5BUJA

Erk2 complexed with a n-h tetrahydroazaindazole
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
350
structure length
331
Chain Sequence
b'AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 331
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bujA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bujA01
4UXQA 3IGGA 3NYXA 3OF0A 4QP4A 3QTRA 4TYIA 3V51A 5CX9A 2W1FA 1JBPE 2YJSA 4MCVA 3O7LB 4GSBA 3BGQA 4BZOA 3NNVA 4DLIA 2W4JA 4C38A 2WELA 4S2ZA 3ZS5A 4IDTA 5E8YA 4JR3A 1UWJA 2BCJA 2HZ0A 1OITA 2BRMA 5M09A 5ANGA 3RPVA 3ZO1A 4IWOA 2WTKC 3C1XA 3RI1A 5JEBA 3ORZA 5A3XA 4FGBA 3TG1A 4AA4A 4GFGA 2QURA 4IDVA 2QOBA 4WOVA 3WZUA 3HMOA 4I5MA 4RT7A 4X3FA 3Q9YA 3LFDA 2JBOA 3ID6C 5KE0A 4RWJA 3FZOA 3QAME 2RFSA 3KCKA 5IZFA 5CENA 5ETAA 3LJ1A 2ETKA 5EFQA 4R6VA 4B8MA 3UNKA 4YO4A 1HCLA 4V01A 3C7QA 4C3RA 4K0YA 3PVWA 4JDIA 2WU6A 3OXIA 3BPRA 4NH1A 4UEUA 2ITUA 2JDTA 4JR7A 5KHWA 4DAWA 2XCHA 1W84A 3HA8A 3RK5A 2O2UA 3ORXA 5JKGA 3ZO3A 4AW5A 3KB7A 4BCFA 1ZOHA 5CY3A 1YVJA 4U42A 1L3RE 4LI5A 5AP6A 5L2TA 4IX3A 4ANMA 3BRBA 4QYFA 3ZBXA 4QMMA 3W33A 5KMKA 1UNHA 3EB0A 3JUHA 3ZDIA 1PYEA 5BMMA 3NRMA 4IZ5A 2C6IA 2QONA 4KKGA 4FIFA 5DPVA 4YJSA 4ACGA 1CSNA 3QD0A 3Q2JA 4PPAA 4TYGA 3FZSA 4LM5A 5DR9A 3MN3A 5ETIA 3HV7A 4ZY4A 1Q24A 4FKGA 4IE9A 1Q3WA 4F63A 2B55A 1K2PA 4YBJA 4O81A 1FGKA 2YABA 4D0WA 3FYKX 4QP2A 2CNVA 3QWKA 1QPDA 1WBOA 3K3IA 2VWBA 4LQMA 3OC1A 4RGJA 1OBGA 4QMPA 4DGMA 3AMAA 4BDIA 5A6OA 1R0PA 4QMTA 5AUYA 2F2CB 2W1CA 4MWHA 4WG3A 5AV0A 1REJA 3VUIA 1STCE 3NVMB 5AV4A 4GK3A 2WAJA 4R7IA 4XV1A 3GBZA 1VZOA 5HLNA 3P7AA 4P2KA 4CRSA 4PP7A 5KO1A 2XKDA 3HNGA 1BLXA 3ORMA 4E26A 4L67A 5C27A 3IECA 1OVEA 4F09A 1W83A 4I6HA 3Q4TA 2XA4A 2ITWA 5HBHA 4WBBB 1Q8ZA 5CSXA 5CU3A 3RTPA 4PUZA 5JQ5A 2XNNA 3G9LX 2WIPA 5E92A 2YAAA 4O7SA 2R7BA 5HCYA 4I92A 1PXIA 4F6WA 2R3JA 4MXCA 4NJ3A 2J9MA 3L8XA 4IADA 5AM7A 4HVHA 5DG5A 1XBAA 2PMNX 2WOUA 4MYGA 5D7VA 4CT2A 4OTIA 3JR1A 3HL7A 2WQBA 3LXPA 4C4FA 3AD6A 3ZLWA 5T3QA 5CEPA 3NUAA 2QQ7A 3G2FA 4YJTA 5LVMA 3C4FA 4UY9A 4U6RA 5AIKA 2WGJA 4C62A 3UOHA 3UGCA 3QCXA 1LP4A 3HRFA 2VTQA 4D4SA 5JZNA 5HNIX 2W0JA 4BIDA 4YUQA 3LFSA 1Q8YA 3P7BA 4BHNA 1RQQA 4XUFA 4ZTMA 3OBJA 3MFRA 4Y72A 5E8WA 3OD6X 1V1KA 2PZPA 1CTPE 5AP1A 4GRBA 2W96B 3D14A 4FR4A 4E7WA 4JAJA 3FAAA 2YM4A 1FINA 1VJYA 2OH4A 3I5ZA 2A2AA 2X81A 2AC5A 3MDYA 4XP3A 5FD2A 3VIDA 4ZJVA 4FKLA 4MD7E 4XV9A 5JGAA 3R7VA 1RDQE 5E4HA 2OXXA 2CGVA 2Y8OA 3MTLA 2C68A 3EFKA 2WPAA 3QQJA 4KINA 3VRZA 2IJMA 4W4YA 5GJGA 2XNGA 4N0SA 5E91A 2WFYA 2YACA 1YXSA 2W06A 4F7JA 4FL3A 2P3GX 4BKZA 2WQEA 2CDZA 2XJ1A 2PVRA 1F0QA 4ARKA 4EWQA 1OECA 4CG8A 3CTJA 5I9VA 2B9JA 4DFXE 2I0VA 1HOWA 3LFCA 1GZ8A 3UO4A 1J1BA 3BU6A 2IZSA 2REIA 5DI1A 1Q8TA 2ITVA 4Z9LA 2YERA 4YTIA 4RVMA 3TZ8A 2ZM4A 4D4YA 3QZIA 4F6SA 4APPA 2VTRA 4ANBA 4EUUA 5CASA 4K11A 3ZRKA 4CV8A 5LVPA 3FMJA 4GUBA 3TNQB 3RMFA 3SHEA 3M2WA 2PVYA 3DV3A 3MFTA 3TL8A 4GT4A 3R30A 3UQGA 4UMUA 4L52A 2QOKA 4OTWA 1XH7A 3AT3A 2WTKB 4QO9A 3FC1X 4FT9A 2VNYA 4LGGA 4OTDA 5HGIA 3DT1A 1P4FA 1KE5A 4HOKA 4RIYB 4CYIA 4F9WA 3D2KA 3ZH8A 1ZZ2A 2H8HA 1CM8A 4FEQA 1ZOEA 4PTGA 4X0MA 5HO8A 3U9NA 4FTRA 3ORPA 4L44A 5EG3A 4EOJA 4XG6A 3WZDA 5A54A 4AF3A 1SVHA 4UBAA 4LYNA 3TZ9A 3NUXA 1YOJA 4CTBA 4I22A 3WF7A 5L8JA 4BGHA 3PDTA 4ONAA 3SG9A 2J6MA 4IJPA 4IQ6A 1OL7A 3SLSA 5L8LA 4BIBA 2PYWA 3VN9A 5KCVA 2EXEA 3UODA 3DAEA 4PMPA 2X7GA 3ZTXA 1Z57A 4PL3A 4ACCA 4R7HA 4ITHA 3TNIA 3PE1A 3C4CA 3QZFA 5JSMA 1LUFA 2QG7A 1KWPA 3F5XA 3DU8A 4M12A 3LMIA 5DR2A 3LQ5A 3COMA 3G51A 4MD8E 2PUPA 3PRFA 3IG7A 5AV1A 3GU5A 3TJDA 4DFLA 3SRVA 3BV2A 1URWA 4DN5A 4FKUA 2IZUA 4G6LA 4FZDB 3VHEA 1IAHA 3OCSA 4O2ZA 2W9ZB 4Y95A 2J4ZA 1UA2A 3QGYA 2W5AA 2J2IB 3VJOA 2WMRA 4IVAA 4O7RA 2ITYA 2WEIA 1DAYA 3D5VA 2ITZA 2QOQA 4LV5A 4UX9A 5HICA 4ALUA 3RGFA 3OY1A 4OT6A 3V3VA 4KRCA 4R3CA 1O6KA 2CNQA 4YPDA 4NTSA 4NKSA 1UNLA 3MY5A 3R83A 3ZFYA 2PVJA 3PJ2A 1B39A 4XJ0A 3I5NA 4EK8A 4E4NA 4V04A 3MI9A 4YNOA 3PJ3A 4UMQA 3FPQA 4LL5A 4EHVA 3PPJA 3TKUA 5CT0A 2JITA 3W10A 2I6LA 1WCCA 3UZTA 3AGMA 4AS0A 3CD3A 2BAQA 3NUYA 3CY3A 2CHLA 2Z02A 2F7ZE 1PMEA 3D5XA 5DRDA 4E6DA 3BCEA 5EDPA 1H1PA 3F2AA 1OIUA 4FV7A 1YKRA 3LFAA 4FV8A 4H3QA 4H3BA 3VBTA 2KTYA 4DEDA 1SM2A 1OIRA 2VWZA 1XH6A 5BYYA 3DKFA 1UU9A 4LUDA 1KE7A 5DEWA 1YWVA 2R0UA 3UIXA 4JS8A 2FYSA 2GU8A 4KKHA 2J0MB 5CF5A 3CTQA 4XLIA 4FZAB 2UZUE 5E1SA 4WNOA 4XG4A 5I0BA 5B7VA 3C0GA 4FTMA 2X6EA 2RFEA 3R0TA 4G3EA 4BDJA 3C5UA 2O8YA 3TUDA 3F2RA 2HENA 4BZDA 3GB2A 2C5YA 4BDFA 1ZRZA 3LPBA 3EQFA 2WTWA 1H0VA 4QP3A 3QRTA 3R7EA 4D2PA 4EK3A 3QF9A 5L3AA 2CKOA 1F5QA 4FSRA 3HP5A 4HYSA 4G5JA 4IAZA 4DBXA 3NR9A 3SW4A 5HE0A 3ZO4A 2B1PA 4FEUA 3ZRMA 1XBCA 1FMKA 4YURA 3V5PA 5C26A 3WBLA 3KQ7A 2FSTX 4A9UA 4DH7A 3QU0A 2FB8A 2W1DA 4BWPA 3R8MA 3VS1A 2ZMDA 4D4VA 5ACKA 5HU3A 3F9NA 1JOWB 3AXWA 3MV5A 2NRYA 4FIHA 3C51A 5AADA 1BUHA 5M55A 2YM7A 4AAAA 4CYJA 2FSMX 3NAYA 1PXNA 4E93A 5CAVA 1FBNA 5EM7A 5IMXA 4ZLZA 3MJ1A 4LG4A 1VEBA 4KAOA 4PF4A 3A99A 3V04A 5LVNA 3DKOA 4JBOA 2AC3A 4FKIA 4PP9A 4CTCA 2JDRA 4YLLA 3GNIB 3KF7A 3W2SA 1BX6A 4I0RA 3BQRA 5H8GA 1R3CA 4IZ7A 4I0SA 4DITA 1W82A 2P33A 4Y8DA 1H0WA 3EFWA 5FDXA 4BBEA 5E9EA 4FIGA 4Z7GA 3SQQA 1UVRA 3JXWA 4I6BA 4GFMA 4JJRA 4E1ZA 2HY0A 1U5RA 3GVUA 4RFZA 4O0XA 4QMWA 4KRDA 3QQKA 2GNGA 2RKUA 4FI1A 4PDPA 5C8NA 1CKPA 2UW8A 3IONA 4I41A 3FEGA 2X4FA 4ASZA 2IZRA 2O3PA 1JSTA 3FI4A 3DK7A 4IB3A 3OXZA 2JDOA 4UYAA 2ITTA 1BL6A 2GHMA 5AR8A 3FDNA 5ANOA 4BCHA 3ZFXA 2VWXA 3KY2A 2VX0A 3V8TA 2IG7A 4BYIA 4FG7A 3THBA 4DC2A 4F9YA 3E8EA 3NGAA 1IA9A 1TVOA 2GDOA 3BELA 4YC3A 3G0FA 3RAKA 5DLSA 4I94A 2VTHA 3I7BA 5DEYA 3CQUA 3MFUA 1YRPA 2PVNA 3VS5A 5LMKC 1Q61A 2QR8A 2Z7LA 3PP1A 5B2KA 4F7LA 3Q53A 4EZ7A 3LE6A 3NLBA 2OIBA 3ODZX 4EC8A 4ZSEA 5I9XA 4UZDA 3CIKA 1H27A 2OJJA 1I09A 4BDKA 3OWJA 4IWDA 4XNEA 3CQWA 2ZV2A 4OTQA 3DKGA 4YC6A 4RZWA 2Q0NA 4JXFA 2QHMA 3HV3A 4BTFA 4BTJA 3U6HA 3DXNA 4EI4A 4JAIA 4M68A 4Y46A 4K6ZA 4RFYA 3OS3A 4NT4A 3A8XA 1ZLTA 3WIKA 1PF8A 3MB7A 2YWPA 3N9XA 4X2JA 4UN0C 3ENHA 3DS6A 5HIEA 4GMYA 4OBPA 4FTIA 4ZTSA 1OL1A 4V0GB 2WMQA 3T9IA 5ANEA 2XM8A 2XIRA 4TXCA 4L68A 3PXFA 3ZEWA 5K4JA 4D58A 3O50A 4U80A 5FEEA 2AYPA 3UVPA 3FLNC 4AZFA 4CQEA 3G5DA 1JLUE 4L42A 4UV0A 5JN2A 1M7QA 4YJPA 3WF8A 4LMNA 4AFJA 3R21A 4W9WA 3VO3A 1TKIA 4QP6A 1J3HA 4RG0A 3P79A 5HG5A 4ZTNA 1JVPP 3MVHA 1IA8A 3CKWA 5CZHA 3GCQA 2PZRA 3SV0A 4FTJA 4GK4A 3V5JA 5D11A 3QD4A 1Q5KA 3POZA 5C1QB 3AC1A 4HNFA 3AC2A 4RVTA 2E2BA 4RLKA 4L7SA 3QTUA 1GY3A 1Q41A 4NKAA 3VF9A 3TKHA 4YHTA 2YDJA 3OFMA 3EN4A 4FF8A 4IC7A 5DFPA 3MYGA 3QA8A 4U79A 4QYEA 2G01A 5DMZA 1OL5A 2WTJA 5EK7A 5I9YA 4YZNA 3P78A 1XWSA 1UKIA 3NW5A 4M3QA 4QQ5A 3UIUA 3QQGA 5F1ZA 3UO6A 4C4IA 3LM0A 4XBRA 4O83A 3HMMA 5LVOA 2OU7A 2PE0A 4WNKA 2QNJA 5EDRA 2V7AA 5CSVA 4U41A 5L2WA 3CTHA 3VULA 4GH2A 1KSWA 3KRJA 3R7GA 2VN9A 3CQEA 4OTPA 3R01A 2CMWA 1KV2A 4I21A 1PRYA 4X2KA 4GT3A 4B4LA 4RWKA 3UOLA 3ZCLA 3GU8A 4D9TA 4YZDA 5JFVA 4DT8A 3R63A 2ONLA 2C5OA 4AT4A 2HW6A 4U40A 4IZAA 2Y4IC 5KZ0A 2WO6A 3MVLA 3GU7A 3DOGA 3D2IA 1IR3A 3Q32A 5HE2A 3RCDA 3LHJA 5CYIA 3VBYA 3ZSGA 4AW2A 4B9DA 4UMPA 2YM8A 3F3UA 4F0IA 3HX4A 4RIYA 4CKIA 3LXLA 4EOLA 3PJCA 1MRVA 5H9BA 2GNJA 3FMEA 3MA6A 3RK9A 4E3CA 5HEZA 2WXVA 2UZTA 4I4FA 3UNJA 5EKNA 3I4BA 3DK6A 4ZJJA 4AFEA 3MTFA 2WQMA 4BCJA 4ANNA 4AG8A 5M57A 5JFXA 4I24A 3N51A 5LQFA 2VTJA 3UIBA 4O7NA 5CAUA 4DF3A 3NVKI 5M08A 3PVGA 3RM7A 1PXLA 2ERKA 4G16A 2YIQA 2PWLA 4I93A 4QMOA 3KREA 3DFCB 2UZEA 3QQLA 4NCTC 2OBJA 4BCMA 3R1YA 5HOAA 3E8CA 2WB8A 3DJ5A 3VUMA 5I9UA 2R0IA 2PPQA 4ZSJA 4FSZA 4NFNA 4PMTA 4NM7A 3LOKA 3EYHA 2VD5A 4XG2A 5F94A 5K4IA 5LOHA 5J5TA 1PHKA 4HCVA 3MA3A 2JKMA 5C01A 3DK3A 3ZONA 3TJCA 4ANSA 5D41A 3UP2A 3TUCA 2CLQA 4FOCA 2R3HA 1H1RA 3A7IA 3Q4UA 4M69B 1GIHA 2GHLA 2OJ9A 2W05A 1OUYA 3BYOA 4I3ZA 2XH5A 3KXNA 2H96A 2E9NA 3COHA 2GFSA 3AGLA 5IUHA 5ICPA 3FQHA 5AJQA 3IOPA 5EQYA 2UZBA 1CMKE 3PG1A 1R39A 3WF9A 4KSPA 3MH1A 3WZJA 1OZ1A 3BE9A 3H30A 2QG5A 3EQHA 5DBXA 4APCA 3R9RA 4RJ3A 4CNHA 4LMUA 4FV4A 2ZM3A 4FV6A 4PMSA 3W2OA 3DFAA 4K18A 2FUMA 2O0UA 2H34A 3BWFA 4CCUA 3RAHA 4EOMA 3F7WA 4F70A 2CNUA 3HAMA 4IZYA 5AP4A 3TTIA 4B8LA 3CSVA 2BZJA 2RG5A 4FV9A 5JGDA 1OKWA 3ZLYA 2QODA 3FV8A 5AP0A 2OI4X 4BCNA 2FVDA 3QRKA 1JKLA 3Q5IA 2JD5A 2ZDTA 4ASDA 3U8WA 3EKNA 3KRXA 1ZOGA 1YDSE 4MAOA 3ZM4A 4ALWA 3BYMA 3BLRA 1VR2A 5M4IA 3Q6UA 3MGYA 2C0IA 3HUCA 4H1JA 3PSDA 4J52A 4JI9A 5IA2A 3G90X 4Z3VA 4N57A 4AZEA 3SC1A 4CV9A 2V55A 1M17A 1Q99A 3FSKA 2C6TA 3Q4CA 5FLFA 2VV9A 3B8QA 2WHBA 4FIIA 4EOOA 3EQIA 5M44A 5M53A 2EXCX 3IDBA 3KVWA 3FZ1A 3UOJA 5C03A 2FA2A 1H1WA 3JS2A 3QKLA 4FV2A 5EW3A 5AR2A 5TO8A 4BI2A 1U46A 2GS6A 1OI9A 1YHWA 1ZYDA 3FLYA 4IAAA 3GFWA 2BVAA 4NM0A 5IQFA 4JG8A 5GNKA 3DJ6A 4P90A 3A61A 1YWNA 2OZAB 3I60A 4S32A 5AX9A 5CU4A 3W2CA 1NVRA 4QMYA 1XHAA 1R0EA 2R3KA 3W18A 5M56A 2OIQA 2Q0BA 4RFMA 2PMOX 3QGWA 3NWWA 3O96A 5CEIA 3QA0A 3EIDA 3E7OA 3WILA 4J7BA 1YXUA 4BDEA 2R5TA 4DEIA 3TV4A 1QMZA 3RALA 2C6MA 2XRWA 4JRVA 3VS3A 1K9AA 4J8NA 4XG3A 2WTIA 3OEFX 3MPMA 3GU4A 1BYGA 2R7IA 3RNIA 4I4EA 3NIEA 1UU7A 4FSQA 1OIQA 1Y6AA 4Y5QA 4HJOA 4C59A 4CFWA 3F6XA 5B2LA 3HZTA 3GC7A 3QTZA 4JL9A 5HU9A 2ZVAA 1OL2A 1LR4A 3ODYX 3ORKA 3PJ1A 4N6YA 4WT6A 4LOOA 5DVRA 5FXSA 4E6AA 2YCFA 1J7LA 4QTDA 1H1QA 2XIYA 3OUNB 4EZ3A 2XK8A 3LXNA 4E8AA 4ZLYA 2DYLA 2CJMA 2HWOA 2Y4IB 3D94A 3NIZA 3BGZA 3QRJA 3QRIA 5FTOA 3EL7A 3C0IA 4R7BA 1WFCA 4K33A 4FVPA 3R7YA 4FL1A 2YDIA 4WG5A 4F9CA 3DLZA 5KMIA 5CAOA 1UU8A 3M42A 5AEPA 3PA3A 4OBQA 4UYNA 3NW7A 2BIKB 4BDDA 3HEGA 3QHRA 2RL5A 4TKSA 2R3PA 3A7JA 1H8FA 4IIRA 4A06A 4BVUA 3M11A 1J1CA 4R5SA 3FXZA 2PULA 1PXPA 3BX5A 3OXTA 4C7TA 2LAVA 5D12A 1ZAOA 4KIPA 4O1OA 4KS7A 3WE8A 2OIDA 1W0XC 1U54B 5HIDA 3RBWA 2E9UA 2WMSA 4MXZA 2E9VA 3KMWA 3MY0A 2B54A 3D7TB 4M15A 4NJDA 2CGXA 3HYHA 3RJCA 4ZLOA 4FZFB 3GGFA 4JG7A 4QYGA 4TNDA 3LMGA 5IISA 2Y0AA 5CTPA 1M2RA 5HX8A 1LEZA 3I0QA 3KU2A 5TR6A 3UPZA 4ACDA 1YQJA 1DS5A 2G15A 4EJNA 3C4EA 3UC4A 1BI7A 4V0GA 1OPKA 3QX2A 4PPCA 3POOA 5A14A 5F9EA 4MF1A 2R3IA 1ZZLA 3EJ1A 3P86A 3VJNA 4YZMA 1FQ1B 4FTCA 4H39A 5LCKA 5AR7A 3EQPA 3L9PA 2QOIA 4UWBA 4I5HA 2WMXA 4L3LA 3DB8A 3CJGA 3R9HA 1GZOA 4EYJA 4FT3A 4I20A 3MPAA 4PRJA 5A4LA 4EYMA 2CKQA 4L3PA 4BDAA 1SNXA 2W1EA 2C5XA 1Q97A 3CEKA 3RHKA 3RAWA 3VBWA 2BZIB 2W5BA 4AN2A 4PV0A 3P7CA 2OJIA 3FLQA 5KX8A 4O7TA 4RC2A 2CCHA 3PVUA 2R3LA 3E8NA 4FIEA 2A1AB 4USDA 5AV3A 4J95A 5GJFA 5E8VA 4CZUA 4F1MA 1NVSA 4AA0A 4IVCA 5CVGA 2BHEA 4RVKA 3FLZA 4HW7A 4BTMA 4W4XA 3SOCA 4FSUA 1F3MC 3QQHA 3UQFA 5HD7A 3DZQA 5HCXA 2ERZE 3GEQA 4GK2A 3QBNA 4EHGA 4B0GA 2PE2A 4HYUA 4YU2A 2PUIA 2QI8A 4GJ2A 3G6GA 5KMJA 4ZXTA 2BALA 5DOSA 5ITAA 4Y5HA 5GZAA 3MSSA 4U3YA 3REPA 3VVHA 3QZGA 2PMLX 4TYHB 2VUWA 3NCGA 3ALOA 2Z2WA 3BHHA 4E6QA 4IMYA 4BI0A 1OPLA 2WTDA 4CFNA 4MXYA 3BE2A 4NW6A 2H9VA 2WOTA 3LFNA 4G6NA 3DY7A 3G0EA 5CEMA 3H4JA 2J0IA 5HBEA 3LVPA 5IDPA 2V5QA 4EH7A 4BCGA 4OR5A 4U8ZA 2G2IA 4YMJA 4RC3A 4GUEA 4J71A 4CQGA 2GNHA 2VTAA 4YPSA 4C36A 4FTLA 1ZARA 2CN8A 2R4BA 3LFEA 4WO5A 4L43A 3IOKA 4L46A 3Q9XA 2J5FA 5HNGA 4AUAA 3KULB 5TKDA 1AGWA 4MHAA 4RIOA 2C3IB 2HELA 2C1BA 3GC9A 5HLWA 3UG1A 2G9XA 4KIQA 3VAPA 4I6QA 2A19B 5FUTA 5AUZA 3DDPA 1QL6A 2ZAZA 4D9UA 2W4OA 3U55A 2XK6A 3DCVA 4DE4A 4ZS0A 3LCTA 1XJDA 4FSMA 4V05A 3TKIA 3MPTA 5GJDA 5DIAA 4RWIA 4JDKA 2YZAA 4ZK5A 3BHYA 3IGOA 5IEVA 1WBWA 3FXXA 3NAXA 4O6LA 5EI6A 5CAPA 1Q62A 4YJUA 2EWAA 1G8AA 4CRLA 3JYAA 4RA4A 3QKMA 4U81A 3PXQA 5CF8A 4QMLA 4EONA 1LPUA 3AOXA 4C4JA 4C2WA 1PKGA 3TZ7A 5BUIA 2ETMA 2ZOQA 1SNUA 2YISA 3FMNA 3HV5A 4M69A 3PFQA 3DTWA 2DUVA 4TZRA 5A4TA 5HORA 5IQAA 2WMVA 4GS6A 1CKIA 1PKDA 5LXMA 3FQSA 4BF2A 5HG9A 3A4PA 3VUKA 3PE2A 5LMAA 5M07A 2CPKE 3TWJA 2I0YA 1U5QA 2PVHA 2WQOA 3E3PA 4ACMA 4BGGA 4A9RA 2CKEA 1Q3DA 2X8DA 3H9RA 4IM2A 3PSBA 4ZY5A 3BHVA 5BVFA 2JLDA 1WVWA 4ZZMA 1K3AA 2HZNA 5K0XA 5A4EA 2BKZA 3F88A 5GZ9A 3FHIA 3FL4A 3B8RA 3MIAA 4FYNA 3QYWA 4FNWA 5DN3A 4EK5A 2QOFA 4XRJA 1ERKA 5I3OA 3R8ZA 3BBTB 1KUTA 3LXKA 3U87A 1OKYA 3GI3A 3EN7A 5CLPA 4M7IA 5CS6A 5CT7A 4EKLA 4F1TA 4ANOA 2OFUA 2WMTA 4O7YA 2VTTA 4EH6A 5E8TA 2W1GA 3QTWA 1YXVA 5EHOA 3WI6A 4Z55A 3VBVA 5JMSA 4GYIA 1Y57A 3HV6A 2CKPA 4NWMA 3GC8A 4O82A 1UNGA 4O86A 3CC6A 3PZHA 4G9CA 4GCJA 2BAJA 2QO2A 1O9UA 3Q3BA 4IFGA 4J97A 4EH9A 2QKWB 2VGOA 3KRLA 1NT2A 4KSQA 5IA5A 4DEBA 3ATTA 3R71A 4UALA 3FYJX 2VO6A 3BZ3A 4FKWA 1J91A 1YWRA 3EH9A 1HCKA 5I3RA 3P1AA 3AC3A 3EZVA 4X3FC 4MXXA 3DJ7A 3BQCA 3FPMA 4AW1A 4FEXA 4RJ5A 4X6RA 3LCKA 5L6OA 2UW7A 4CMUA 5FXQA 3RINA 3KN5A 2XK7A 4CEGA 4AA5A 2WMUA 1AQ1A 2OICA 4ITIA 4UMRA 2C3JA 3QQFA 4QTAA 4G1WA 1G5SA 2C47A 4EOQA 4OTFA 3IS5A 3KA0A 4IFCA 4PTCA 3I0OA 4CKRA 1H1SA 5IQCA 1E1XA 2OZAA 2VWIA 4GG5A 4M13A 5ANKA 4ZY6A 4KS8A 3CPBA 5M4UA 3C0HA 1PY5A 3GOKA 3L8SA 1KOAA 2HAKA 4YZCA 4G3FA 5DRBA 3TN8A 4X2NA 1BL7A 1M2PA 2YA9A 4WRGA 4YJRA 4D55A 4EH5A 3I81A 5M4FA 1QPEA 3D7ZA 4GIHA 3BV3A 5ANIA 1ZYSA 3P5KA 4HGEA 4JLCA 5ANDA 4GT5A 4B99A 4ZAUA 4Q5HA 3UMWA 4EOPA 3TDVA 3HMNA 2XUUA 3EN9A 4CMTA 3DNDA 3GOPA 4G3GA 5KUPA 1PMVA 5C8MA 5JRSA 3RP9A 4I0TA 3W2PA 2XM9A 1IEPA 2PUUA 2BZHB 5CQWA 4KWPA 2YLEA 4YJQA 3R9NA 4EJ7A 5AIRA 2FSOX 2OJGA 3DB6A 1APME 4FUYA 4E4LA 3FUPA 4AGUA 2PL0A 1WBNA 1H24A 5BVWA 5K3YA 1R78A 5I5ZA 3KVXA 4F1OA 3RCJA 3T9TA 4TN6A 2W7XA 3JY0A 3R7UA 3NMUF 2GQGA 3GXLA 5A4CA 4IBMA 4J53A 2QKRA 4ZTRA 4M67A 2WKMA 2JEDA 1KE8A 2YCRA 3PWYA 5CI7A 5AUWA 5LWMA 3ITZA 4BCPA 2XNPA 4YHFA 4IVDA 2X2KA 4GG7A 3F82A 4MNEB 2PE1A 4QP1A 1UV5A 3D0EA 3ORTA 5CXZA 4C02A 1JNKA 3NUNA 3KKVA 4IACA 4KBKA 1V0PA 3DQWA 4IH8A 2C6KA 4YBKA 1ND4A 2X2MA 4AW0A 3GUBA 4KB8A 1RJBA 3O8UA 4RIXB 2P4IA 3C13A 3QKKA 5FBOA 3U9CA 3R2YA 4ID7A 4GL9A 3TNPC 3W2RA 1QPJA 4RX7A 2W5HA 3D9VA 3OEZA 5DT0A 1U54A 5BPYA 5IQBA 2VRXA 4L01A 4M66A 5EH0A 3D7TA 2GCDA 4Z7HA 3FMLA 3V8SA 3DAJA 1QCFA 4IEBA 1KOBA 4C57A 4KKEA 4NCTA 4QMVA 3QYZA 3R00A 3CCNA 4NEUA 5BYLA 3MS9A 1WBTA 2O65A 3R6XA 4HGTA 4ERWA 3QTIA 3KCFA 4WHZA 4RVLA 1YI4A 2BPMA 5KKRC 2WMAA 4NIFB 4NFMA 4EC9A 4FSWA 2OZOA 3AT4A 3FI3A 5IA3A 3A62A 5AV2A 3EFJA 4S33A 4FVRA 4AOTA 1I44A 4DTAA 5CU6A 5E8XA 3F3WA 3OWLA 3VQHA 3F3VA 5CQUA 3T3VA 3E7VA 2R2PA 4FV0A 4DT9A 3A2CA 3ACKA 4X21A 4MKCA 2A4LA 4QMQA 1S9IA 4QNYA 2GNFA 4FKJA 4PL4A 3FLSA 4HNIA 3GQIA 4CZYB 4BWKA 5HTBA 2XK3A 2PZIA 3OROA 4KIOA 3LZBA 2J5EA 3Q5ZA 5F95A 2OJFE 5J1VA 4AGWA 4ENXA 2BDJA 2GS7A 3CP9A 4X3JA 2WTCA 2F49A 3Q04A 2JAMA 5AUVA 5L6PA 2YITA 4O0TA 5IMEA 4S31A 3N4TA 3UZPA 2BR1A 3KEXA 3ZEPA 5HHWA 4O6EA 2VX3A 3HDNA 1A9UA 5IQHA 2VGPA 3GFEA 3R8UA 5EYMA 4QMUA 3UO5A 1GAGA 4F08A 2R3NA 3FXWA 4U9AA 3FE3A 5IDNA 4YJNA 5J95A 3KF4A 2ITXA 4TY1A 5AP2A 4IB0A 4O0WA 4RLLA 4R78A 2UVXA 4XP0A 5AMNA 4EEVA 1YDRE 2VO3A 3OWPA 5CEKA 3DKCA 2XEZA 3ORNA 4G6OA 3DAKA 4FSYA 4G5PA 3TTJA 1IRKA 3LW0A 1NVQA 4TYHA 3H10A 3E8DA 3TXOA 4XV2A 2J50A 3QC9A 3CLYA 4MH7A 2J0LA 4L53A 3EQDA 5AR3A 3H9OA 3HRBA 2IW6A 2FSLX 1QPCA 3FMHA 4YLKA 4YSJA 4KUJA 2F9GA 2Y6MA 3BI6A 1R1WA 2I0HA 2X4ZA 3O17A 2BFXA 2C6EA 5AM6A 4WUAA 4BC6A 3RPRA 5B0XA 2HXLA 1GNGA 4F9AA 4LOQA 5IA1A 4TWNA 3LJ2A 3IW5A 4DA5A 1U4DA 3BHTA 4XBUA 2UZNA 4FIJA 4PX6A 2OF2A 3QRUA 2R3MA 2J0KA 2OW3A 4BY9E 3KULA 4ZEGA 4EK4A 1MQ4A 4QPSA 5FRIA 3ROYA 1NY3A 5LWNA 3UVQA 1OB3A 2GQRA 3OTVA 4C34A 1XH4A 4CD0A 2NPQA 3LMHA 2J7TA 3QD2B 2CCIA 2GPHA 3NUPA 3I7CA 4DEAA 3NYOA 2XKEA 2G2FA 3R8PA 3C4XA 5CU0A 4WKQA 4C0TA 1BMKA 4D2RA 3UYTA 4JDJA 4OGRA 3KXHA 4GU9A 4EZ5A 4H3PA 2IPXA 3LLTA 3VUDA 5K9IA 2QOLA 4O1PA 4FT7A 4C3PA 1H01A 3ZUVA 5KBQA 4RJ8A 3ETAA 4QPMA 5BVEA 3FKNA 3KXMA 4G3DA 1PMNA 2GNLA 3Q52A 4C58A 5LJJA 2OF4A 2W4KA 2P2IA 2HIWA 2X9FA 3UBDA 1MUOA 4IM0A 4S30A 1OM1A 2XZSA 3JY9A 3AMBA 3TIZA 4MX9A 3CS9A 4ZP5A 3SW7A 2A0CX 4BI1A 3ZHPC 4L8MA 5AA9A 3SXRA 3F2NA 4IHPA 4KD1A 3K2LA 3R1QA 1Z9XA 2YDKA 2YCQA 2OXDA 2Z60A 3H0YA 3HECA 4M97A 5IUIA 3TZMA 2CSNA 2JKOA 3VNTA 4TL0A 3ATSA 3S95A 2QHNA 2R3FA 2XRUA 2RFNA 3F3ZA 5EQEA 1GIIA 2HK5A 5CSWA 3Q2MA 4KA3A 4YTHA 2B0QA 2HWPA 3FL5A 3VS4A 3EQGA 4PDYA 2X8IA 2ZMCA 4MK0A 4HPTE 4GKIA 4D0XA 1XH9A 3TNWA 5M06A 5IH5A 5ANJA 4QQCA 3ZC5A 5HG8A 4DYMA 5KMOA 3DGKA 2GS2A 3NUSA 3DDQA 2QD9A 3UG2A 1GZNA 3R8LA 2VU3A 1EH4A 3IW6A 2SRCA 5BVKA 5KZIA 3QALE 5D9HA 4A9TA 3OMVA 4WIHA 1PXOA 3R8VA 1SVEA 5FWKK 4BCKA 2Z7RA 5JFSA 5JFWA 5F20A 2VWUA 4AT5A 5E7RA 5J9ZA 4MXAA 5J9LA 1ZWSA 2JFLA 3QHWA 3SOAA 2PZYA 3QC4A 4FBXA 2BUJA 4GV1A 5H8BA 1UKHA 3V5LA 4HVSA 4ZSAA 4QTCA 5KKRB 2UZWE 4E73A 3D4QA 3H0ZA 3BLQA 3K3JA 5IQIA 4RQKA 4USEA 2C6OA 4FV5A 4CXAA 3DQXA 4M84A 2XP2A 4RX8A 3NEWA 5KMNA 2X7FA 4MNFA 4IANA 4X7QA 2YAKA 4IX5A 4CFMA 2JFMA 3Q4ZA 4IM3A 4YZBA 4BICA 3R2BA 4HZRA 3IW8A 3EMGA 4HVDA 3ULIA 5I4NA 3O71A 2BROA 3ENMA 3KK9A 4C3FA 2Z7SA 3ERKA 2BFYA 4II5A 1JSVA 2YCSA 3EQBA 3VWAA 3ORIA 2XF0A 3UC3A 4AGDA 2VTOA 2E9OA 4Z16A 5ETCA 4EQMA 2J90A 4FKOA 2ZB1A 3PP0A 5CALA 3O0GA 4G2FA 3GP0A 3D5WA 3A8WA 4TWOA 5G1XA 4DEEA 1G8SA 3VW8A 3GU6A 4ZMEA 2I40A 2C30A 4OTRA 4PY1A 3WE4A 4ASEA 3D15A 2UW5A 3ZLXA 4DGOA 4EOSA 4ZZNA 3MH2A 3LIJA 4AOJA 1MRYA 2QOHA 3TV6A 4PL5A 2XIZA 5E8SA 2JIUA 5D10A 3JVRA 4GIIA 4YC8A 5T68A 4MEDA 3H3CA 3RM6A 3IDPA 5J9YA 3OOGA 4XMOA 3N4UA 2BRNA 3L9LA 2QC6A 4Q2AA 5JQ8A 4HCUA 4U44A 3ZYAA 4PTEA 4A4OA 2C5NA 2ACXA 3L9MA 3EHAA 4CMOA 3AD5A 4FEVA 3SKCA 4BCQA 2PVMA 2PMIA 2ITQA 2XMYA 5IKWA 3QXOA 3TCPA 4E20A 3GCPA 4CVAA 5CNOA 4IB5A 3FKLA 2A27A 5CZIA 4D2WA 5EI2A 2C0TA 3TUBA 4UWCA 4Y83A 4LRMA 3LFFA 2NNWB 4MNEA 3U51A 4O0UA 5FP5A 4BTKA 4O0SA 4W8DA 3G9NA 4A4XA 3AD4A 5HX6A 3MIYA 2IVSA 2XJ2A 3V5TA 3EQCA 4QD6A 5BVOA 2UVYA 1L8TA 4RIXA 3NZ0A 5H8EA 2VNWA 3PYYA 4HZSA 3OW3A 3HLLA 1VYZA 5IEYA 4USFA 1YW2A 4FA2A 1GZKA 3UTOA 3OT3A 5FXRA 4TW9A 4FV1A 3R04A 5ETFA 2YN8A 4AZSA 4F0GA 3CBLA 5A6NA 2C3KA 1ZYJA 3ACJA 3NNUA 3UDBA 5DNRA 4MBLA 4A07A 3FZPA 3FI2A 3FHRA 4PNKA 2R9SA 1OPJA 2JIVA 3OCBA 1BKXA 2IW8A 4NUSA 1DM2A 3RPYA 3OUKA 3EWHA 4U5JA 4W4WA 5FQDC 5GIOE 1OUKA 3BEAA 1FGIA 1TQIA 2QLUA 3EN5A 4JOAA 4AACA 2NP8A 5A9UA 3O51A 4GW8A 2EUFB 3SAYA 2XK4A 3KRWA 2W1ZA 3UQCA 2X0GA 2YWVA 3PJ8A 5B2MA 3OG7A 1CDKA 3TI1A 4R3PA 5E1EA 4M0ZA 1T46A 1Y6BA 2GTNA 3PA4A 4ZOGA 5J5SA 2VAGA 4YTCA 3HRCA 3U54A 1P4OA 2PSQA 3A7FA 5FP6A 4JNWA 4DGGA 4QP8A 4W8EA 2ITPA 5D1JA 2XYUA 2B9HA 3QLFA 3R28A 4DFZE 5AAGA 4KABA 3C5IA 4ZS4A 2ITOA 2JGZA 4OW8A 2WD1A 3PPZA 1WVXA 3AC8A 4NK9A 4YSMA 4FC0A 3VC4A 4GEOA 1YOLA 2X1NA 2YEXA 4IXPA 4QYHA 3I6UA 3P23A 4R3RA 4RIWB 1V0BA 5GHVA 3RPOA 5HTIA 5IF1A 1TQMA 3Q6WA 3QFVA 4JBVA 4RBLA 3OY3A 4TYEA 2KULA 3S3IA 3VBXA 3MH3A 3O8PA 4WG4A 3R9DA 5TF9A 3SDJA 5EDQA 1KV1A 2P55A 3G6HA 3MJ2A 4WUNA 2ONLC 4MVFA 3UIMA 3ZXTA 4OTGA 4EWHA 4FSNA 4H58A 4ZMFA 2Y7JA 5BVDA 4EBVA 3OT8A 3KK8A 4QRCA 2C0OA 4BCOA 2CGUA 5AAEA 4BYJA 5HI2A 2JAVA 4D1SA 4C4EA 3COKA 5L2SA 3PXRA 2VTSA 1YDTE 2X6DA 1DAWA 2C69A 2VTIA 5ACBC 4BBMA 4W9XA 5AR5A 5HVJA 4M0YA 2NRUA 4DFUA 1LEWA 4JQ7A 1W98A 3RNYA 2I1MA 2JDSA 4FKRA 2VWVA 4BCIA 4EHEA 4RPVA 1VYWA 5CWZA 3RAIA 2PK9A 4MD9E 4CG9A 4UMTA 4QT1A 4MQ2A 4BDGA 2HY81 4AP7A 4NSTA 5CANA 4BGQA 2C3LA 2XBAA 5A4QA 3CJFA 4ZJIA 5AFVA 4E4XA 3PY3A 2NO3A 2JKKA 5KNJA 2WMBA 4D28A 2UW0A 2YM6A 3E62A 3EOCA 3GC0A 3R9OA 3RK7A 4BDHA 1JSUA 2WU7A 3QLGA 4FTOA 5IA0A 1DI8A 1FVTA 3DBFA 4DLJA 4FE2A 4O38A 4HYHA 3UJGA 5KBRA 5AA8A 2HOGA 3FJQE 3ZC6A 4OAUC 3O23A 5FG8A 3UNZA 4J96A 5JT2A 2QCSA 3HDMA 4H36A 4YJVA 3VS0A 5HNBA 4FVQA 5IQEA 1JKTA 3KMMA 3OHTA 5IUGA 5C9CA 3P4KA 1BI8A 5HD4A 4RRVA 4WD5A 2YJRA 3VHKA 4F64A 2P0CA 2XKFA 3VS2A 3VUGA 3WIGA 2Y4PA 2B52A 2C6DA 3D5UA 3WOWA 3UVRA 3HAVA 1NA7A 2YIRA 3WARA 1SVGA 3VBQA 4QPAA 5I9ZA 4NL0A 5E8UA 4LOPA 5EYDA 2B9FA 2XS0A 4YJOA 4B7TA 2PHKA 5L2QA 2C1AA 4K8AA 2W1HA 2QU5A 3RZBA 2FGIA 3PIZA 4EORA 2R3GA 4J98A 1JPAA 5LCJA 3ELJA 5AP7A 4LGHA 4E6CA 1ZY4A 3DLSA 4JQ8A 3RHXA 2ZV8A 3TEIA 2YLFA 3CPCA 2QOOA 2QOCA 4I1ZA 3LQ8A 4KBCA 4QMNA 5EM5A 5CF6A 1FVRA 1ATPE 2XYNA 3KN6A 4D1ZA 2XB7A 4FG8A 4HCTA 3F5GA 1A06A 4AE9A 2YIWA 5IA4A 4C8BA 3IPHA 4CLIA 3QUPA 4F7NA 1PXJA 1ZMUA 2JKQA 1W7HA 2Z7QA 5D7AA 1B38A 5DA3A 4FT0A 4BWXA 3WF6A 2P2HA 3PY0A 3MB6A 5HE1A 1SZMA 1REKA 4TRLA 2ESMA 1FOTA 2CLXA 4F6UA 3LJ0A 5EI8A 1FPUA 3K5UA 5HE3A 3VUTA 1U59A 3F61A 3QWJA 4BL1A 4DTKA 1ZYCA 3ZXZA 2BAKA 3I1AA 2B53A 2B7AA 2UW3A 2WNTA 4I23A 5EHYA 3H9FA 4RJ6A 4P7EA 2RSVA 5HZNA 5CXHA 4TWCA 3UP7A 1RW8A 4F7SA 4JVGA 1JWHA 1PYXA 5HLPA 4O84A 4XG9A 2QLQA 5AP5A 2WQNA 3GT8A 3QUDA 4EHZA 1UU3A 3E63A 4OUCA 3A4OX 4U43A 3VS6A 3ZU7A 3LCSA 5AUXA 4NW5A 1FMOE 1H28A 4L45A 2W1IA 2WTVA 3PIXA 1Y8GA 4C33A 2XNBA 1Q4LA 1PW2A 4IVBA 4D2VA 4R1YA 3C50A 3VF8A 1GOLA 4PQNA 3K54A 2R64A 4A9SA 4B6LA 2XJ0A 3E93A 4N6ZA 4TWPA 4P4CA 3V6SA 4O0VA 3QTXA 3U6JA 3IW7A 1XKKA 3F69A 3ZO2A 4AXAA 2V22A 4K9YA 3GQLA 4N4SA 4DHFA 3PA5A 4RX5A 3U4WA 4QOXA 1E1VA 4I6FA 5J1WA 1NW1A 3QTQA 3T8OA 3BHUA 3CY2A 5CEOA 5CF4A 2VO0A 4RZVA 3HUBA 4QMXA 1P2AA 3UOKA 5LMKA 1SYKA 4BBFA 4LL0A 5T6KA 4DH5A 3A7HA 5H3QA 3NS9A 1E9HA 5LARA 5IPJA 3RVGA 5HG7A 2XKCA 4YLJA 3TIYA 4HGLA 2BZKB 3C4ZA 5CU2A 4EH2A 4FUXA 5I9WA 3RWQA 1OMWA 4AN9A 3KFAA 4NM5A 4E5AX 2YIYA 3ET7A 3I6WA 4KBAA 3DNEA 2V0DA 3UMXA 5DYJA 2CGWA 4IAKA 2O5KA 4FK6A 4EUTA 3BLHA 3LFBA 4G31A 3E87A 4OBOA 3WYYA 4E4MA 1WBVA 3UZRA 5IG1A 3ULZA 5TT7A 4A7CA 1G3NA 2VTPA 2WIHA 4K77A 5HTCA 3NPCA 1TQPA 3R02A 4FV3A 2I0EA 3GCVA 5HIBA 2E9PA 2PUNA 3W32A 4XG8A 3S4QA 3OBGA 3PTGA 5J8IA 2RIOA 5G6VA 5J79A 3S00A 4S34A 3QCYA 2UW9A 5EM8A 3AT2A 3KMUA 4XS2A 4G3CA 1WZYA 1YXTA 3W1FA 3ZSIA 2UZDA 3E3BX 5EOLA 2GSFA 4RQVA 4FL2A 3R1NA 4KIKB 3QX4A 1XR1A 3DA6A 1NXKA 4L6QA 3VRYA 1H08A 3WF5A 4R77A 4XRLA 3E92A 5CI6A 4HVIA 2IO6A 2ZJWA 3AQVA 3V8WA 5EW9A 1H00A 1IAJA 4Q9SA 1V0OA 3BYVA 4IX4A 2QVSE 3DTCA 3IK3A 3BYSA 3KGAA 4FKTA 4EQCA 5HO7A 4ZIMA 5JK3A 1P14A 3LFQA 3F5UA 3SD0A 5HKMA 3FC2A 4DFBA 1H26A 4LV8A 3L1SA 4O91A 5HQ0A 3SG8A 3MVMA 3BYUA 2PZ5A 3FZRA 4XHKB 5DWRA 4YTFA 5IQDA 1Q8UA 3L8VA 4M14A 3ANRA 5M4CA 5K5NA 4RJ7A 1XQZA 3JPVA 4EOKA 4HYIA 2HCKA 1Q8WA 4QP7A 5AR4A 5KHXA 4NTTA 3GENA 4LRJA 2F2UA 4EKKA 4GYGA 2IZTA 1DI9A 2H6DA 4BIEA 4XX9A 4YZ9A 2XIKA 3ROCA 2PVLA 4TNBA 2Y6OA 1IASA 4U45A 4AU8A 5E90A 4EOIA 1H07A 3MY1A 3Q9WA 2VX1A 3PY1A 3FMDA 5M51A 3OZ6A 1WBSA 3LCDA 4GJ3A 4O2PA 5IEXA 4ANQA 4FODA 4LUEA 1KE9A 1WVYA 2UZLA 5CVFA 4D2SA 2WEVA 5LVLA 4BZNA 3W8QA 5BUJA 4RIWA 3PRIA 4ERKA 2HYYA 4RA5A 2WZJA 4C37A 5BNJA 4O7WA 4IJ9A 4TPTA 4ITJA 2GMXA 3OTUA 4N70A 2BHHA 2OSCA 2O63A 2CN5A 2W99B 4KNBA 4Q5EA 1Y91A 1OKVA 3GCUA 4BR3A 4C61A 5IQGA 4JT3A 1IG1A 4EL9A 2ZB0A 4IX6A 4DGNA 5C4KA 4YR8A 3V5QA 2OH0E 3NCZA 2ETRA 2C6LA 4LFIA 2XEYA 3OWKA 4W4VA 4AQCA 4FKSA 1KE6A 2AUHA 3QTSA 2W17A 3QD3A 5DGZA 3DZOA 4R1VA 5A46A 3CD8A 3HVCA 5GZ8A 3CXWA 4MBIA 5J7BA 1O6YA 2GTMA 4Y73A 4DG3E 2C5VA 2VO7A 2ZM1A 3F5PA 3O2MA 3S2PA 3ZLSA 3MH0A 2RG6A 3TV7A 3QQUA 3COIA 4O0RA 2UZVA 2PVFA 4AOIA 4FTTA 3PSCA 3W16A 3PLAE 2OWBA 1T45A 4XEYA 4K2RA 2W9FB 5BX0A 4FZ7A 4WBOA 4FOBA 5GIPE 2PU8A 5AX3A 4MF0A 3DPKA 4L7FA 5BYZA 1A48A 2G1TA 2XBJA 3BEGA 4FYOA 2OG8A 4J1RA 1JQHA 2X8EA 3U4UA 1FVVA 2BDWA 4DCAA 3IO7A 4IWPA 3PVBA 3PLSA 4JRNA 5HCZA 2F7EE 4RC4A 4DH1A 3L8PA 4U97A 5LMBA 3R22A 4DG0E 3QL8A 3WZEA 5KMMA 4JX3A 2DWBA 3P0MA 3PUPA 1YXXA 2C4GA 5CEQA 1OKZA 5IH6A 3OCGA 4G17A 4M8TA 2B9IA 3FY0A 3SX9A 3F66A 5BQ0A 2VTMA 1SMHA 3LAUA 4XV3A 1H25A 3LM5A 5EYKA 5L8KA 1OL6A 3R7OA 1ZMVA 4U7ZA 4EBWA 5KMLA 3AG9A 4QNAA 1AD5A 4CCBA 5DH3A 1YHVA 2UVZA 3CR0A 4MWIA 4MXOA 3QCSA 3DXQA 2DS1A 2XIXA 4EK6A 3NW6A 3CGOA 1ZMWA 2Z8CA 3B2TA 3IQ7A 5EHLA 3UPXA 3ZUUA 2Q83A 2X7OA 4LGDA 4RWLA 4AGCA 4AZWA 4X3FB 4DEGA 3EKKA 4GVJA 4XG7A 3PXKA 4MQ1A 4IC8A 1OBDA 2Y9QA 4UZHA 2FH9A 1PJKA 5K0KA 2RFDA 3LCOA 5TE0A 2FO0A 2RGPA 3ZZWA 3CKXA 1O6LA 3KXGA 4FNZA 5FM3A 3ZMMA 4AWIA 1M14A 4WRSA 5TOZA 2IVUA 2QU6A 1OIYA 1RE8A 1B6CB 3C9WA 4J99A 3NNXA 3UYSA 2J51A 5AWMA 5CVHA 3KL8A 5JH6A 3TM0A 4OLIA 4IAFA 3SVVA 2G2HA 3HV4A 2X39A 3OW4A 4PMMA 4G9RA 4O0YA 5H2UA 4HVGA 2UZOA 3MWUA 5DR6A 5HESA 4CFVA 3NUUA 4Y85A 4DINA 2XNOA 3W8LA 4XH6A 1XBBA 1P5EA 4FX3A 4X2FA 1Z5MA 5C8KA 3GCSA 4FTQA 4UXLA 1JKSA 3AC4A 3AC5A 3FZTA 3L9NA 3NDMA 4JIAA 1M52A 2EVAA 2HW7A 4BDCA 2UUEA 3MESA 5DT3A 2OK1A 3NX8A 4JIKA 3ZZEA 2YM3A 4J8MA 2DQ7X 4FKQA 3U6IA 4GKHA 3ALNA 1GIJA 2WMWA 5J87A 1YI6A 4EH4A 3F3TA 3ORLA 4C2VA 4YGAA 5FEDA 4FKPA 3TACA 4DG2E 3NNWA 2PTKA 4PWNA 3CGFA 2JBPA 3TDWA 4BB4A 4AT3A 2HZIA 1WAKA 2VTNA 4XYFA 3B2WA 1XH8A 3IDCA 4O22A 3P9JA 4XCUA 3OCTA 3SXFA 4BKJA 5CAQA 5C4LA 4D5KA 4HPUE 4H05A 3IKAA 3CE3A 4CFXA 2BRBA 3RZFA 4F9BA 4XP2A 3ZRLA 3R7IA 4U3ZA 5HVKA 3OP5A 3LQ3A 2XNEA 5FM2A 2R3QA 1Y8YA 3EZRA 3JVSA 3MBLA 3VUHA 5AUUA 2BTRA 4IB1A 4P5ZA 3EQRA 5JGBA 4DTBA 2QO7A 3BU5A 3VW6A 4FK3A 3IW4A 5DE2A 3AMYA 2BRHA 3NSZA 4DGLC 4OAVB 4NM3A 2JDVA 2UV2A 2UW4A 3BWJA 4YNEA 3TNHA 3W55A 1OGUA 1XH5A 3NYNA 4L3JA 3TT0A 3FY2A 2BKKA 4RSSA 3WZKA 2UW6A 1PMUA 4L00A 1UWHA 1YHSA 3PXZA 2VWYA 2X2LA 5L6WL 3QZHA 4JDHA 5CSHA 4QP9A 1J7IA 3DBDA 4FZ6A 4AE6A 1URCA 4JQEA 3T3UA 4QMSA 4F4PA 4O96A 2XNMA 4FT5A 5CSPA 1W8CA 3PIYA 4DFNA 2F4JA 1X8BA 2ZYBA 3S1HA 4BRXA 3BU3A 5JZJA 5FGKA 4O7ZA 5L2IA 3DXPA 2GQSA 4JG6A 5BVNA 2YHVA 5EM6A 4QYYA 4CGAA 5GINE 4ACHA 4YP8A 5FTQA 2GFCA 4ASXA 4EH3A 3PWDA 2HXQA 4QTEA 2R3RA 5DHJA 4GVAA 4WSQA 4FNXA 1J7UA 3OVVA 4CSVA 2EXMA 3O7LD 4QMZA 2O64A 4IWQA 1PXMA 2XCKA 3Q96A 1XO2B 4FTUA 4X2GA 3S0OA 3E64A 4Q9ZA 4X6QC 4ZSGA 3VS7A 3HA6A 3QXPA 3D83A 4TTHB 3RWPA 3VQUA 1MQBA 3A7GA 2J0JA 4JBPA 3FQEA 5EOBA 4F0FA 4RMZA 3DBCA 4FG9A 4U0IA 3P08A 3SA0A 4TYJA 4AN3A 3FBVA 3M1SA 3PXYA 3F7ZA 5AAFA 4QTBA 4BHZA 4KIKA 2GNIA 3G15A 4FSTA 3V5WA 4F65A 5JRQA 4C4HA 4EH8A 2EB3A 3BBWA 2ZV7A 3NYVA 2IWIA 4E5WA 3MW1A 4O7VA 1S9JA 3HMPA 4LRKA 5DT4A 3HMIA 3ZDUA 2BMCA 2QR7A 3PZEA 4FICA 5EKOA 3RPSA 3ZBFA 2EU9A 4AZVA 2BTSA 3E88A 4DBNA 2PY3A 3LKMA 2IVVA 3ZFMA 4ENYA 4ALVA 3A60A 4R5YA 5J7HA 4F99A 4R8QA 2I7QA 4DFYA 4WNPA 3V6RA 3N4VA 2ZV9A 3KC3A 4FMQA 4XOZA 4YHJA 3FMMA 2VZ6A 2OGVA 1WBPA 2V7OA 4FEWA 5FTGA 2BIYA 4A4LA 1MRUA 1CKJA 4D4RA 2OXYA 2BRGA 2VWWA 3ANQA 4JBQA 3FWQA 4PDSA 4EQUA 4K1BA 4QQTA 4XOYA 4ZSLA 2JIIA 4BN1A 2JC6A 4PPBA 4CZTA 2BILB 5FDPA 5AUTA 3I79A 3KXXA 1YI3A 4ZTHA 4DH8A 3R73A 4FNYA 2OO8X 1PXKA 1H4LA 5HVYA 3E5AA 1GJOA 3QCQA 4P5QA 4BDBA 4DEHA 4MTAA 3SXSA 3V01A 5L4QA 3PPKA 3ZUTA 3ZM9A 4A9YA 3FLWA 1MP8A 5EYCA 2IW9A 4PDOA 4NYEA 2OFVA 3O8TA 4JX7A 4DH3A 4NU1A 5AP3A 2BDFA 3BKBA 4DCEA 4GU6A 3EN6A 3R1SA 4ANLA 3LLAA 2V62A 5IH4A 4D2TA 5FEQA 2IN6A 3MVJA 1JKKA 1ZXEA 2YIXA 2LGCA 5E8ZA 3ZSHA 4GFOA 4O27B 4TT7A 4CLJA 4BFMA 2F7XE 4CFFA 4ZTQA 2ITNA 3DBEA 3BIZA 1JAMA 4O7LA 2B4SB 1M2QA 3FMKA 5F4NA 3II5A 3EYGA 3SRVB 3FSFA 2XK9A 4AZTA 4D5HA 4UB7A 1YOMA 1WMKA 2PVKA 3EFLA 4BKYA 5K5XA 2VTLA 4E5BA 4O21A 5HO6A 4YO6A 3G33A 4NZWB 3UE4A 4ZZOA 5EQPA 4ZTLA 2XVDA 2RF9A 4NIFA 3ZOSA 5HBJA 2OKRA 2F57A 3PG3A 4I5PA 4FTKA 2GHGA 1ZY5A 3BGPA 4CKJA 5CNNA 1ZYLA 3K5VA 2R3OA 2ZDUA 3DBQA 3KRRA 4RX9A 4CT1A 3Q9ZA 4XLVA 4HGSA 4C35A 2YM5A 4QQJA 4OT5A 2YFXA 4IAIA 3W2QA 4CFUA 3FKOA 4OTHA 2X9EA 4C4GA 3FI8A 2YZLA 3WYXA 4H1MA 4D1XA 4RJ4A 4I5CA 2IVTA 4IW0A 3MFSA 3KXZA 2EB2A 2OLCA 3EL8A 4WA9A 1M7NA 4MBJA 4UWYA 2HZ4A 4WNMA 4FTAA 5BMSA 4G34A 4FGRA 4ORKA 3HGKA 4AX8A 4PNIA 3HKOA 4L9IA 3SGCA 5EW8A 3QUEA 2QO9A 5FBNC 3HP2A 4IAYA 3C4WA 4FTNA 3OOMA 5IU2A 3RKBA 3Q60A 4WSYA 4FKVA 5BUEA
chains in the Genus database with same CATH superfamily
4UXQA 3IGGA 3NYXA 3OF0A 4QP4A 3QTRA 4TYIA 3V51A 3AKLA 3UDSA 5CX9A 2W1FA 1JBPE 2YJSA 4MCVA 3O7LB 4GSBA 3BGQA 4BZOA 3NNVA 4DLIA 2W4JA 4C38A 2WELA 4S2ZA 3ZS5A 4IDTA 5E8YA 4JR3A 1UWJA 2BCJA 2HZ0A 1OITA 2BRMA 5M09A 5ANGA 3RPVA 3ZO1A 4IWOA 2WTKC 2XAOA 3C1XA 3RI1A 5JEBA 3ORZA 5A3XA 4FGBA 2IF8A 3TG1A 4AA4A 4GFGA 2QURA 4IDVA 2QOBA 4WOVA 3WZUA 3HMOA 4I5MA 4RT7A 4X3FA 3Q9YA 3LFDA 2JBOA 3ID6C 5KE0A 4RWJA 3FZOA 3QAME 2RFSA 3KCKA 5IZFA 5CENA 5ETAA 3LJ1A 2ETKA 5EFQA 4R6VA 4B8MA 3UNKA 4YO4A 1HCLA 4V01A 3C7QA 4QEBA 4C3RA 4K0YA 3PVWA 4JDIA 2WU6A 3OXIA 3BPRA 4NH1A 4UEUA 2ITUA 2JDTA 4JR7A 5KHWA 4DAWA 2XCHA 1W84A 3HA8A 3RK5A 2O2UA 3ORXA 5JKGA 3ZO3A 4AW5A 3KB7A 4BCFA 1ZOHA 3PUFC 5CY3A 1YVJA 4U42A 1L3RE 4LI5A 5AP6A 5L2TA 3W0OA 4IX3A 4ANMA 3BRBA 4QYFA 3ZBXA 4QMMA 3W33A 5KMKA 1UNHA 3EB0A 3JUHA 3ZDIA 1PYEA 5BMMA 3NRMA 4IZ5A 2C6IA 2QONA 4KKGA 4FIFA 5DPVA 4YJSA 4ACGA 1CSNA 3QD0A 3Q2JA 4PPAA 4TYGA 3FZSA 4LM5A 5DR9A 3MN3A 5ETIA 3HV7A 4ZY4A 1Q24A 4FKGA 4IE9A 1Q3WA 4F63A 2B55A 1K2PA 4YBJA 4O81A 1FGKA 2YABA 4D0WA 3FYKX 4QP2A 2CNVA 3QWKA 1QPDA 1WBOA 3K3IA 2VWBA 4LQMA 3OC1A 4RGJA 1OBGA 4QMPA 4DGMA 3AMAA 4BDIA 5A6OA 1R0PA 4QMTA 5AUYA 2F2CB 2W1CA 4MWHA 4WG3A 5AV0A 1REJA 3VUIA 1STCE 3NVMB 5AV4A 4GK3A 2WAJA 4R7IA 4XV1A 3GBZA 1VZOA 5HLNA 3P7AA 4P2KA 4CRSA 4PP7A 5KO1A 2XKDA 3HNGA 3W0NA 1BLXA 3ORMA 4E26A 4L67A 5C27A 3IECA 1OVEA 4F09A 1W83A 4I6HA 3Q4TA 2XA4A 2ITWA 5HBHA 4WBBB 1Q8ZA 5CSXA 5CU3A 3RTPA 4PUZA 5JQ5A 2XNNA 3G9LX 2WIPA 5E92A 2YAAA 4O7SA 2R7BA 5HCYA 4I92A 1PXIA 4F6WA 2R3JA 4MXCA 4NJ3A 2J9MA 3L8XA 4IADA 5AM7A 4HVHA 5DG5A 1XBAA 2PMNX 2WOUA 4MYGA 5D7VA 4CT2A 4OTIA 3JR1A 3HL7A 2WQBA 3LXPA 3BL9A 4C4FA 3AD6A 3ZLWA 5T3QA 5CEPA 3NUAA 2QQ7A 3G2FA 4YJTA 5LVMA 3C4FA 4UY9A 4U6RA 5AIKA 2WGJA 4C62A 3UOHA 3UGCA 3QCXA 1LP4A 3HRFA 2VTQA 4D4SA 5JZNA 5HNIX 2W0JA 4BIDA 4YUQA 3LFSA 1Q8YA 3P7BA 4BHNA 1RQQA 4XUFA 4ZTMA 3OBJA 3MFRA 4Y72A 5E8WA 3OD6X 1V1KA 2PZPA 1CTPE 5AP1A 4GRBA 2W96B 3D14A 4FR4A 4E7WA 4JAJA 3FAAA 2YM4A 1FINA 1VJYA 2OH4A 3I5ZA 2A2AA 2X81A 2AC5A 3MDYA 4XP3A 5FD2A 3VIDA 4ZJVA 4FKLA 4MD7E 4XV9A 5JGAA 3R7VA 1RDQE 5E4HA 2OXXA 2CGVA 2Y8OA 3MTLA 2C68A 3EFKA 2WPAA 3QQJA 4KINA 3VRZA 2IJMA 4W4YA 3P5JC 5GJGA 2XNGA 4N0SA 5E91A 2WFYA 2YACA 1YXSA 2W06A 4F7JA 4FL3A 2P3GX 4BKZA 2WQEA 2CDZA 2XJ1A 2PVRA 1F0QA 4ARKA 4EWQA 1OECA 4CG8A 3CTJA 5I9VA 2B9JA 4DFXE 2I0VA 1HOWA 3LFCA 1GZ8A 3UO4A 1J1BA 3BU6A 2IZSA 2REIA 5DI1A 1Q8TA 2ITVA 4Z9LA 2YERA 4YTIA 4RVMA 3TZ8A 2ZM4A 4D4YA 3QZIA 4F6SA 4APPA 2VTRA 4ANBA 4EUUA 5CASA 4K11A 3ZRKA 4CV8A 5LVPA 4FJVA 3FMJA 4GUBA 3TNQB 3RMFA 3SHEA 3M2WA 2PVYA 3DV3A 3MFTA 3TL8A 4GT4A 3R30A 4O4BB 3UQGA 4UMUA 4L52A 2QOKA 4OTWA 1XH7A 3AT3A 2WTKB 4QO9A 3FC1X 4FT9A 2VNYA 4LGGA 4OTDA 5HGIA 3DT1A 1P4FA 1KE5A 4HOKA 4RIYB 4CYIA 4F9WA 3D2KA 3ZH8A 1ZZ2A 2H8HA 1CM8A 4FEQA 1ZOEA 4PTGA 4X0MA 5HO8A 3U9NA 4FTRA 3ORPA 4L44A 5EG3A 4EOJA 4XG6A 3WZDA 5A54A 4AF3A 1SVHA 4UBAA 4LYNA 3TZ9A 3NUXA 1YOJA 4CTBA 4I22A 3WF7A 5L8JA 4BGHA 3PDTA 4ONAA 3SG9A 2J6MA 4IJPA 4IQ6A 1OL7A 3SLSA 5L8LA 4BIBA 2PYWA 3VN9A 5KCVA 2EXEA 3UODA 3DAEA 4PMPA 2X7GA 3ZTXA 1Z57A 4PL3A 4ACCA 4R7HA 3W0RA 4ITHA 3TNIA 2XAMA 3PE1A 3C4CA 3QZFA 5JSMA 1LUFA 2QG7A 1KWPA 3F5XA 3DU8A 4M12A 3LMIA 5DR2A 3LQ5A 3COMA 3G51A 4MD8E 2PUPA 4DHJA 3PRFA 3IG7A 5AV1A 3GU5A 3TJDA 4DFLA 3SRVA 3BV2A 1URWA 4DN5A 4FKUA 2IZUA 4G6LA 4FZDB 3VHEA 1IAHA 3OCSA 4O2ZA 2W9ZB 4Y95A 2J4ZA 1UA2A 3QGYA 2W5AA 2J2IB 3VJOA 2WMRA 4IVAA 4O7RA 2ITYA 2WEIA 3NFFB 1DAYA 3D5VA 2ITZA 2QOQA 4LV5A 4UX9A 5HICA 4ALUA 3RGFA 3OY1A 4OT6A 3V3VA 4KRCA 4R3CA 1O6KA 2CNQA 4YPDA 4NTSA 4NKSA 1UNLA 3MY5A 3R83A 3ZFYA 2PVJA 3PJ2A 1B39A 4XJ0A 4BJJA 3I5NA 4EK8A 4E4NA 4V04A 3MI9A 4YNOA 3PJ3A 4UMQA 3FPQA 4LL5A 4EHVA 3PPJA 3TKUA 5CT0A 2JITA 3W10A 2I6LA 4MUQA 4QDEA 1WCCA 3UZTA 3AGMA 4AS0A 3CD3A 2BAQA 3NUYA 3CY3A 2CHLA 2Z02A 2F7ZE 1PMEA 3D5XA 5DRDA 4E6DA 3BCEA 5EDPA 1H1PA 3F2AA 1OIUA 4FV7A 1YKRA 3LFAA 4FV8A 4H3QA 4H3BA 3VBTA 2KTYA 4DEDA 1SM2A 1OIRA 2VWZA 1XH6A 5BYYA 3DKFA 1UU9A 4LUDA 1KE7A 5DEWA 1YWVA 2R0UA 3UIXA 4JS8A 2FYSA 2GU8A 4KKHA 2J0MB 5CF5A 3CTQA 4XLIA 4FZAB 2UZUE 3W0SA 5E1SA 4WNOA 4XG4A 5I0BA 5B7VA 3C0GA 4FTMA 2X6EA 2RFEA 3R0TA 4G3EA 4BDJA 3C5UA 2O8YA 3TUDA 3F2RA 2HENA 4BZDA 3GB2A 2C5YA 4BDFA 1ZRZA 3LPBA 3EQFA 2WTWA 1H0VA 4QP3A 3QRTA 3R7EA 4D2PA 4EK3A 3QF9A 5L3AA 2CKOA 1F5QA 4FSRA 3HP5A 4HYSA 4G5JA 4IAZA 4DBXA 3NR9A 3SW4A 5HE0A 3ZO4A 2B1PA 4FEUA 3ZRMA 1XBCA 1FMKA 4YURA 3V5PA 5C26A 3WBLA 3KQ7A 2FSTX 4A9UA 4DH7A 3QU0A 2FB8A 2W1DA 4BWPA 3R8MA 3VS1A 2ZMDA 4D4VA 5ACKA 5HU3A 3F9NA 1JOWB 3AXWA 3MV5A 2NRYA 4FIHA 3C51A 5AADA 1BUHA 5M55A 2YM7A 4AAAA 3W0MA 4CYJA 2FSMX 3NAYA 1PXNA 4E93A 5CAVA 1FBNA 5EM7A 5IMXA 4ZLZA 3MJ1A 4LG4A 1VEBA 4KAOA 4PF4A 3A99A 3V04A 5LVNA 3DKOA 4JBOA 2AC3A 4FKIA 4PP9A 4CTCA 2JDRA 2NYAA 4YLLA 3GNIB 3KF7A 3W2SA 1BX6A 4I0RA 3BQRA 5H8GA 1R3CA 4IZ7A 4I0SA 4DITA 1W82A 2P33A 4Y8DA 1H0WA 3EFWA 5FDXA 4BBEA 5E9EA 4FIGA 4Z7GA 3SQQA 1UVRA 3JXWA 4I6BA 4GFMA 4JJRA 4E1ZA 2HY0A 1U5RA 3GVUA 4RFZA 4O0XA 4QMWA 4KRDA 3QQKA 2GNGA 2RKUA 4FI1A 4PDPA 1W2CA 5C8NA 1CKPA 2UW8A 3IONA 4I41A 3FEGA 2X4FA 4ASZA 2IZRA 2O3PA 1JSTA 3FI4A 3DK7A 4IB3A 3OXZA 2JDOA 4UYAA 2ITTA 1BL6A 2GHMA 5AR8A 3FDNA 5ANOA 4BCHA 3ZFXA 2VWXA 3KY2A 2VX0A 3V8TA 2IG7A 4BYIA 4FG7A 3THBA 4DC2A 4F9YA 3E8EA 3NGAA 1IA9A 1TVOA 2GDOA 3BELA 4YC3A 3G0FA 3RAKA 5DLSA 4I94A 2VTHA 3I7BA 5DEYA 3CQUA 3MFUA 1YRPA 2PVNA 3VS5A 5LMKC 1Q61A 2QR8A 2Z7LA 3PP1A 5B2KA 4F7LA 3Q53A 4EZ7A 3LE6A 3NLBA 2OIBA 3ODZX 4EC8A 4ZSEA 5I9XA 4UZDA 3CIKA 1H27A 2OJJA 1I09A 4BDKA 3OWJA 4IWDA 4XNEA 3CQWA 2ZV2A 4OTQA 3DKGA 4YC6A 4RZWA 2Q0NA 4JXFA 2QHMA 3HV3A 4BTFA 4BTJA 3U6HA 3DXNA 4EI4A 4JAIA 4M68A 4Y46A 4K6ZA 2A98A 4RFYA 3OS3A 4NT4A 3A8XA 1ZLTA 3WIKA 1PF8A 3MB7A 2YWPA 3N9XA 4X2JA 4UN0C 3ENHA 3DS6A 5HIEA 4GMYA 4OBPA 4FTIA 4ZTSA 1OL1A 4V0GB 2WMQA 3T9IA 5ANEA 2XM8A 2XIRA 4TXCA 4L68A 3PXFA 4O4FA 3ZEWA 4D58A 5K4JA 3O50A 4U80A 5FEEA 2AYPA 3UVPA 3FLNC 4AZFA 4CQEA 3G5DA 1JLUE 4L42A 4UV0A 5JN2A 1M7QA 4YJPA 3WF8A 4LMNA 4AFJA 3R21A 4W9WA 3VO3A 1TKIA 4QP6A 1J3HA 4RG0A 3P79A 5HG5A 4ZTNA 1JVPP 3MVHA 1IA8A 3CKWA 5CZHA 3GCQA 4DDGA 2PZRA 3SV0A 4FTJA 4GK4A 3V5JA 5D11A 3QD4A 1ST0A 1Q5KA 3POZA 5C1QB 3AC1A 4HNFA 3AC2A 4RVTA 2E2BA 4RLKA 4L7SA 3QTUA 1GY3A 1Q41A 4NKAA 3VF9A 3TKHA 4YHTA 2YDJA 3OFMA 3EN4A 4FF8A 4IC7A 5DFPA 3MYGA 3QA8A 4U79A 4QYEA 2G01A 5DMZA 1OL5A 2WTJA 5EK7A 5I9YA 4YZNA 3P78A 1XWSA 1UKIA 3NW5A 4M3QA 4QQ5A 3UIUA 3QQGA 5F1ZA 3UO6A 4C4IA 3LM0A 4XBRA 4O83A 3HMMA 5LVOA 2OU7A 2PE0A 4WNKA 2QNJA 5EDRA 2V7AA 5CSVA 4U41A 5L2WA 3CTHA 3VULA 4GH2A 1KSWA 3KRJA 3R7GA 2VN9A 3CQEA 4OTPA 3R01A 2CMWA 1KV2A 4I21A 1PRYA 4X2KA 4GT3A 4B4LA 4RWKA 3UOLA 3ZCLA 3GU8A 4D9TA 4YZDA 5JFVA 4DT8A 3R63A 2ONLA 2C5OA 4AT4A 2HW6A 4U40A 4IZAA 2Y4IC 5KZ0A 2WO6A 3MVLA 4QDVA 3GU7A 3DOGA 3D2IA 1IR3A 3Q32A 5HE2A 3RCDA 3LHJA 5CYIA 3VBYA 3ZSGA 4AW2A 4B9DA 4UMPA 2YM8A 3F3UA 4F0IA 3HX4A 4RIYA 4CKIA 3LXLA 4EOLA 3PJCA 1MRVA 5H9BA 2GNJA 3FMEA 3MA6A 3RK9A 4E3CA 5HEZA 2WXVA 2UZTA 4I4FA 3UNJA 5EKNA 3I4BA 3DK6A 4ZJJA 4AFEA 3MTFA 2WQMA 4BCJA 4ANNA 4AG8A 5M57A 5JFXA 4I24A 3N51A 5LQFA 2VTJA 3UIBA 4O7NA 5CAUA 4DF3A 3NVKI 5M08A 3PVGA 3RM7A 1PXLA 2ERKA 4G16A 2YIQA 2PWLA 4I93A 4QMOA 3KREA 3DFCB 2UZEA 3QQLA 4NCTC 2OBJA 4BCMA 3R1YA 5HOAA 3E8CA 2WB8A 3DJ5A 3VUMA 5I9UA 2R0IA 2PPQA 4ZSJA 4FSZA 4NFNA 2X0OA 4NM7A 3LOKA 3EYHA 4PMTA 2VD5A 4XG2A 5F94A 5K4IA 5LOHA 5J5TA 1PHKA 4HCVA 3MA3A 2JKMA 5C01A 3DK3A 3ZONA 3TJCA 4ANSA 5D41A 3UP2A 3TUCA 2CLQA 4FOCA 2R3HA 1H1RA 3A7IA 3Q4UA 4M69B 1GIHA 2GHLA 2OJ9A 2W05A 1OUYA 3BYOA 4I3ZA 4LDTA 2XH5A 3KXNA 2H96A 2E9NA 3COHA 2GFSA 3AGLA 5IUHA 5ICPA 3FQHA 5AJQA 3IOPA 3PFYA 5EQYA 2UZBA 1CMKE 1XMMA 3PG1A 1R39A 3WF9A 4KSPA 3MH1A 3WZJA 1OZ1A 3BE9A 3H30A 2QG5A 3EQHA 5DBXA 4APCA 3R9RA 4RJ3A 4CNHA 4LMUA 4FV4A 2ZM3A 4FV6A 4PMSA 3W2OA 3DFAA 4K18A 2FUMA 2O0UA 2H34A 3BWFA 4CCUA 4F78A 3RAHA 4EOMA 3F7WA 4F70A 2CNUA 3HAMA 4IZYA 5AP4A 3TTIA 4B8LA 3CSVA 2BZJA 2RG5A 4FV9A 5JGDA 1OKWA 3ZLYA 2QODA 3FV8A 5AP0A 2OI4X 4BCNA 2FVDA 3QRKA 1JKLA 3Q5IA 2JD5A 2ZDTA 4ASDA 3U8WA 3EKNA 3KRXA 1ZOGA 1YDSE 4MAOA 3ZM4A 4ALWA 3BYMA 1VLRA 3BLRA 1VR2A 5M4IA 3Q6UA 3MGYA 2C0IA 3HUCA 4H1JA 3PSDA 4J52A 4JI9A 5IA2A 3G90X 4Z3VA 4N57A 4AZEA 3SC1A 4CV9A 2V55A 1M17A 1Q99A 3FSKA 2C6TA 3Q4CA 5FLFA 2VV9A 3B8QA 2WHBA 4FIIA 4EOOA 3EQIA 5M44A 5M53A 2EXCX 3IDBA 3KVWA 3FZ1A 3UOJA 5C03A 2FA2A 1H1WA 2X0PA 3JS2A 3QKLA 4FV2A 5EW3A 5AR2A 5TO8A 4BI2A 1U46A 2GS6A 1OI9A 1YHWA 1ZYDA 3FLYA 4IAAA 3GFWA 2BVAA 4NM0A 5IQFA 4JG8A 5GNKA 3DJ6A 4P90A 3A61A 1YWNA 2OZAB 3I60A 4S32A 5AX9A 5CU4A 3W2CA 1NVRA 4QMYA 1XHAA 1R0EA 2R3KA 3W18A 5M56A 2OIQA 2Q0BA 4RFMA 2PMOX 3QGWA 3NWWA 3O96A 5CEIA 3QA0A 3EIDA 3E7OA 3WILA 4J7BA 1YXUA 4BDEA 2R5TA 4DEIA 3TV4A 1QMZA 3RALA 2C6MA 2XRWA 4JRVA 3VS3A 1K9AA 4J8NA 4XG3A 2WTIA 3OEFX 3MPMA 3GU4A 1BYGA 3BLAA 2R7IA 3RNIA 4I4EA 3NIEA 1UU7A 4FSQA 1OIQA 1Y6AA 4Y5QA 4HJOA 4C59A 4CFWA 3F6XA 5B2LA 3HZTA 3GC7A 3QTZA 4JL9A 5HU9A 2ZVAA 1OL2A 1LR4A 3ODYX 3ORKA 3PJ1A 4N6YA 4WT6A 4LOOA 5DVRA 5FXSA 4E6AA 1ST4A 2YCFA 1J7LA 4QTDA 1H1QA 2XIYA 3OUNB 4EZ3A 2XK8A 3LXNA 4E8AA 4ZLYA 2DYLA 2CJMA 2HWOA 2Y4IB 3D94A 3NIZA 3BGZA 3QRJA 3QRIA 5FTOA 3EL7A 3C0IA 4R7BA 1WFCA 4K33A 4FVPA 3R7YA 4FL1A 2YDIA 4WG5A 4F9CA 3DLZA 5KMIA 5CAOA 1UU8A 3M42A 5AEPA 3PA3A 4OBQA 4UYNA 3NW7A 2BIKB 4BDDA 3HEGA 3QHRA 2RL5A 4TKSA 2R3PA 3A7JA 1H8FA 4IIRA 4A06A 4BVUA 3M11A 1J1CA 4R5SA 3FXZA 2PULA 1PXPA 3BX5A 3OXTA 4C7TA 2LAVA 5D12A 1ZAOA 4KIPA 4O1OA 4KS7A 3WE8A 2OIDA 1W0XC 1U54B 3UDTA 5HIDA 3RBWA 2E9UA 2WMSA 4MXZA 2E9VA 3KMWA 3MY0A 2B54A 3D7TB 4M15A 4NJDA 2CGXA 3HYHA 3RJCA 4ZLOA 4FZFB 3GGFA 4JG7A 4QYGA 4TNDA 3LMGA 5IISA 2Y0AA 5CTPA 1M2RA 5HX8A 1LEZA 3I0QA 3KU2A 5TR6A 3UPZA 4ACDA 1YQJA 1DS5A 2G15A 4EJNA 3C4EA 3UC4A 1BI7A 4V0GA 1OPKA 3QX2A 4PPCA 3POOA 5A14A 5F9EA 4MF1A 2R3IA 1ZZLA 3EJ1A 3P86A 3VJNA 4YZMA 1FQ1B 4FTCA 4H39A 5LCKA 5AR7A 2X0QA 3EQPA 3L9PA 2QOIA 4UWBA 4I5HA 2WMXA 4L3LA 3DB8A 3CJGA 3R9HA 1GZOA 4EYJA 4FT3A 4I20A 3MPAA 4PRJA 5A4LA 4EYMA 2CKQA 4L3PA 4BDAA 1SNXA 2W1EA 2C5XA 1Q97A 3CEKA 3RHKA 3RAWA 3VBWA 2BZIB 2W5BA 4AN2A 4PV0A 3P7CA 2OJIA 3FLQA 5KX8A 4O7TA 4RC2A 2CCHA 3PVUA 2R3LA 3E8NA 4FIEA 2A1AB 4USDA 5AV3A 4J95A 5GJFA 5E8VA 4CZUA 4F1MA 1NVSA 4AA0A 4IVCA 5CVGA 2BHEA 4RVKA 3FLZA 4HW7A 4BTMA 4O4DA 4W4XA 4FSUA 3SOCA 1F3MC 3QQHA 3UQFA 5HD7A 4DHZA 3DZQA 5HCXA 2ERZE 3GEQA 4GK2A 3QBNA 4EHGA 4B0GA 2PE2A 4HYUA 4YU2A 2PUIA 2QI8A 4GJ2A 3G6GA 5KMJA 4ZXTA 2BALA 5DOSA 5ITAA 4Y5HA 5GZAA 3MSSA 4U3YA 3REPA 3VVHA 3QZGA 2PMLX 4TYHB 2VUWA 3NCGA 3AKKA 3ALOA 2Z2WA 3BHHA 4E6QA 4IMYA 4BI0A 1OPLA 2WTDA 4CFNA 4MXYA 3BE2A 4NW6A 2XANA 2H9VA 2WOTA 3LFNA 4G6NA 3DY7A 3G0EA 5CEMA 3H4JA 2J0IA 5HBEA 3LVPA 5IDPA 2V5QA 4EH7A 4BCGA 4OR5A 4U8ZA 2G2IA 4YMJA 4DHIB 4RC3A 4GUEA 4J71A 4CQGA 2GNHA 2VTAA 4YPSA 4C36A 4FTLA 1ZARA 2CN8A 2R4BA 3LFEA 4WO5A 4L43A 3IOKA 4L46A 3Q9XA 2J5FA 5HNGA 4AUAA 3KULB 5TKDA 1AGWA 4MHAA 4RIOA 2C3IB 2HELA 2C1BA 3GC9A 5HLWA 3UG1A 2G9XA 4KIQA 3VAPA 4I6QA 2A19B 5FUTA 5AUZA 3DDPA 1QL6A 2ZAZA 4D9UA 2W4OA 3U55A 2XK6A 3DCVA 4DE4A 4ZS0A 3LCTA 1XJDA 4FSMA 4V05A 3TKIA 3MPTA 5GJDA 5DIAA 4RWIA 4JDKA 2YZAA 4ZK5A 3BHYA 3IGOA 5IEVA 1WBWA 3FXXA 3NAXA 4O6LA 5EI6A 5CAPA 1Q62A 4YJUA 2EWAA 1G8AA 4CRLA 3JYAA 4RA4A 3QKMA 4U81A 3PXQA 5CF8A 4QMLA 4EONA 1LPUA 3AOXA 4C4JA 4C2WA 1PKGA 3TZ7A 5BUIA 2ETMA 2ZOQA 1SNUA 2YISA 3FMNA 3HV5A 4M69A 3PFQA 3DTWA 2DUVA 4TZRA 5A4TA 5HORA 5IQAA 2WMVA 4GS6A 1CKIA 1PKDA 5LXMA 3FQSA 4BF2A 5HG9A 3A4PA 3VUKA 3PE2A 5LMAA 5M07A 2CPKE 3TWJA 2I0YA 1U5QA 2PVHA 2WQOA 3E3PA 4ACMA 4BGGA 4A9RA 2CKEA 1Q3DA 2X8DA 3H9RA 4IM2A 3PSBA 4ZY5A 3BHVA 5BVFA 2JLDA 1WVWA 4ZZMA 1K3AA 2HZNA 5K0XA 5A4EA 2BKZA 3F88A 5GZ9A 3FHIA 3FL4A 3B8RA 3MIAA 4FYNA 3QYWA 4FNWA 5DN3A 4EK5A 2QOFA 4XRJA 1ERKA 5I3OA 3R8ZA 3BBTB 1KUTA 3LXKA 3U87A 1OKYA 3GI3A 3EN7A 5CLPA 4M7IA 5CS6A 5CT7A 4EKLA 4F1TA 4ANOA 2OFUA 2WMTA 4O7YA 2VTTA 4EH6A 5E8TA 2W1GA 3QTWA 1YXVA 5EHOA 3WI6A 4Z55A 3VBVA 5JMSA 4GYIA 1Y57A 3HV6A 2CKPA 4NWMA 3GC8A 4O82A 1UNGA 4O86A 3CC6A 3PZHA 4G9CA 4GCJA 2BAJA 2QO2A 3AKJA 1O9UA 3Q3BA 4IFGA 4J97A 4EH9A 2QKWB 2VGOA 3KRLA 1NT2A 4KSQA 5IA5A 4DEBA 3ATTA 3R71A 4UALA 3FYJX 2VO6A 3BZ3A 4FKWA 1J91A 1YWRA 3EH9A 1HCKA 5I3RA 3P1AA 3AC3A 3EZVA 4X3FC 4MXXA 3DJ7A 3BQCA 3FPMA 4AW1A 4FEXA 4RJ5A 4X6RA 3LCKA 5L6OA 2UW7A 4CMUA 5FXQA 3RINA 3KN5A 2XK7A 4CEGA 4AA5A 2WMUA 1AQ1A 2OICA 4ITIA 4UMRA 2C3JA 3QQFA 4QTAA 4G1WA 1G5SA 2C47A 4EOQA 4OTFA 3IS5A 3KA0A 4IFCA 4PTCA 3I0OA 4CKRA 1H1SA 5IQCA 1E1XA 2OZAA 2VWIA 4GG5A 4M13A 5ANKA 4ZY6A 4KS8A 3CPBA 5M4UA 3C0HA 1PY5A 3GOKA 3L8SA 1KOAA 2HAKA 4YZCA 4G3FA 5DRBA 3TN8A 4X2NA 1BL7A 1M2PA 2YA9A 4WRGA 4YJRA 4D55A 4EH5A 3I81A 5M4FA 1QPEA 3D7ZA 4GIHA 3BV3A 5ANIA 1ZYSA 3P5KA 4HGEA 4JLCA 5ANDA 4GT5A 4B99A 4ZAUA 1XMLA 4Q5HA 3UMWA 4EOPA 3TDVA 3HMNA 2XUUA 3EN9A 4CMTA 3DNDA 3GOPA 4G3GA 5KUPA 1PMVA 5C8MA 5JRSA 3RP9A 4I0TA 3W2PA 2XM9A 1IEPA 2PUUA 2BZHB 5CQWA 4KWPA 2YLEA 4YJQA 3R9NA 4EJ7A 5AIRA 2FSOX 2OJGA 3DB6A 1APME 4FUYA 4E4LA 3FUPA 4AGUA 2PL0A 1WBNA 1H24A 5BVWA 5K3YA 1R78A 5I5ZA 3KVXA 4F1OA 3RCJA 3T9TA 4TN6A 2W7XA 3JY0A 3R7UA 3NMUF 2GQGA 3GXLA 5A4CA 4IBMA 4J53A 2QKRA 4ZTRA 4M67A 2WKMA 2JEDA 1KE8A 2YCRA 3PWYA 5CI7A 5AUWA 5LWMA 3ITZA 4BCPA 2XNPA 4YHFA 4IVDA 2X2KA 4GG7A 3F82A 4MNEB 2PE1A 4QP1A 1UV5A 3D0EA 3ORTA 5CXZA 4C02A 1JNKA 3NUNA 3KKVA 4IACA 4KBKA 1V0PA 3DQWA 4IH8A 2C6KA 4YBKA 1ND4A 2X2MA 4AW0A 3GUBA 4KB8A 1RJBA 3O8UA 4RIXB 2P4IA 3C13A 3QKKA 5FBOA 3U9CA 3R2YA 4ID7A 4GL9A 3TNPC 3W2RA 1QPJA 4RX7A 2W5HA 3D9VA 3OEZA 5DT0A 1U54A 1TZDA 5BPYA 5IQBA 2VRXA 4L01A 4M66A 5EH0A 3D7TA 2GCDA 4Z7HA 3FMLA 3V8SA 3DAJA 1QCFA 4IEBA 1KOBA 4C57A 4KKEA 4NCTA 4QMVA 3QYZA 3R00A 3CCNA 4NEUA 5BYLA 3MS9A 1WBTA 2O65A 3R6XA 4HGTA 4ERWA 3QTIA 3KCFA 4WHZA 4RVLA