57A 4AN2A 2GNHA 3BHTA 3W2PA 3L8VA 5A54A 4O7ZA 1ZMWA 2BRNA 2ERZE 1JKKA 2BDJA 4CEGA 4DGMA 4I20A 2XVDA 4FSZA 1XMLA 4KIKA 3Q60A 3R83A 3R1YA 2CGUA 3Q9XA 4WNKA 4W4WA 3G33A 3LCOA 4F6UA 4FODA 4G16A 4FKSA 4AN3A 3R04A 4BI2A 4HNIA 2WU6A 5AAGA 3H30A 5HLPA 3POOA 5KZIA 3GOKA 1GZNA 3MH2A 4ENYA 4F99A 3ZO1A 1ZOGA 4BCFA 5DR6A 5A4TA 2PVMA 2ITVA 4AWIA 3UOJA 4RQKA 3R8VA 3C9WA 3CXWA 3NLBA 3PIXA 4FSTA 4D28A 4OT6A 3OWPA 3Q5ZA 4G3CA 2ZAZA 5KMLA 3ATTA 4J53A 4CTBA 3PIZA 2R2PA 3EFKA 3CCNA 3WF8A 4O86A 5EQPA 4QMSA 3A8XA 4I6HA 5AUWA 4A4LA 1U54A 3EL7A 4AT4A 2F49A 2CGWA 3NVMB 5FM2A 3G5DA 4E4XA 3PA3A 4USEA 5F9EA 3C5UA 3HP2A 3CR0A 1U5RA 4CZUA 4I6BA 1JKSA 4GG7A 5EG3A 5HE0A 3OFMA 3PA5A 3COMA 3TDWA 4I5CA 2A0CX 5DMZA 2AEGA 4IB3A 2IVTA 4EHVA 1Q97A 2IW6A 3LXLA 3VHKA 3N4UA 4YZDA 4O7NA 4RX7A 1IAJA 5DRDA 3ETAA 2O0UA 4D2RA 3DLZA 3EQGA 1GAGA 3PXRA 2WTJA 4PY1A 2WOUA 4CCUA 4DFYA 4DN5A 4KKEA 2FO0A 4G34A 3W0QA 4YPDA 5CT0A 2W1IA 2F7ZE 3RPYA 4TWNA 2PVHA 4WNOA 4NCTC 3ZC6A 3TKUA 4DEHA 4EK6A 5JFSA 1K3AA 1ZARA 1ZYJA 1OGYA 1MRUA 5E8ZA 4QMVA 3VS6A 3FMLA 4M67A 3COHA 3EQPA 4R5SA 5TF9A 2YEXA 4AE6A 2J0LA 5HIEA 4P2KA 1TFFA 3I7BA 2QHMA 2FSOX 3MB7A 5DT4A 2PUIA 2BZJA 3H9RA 2WQBA 4QRCA 5AP7A 2RG5A 2QO2A 4YU2A 3DDQA 5AV1A 5ETIA 1OPJA 1Q8TA 5FP6A 3PA4A 4FNWA 2C69A 4LRKA 5LXMA 2XUUA 2OJGA 3ORNA 5KO1A 4OW8A 4MH7A 3AXWA 2X8IA 3PG1A 3VBXA 3HV4A 2J51A 1ERKA 4K9YA 4WRGA 1S9JA 2C0TA 2YJRA 3OWKA 4D1ZA 3ORTA 3CY2A 3ZUVA 1PXMA 4AUAA 1YXSA 1UKIA 1NA7A 2UZVA 3HKOA 4IC8A 4FSWA 4MBJA 5HCYA 4BCKA 2YWPA 1WFCA 3DKFA 3V8WA 3CKWA 5HLNA 2O63A 2X7FA 3I4BA 1WBVA 4EWHA 4FV1A 2WEVA 3UZPA 3UG2A 1JQHA 2OZAA 4WSQA 2CGXA 4BICA 3GBZA 2B54A 5I3RA 5IUHA 2JDSA 4B4LA 4QNYA 1CMKE 2ZB0A 4BTFA 4ZS4A 2XK4A 2XZSA 3PXYA 3PJ2A 3TT0A 2XK9A 4KRCA 4ZMEA 3PPKA 1OUYA 1TZDA 1ZOHA 3QQUA 4IB0A 4DYMA 4DF3A 3P1AA 3QRIA 3ZLYA 4F7NA 3BE2A 4JDJA 3VRYA 4O96A 4HJOA 3BEAA 3PWDA 3QC9A 3RGFA 5L2SA 4R78A 4IAAA 3ULIA 3V5WA 4I0RA 4QMWA 2JDVA 2PTKA 3FLNC 5C8NA 2G2IA 2ZV9A 4DE4A 4EJ7A 1BI8A 2VO6A 1QCFA 2JKKA 4Q2AA 4TW9A 3PYYA 4JOAA 4TNDA 3PJ8A 4PTCA 4A9YA 4BZDA 3NAXA 2ITPA 4M69B 3KK9A 1XH9A 1J3HA 3E63A 2GNGA 3HMPA 4L3PA 2BILB 5AV4A 4BTKA 4WBBB 3DA6A 2Y8OA 3EKKA 1W2DA 4ANLA 1OPLA 3CD3A 2GMXA 1I44A 2QO7A 3GU5A 4L6QA 5D41A 3EB0A 1FGIA 3QYZA 4PRJA 2QLQA 4ZSGA 4DG0E 4L52A 3W2RA 2XM9A 3UIBA 3O17A 1HCKA 1RJBA 2UZDA 2WMTA 3MFUA 1ZYSA 5EW8A 4UMPA 4Y46A 4QQCA 2A27A 3JUHA 1WVYA 4LYNA 4U5JA 3OBGA 5IQBA 3UDTA 5HG9A 4PDYA 4IQ6A 1RE8A 3V6SA 4FTTA 4HGTA 2YCSA 4ZTSA 1PXPA 3FL5A 1WVXA 2WXVA 3R8PA 3NEWA 3LQ3A 4FA2A 5HE3A 5ACBC 1IAHA 2H8HA 3EN6A 4FV8A 3BYMA 4KRDA 5LVNA 2ITZA 4FRFA 5BUEA 4NK9A 5IKWA 1WBNA 3BU6A 3F2NA 3JS2A 3CGFA 2BAKA 4BDBA 1PHKA 1ZZ2A 2W5HA 4ZXTA 4MTAA 5HTIA 2C3KA 2QOOA 1M2QA 1G8SA 4NT4A 3VF9A 1GZKA 4U6RA 3RNIA 5CVFA 3ROYA 4QYHA 1H0VA 3AD4A 2OU7A 3GP0A 4IDVA 4MXXA 5HVYA 4I6LA 1IASA 4GK4A 4OR5A 4IJ9A 4CQGA 3II5A 4ACDA 4O0XA 5CXZA 3UTOA 3D9VA 5LARA 5KMNA 2WTWA 3CJGA 3E3BX 4AGDA 3ZH8A 3HUBA 4UV0A 3W16A 4FX3A 5C27A 2OKRA 1GIJA 3WZEA 1OBDA 2BR1A 4GIHA 4YC6A 4BIBA 4EH7A 2PULA 2IF8A 3ROCA 3WOWA 2H34A 4RIWB 4YP8A 4O2PA 1MQBA 3UIMA 4QP3A 1CKJA 3BE9A 3H3CA 4A4OA 4HGEA 2XK7A 3RK7A 5J9ZA 1AGWA 2ITYA 2RF9A 2OJ9A 5CX9A 1P4OA 3W2CA 4EK5A 2EU9A 3NCGA 3G2FA 4G3DA 4F08A 4GG5A 4RVMA 4BTMA 3HV6A 3UE4A 5JFVA 2LGCA 2VRXA 4ZOGA 3IG7A 4OTGA 4O4CA 4UWYA 4Z55A 2AUHA 4JI9A 5BVWA 4A4XA 2I0EA 2Z8CA 3PZEA 5LVLA 4JBPA 4HYUA 1YQJA 3BV3A 3Q4UA 3BGPA 4C4FA 2VWVA 1KE6A 3UDZA 3LXNA 2GNJA 1Q5KA 2UZTA 3CBLA 2G01A 3TG1A 2QU5A 2CMWA 2YHVA 4CMTA 2X8EA 3IECA 3A99A 4M13A 3R6XA 1H8FA 3R00A 3UOLA 5M08A 3ORKA 1UU9A 3WF6A 5AP6A 3R7EA 4U7ZA 4RZVA 1T45A 3FLYA 4CMOA 3MWUA 4DBXA 3ALOA 2Y9QA 3U87A 2VNYA 5DNRA 3SXFA 4AXAA 3HZTA 3MESA 5BUJA 3BRBA 3MFSA 4BHNA 2ZV7A 2W1FA 1YOJA 5IEYA 4CFWA 2GQSA 3IOKA 4R1VA 5EW9A 2VO7A 4YZCA 3NAYA 1SVGA 1XQZA 3QA0A 3PG3A 3A61A 4QYGA 4MF1A 1H1WA 3R2BA 5ETAA 3RM6A 3RINA 4BKZA 4D4VA 5DT3A 3ZHPC 2UZWE 3UQGA 3I0QA 1UNGA 1DS5A 1KE9A 3FZRA 4GT5A 4QYEA 3KXZA 4FKTA 3UOKA 4DGOA 3P79A 3VUKA 4AZSA 3F7WA 5IQFA 3CKXA 4FUYA 5EM8A 2XARA 5F1ZA 4YJNA 4CZYB 3F2AA 4RIYA 4LGHA 4JR3A 4RWKA 5FEEA 2QG7A 2W4OA 5CYIA 1CTPE 5A4EA 5AJQA 2WTIA 4I94A 2RG6A 5AUYA 5JQ8A 5CEIA 1HOWA 4O7TA 1TVOA 5HVJA 1M14A 2QU6A 4OUCA 4TWOA 3O71A 4FSMA 3LMIA 3W1FA 3E87A 1PRYA 3OXZA 2XRWA 2YZLA 1REKA 3LFDA 4GU6A 2CKPA 3U4UA 2Z2WA 4J71A 3D4QA 5I9WA 3AC1A 4QTEA 1SNUA 2NYAA 4NTSA 3T8OA 4RFMA 5EM7A 4QP4A 2PY3A 1V0BA 1OL6A 2GDOA 3PY1A 4MQ1A 4M12A 4BGQA 4ITHA 1XH5A 3SC1A 3AC2A 3BBWA 3MFTA 5BVKA 1ZY4A 4E6CA 2HZIA 4AFEA 3DK6A 3LM5A 2W17A 3D7TB 3V5PA 4PMPA 3F2RA 2YFXA 4E5AX 4RMZA 4ORKA 4L43A 3NDMA 3LFCA 5AV3A 2VTMA 5I9YA 1YI6A 1ST0A 2VX1A 3PWYA 1XMMA 4GJ2A 3ZSIA 1QPEA 4LRMA 1E9HA 2Q0BA 2FSLX 4WD5A 1ND4A 3L9PA 4P5QA 4U41A 2VGPA 1LR4A 3NW7A 4UYNA 1UU8A 2UZOA 3Q6WA 4YSMA 4ANBA 4QTDA 3NCZA 5L6OA 1L3RE 1BI7A 5HHWA 2DYLA 3UO4A 4C38A 4GU9A 3QFVA 3C4XA 2AC3A 3RMFA 4FTLA 2DQ7X 3TV7A 4BL1A 3F3VA 1Y8YA 1YI3A 2JEDA 2VX3A 3Q04A 5M07A 2VTAA 4FT3A 4XRLA 4Y5QA 4ZLOA 3R1QA 4JRVA 2VGOA 3DJ7A 5AX9A 3P4KA 5EW3A 5FTOA 4A9UA 3PFQA 5C8KA 3FYKX 4AW2A 3JY9A 4QMYA 4GCJA 4I5HA 1Q41A 3ORZA 4W8EA 4QMPA 3ORXA 3PJ1A 4HZRA 3G90X 2PL0A 1WBOA 2QD9A 3O96A 4DEIA 5J5TA 3FZOA 4XOYA 5HLWA 3F3WA 3HRFA 1YVJA 3UZRA 3KL8A 5CQWA 5AEPA 4FUXA 2UUEA 2CJMA 2XCHA 1PXIA 3MDYA 1SM2A 4HYSA 2XKEA 4IX6A 4JAIA 4L46A 4EUTA 4HVDA 2R0IA 4FKPA 4IC7A 4RC2A 3TL8A 2FH9A 3QKMA 4F0GA 2XKCA 1XH4A 5EK7A 3KIOC 4DCAA 4X2GA 2XJ1A 1JNKA 3EZRA 4APPA 1CKIA 4DLJA 4FEUA 3GCPA 2R3HA 4KKHA 3SGCA 3KGAA 5E1SA 2W4JA 4ZP5A 4MQ2A 5M09A 2WHBA 3N51A 4KB8A 3OS3A 3GCQA 4QPMA 3LQ8A 2XJ0A 5AA8A 2CKQA 3SLSA 3MPMA 2PPQA 3FLSA 3FPQA 3QTRA 3VONA 3HMMA 5JGBA 2EUFB 3HAMA 3A2CA 2O2UA 5A9UA 5EYMA 4O1OA 3VBYA 2R3KA 2XALA 2J90A 2Z7QA 2ZMCA 5A3XA 3QCYA 3EKNA 5HO6A 4JX3A 2VWWA 3DBEA 3RWPA 5DEYA 2AYPA 1B39A 2UW5A 5CVHA 4TTHB 3ZXTA 4I5PA 4FT0A 4LM5A 1OVEA 2VTLA 4X6RA 3VULA 4ZLYA 2ACXA 2R3RA 4JLCA 5AR2A 2YM5A 4V01A 3SW4A 4E7WA 4MUQA 2X0QA 5IA0A 4AQKA 4ALUA 4R3RA 4ZTNA 4GK2A 2ONLA 4MAOA 4NSTA 4A06A 3E88A 3PJCA 4IZ7A 1KE7A 1YHVA 3A7IA 4EJNA 2WZJA 2IG7A 1JKLA 3SG9A 3FPMA 1OUKA 5JGDA 2QG5A 2ITNA 3IK3A 3RNYA 2RL5A 3MY5A 3ORMA 4DFUA 3FMHA 2YAKA 3F82A 4HCUA 4AW0A 3WZDA 3V8TA 1H08A 3L8PA 4Z7HA 2R3IA 3O7LB 4L7SA 2C30A 2QOBA 3C4CA 4CG9A 2OICA 2QOKA 4JQEA 5CTPA 3OD6X 1OIUA 4O0SA 4PL5A 4BDEA 4B6LA 3QTIA 4XP2A 4EH6A 4DDIA 3QQHA 4X2KA 3EQRA 4X3FB 2GHMA 5JRQA 3KKVA 3R9DA 4C59A 5EQEA 2XJ2A 4XG3A 4EK8A 3RPSA 3PXZA 4R5YA 4I0SA 3O2MA 1I09A 1M7QA 5CU4A 4XP3A 2XEYA 4O0YA 5HEZA 5HI2A 4JXFA 5CVGA 4JAJA 5BQ0A 3TV4A 2IEWA 4EQMA 4UX9A 1ZYCA 4YGAA 3FI2A 4ACGA 4C0TA 1BKXA 1ZOEA 3E8EA 2RFSA 3LQ5A 3OHTA 4NJDA 4ASDA 4EOSA 1VJYA 5LMKC 5IQAA 3F5GA 3DB6A 3QF9A 4BDAA 4FOBA 3VHEA 5FUTA 3HMIA 4E4MA 4MD8E 2OBJA 2VTSA 3E62A 5CS6A 4D9TA 3NPCA 2JKOA 3QU0A 3QTXA 4YJOA 3GOPA 5KMMA 2R3MA 3QRTA 4FTUA 3L9LA 4KBAA 5BVEA 3ZO4A 3NW5A 5L8LA 2YJSA 3E93A 4ZJJA 4FTMA 5FXRA 1PXOA 2R0UA 4BCIA 4IX3A 3N4TA 4FVPA 2BZKB 1F0QA 2OLCA 3FBVA 3MJ2A 2VNWA 3OZ6A 4BCHA 4X3FC 4DTAA 4GIIA 4JT3A 4KAOA 3UNZA 2QLUA 2FB8A 3ZU7A 4O4BB 3UOHA 2QOIA 3JPVA 4AGWA 1U4DA 2YDKA 4E5WA 3ORLA 5EI6A 3AT2A 2HIWA 5ITAA 3FLQA 2WQNA 3A62A 2R3GA 3PXFA 2EB3A 3BHYA 4UMQA 3MW1A 5L8JA 2VTTA 4GUEA 4LL0A 3WILA 2ZYBA 4BCOA 4FNYA 5E8TA 3UDBA 3N4VA 4V0GB 5HICA 4OTWA 3VS7A 4F7JA 4FKJA 3LLAA 3VS5A 4JIAA 1R1WA 1IEPA 4LOQA 4BKJA 4RBLA 3NNWA 3RP9A 5HU3A 4MXAA 4E26A 4EYJA 2RFEA 3BCEA 3ZYAA 2PZRA 4FZFB 5L3AA 4OTIA 4JRNA 4CFMA 4YZ9A 5GJGA 2G2HA 5TE0A 1K2PA 5AUZA 3WE4A 2Y4PA 5IQCA 3PLAE 3MTFA 3DK7A 1H1QA 3IW4A 5E8VA 4IDTA 4DEGA 5B2LA 4RX8A 5J1WA 4QTBA 2JDRA 3PP0A 2OFUA 5C26A 4LQMA 1U59A 3DCVA 5CU3A 3OY1A 2RGPA 1OL2A 3GB2A 2XK6A 3SRVA 1V0OA 4CRSA 3AC5A 4E3CA 4FT7A 2UW9A 5HIDA 4MD9E 3WYYA 3P5JC 2C0IA 5TKDA 3BHVA 4FE2A 1GOLA 1KOAA 4D58A 2XIRA 2VTRA 3LCSA 4S30A 3BL9A 3LPBA 3I6UA 4LV7A 2VU3A 2OG8A 1GNGA 2I0HA 3CP9A 3EH9A 5M57A 4FL3A 3TZMA 2EXEA 3FC2A 4ZSAA 4CGAA 3E8DA 3AGMA 3F3UA 4EL9A 1OMWA 1PY5A 3OT3A 5DR9A 4AOTA 1PYEA 2WU7A 4RIXB 2BROA 2GNIA 3GGFA 3NUNA 4U0IA 3BIZA 3F69A 3JYAA 4XP0A 5LMAA 5CENA 3GU4A 5E1EA 5GHVA 4S34A 1ZLTA 3TM0A 3RHXA 3PPZA 2PUPA 4DGNA 3ZMMA 3H0YA 4QDEA 1WVWA 2PE2A 2V62A 3FMKA 3NR9A 2GS6A 5KE0A 4DHZA 5DN3A 4DH3A 4JMQA 2QURA 3Q3BA 4RJ3A 5IA5A 3AGLA 3ML1A 4C61A 3KVWA 1ZY5A 4TYHB 3HA8A 3DT1A 3CPCA 3ZRMA 5JEBA 3VNTA 4O7WA 2B53A 2XP2A 2IPXA 4DEBA 1J1CA 1OKYA 3L1SA 5EFQA 4FTAA 3AT4A 4FV9A 2Y6OA 3UVQA 4FV4A 5ANKA 4PTGA 2VTHA 4FTRA 3QZFA 1Q3DA 2HOGA 2CKEA 3FWQA 4JBVA 3GCSA 4BB4A 3BLAA 4C62A 2I40A 3NNXA 4QP9A 3FKLA 4RWLA 4TYIA 4DLIA 5BVDA 4DFBA 4Y72A 5DR2A 3DKGA 3THBA 1LEWA 2XA4A 4FTNA 2A4LA 3AQVA 1YXXA 3E8CA 1NY3A 3DU8A 3QTQA 4HPTE 3ANQA 4OBOA 5GIOE 1ZRZA 3KMMA 4DHJA 4FKVA 3UC3A 2WMSA 2R5TA 3G9NA 3P78A 5DFPA 4AAAA 4J99A 4IM0A 4DG3E 2X7GA 3MH0A 4FF8A 4KIPA 2OIBA 4BDCA 2XIKA 4D1SA 1QMZA 2OSCA 3I0OA 4K33A 3Q96A 2JBPA 3DXNA 3ORIA 2FYSA 4H1MA 3S2PA 4KINA 3LE6A 5E8XA 3FHIA 2HW7A 4U3ZA 4RVLA 3R73A 4D4YA 1XH6A 3QWKA 4RC4A 5GJFA 3VS0A 2DUVA 4IE9A 2GSFA 2G15A 4NYEA 2AQXA 3KXHA 2HW6A 1YDTE 1RDQE 5J9LA 3I1AA 3U55A 3M11A 3W0NA 5EHLA 1JBPE 4UALA 4MBIA 2YM7A 5C03A 4I22A 2YIYA 4V05A 4NL0A 5CF8A 3C1XA 2CHLA 3BGZA 3JY0A 3EN9A 3FXWA 4DBNA 3P7AA 1BYGA 2R4BA 4YJVA 1FGKA 2ETMA 2OXDA 2Y4IB 4FV6A 5KMOA 4QP7A 4IWOA 1XBBA 4C02A 3GQLA 3K5UA 2F9GA 4W9WA 2OIQA 3BQRA 3UYSA 1W2CA 3LFFA 3P86A 4L8MA 4YPSA 2I7QA 1OI9A 4CD0A 2CCIA 4Y8DA 4GT3A 4BF2A 4EH3A 2OO8X 3IPHA 4ZZOA 2VWZA 4I41A 4K11A 3QC4A 4D2WA 3DDPA 2X4ZA 3QQJA 4PX6A 2OZAB 4ZK5A 3RVGA 4GKHA 4H3BA 5IISA 3NIEA 3NVKI 5AUXA 2HXLA 4G17A 4B7TA 5C4KA 3B8RA 4TXCA 5EYCA 4RJ4A 4RT7A 4BBFA 2WGJA 4JG8A 4XG8A 5IDNA 4H05A 3UMXA 3NFGB 2WMUA 3GI3A 3QRKA 3OCSA 2XBJA 1YXUA 5I9VA 3OOMA 4M14A 4FKUA 4O4FA 3BYVA 5GZ8A 4YHFA 4G6LA 2ZDTA 3WIGA 5J1VA 1YDRE 2UZUE 1CKPA 3IOPA 4F0FA 2YABA 3DY7A 3JXWA 4YUQ