5BUJA

Erk2 complexed with a n-h tetrahydroazaindazole
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
350
structure length
331
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 331
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bujA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bujA01
4QTDA 4F9YA 3NYVA 4MNEA 3LJ1A 2PVKA 4G31A 3R30A 3UG1A 2OIBA 4E3CA 3AT4A 4X2JA 4ASDA 5LCKA 4A7CA 2HOGA 4U45A 5JQ8A 2VTOA 4OUCA 3MI9A 4NTTA 2JDOA 2QODA 4FVPA 4ANSA 3QUEA 1V0BA 4BVUA 2OG8A 3BLHA 3WOWA 4QRCA 3SX9A 3EQDA 4MXCA 3R9DA 1CKIA 1JWHA 4FSZA 3FL5A 3LQ5A 2XNPA 4TWPA 4NCTA 3O0GA 3BYMA 2H34A 4X6RA 3HV5A 5AV3A 4BB4A 5E9EA 4BWKA 3F2RA 3HV3A 1SVEA 3F2AA 4KINA 4Z9LA 5JSMA 2VTSA 3LM5A 3KULA 1MP8A 2BTSA 2C5NA 3HNGA 4YO6A 2XZSA 4U9AA 3NUSA 3VBTA 1U54A 1UNGA 2WHBA 2QI8A 2ITUA 3AOXA 3D5XA 3ODYX 3PA5A 3QXPA 4KS7A 5FTQA 3GBZA 3HECA 5CQUA 3U87A 2C0TA 4KSQA 3NUNA 1QL6A 5CY3A 3LFBA 2ZM1A 4UMTA 3Q60A 1KV1A 4J71A 1ZOHA 4W4YA 4JVGA 5CEPA 4AAAA 4DH8A 3PG3A 3PY1A 2ZOQA 2Y0AA 3TN8A 4PL4A 4D1SA 1WVYA 5CEKA 5CAUA 4NEUA 1IAJA 4MAOA 2WMRA 2Z7SA 1OPLA 2HAKA 4C4IA 5A6NA 5GJDA 1L8TA 4XG4A 3LXKA 4LRKA 5IISA 3DT1A 1U46A 3F9NA 5DR9A 2BDWA 4MXZA 4GUBA 3A62A 1OIRA 4NJDA 2PUPA 2JIIA 4U42A 3BELA 5HVKA 3E63A 3ORXA 4D2VA 2I0VA 3N4VA 1KE8A 5CEMA 3LLTA 5DOSA 4I0SA 4QYEA 1WBOA 1WCCA 1XH9A 3Q5IA 3HMOA 3SVVA 4J8MA 2PVLA 4RFZA 3UVPA 1HCLA 4LRJA 4APCA 3FLQA 4I6BA 4KBAA 2UZNA 3LAUA 3DS6A 3VJOA 3V8SA 5ANEA 4JBPA 3U51A 3FHRA 4XG2A 2Y4PA 3R2YA 4Y5QA 4RIXB 2YM4A 3MFRA 3IW8A 4K18A 2PE0A 1LEZA 2DYLA 1P14A 2C69A 4FNZA 3QU0A 5EH0A 3P0MA 5DN3A 5CVHA 2ZM4A 3OP5A 3MY0A 3R1SA 1WVXA 4GK2A 5ITAA 4XP2A 1FVRA 3R2BA 5HU9A 4S32A 2Y6OA 3TCPA 4BDDA 5E7RA 3PPKA 5IUGA 5AP1A 5AFVA 4FIHA 5LMAA 5JEBA 3H9FA 4MD9E 5HTBA 1HOWA 4EK8A 4C4HA 4L67A 4Y83A 4EC9A 4YR8A 4DFLA 4FG9A 4RQKA 4UXLA 5BYLA 1H8FA 3EQHA 2Z02A 3C5UA 3FZSA 3TZ9A 4QMZA 2JBPA 2PVFA 3NUUA 3Q04A 3P7CA 4LI5A 4GKIA 3NW5A 5FWKK 4RC2A 3MFTA 3OWPA 3VF9A 4AZVA 4A9SA 4UN0C 4MBIA 3MESA 5LVNA 3BBWA 3MJ1A 2C6IA 4BDKA 3I6WA 3KFAA 3LCTA 1WMKA 3PXKA 4CV8A 4CRSA 4ENYA 5DMZA 4JJRA 2VWBA 1SNXA 1CSNA 2O2UA 5CAPA 4JDIA 3QTWA 4AW5A 2GNIA 5E8TA 4EH7A 3DBCA 4FG8A 4FR4A 3CQEA 4PTEA 4DGNA 1I44A 1TVOA 3WZDA 1KWPA 2YCFA 3UIXA 4N70A 1FPUA 5HI2A 2JIUA 2WO6A 3OY3A 2I0EA 2WB8A 3MVJA 2OZAA 4C33A 1Z5MA 2OU7A 4B7TA 3CTQA 5GHVA 1BI8A 2V7AA 4IANA 3D7TB 4U3ZA 4M66A 4IWPA 2UZOA 5K5XA 3S2PA 4ZJIA 4FEWA 2WMSA 3PSBA 4L6QA 1FOTA 3U8WA 5CT0A 5AX3A 4CTCA 4EORA 3BPRA 3R1NA 5A9UA 1OBGA 3R7UA 3FQEA 4BF2A 2GNHA 2NRUA 3LIJA 2WMXA 2PVHA 3QQLA 4K6ZA 3UC3A 4L52A 3SHEA 5CF6A 2PPQA 5AAFA 1OM1A 2E2BA 1W83A 4DN5A 4IX3A 1OGUA 5FUTA 2XK3A 4YPSA 4MVFA 4UWCA 4FTAA 4BCPA 2W9FB 3I6UA 4R1VA 4BN1A 1OL5A 3ORZA 5KX8A 3GEQA 3R28A 2XH5A 3NIZA 4O7WA 1H24A 4LGGA 4PP7A 2J90A 3DJ7A 5D7VA 1ZY4A 3FZTA 3TIZA 2J4ZA 3O23A 5H8BA 2OK1A 2YN8A 3PYYA 3GOKA 2C5VA 3HAVA 2W1EA 4NTSA 4BFMA 3FKOA 2R4BA 2BVAA 2OJGA 2QHMA 5HESA 4E8AA 5AIRA 4KS8A 2GHLA 4PX6A 4TPTA 2HYYA 4D5HA 2BAQA 3AC1A 4NW5A 5IZFA 1GZ8A 2RG5A 3EQGA 3CY3A 3V8WA 3DDQA 4DG0E 5FDPA 4G17A 5K9IA 2P0CA 1E1VA 4RWLA 4XMOA 1PMUA 3FPQA 3D2IA 3UMXA 1DS5A 1YXTA 3K3IA 3F7ZA 3VUTA 4MX9A 4N6YA 3NPCA 3UGCA 2C47A 2J5FA 5BMMA 2RIOA 1J1BA 2WQEA 3F69A 4ERWA 5AP2A 5GJGA 1RW8A 1QPCA 4E5WA 2UZWE 4XV3A 2B7AA 4MD7E 4C2WA 3O96A 5JN2A 4NL0A 3G6GA 4FEVA 5IA4A 3OEFX 2J0MB 4I24A 2O8YA 1O9UA 4L8MA 4OBOA 2X6DA 4G6LA 3EN9A 4BCJA 1JQHA 3Q3BA 4C58A 4D2WA 3BEAA 4RIOA 2XKDA 2W4KA 3C50A 1P4FA 5AP5A 3L9PA 2UV2A 1XHAA 4OR5A 5L8KA 4ZEGA 3SG9A 5AUZA 3P79A 2XNGA 2F7ZE 2HXLA 3COKA 1FQ1B 1SVGA 2R3NA 3CEKA 3P9JA 4GG5A 2LAVA 4ACHA 1GIHA 3UE4A 5FRIA 1QCFA 2WTCA 1UKHA 4FMQA 1ZYLA 1OL2A 1XBCA 2NPQA 3R04A 4YC6A 3FMJA 2VTPA 3OW4A 3GQIA 3ALOA 4XG9A 2X0GA 5JT2A 4RX7A 4PMPA 1O6LA 3EQFA 2G1TA 4DTBA 1URWA 1KOAA 3FLNC 3H0YA 2VZ6A 4U8ZA 4QQJA 1XBAA 4FKRA 1JLUE 2Z2WA 3TWJA 2CGWA 3ZRMA 4CFVA 2Q83A 4XBUA 3Q9WA 3DXNA 2GQGA 3L8XA 3VBXA 1WBTA 3O8UA 4QTCA 4FSTA 4WNMA 3KKVA 5CASA 4CT1A 1ZARA 1PXJA 3GCVA 2GCDA 5HCXA 3G0FA 1U5RA 2ERKA 5IDNA 3LZBA 1SZMA 3E93A 3MYGA 4EUTA 2ETMA 3EN5A 2IW9A 2BAJA 2R7BA 2OO8X 3DKOA 2CCHA 3DB8A 3HA8A 3QQGA 3VBWA 4DEGA 1OIYA 4IM3A 3R02A 3DKCA 3TXOA 4QOXA 3AD6A 3PRFA 5EDRA 3EZVA 2ZJWA 4B6LA 4IM0A 2WMVA 2HW7A 3PXZA 4FIGA 4HGLA 2XRUA 1Q8WA 4NJ3A 4MHAA 1SNUA 4ASXA 5BMSA 5I9ZA 4J7BA 5DE2A 4CLIA 3QTSA 3EKNA 3WF6A 1IA8A 3M2WA 4I6HA 4BCKA 4CD0A 2W1CA 5HLNA 5IQEA 3GUBA 1YI4A 3FMNA 4RC4A 4XNEA 4LV5A 2QNJA 4I4EA 3UZPA 2BRMA 3VVHA 5HG5A 1OPJA 1DI9A 4J52A 5AP3A 3UOLA 4WRGA 3SGCA 3DCVA 5LWMA 2B9IA 5BVKA 2ZV7A 3ZFYA 1QMZA 2J0JA 3KU2A 3TNWA 3OHTA 3QFVA 1RJBA 1JAMA 3QTUA 3R9HA 4A9UA 3CKXA 5TE0A 2F49A 2R3HA 3DV3A 4S31A 5M57A 4KB8A 4IAZA 4U44A 3GC9A 4CQGA 2ACXA 4AFEA 1YWNA 5J5TA 2X2KA 2E9OA 2XMYA 5ANOA 3SDJA 3TG1A 3TKHA 3UDBA 2GNFA 3AD4A 3VUGA 1PJKA 4C4EA 4UZHA 3OT3A 1OBDA 3NYXA 3V8TA 3BQRA 1G8AA 4WG3A 1W84A 4O86A 4ZY5A 4W8DA 3VS2A 4IDTA 4PPBA 5E8WA 4JAIA 2YIRA 5C03A 4C4FA 3R7YA 4E6DA 3C4XA 3Q9XA 3EMGA 4O0SA 1GZNA 3QLFA 4FV5A 1ZYJA 5ETIA 2X7OA 4IZ5A 3ZS5A 4WRSA 3WE4A 4UMRA 5JH6A 3Q96A 5A46A 4PNKA 2JLDA 4F7NA 3QCSA 3LCKA 5IUHA 2OXDA 5BUEA 4AGUA 5AUYA 1UKIA 1YDTE 4YTCA 4CFFA 2C1BA 3ZXTA 5EK7A 2E9VA 1BKXA 3FV8A 2JBOA 3NLBA 3O8PA 4ZSLA 5BYZA 5AUTA 4CKJA 2Y7JA 3WIKA 1A06A 5AJQA 4BIBA 5GNKA 3QF9A 4EHEA 3C51A 2X4FA 2X81A 4TWCA 5AV1A 2P4IA 4YNOA 1YWVA 4HW7A 4JDHA 4JS8A 5HBEA 5T68A 3D83A 2J5EA 3LPBA 2ESMA 1PXMA 3G0EA 1ZYDA 4K77A 4FIIA 4RVTA 3A7JA 3SW4A 5KBRA 1ZAOA 5EHOA 5I9UA 3GXLA 4V05A 5F1ZA 3FEGA 4YSJA 3LMGA 2J0KA 3DK3A 5C8MA 3OBJA 3M11A 3T9IA 3VJNA 4KA3A 4X3FA 4I21A 3UYTA 1J7LA 3TNQB 3F5UA 3FQSA 2CGVA 2UW7A 3DA6A 1WAKA 3MPTA 1YHVA 4FF8A 4O7LA 5I3RA 3I1AA 1H1PA 5C26A 2QOLA 4AE9A 3BHVA 3QCYA 1IAHA 5C1QB 5EHLA 2A2AA 4ITHA 4IWQA 3RNYA 4BHZA 4DC2A 4J1RA 4KIKA 3GB2A 2WU6A 1Q41A 4MWIA 1M2PA 4QPSA 2PSQA 3H9RA 4FKQA 4QMTA 4RMZA 1YI3A 4FV1A 4R1YA 4YJVA 3EQIA 3I5ZA 4AF3A 4GEOA 3C9WA 4WBBB 4A9RA 2HZNA 2O63A 2VGPA 4L46A 4I3ZA 5EM8A 4FZDB 5EHYA 1OIQA 2ITWA 3RINA 4ACMA 1XO2B 4R6VA 4A4XA 5CALA 4FTLA 2GTMA 5JZJA 3NCZA 3PJ2A 4I1ZA 5CEOA 1H00A 3DAEA 3HZTA 2OKRA 4FC0A 4J99A 4MYGA 4EH4A 3TV7A 4E73A 4BCMA 2A19B 3E62A 3PVGA 4AZFA 4MBLA 1H26A 2VX3A 3PIXA 3QL8A 3S3IA 4KAOA 3VNTA 4L3PA 4O7ZA 4MTAA 4PL3A 3WZJA 3CTJA 2BTRA 2V62A 2IN6A 4HGTA 1GZKA 4BY9E 3I60A 3OBGA 5DG5A 4CT2A 4GS6A 4O7TA 5AV0A 1S9JA 4EOKA 4TYIA 4BBEA 2C6EA 2PZYA 5GJFA 3AT3A 3QCQA 4RGJA 2YM7A 3EFJA 4QMVA 2YZLA 5LARA 4LL5A 5L2SA 1B39A 5BVEA 3C4ZA 3QQUA 3ATTA 3OXTA 5ETFA 2C0OA 3TV6A 4D28A 5LWNA 4ANLA 1STCE 4FV2A 2YM3A 3D15A 3FWQA 3O17A 4IVCA 4USDA 3RCDA 4FV9A 5C01A 4EZ5A 2F7XE 5CEQA 2UZTA 4UZDA 2ZB1A 2R3KA 4E4NA 5DEWA 4LOOA 3W2QA 1OUKA 1RQQA 5AP7A 5JRQA 1JKLA 1H08A 4PPCA 4IIRA 4A4LA 2ZAZA 3TKUA 4EQMA 1J3HA 3R01A 3DBEA 4JIKA 5CI7A 1T45A 4I93A 5TT7A 4RT7A 5CYIA 3VW8A 5M09A 1X8BA 4ASEA 3V5LA 4DG2E 2YIQA 3HVCA 1Y91A 4AE6A 2R0IA 4NCTC 2ITNA 2XJ1A 3ORPA 4EH3A 3UTOA 3QKLA 4ZJVA 4IVBA 3FLZA 4ANBA 3CJGA 5EQYA 2YAKA 3F3TA 5M56A 1YKRA 4TYEA 3IGOA 3V6SA 4O0RA 2XUUA 3KXNA 4EQCA 3S0OA 3LFAA 4QYGA 3RZBA 4R7IA 4ZSAA 4CCUA 4RSSA 2BIKB 3PXFA 2HY81 4FTKA 2HW6A 4BZNA 2WGJA 4FNYA 3TT0A 4FG7A 2WOTA 4TW9A 4CFMA 3NUPA 4E5AX 4ZTSA 5B2LA 4HVSA 2C5YA 3FMKA 3UJGA 3KK9A 3MH3A 1BMKA 4EOSA 3HDMA 4FNWA 3KRLA 2PTKA 1A9UA 2YIYA 3OFMA 4MWHA 2BZIB 2UUEA 3N9XA 4QMOA 3PPZA 3V5TA 3E8CA 4E4LA 5KNJA 4QYFA 4CCBA 4UYNA 1Z9XA 2VWYA 3G15A 4F1TA 1M7QA 5JGBA 3LHJA 3H3CA 4USEA 2W1IA 3UOKA 4WOVA 4O0WA 5FEEA 4BI0A 5M4FA 3LFNA 4DH1A 4HGSA 4F08A 4IVAA 3TKIA 4DG3E 2YWPA 5CI6A 2C3LA 5M06A 2VTJA 2UZEA 4TYGA 2BAKA 3WZEA 4R7HA 4HNFA 3GOPA 3RP9A 4JL9A 3N51A 4P2KA 5A4TA 2X9FA 3UPZA 2P33A 4JDJA 2WMTA 1APME 3WF8A 2Y6MA 2WPAA 3GI3A 4HCUA 4OTGA 3S4QA 5KKRB 3CQWA 3LFFA 5AEPA 4G2FA 3RAIA 2YWVA 2UW5A 4CZUA 4TWNA 4WNPA 1V1KA 2C6KA 2XJ2A 2ZV8A 3LXLA 4K0YA 2HENA 2PZIA 4EBVA 4C57A 3NZ0A 4PDSA 2OGVA 5CSXA 2VN9A 3EQRA 4WG5A 4CVAA 4JBQA 4NM3A 1CDKA 4EONA 3THBA 3CY2A 4BDBA 3G6HA 1Q8ZA 4QPMA 3MFUA 3UIUA 2QLUA 3LFQA 3RNIA 5CF5A 2WQBA 1KE7A 4IH8A 1BUHA 3QD4A 3VUIA 3TZ7A 2QOFA 2OI4X 3II5A 4JOAA 3BYVA 4BBFA 4A9TA 1T46A 3EQCA 5M51A 2NO3A 3UNJA 2BRHA 3VBQA 3EYGA 2XP2A 3LCSA 2PUUA 5FP6A 5A54A 5H9BA 3E64A 3LJ2A 1FGKA 2LGCA 2YA9A 4V0GB 5E1SA 4C3FA 2XIKA 3NUYA 3IKAA 2HCKA 2XF0A 4DFXE 5HOAA 4TYHB 2H6DA 1NW1A 5FXRA 3MPAA 1MQBA 4GIIA 3EN4A 3MDYA 3ODZX 4XG6A 5IU2A 4Y85A 1TKIA 3W18A 3QCXA 3NYOA 1FMKA 2H96A 3R9RA 3PVWA 4O91A 3TNPC 3MTLA 3OF0A 1UWHA 5E8VA 3O51A 3KXMA 3UQFA 4RIWB 1BYGA 4E5BA 1H01A 2X7GA 1URCA 4J97A 4DFZE 5ANGA 2W96B 4U6RA 4E20A 5BNJA 3H30A 3RPYA 5HU3A 4FSMA 1UV5A 4O96A 3V5PA 5HX6A 3MSSA 3IQ7A 1YOMA 2ITPA 5FLFA 2R3PA 3F6XA 2UZLA 2JAVA 3IW7A 3L9NA 5AWMA 2B1PA 2QKWB 2PVNA 4JIAA 3FBVA 1GOLA 3FXWA 2R7IA 2CKEA 2JITA 1PKGA 4O0UA 4G9RA 3R8LA 4EOJA 5IH4A 3LMIA 5JZNA 3RHKA 3ZU7A 4MNEB 3BHHA 4CYIA 2VAGA 3VUDA 3L1SA 5E90A 3JY0A 2AC5A 3R7EA 2WQNA 3UYSA 4G3FA 1ZWSA 2XKEA 5CQWA 2GSFA 4G5JA 2ZV9A 4WT6A 2JC6A 3FSFA 3QRTA 4FKWA 3KXZA 4FODA 4JG6A 4LMNA 3A7FA 3ULZA 4DHFA 1NT2A 3QLGA 4MNFA 5KZ0A 1VEBA 3QRJA 2I1MA 3L9LA 4I6QA 4PDOA 4GIHA 1OMWA 4R7BA 3FC2A 3DOGA 4E1ZA 5KO1A 4AT3A 5C4LA 2XNNA 4FZ6A 2JD5A 3COMA 3ZC5A 3ZC6A 4GU6A 3PJCA 1WFCA 3BU3A 5IA5A 4AW1A 5A4EA 3KULB 1G5SA 3G5DA 2BRGA 3SXFA 4X21A 1H0WA 1U54B 2Y4IC 4FSRA 3BE9A 4O0VA 3ZTXA 4F65A 5KBQA 3U55A 2KTYA 2XJ0A 3NYNA 2XBJA 2PYWA 1AQ1A 4D0XA 3ULIA 3SW7A 2GQSA 3OUNB 4TXCA 5CEIA 5TF9A 3S95A 1U5QA 5M4CA 4UY9A 4EH8A 5BVNA 3P86A 3ZH8A 2BUJA 4FT7A 5EOLA 4C62A 4K8AA 3TM0A 4NU1A 4XLIA 2XRWA 4IACA 4FIFA 4NIFA 4D0WA 3A8WA 5HNIX 5DI1A 4K33A 3UO4A 5M55A 4F0IA 3C0IA 3NUXA 4FYNA 2AUHA 4GJ3A 2NNWB 3ZSGA 1IR3A 2VO7A 3QTXA 5B2MA 4YLKA 3DK7A 4DEBA 2X6EA 5KCVA 4ZTLA 2VWUA 3T3VA 2ONLC 3SV0A 3LCDA 4GVJA 3F5GA 1M17A 4RJ8A 4OTWA 4DF3A 4CMUA 4EOMA 3OS3A 5B7VA 3FQHA 2RFEA 5IQCA 4ZTNA 3HRFA 3DZQA 3HKOA 3FMDA 3ZHPC 4PV0A 2JEDA 4AX8A 4FA2A 3EQBA 3KGAA 1IASA 3W32A 3TTIA 5M4IA 3B2WA 2JKKA 4YHFA 2UZBA 3R71A 4QP7A 4RG0A 1W7HA 4FVQA 4Q5HA 2P55A 2HIWA 4QMWA 5AADA 3D5UA 5L6OA 5I5ZA 3HP2A 2R3JA 4I94A 2OFVA 4I6FA 3W1FA 4QMQA 5HX8A 3BI6A 4ZTHA 3E3BX 5KMKA 4AWIA 4MBJA 2Z7QA 4DGGA 5E92A 5FEQA 3PSCA 1OL7A 1VZOA 2J51A 3FKNA 4QTEA 2DWBA 1SM2A 2BKZA 5CF4A 5CT7A 1WBNA 1YXSA 2YM5A 1KV2A 4M97A 4O21A 4D58A 4WKQA 1Q3DA 2GTNA 2XA4A 3EN6A 3MA3A 4QQTA 2NRYA 3FZOA 4HPUE 5HLWA 3CSVA 3DFCB 4FL1A 5EW8A 3ORIA 4FKSA 5EOBA 3KF4A 3KRXA 4RA5A 3W2CA 2ZVAA 3DXQA 4C34A 4OT5A 1PW2A 5F94A 3VWAA 4ZLZA 4IE9A 3CGOA 4J53A 2BPMA 4R3RA 3IS5A 4J98A 4TNBA 3PE1A 5C9CA 3Q4TA 4ZTQA 4CFWA 4X2FA 2R3IA 2F2CB 1R39A 2GHGA 4IMYA 4UBAA 5IA2A 3AC8A 2CN5A 2PZRA 3DBQA 4JG7A 4Y72A 5E8ZA 2AYPA 1MRUA 4FL2A 3R83A 4BHNA 4CXAA 2Q0BA 1SYKA 4O0XA 1L3RE 5I3OA 4CKIA 4LG4A 1ZY5A 4XJ0A 4ACGA 1OPKA 3ZOSA 4QP2A 1P4OA 3IONA 4HPTE 4DYMA 1ZMWA 4DGOA 4EHZA 3KB7A 4R8QA 2VWWA 4C59A 5DLSA 2CNUA 3EN7A 4KIQA 4JBVA 1WBWA 3BGPA 3GC8A 4JDKA 3BZ3A 1PMEA 2C0IA 4XEYA 4DGLC 1OKVA 4L3JA 2OZAB 3W2RA 3QHWA 3EL8A 1YHWA 1GJOA 3OTUA 2AC3A 2J0LA 3VQUA 1JOWB 1KE9A 2J7TA 3P7AA 3P4KA 4FSNA 3DAKA 3UO6A 3QA8A 5IH5A 3HMPA 2C6OA 2C6LA 4Q2AA 4BCNA 4FSUA 4GK3A 3SD0A 3OUKA 4MQ1A 2BHEA 2UW4A 3O50A 3PZEA 3OCSA 4GMYA 3OMVA 2VWIA 3ZEPA 5CAVA 4QMNA 4IW0A 2R3FA 2ZMCA 2YABA 3CR0A 3PIYA 2UW6A 3QA0A 3A4OX 3WYYA 4W9XA 3CCNA 3S1HA 5J1VA 4IC8A 3FKLA 4M69B 5L4QA 3H10A 3WIGA 4ZSEA 4XRLA 5IUIA 4ZZNA 3DDPA 4IAAA 4XG8A 2UZDA 1PXIA 3TIYA 4AA0A 4GCJA 3CXWA 3RKBA 2WZJA 3BLQA 4X2GA 3E92A 4YURA 3MVHA 5TR6A 1M14A 2Y4IB 3HUCA 1O6KA 4ENXA 2ETKA 4XYFA 3TDVA 2BFXA 1UU3A 4FKLA 4BC6A 3NS9A 3OD6X 3R8ZA 3KMUA 2WQMA 2XK9A 2HK5A 3COIA 2B54A 4EH9A 3KMWA 2BALA 4B99A 3U9NA 3E87A 4IWDA 3D5WA 2Z7LA 3FI8A 4DTKA 4J96A 2WMUA 2XIXA 5K4JA 3F88A 3VIDA 4C4JA 2UW3A 2YLFA 1LEWA 4JXFA 3ZFXA 3RAHA 2GS7A 3RMFA 5KHWA 2ITXA 5AM6A 5EQEA 2ITZA 5KMIA 4O7NA 3PVBA 3HRBA 1Q97A 5LMKA 3Q4UA 3CTHA 3U6IA 3SXSA 4FZFB 3MFSA 4WG4A 3RBWA 2VTMA 3GU4A 3PG1A 3D5VA 5FTOA 4ARKA 3JYAA 3VAPA 3ACJA 4CYJA 3TUBA 3NAXA 2C5OA 1S9IA 4BL1A 3UQCA 1OL6A 2CN8A 4NYEA 5AUXA 2ONLA 2X39A 2WTJA 4ITJA 4X3FC 3DFAA 3NGAA 3VS0A 1YDSE 4JRVA 4NM7A 5J95A 3JR1A 5AAEA 3D0EA 3ZUVA 3A60A 2W1FA 4G3CA 4M67A 4UWBA 3WF5A 2EXEA 3R0TA 4HVIA 4S33A 2GNLA 3W8QA 3QD3A 5LVOA 4NZWB 5L8LA 4ZOGA 4BIEA 3QTIA 3JPVA 5D12A 3BLRA 1DI8A 3GENA 2OJ9A 3SRVA 4I5CA 2VTLA 2G9XA 3O71A 4YC3A 5AX9A 5FDXA 2XEYA 3NR9A 1JKKA 3BCEA 2I7QA 3R7OA 4II5A 4F99A 3ORNA 1U4DA 4LQMA 1F5QA 4U43A 3BGQA 3UO5A 3LCOA 2R64A 3W10A 5CZHA 4E26A 3CP9A 4J95A 5IQFA 4KWPA 5CENA 2QO2A 2XYUA 3CPBA 3KXHA 5CXHA 2C3JA 4GV1A 2ZMDA 4QP1A 4IC7A 4WHZA 2CNQA 3KMMA 1UWJA 1PRYA 5EQPA 4DLJA 4LOPA 5ACKA 4LGDA 4FGBA 4KKGA 2OICA 4YJOA 4NWMA 4ERKA 2J50A 4L68A 4TYJA 1ZLTA 4B4LA 4GFGA 2JDTA 1LPUA 5K0KA 1PXPA 4M8TA 4EOIA 2H9VA 4FT9A 2YCSA 4EJNA 4BGQA 4TN6A 3OOGA 2RL5A 4Q5EA 3W16A 1JPAA 3HMMA 4XP0A 3QD0A 5BPYA 3EHAA 3A8XA 2QOBA 3QTQA 4FKGA 4FTQA 2P2HA 3N4UA 2OJIA 2VRXA 1R1WA 2R3RA 1XWSA 2ITVA 1ZOGA 5CNOA 3GGFA 5BUJA 3GCPA 3K54A 5AAGA 4ACDA 3ZO4A 2V7OA 1J7IA 4GUEA 3FAAA 1VYWA 3WILA 3C4FA 4EOPA 5HEZA 3P1AA 4IADA 4M13A 4U97A 5DWRA 5KMLA 3KA0A 5DBXA 3LQ8A 3WI6A 3AQVA 3RHXA 4JR3A 3O8TA 3AC5A 4CQEA 3PA3A 2VO3A 3HDNA 2UVYA 3NAYA 3QGWA 2HWOA 5DA3A 5IEVA 4GH2A 4OTPA 3KF7A 3ERKA 2CKQA 3RAKA 3R8MA 3KY2A 4H39A 4F7LA 1REKA 2YERA 4JAJA 4CFXA 2ZDTA 2ITQA 3ZO2A 5EW3A 1YI6A 4ZY6A 2QO7A 4AA4A 1K9AA 2WXVA 3Q5ZA 3LFEA 2WMBA 5HVJA 4Q9ZA 4GFMA 2VTTA 4F09A 1ND4A 5E8YA 4O84A 4G34A 4CFNA 3UZTA 2X8DA 3R00A 2FVDA 3RAWA 4D9TA 3LXPA 5J79A 3ZDIA 3DKGA 4EK4A 5JQ5A 4APPA 4R3CA 4DCAA 4RJ7A 3W2SA 4G6NA 1XH6A 4LUEA 5IG1A 5C8NA 3NRMA 3LFDA 2GDOA 1Q8UA 3K5VA 3EB0A 3V5QA 5AR4A 3GC0A 4ZS0A 1RE8A 4LRMA 4BTKA 5LXMA 4U0IA 4FIEA 4YTHA 4X6QC 3ZONA 4XRJA 5IQGA 3VF8A 2YEXA 4FGRA 1UNLA 4XBRA 2QOIA 4C4GA 3EKKA 1NVRA 3EJ1A 5EYCA 1KE6A 4O2PA 4BGHA 3RZFA 5HORA 1CMKE 1ZYSA 5AA9A 3RVGA 4XX9A 2QHNA 4X0MA 3ROYA 2XBAA 2H8HA 3OZ6A 4L3LA 5AP4A 4D4VA 5I9XA 1P5EA 2O65A 2YHVA 2CGUA 2I6LA 3DZOA 3MH0A 4YBKA 2XCHA 5HIBA 3G2FA 4BKYA 3FYKX 5DVRA 4WUAA 4U41A 3RWQA 1R3CA 5J87A 3UIBA 3SXRA 1Z57A 1OL1A 2XIZA 4I5MA 3DU8A 4YHTA 4TNDA 3VS7A 3MB7A 4F9BA 3R7VA 2VD5A 4AGDA 1OVEA 3FZPA 3VULA 4BCOA 5IEXA 3FLYA 4IJPA 3UNKA 3DTWA 2B4SB 3GCQA 3VUHA 4XS2A 4BDIA 5I9WA 4OBPA 1FMOE 3ZLWA 3VUMA 3IW6A 5IDPA 4D2PA 2FSMX 2O0UA 4W4WA 2W4OA 3E8EA 4QMPA 3FMHA 1VYZA 4Z16A 3KC3A 5GZAA 4FV4A 3L8PA 5FP5A 3CJFA 5AUWA 3K2LA 3U54A 3QZFA 5L8JA 2UW9A 4O0YA 2VV9A 3DBDA 3FC1X 4H3PA 3ROCA 4D9UA 4ZAUA 4CGAA 1H4LA 4F1MA 2HELA 1CKPA 3NCGA 3R7GA 4K9YA 4F7JA 4IFCA 4HVDA 5IPJA 2YAAA 2X7FA 2WTDA 2XIRA 5CSWA 1Q99A 3NNXA 2GHMA 5I9YA 5DH3A 4WA9A 3VS1A 1CM8A 2ITOA 4QMXA 3ZMMA 4DFBA 4DA5A 3E7OA 4NM0A 3FY0A 1MRYA 4PP9A 3QALE 5CNNA 5ETAA 4JX7A 3FLSA 3MN3A 2JKQA 3E3PA 3QC4A 2IJMA 3R6XA 1ZOEA 4FUYA 4FV7A 4PWNA 5AM7A 1TQIA 3DQWA 3FMLA 3L8VA 5I4NA 4IHPA 3SA0A 3GU8A 3TJDA 4ZXTA 5CX9A 2YITA 5CF8A 3QD2B 4FTMA 4WO5A 4AACA 4QD6A 4EYMA 5HD4A 3D7ZA 4DT9A 3Q52A 5CU0A 3ZM9A 1QPEA 2YDJA 4U40A 3E88A 3FZ1A 3KCFA 5L6WL 4BWPA 4ZMFA 5DR2A 4XCUA 1UU8A 2F2UA 2IW6A 4JQ8A 4HGEA 4RIYA 1J91A 2RGPA 2WTKC 4QTBA 5CLPA 1V0PA 3TL8A 2YIWA 4AZTA 4EBWA 4AW0A 4IBMA 1Q8YA 4I23A 3RM6A 3ORMA 3MY1A 2QOOA 4KIPA 3OC1A 5CZIA 5G6VA 3GP0A 2EWAA 3POOA 5EM5A 4OAUC 1W8CA 3FMMA 5IMEA 3W55A 5HNBA 2GMXA 2PZ5A 2WNTA 4ALWA 5JMSA 4QYYA 1Q4LA 5L2TA 4I41A 4EKKA 4BDFA 4C36A 4E6AA 1GY3A 4IAFA 3FSKA 5EFQA 4YJUA 2BRBA 3OCTA 4RQVA 3A7GA 2YFXA 4E4XA 2QR7A 3QBNA 3PXYA 4AP7A 4EWHA 3ORTA 3E8DA 4L00A 2FSLX 3UNZA 3DNEA 4I0TA 3ZZWA 4C3RA 1Y8GA 3CD8A 2QCSA 3TZ8A 5C27A 4F9CA 2DQ7X 3GQLA 2B9HA 5GIPE 3L9MA 4F4PA 4O22A 5BX0A 2EXCX 3HP5A 3TI1A 3QAME 2WIPA 2IZTA 3JVRA 3R1QA 3BEGA 4U5JA 2WTWA 4OLIA 5IQBA 4GRBA 4JQEA 3BHUA 4MXOA 5CVGA 4KNBA 2F9GA 4KRCA 3P5KA 3DXPA 2JDSA 3MWUA 3KRRA 3HV4A 3EIDA 4U79A 4C02A 4F7SA 2HZ4A 3OW3A 4ZZOA 4IDVA 2C5XA 3RGFA 4XP3A 3PA4A 3CKWA 3PIZA 4XHKB 4OTHA 2WQOA 4JG8A 4O6LA 2XM8A 4BZOA 2XS0A 3KRWA 4FV3A 5AP0A 1ZZ2A 1W98A 2W1GA 3CD3A 1ZMUA 4V01A 3UMWA 4EI4A 1G8SA 3PLAE 1JBPE 4NW6A 4FOBA 5HNGA 3U9CA 5K0XA 3VHEA 2C6MA 3VBVA 2IVUA 1DAYA 3EFWA 3M42A 2CJMA 1AD5A 5TOZA 4FVRA 5HIDA 4GK4A 5BVOA 3HUBA 2YM6A 4UALA 3UZRA 3S00A 3BBTB 3AGLA 2G2HA 3OWJA 4M68A 4EK5A 4O7SA 4AXAA 5AR7A 4YHJA 5BVWA 4LL0A 5JFXA 5LOHA 4EOLA 4FNXA 3QKMA 3BRBA 3QC9A 4X2KA 2QVSE 3P08A 1OIUA 4D2RA 2ZM3A 3ZLSA 4QMMA 1FBNA 1A48A 5IQHA 3OG7A 3ZFMA 5IA1A 4L53A 4YMJA 3OXIA 5T3QA 3GVUA 1PF8A 3KEXA 5K4IA 4DTAA 1R78A 3EOCA 3DLSA 1JVPP 1BX6A 2Z7RA 4M7IA 4N4SA 5D1JA 4ANOA 3U4WA 4BDCA 5IA3A 5A6OA 4IX5A 4H1JA 2FSTX 4YZNA 4U7ZA 2CCIA 2XEZA 4HYSA 2VWVA 3E8NA 3W33A 4RX5A 1UU7A 3IW4A 2PMIA 4RJ4A 3ZUTA 1M2RA 1IG1A 2A4LA 2GNGA 4ZZMA 2VTHA 1XKKA 1JKSA 3MH2A 4L45A 2OFUA 5HD7A 1HCKA 1U59A 4WSYA 3DBFA 1J1CA 4RFYA 4R5YA 4MF0A 2IW8A 1H0VA 4NT4A 2PE1A 3I81A 3MIAA 3PXQA 3V51A 4M0YA 4XLVA 3WBLA 5GINE 2WOUA 3AG9A 4NFMA 5A3XA 3FMEA 4EZ3A 2JAMA 2NP8A 2WAJA 3O7LB 2CPKE 3R63A 4UMQA 5CSPA 5KMJA 2EB2A 1Q8TA 3ZEWA 3R9NA 2G01A 4FSYA 3MY5A 5CSHA 2W5HA 3DJ5A 3FPMA 4FEXA 5L2WA 3GCUA 1R0EA 2FSOX 3FUPA 4N57A 2ETRA 3IOPA 5TO8A 4FTTA 1WBSA 4FOCA 4B0GA 3QX4A 3PPJA 5HKMA 2E9UA 2GPHA 1PHKA 2XK4A 3H0ZA 3HLLA 3PXRA 5BUIA 3LXNA 1XR1A 4P5ZA 4ZSGA 2VO6A 2OJJA 4X7QA 2E9NA 1NVSA 3MW1A 2WTVA 2C30A 1REJA 1PXKA 4PPAA 5AMNA 2YISA 5F95A 2WTKB 3UIMA 3OOMA 3ALNA 3DQXA 5CXZA 2QU5A 5HCYA 5DR6A 5LCJA 3V6RA 3PP0A 2WMAA 2A27A 2A0CX 3WE8A 2QG5A 3KL8A 3FJQE 3UBDA 4QMYA 4F6SA 4QQ5A 2O5KA 3R8VA 4TTHB 1LP4A 3OVVA 2C6DA 5DEYA 3ENHA 1XH7A 4W8EA 4AOJA 3V01A 3QWJA 3KCKA 4PMTA 5K5NA 4QPAA 2JFLA 4AGWA 5BVFA 4H58A 3HRCA 5CVFA 4ZIMA 3H9OA 5HG9A 2HZIA 3QZGA 2QR8A 2BDFA 2YDIA 2Y9QA 4QQCA 2QU6A 4BZDA 2EB3A 4M84A 4IJ9A 1H25A 2B9JA 4GT5A 4TYHA 1GIIA 4ZTMA 3QX2A 4YZMA 2W1HA 4BKJA 3ITZA 2BRNA 5HE3A 2JKOA 2W99B 5H8GA 3LKMA 3UC4A 3EFKA 3AXWA 1YHSA 4IEBA 4HYIA 4UWYA 5BYYA 3AD5A 2OWBA 2XK7A 4XV2A 2W7XA 4DINA 4FTOA 1LUFA 2J2IB 3DGKA 1IEPA 3KVXA 5HO6A 2OJFE 1JNKA 5F20A 3PFQA 4Y5HA 5HICA 4JR7A 5DPVA 2FA2A 4I22A 3ZO1A 4ANMA 4XOZA 1NVQA 3M1SA 3HEGA 4Y95A 4TWOA 3NVKI 4CLJA 2X9EA 2W1ZA 4CNHA 1PXOA 2OIQA 2OIDA 1UU9A 3MH1A 3PLSA 4FK6A 4G5PA 5A14A 3F3UA 4EH2A 4IZAA 5H3QA 1E9HA 4RFMA 1Q24A 2BILB 4W4XA 3QRIA 4NIFB 5D11A 1YVJA 4Z7GA 3CPCA 2J0IA 5HE1A 3BQCA 4EL9A 4E4MA 4AS0A 4L01A 2CHLA 2OBJA 3P7BA 3Q2MA 3F3WA 5LMKC 4MKCA 2F4JA 1M52A 3G33A 5JFWA 4ZS4A 4ZP5A 3A61A 3QWKA 4EK6A 4MF1A 3LE6A 2EVAA 1Y8YA 4E6CA 4FKVA 4FSQA 5J9YA 5AIKA 3RM7A 2XNBA 3CIKA 4FZ7A 4IB5A 3I7CA 1CTPE 4FKTA 5AV2A 3VC4A 4O1OA 3LQ3A 4YPDA 1MUOA 3RPSA 5ETCA 3BX5A 1Q61A 5EYKA 3QQFA 5LMBA 1DM2A 2VNWA 4EWQA 4FKPA 4AZWA 4RX9A 4G3GA 5A4LA 3SLSA 3AT2A 4D4RA 5DT4A 4WNKA 1DAWA 3GFWA 1FGIA 4W9WA 3RWPA 3A2CA 4DLIA 2PUIA 2PU8A 4BDGA 5AA8A 3K3JA 3PJ8A 4HYUA 1YXUA 4IB1A 4AN2A 2B52A 2R3LA 3POZA 3UPXA 4F0FA 4UMPA 5AV4A 3HGKA 4ZTRA 3FI4A 3EZRA 3JVSA 1YWRA 5FG8A 3PE2A 1XJDA 3VQHA 5LVMA 3BHTA 3CS9A 3NEWA 4H1MA 4XH6A 4O27B 3ZBFA 4B9DA 5A4CA 1Y6AA 4BCQA 2XB7A 1W0XC 4PTCA 2QG7A 2IZSA 4NSTA 1ZZLA 4QYHA 4IXPA 4EOOA 4AW2A 3KXXA 3KVWA 4P90A 5HLPA 5HTIA 4KD1A 4AGCA 3GCSA 4FV8A 2F57A 4YJQA 5L2QA 4IAIA 3SG8A 5LVLA 4ONAA 4ZLYA 4AT5A 2BMCA 4TL0A 4MQ2A 3QXOA 2GFSA 1XH4A 4FT5A 5D41A 4O1PA 3G51A 5C8KA 5KMNA 3NW6A 3OT8A 4LUDA 5JFSA 4YLLA 3PJ1A 4R77A 4OTIA 5AR5A 4IVDA 3CQUA 5DRBA 4AUAA 1H28A 4L44A 4G9CA 3DB6A 2R3GA 4IB3A 4NKSA 1VR2A 1QPDA 2JDRA 2PK9A 1F3MC 3TUCA 3IOKA 3VS6A 5CU6A 4QMUA 1YOJA 4I20A 3HX4A 3RPVA 2IVVA 3D94A 3IDCA 3D14A 4YTFA 2JDVA 3NX8A 2QOKA 1M7NA 3BWJA 2Z60A 4EK3A 4MEDA 3HV6A 4DFUA 4MK0A 1YW2A 3F66A 2X8IA 4BBMA 3QUPA 2IZUA 2W4JA 1YDRE 5HO7A 3VHKA 4D1XA 4FIJA 3OTVA 3IECA 1B38A 1CKJA 1LR4A 2EU9A 2WU7A 3ENMA 4G1WA 4DITA 5DYJA 2BCJA 2G2IA 4ZMEA 3ELJA 3MB6A 4UV0A 4B8LA 3BHYA 4WIHA 2JIVA 3QYZA 5JRSA 4RIXA 4YZCA 5J7BA 4QMSA 3NSZA 2E9PA 4U80A 4Y46A 3F3VA 2YDKA 1IRKA 1TQPA 1MRVA 3QTRA 4RRVA 3BGZA 1UVRA 2VWXA 2IO6A 4NKAA 1F0QA 3K5UA 5HGIA 5IKWA 5EI2A 1M2QA 5HCZA 4O6EA 4BCIA 3NNVA 3E7VA 4FTJA 2XNMA 4F63A 3CBLA 1K3AA 1RDQE 4AZSA 1PYEA 5CWZA 4TY1A 5DIAA 4A4OA 4WD5A 2XK6A 3QGYA 2VX0A 3ZO3A 4BKZA 1OKZA 4RLKA 1GIJA 4AA5A 5JGAA 2C3IB 3CLYA 2VGOA 1JSTA 2W0JA 2B53A 4FTUA 5CSVA 4W4VA 1QPJA 3QRKA 4BGGA 4G6OA 4DFNA 4DEEA 3P78A 4MD8E 3BU6A 3EH9A 4LFIA 4NK9A 5DGZA 5B0XA 3JY9A 5TKDA 4FT3A 3GFEA 2VU3A 3PVUA 4RPVA 3I79A 4C7TA 4PMSA 2R3MA 3NNWA 4QNAA 5HE2A 5EDPA 3C4EA 1J7UA 1H1QA 3F5XA 2BZKB 3EYHA 2WELA 3AC3A 2R0UA 4IZ7A 3I4BA 3VRYA 5HZNA 4GFOA 1ERKA 2XNOA 5HG7A 4FX3A 3SOCA 4ZK5A 4RA4A 5J8IA 5KUPA 5JFVA 3SAYA 3CE3A 3PSDA 5FTGA 4ORKA 4JI9A 1YXXA 1Q3WA 4AZEA 3OROA 1XH8A 4QTAA 3D7TA 5CANA 4I5HA 2X8EA 3AC2A 4BYIA 2WD1A 2KULA 2JKMA 3HV7A 4YTIA 3DK6A 2CGXA 3IO7A 3IG7A 3QRUA 4FTNA 5GZ9A 5FD2A 1OI9A 5IF1A 2RF9A 3ZZEA 4FEQA 5EM7A 3A7IA 4M69A 4Q9SA 2V5QA 4CMOA 3IW5A 2XIYA 3I0OA 5AP6A 5EKNA 5M53A 1VJYA 3EQPA 3TEIA 4BDJA 4TZRA 3ANRA 4IAYA 3KREA 1FINA 2WKMA 2P3GX 4PL5A 4AFJA 4BCGA 4GYIA 4GSBA 3W8LA 3SRVB 3UOJA 2XYNA 5EW9A 3LM0A 4DGMA 5LJJA 2Y8OA 3QZIA 4YNEA 4ZY4A 1WVWA 4TKSA 5HTCA 4PTGA 3MGYA 3JUHA 4Z55A 5E8XA 4M15A 4YJSA 3IDPA 4YU2A 4KIOA 4OTDA 3QYWA 2W9ZB 5J9LA 4ITIA 2QOQA 3EFLA 4RWKA 5J1WA 1ATPE 4AG8A 4DT8A 3BYUA 4C8BA 1OB3A 2B55A 3OY1A 3I5NA 4PMMA 1OUYA 2WIHA 4ZSJA 3FL4A 3L8SA 4BIDA 4GVAA 2UVZA 3LJ0A 4JRNA 4BTJA 4DBNA 3A4PA 4RZVA 4EH6A 3JXWA 3UP2A 2JGZA 2X1NA 5JK3A 4Z3VA 2FUMA 4YSMA 1MQ4A 3Q4CA 3LVPA 3O7LD 4H36A 2C3KA 1G3NA 4LV8A 3SOAA 4R78A 4MCVA 3RPRA 2VTAA 3MJ2A 3BU5A 3C4CA 5KMMA 3LMHA 2JFMA 3R22A 4FV6A 4EQUA 3FY2A 2IG7A 1WZYA 3KQ7A 5ANIA 4FK3A 4CG9A 5CTPA 3TTJA 2R3QA 2WEIA 3ZDUA 2W1DA 3N4TA 3AC4A 3H4JA 2PWLA 3RK5A 3MS9A 4QT1A 3C4WA 3ET7A 1OKYA 4EHGA 4IWOA 5BVDA 4P4CA 4C37A 1IA9A 3DNDA 1WBPA 4YGAA 5FGKA 2HXQA 3TNIA 4F1OA 4N0SA 5KMOA 4YJRA 3ZLXA 5AR2A 3BYOA 4QO9A 4BI2A 5IQDA 3CGFA 3Q6WA 4OAVB 2X4ZA 2V22A 4RZWA 3HMNA 4QP9A 1E1XA 2PVYA 1Q5KA 1EH4A 4LM5A 3BV3A 3OEZA 5DNRA 4AOTA 3VO3A 4FTIA 4GW8A 4D4YA 5G1XA 5IEYA 3KK8A 4FI1A 3RK7A 4BRXA 1GZOA 3AMAA 3V5JA 2CLQA 3Q32A 2GNJA 3RI1A 3ZSIA 3T8OA 3ZRKA 3NUAA 3AMBA 2OXXA 5L2IA 4A07A 4K1BA 4AT4A 4CEGA 1XH5A 4P7EA 2GQRA 1NA7A 2HZ0A 5KZIA 4EYJA 3WYXA 4HVHA 1Y57A 3LFSA 4D4SA 3NWWA 3Q6UA 2R9SA 2OSCA 3FXXA 2XKCA 3Q9YA 3GC7A 4FKUA 4FV0A 5AR8A 1GNGA 1ZMVA 2IZRA 4PDYA 4I4FA 4FUXA 4QP6A 4F9AA 5FXSA 4OW8A 3E5AA 2WEVA 3OWLA 4BTMA 3BYSA 2J9MA 2IVTA 2FB8A 2B0QA 3TDWA 4C35A 5IH6A 2I0YA 5M08A 2I0HA 2P2IA 3WZUA 4PQNA 1V0OA 1JSVA 2W17A 3KXGA 1P2AA 3B2TA 4FL3A 2F7EE 4D2TA 4QP3A 3HYHA 5GIOE 4ACCA 2R5TA 2QC6A 2C1AA 2YLEA 5HO8A 3KN6A 5EYMA 2RFSA 3GU6A 4CV9A 3Q2JA 1YQJA 4UXQA 3OXZA 4R3PA 4GT3A 5EKOA 4FYOA 4DH7A 1ZXEA 4JBOA 1PMVA 4FT0A 5AUUA 3FYJX 4R5SA 5ACBC 3VS3A 4P5QA 4QP4A 4CFUA 4F64A 2OW3A 4HNIA 4DEHA 3G9NA 4B8MA 5JKGA 4HJOA 2ZYBA 2OF4A 4D2SA 3RCJA 4O7RA 3F61A 2VTRA 3VS5A 4EC8A 5L6PA 4PY1A 4RWIA 3QQHA 4JT3A 3P23A 4MXYA 5HIEA 2DUVA 1PY5A 3GU7A 2C68A 3FHIA 4PF4A 4LOQA 4BR3A 2FH9A 3TV4A 3FXZA 3UQGA 4X3FB 3FI3A 4NFNA 4OTFA 5FEDA 2YACA 4RVLA 1FVVA 2PHKA 4OT6A 2R2PA 3C7QA 4O38A 3NVMB 2QKRA 5AUVA 2ITTA 2GS6A 4E6QA 3JS2A 4QNYA 2VO0A 4KIKB 4NH1A 3R21A 3ATSA 1Y6BA 4FEUA 3MTFA 4EJ7A 4DEIA 4FTRA 3FZRA 3QKKA 4OTRA 3V5WA 3O2MA 3PWDA 4RJ5A 4NM5A 2B9FA 2UZUE 1FVTA 4CKRA 5IQAA 5HVYA 4XUFA 4G16A 5F9EA 4FZAB 4KKEA 3PJ3A 3DPKA 4D1ZA 5DHJA 1H1SA 4CRLA 5D10A 3HL7A 4YO4A 5CAQA 3MPMA 3C5IA 2C6TA 1R0PA 2X2MA 2PULA 5KKRC 1SMHA 3W2PA 4RVMA 2XCKA 3V04A 2RG6A 4CSVA 4DFYA 4UX9A 4FSWA 4TRLA 2WMQA 2BKKA 1K2PA 3MIYA 2PVJA 5HHWA 1YOLA 5ANKA 3UG2A 5D7AA 4RIYB 4Z7HA 3FI2A 4ZLOA 5FQDC 4CZTA 1ZYCA 5DT3A 4DEDA 1SVHA 2W5AA 3OCGA 3F5PA 5HQ0A 4EUUA 5H8EA 4KBKA 2O64A 4C0TA 2QONA 4UYAA 2QURA 1OZ1A 4IX4A 4YLJA 5FBOA 4BYJA 2QLQA 4E93A 2IPXA 5M4UA 4KRDA 3LOKA 4OTQA 3ZM4A 2I40A 1BLXA 3QHRA 1ZRZA 2UVXA 2GFCA 3PUPA 2BDJA 4LMUA 4M12A 3FE3A 4RJ3A 5KE0A 4O7YA 4DCEA 4KABA 5LQFA 1H1RA 3DTCA 4G3DA 3ZYAA 3R1YA 4I92A 4KBCA 5CU2A 4C3PA 4CMTA 3VBYA 2W06A 3NNUA 3ZSHA 4YJNA 2VUWA 3QQKA 4GT4A 4YZ9A 4S2ZA 2PZPA 3QZHA 4IB0A 3A99A 4JQ7A 3F82A 5E1EA 4BWXA 3U6JA 2XNEA 4UEUA 2PVMA 4GL9A 4YJPA 5EM6A 2CLXA 2WTIA 4AN9A 4RX8A 4ANNA 2OLCA 4O7VA 1H1WA 4M0ZA 2V0DA 2VTIA 2UZVA 4E7WA 5CU3A 4O82A 2BHHA 4ID7A 1BL6A 2YCRA 3D9VA 4XOYA 3MVLA 3I0QA 3R7IA 2YZAA 3NMUF 3BV2A 5H2UA 2PMOX 1NY3A 4UMUA 5KHXA 2G2FA 3GU5A 3W2OA 3G9LX 2YCQA 4FBXA 3R8PA 3C13A 5HG8A 3ZCLA 1BL7A 3FDNA 4DH3A 4YJTA 5IQIA 5E91A 4CG8A 4J8NA 4FTCA 4BI1A 3PZHA 4D55A 4HCTA 2HY0A 4O83A 4YBJA 3C0HA 4PDPA 3QQJA 2FO0A 4MXAA 3UP7A 2PVRA 4IZYA 4PRJA 3C1XA 1AGWA 1H07A 5J7HA 3I7BA 5FM2A 2J6MA 5L3AA 2BZJA 3ACKA 5CS6A 3T3UA 3TACA 1I09A 2A1AB 5E8UA 5EYDA 3VS4A 2VWZA 4RWJA 2CNVA 4KUJA 2OF2A 5K3YA 3HA6A 3VW6A 2ZB0A 4JLCA 4HVGA 2PE2A 4XG7A 5ANDA 4EEVA 5IMXA 3LFCA 2ERZE 4OGRA 3C0GA 5I0BA 3UODA 4C61A 4WSQA 2IVSA 2XVDA 3WF7A 2PY3A 4K11A 3VN9A 4FICA 4HYHA 2W5BA 3U6HA 4BDHA 3KRJA 4L43A 2PL0A 3R8UA 1W82A 1KSWA 3UVQA 3ZXZA 4U81A 3OWKA 4RBLA 3BWFA 4WNOA 4WBOA 3ID6C 3F7WA 5M44A 4BCFA 5J5SA 4L7SA 4IFGA 3KN5A 4X3JA 3Q4ZA 1B6CB 1PYXA 4DH5A 5HBJA 3B8QA 3RK9A 5HE0A 3SQQA 4HOKA 2REIA 2IWIA 4F6WA 4TT7A 1OECA 4AQCA 5C4KA 4FKOA 5M07A 2QOCA 5HBHA 2OH4A 4RVKA 5B2KA 3EWHA 4EOQA 4EKLA 5EG3A 1O6YA 1UNHA 3CC6A 4USFA 3BE2A 3DY7A 5ICPA 4ZJJA 3PP1A 3DKFA 3FLWA 4H05A 2WFYA 2X2LA 3VUKA 2CKPA 2O3PA 2V55A 1TQMA 5FBNC 5E4HA 4I5PA 4AN3A 4OBQA 3PY3A 4YP8A 2UW8A 5FM3A 4GU9A 3RALA 4O0TA 4Y73A 1JSUA 4RLLA 4NUSA 2G15A 4Y8DA 3TZMA 4DAWA 5DT0A 5CU4A 4F70A 2VTQA 4PUZA 4EHVA 2ITYA 3F2NA 3GT8A 2PMLX 3Q53A 4ALVA 3ZRLA 4GYGA 4O2ZA 4O81A 3D4QA 2CDZA 3R9OA 4HZSA 3TNHA 4QP8A 2GS2A 3QUDA 4CTBA 5I9VA 3G90X 3RTPA 3T9TA 2WMWA 4S30A 4ANQA 5A4QA 5BQ0A 2BROA 2EUFB 3EL7A 5T6KA 3ZLYA 3AGMA 3PY0A 4C38A 2SRCA 3UOHA 4GKHA 3Q9ZA 3LW0A 2VTNA 4U3YA 4S34A 4JX3A 3IPHA 5DRDA 1KUTA 1UA2A 2VNYA 3PWYA 4QMLA 3GNIB 2ZDUA 2XKFA 2OZOA 3BIZA 3IK3A 3ORLA 4FKIA 5EI6A 5E8SA 1KE5A 4YC8A 4F6UA 3QTZA 4H3QA 4K2RA 1WBVA 5IA0A 4L7FA 3RPOA 1XQZA 2C4GA 2QQ7A 3IDBA 4N6ZA 3V3VA 1XBBA 4V04A 2CSNA 3ETAA 1H27A 4JNWA 3WZKA 3ORKA 3COHA 4MH7A 4XG3A 2W05A 3DAJA 4BDEA 4C2VA 2FGIA 3DLZA 4RC3A 4I0RA 4IAKA 3ZBXA 4MXXA 2YM8A 4WUNA 5DFPA 3HMIA 3MV5A 2DS1A 4EZ7A 4RJ6A 2EXMA 4IM2A 4ASZA 2RKUA 5EDQA 4CZYB 4FKJA 1JKTA 2BZHB 2YJRA 4ALUA 2BIYA 4EH5A 4KSPA 1PKDA 2RFDA 1NXKA 2FYSA 4HCVA 3ANQA 4YUQA 3BKBA 4FE2A 3ZUUA 4AU8A 5D9HA 3TUDA 5LVPA 2XM9A 1PMNA 4M3QA 1OITA 2QD9A 3RJCA 4F0GA 4AOIA 4V0GA 4A06A 2YJSA 3PDTA 2ZV2A 2Q0NA 1Q62A 4L9IA 3SC1A 4IX6A 4LGHA 5AR3A 4XV1A 3MA6A 3PRIA 4L42A 4LYNA 2YIXA 1PXNA 1YRPA 2RFNA 4HZRA 4BCHA 2BFYA 4UB7A 4IQ6A 4DEAA 5J9ZA 3D2KA 3REPA 4BICA 3MVMA 1BI7A 4PNIA 4A9YA 1YXVA 4YZBA 4DE4A 5CAOA 4KKHA 4F9WA 1KOBA 4D5KA 2VX1A 2CMWA 2GU8A 2QOHA 1GAGA 4RIWA 4BTFA 3WARA 2RSVA 2Z8CA 2QO9A 3DJ6A 2HWPA 3MBLA 4G3EA 5EI8A 2PUNA 3NDMA 4YZDA 3SKCA 4GJ2A 2OH0E 4X2NA 3AMYA 2XK8A 4BDAA 4XV9A 3WF9A 5JGDA 5ANJA 3U4UA 3PTGA 5FXQA 3HAMA 2OXYA 4GG7A 3UVRA 2PMNX 2UW0A 3R73A 3NIEA 3IGGA 5GZ8A 3OCBA 1OKWA 4M14A 3LLAA 3NW7A 2R3OA 3A7HA 5F4NA 2CKOA 3VRZA 4DBXA 1PXLA 2BR1A 3TJCA 4H3BA 3B8RA 3F3ZA
chains in the Genus database with same CATH superfamily
4QTDA 4F9YA 3NYVA 4MNEA 3LJ1A 2PVKA 4G31A 3R30A 3UG1A 2OIBA 4E3CA 3AT4A 4X2JA 4ASDA 5LCKA 4A7CA 2HOGA 4U45A 5JQ8A 2VTOA 4OUCA 3MI9A 4NTTA 2JDOA 2QODA 4FVPA 4ANSA 3QUEA 1V0BA 4BVUA 2OG8A 3BLHA 3WOWA 4QRCA 3SX9A 3EQDA 4MXCA 3R9DA 1CKIA 1JWHA 4FSZA 3FL5A 3LQ5A 2XNPA 4TWPA 4NCTA 3O0GA 3BYMA 2H34A 4X6RA 3HV5A 5AV3A 4BB4A 5E9EA 4BWKA 3F2RA 3HV3A 1SVEA 3F2AA 4KINA 4Z9LA 5JSMA 2VTSA 3LM5A 3KULA 1MP8A 2BTSA 2C5NA 3HNGA 4YO6A 2XZSA 4U9AA 3NUSA 3VBTA 1U54A 1UNGA 2WHBA 2QI8A 2ITUA 3AOXA 3D5XA 3ODYX 3PA5A 3QXPA 4KS7A 5FTQA 3GBZA 3HECA 5CQUA 3U87A 2C0TA 4KSQA 3NUNA 1QL6A 5CY3A 3LFBA 2ZM1A 4UMTA 3Q60A 1KV1A 4J71A 1ZOHA 4W4YA 4JVGA 5CEPA 4AAAA 4DH8A 3PG3A 3PY1A 2ZOQA 2Y0AA 3TN8A 4PL4A 4QEBA 4D1SA 1WVYA 5CEKA 5CAUA 4NEUA 1IAJA 4MAOA 2WMRA 2Z7SA 1OPLA 2HAKA 4C4IA 5A6NA 5GJDA 1L8TA 4XG4A 3LXKA 4LRKA 5IISA 3DT1A 1U46A 3F9NA 5DR9A 2BDWA 4MXZA 4GUBA 3A62A 1OIRA 4NJDA 2PUPA 2JIIA 4U42A 3BELA 5HVKA 3E63A 3ORXA 4D2VA 2I0VA 3N4VA 1KE8A 5CEMA 3LLTA 5DOSA 4I0SA 4QYEA 1WBOA 1WCCA 1XH9A 3Q5IA 3HMOA 3SVVA 4J8MA 2PVLA 4RFZA 3UVPA 1HCLA 4LRJA 4APCA 3FLQA 4I6BA 4KBAA 2UZNA 3LAUA 3DS6A 3VJOA 3V8SA 5ANEA 4JBPA 3U51A 3FHRA 4XG2A 2Y4PA 3R2YA 4Y5QA 4RIXB 2YM4A 3MFRA 3IW8A 4K18A 2PE0A 1LEZA 2DYLA 1P14A 2C69A 4FNZA 3QU0A 5EH0A 3P0MA 5DN3A 5CVHA 2ZM4A 3OP5A 3MY0A 3R1SA 1WVXA 4GK2A 5ITAA 4XP2A 1FVRA 3R2BA 5HU9A 4S32A 2Y6OA 3TCPA 4BDDA 5E7RA 3PPKA 5IUGA 5AP1A 5AFVA 4FIHA 5LMAA 5JEBA 3H9FA 4MD9E 5HTBA 1HOWA 4EK8A 4C4HA 4L67A 4O4DA 4Y83A 4EC9A 4YR8A 4DFLA 4FG9A 3O5AA 4RQKA 4UXLA 1G8KA 5BYLA 1H8FA 3EQHA 2Z02A 3C5UA 3FZSA 2X0OA 3TZ9A 4QMZA 2JBPA 2PVFA 3NUUA 3Q04A 3P7CA 4LI5A 4GKIA 3NW5A 5FWKK 4RC2A 3MFTA 3OWPA 3VF9A 4AZVA 4A9SA 4UN0C 4MBIA 3MESA 5LVNA 3BBWA 3MJ1A 2C6IA 4BDKA 3I6WA 3KFAA 3LCTA 1WMKA 3PXKA 4CV8A 4CRSA 4ENYA 5DMZA 4JJRA 2VWBA 1SNXA 1CSNA 2O2UA 5CAPA 4JDIA 3QTWA 4AW5A 2GNIA 5E8TA 4EH7A 3DBCA 4FG8A 4FR4A 3CQEA 4PTEA 4DGNA 1I44A 1TVOA 3WZDA 1KWPA 2YCFA 3UIXA 4N70A 1FPUA 5HI2A 2JIUA 2WO6A 3OY3A 2I0EA 2WB8A 3MVJA 2OZAA 4C33A 1Z5MA 2OU7A 4B7TA 3CTQA 5GHVA 1BI8A 2V7AA 4IANA 3D7TB 4U3ZA 4M66A 4IWPA 2UZOA 5K5XA 3S2PA 4ZJIA 4FEWA 2WMSA 3PSBA 4L6QA 1FOTA 3U8WA 5CT0A 5AX3A 4CTCA 4EORA 3BPRA 3R1NA 3W0NA 5A9UA 1OBGA 3R7UA 3FQEA 4BF2A 2GNHA 2NRUA 3LIJA 2WMXA 2PVHA 3QQLA 4K6ZA 3UC3A 4L52A 3SHEA 5CF6A 2PPQA 5AAFA 1OM1A 2E2BA 1W83A 4DN5A 4IX3A 1OGUA 5FUTA 2XK3A 4YPSA 4MVFA 4UWCA 4FTAA 4BCPA 2W9FB 3I6UA 4R1VA 4BN1A 1OL5A 3ORZA 5KX8A 3GEQA 3R28A 2XH5A 3NIZA 4O7WA 1H24A 4LGGA 4PP7A 2J90A 3DJ7A 5D7VA 1ZY4A 3FZTA 3TIZA 2J4ZA 3O23A 3W0SA 5H8BA 2OK1A 2YN8A 3PYYA 3GOKA 2C5VA 3HAVA 2W1EA 4NTSA 4BFMA 3FKOA 2R4BA 2BVAA 2OJGA 2QHMA 5HESA 4E8AA 5AIRA 4KS8A 2GHLA 4PX6A 4TPTA 2HYYA 4D5HA 2BAQA 3AC1A 4NW5A 5IZFA 1GZ8A 2RG5A 3EQGA 3CY3A 3V8WA 3DDQA 4DG0E 5FDPA 4G17A 5K9IA 2P0CA 1E1VA 4RWLA 4XMOA 1PMUA 3FPQA 3D2IA 3UMXA 1DS5A 1YXTA 3K3IA 3F7ZA 3VUTA 4MX9A 4N6YA 3NPCA 3UGCA 2C47A 2J5FA 5BMMA 2RIOA 1J1BA 2WQEA 3F69A 4ERWA 5AP2A 5GJGA 1RW8A 1QPCA 4E5WA 2UZWE 4XV3A 2B7AA 4MD7E 3ML1A 4C2WA 3O96A 5JN2A 4NL0A 3G6GA 4FEVA 5IA4A 3OEFX 2J0MB 4I24A 2O8YA 1O9UA 4L8MA 4OBOA 2X6DA 4G6LA 3EN9A 4BCJA 1JQHA 3Q3BA 4C58A 4D2WA 3BEAA 4RIOA 2XKDA 2W4KA 3C50A 1P4FA 5AP5A 3L9PA 2UV2A 1XHAA 4OR5A 5L8KA 4ZEGA 3SG9A 5AUZA 3P79A 2XNGA 2F7ZE 2HXLA 3COKA 1FQ1B 1SVGA 2R3NA 3CEKA 3P9JA 4GG5A 2LAVA 4ACHA 1GIHA 3UE4A 5FRIA 1QCFA 2WTCA 1UKHA 4FMQA 1ZYLA 1OL2A 1XBCA 2NPQA 3R04A 4YC6A 3FMJA 2VTPA 3OW4A 3GQIA 3ALOA 4XG9A 2X0GA 5JT2A 4RX7A 4PMPA 1O6LA 3EQFA 2G1TA 4DTBA 1URWA 1KOAA 3FLNC 3H0YA 4O4CA 2VZ6A 4U8ZA 4QQJA 1XBAA 4FKRA 1JLUE 2Z2WA 3TWJA 2CGWA 3ZRMA 4CFVA 2Q83A 4XBUA 3Q9WA 3DXNA 2GQGA 3L8XA 3VBXA 1WBTA 3O8UA 4QTCA 4FSTA 4WNMA 3KKVA 5CASA 4CT1A 1ZARA 1PXJA 3GCVA 2GCDA 5HCXA 3G0FA 1U5RA 2ERKA 5IDNA 3LZBA 1SZMA 3E93A 3MYGA 4EUTA 2ETMA 3EN5A 2IW9A 2BAJA 2R7BA 2OO8X 3DKOA 3NFFB 2CCHA 3DB8A 3HA8A 3QQGA 3VBWA 4DEGA 1OIYA 4IM3A 3R02A 3DKCA 3TXOA 4QOXA 3AD6A 3PRFA 5EDRA 3EZVA 2ZJWA 4DHJA 4B6LA 4IM0A 2WMVA 2HW7A 3PXZA 4FIGA 4HGLA 2XRUA 1Q8WA 4NJ3A 4MHAA 1SNUA 4ASXA 5BMSA 5I9ZA 4J7BA 5DE2A 4CLIA 3QTSA 3EKNA 3WF6A 1IA8A 3M2WA 4I6HA 4BCKA 4CD0A 2W1CA 5HLNA 5IQEA 1W2FA 3GUBA 1YI4A 3FMNA 4RC4A 4XNEA 4LV5A 2QNJA 4I4EA 3UZPA 2BRMA 3VVHA 5HG5A 1OPJA 1DI9A 4J52A 5AP3A 3UOLA 4WRGA 3SGCA 3DCVA 5LWMA 2B9IA 5BVKA 2ZV7A 3ZFYA 1QMZA 2J0JA 3KU2A 3TNWA 3OHTA 3QFVA 1RJBA 1JAMA 3QTUA 3R9HA 4A9UA 3W0MA 3CKXA 5TE0A 2F49A 2R3HA 3DV3A 4S31A 5M57A 4KB8A 4AAYA 4IAZA 4U44A 3GC9A 4CQGA 2ACXA 4AFEA 1YWNA 5J5TA 2X2KA 2E9OA 4F78A 2XMYA 5ANOA 3SDJA 3TG1A 3TKHA 3UDBA 2GNFA 3AD4A 3VUGA 1PJKA 4C4EA 4UZHA 3OT3A 1OBDA 3UDTA 3NYXA 3V8TA 3BQRA 1G8AA 4WG3A 1W84A 4O86A 4ZY5A 4W8DA 3VS2A 4IDTA 4PPBA 5E8WA 4JAIA 2YIRA 5C03A 4C4FA 3R7YA 4E6DA 3C4XA 3Q9XA 3EMGA 4O0SA 1GZNA 3QLFA 4FV5A 1ZYJA 5ETIA 2X7OA 4IZ5A 3ZS5A 4WRSA 3WE4A 1XMMA 4UMRA 5JH6A 3Q96A 5A46A 4PNKA 2JLDA 4F7NA 3QCSA 3LCKA 5IUHA 2OXDA 5BUEA 4AGUA 5AUYA 1UKIA 1YDTE 4YTCA 4CFFA 2C1BA 3ZXTA 5EK7A 2E9VA 1BKXA 3FV8A 2JBOA 3NLBA 3O8PA 4ZSLA 5BYZA 5AUTA 4CKJA 2Y7JA 3WIKA 1A06A 5AJQA 4BIBA 5GNKA 3QF9A 4EHEA 3C51A 2X4FA 2X81A 4TWCA 5AV1A 2P4IA 4YNOA 1YWVA 4HW7A 4JDHA 4JS8A 5HBEA 5T68A 3D83A 2J5EA 3LPBA 2ESMA 1PXMA 3G0EA 1ZYDA 4K77A 4FIIA 4RVTA 3A7JA 3SW4A 5KBRA 1ZAOA 5EHOA 5I9UA 3GXLA 4V05A 5F1ZA 3FEGA 4YSJA 3LMGA 2J0KA 3DK3A 5C8MA 3OBJA 3M11A 3T9IA 3VJNA 4KA3A 4X3FA 4I21A 3UYTA 1J7LA 3TNQB 3F5UA 3FQSA 2CGVA 2UW7A 3DA6A 1WAKA 3MPTA 1YHVA 4FF8A 4O7LA 5I3RA 3I1AA 1H1PA 5C26A 2QOLA 4AE9A 3BHVA 3QCYA 1IAHA 5C1QB 5EHLA 2A2AA 4ITHA 4IWQA 3RNYA 4BHZA 4DC2A 4J1RA 4KIKA 3GB2A 2WU6A 1Q41A 4MWIA 1M2PA 4QPSA 2PSQA 3H9RA 4FKQA 4QMTA 4RMZA 1YI3A 4FV1A 4R1YA 4YJVA 3EQIA 3I5ZA 4AF3A 4GEOA 3C9WA 4WBBB 4A9RA 2HZNA 2O63A 2VGPA 4L46A 4I3ZA 5EM8A 4FZDB 5EHYA 1OIQA 2ITWA 3RINA 4ACMA 1XO2B 4R6VA 4A4XA 5CALA 4FTLA 2GTMA 5JZJA 3NCZA 3PJ2A 4I1ZA 5CEOA 1H00A 3DAEA 3HZTA 2OKRA 4FC0A 4J99A 4MYGA 4EH4A 3TV7A 4E73A 4BCMA 2A19B 3E62A 3PVGA 4AZFA 4MBLA 1H26A 2VX3A 3PIXA 3QL8A 3S3IA 4KAOA 3VNTA 2IF8A 4L3PA 4O7ZA 4MTAA 4PL3A 3WZJA 3CTJA 1OGYA 2BTRA 2V62A 2IN6A 4HGTA 1GZKA 4FJVA 4BY9E 3I60A 3OBGA 5DG5A 4CT2A 4GS6A 4O7TA 5AV0A 1S9JA 4EOKA 4TYIA 4BBEA 2C6EA 2PZYA 5GJFA 3AT3A 3QCQA 4RGJA 2YM7A 3EFJA 4QMVA 2YZLA 5LARA 4LL5A 5L2SA 1B39A 5BVEA 3C4ZA 3QQUA 3ATTA 3OXTA 5ETFA 2C0OA 3TV6A 4D28A 5LWNA 4ANLA 1STCE 4FV2A 2YM3A 3D15A 3FWQA 3O17A 4IVCA 4USDA 3RCDA 4FV9A 5C01A 4EZ5A 2F7XE 3PUFC 5CEQA 2UZTA 4UZDA 2ZB1A 2R3KA 4E4NA 5DEWA 4LOOA 3W2QA 1OUKA 1RQQA 5AP7A 5JRQA 1JKLA 1H08A 4PPCA 4IIRA 4A4LA 2ZAZA 3TKUA 4EQMA 1J3HA 3R01A 3DBEA 4JIKA 5CI7A 1T45A 4I93A 5TT7A 4RT7A 5CYIA 3VW8A 5M09A 1X8BA 4ASEA 3V5LA 4DG2E 2YIQA 3HVCA 1Y91A 4AE6A 2R0IA 4NCTC 2ITNA 2XJ1A 3ORPA 4EH3A 3UTOA 3QKLA 4ZJVA 4IVBA 3FLZA 4ANBA 3CJGA 5EQYA 2YAKA 3F3TA 5M56A 1YKRA 4TYEA 3IGOA 3V6SA 4O0RA 2XUUA 3KXNA 4EQCA 3S0OA 3LFAA 4QYGA 3RZBA 4R7IA 4ZSAA 4CCUA 4RSSA 2BIKB 3PXFA 2HY81 4FTKA 2HW6A 4BZNA 2WGJA 4FNYA 3TT0A 4FG7A 2WOTA 4TW9A 4CFMA 3NUPA 4E5AX 4ZTSA 5B2LA 4HVSA 2C5YA 3FMKA 3UJGA 3KK9A 3MH3A 1BMKA 4EOSA 3HDMA 4FNWA 3KRLA 2PTKA 1A9UA 2YIYA 3OFMA 4FRFA 4MWHA 2BZIB 2UUEA 3N9XA 4QMOA 3PPZA 3V5TA 3E8CA 4E4LA 5KNJA 4QYFA 4CCBA 4UYNA 1Z9XA 2VWYA 3G15A 4O4BB 4F1TA 1M7QA 5JGBA 3LHJA 3H3CA 4USEA 2W1IA 3UOKA 4WOVA 4O0WA 5FEEA 4BI0A 5M4FA 3LFNA 4DH1A 4HGSA 4F08A 4IVAA 3TKIA 4DG3E 2YWPA 5CI6A 2C3LA 5M06A 2VTJA 2UZEA 4TYGA 2BAKA 3WZEA 4R7HA 4HNFA 3GOPA 3RP9A 4JL9A 3N51A 4P2KA 4MUQA 5A4TA 2X9FA 3UPZA 2P33A 4JDJA 2WMTA 1APME 3WF8A 2Y6MA 2WPAA 3GI3A 4HCUA 4OTGA 3S4QA 5KKRB 3CQWA 3LFFA 5AEPA 4G2FA 3RAIA 2YWVA 2UW5A 4CZUA 4TWNA 4WNPA 1V1KA 2C6KA 2XJ2A 2ZV8A 3LXLA 4K0YA 2HENA 2PZIA 4EBVA 4C57A 3NZ0A 4PDSA 2OGVA 5CSXA 2VN9A 3EQRA 4WG5A 2X0PA 4CVAA 4JBQA 4NM3A 1CDKA 4EONA 3THBA 3CY2A 4BDBA 3G6HA 1Q8ZA 4QPMA 3MFUA 4O4FA 3UIUA 2QLUA 3LFQA 3RNIA 5CF5A 2WQBA 1KE7A 4IH8A 1BUHA 3QD4A 3VUIA 3TZ7A 2QOFA 2OI4X 3II5A 4JOAA 3BYVA 4BBFA 4A9TA 1T46A 3EQCA 5M51A 2NO3A 3UNJA 2BRHA 3VBQA 3EYGA 2XP2A 3LCSA 2PUUA 5FP6A 5A54A 5H9BA 3E64A 3LJ2A 1FGKA 2LGCA 2YA9A 4V0GB 5E1SA 4C3FA 2XIKA 3NUYA 3IKAA 2HCKA 2XF0A 4DFXE 5HOAA 4TYHB 2H6DA 1NW1A 5FXRA 2IEWA 1MQBA 3MPAA 4GIIA 3EN4A 3MDYA 3ODZX 4XG6A 5IU2A 4Y85A 1TKIA 3W18A 3QCXA 3NYOA 1FMKA 2H96A 3R9RA 3PVWA 4O91A 3TNPC 3MTLA 3OF0A 1UWHA 5E8VA 3O51A 3KXMA 3UQFA 4RIWB 1BYGA 4E5BA 1H01A 2X7GA 1URCA 4J97A 4DFZE 5ANGA 2W96B 4U6RA 4E20A 5BNJA 3H30A 3RPYA 5HU3A 4FSMA 1UV5A 4O96A 3V5PA 5HX6A 3MSSA 3IQ7A 1YOMA 2ITPA 5FLFA 2R3PA 3F6XA 2UZLA 2JAVA 3IW7A 3L9NA 5AWMA 2B1PA 2QKWB 4DDGA 2PVNA 4JIAA 3FBVA 1GOLA 3FXWA 2R7IA 2CKEA 2JITA 1PKGA 4O0UA 4G9RA 3R8LA 4EOJA 5IH4A 3LMIA 5JZNA 3RHKA 3ZU7A 4MNEB 3BHHA 4CYIA 2VAGA 3VUDA 3L1SA 5E90A 3JY0A 2AC5A 3R7EA 2WQNA 3UYSA 4G3FA 1ZWSA 2AEGA 2XKEA 5CQWA 2GSFA 4G5JA 2ZV9A 4QDEA 4WT6A 2JC6A 3FSFA 3QRTA 4FKWA 3KXZA 4FODA 4JG6A 4LMNA 3A7FA 3ULZA 4DHFA 1NT2A 3QLGA 4MNFA 5KZ0A 1VEBA 3QRJA 2I1MA 3L9LA 4I6QA 4PDOA 4GIHA 1OMWA 4R7BA 3FC2A 3DOGA 4E1ZA 5KO1A 4AT3A 5C4LA 2XNNA 4FZ6A 2JD5A 3COMA 3ZC5A 3ZC6A 4GU6A 3PJCA 1WFCA 3BU3A 5IA5A 4AW1A 5A4EA 3KULB 1G5SA 3G5DA 2BRGA 3SXFA 4X21A 1H0WA 1U54B 2Y4IC 4FSRA 3BE9A 4O0VA 3ZTXA 4F65A 5KBQA 3U55A 2KTYA 2XJ0A 3NYNA 2XBJA 2PYWA 1AQ1A 4D0XA 3ULIA 3SW7A 2GQSA 3OUNB 4TXCA 5CEIA 5TF9A 3S95A 4AXFA 1U5QA 5M4CA 4UY9A 4EH8A 5BVNA 3P86A 3ZH8A 2BUJA 4FT7A 5EOLA 4C62A 4K8AA 3TM0A 4NU1A 4XLIA 2XRWA 4IACA 4FIFA 4NIFA 4D0WA 3A8WA 5HNIX 5DI1A 4K33A 3UO4A 5M55A 4F0IA 3C0IA 3NUXA 4FYNA 2AUHA 4GJ3A 2NNWB 3ZSGA 1IR3A 2VO7A 3QTXA 5B2MA 4YLKA 3DK7A 4DEBA 2X6EA 5KCVA 4ZTLA 2VWUA 3T3VA 2ONLC 3SV0A 3LCDA 4GVJA 3F5GA 1M17A 4RJ8A 4OTWA 4DF3A 4CMUA 4EOMA 3OS3A 5B7VA 3FQHA 2RFEA 5IQCA 4ZTNA 3HRFA 3DZQA 3HKOA 3FMDA 3ZHPC 4PV0A 2JEDA 4AX8A 4FA2A 3EQBA 3W0OA 3KGAA 1IASA 3W32A 3TTIA 5M4IA 3B2WA 2JKKA 4YHFA 2UZBA 3R71A 4QP7A 4RG0A 1W7HA 4FVQA 4Q5HA 2P55A 2HIWA 4QMWA 5AADA 3D5UA 5L6OA 5I5ZA 3HP2A 2R3JA 4I94A 2OFVA 4I6FA 3W1FA 4QMQA 5HX8A 3BI6A 4ZTHA 3E3BX 2X0QA 5KMKA 4AWIA 4MBJA 2Z7QA 4DGGA 5E92A 5FEQA 3PSCA 1OL7A 1VZOA 2J51A 3FKNA 4QTEA 2DWBA 1SM2A 2BKZA 5CF4A 5CT7A 1G8JA 1WBNA 1YXSA 2YM5A 1KV2A 4M97A 4O21A 4D58A 4WKQA 1Q3DA 2GTNA 2XA4A 3EN6A 3MA3A 4QQTA 3PFYA 2NRYA 3FZOA 4HPUE 5HLWA 3CSVA 3DFCB 1TZDA 4FL1A 5EW8A 3ORIA 4FKSA 5EOBA 3KF4A 3KRXA 4RA5A 3W2CA 2ZVAA 3DXQA 4C34A 4OT5A 1PW2A 5F94A 3VWAA 4ZLZA 4IE9A 3CGOA 4J53A 2BPMA 4R3RA 3IS5A 4J98A 4TNBA 3PE1A 5C9CA 3Q4TA 4ZTQA 4CFWA 4X2FA 2R3IA 2F2CB 1R39A 2GHGA 4IMYA 4UBAA 5IA2A 3AC8A 2CN5A 2PZRA 3DBQA 4JG7A 4Y72A 5E8ZA 2AYPA 1MRUA 4FL2A 3R83A 4BHNA 4CXAA 2Q0BA 1SYKA 4O0XA 1L3RE 5I3OA 4CKIA 4LG4A 1ZY5A 4XJ0A 4ACGA 1OPKA 3ZOSA 4QP2A 1P4OA 3IONA 4HPTE 4DYMA 1ZMWA 4DGOA 4EHZA 3KB7A 4R8QA 2VWWA 4C59A 5DLSA 2CNUA 3EN7A 4KIQA 4JBVA 1WBWA 3BGPA 3GC8A 4JDKA 3BZ3A 1PMEA 2C0IA 4XEYA 4DGLC 1OKVA 4L3JA 2OZAB 3W2RA 3QHWA 3EL8A 1YHWA 1GJOA 3OTUA 2AC3A 2J0LA 3VQUA 1JOWB 1KE9A 2J7TA 3P7AA 3P4KA 4FSNA 3DAKA 3UO6A 3QA8A 5IH5A 3HMPA 2C6OA 2C6LA 4Q2AA 4BCNA 4FSUA 4GK3A 3SD0A 3OUKA 4MQ1A 2BHEA 2UW4A 3O50A 3PZEA 3OCSA 4GMYA 3OMVA 2VWIA 3ZEPA 5CAVA 4QMNA 4IW0A 2R3FA 2ZMCA 2YABA 3CR0A 3PIYA 2UW6A 3QA0A 3A4OX 3WYYA 4W9XA 3CCNA 3S1HA 5J1VA 4IC8A 3FKLA 4M69B 5L4QA 3H10A 3WIGA 4ZSEA 4XRLA 5IUIA 4ZZNA 3DDPA 4IAAA 4XG8A 2UZDA 1PXIA 3TIYA 4AA0A 4GCJA 3CXWA 3RKBA 2WZJA 3BLQA 4X2GA 3E92A 4YURA 3MVHA 5TR6A 1M14A 2Y4IB 3HUCA 1O6KA 4ENXA 2ETKA 3AKKA 4XYFA 3TDVA 2BFXA 1UU3A 4FKLA 4BC6A 3NS9A 3OD6X 3R8ZA 3KMUA 2WQMA 2XK9A 2HK5A 3COIA 2B54A 4EH9A 3KMWA 2BALA 4B99A 3U9NA 3BL7A 3E87A 4IWDA 3D5WA 2Z7LA 3FI8A 4DTKA 4J96A 2WMUA 2XIXA 5K4JA 3F88A 3VIDA 4C4JA 2UW3A 2YLFA 1LEWA 4JXFA 3ZFXA 3RAHA 2GS7A 3RMFA 5KHWA 2ITXA 5AM6A 5EQEA 2ITZA 5KMIA 4O7NA 3PVBA 3HRBA 1Q97A 5LMKA 3Q4UA 3CTHA 3W0PA 3U6IA 3SXSA 4AQKA 4FZFB 3MFSA 4WG4A 3RBWA 3P5JC 2VTMA 3GU4A 3PG1A 3D5VA 5FTOA 4ARKA 3JYAA 3VAPA 3ACJA 4CYJA 3TUBA 3NAXA 2C5OA 1S9IA 4BL1A 3UQCA 1OL6A 2CN8A 4NYEA 5AUXA 2ONLA 2X39A 2WTJA 4ITJA 4X3FC 3DFAA 3NGAA 3VS0A 1YDSE 4JRVA 4NM7A 5J95A 3JR1A 5AAEA 3D0EA 3ZUVA 2AQXA 3A60A 2W1FA 4G3CA 4M67A 4UWBA 3WF5A 2EXEA 3R0TA 4HVIA 4S33A 3UDZA 2GNLA 3W8QA 3QD3A 2XAMA 2XARA 5LVOA 4NZWB 5L8LA 4ZOGA 4BIEA 3QTIA 3JPVA 5D12A 3BLRA 1DI8A 3GENA 2OJ9A 3SRVA 4I5CA 2VTLA 2G9XA 3O71A 4YC3A 5AX9A 5FDXA 2XEYA 3NR9A 1JKKA 3BCEA 2I7QA 3R7OA 4II5A 4F99A 3ORNA 1U4DA 4LQMA 1F5QA 4U43A 3BGQA 3UO5A 4LV7A 3LCOA 2R64A 3W10A 5CZHA 4E26A 3CP9A 4J95A 4DHZA 4KWPA 5IQFA 5CENA 2QO2A 2XYUA 3CPBA 3KXHA 5CXHA 2C3JA 4GV1A 2ZMDA 4QP1A 4IC7A 4WHZA 2CNQA 3KMMA 1UWJA 1PRYA 5EQPA 4DLJA 4LOPA 5ACKA 4LGDA 4FGBA 4KKGA 2OICA 4YJOA 4NWMA 4ERKA 3VONA 2J50A 4DHIB 4L68A 4TYJA 1ZLTA 4B4LA 4GFGA 2JDTA 1LPUA 5K0KA 1PXPA 4M8TA 4EOIA 2H9VA 4FT9A 2YCSA 4EJNA 4BGQA 4TN6A 3OOGA 2RL5A 4Q5EA 3W16A 1JPAA 3HMMA 4XP0A 3QD0A 5BPYA 3EHAA 3A8XA 4DDIA 2QOBA 3QTQA 4FKGA 4FTQA 2P2HA 3N4UA 2OJIA 4QDVA 2VRXA 1R1WA 2R3RA 1XWSA 2ITVA 1ZOGA 5CNOA 3GGFA 5BUJA 3GCPA 3K54A 5AAGA 4ACDA 3ZO4A 2V7OA 1J7IA 4GUEA 3FAAA 1VYWA 3WILA 3C4FA 4EOPA 5HEZA 3P1AA 4IADA 4M13A 4U97A 5DWRA 5KMLA 3KA0A 5DBXA 3LQ8A 3WI6A 3AQVA 3RHXA 4JR3A 3O8TA 3AC5A 4CQEA 3PA3A 2VO3A 3HDNA 2UVYA 3NAYA 3QGWA 2HWOA 5DA3A 5IEVA 4GH2A 4OTPA 3KF7A 3ERKA 2CKQA 3RAKA 3R8MA 3KY2A 4H39A 4F7LA 1REKA 2YERA 4JAJA 4CFXA 2ZDTA 2ITQA 3ZO2A 5EW3A 1YI6A 4ZY6A 2QO7A 4AA4A 1K9AA 2WXVA 3Q5ZA 3LFEA 2WMBA 5HVJA 4Q9ZA 4GFMA 2VTTA 4F09A 1ND4A 5E8YA 4O84A 4G34A 4CFNA 3UZTA 2X8DA 3R00A 2FVDA 3RAWA 4D9TA 3LXPA 5J79A 3ZDIA 3DKGA 4EK4A 5JQ5A 4APPA 4R3CA 4DCAA 4RJ7A 3W2SA 4G6NA 1XH6A 4LUEA 5IG1A 5C8NA 3NRMA 3LFDA 2GDOA 1Q8UA 3K5VA 3EB0A 3V5QA 5AR4A 3GC0A 4ZS0A 1RE8A 4LRMA 4BTKA 5LXMA 4U0IA 4FIEA 4YTHA 4X6QC 3ZONA 4XRJA 5IQGA 3VF8A 2YEXA 4FGRA 1UNLA 4XBRA 2QOIA 4C4GA 3EKKA 1NVRA 3EJ1A 5EYCA 1KE6A 4O2PA 4BGHA 3RZFA 5H