5BUJA

Erk2 complexed with a n-h tetrahydroazaindazole
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
350
structure length
331
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 331
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bujA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bujA01
4Z55A 4NTSA 4ID7A 3K3JA 5JGBA 2Z60A 2ITQA 1IASA 3OW3A 4B9DA 1M2QA 1YDSE 4C58A 5FDPA 3DBEA 4G34A 1ZOEA 2F2UA 2QU6A 2Y6OA 3C5UA 3FC2A 4TW9A 5IA0A 1VYWA 5DWRA 5LVLA 3F5PA 4UV0A 2XBJA 5EDQA 3H0YA 4CXAA 4QO9A 3ZSHA 3N4UA 3OT8A 4LOOA 2R3OA 3D9VA 4R5YA 2VO0A 3DNDA 5AM7A 4YPDA 4MXYA 4ALUA 3K5VA 4IFGA 3ZO3A 3FWQA 2F4JA 2PE2A 4QP1A 2XIXA 3BU6A 4WA9A 4XRJA 4HYSA 3LFFA 4CMTA 1SNUA 5CVGA 3MVJA 3WF8A 4BKYA 3I0QA 4F9CA 5KNJA 4AN9A 3KK9A 2GHLA 1KE6A 2C68A 5TKDA 2PPQA 4F0IA 2XK4A 2C1BA 4Z3VA 4YC8A 4H3QA 4I6HA 4M97A 3UVQA 5KCVA 5C1QB 1B6CB 1RJBA 2WQBA 3Q4UA 4TWOA 4D55A 4EH8A 1R1WA 4GMYA 4EYMA 5HORA 4I21A 3R1YA 3TZ8A 4FKGA 5EM5A 4HJOA 4LV8A 4W4WA 5EYKA 3MFTA 3LXPA 3NLBA 4MF1A 4RC2A 5GJGA 5L4QA 2WIHA 2YCSA 3ZFYA 4I4FA 3TV7A 4YJOA 1LEWA 3PTGA 4WG3A 1XH6A 3EYGA 3H30A 4WNPA 2W4OA 3DLZA 4I20A 5AX3A 2V55A 2WMQA 3JUHA 4ZS4A 3MFRA 4CFFA 3V8SA 4I22A 2IJMA 4HPUE 1ZY5A 3UZRA 2CMWA 1VZOA 2WMTA 5H8GA 1UNHA 5CF8A 3BV2A 4X2NA 4RX7A 3FZOA 4CFVA 2O2UA 1DM2A 2BZHB 4C4IA 1G8SA 3OMVA 4W4XA 4U0IA 3KXZA 1KE8A 4NCTA 1WBNA 2VU3A 5AP5A 3VIDA 4ACHA 2C6MA 4FTOA 2FUMA 4R7HA 3VWAA 4G9CA 2SRCA 4LI5A 5CZIA 3ZHPC 3UNJA 4O7VA 2OF4A 2GQRA 3L9PA 2C5NA 3IPHA 5CAVA 4FIEA 4YZCA 1ZWSA 2X7FA 4P7EA 4QMZA 4FEVA 1FGKA 1YXXA 2P2HA 1URCA 3T8OA 4PWNA 5CXHA 4FTNA 1YOJA 3Q5IA 4IQ6A 3TUCA 2CNUA 3BHTA 3E88A 3R9DA 4BCQA 5C8KA 3EQHA 4IE9A 3JR1A 1XH9A 5CT0A 3ZZEA 1OI9A 3ZU7A 2PVHA 3UZPA 4XOZA 4I4EA 4U43A 1RE8A 2GHGA 5AM6A 3GFWA 1Q61A 3DLSA 3NR9A 5LCKA 4IJ9A 4ZTHA 4NUSA 4QYHA 5TE0A 1ZY4A 1KSWA 2JDTA 4O22A 4QP7A 2R64A 1IRKA 2VGPA 5CASA 3TDWA 3D2KA 2QQ7A 4F6WA 1W82A 4UX9A 4I6QA 5B2LA 2A0CX 5AV0A 1IR3A 3ORTA 4FKSA 4FTCA 5L6WL 4AGDA 4PDSA 2OFVA 3L9NA 3CCNA 3KRLA 3RK7A 5JGDA 5J95A 2ZVAA 4FTLA 3TIZA 4BDEA 4JJRA 3TTIA 4C57A 3FZPA 1PYXA 2ITZA 3TCPA 5C01A 4C61A 4II5A 5EOLA 1QPCA 1WAKA 2W99B 4DFLA 5I9VA 2P4IA 3BHHA 3LOKA 4LGHA 5HOAA 4AS0A 4ZSEA 4WBOA 3W1FA 4F9WA 5C26A 5A6OA 3COHA 1WBPA 3O8TA 4GIHA 4TTHB 3AGLA 4RQVA 3R7OA 3GU4A 3GU5A 3BWJA 4PX6A 2E9OA 2W96B 5AJQA 4F64A 5E4HA 3E3PA 1EH4A 2HZ4A 5HNBA 4AOJA 5BX0A 1SVHA 2W17A 5HD7A 3U4UA 5M06A 2X7GA 3GCPA 3F3WA 3HUBA 3ATTA 3LQ8A 4FTTA 3QTZA 3BX5A 4AG8A 5CSHA 4EOOA 2BUJA 3BYSA 3WZKA 2XEYA 3RNYA 3CTHA 1TKIA 3VC4A 3EJ1A 4C37A 3D14A 3HV5A 3VUHA 3HUCA 2R3MA 5J1WA 1XH4A 2RG6A 2I0VA 4E73A 1L3RE 1L8TA 2G2IA 3NW7A 4MAOA 3G9LX 2JLDA 4RFMA 3DAJA 1E9HA 4R5SA 2P0CA 2CHLA 4DTBA 2BTRA 4FG7A 2BZIB 3LM5A 2GTNA 3MTFA 4IX6A 3ZRLA 4M12A 5M56A 1OL5A 1Q3WA 3COMA 2B55A 1OL1A 3KRWA 4AN2A 4CKRA 1Y6BA 4J96A 4OTIA 4GT3A 5HBJA 4I94A 4PRJA 3BI6A 4DFYA 4EOIA 3UIXA 3L8VA 4AZWA 4FR4A 5CF5A 3SOCA 4S33A 2HZNA 3UMXA 5D7VA 3D5VA 4QP3A 2C3LA 3CXWA 3CKXA 4TNBA 2F7EE 2X7OA 4G3DA 2BFYA 4RA5A 3AC2A 5AP0A 4D2SA 2UW6A 4MVFA 3QHRA 4FC0A 4DEHA 5HVKA 5CTPA 1H1QA 4MXXA 4E6QA 4ZSJA 4FV1A 5CF6A 4YO4A 5IF1A 3FLZA 1U54B 3IGOA 4LQMA 2W4JA 1PXOA 2CSNA 3Q4TA 4V04A 2RFSA 4OBQA 5KKRB 1RQQA 4F09A 4YJRA 2RSVA 2YCRA 3NPCA 5L8KA 2UVZA 3DPKA 3CQUA 5IMEA 1UA2A 2XP2A 3DAEA 3LIJA 2XKDA 5IDPA 4YO6A 2VTNA 1JBPE 2PZYA 1Y91A 2Z2WA 3H0ZA 4TNDA 1JKTA 4PP7A 3F5GA 4RC3A 4KIPA 4DFZE 1KE7A 3B8RA 5I9YA 2YLFA 3OF0A 4EOJA 5EQYA 5M55A 5JT2A 2HW6A 3VS5A 4L9IA 4X3JA 5F4NA 4AGCA 4HCUA 3R2YA 3DBDA 3R0TA 1GIHA 2Z7RA 3MH2A 4RIYA 3C1XA 4JNWA 2UZLA 3A8XA 4QTAA 2JKMA 4E5BA 5FTOA 1LPUA 1V0BA 1PW2A 1PYEA 1X8BA 2XS0A 1UU8A 1FVRA 3K54A 4RLLA 4AE9A 1GIJA 1OKVA 2WXVA 3R73A 2UW4A 2VWBA 4JX3A 4L46A 3SG8A 1YI3A 4XP3A 1FVVA 4QMQA 2ZV2A 2BR1A 3QBNA 3KN6A 5HD4A 4RX9A 4WD5A 4OTDA 2I1MA 4C0TA 2OZAB 1JKLA 2QKWB 4LMNA 3FLSA 4QPMA 2YABA 3R63A 3TIYA 1OUYA 5FUTA 1REJA 2NRYA 5BVDA 4FODA 3S00A 2Y6MA 1WMKA 5C8MA 3KFAA 4IAZA 4O96A 4GG7A 3L8SA 5A4LA 4G31A 2O0UA 3HA8A 4UWBA 1PRYA 4OTWA 2C6EA 5C4KA 1R78A 4I5PA 2EXCX 2QU5A 4BTFA 1R0EA 3OBJA 4LL0A 5LVOA 2WHBA 2W1EA 1P2AA 3QRKA 3ZCLA 3E8DA 4CSVA 1H28A 3ENMA 4OR5A 3DDQA 4O0VA 4GKHA 3ORMA 4JG6A 4CRLA 3F61A 3SLSA 5CU4A 2QOFA 4YMJA 4LYNA 1O6KA 4WUAA 1Q62A 3U55A 3QTRA 4RVKA 3SV0A 4EOSA 1WZYA 3LFCA 4GYGA 2YHVA 3RCDA 4CFXA 4O7TA 2XCHA 2BAKA 3BRBA 4RZWA 5EYDA 4ERWA 2YWPA 3OG7A 2C69A 2XF0A 5LWNA 3GU8A 4BC6A 3VQHA 3LVPA 4RIXA 4DA5A 3NMUF 4QMVA 2V22A 3NYXA 1T45A 4UYAA 4R3CA 5DRBA 5BVWA 2YLEA 3TKHA 5ETAA 5KMOA 4X0MA 4YPSA 4IIRA 4QPSA 5I9ZA 1OBDA 2WOTA 4QMPA 1OPLA 3DV3A 4JDKA 4MHAA 5HCZA 3UG1A 3HRFA 5AA9A 4XYFA 4GVAA 2XNOA 4QMWA 4EKKA 1U4DA 5CLPA 2XCKA 3G0FA 4EUTA 1OIUA 4FSMA 1OKYA 3P08A 5JSMA 4M67A 4I5CA 1OIRA 2IZTA 3HMOA 4IM0A 3U87A 4FSWA 4L6QA 4XV9A 2QOBA 5HG5A 4ORKA 4F7NA 5IQIA 4LFIA 1UNLA 4QMTA 4A9YA 3PRIA 3VW8A 3GC0A 4MKCA 2CPKE 4U3ZA 4BICA 3PSDA 2UW0A 1CM8A 4YTFA 5JFXA 1ZOHA 3V51A 4YJPA 2B9IA 2GS6A 3R7GA 3VBWA 3BPRA 4O6EA 2UVXA 4AGUA 2PWLA 2B9HA 2ITPA 4H1MA 3LFNA 4UXQA 3LMGA 4BBEA 4FV0A 2BVAA 4AX8A 1FGIA 3DB8A 1UVRA 2BHHA 3ORLA 3R8MA 3ZO2A 3C4CA 1YXTA 3QLFA 4ZIMA 3D94A 4JL9A 2J0IA 1YWRA 3LM0A 4HVIA 5HO7A 2H9VA 2PVFA 3BE2A 5DVRA 4NU1A 5AR3A 5B2MA 3FE3A 3L9LA 3Q96A 3TJCA 5BVFA 2R4BA 2YJRA 3Q32A 2XYNA 4GK4A 2R3HA 3TUBA 4ENXA 4E20A 4FGRA 3QGYA 2B0QA 2R3JA 4CEGA 4FEQA 4EZ3A 3FKNA 3ZC5A 2WIPA 4FTQA 3KMUA 2PK9A 4LG4A 4U80A 3D4QA 3BCEA 2I7QA 2IW9A 1E1XA 2YEXA 4FE2A 5IA4A 5I9WA 2W5BA 2PU8A 1B38A 3OP5A 3BLQA 4XOYA 2PUNA 4MXOA 4QMMA 4UMQA 3UIBA 2VAGA 5AP1A 2J7TA 2W5AA 3P78A 4G5PA 4MWIA 4YC3A 4IDVA 5EI6A 1E1VA 3AMYA 3FAAA 5M4UA 2WQMA 3DBCA 1XKKA 2W1GA 2WD1A 4A06A 5JQ5A 5AFVA 3KULA 3ZUUA 4P5ZA 5AUXA 4BKZA 3P7AA 4FF8A 1PF8A 4N57A 2XNEA 4H1JA 5JGAA 4FIIA 4DLIA 3RALA 2O63A 4LGGA 2VV9A 1ZMWA 4BIEA 4EHEA 3BKBA 1A9UA 2J50A 3F2AA 3H3CA 3QQHA 5E91A 3RP9A 3U6HA 4G17A 4M66A 4NM0A 3R8PA 3RAIA 1UWHA 3WF6A 5L6PA 3GC9A 4WUNA 5CEMA 3FHIA 4TRLA 3Q52A 2YIXA 4D4VA 4F1MA 4E8AA 3VQUA 3I1AA 5HX6A 5F94A 2QOIA 3UO5A 3KREA 4ANMA 4CRSA 3RM7A 2WGJA 3OZ6A 4L7SA 5T6KA 3COKA 4ZJVA 2J5EA 3EMGA 2NO3A 5ANOA 3HMIA 2BKZA 3AD5A 4FA2A 3O2MA 5EHLA 2QOLA 3NS9A 4FIHA 5ICPA 3FZTA 5EQEA 3VJOA 5ANIA 5EW3A 5G1XA 2JDSA 4BDFA 5BYYA 2GFSA 3EFLA 4P5QA 2BRMA 4DH1A 5EK7A 4BWKA 4FOCA 4GIIA 3BIZA 4IVBA 4ZTMA 3EOCA 4K2RA 4TYGA 4KIKB 4MBLA 3QTUA 4DEGA 2JIVA 4XG8A 1A06A 4AT3A 3HP5A 4JLCA 5HI2A 4D5HA 3AD6A 5EG3A 3PXFA 2UZVA 4O21A 5DA3A 2ACXA 2Q83A 3FSFA 4K1BA 2EU9A 2G2HA 5FGKA 1GJOA 3KY2A 4L3LA 1P4FA 3VF9A 3AG9A 2W1IA 5CY3A 2V0DA 5K0KA 3NVMB 5CI7A 5CX9A 4BWXA 2X9EA 5CEPA 1GNGA 4IB5A 3QA0A 4FSYA 4EQMA 5L2QA 3IK3A 3Q9WA 1OIQA 2JIIA 5HTIA 2FSLX 3UOHA 3R8ZA 1CKJA 3QTIA 1PKGA 5IG1A 3MFUA 1V1KA 5BVEA 2QURA 4M8TA 2C0IA 2RGPA 2O8YA 4J1RA 4MD9E 4QYGA 5E92A 4TPTA 5AR5A 2ZJWA 4YR8A 3QXPA 3VNTA 4B8LA 3C4FA 3HDNA 4XP0A 4EK8A 1WVXA 2BHEA 4NW5A 2IG7A 2XNNA 3AC3A 4FV6A 3R7VA 3MJ1A 2E9PA 5ITAA 1PXPA 3MTLA 4C38A 4BRXA 4Y5QA 2UZTA 3BHVA 4ZY6A 2QC6A 2YDJA 3ZOSA 1K9AA 3ZO4A 5J1VA 3M1SA 1ZZ2A 4I6BA 4PMMA 1K2PA 1MQBA 2J0JA 3KXMA 4AA0A 1JSVA 5M57A 2HCKA 2JAMA 4GEOA 5H8BA 3WIKA 3IW7A 1JSTA 2JBPA 4FSZA 4XEYA 3QC9A 4IMYA 1J7LA 2VTTA 3NNXA 4RIOA 2FSOX 4ACCA 2XKEA 1JLUE 1H25A 3VUTA 2XK8A 2AC3A 4FK6A 3HEGA 1FPUA 4NM7A 1YWNA 2VTOA 4FT7A 4J98A 4EH6A 2CLXA 1BLXA 5BVKA 3VS7A 3IDBA 5HG7A 3CPCA 4IB3A 2OZOA 3TNIA 3KCFA 3AT4A 1BL7A 5IKWA 3FLWA 4R8QA 4FSUA 4RT7A 3NNUA 2C6LA 2G15A 2J0MB 3DT1A 3WI6A 4E6DA 4CQEA 3NAXA 2GS7A 3NVKI 2VRXA 2Z02A 3ALOA 3Q60A 4FKRA 3EQDA 4JBPA 4B99A 4C4GA 2EXEA 4F6SA 4PPAA 2VWIA 1Y6AA 4F9YA 1F3MC 2EXMA 5HIBA 3O8UA 1WBSA 1OPKA 2HWOA 3MJ2A 3NDMA 4O0XA 1Q8TA 5AAGA 3TDVA 2GNHA 3MY5A 3QZIA 3HV4A 3PWDA 4O91A 2YCQA 1MRVA 3VUKA 4KKGA 4O82A 1ZYJA 4FUYA 4QYEA 2VWZA 5EM6A 2XYUA 4NK9A 3D0EA 3SRVB 4ALVA 2JFMA 3HMPA 3R9NA 4EC8A 4GUEA 4AN3A 3R1SA 2W1DA 4DFUA 4FYNA 4F6UA 1Q99A 4FV7A 1YVJA 3C9WA 4R77A 2A19B 3DKOA 4Y8DA 3KF4A 2UW7A 4XH6A 4YTIA 3FLNC 2WQNA 4L43A 3T3VA 4JVGA 3G6GA 4DLJA 4FEUA 1P14A 3UBDA 5BVOA 1SMHA 4HGSA 5LARA 4MBJA 5EDRA 1Q24A 3WBLA 4YJSA 5L2SA 4RWIA 4Y83A 5KMMA 3I0OA 3EQPA 1V0OA 4JR3A 2UZDA 3JPVA 3RBWA 3KA0A 3PP0A 2PZRA 3EL7A 5J7BA 4XBRA 3BYVA 5CANA 1H26A 4QYFA 3UQFA 4EH2A 3QKKA 3FY0A 4L8MA 4TWPA 4HNFA 5A4EA 5L3AA 4QMXA 3O7LB 3PXKA 3SXRA 2J4ZA 4BI0A 4H3PA 5FWKK 4EEVA 4K6ZA 3RPVA 5HLWA 1A48A 2OJGA 4MQ2A 3EZVA 4LL5A 3ZFXA 3ROYA 4Z7HA 4KSQA 4U6RA 3TL8A 1OBGA 5D12A 4H58A 4LUEA 4C33A 3EFWA 2GS2A 4C35A 4ANQA 5LMKC 2I0HA 2OW3A 4MEDA 4HZSA 5DT4A 1H4LA 4FVPA 4DGOA 5KZIA 2R3QA 4E4MA 4E4XA 4KB8A 2UZEA 3FMNA 4YP8A 4XV1A 2CGUA 4D58A 5J79A 2BAQA 2QO2A 2WO6A 4N70A 4XHKB 5GHVA 4FKOA 2NRUA 3ROCA 4IZAA 3SXFA 3QRJA 1DAYA 1P4OA 4WG4A 4DGGA 2OG8A 3NCZA 3KXNA 5BYZA 4Y73A 1UKIA 2AC5A 2ESMA 3UC4A 3FXXA 4M84A 4M69B 2WELA 3KU2A 3PE2A 4F08A 1ZRZA 1WFCA 5CVFA 4IAYA 4JAJA 2QR7A 3TUDA 1UKHA 3OS3A 2XM9A 2UW8A 3GB2A 3IOPA 3MA3A 3OCSA 4H36A 4IZ5A 4RJ4A 3W16A 4GT4A 4QQ5A 4D2TA 4ZMEA 4U81A 5HO8A 1W98A 3W2SA 4D2WA 4AU8A 1PKDA 4CD0A 3FXZA 3VBTA 4IX4A 4IM2A 1DI8A 3R1QA 2E9NA 3ITZA 4U7ZA 3MVHA 3VS2A 4FICA 4O6LA 2W06A 3AMBA 2ZV9A 5K4JA 5DRDA 3VS4A 2HW7A 3P86A 4AT5A 5KBRA 3BEGA 4ZY4A 1H8FA 4FSNA 3EH9A 4D0WA 5A54A 2XUUA 4W4VA 3C0GA 4A9UA 4BI1A 5AR2A 4EHZA 3QQKA 3QD2B 4C4HA 1FQ1B 2WTDA 1YWVA 1ZXEA 2IPXA 4M14A 4QMOA 5CWZA 3EIDA 5LVNA 4HVDA 3H9RA 1M14A 1BUHA 5IH5A 4MBIA 5B7VA 2JGZA 4MNEA 2G1TA 5FP5A 5AWMA 4HOKA 4D2VA 4DFBA 1CDKA 3Q9YA 3RI1A 1FOTA 4TY1A 4JG8A 4KUJA 1PMEA 2V7OA 4EYJA 3KB7A 4RSSA 2UW5A 4OAVB 5IQEA 3S2PA 2C47A 4M0YA 3WIGA 2G01A 3WF9A 4I3ZA 3D2IA 3GCQA 1QL6A 2X8DA 5AUTA 2UV2A 3MIYA 3P4KA 4PTCA 5IU2A 2Z7SA 3HL7A 1Q8WA 3C5IA 3FI4A 2YDIA 4BBFA 5IEXA 4DBNA 5JFVA 4QQTA 3BQCA 3R04A 2BKKA 2C4GA 4BN1A 2XIYA 4RWJA 4ACGA 5FTGA 5ETFA 4QMUA 4GFOA 3I81A 1OB3A 4C62A 4JOAA 4LOPA 3TV4A 5M07A 2VO3A 4FKVA 1PXNA 4X6QC 1RDQE 1YXVA 1XH5A 5M51A 3DKCA 1XJDA 4F9AA 3CD3A 5EHOA 4IAAA 4QMYA 4FZ6A 2XIKA 4QRCA 4Z16A 1LP4A 4U8ZA 3HECA 1I44A 2EB3A 2IN6A 1JOWB 3EB0A 4X2GA 4YJNA 5CZHA 3DXNA 4CZYB 4S2ZA 4USFA 1U46A 3QUPA 3REPA 3QC4A 3W2CA 4O84A 4KBKA 2WMAA 1H01A 2YZAA 3PVBA 3DTWA 5ANDA 1YI6A 4C3FA 4KIOA 5T3QA 2YITA 4ASEA 4K11A 4RIWA 4AA4A 3UYSA 4AE6A 3WZUA 4YURA 1HOWA 1WCCA 1ZLTA 3EN6A 4OGRA 4RLKA 3DBFA 1ERKA 3BEAA 3G0EA 4M68A 4OTHA 5EW9A 3PXRA 2OH0E 3I6UA 3BE9A 3GEQA 2YAAA 3MPMA 4V0GB 5AUVA 2WQOA 4AOTA 4HCTA 1ATPE 5GJFA 4HVGA 2PZIA 3PA3A 3VBXA 3SVVA 4BF2A 4USDA 3SA0A 5FP6A 4DE4A 3OCBA 2FGIA 4EBWA 3SW7A 3PG1A 4BFMA 3DU8A 1Y8YA 3LLTA 5HGIA 3OTVA 5M09A 2R7IA 1Z5MA 3CJFA 3KL8A 3PPZA 4J53A 4DEEA 2V62A 3E62A 3LQ3A 4PTEA 1DS5A 2GHMA 4TYHA 2LGCA 4UBAA 1YDRE 3FMEA 4M0ZA 5E8TA 3O71A 4QP4A 1MRUA 2ITTA 2OIQA 3I7CA 3NW5A 4FNXA 4OTRA 4G6OA 3MH0A 3OXTA 4G16A 4GKIA 1LUFA 1J91A 5CU3A 3UO4A 5CSXA 2X1NA 3A60A 1I09A 3KXGA 3D7TA 5H9BA 3CTJA 4EONA 3PRFA 4UN0C 3BYOA 4F1TA 2P3GX 1H08A 4BZOA 3Q2JA 4IZYA 3ORIA 3UODA 1YOMA 3Q4CA 5HESA 5AMNA 4YBKA 3IW8A 3LFBA 4IBMA 4RJ7A 2BCJA 3GU6A 3W32A 3QCYA 4BVUA 5KO1A 2R3GA 3PUPA 4BGQA 2CNQA 3QTXA 3ZDIA 4H3BA 4OW8A 1H1PA 4I93A 5HTBA 4FTJA 4TXCA 3QUDA 2OIDA 3DK6A 3R1NA 3OEFX 5L8JA 4CVAA 3KCKA 2WTVA 4YHFA 3E92A 4DFXE 4AT4A 2QOOA 4TKSA 5JEBA 4Y46A 1VEBA 4ZSLA 4ZK5A 4ASXA 5KMKA 2B4SB 3H4JA 2FB8A 4ITJA 1KOAA 2ETRA 4XNEA 4FT9A 1K3AA 4QP8A 4ZLYA 4ZS0A 1KV2A 4BDIA 3GQLA 3QRUA 3IKAA 4IHPA 1YRPA 3TZ7A 4JT3A 5E90A 3W2OA 3AXWA 2WEVA 4GL9A 4JDHA 5FG8A 4P90A 2QHMA 4UYNA 1JKSA 3VULA 1BI8A 2YERA 1KV1A 3CR0A 5IQDA 3COIA 4O7RA 3S0OA 3KXXA 4O7LA 2VX1A 2ITUA 2P55A 3DQXA 5KKRC 1OECA 3ACKA 5H3QA 3MY0A 2R9SA 5LVPA 4ZTSA 3G6HA 2BRHA 4OT6A 2RF9A 3MW1A 4C4FA 3PP1A 1J1BA 5AAEA 5J5TA 3DFCB 5AADA 1NVSA 3OBGA 3S95A 1YHSA 3IDCA 4C2VA 4IADA 5JN2A 3TG1A 2WTWA 5IH6A 2VGOA 4GUBA 5AR4A 3UP2A 3DQWA 3EN7A 3EQRA 4EHGA 4EQCA 2QCSA 4LRJA 4M15A 5D41A 4AW1A 4MYGA 2X9FA 4K18A 2FVDA 3I5NA 2Q0NA 3Q6WA 2UVYA 4PL4A 4RVMA 4B7TA 3PJ8A 5B0XA 2F2CB 2XMYA 4DC2A 1OZ1A 3O96A 3OCTA 4K9YA 3LMIA 5GIPE 3P7BA 2QR8A 2C5YA 3PLSA 4CT2A 1ZAOA 3U6JA 1W0XC 4DN5A 3M11A 3K3IA 3FKLA 4FKJA 4ACDA 1S9JA 2V7AA 3BBWA 3FMKA 3I4BA 4IACA 3VBYA 4PMSA 4MTAA 5E1SA 5KMIA 2XK3A 1YXSA 5AUUA 2ZB1A 4E6AA 4WRGA 3PZHA 3ORKA 4U41A 5K3YA 3MB6A 4R3RA 3VBQA 4L67A 4AZEA 4NFNA 3S3IA 2HIWA 2XK6A 3ZDUA 3F5UA 3HMNA 1PY5A 2QO7A 3VW6A 3ATSA 2OBJA 4GVJA 3DK3A 5FEEA 4FOBA 5HCXA 5AEPA 1ZYCA 2B54A 3JVSA 3OOMA 4EOKA 4KA3A 5CNOA 2UW9A 1UV5A 3FQEA 4EHVA 1Q8ZA 1KOBA 3QTWA 1TQIA 3LJ0A 4L3JA 4L01A 3RPSA 2UZBA 3UG2A 4F0FA 5E8YA 2QI8A 2Z7LA 2GU8A 3F7ZA 1PHKA 2FA2A 1FBNA 2WMWA 2XZSA 2WAJA 2WOUA 3NUNA 3BU3A 3OVVA 2Y7JA 1H24A 2GSFA 1UU9A 4FKPA 2VTMA 2RG5A 3QUEA 5C03A 4B0GA 3DB6A 4MXZA 4E6CA 4EH7A 2GDOA 2Y4PA 4O1PA 2IW6A 2GNFA 4LRMA 4V01A 2A2AA 4O0SA 5E9EA 1UNGA 1UU3A 2E9VA 2W1HA 3FYJX 3PIXA 5DBXA 5HQ0A 4UY9A 4CTCA 2OF2A 3LXLA 4BDKA 3QCQA 5HLPA 2QHNA 4ZTLA 4DCAA 3DZOA 2XNPA 4R1YA 3RAWA 4ANNA 5BUIA 3FZ1A 3KMMA 3TACA 2PE1A 2OICA 3L8XA 4FIJA 3CQEA 4Y5HA 4E7WA 2XJ1A 4YJQA 3SOAA 2OXXA 3KRRA 5HIEA 3P1AA 4IWQA 4RWLA 3F5XA 2XJ2A 1NT2A 3ZBFA 3I79A 3W2PA 3WZJA 3EQCA 4EI4A 5FXSA 5AIRA 2C1AA 4DYMA 4FEWA 3R7UA 5TR6A 4IM3A 2OWBA 4BDGA 3FC1X 2W0JA 3BLRA 5LXMA 5ETIA 4EOLA 4AF3A 3BGQA 4EZ5A 2PULA 2YCFA 1LR4A 2XH5A 1YHVA 3CTQA 3P0MA 3ZUTA 4HCVA 5AX9A 3OXZA 3PDTA 3NEWA 4ZTRA 3F66A 5D7AA 5E8XA 1SNXA 3G2FA 2ZYBA 4UZDA 3KULB 3Q53A 3V5QA 4EZ7A 4PQNA 3AT3A 1TVOA 4FG9A 3V5PA 5JMSA 4C59A 2PYWA 4CG9A 2WKMA 4FVRA 4NEUA 3V5JA 5A6NA 4XG9A 4L42A 3RWPA 4GK3A 5E8VA 3Q3BA 4DEAA 5IUIA 1TQPA 5I5ZA 5IA1A 4N4SA 4BCGA 4FNWA 4JI9A 4F63A 1U54A 3AOXA 3E87A 3EFJA 3A7HA 4IFCA 3TTJA 4AOIA 4E4NA 3QWKA 5EQPA 4HPTE 4FZAB 4X2KA 4OUCA 2HK5A 5KMLA 5HO6A 4NKAA 3WZDA 2YIRA 4PL3A 4F65A 1J7UA 3TV6A 4J8NA 4XG6A 2CN5A 2OXYA 4FVQA 2XK7A 3ET7A 4OAUC 5H2UA 4JQ7A 4F7LA 2OJIA 3NUUA 2YM6A 3ZSIA 4FG8A 5IQFA 3FDNA 3CEKA 1M7QA 4L52A 4U79A 3VJNA 4Y85A 3OEZA 4LUDA 1Y8GA 3JS2A 3RPYA 2YIYA 3IECA 1KUTA 3TZMA 3UOLA 5IZFA 1Q8YA 4IC7A 4WNOA 2W9ZB 3HNGA 3ENHA 3QTQA 4L3PA 4DGMA 2BRNA 2J0LA 4EK5A 1PJKA 1Q8UA 3QALE 5FQDC 4YTCA 4BCIA 4CNHA 4JIAA 3ANRA 2QO9A 5ETCA 2BIKB 3RK9A 5AP2A 5BPYA 4A9RA 1JAMA 3QFVA 4DT8A 4EK6A 3PZEA 4EOMA 4BCFA 4XV2A 3FPMA 1J7IA 4ZTQA 2O65A 2UZWE 2R3NA 4ZJIA 2VNYA 3NUYA 5JK3A 4CG8A 2X81A 4ANBA 3JVRA 3QAME 4U40A 3A4PA 4IB1A 3OUKA 4BZDA 4ZLOA 2H6DA 3DA6A 1IEPA 4JRVA 4JXFA 2OK1A 4RA4A 5E8ZA 4MWHA 5JFWA 2X8IA 3NNWA 2HYYA 4TYIA 4QPAA 3GUBA 3T3UA 3HP2A 2XA4A 5H8EA 2DS1A 4FL2A 5CI6A 5C4LA 5IQGA 2OKRA 2VO6A 3NIZA 5IEVA 3DY7A 2GQGA 2WMSA 3MWUA 3NUPA 4U45A 3NW6A 2ZB0A 3ZLSA 3V5WA 1H1SA 4UMPA 4IZ7A 2OIBA 2V5QA 5DT0A 3W2RA 4DTKA 4HVSA 4FEXA 4BDHA 2LAVA 3NUAA 5M4IA 4AZSA 2BDWA 3MVLA 3QQUA 5LCJA 4X3FB 1U5RA 3F3VA 3ODYX 3GNIB 5G6VA 3R9OA 3E8NA 4CV9A 3Q4ZA 4HNIA 5GINE 3HV7A 3R9RA 2VO7A 1IAJA 1B39A 4V05A 2VWVA 4D28A 4OTQA 1DAWA 1SZMA 2BPMA 4E5WA 4AW5A 4J7BA 5CU2A 4HGLA 3HX4A 3CBLA 1H1WA 4S34A 4BCKA 3D5WA 3DFAA 4I1ZA 4CFMA 5K0XA 2OJJA 1XH7A 3FJQE 1BI7A 1H1RA 5J9LA 4XG3A 5A4CA 3BZ3A 3E93A 3HAVA 4EH3A 4NW6A 4ZSGA 4DBXA 3QD3A 3ZLWA 2AYPA 4C3RA 3RWQA 4F7SA 2ZMDA 3GFEA 3SQQA 4F1OA 1WVWA 2NP8A 4A4XA 2JDOA 3VHEA 1KWPA 4DEIA 1IA9A 4FUXA 2JD5A 4R7IA 3C51A 3UPXA 3KGAA 5J87A 3E8CA 4YJUA 4WRSA 4I92A 4KD1A 4MD8E 3BU5A 4MX9A 4NIFA 4PMTA 2C6OA 3F88A 4HVHA 5KBQA 3AD4A 3R21A 4HW7A 4PDYA 3R02A 3FZRA 4A9TA 3AT2A 3CGOA 4A07A 3F2RA 1YQJA 4QTDA 2RFDA 2X6DA 3GGFA 2VX0A 4GU6A 2R3IA 2PVLA 3P79A 4IXPA 4RC4A 3LCTA 5C27A 1MQ4A 3UNZA 4FGBA 3RNIA 2PVKA 3KF7A 5IEYA 4Z9LA 1FVTA 3SX9A 2ERZE 3H9OA 3QKMA 1STCE 3HZTA 4NZWB 1HCKA 2I0EA 2OO8X 4FV5A 2HY81 2UZOA 4E5AX 4OLIA 5GZ8A 3PA5A 4GS6A 4HZRA 3KMWA 3FLYA 3TN8A 5DOSA 3L8PA 5JFSA 3FQSA 3TNPC 2IVSA 4G3EA 5E8SA 3VUDA 2CKOA 3TZ9A 3PXYA 5I9UA 5ANGA 3Q5ZA 2PTKA 3QLGA 4ASDA 2J2IB 3LAUA 3DJ7A 5EM7A 4PTGA 4LM5A 4O38A 2VWXA 4WIHA 5CXZA 1V0PA 2WMRA 4R1VA 4RBLA 4PMPA 3BYMA 3GQIA 3ZRMA 5IQBA 3HAMA 4YGAA 2YDKA 3C13A 5KE0A 4DG2E 5IA3A 4GCJA 2ZDTA 5F1ZA 2QD9A 4BGGA 2YM4A 1S9IA 2ZDUA 4IW0A 4XG2A 3U51A 1KE5A 2PMLX 2PVNA 4O81A 2WU7A 4EUUA 3KN5A 3O50A 4KIQA 3MH1A 5ACBC 3RVGA 5CU0A 3DOGA 4KBAA 4OTGA 1J1CA 5CU6A 4EOQA 1F0QA 4BTKA 3RINA 3FV8A 3ZS5A 5JRQA 2ETKA 5GJDA 1P5EA 4DT9A 2RKUA 3EN9A 4C7TA 3QYZA 5DN3A 3UVRA 4PPCA 4AXAA 4EL9A 4ANSA 2J51A 3ULIA 2VTLA 2B9JA 3L1SA 4BBMA 2CN8A 3PA4A 2I0YA 3G9NA 4XV3A 4G3FA 2JKKA 1SYKA 2WNTA 5AP4A 5FEQA 3O0GA 2GFCA 2JDVA 3ORXA 4XG4A 3HA6A 3R83A 1OGUA 2VTPA 3HMMA 3V5TA 5I0BA 4CYIA 3TNHA 2E2BA 4FMQA 2JFLA 3LQ5A 4YJVA 5AAFA 4E1ZA 1CKPA 2OJ9A 2OU7A 4X2JA 1XBCA 3UVPA 4DINA 5TO8A 3NUSA 1PMVA 1NVQA 5I9XA 3W8LA 4D0XA 4FTIA 4KIKA 2C0OA 3F3UA 2BZJA 4JIKA 4IC8A 3QX2A 5L2IA 5IPJA 3R28A 3OXIA 3BV3A 1BMKA 3QL8A 3OW4A 3W8QA 3F7WA 4CLIA 4EK4A 2IZSA 2X8EA 4DHFA 4Z7GA 3ANQA 2YWVA 2VUWA 2C6IA 5D11A 5DE2A 4NT4A 5FDXA 3A99A 4GV1A 3WF7A 3GU7A 3QZHA 4FKLA 2FSMX 2NPQA 3A2CA 4O2ZA 4ENYA 3FMMA 1OMWA 5DMZA 4GW8A 3BYUA 1XHAA 3UP7A 4ALWA 1W8CA 3MH3A 3LJ2A 4WBBB 2A4LA 4FZDB 4ZZNA 2R3KA 2AUHA 4AFEA 5BNJA 2J90A 3RAHA 3R8LA 4GYIA 5DIAA 3SG9A 1CKIA 3LXNA 4D4SA 2GNJA 2JKOA 5JZJA 2JITA 3FHRA 4M7IA 5HZNA 3E7OA 4NCTC 2PHKA 4NFMA 5LMBA 4RJ6A 4JQEA 2F9GA 2W9FB 3BHYA 2C6TA 4APPA 5HG9A 2ONLC 3UDBA 4GT5A 2B7AA 1XR1A 3D15A 3KVWA 4FTUA 4JS8A 3U4WA 3FEGA 5CALA 2CJMA 3E8EA 3ZTXA 4CV8A 4W9XA 5IQAA 5EHYA 5CT7A 3EHAA 3NYVA 3B8QA 3FMJA 1PXJA 2IZRA 4FTRA 5AP6A 4BDJA 1Q41A 3NNVA 3FI2A 4QMSA 4PUZA 3WF5A 4A4OA 2F49A 3SD0A 3R01A 4D2RA 2ITYA 4K33A 4YJTA 3QD4A 5CSPA 3MPTA 1OPJA 1QPEA 5HEZA 2W5HA 4TT7A 4CFWA 3K5UA 5HU3A 1ND4A 3IW6A 1REKA 3HYHA 4IAKA 4CFUA 5ANEA 4YU2A 2XVDA 2RFEA 2QLUA 1QPDA 2OH4A 3IW5A 2KTYA 4BCHA 2VTIA 3QQLA 3OWPA 5D1JA 3N51A 1FINA 1JNKA 1Z9XA 3D83A 4QP9A 3KC3A 4Q2AA 5CEKA 3EQGA 2FYSA 2HZIA 3DS6A 3R7IA 2BMCA 4XMOA 3UTOA 3DGKA 2O5KA 2Y4IB 3SC1A 3ZZWA 2WTKB 4A9SA 3OC1A 4WT6A 5ANKA 5HLNA 2WMBA 4FBXA 2PVYA 5BMMA 3HGKA 1YKRA 3CC6A 4TYJA 4ZP5A 3SXSA 2EB2A 5LVMA 1URWA 3CGFA 5CSVA 4L7FA 3TEIA 5K4IA 4GFGA 2PMNX 3W33A 2C0TA 4CMUA 3RK5A 3CY3A 5HBHA 3R71A 4EJ7A 3MB7A 2PMOX 5A4TA 4C02A 3PJ3A 4YZNA 3SRVA 3R6XA 4DH3A 4BKJA 4TZRA 2VTQA 2W4KA 4YZMA 5DLSA 2YISA 2WTCA 5DEYA 3THBA 1KE9A 5EKOA 2BAJA 5HE0A 4OTPA 3A7IA 4IH8A 5HBEA 4I6FA 3RJCA 5F9EA 5DR9A 3LFEA 4KS8A 2DWBA 1PMUA 5TF9A 3PWYA 4FKIA 4R6VA 4IVAA 3K2LA 2YM8A 2H96A 4QNYA 3JY9A 3VAPA 1M52A 1PXLA 4QNAA 4WNMA 3D7TB 4ANLA 2F7XE 2CKQA 3BHUA 3FYKX 4PY1A 4FT5A 3CSVA 5CEOA 4UWCA 1U59A 2A27A 2QLQA 4NSTA 3AC1A 4O1OA 3NRMA 2X4ZA 2C3IB 2E9UA 2GNIA 4C4EA 2B9FA 2XKCA 5E8UA 1W84A 1YOLA 4J52A 3RMFA 2OJFE 4CLJA 4XG7A 4BCNA 1M2RA 2PZ5A 2R3FA 4O0UA 2BIYA 2W1ZA 3LCSA 3R22A 4MK0A 1RW8A 4D1SA 5M4FA 1QPJA 3ZXZA 4PL5A 5LQFA 2R0UA 5FXQA 3P5KA 4QT1A 2GNLA 4KBCA 1WBVA 3DNEA 3VHKA 3QD0A 3ZFMA 2BZKB 3Q6UA 4W4YA 4XUFA 5IUGA 3DTCA 4U5JA 2O3PA 2VTJA 3VS6A 2YACA 3F82A 4FSRA 1CMKE 1OL2A 3F3TA 4ITHA 3PG3A 4J97A 4NJDA 3A62A 4NWMA 4WHZA 2QOCA 5FBOA 1PMNA 4J8MA 4TWCA 1IG1A 5J7HA 4U9AA 4UMRA 3SHEA 4HGEA 4I24A 3TKUA 4EH4A 4XBUA 5CAOA 4YZBA 1M2PA 4GJ2A 4L00A 3HRBA 1BYGA 1XBAA 4YNOA 3UNKA 3HVCA 3FMLA 4QD6A 1MRYA 2BDJA 1JPAA 3QF9A 4AW2A 4G1WA 4YSMA 4ANOA 5LWMA 5M44A 2QOKA 2WTJA 3KKVA 4NM5A 4BCJA 4USEA 4M69A 4C36A 1J3HA 5LOHA 3UOJA 5AV1A 3DXPA 4EK3A 5K5NA 4ACMA 5LMAA 4ZJJA 1XWSA 2VTSA 3PFQA 4FTAA 4IJPA 1CTPE 2JIUA 4L68A 5DEWA 2QODA 3ZXTA 4IAFA 5DFPA 2RIOA 4S31A 4YC6A 5KHXA 4O0WA 3G51A 3P23A 2YM7A 3LFAA 3WE4A 3QRTA 4F99A 2WMVA 4GFMA 4F70A 2OGVA 2WB8A 2X2KA 3DZQA 4WG5A 3MDYA 2ONLA 4YBJA 3ZLXA 2HAKA 4UWYA 3PPKA 1JWHA 5LMKA 3O17A 4TYEA 3NSZA 4GK2A 3P7CA 3PY0A 5L2WA 4FKUA 4UMUA 4NTTA 5HCYA 5HTCA 4XJ0A 4XLVA 2CGWA 4QP2A 1JSUA 3OCGA 5GZ9A 3C50A 3TKIA 3ZM4A 3QQFA 4X7QA 3T9IA 5KUPA 5FTQA 3ZBXA 3DCVA 3MFSA 3PSBA 2UUEA 3Q9ZA 1IA8A 2ERKA 2WMXA 1G8AA 3OUNB 2CKEA 3QTSA 2R5TA 4FSTA 2NNWB 5FXRA 4S30A 1ZZLA 1H00A 2X4FA 3QCXA 4YLKA 3V5LA 2C3KA 3V8WA 3LE6A 4IAIA 4DH7A 3U9CA 4YLLA 3RPOA 1W83A 1OM1A 4O86A 4H39A 4MH7A 2PY3A 4EORA 4KKEA 5BVNA 4RWKA 3OY1A 5AUWA 2F7ZE 2YIQA 3B2TA 3QGWA 3CE3A 3WZEA 4ARKA 2XJ0A 1BL6A 5IISA 5EW8A 3VO3A 5A3XA 3UIMA 4QTBA 1GAGA 4J99A 4BZNA 1Z57A 3CJGA 2JAVA 4RIYB 1ZYDA 3WE8A 3FMHA 2HELA 5AA8A 2PUPA 2BILB 2X39A 3UO6A 3SGCA 4TWNA 4BCOA 3EQFA 5KZ0A 4YZDA 4CCBA 4D4YA 4FV2A 4FT0A 4FV8A 2XNBA 5IQCA 3C4WA 4P4CA 4WOVA 4NYEA 3HRCA 2EUFB 5EFQA 5ACKA 2ZV7A 2ZM4A 4ZXTA 4IVDA 2H34A 3QQJA 4BL1A 3WOWA 4NKSA 4QQJA 5DG5A 3EWHA 3LJ1A 3R9HA 4BB4A 4D9TA 1WBWA 3V04A 3ZSGA 2VZ6A 2IW8A 4R3PA 3FUPA 4JX7A 2CGXA 5HE2A 1TQMA 1W7HA 2VD5A 3Q04A 5EYCA 5BYLA 5M08A 3ZONA 2HXQA 3WILA 1H07A 2YM3A 2J9MA 3AC8A 3IONA 5GZAA 3FPQA 5DYJA 3MI9A 2KULA 4DF3A 1H0WA 4FZ7A 4TL0A 5DHJA 3LCDA 1NY3A 4ZLZA 2IWIA 3L9MA 4MXCA 3PY3A 4O0RA 4V0GA 3VN9A 4EBVA 3WYYA 5A46A 5JQ8A 2Z7QA 3PIZA 3PJCA 3LPBA 4ONAA 1U5QA 4M13A 5JRSA 3LHJA 4Q9ZA 2C5XA 4M3QA 4N6YA 4FSQA 1Q3DA 3ACJA 4KKHA 3II5A 5DT3A 1M17A 4Q5HA 4KINA 2CDZA 3VS1A 4AAAA 3MSSA 2UZUE 4RQKA 5AV4A 4D1ZA 2XNGA 2CKPA 1ZMVA 3ALNA 2BTSA 4IX5A 4ZSAA 2GCDA 2XB7A 3TNQB 2X0GA 2J5FA 2QVSE 3OROA 3AC5A 1FMOE 4RIXB 4PPBA 3CD8A 4XCUA 2B52A 2O64A 3OTUA 1GY3A 4BYIA 5IDNA 3E3BX 3RTPA 5K9IA 4N6ZA 4AUAA 4ZEGA 3EN5A 3PPJA 3QQGA 5AV2A 3PVWA 4BWPA 3S4QA 4B6LA 3QYWA 2IZUA 4BDBA 1WBOA 3D7ZA 3UE4A 4QMNA 3DK7A 4JR7A 5M53A 2HWPA 2PL0A 4U97A 4BY9E 4D9UA 1GIIA 2WFYA 5IMXA 5I3OA 4FKQA 4W9WA 3I7BA 3LW0A 1NXKA 2C5VA 4IWOA 3OT3A 4BDAA 2G9XA 2OXDA 4C8BA 5J9ZA 5DPVA 4MCVA 2YJSA 2BALA 3GC8A 3OWJA 4NJ3A 3VUIA 3FKOA 4RRVA 5J5SA 3GVUA 1Q4LA 4WNKA 5FLFA 3N9XA 3FY2A 1XO2B 4P2KA 2ITVA 5CVHA 3POOA 3VRZA 5EI8A 4DGLC 4RFYA 4O0YA 4APCA 1OL6A 3EQBA 4UALA 3BWFA 3RHKA 4BIDA 4C4JA 1QMZA 3LXKA 4PV0A 4B8MA 3IS5A 1HCLA 2PVRA 4LGDA 1VR2A 4CQGA 5IUHA 4PNKA 2HOGA 4ZMFA 4EH9A 4EWHA 2ZM3A 3OFMA 4NM3A 2FH9A 3MIAA 4EWQA 4OT5A 5IH4A 3ULZA 5HE3A 5L8LA 3LZBA 4BCMA 5A4QA 2J6MA 4XP2A 2W1FA 1OITA 2P2IA 1T46A 2B1PA 2QG5A 5HE1A 2XRUA 2DYLA 4ASZA 4G3CA 3JYAA 3SAYA 3SDJA 1CSNA 3N4VA 1G5SA 5DI1A 4U3YA 5EM8A 3S1HA 4U42A 3CP9A 3ZM9A 5F95A 3FI3A 4HYIA 2ITNA 3C4EA 2XIRA 4G2FA 5HICA 3AGMA 4GU9A 3OWKA 4DAWA 4CCUA 1MP8A 4BIBA 4FL3A 3GOPA 3T9TA 3E5AA 3JY0A 3FL5A 4CKJA 3CLYA 3MYGA 1O9UA 4AGWA 3C0IA 5A9UA 3LKMA 4KSPA 3RCJA 1H27A 2PVMA 2W05A 2R3RA 3F69A 4C34A 1GZKA 4FKWA 3UYTA 3D5XA 4I0SA 4MF0A 2REIA 5EOBA 3FI8A 4IX3A 2VTAA 3V01A 3PJ2A 5ANJA 1GZ8A 4EH5A 3M42A 2OFUA 4BDDA 5EKNA 2EWAA 4ZTNA 4KS7A 3PE1A 5KMJA 1Q5KA 3UZTA 5HX8A 1SVEA 3CKWA 3F6XA 1AGWA 2PZPA 3GCSA 4LV5A 1UU7A 1WVYA 3MGYA 4O0TA 3ZYAA 5KMNA 5L6OA 4X21A 2QG7A 2GPHA 3RHXA 4JDIA 4I41A 4QTCA 2HXLA 2IO6A 3F3ZA 3NYNA 5TOZA 3VF8A 1R3CA 3PXZA 4CZTA 3DBQA 4S32A 3KRJA 4D5KA 3E64A 1ZARA 3OWLA 4AA5A 4FYOA 3HLLA 3QCSA 1Q97A 3R7EA 3IOKA 3NZ0A 5CSWA 3A8WA 3SW4A 4QQCA 1GZOA 3DKFA 2HY0A 3KEXA 5D10A 3ZMMA 5KX8A 3CQWA 3P9JA 3QHWA 4NH1A 3ZC6A 3H10A 3FMDA 4RVLA 1G3NA 3FBVA 3DJ6A 2BFXA 1YDTE 4I0RA 3C4XA 5AR8A 1JVPP 4G6NA 3VVHA 4YZ9A 2BDFA 3KXHA 4PF4A 5AIKA 1OL7A 4JBOA 3UPZA 1O6YA 2ITXA 4QP6A 4CFNA 2X2LA 4L44A 5KHWA 5AP3A 4F7JA 5IQHA 4I5HA 1F5QA 4DEDA 5CAUA 3G15A 2GNGA 3TT0A 4NIFB 3FZSA 4X3FC 3UIUA 3NGAA 5HIDA 4RJ8A 2PVJA 2RL5A 2ZM1A 4DTAA 5CQWA 2QONA 4UMTA 2F57A 4HYHA 4DH5A 5DGZA 3GXLA 4LOQA 4ZY5A 2XNMA 4EOPA 4HGTA 3AMAA 5IA2A 2OZAA 5L2TA 1NW1A 1PXIA 4I23A 4I0TA 3MA6A 2R0IA 4CYJA 4F4PA 1R39A 5CF4A 3U54A 3TJDA 5EDPA 5FD2A 2C30A 4O7SA 3GBZA 2VTRA 3BBTB 5CQUA 3IQ7A 5CEIA 3U8WA 4CKIA 2ZOQA 5C8NA 3W18A 4W8DA 4OBOA 2C6DA 3MVMA 4A4LA 3V6SA 4ITIA 5K5XA 1AQ1A 2R3LA 3O23A 4ZZMA 4AACA 4FX3A 3NIEA 5EYMA 5M4CA 2XIZA 4MNFA 3N4TA 4R7BA 3PVUA 5HNIX 2ZAZA 2DQ7X 4OTFA 4HYUA 5GIOE 3AC4A 5HG8A 3UMWA 2YN8A 2VNWA 4RPVA 5FBNC 4RGJA 5HNGA 4JDJA 4JAIA 2XRWA 2C5OA 1R0PA 3FLQA 3NX8A 4RX5A 3Q2MA 3FL4A 3MY1A 5C9CA 1SM2A 4DCEA 4A7CA 3G90X 2C3JA 3QX4A 1BKXA 2Y0AA 2QKRA 3HKOA 4X2FA 2VWYA 2W1CA 1QCFA 3TI1A 3GENA 4GG5A 2VX3A 1AD5A 2XBAA 4O2PA 1OKWA 3HV3A 3EN4A 2XK9A 4CMOA 3ZLYA 2ITWA 3UOKA 4ZZOA 2IVTA 3R30A 3MS9A 4RJ3A 4JBQA 3ZRKA 5HHWA 1ZMUA 4D1XA 1MUOA 1YHWA 3DKGA 5AR7A 2HZ0A 2QNJA 3IGGA 3TXOA 4FL1A 4PNIA 4C3PA 1OUKA 3OY3A 3A7JA 5FEDA 3C7QA 4DEBA 4FV4A 4MXAA 2YFXA 4IWPA 3RAKA 4YHJA 3DAKA 3W55A 4KRCA 3I6WA 5JZNA 3WYXA 4G3GA 2BRGA 1FMKA 3OHTA 2OSCA 1APME 4FTKA 4IWDA 4O7YA 3EFKA 3W10A 2GMXA 4CTBA 4EQUA 2YZLA 2PMIA 3ELJA 1BX6A 4FNZA 3ZUVA 3VRYA 3V3VA 3QWJA 2CNVA 2QOHA 1JQHA 3FXWA 4L53A 2WZJA 5IA5A 3QZGA 4UZHA 4CT1A 4DGNA 2CCIA 2VN9A 2R7BA 4J71A 4RX8A 3V8TA 4N0SA 4C2WA 3RM6A 4KRDA 3R2BA 2B53A 2FO0A 5CNNA 3TWJA 5GNKA 4LMUA 3CIKA 4IANA 2WMUA 4D2PA 4BHNA 2VTHA 3GT8A 3LFSA 3NAYA 3QXOA 2GTMA 2I40A 4FIGA 4WSYA 4E26A 5HU9A 2OLCA 3F9NA 1GZNA 4G5JA 4QMLA 4KAOA 4YHTA 4E4LA 3TM0A 4YTHA 5DNRA 3GI3A 4G9RA 3ORZA 4XRLA 4ZOGA 4O7WA 4NL0A 2R3PA 5B2KA 4YNEA 4PDPA 3DXQA 3QU0A 5JKGA 3CS9A 3DDPA 1ZOGA 4PP9A 4RMZA 3I5ZA 3H9FA 2XM8A 2C6KA 4QYYA 5E7RA 3RGFA 3CPBA 3RZBA 3OOGA 3LFDA 4I5MA 4BYJA 3PLAE 4LRKA 4KWPA 3SKCA 1ZYSA 2YM5A 2Z8CA 3MN3A 4AZFA 5AV3A 5I4NA 2H8HA 3ERKA 3A4OX 4O27B 3VS3A 3DJ5A 4DFNA 4WO5A 4EJNA 5HKMA 4AQCA 4FTMA 4UEUA 3A7GA 3VS0A 4K0YA 1SVGA 4FV9A 3ODZX 3POZA 4KNBA 4YSJA 3UQGA 5CEQA 2IVVA 3E7VA 3PY1A 4YUQA 3MV5A 1VJYA 1XQZA 3QZFA 3ZEWA 5BMSA 4X3FA 4AP7A 3LCKA 3R8UA 4IDTA 2XEZA 1YW2A 5DR2A 4D4RA 3BLHA 4X6RA 3C0HA 5CS6A 4JRNA 3D5UA 1LEZA 2JKQA 1GOLA 4BTMA 4AZTA 3IG7A 4F9BA 4Y72A 4GH2A 2JBOA 3LLAA 4H05A 3GCVA 3GOKA 4DG3E 4YLJA 2UW3A 5EH0A 3EKKA 5EI2A 4QTEA 3R8VA 5CAPA 3ETAA 3PYYA 4Q5EA 4CGAA 2PUUA 4B4LA 4PDOA 3LFQA 4BTJA 3C4ZA 4QOXA 2ETMA 4TN6A 1H0VA 3FSKA 3UGCA 4DH8A 2YIWA 1Y57A 1PXMA 2RFNA 4JG7A 4J95A 4FT3A 3G33A 5AP7A 4ZAUA 3NWWA 2WPAA 3G5DA 2WU6A 4FNYA 3ZEPA 4BHZA 4MD7E 3UJGA 3UC3A 2JDRA 2JEDA 4RG0A 3NCGA 1OIYA 3U9NA 5DR6A 5FM3A 4F0GA 3KVXA 3PXQA 4Y95A 4Q9SA 2YAKA 3ORNA 3QKLA 4AFJA 5BQ0A 4BR3A 3QA8A 3EQIA 3PJ1A 3KK8A 4XS2A 3RPRA 4RFZA 4AWIA 2DUVA 4BCPA 3VUGA 2VWUA 3IO7A 3MESA 4RVTA 4K8AA 4ERKA 5T68A 2A1AB 2G2FA 2WEIA 2X6EA 3JXWA 2IVUA 5CENA 4MNEB 4DG0E 3A61A 3HDMA 5AUYA 3BELA 4JQ8A 5J8IA 4WSQA 3RKBA 1PXKA 1WBTA 4R78A 1XBBA 4RZVA 4CZUA 3UQCA 4BGHA 3VBVA 5AUZA 1NA7A 4FK3A 3R00A 3O51A 4FKTA 5BUEA 3ZH8A 1YXUA 2Y4IC 1M7NA 3BGZA 2WTKC 3F2NA 4GJ3A 3AQVA 3IW4A 4L45A 2HENA 5LJJA 3GC7A 3ORPA 3KRXA 1JKKA 2WTIA 3NYOA 2W7XA 2BROA 5E8WA 5CYIA 2YA9A 3R7YA 3EKNA 4FZFB 4AZVA 3MBLA 4FIFA 3IDPA 4K77A 3I60A 1O6LA 2CGVA 4GRBA 4JBVA 2CLQA 3NUXA 4FI1A 3HV6A 1UWJA 5JH6A 1DI9A 3LMHA 4O7NA 2QOQA 4G6LA 2CCHA 2I6LA 2XKFA 5I3RA 4E3CA 2PSQA 1NVRA 3E63A 4RJ5A 4XLIA 4BI2A 1IAHA 3ID6C 2ZMCA 4E93A 2VWWA 4O83A 3MPAA 2PUIA 3O8PA 3W2QA 2Q0BA 2OI4X 4IEBA 3TNWA 1VYZA 3EZRA 2PE0A 2R2PA 4RIWB 3EL8A 2J0KA 2P33A 5CAQA 2ITOA 5FRIA 4IVCA 4AW0A 4OBPA 4FV3A 2JC6A 5BUJA 4GSBA 4XX9A 2FSTX 3O7LD 4MQ1A 2Y9QA 3OD6X 4W8EA 4U44A 3B2WA 2Y8OA 5FM2A 3GP0A 3PVGA 3BQRA 5HVYA 3LCOA 3GCUA 3CY2A 4EKLA 4WKQA 5A14A 5D9HA 4KABA 5E1EA 1OVEA 5HVJA 3VUMA 3RZFA 3Q9XA 3FQHA 2X2MA 5TT7A 4EC9A 3PSCA 5F20A 3QRIA 1OKZA 4UB7A 5DH3A 2EVAA 3V6RA 3U6IA 2ZV8A 4IB0A 2GQSA 3PIYA 3WARA 1YI4A 3KQ7A 5J9YA 4O7ZA 2UZNA 1XH8A 4TYHB 2BRBA 4UXLA 4DITA 3BGPA 3EYHA 4BDCA 3M2WA 2WQEA 3ZO1A 1ZYLA 3A7FA
chains in the Genus database with same CATH superfamily
4Z55A 4NTSA 4ID7A 3K3JA 5JGBA 2Z60A 2ITQA 1IASA 3OW3A 4B9DA 1M2QA 1YDSE 4C58A 5FDPA 3DBEA 4G34A 1ZOEA 2F2UA 2QU6A 2Y6OA 3C5UA 3FC2A 4TW9A 5IA0A 1VYWA 5DWRA 5LVLA 3F5PA 4UV0A 2XBJA 5EDQA 3H0YA 4CXAA 4QO9A 3ZSHA 3N4UA 3OT8A 4LOOA 2R3OA 3D9VA 4R5YA 2VO0A 3DNDA 5AM7A 4YPDA 4MXYA 4ALUA 3K5VA 4IFGA 3ZO3A 3FWQA 3W0QA 2F4JA 2PE2A 4QP1A 2XIXA 3BU6A 4WA9A 4XRJA 4HYSA 3LFFA 4CMTA 1SNUA 5CVGA 3MVJA 3WF8A 4BKYA 3I0QA 4F9CA 5KNJA 4AN9A 3KK9A 2GHLA 1KE6A 2C68A 5TKDA 2PPQA 4F0IA 2XK4A 2C1BA 4Z3VA 4YC8A 4H3QA 4I6HA 4M97A 3UVQA 5KCVA 5C1QB 1B6CB 1RJBA 2WQBA 3Q4UA 4TWOA 4D55A 4EH8A 1R1WA 4GMYA 4EYMA 5HORA 4I21A 3R1YA 3TZ8A 4FKGA 5EM5A 4HJOA 4LV8A 4O4DA 4W4WA 5EYKA 3MFTA 3LXPA 3NLBA 4MF1A 4RC2A 5GJGA 5L4QA 2WIHA 2YCSA 3ZFYA 4I4FA 3TV7A 4YJOA 1LEWA 3PTGA 4WG3A 1XH6A 4F78A 3EYGA 3H30A 4WNPA 2W4OA 3DLZA 4I20A 5AX3A 2V55A 2WMQA 3JUHA 4ZS4A 3MFRA 4CFFA 3V8SA 4I22A 2IJMA 4HPUE 1ZY5A 3UZRA 2CMWA 1VZOA 2WMTA 5H8GA 1UNHA 5CF8A 3BV2A 4X2NA 4RX7A 3FZOA 4CFVA 2O2UA 1DM2A 2BZHB 4C4IA 1G8SA 3OMVA 4W4XA 4U0IA 3KXZA 1KE8A 4NCTA 1WBNA 2VU3A 5AP5A 3VIDA 4ACHA 2C6MA 4FTOA 2FUMA 4R7HA 3VWAA 4G9CA 2SRCA 4LI5A 5CZIA 3ZHPC 3UNJA 4O7VA 2OF4A 2GQRA 3L9PA 2C5NA 3IPHA 5CAVA 4FIEA 4YZCA 1ZWSA 2X7FA 4P7EA 4QMZA 4FEVA 1FGKA 1YXXA 2P2HA 1URCA 3T8OA 4PWNA 5CXHA 4FTNA 1YOJA 3Q5IA 4IQ6A 3TUCA 2CNUA 3BHTA 3E88A 3R9DA 4BCQA 5C8KA 3EQHA 4IE9A 3JR1A 1XH9A 5CT0A 3ZZEA 3W0PA 1OI9A 3ZU7A 2PVHA 3UZPA 4XOZA 4I4EA 4U43A 1RE8A 2GHGA 5AM6A 3GFWA 1Q61A 3DLSA 3NR9A 5LCKA 4IJ9A 4ZTHA 4NUSA 4QYHA 5TE0A 1ZY4A 1KSWA 2JDTA 4O22A 4QP7A 2R64A 1IRKA 2VGPA 5CASA 3TDWA 3D2KA 2QQ7A 4F6WA 1W82A 4UX9A 4I6QA 5B2LA 2A0CX 5AV0A 1IR3A 3ORTA 4FKSA 4FTCA 5L6WL 4AGDA 4PDSA 2OFVA 3L9NA 3CCNA 3KRLA 3RK7A 5JGDA 5J95A 2ZVAA 4FTLA 3TIZA 4BDEA 4JJRA 3TTIA 4C57A 3FZPA 1PYXA 2ITZA 3TCPA 5C01A 4C61A 4II5A 5EOLA 3PFYA 1QPCA 1WAKA 2W99B 4DFLA 5I9VA 2P4IA 3BHHA 3LOKA 4LGHA 5HOAA 4AS0A 4ZSEA 4WBOA 3W1FA 4F9WA 5C26A 5A6OA 3COHA 1WBPA 3O8TA 4GIHA 4TTHB 3AGLA 4RQVA 3R7OA 3GU4A 3GU5A 3BWJA 4PX6A 2E9OA 2W96B 5AJQA 4F64A 5E4HA 3E3PA 1EH4A 2HZ4A 5HNBA 4AOJA 5BX0A 1SVHA 2W17A 5HD7A 3U4UA 1G8JA 5M06A 2X7GA 3GCPA 3F3WA 3HUBA 3ATTA 3LQ8A 4FTTA 3QTZA 3BX5A 4AG8A 5CSHA 4EOOA 2BUJA 3BYSA 3WZKA 2XEYA 3RNYA 3CTHA 1TKIA 3VC4A 3EJ1A 4C37A 3D14A 3HV5A 3VUHA 3HUCA 2R3MA 5J1WA 1XH4A 2RG6A 2I0VA 4E73A 1L3RE 1L8TA 2G2IA 3NW7A 4MAOA 3G9LX 2JLDA 4RFMA 3DAJA 1E9HA 4R5SA 2P0CA 2CHLA 4DTBA 2BTRA 4FG7A 2BZIB 3LM5A 1OGYA 2GTNA 3MTFA 4IX6A 3ZRLA 4M12A 5M56A 1OL5A 1Q3WA 3COMA 2B55A 2XANA 1OL1A 3KRWA 4AN2A 4CKRA 1Y6BA 4J96A 4OTIA 4GT3A 5HBJA 4I94A 4PRJA 3BI6A 4DFYA 4EOIA 3UIXA 3L8VA 4AZWA 4FR4A 5CF5A 3SOCA 4S33A 2HZNA 3UMXA 5D7VA 3D5VA 4QP3A 2C3LA 3CXWA 3CKXA 4TNBA 2F7EE 2X7OA 4G3DA 3UDZA 2BFYA 4RA5A 3AC2A 5AP0A 4D2SA 2UW6A 4MVFA 3QHRA 4C4JA 4FC0A 4DEHA 5HVKA 5CTPA 1H1QA 4MXXA 4E6QA 4ZSJA 4FV1A 5CF6A 4YO4A 5IF1A 3FLZA 1U54B 3IGOA 4LQMA 2W4JA 1PXOA 2CSNA 3Q4TA 4V04A 2RFSA 4OBQA 5KKRB 1RQQA 4F09A 4YJRA 2RSVA 2YCRA 3NPCA 5L8KA 2UVZA 3DPKA 3CQUA 5IMEA 1UA2A 2XP2A 3DAEA 3LIJA 2XKDA 5IDPA 4YO6A 2VTNA 1JBPE 2PZYA 1Y91A 2Z2WA 3H0ZA 4TNDA 1JKTA 4PP7A 3F5GA 4RC3A 4KIPA 4DFZE 1KE7A 3B8RA 5I9YA 2YLFA 3OF0A 4EOJA 5EQYA 5M55A 5JT2A 2HW6A 3VS5A 4L9IA 4AXDA 4X3JA 5F4NA 4AGCA 4HCUA 3R2YA 3DBDA 3R0TA 1GIHA 2Z7RA 3MH2A 4RIYA 3C1XA 4JNWA 2UZLA 3A8XA 4QTAA 2JKMA 4E5BA 5FTOA 1LPUA 1V0BA 1PW2A 1PYEA 1X8BA 2XS0A 1UU8A 1FVRA 3K54A 4RLLA 4AE9A 1GIJA 1OKVA 2WXVA 3R73A 2UW4A 2VWBA 4JX3A 4L46A 3SG8A 1YI3A 4XP3A 1FVVA 4QMQA 2ZV2A 2BR1A 3QBNA 3KN6A 5HD4A 4RX9A 4WD5A 4OTDA 2I1MA 4C0TA 2OZAB 1JKLA 2QKWB 4LMNA 3FLSA 4QPMA 2YABA 3R63A 3TIYA 1OUYA 5FUTA 1REJA 2NRYA 5BVDA 4FODA 3S00A 2Y6MA 1WMKA 5C8MA 3KFAA 4IAZA 4O96A 4GG7A 3L8SA 5A4LA 4G31A 2O0UA 3HA8A 4UWBA 1PRYA 4OTWA 2C6EA 5C4KA 1R78A 4I5PA 2EXCX 2QU5A 4BTFA 1R0EA 3OBJA 4LL0A 5LVOA 2WHBA 2W1EA 1P2AA 3QRKA 3ZCLA 3E8DA 4CSVA 1H28A 3ENMA 4OR5A 3DDQA 4O0VA 4GKHA 3ORMA 4JG6A 4CRLA 3F61A 3SLSA 5CU4A 2QOFA 4YMJA 4LYNA 1O6KA 4WUAA 1Q62A 3U55A 3QTRA 4RVKA 3SV0A 4EOSA 1WZYA 3LFCA 4GYGA 2YHVA 3RCDA 4CFXA 4O7TA 2XCHA 2BAKA 3BRBA 4RZWA 5EYDA 4ERWA 2YWPA 3OG7A 2C69A 2XF0A 5LWNA 3GU8A 4BC6A 3VQHA 3LVPA 4RIXA 4DA5A 3NMUF 4QMVA 2V22A 3NYXA 1T45A 4UYAA 4R3CA 5DRBA 5BVWA 2YLEA 3TKHA 5ETAA 5KMOA 4X0MA 4YPSA 4IIRA 4QPSA 5I9ZA 1OBDA 2WOTA 4QMPA 1OPLA 3DV3A 4JDKA 4MHAA 5HCZA 3UG1A 3HRFA 5AA9A 4XYFA 4GVAA 2XNOA 4QMWA 4EKKA 1U4DA 5CLPA 2XCKA 3G0FA 4EUTA 1OIUA 4FSMA 1OKYA 3P08A 5JSMA 4M67A 4I5CA 1OIRA 2IZTA 3HMOA 4IM0A 3U87A 4FSWA 4L6QA 4XV9A 2QOBA 5HG5A 4ORKA 4F7NA 5IQIA 4LFIA 1UNLA 4QMTA 4A9YA 3PRIA 3VW8A 3GC0A 4MKCA 2CPKE 4U3ZA 4BICA 3PSDA 2UW0A 1CM8A 4YTFA 5JFXA 1ZOHA 3V51A 4YJPA 2B9IA 2GS6A 3R7GA 3VBWA 3BPRA 4O6EA 2UVXA 4AGUA 2PWLA 2B9HA 2ITPA 4H1MA 3LFNA 4UXQA 3LMGA 4BBEA 4FV0A 2BVAA 4AX8A 1FGIA 3DB8A 1UVRA 2BHHA 3ORLA 3R8MA 3ZO2A 3C4CA 1YXTA 3QLFA 4ZIMA 3D94A 4JL9A 2J0IA 1YWRA 3LM0A 1ST4A 4HVIA 5HO7A 2H9VA 2PVFA 3BE2A 5DVRA 4NU1A 5AR3A 5B2MA 3FE3A 3L9LA 3Q96A 3TJCA 5BVFA 2R4BA 2YJRA 3Q32A 2XYNA 4GK4A 2R3HA 3TUBA 4ENXA 4E20A 4FGRA 3QGYA 2B0QA 2R3JA 4CEGA 4FEQA 4EZ3A 3FKNA 3ZC5A 2WIPA 4FTQA 3KMUA 2PK9A 4LG4A 4U80A 3D4QA 3BCEA 2I7QA 2IW9A 1E1XA 2YEXA 4FE2A 5IA4A 5I9WA 2W5BA 2PU8A 1B38A 3OP5A 1XMLA 3BLQA 4XOYA 2PUNA 4MXOA 4QMMA 4UMQA 3UIBA 2VAGA 5AP1A 2J7TA 2W5AA 3P78A 4G5PA 4MWIA 4YC3A 4IDVA 5EI6A 1E1VA 3AMYA 3FAAA 5M4UA 2WQMA 3DBCA 1XKKA 2W1GA 2WD1A 4A06A 5JQ5A 5AFVA 3KULA 3ZUUA 4P5ZA 5AUXA 4BKZA 3P7AA 4FF8A 1PF8A 4N57A 2XNEA 4H1JA 5JGAA 4FIIA 4DLIA 3RALA 2O63A 4LGGA 3BLAA 2VV9A 1ZMWA 4BIEA 4EHEA 3BKBA 1A9UA 2J50A 3F2AA 3H3CA 3QQHA 5E91A 3RP9A 3U6HA 4G17A 4M66A 4NM0A 3R8PA 3RAIA 1UWHA 3WF6A 5L6PA 3GC9A 4WUNA 5CEMA 3FHIA 4TRLA 3Q52A 2YIXA 4D4VA 4F1MA 4E8AA 3VQUA 3I1AA 5HX6A 5F94A 2QOIA 3UO5A 3KREA 4ANMA 4CRSA 3RM7A 2WGJA 3OZ6A 4L7SA 5T6KA 3COKA 4ZJVA 2J5EA 3EMGA 2NO3A 5ANOA 3HMIA 2BKZA 3AD5A 4FA2A 3O2MA 5EHLA 2QOLA 3NS9A 4FIHA 5ICPA 3FZTA 5EQEA 3VJOA 5ANIA 5EW3A 5G1XA 2JDSA 4BDFA 5BYYA 2GFSA 3EFLA 4P5QA 2BRMA 4DH1A 5EK7A 4BWKA 4FOCA 4GIIA 3BIZA 4IVBA 4ZTMA 3EOCA 4K2RA 4TYGA 4KIKB 4MBLA 3QTUA 4DEGA 2JIVA 4XG8A 1A06A 4AT3A 3HP5A 4JLCA 5HI2A 4D5HA 3AD6A 5EG3A 3PXFA 2UZVA 3W0OA 4O21A 5DA3A 1W2FA 2ACXA 2Q83A 3FSFA 4K1BA 2EU9A 2G2HA 5FGKA 1GJOA 3KY2A 4L3LA 1P4FA 3VF9A 3AG9A 2W1IA 5CY3A 2V0DA 5K0KA 3NVMB 5CI7A 5CX9A 4BWXA 2X9EA 5CEPA 1GNGA 4IB5A 3QA0A 4FSYA 4EQMA 5L2QA 3IK3A 3Q9WA 1OIQA 2JIIA 5HTIA 2FSLX 3UOHA 3R8ZA 1CKJA 3QTIA 1PKGA 5IG1A 1XMMA 3MFUA 1V1KA 5BVEA 2QURA 4M8TA 2C0IA 2RGPA 2O8YA 4J1RA 4MD9E 4QYGA 5E92A 4TPTA 5AR5A 2ZJWA 4YR8A 3QXPA 3VNTA 4AXEA 4B8LA 3C4FA 3HDNA 4XP0A 4EK8A 1WVXA 2BHEA 4NW5A 2IG7A 2XNNA 3AC3A 4FV6A 3R7VA 3MJ1A 4DHZA 2E9PA 5ITAA 1PXPA 3MTLA 4C38A 4BRXA 4Y5QA 2UZTA 3BHVA 4ZY6A 2QC6A 2YDJA 3ZOSA 1K9AA 3ZO4A 5J1VA 3M1SA 1ZZ2A 4I6BA 4PMMA 1K2PA 1MQBA 2J0JA 3KXMA 4AA0A 1JSVA 5M57A 2HCKA 2JAMA 4GEOA 5H8BA 3WIKA 3IW7A 1JSTA 2JBPA 4FSZA 4XEYA 3QC9A 4IMYA 1J7LA 2VTTA 3NNXA 4RIOA 2FSOX 4ACCA 2XKEA 1JLUE 1H25A 3VUTA 4BJJB 2XK8A 2AC3A 4FK6A 3HEGA 1FPUA 4NM7A 1YWNA 2VTOA 4FT7A 4J98A 4EH6A 2CLXA 1BLXA 5BVKA 3VS7A 3IDBA 5HG7A 3CPCA 4IB3A 2OZOA 3TNIA 3KCFA 3AT4A 1BL7A 5IKWA 3FLWA 4R8QA 4I6LA 4FSUA 4RT7A 3NNUA 2C6LA 2G15A 2J0MB 3DT1A 3WI6A 4E6DA 4CQEA 3NAXA 2GS7A 3NVKI 2VRXA 2Z02A 3ALOA 3Q60A 4FKRA 3EQDA 4JBPA 4B99A 4C4GA 2EXEA 4F6SA 4PPAA 2VWIA 1Y6AA 4F9YA 1F3MC 2EXMA 5HIBA 3O8UA 1WBSA 1OPKA 2HWOA 3MJ2A 3NDMA 4O0XA 1Q8TA 5AAGA 3TDVA 2GNHA 3MY5A 3QZIA 3W0SA 3HV4A 3PWDA 4O91A 2YCQA 1MRVA 3VUKA 4KKGA 4O82A 1ZYJA 4FUYA 4QYEA 2VWZA 5EM6A 2XYUA 4NK9A 3D0EA 3SRVB 4ALVA 2JFMA 3HMPA 3R9NA 4EC8A 4GUEA 4AN3A 3R1SA 2W1DA 4DFUA 4FYNA 4F6UA 1Q99A 4FV7A 1YVJA 3C9WA 4R77A 2A19B 3DKOA 4Y8DA 3KF4A 2UW7A 4XH6A 4YTIA 3FLNC 2WQNA 4L43A 3T3VA 4JVGA 3G6GA 4DLJA 4FEUA 1P14A 3UBDA 5BVOA 1SMHA 4HGSA 5LARA 4MBJA 5EDRA 1Q24A 3WBLA 4YJSA 5L2SA 4RWIA 4Y83A 5KMMA 3I0OA 3EQPA 1V0OA 4JR3A 2UZDA 3JPVA 3RBWA 3KA0A 3PP0A 2PZRA 3EL7A 5J7BA 4XBRA 3BYVA 5CANA 1H26A 4QYFA 3UQFA 4EH2A 3QKKA 3FY0A 4L8MA 4TWPA 4HNFA 5A4EA 5L3AA 4QMXA 3O7LB 3PXKA 3SXRA 2J4ZA 4BI0A 4H3PA 5FWKK 4EEVA 4K6ZA 3RPVA 5HLWA 1A48A 2OJGA 4MQ2A 3EZVA 4LL5A 3ZFXA 3ROYA 4Z7HA 3UDTA 4KSQA 4U6RA 3TL8A 1OBGA 5D12A 4H58A 4LUEA 4C33A 3EFWA 2GS2A 4C35A 4ANQA 5LMKC 2I0HA 2OW3A 4MEDA 4HZSA 5DT4A 1H4LA 4FVPA 4DGOA 5KZIA 2R3QA 4E4MA 4E4XA 4KB8A 2UZEA 3FMNA 4YP8A 4XV1A 2CGUA 4D58A 5J79A 2BAQA 2QO2A 2WO6A 4N70A 4XHKB 5GHVA 4FKOA 2NRUA 3ROCA 4IZAA 3SXFA 3QRJA 1DAYA 1P4OA 4WG4A 4DGGA 2OG8A 3NCZA 3KXNA 5BYZA 4Y73A 1UKIA 2AC5A 2ESMA 3UC4A 3FXXA 4M84A 4M69B 2WELA 3KU2A 3PE2A 4F08A 1ZRZA 1WFCA 5CVFA 4IAYA 4JAJA 2QR7A 3TUDA 1UKHA 3OS3A 2XM9A 2UW8A 3GB2A 3IOPA 3MA3A 3OCSA 4H36A 4IZ5A 4RJ4A 3W16A 4GT4A 4QQ5A 4D2TA 4ZMEA 4U81A 5HO8A 1W98A 3W2SA 4D2WA 4AU8A 1PKDA 4CD0A 3FXZA 3VBTA 4IX4A 4IM2A 1DI8A 3R1QA 2E9NA 3ITZA 4U7ZA 3MVHA 3VS2A 4FICA 4O6LA 2W06A 3AMBA 2ZV9A 5K4JA 5DRDA 3VS4A 2HW7A 3P86A 4AT5A 5KBRA 3BEGA 4ZY4A 1H8FA 4FSNA 3EH9A 4D0WA 5A54A 2XUUA 4W4VA 3C0GA 4A9UA 4BI1A 5AR2A 4EHZA 3QQKA 3QD2B 4C4HA 1FQ1B 2WTDA 1YWVA 1ZXEA 2IPXA 4M14A 4QMOA 5CWZA 3ML1A 3EIDA 5LVNA 4HVDA 3H9RA 1M14A 1BUHA 5IH5A 4MBIA 5B7VA 2JGZA 4MNEA 2G1TA 5FP5A 5AWMA 4HOKA 4D2VA 4DFBA 1CDKA 3Q9YA 3RI1A 1FOTA 4TY1A 4JG8A 4KUJA 1PMEA 2V7OA 4EYJA 3KB7A 4RSSA 2UW5A 4OAVB 5IQEA 3S2PA 2C47A 4M0YA 3WIGA 2G01A 3WF9A 4I3ZA 3D2IA 3GCQA 1QL6A 2X8DA 5AUTA 2UV2A 3MIYA 3P4KA 4PTCA 5IU2A 2Z7SA 3HL7A 1Q8WA 3C5IA 3FI4A 2YDIA 4BBFA 5IEXA 4DBNA 5JFVA 4QQTA 3BQCA 3R04A 2BKKA 2C4GA 4BN1A 2XIYA 4RWJA 4ACGA 5FTGA 5ETFA 4QMUA 4GFOA 3I81A 1OB3A 4C62A 4JOAA 4LOPA 3TV4A 5M07A 2VO3A 4FKVA 1PXNA 4X6QC 1RDQE 1YXVA 1XH5A 5M51A 3DKCA 1XJDA 2X0PA 4F9AA 3CD3A 5EHOA 4IAAA 4QMYA 4FZ6A 2XIKA 4QRCA 4Z16A 1LP4A 4U8ZA 3HECA 1I44A 2EB3A 2IN6A 1JOWB 3EB0A 4X2GA 4YJNA 5CZHA 3DXNA 4CZYB 4S2ZA 4USFA 1U46A 3QUPA 3REPA 3QC4A 3W2CA 4O84A 4KBKA 2WMAA 1H01A 2YZAA 3PVBA 3DTWA 4O4CA 5ANDA 1YI6A 4C3FA 4KIOA 5T3QA 2YITA 4ASEA 4K11A 4RIWA 4AA4A 3UYSA 4AE6A 3WZUA 4YURA 1HOWA 1WCCA 1ZLTA 3EN6A 4OGRA 4RLKA 3DBFA 1ERKA 3BEAA 3G0EA 4M68A 4OTHA 5EW9A 3PXRA 2OH0E 3I6UA 3BE9A 3GEQA 2YAAA 3MPMA 4QEBA 4V0GB 5AUVA 2WQOA 4AOTA 4HCTA 1ATPE 5GJFA 4HVGA 2PZIA 3PA3A 3VBXA 3SVVA 4BF2A 4USDA 3SA0A 5FP6A 4DE4A 3OCBA 2FGIA 4EBWA 3SW7A 3PG1A 4BFMA 3DU8A 1Y8YA 3LLTA 5HGIA 3OTVA 5M09A 2R7IA 1Z5MA 3CJFA 3KL8A 3PPZA 4J53A 4DEEA 2V62A 3BL9A 3E62A 3LQ3A 4PTEA 1DS5A 2GHMA 4TYHA 2LGCA 4UBAA 1YDRE 3FMEA 4M0ZA 5E8TA 3O71A 4QP4A 1MRUA 2ITTA 2OIQA 3I7CA 3NW5A 4FNXA 4OTRA 4G6OA 3MH0A 3OXTA 4G16A 4GKIA 1LUFA 1J91A 5CU3A 3UO4A 5CSXA 2X1NA 3A60A 1I09A 3KXGA 3D7TA 5H9BA 3CTJA 4EONA 3PRFA 4UN0C 3BYOA 4F1TA 2P3GX 1H08A 4BZOA 3Q2JA 4IZYA 3ORIA 3UODA 1YOMA 3Q4CA 5HESA 5AMNA 4YBKA 3IW8A 3LFBA 4IBMA 4RJ7A 2BCJA 3GU6A 3W32A 3QCYA 4BVUA 5KO1A 2R3GA 3PUPA 4BGQA 2CNQA 3QTXA 3ZDIA 4H3BA 4OW8A 1H1PA 4I93A 5HTBA 4FTJA 4TXCA 3QUDA 2OIDA 4DHJA 3DK6A 3R1NA 3OEFX 5L8JA 4CVAA 3KCKA 2WTVA 4YHFA 3E92A 4FJVA 4DFXE 4AT4A 2QOOA 4TKSA 5JEBA 4Y46A 1VEBA 4ZSLA 4ZK5A 4ASXA 5KMKA 2B4SB 3H4JA 2FB8A 4ITJA 1KOAA 2ETRA 4XNEA 4FT9A 1K3AA 4QP8A 4ZLYA 4ZS0A 1KV2A 4BDIA 3GQLA 3QRUA 3IKAA 4IHPA 1YRPA 3TZ7A 4JT3A 5E90A 3W2OA 3AXWA 2WEVA 4GL9A 4JDHA 5FG8A 4P90A 2QHMA 4UYNA 1JKSA 3VULA 1BI8A 2YERA 1KV1A 3CR0A 5IQDA 3COIA 4O7RA 3S0OA 3KXXA 4O7LA 2VX1A 2ITUA 2P55A 3DQXA 5KKRC 1OECA 3ACKA 5H3QA 3MY0A 2R9SA 5LVPA 4ZTSA 3G6HA 2BRHA 4OT6A 3NFFB 2RF9A 3MW1A 4C4FA 3PP1A 1J1BA 5AAEA 5J5TA 3DFCB 5AADA 1NVSA 3OBGA 3S95A 1YHSA 3IDCA 4C2VA 4IADA 5JN2A 3TG1A 2WTWA 5IH6A 2VGOA 4GUBA 5AR4A 3UP2A 3DQWA 3EN7A 3EQRA 4EHGA 4EQCA 2QCSA 4LRJA 4M15A 5D41A 4AW1A 4MYGA 2X9FA 4K18A 2FVDA 3I5NA 2Q0NA 3Q6WA 2UVYA 4PL4A 4RVMA 4B7TA 3PJ8A 5B0XA 2F2CB 2XMYA 4DC2A 1OZ1A 2XALA 3O96A 3OCTA 4K9YA 3LMIA 5GIPE 3P7BA 2QR8A 2C5YA 3PLSA 4CT2A 1ZAOA 3U6JA 1W0XC 4DN5A 3M11A 4DDIA 3K3IA 3FKLA 4FKJA 4ACDA 1S9JA 2V7AA 3BBWA 3FMKA 3I4BA 4IACA 3VBYA 4PMSA 4MTAA 5E1SA 5KMIA 2XK3A 1YXSA 5AUUA 2ZB1A 4E6AA 4WRGA 3PZHA 3ORKA 4U41A 5K3YA 3MB6A 4R3RA 3VBQA 4L67A 4AZEA 4NFNA 3S3IA 2HIWA 2XK6A 3ZDUA 3F5UA 3HMNA 2XARA 1PY5A 2QO7A 3VW6A 3ATSA 2OBJA 4GVJA 3DK3A 5FEEA 4FOBA 5HCXA 5AEPA 1ZYCA 2B54A 3JVSA 3OOMA 4EOKA 4KA3A 5CNOA 2UW9A 1UV5A 3FQEA 4EHVA 1Q8ZA 1KOBA 3QTWA 1TQIA 1G8KA 3LJ0A 4L3JA 4L01A 3RPSA 2UZBA 3UG2A 4F0FA 5E8YA 2QI8A 2Z7LA 2GU8A 3F7ZA 1PHKA 2FA2A 1FBNA 2WMWA 2XZSA 2WAJA 2WOUA 3NUNA 3BU3A 3OVVA 2Y7JA 1H24A 2GSFA 1UU9A 4FKPA 2VTMA 2RG5A 3QUEA 5C03A 4B0GA 3DB6A 4MXZA 3AKKA 4E6CA 4EH7A 2GDOA 2Y4PA 4O1PA 2IW6A 2GNFA 4LRMA 4V01A 2A2AA 4O0SA 5E9EA 1UNGA 1UU3A 2E9VA 2W1HA 3FYJX 3PIXA 5DBXA 5HQ0A 4UY9A 4CTCA 2OF2A 3LXLA 4BDKA 3QCQA 5HLPA 2QHNA 4ZTLA 4DCAA 3DZOA 2XNPA 4R1YA 3RAWA 4ANNA 5BUIA 3FZ1A 3KMMA 3TACA 2PE1A 2OICA 3L8XA 4FIJA 3CQEA 4Y5HA 4E7WA 2XJ1A 4YJQA 3SOAA 2OXXA 3KRRA 1W2CA 5HIEA 3P1AA 4IWQA 4RWLA 3F5XA 2XJ2A 1NT2A 3ZBFA 3I79A 3W2PA 3WZJA 3EQCA 4EI4A 5FXSA 5AIRA 2C1AA 4DYMA 4FEWA 3R7UA 5TR6A 4IM3A 2OWBA 4BDGA 3FC1X 2W0JA 3BLRA 5LXMA 5ETIA 4EOLA 4AF3A 3BGQA 4EZ5A 2PULA 2YCFA 1LR4A 2XH5A 1YHVA 3CTQA 3P0MA 3ZUTA 4HCVA 5AX9A 3OXZA 3PDTA 3NEWA 4ZTRA 3F66A 5D7AA 5E8XA 1SNXA 3G2FA 2ZYBA 4UZDA 3KULB 3Q53A 3V5QA 4EZ7A 4PQNA 3AT3A 1TVOA 4FG9A 3V5PA 5JMSA 4C59A 2PYWA 4CG9A 2WKMA 4FVRA 4NEUA 3V5JA 4JMQA 5A6NA 4XG9A 4L42A 3RWPA 4GK3A 5E8VA 3Q3BA 4DEAA 5IUIA 1TQPA 5I5ZA 5IA1A 4N4SA 4BCGA 4FNWA 4JI9A 4F63A 1U54A 3AOXA 3E87A 3EFJA 3A7HA 4IFCA 3TTJA 4AOIA 4E4NA 3QWKA 5EQPA 4HPTE 4FZAB 4X2KA 4OUCA 2HK5A 5KMLA 5HO6A 4NKAA 3WZDA 2YIRA 4PL3A 4F65A 1J7UA 3TV6A 4J8NA 4XG6A 2CN5A 2OXYA 4FVQA 2XK7A 3ET7A 4OAUC 5H2UA 4JQ7A 4F7LA 2OJIA 3NUUA 2YM6A 3ZSIA 4FG8A 5IQFA 3FDNA 3CEKA 1M7QA 4L52A 4U79A 3VJNA 4Y85A 3OEZA 4LUDA 1Y8GA 3JS2A 3RPYA 2YIYA 3IECA 1KUTA