3FMMA

P38 kinase crystal structure in complex with ro6226
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
349
structure length
346
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
publication title P38 kinase crystal structure in complex with RO6226
rcsb
source organism Homo sapiens
total genus 113
structure length 346
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fmmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fmmA01
3H0YA 4PUZA 1FMOE 1W82A 3BLHA 4FNXA 4G3DA 4AGDA 5J9ZA 1WBPA 3GU5A 4RIYA 4DAWA 1SVHA 5HEZA 3MESA 3FLNC 5DR2A 4X2NA 3R28A 4HVDA 3ZLXA 2QO9A 5M53A 4L01A 1JNKA 3ZONA 3EHAA 3ALOA 3OCSA 4U42A 4BCGA 4C0TA 1BL6A 4FV4A 3CTQA 3P5KA 2HENA 4WNKA 3BU3A 5CNNA 3T9TA 4TN6A 4N4SA 2W1GA 5HE2A 4C4HA 4GK2A 4RA5A 4JQ7A 4O21A 2JKOA 1OM1A 4O7WA 2YWPA 3A7HA 4QP7A 3ZS5A 4ZAUA 4FG8A 1W0XC 3MV5A 3PLSA 5AV0A 4I6HA 4IEBA 3WIGA 4AW1A 1ZYCA 4AE9A 5EQPA 4M0ZA 2VO3A 4Z9LA 3W2CA 1SM2A 3BHUA 4BDAA 4CCUA 3Q2MA 3AQVA 4PL4A 1HCLA 3RBWA 4DEBA 2BZIB 3F3UA 5CU4A 4I3ZA 2UW8A 4GG5A 3ZYAA 3LQ3A 4IACA 4H05A 2BKZA 4O82A 4KIPA 4C62A 1WCCA 4BCKA 3DK7A 3GU6A 5EOBA 4CLJA 1JWHA 5J9YA 5FQDC 3COMA 3F88A 5DFPA 5FDXA 3HRFA 4WG4A 2JC6A 2BPMA 2I40A 2OJJA 3FC1X 3BCEA 2BUJA 4BI1A 4NEUA 4XRJA 1B38A 2V55A 4XBUA 4C3RA 1MP8A 1SVEA 4NJDA 4AGWA 4QPMA 4JRVA 3VQHA 3IK3A 1XH9A 3FL4A 3PXRA 2ITNA 3D7TB 3W8QA 2Y6MA 4DFZE 2W9FB 4QP2A 2GNIA 4A7CA 1UWJA 3D5VA 3QZIA 4RX8A 1NA7A 3OXIA 4QO9A 3W2SA 4BBMA 2YM3A 4K6ZA 3W8LA 4AA4A 4HVIA 5EI6A 3F9NA 1G5SA 1CSNA 3FV8A 2O5KA 3DA6A 3WF9A 4I41A 4AQCA 5L6PA 2CN5A 4IHPA 1XH4A 4FV7A 1Y6BA 2PMOX 3BKBA 2BFXA 4KIKB 4FIFA 4ZTSA 4EH9A 3AT3A 2JKQA 5D11A 3TJCA 3DS6A 4ASZA 4AWIA 3KCKA 3ROYA 5M44A 4FEWA 2ONLC 4LYNA 5IQIA 3CTJA 3TT0A 3WIKA 4WUAA 4PF4A 2C5XA 4QYYA 4BDDA 4CTBA 3PA4A 5L2TA 4QTBA 3GC0A 4L43A 5EYCA 4ZJJA 2GSFA 5M57A 4AE6A 1YHVA 4D9TA 2LGCA 4M13A 2OU7A 3VS2A 1FINA 4FK6A 3K2LA 2UUEA 4AW5A 5E91A 1RQQA 2QURA 4QTDA 4ZTMA 4U9AA 2JDRA 3R2YA 4Q9ZA 2DUVA 3G15A 3CGFA 1ZRZA 2EU9A 2ZB1A 4DGGA 4F6UA 3KK9A 4RJ8A 5KE0A 4HW7A 4P4CA 2BVAA 5DIAA 4D2SA 3P7BA 3PXZA 5CXZA 3AC8A 2WB8A 4XUFA 4Z16A 4MXCA 1MUOA 4OTRA 4XG2A 3V01A 3O96A 4EOOA 3DV3A 3E3PA 4JG8A 4TWNA 3JXWA 3VW6A 4O1PA 2WKMA 4M66A 4YBJA 3AD6A 3DU8A 5EW3A 4E5WA 2HXQA 4D0WA 2OKRA 4Y72A 2QKWB 2UZNA 5L8KA 2Z8CA 4NU1A 2XK7A 4ZZNA 2WMWA 3CS9A 4LMUA 3VS5A 3OWPA 3U8WA 3UNZA 3PJ1A 4ZY6A 2RKUA 4FX3A 3NW7A 4I6FA 3HRBA 3U54A 2ZMCA 3DBCA 3ZBXA 3IOKA 4HZRA 1ZYSA 3TZMA 1Y8GA 3DB8A 2WTCA 2GNJA 3PIYA 3QGYA 4XYFA 5DG5A 3RPOA 2R2PA 3UO4A 2YAKA 3ZUUA 2PUNA 1VYZA 4CSVA 2QOQA 1YOMA 4JL9A 2PZYA 3ZZEA 4HVSA 4F99A 4JIKA 4E5AX 5E4HA 3U6HA 3EFKA 5JT2A 2VZ6A 3ORKA 3S2PA 2HWPA 3PY3A 4TWOA 4O0WA 4W4WA 5JFSA 1GJOA 3R8VA 3ZFXA 4EC8A 5BVWA 4PMPA 5CF4A 2PVMA 3CD8A 3CPBA 3ATSA 5C8KA 2BRGA 3GUBA 2BMCA 3IGOA 5AA9A 1LEZA 3R7OA 3CGOA 2A2AA 3MH0A 4GK3A 2I0YA 4UMUA 3L8SA 2X4FA 4GH2A 2BALA 2BKKA 1PW2A 2Z2WA 4BTMA 3QTUA 1KOAA 2IZRA 3NYVA 4EWQA 3C9WA 2WTKB 2Z7RA 3FJQE 1APME 3D4QA 3ZLWA 2ACXA 4BI2A 1WBTA 3FY2A 4L6QA 3B8RA 4GKHA 2R3GA 4EH6A 3RPVA 4ARKA 1WVXA 2WPAA 4FSTA 3FLWA 2C5OA 1EH4A 5JFXA 2XKFA 2BRNA 4K77A 5EFQA 4QOXA 3AGMA 4C37A 2BAKA 2CMWA 2YHVA 1V0BA 3BGZA 3P7CA 4TKSA 4TXCA 2C5NA 2C6IA 1GZNA 2P2HA 2YCFA 3L9NA 5T3QA 4KD1A 4I20A 3I6UA 1B39A 2W9ZB 3F5GA 2R4BA 3VAPA 5JZJA 5A4QA 3TM0A 3N4UA 2PE2A 1OIUA 2XKEA 2RL5A 2XK6A 2PYWA 4YUQA 4AZFA 4YC3A 4OTHA 3EB0A 2F7XE 2YCSA 3D83A 2Y7JA 1W8CA 4W8DA 4WBBB 4R77A 2JDOA 3P0MA 1H24A 1IA8A 1OUYA 3LMIA 3MA6A 3L8PA 3BYVA 3CKXA 4K11A 4PRJA 1PYXA 2W1IA 2YABA 1KOBA 4GS6A 5FP6A 4DFNA 4IWQA 5HCZA 4MWHA 5CSPA 2IW9A 3F2NA 3VS3A 4O7TA 5DLSA 2R64A 3GOKA 1PXNA 4M84A 4F9AA 4F0IA 4ZTNA 1GY3A 1Q97A 4JBQA 2UZUE 1YXSA 2GHMA 3FMDA 4MXXA 4CFUA 4FTJA 1XBCA 4DA5A 4FVQA 4ACMA 4EBVA 5A9UA 5E8ZA 3VS1A 4F1MA 5IA1A 1I09A 4RC3A 3KULB 5C4LA 3F7WA 3TZ8A 4YPDA 3LMGA 3V5WA 3QLFA 1Y8YA 3QTIA 4ZXTA 3I4BA 1FMKA 4ZK5A 3RNIA 3LFNA 1GZKA 2W05A 2XBJA 3EN9A 4W4YA 4O7ZA 5LARA 5C8MA 5T68A 4EWHA 1JOWB 2JEDA 4KKHA 4QQCA 4XS2A 5EQYA 2SRCA 4FVRA 2VRXA 4HYSA 4NIFB 4D5HA 4BGHA 4BDJA 3PVBA 3KC3A 3NAYA 3RCJA 2C6MA 4U79A 5HG9A 3E92A 1A9UA 2HIWA 4AN9A 4WA9A 3O50A 3VS0A 2XRWA 3DAKA 4G3CA 4L9IA 2PUPA 1YDTE 4UBAA 5IQFA 3R1YA 4JQEA 3A2CA 3HMIA 5AR2A 3UMXA 4XMOA 3FZPA 1RJBA 3ZXTA 2X9FA 4F6SA 1M2RA 3FSKA 4BCOA 2R7IA 5I9XA 4IB5A 4A07A 2BAQA 3ZTXA 1BI8A 3DDQA 4MK0A 4LL5A 5E1SA 2X2KA 4DGMA 3QRJA 5M55A 2ITYA 2X6EA 3KRLA 2QD9A 3P1AA 2FUMA 3DNDA 4UB7A 3U9CA 5KCVA 2W1CA 3IOPA 4FKIA 3RGFA 3ULZA 5EQEA 2DQ7X 4BF2A 1GZ8A 1OKWA 3D7ZA 5HOAA 4ANLA 5B7VA 4I0TA 4D2TA 4DHFA 1XQZA 3FDNA 5IH5A 3TG1A 1WFCA 4IZ7A 5CVGA 2PMLX 4RFYA 3ZRMA 1LR4A 3FUPA 2XJ0A 4M0YA 2W17A 4F7SA 1UV5A 4BDEA 1TKIA 4C7TA 1VEBA 3S0OA 1LUFA 1PXMA 3D2KA 3DY7A 4ZLOA 4QNAA 1M17A 1PF8A 3KKVA 1VZOA 2BROA 3C50A 4RIXB 4HCVA 4X3FB 2XIXA 5TO8A 4N6YA 2CJMA 3SRVA 2B55A 3A7GA 1OPJA 2GCDA 5K4JA 3FKLA 4GMYA 1KE9A 3DTCA 4Z55A 3IGGA 3HV7A 1YWNA 3R1NA 4M12A 4ENYA 3O7LD 5DI1A 3PSDA 5FTQA 4FR4A 3PTGA 4M67A 4HGSA 2QOHA 3SVVA 3DAEA 3G90X 4M7IA 3GCVA 3QQLA 1OZ1A 2ETRA 4BI0A 2VO7A 3OS3A 3OTVA 4Y8DA 3DQWA 3PJ3A 3SV0A 4JOAA 5DWRA 4FTTA 5CAPA 5HG8A 2EXCX 1R78A 4AN2A 3EWHA 1BL7A 3NCGA 3PVGA 4Y83A 5M4CA 4BDBA 4JQ8A 1NVRA 4YU2A 4IXPA 2GQSA 4G6NA 3A61A 4DFXE 3QA0A 5IQBA 3PJ8A 2J0KA 4FSWA 5J1WA 3E5AA 3KXNA 1Q4LA 3R04A 4WIHA 3OWJA 1JBPE 2WTKC 4DC2A 5ETAA 2CNVA 2E9UA 3UO6A 3LJ1A 5AP7A 4Q5HA 4YNEA 4UZDA 2ITQA 2XK9A 4FEUA 4ANQA 2VGOA 2HYYA 1T46A 1R0PA 1P5EA 4CFFA 4RVMA 2WELA 3HMOA 2C6OA 1QPCA 2WOTA 3UOKA 4F0GA 4IVBA 2ZDTA 3OCBA 2J4ZA 3OW4A 3FEGA 1M7QA 5AM6A 5C27A 3W16A 1NW1A 4TPTA 1DAYA 1FVTA 2X2MA 5AP5A 4XV2A 5JEBA 1S9JA 4BIEA 4A06A 4C3PA 2X8DA 1CM8A 2UVXA 4FZAB 4LV5A 4N6ZA 3RK7A 4XV9A 4I21A 4RJ4A 4EORA 3CTHA 3QQFA 4M68A 3GBZA 4YLJA 5AX9A 5KZIA 3HRCA 3Q9XA 5AAGA 4BTFA 3A7JA 3EYHA 3G0EA 3VUDA 2HY0A 3ZRLA 3LJ2A 1WAKA 5AP3A 3GCPA 4QMQA 5LWMA 5TKDA 1Q99A 1PMEA 3ORXA 1GZOA 4KIQA 3QQJA 3OWKA 4FKTA 3SXFA 4FSMA 4IB1A 3PJ2A 5KMOA 2WQBA 1PMVA 4FICA 4Q9SA 3PPJA 4I5CA 2AC3A 2F7ZE 4CV8A 3BRBA 5DT4A 4BGGA 3VBQA 5L2QA 5HNGA 4BCHA 4YPSA 4JNWA 4C4EA 4TT7A 4LL0A 1Q62A 1H00A 2FSOX 1H0WA 3NUUA 4ZTQA 2XJ2A 5DHJA 4BDKA 4PL3A 1Y57A 2PUUA 5CVHA 4CD0A 2WGJA 2YZAA 3DOGA 4LUEA 4NTTA 4FV2A 3W2OA 3DLSA 1M14A 4FT9A 4NK9A 4NT4A 4HZSA 4OT5A 4YHJA 4YC8A 5AV4A 4FZDB 5F9EA 1REJA 4FTMA 4QYHA 4E5BA 3KGAA 4IB0A 4EH8A 5HNIX 3B2WA 4EH4A 1WVYA 3HDNA 4FV0A 4S31A 2OXDA 3MB6A 4CYJA 1ZZLA 4DGLC 2YFXA 3LVPA 3JY0A 2R3RA 2I1MA 4GUEA 3ORNA 2XZSA 3KF7A 4AT4A 3ZEPA 4L8MA 5M56A 4ALVA 3C5UA 3ZO3A 4JX7A 3CQUA 3KB7A 1YI6A 4FIHA 4DINA 2IG7A 5M07A 1OL5A 3BX5A 1V0OA 4BGQA 4IC7A 3FHIA 2F49A 4OBQA 1K3AA 4UALA 4LQMA 4L46A 3BHHA 4NUSA 1H8FA 3BHTA 4Z7GA 3BI6A 3CE3A 2OF2A 3OMVA 4OT6A 4TYEA 3QQKA 2X8IA 4YLKA 3KK8A 4JG7A 4O7VA 2X4ZA 4ZTHA 3ZUTA 3RALA 2W4OA 1U4DA 4D2RA 2R3KA 3Q04A 2YWVA 3OTUA 4G6LA 3A62A 2YCQA 4KINA 5CSWA 1KE5A 4FTUA 4K1BA 4H36A 4XG9A 4KAOA 2PVYA 3BYMA 2FVDA 2VWBA 4LOOA 3V8SA 3ZC6A 2PPQA 3F3ZA 4X2FA 4QRCA 4QTCA 3HECA 3L9LA 3MVHA 3C1XA 2E9VA 3D14A 5HE0A 4YSJA 4KKEA 5DR9A 4M14A 4X3FC 3LCTA 3CY2A 3OCGA 1WBWA 3FAAA 1IR3A 2VNWA 2AYPA 3AG9A 5BX0A 3ERKA 4ZTRA 4AXAA 4F08A 5AV1A 1TQMA 4IIRA 3PFQA 5FRIA 4H1JA 3RTPA 3GQIA 3R2BA 3R7YA 1ND4A 4BBEA 5HKMA 5AUVA 4BCQA 4D2PA 4EHVA 4DG0E 1NY3A 1YHSA 4QPAA 2QHMA 1GIJA 3DFCB 3M2WA 3PZEA 4GL9A 4ERKA 1CKJA 3DFAA 2IVTA 5BMMA 1O6YA 2XIRA 3FI3A 3NNXA 4ID7A 5E8UA 1KV1A 3ORIA 4BFMA 1JKLA 2WMSA 5KX8A 2QOFA 4D4VA 3QUPA 4FKSA 2QR7A 3BYUA 1OMWA 4JDIA 3JY9A 4AA0A 3SA0A 4XLIA 2PVLA 3DPKA 3TIZA 3MH3A 2WMVA 4LRKA 3MFUA 4NM5A 3D0EA 5IEYA 4EH7A 1ATPE 4NKAA 3AD4A 5CNOA 2RSVA 4KA3A 4UZHA 3WF6A 3QUEA 5I3RA 5ANOA 1W84A 4MBLA 5I9WA 3NS9A 4XEYA 3MH2A 3OUNB 3VJNA 3HV5A 1OL6A 2WQNA 5H8GA 2X39A 2YIQA 3QYWA 4ZS0A 3UVQA 4NFNA 2BIKB 2EWAA 3MBLA 4RZWA 5GJGA 3EJ1A 2F2UA 4UN0C 4X21A 4CVAA 4D4YA 4II5A 1ZMUA 1PY5A 4DEEA 3VJOA 3O71A 4R7IA 3FMMA 5J9LA 2PVRA 3RAKA 4MQ1A 3BU5A 3EKKA 2QKRA 3Q60A 4AAAA 3EQFA 3EOCA 2YIRA 3IW5A 2IZSA 3EZVA 4J95A 4G1WA 4YTFA 2ZB0A 4FSYA 3HYHA 3BYOA 3FPMA 5B0XA 4F7LA 2C30A 3NWWA 3DBQA 2RFEA 4XG7A 5DYJA 4FKJA 1YDSE 4FTQA 4CMOA 4O0XA 1FOTA 4XG6A 2JGZA 4YR8A 1OKZA 2Y4PA 5DNRA 4C57A 2ZAZA 4QMPA 4YJTA 5HLNA 4IM2A 4ANSA 3KVWA 4QMVA 1H1PA 4MAOA 2VTIA 5AP2A 1FVRA 5IU2A 2GNHA 3TEIA 4FGBA 4TTHB 5CEOA 2C0OA 2BDFA 5IA3A 3E64A 1Q8UA 3LXPA 5IUGA 2YEXA 3UZTA 2QCSA 5I9UA 4IX5A 5KMNA 1H0VA 4ZIMA 4IADA 1BYGA 3QD4A 1DAWA 4JR7A 5FBNC 4MF1A 5IDPA 2NPQA 4BYIA 4YNOA 5A6OA 2CPKE 3P23A 3BGQA 4OBPA 3WYXA 1R3CA 4PTCA 4AFJA 3EMGA 3ZXZA 3W2QA 3MFSA 1H27A 4OR5A 4UWCA 4JT3A 4JVGA 3EQPA 3NMUF 4UMQA 3R7IA 5LMKA 3W55A 4JAIA 2FSLX 2XA4A 2Y4IC 4KBAA 3FLQA 2E9OA 5EW8A 5I0BA 4ZZOA 1YKRA 4YLLA 3DKOA 4FK3A 4H39A 4ITHA 2UZBA 4W4XA 3ZZWA 4EKLA 2ZJWA 1Z57A 3HMMA 3KA0A 3TXOA 4CQEA 4F4PA 2W06A 3LFAA 2UZVA 2B9FA 4WSYA 4FNZA 2OH4A 3FQEA 4IX4A 4J8NA 3S3IA 3Q6UA 3TV4A 2GS2A 3V6RA 4XH6A 3ENMA 1YWVA 4MD7E 4EK3A 2HXLA 3MJ1A 3OXTA 1OIRA 2YDKA 4BDFA 3H9OA 4RWIA 1XO2B 3MH1A 3FPQA 4FODA 5JGAA 4GKIA 2VTOA 2A27A 4J98A 5J87A 5CEQA 2JKMA 4ITJA 2Y6OA 2QHNA 5B2LA 4FV8A 4DBXA 3A99A 1ZWSA 3MN3A 2YIWA 4DTBA 3SW4A 4JDHA 3E8CA 4MVFA 1STCE 2P55A 3BIZA 5EDPA 3PDTA 4DF3A 2JD5A 5CXHA 3GI3A 3K54A 4E4XA 3BBTB 5H2UA 5AJQA 3CQWA 2ZM4A 3D5XA 5I4NA 3G9LX 4CMUA 2A19B 2I6LA 1M7NA 4ZSLA 1VR2A 3MIAA 4TW9A 3IW7A 4HVHA 4U45A 4GUBA 4E7WA 4EHEA 4I0RA 3F82A 4AOJA 2GNFA 3BQCA 1P14A 2XNMA 5BPYA 5M4IA 3MS9A 2QONA 2ZMDA 2WQEA 4ZSJA 2JDTA 5HIBA 3QCSA 2XUUA 3MGYA 3O51A 3AC2A 3EQIA 4APCA 5HG5A 2J50A 1X8BA 3ORLA 3WZDA 1FGKA 5JQ5A 5CU0A 1JSTA 1BLXA 5HORA 3VBXA 4QP3A 4O0RA 4BWXA 1Q8WA 2W4KA 4ZMFA 2W1ZA 3NUPA 2YACA 2NNWB 1ZZ2A 3EKNA 4FOCA 4R5SA 2G2HA 1GIHA 2X1NA 3IW6A 3HL7A 4WD5A 2Y0AA 2XIYA 3AMYA 3Q9WA 2J0MB 4O7YA 2QR8A 5GIPE 4TRLA 5AEPA 2EUFB 2GFCA 5BUEA 2OZAB 4IE9A 1JQHA 2JLDA 2G2FA 2YISA 3Q3BA 4RFZA 4XHKB 4CRLA 5JFVA 3ET7A 5TE0A 1OKYA 3SHEA 3KXZA 3F66A 4F9CA 5GIOE 5HO8A 2XNPA 3I0QA 2OIQA 5AAFA 2ZM1A 1QMZA 2BRMA 2BZHB 3JVRA 4LMNA 4RVTA 1BUHA 4FUYA 3PRIA 3AD5A 4BCIA 2OWBA 1KE7A 3O17A 3SX9A 4FTOA 5CX9A 4BYJA 5J5SA 1UKHA 2UV2A 5FTOA 4NFMA 4L3JA 1H1WA 3UOLA 4CFXA 4ZEGA 2AUHA 5JMSA 4WSQA 1CDKA 2CGVA 3R0TA 4TZRA 4WG5A 4ZZMA 3GCQA 3NYNA 4FKUA 4CT1A 5J1VA 2KULA 2XEYA 5CU6A 3GFWA 1UNGA 1ERKA 3R9DA 4EI4A 5LCKA 4QT1A 3C0IA 2O63A 4EONA 4CTCA 4YURA 2J0JA 3V04A 4BHNA 2C1AA 4DH1A 4QYFA 4F63A 4G3EA 4RWKA 2XB7A 2XNNA 3AT2A 3KF4A 1WMKA 3VHKA 3PA5A 4O0TA 2IVUA 2OH0E 5CYIA 3LAUA 5DMZA 3QTWA 2WTVA 5K4IA 5KMLA 3GB2A 5BYLA 3W32A 1MRYA 2REIA 4RX7A 2JBOA 2W5BA 2VX3A 3VS4A 1OIQA 2B4SB 2C6DA 1IEPA 3TIYA 3Q5ZA 4AUAA 2XK4A 3C7QA 3TNPC 3VBVA 3FZTA 4R7HA 4AG8A 4EJ7A 1MRUA 4E26A 3D2IA 3F3TA 4DTAA 5CQUA 4O7LA 4R5YA 5C01A 2OG8A 4MXZA 2J0LA 3LCSA 2OW3A 4MNFA 5ETCA 2BAJA 3FLZA 4XP3A 4L00A 2YITA 4MNEB 4R6VA 4D9UA 3WF8A 2HZIA 2B53A 4EUUA 3Q32A 5DN3A 3QLGA 4CGAA 1E1VA 2Q83A 2ITWA 2ERZE 1YHWA 4XJ0A 3RK9A 4S34A 5AUTA 4FZ7A 2C47A 4PPBA 4KIOA 3HP2A 4C33A 4EC9A 4ERWA 4OAUC 1J7LA 4K2RA 1JVPP 4IWDA 3RKBA 4MXOA 2ZV7A 3COIA 4P2KA 3RNYA 4AACA 4CFWA 3NUXA 4ZP5A 4DEAA 2ONLA 2X81A 4R1YA 4JX3A 3MB7A 4FI1A 1J3HA 3KU2A 3MYGA 5EK7A 5ANEA 5GZ9A 3PE2A 3QD0A 3NRMA 3QRIA 3QGWA 2FGIA 3K5VA 4RVKA 1AGWA 3FMEA 3FL5A 4XBRA 5D10A 5DVRA 1XH7A 4FSZA 4EOKA 3RAHA 1OPLA 4QMMA 4QMTA 2GPHA 2PWLA 2BZJA 3GCUA 2J5FA 4FOBA 4G31A 4K9YA 1V1KA 4FSQA 3ZEWA 3DQXA 2O64A 1YI3A 1VJYA 3QZFA 3ZDIA 2C5VA 5CASA 2VX0A 2VN9A 4O0YA 3OZ6A 4KNBA 1M2PA 3TUBA 4FV5A 2WMRA 3ANQA 4BVUA 3UIXA 4D55A 3OEZA 3SW7A 3NDMA 4PDPA 4U40A 1U54A 3F5XA 4WRSA 3DBDA 3FMJA 2IVSA 3R00A 3DBEA 5K0XA 3RZFA 2BR1A 2CNUA 4BN1A 4GIIA 3TNWA 3QRUA 3D5UA 3JYAA 4LGGA 4USDA 3FZ1A 4C4GA 3IW8A 3DDPA 3WZJA 4Z7HA 5M09A 1WBOA 2R3NA 5HO6A 4RMZA 4KWPA 5L2WA 4FE2A 2EVAA 4P7EA 2H34A 3OF0A 5EM7A 2OIDA 3NUSA 4OTFA 3ORZA 5AADA 4FZ6A 3UYTA 3ACKA 1YVJA 1MQBA 2C69A 3EQBA 3HKOA 2PVKA 5L6OA 4MXYA 1OL2A 2UZWE 2EXMA 3IDCA 4Y46A 1SVGA 2R3IA 3PIZA 5FEQA 4CZTA 5DR6A 3LLAA 4ORKA 4CNHA 2UVYA 3QUDA 3SAYA 3D15A 3ZOSA 2HY81 3U9NA 2OZOA 3E7OA 1XWSA 3ODZX 4HJOA 4H58A 5H3QA 4EH3A 3ETAA 1G8AA 2G2IA 2VTJA 5IZFA 4C36A 4RJ7A 5DOSA 3LOKA 4D28A 4TWPA 1URCA 3H10A 1LP4A 2O8YA 3R7GA 4AZEA 4EQUA 3MA3A 4NW6A 3E62A 4FYOA 5D41A 2UW5A 4YZDA 4G34A 3LCKA 5ANDA 4QNYA 1CMKE 2FH9A 3JVSA 3GGFA 2GS7A 4QYEA 3FQHA 3LFFA 4S32A 3UE4A 2CKPA 3DZQA 2QQ7A 3LQ8A 3VRYA 4AP7A 4WNMA 3KXGA 1ZMWA 4FV6A 4MCVA 2WMUA 4XV1A 1K2PA 5EYKA 3F69A 4OBOA 2E2BA 5CLPA 4D0XA 3SG9A 5CAVA 3Q6WA 4DT9A 3PLAE 1DI8A 2R3JA 4FC0A 3SXRA 3OXZA 5HCYA 5TF9A 4RQVA 3R7EA 3F7ZA 4D2WA 2OI4X 2Z7SA 4I92A 2OBJA 2WNTA 3KFAA 3QTSA 5DH3A 2NO3A 4IVDA 4S30A 5EYMA 2I7QA 3QCXA 4GV1A 5B2MA 1UVRA 4O0VA 4PV0A 3T8OA 1Q3DA 1Q3WA 2IW8A 3UP2A 4UX9A 3POOA 4NCTC 3A7FA 4ONAA 3VN9A 1UA2A 2VNYA 4M97A 3II5A 2VTRA 4DEDA 2CCIA 3GC8A 4QP9A 5H9BA 3KRXA 3L1SA 3C0HA 1WBSA 2YLFA 3OY3A 5HO7A 3QC4A 3ENHA 3K5UA 5DBXA 4I93A 4CKRA 3E87A 4J1RA 4XP2A 3D7TA 1PHKA 4L68A 3OROA 2EXEA 5GJFA 5FM2A 4TNBA 5ANGA 5FXRA 5JGBA 4O86A 3KN6A 3HNGA 5ITAA 1IA9A 3I7CA 4JS8A 4J99A 4XX9A 4RX9A 3HLLA 3QHWA 4BBFA 3HAVA 3C4FA 4BDCA 4RBLA 2CLXA 5KKRB 5CVFA 3V8TA 4C02A 5F95A 2XMYA 4C35A 1NVQA 1REKA 2VWZA 2XBAA 2P2IA 2CSNA 2XYNA 3R22A 4D1XA 4EYMA 4I6QA 5JN2A 5LVMA 3UQGA 3V8WA 1MQ4A 3RM6A 3Q9YA 5HTCA 3NVMB 3NIEA 3NEWA 2RFDA 3V5QA 4RJ3A 3ZCLA 3ITZA 3VNTA 5E8TA 5A3XA 3GP0A 4IANA 4WT6A 3OBGA 3F61A 2X7GA 4RJ6A 1KE8A 4JBPA 4A4XA 2PZPA 2PHKA 2JDSA 3DCVA 3WZUA 2FYSA 5HVKA 1Y6AA 2X7FA 3Q96A 4UMTA 3VUTA 5LQFA 2F4JA 3IDPA 5E7RA 5GZ8A 2XM8A 3BQRA 5AIRA 2WU6A 3VO3A 2XNOA 5M51A 4IZ5A 5FBOA 3ZU7A 3RINA 1OPKA 4CZUA 3Q5IA 1XBBA 1KE6A 2R0IA 4PY1A 4ACDA 1SNUA 1Q5KA 2YJSA 3FKNA 3L9PA 4MYGA 4RVLA 5JK3A 4L7SA 4E6AA 3I60A 1ZOHA 3MY0A 5ICPA 4BTJA 3RHXA 4C59A 2VTLA 3QTZA 3UODA 5FEEA 5HBEA 4FKLA 1H08A 5BUIA 4PPAA 5DRBA 2GHGA 3QTQA 3R1SA 4QMLA 3G51A 3EFLA 3WF7A 4F0FA 1GOLA 2ITVA 3LFCA 1ZMVA 2PVNA 4D5KA 4UWBA 5M4UA 2BRBA 2X2LA 3FYKX 3BPRA 2GU8A 1XR1A 4DN5A 3A60A 3ZFYA 2R3MA 2XCHA 5IISA 3AT4A 1Q24A 5HE1A 4JDKA 4D2VA 3LXLA 4IB3A 4MWIA 3PWDA 5AV3A 4BZNA 2PY3A 4H1MA 4R3RA 4CRSA 5HLPA 4V0GA 3G6HA 3BELA 3UPXA 2RG6A 3WYYA 3R30A 3AOXA 2V0DA 3UTOA 5LJJA 3C4XA 1HCKA 4V04A 2WTDA 3LE6A 3RP9A 3UGCA 4FSUA 3ZO4A 4CV9A 1U5RA 4PWNA 4RWLA 5HVJA 3MWUA 3NPCA 2GMXA 2V7AA 3O8PA 4ACCA 2I0EA 4MD8E 5A4LA 3DXNA 3OOMA 2ITUA 1UU3A 1IASA 2XIKA 2PZIA 3OHTA 4HGTA 3FXZA 1WBNA 3P78A 3QFVA 3TUCA 2J51A 3I81A 5LCJA 4FTAA 4MX9A 2VWWA 3PUPA 4PMMA 5IA2A 3HA8A 4LUDA 4U41A 5D7AA 2XS0A 2OICA 2UW7A 3Q4ZA 2YM4A 3NNVA 3RMFA 4LGDA 3U87A 4GFGA 4AOIA 3CY3A 3S4QA 2BHEA 3UMWA 3QC9A 3W33A 1PXJA 2PE0A 5E90A 3TN8A 3Q4TA 4BWPA 2ZYBA 4HYHA 5K0KA 3KVXA 1PXIA 4FEQA 4AGCA 2HCKA 4IW0A 5HE3A 3CD3A 1JLUE 3BE2A 2XEZA 4ACGA 5IUIA 2V7OA 2R3LA 3E63A 2WTIA 3NSZA 4EK5A 5HTIA 3KRJA 5K5XA 3CSVA 3HAMA 2PMIA 4LI5A 5EHYA 2QNJA 3OEFX 4JAJA 2YN8A 4AN3A 3AC1A 1WBVA 1ZYLA 1JSVA 3P86A 5E9EA 1J7IA 4LRJA 4UXQA 3QTXA 1OECA 5JRSA 4EOSA 3BE9A 4L3PA 3HDMA 3TKHA 1OIYA 2XNEA 3CCNA 5EW9A 3VUIA 2WOUA 4B4LA 3S00A 3ZMMA 4G5PA 3ZHPC 2Y8OA 4E73A 3Q4CA 4EHZA 5LVPA 3C13A 3NVKI 4YZBA 3QRTA 4DEGA 4NYEA 3LCDA 3PXFA 3R02A 1B6CB 2KTYA 4YJPA 2XIZA 4IWPA 5DE2A 4O38A 3NUNA 1JKKA 4R1VA 4FL3A 2R7BA 5EI2A 4B6LA 4G3GA 4L53A 4I94A 3TZ7A 4EK6A 5FEDA 4FV9A 3PXKA 4GT5A 3PG3A 2JITA 3EQDA 5C8NA 2JBPA 2W96B 2Z7QA 5EKOA 4B9DA 3LPBA 2WMAA 4FIGA 3UBDA 4RIYB 5IH6A 4IBMA 3KEXA 2HW7A 5JFWA 5KUPA 2IW6A 5EH0A 4XRLA 5CANA 3HZTA 3PWYA 3TTIA 4BKJA 3MW1A 2B9JA 2BTSA 2W1EA 4UYAA 3RCDA 3FQSA 3KULA 3E8EA 4FTIA 4AT3A 2GTMA 4J97A 2B9IA 4E6DA 4IAYA 3H0ZA 1G8SA 2R5TA 2ZV9A 4QD6A 4QP6A 3HX4A 4L45A 4FKOA 4DH3A 2C3JA 4W8EA 4EZ5A 4YJNA 3V5JA 1PMNA 2XKCA 5HX8A 1YXUA 3OWLA 4O81A 4DE4A 5A4TA 4TWCA 4QMXA 4FIEA 4HNFA 1GAGA 3SLSA 3BYSA 2G1TA 3COKA 2YJRA 4GYIA 3SGCA 5I9ZA 5AM7A 3NYXA 5DT3A 4GRBA 4EOJA 4HCUA 4XLVA 3LXKA 4JBOA 1PXPA 1Q8ZA 4LFIA 1ZXEA 1GNGA 3DGKA 4M15A 4E6QA 3C0GA 4J8MA 4C2WA 4DFLA 4YO4A 3DZOA 5DRDA 2A4LA 4NM0A 5HD4A 3QHRA 5BMSA 4AZTA 3BZ3A 3QXOA 4QMYA 2CKQA 4CG8A 4F64A 3VF9A 5IQHA 2W0JA 4DG2E 5AR5A 1XH6A 4ALUA 1H4LA 5IA4A 3FXWA 4UMRA 3TDWA 2J2IB 3FXXA 4NKSA 1W98A 3DTWA 4DGNA 1F5QA 2DYLA 1ZYJA 4X2KA 5EM8A 2HAKA 3VS6A 5KO1A 4BCFA 3SOAA 2VWXA 3TCPA 4CFMA 3IS5A 4TNDA 4RLLA 1H1QA 2PU8A 2CGWA 3HGKA 1YOJA 4FYNA 4WRGA 1MRVA 1ZY5A 3QZHA 4FIJA 3V3VA 4Z3VA 2PULA 4USFA 5JH6A 4YTIA 5HICA 3AC5A 4UV0A 4BCNA 2WHBA 4U6RA 3BHYA 4KS8A 4JG6A 1T45A 5CENA 4C58A 5L2IA 3MDYA 2YIXA 5K9IA 2YZLA 2UZOA 3MI9A 4RIXA 5JZNA 4X3FA 4YP8A 3ZSGA 1W83A 3IKAA 2YIYA 2ITXA 4GT3A 4RC2A 4RZVA 2OO8X 3QQGA 3KMWA 4A4OA 5LVNA 5HTBA 5HZNA 2RFNA 3AMAA 4FIIA 2R3FA 5E1EA 3ORMA 3CC6A 4IWOA 2QG5A 3NZ0A 5HHWA 5ACKA 2VTQA 5TT7A 2ZV2A 4YTCA 3LFQA 3W2RA 3KY2A 2A1AB 3O2MA 4D4SA 5KMJA 3MJ2A 2CHLA 4IQ6A 4QYGA 3EIDA 4O83A 4LOQA 2C6KA 2ITTA 4OTGA 3RZBA 3FKOA 4YTHA 1YOLA 2XCKA 4S2ZA 4V01A 3DLZA 1F3MC 4AZVA 3Q52A 2BZKB 4ALWA 4WOVA 1G3NA 5IQDA 5CEIA 5DGZA 5AWMA 3L9MA 5AR3A 2OJFE 2WAJA 3DJ6A 3GU7A 3MTLA 1K9AA 3MVJA 4CMTA 5HVYA 3LM0A 4IDTA 1LPUA 2LAVA 3UDBA 4AOTA 3DB6A 4KSPA 4ANOA 2CGXA 4JR3A 4IAFA 5CZIA 3THBA 4Y95A 5TR6A 2XRUA 3NCZA 3QD2B 2NRUA 4GU6A 2NP8A 3EQHA 4NJ3A 3GC7A 3JUHA 3F2RA 2GFSA 3UC3A 4I0SA 1NXKA 3FC2A 5LWNA 1KV2A 2ESMA 3VBTA 3G6GA 4BZDA 4F1TA 1Q8YA 2IZTA 4QMZA 5CSXA 2WIHA 3QZGA 4IAAA 5HGIA 3KXHA 3P79A 3V6SA 4G17A 4YZMA 3ZBFA 3U4WA 2EB3A 3A4OX 1R39A 4XV3A 3QCQA 1PXKA 4R8QA 3G2FA 3VRZA 4GYGA 3PRFA 4KRDA 4QMWA 3ZM9A 3QF9A 1O9UA 3PP1A 3DAJA 3LW0A 4AFEA 3HMPA 4Y5QA 1Q8TA 3GOPA 5KBRA 1JAMA 5J8IA 4ZSAA 3VUHA 4RWJA 1YXTA 4J53A 4D58A 3FY0A 4PQNA 3C4EA 1WVWA 5D1JA 5EDQA 2HZ0A 4FKPA 4LV8A 3ZO2A 4FKQA 3SG8A 4C61A 4YJSA 5D12A 4BKYA 1LEWA 2XKDA 4P5ZA 4HNIA 4HPTE 4IZAA 1A06A 4KBCA 5ETIA 3EFWA 4GFMA 3E8DA 4FTLA 3GU4A 4XOYA 2RGPA 4O84A 1H07A 4C8BA 2UZEA 3LFBA 3HEGA 4X6RA 1OL7A 4EH2A 4P90A 3R73A 4U8ZA 4E4LA 4XG3A 2BHHA 5AUUA 2H8HA 2YLEA 3QRKA 3ODYX 5CQWA 1IAJA 2C68A 3KL8A 1YWRA 3KXXA 4KKGA 3V5LA 2G9XA 2PK9A 2ZDUA 2VV9A 3CKWA 2QOBA 3WZEA 4BDGA 4RA4A 4FT7A 4I5HA 2ZOQA 1OBDA 1PKGA 3QCYA 5JSMA 2VTMA 3I6WA 1Y91A 1Z5MA 3E93A 5CAOA 4HYIA 3WBLA 3JS2A 5CT7A 3CR0A 4KABA 4WNOA 3MFTA 5H8BA 4U3YA 3B8QA 5HIDA 3R01A 3GC9A 4O91A 3EH9A 3ZO1A 4U44A 5A54A 2ZV8A 5BYYA 4HOKA 4OUCA 1OGUA 3OD6X 2C4GA 4M3QA 5FM3A 5L8LA 2B0QA 2ITOA 3CXWA 4KB8A 5IQAA 4DH8A 4I4EA 5BVEA 3RWPA 4F7JA 1CKPA 2B1PA 4TYJA 5F94A 3SDJA 3KREA 2YAAA 2R0UA 3NAXA 4G16A 4G6OA 3TV7A 4BRXA 3NUYA 1IG1A 5GINE 3M1SA 3GCSA 1V0PA 3PXQA 4QQTA 1XKKA 3BV3A 5ANKA 2WMTA 3RAWA 4JJRA 3G5DA 3QA8A 4FTRA 1OI9A 4F09A 3QWKA 2WIPA 3IONA 5C03A 3MFRA 3VQUA 4U0IA 5EKNA 4X0MA 5JGDA 4JIAA 3WILA 3WZKA 2VO6A 2BCJA 2P4IA 5IEXA 2CNQA 4YMJA 2OJGA 4O22A 2R3OA 4A9TA 4D1SA 1P4FA 2GNLA 5HX6A 1A48A 1RW8A 1YRPA 2VAGA 4OW8A 4PP7A 3KRRA 2GNGA 3FLSA 3ZLSA 2JIVA 2GTNA 4AA5A 3R8UA 4YJQA 1YXVA 3R7VA 4KBKA 2UVZA 4JI9A 4YBKA 3UQCA 5IQGA 3UO5A 2ERKA 4X2GA 5I9VA 2F9GA 5J7BA 2QU6A 3EQRA 2Q0NA 2CN8A 3R21A 4L67A 4YSMA 4CXAA 4FUXA 4RIWA 3RAIA 3VC4A 1XH5A 4HYUA 5KHWA 5L6WL 3W1FA 4O1OA 5HQ0A 1URWA 2XVDA 4FF8A 4PDOA 3DK3A 2H6DA 5FLFA 3OY1A 3R8LA 4L7FA 3TZ9A 2V22A 3BEGA 4G9RA 4RSSA 4LOPA 2C0IA 3LMHA 2UW6A 5C9CA 4I1ZA 2B54A 4ZLYA 3HVCA 3BBWA 1ZOEA 4RT7A 2QG7A 4I5MA 2QLUA 5LMAA 4HPUE 4LM5A 3GENA 1O6LA 3LIJA 3OVVA 5FGKA 4WUNA 3G33A 3FWQA 2PZ5A 4FGRA 4EQCA 2W4JA 3E3BX 3PG1A 4MHAA 5CU3A 3VW8A 2Q0BA 2WEIA 2W1HA 3R1QA 3QKKA 4IZYA 5CAQA 3FMNA 2PSQA 1KUTA 3R9RA 3HP5A 1BKXA 4QTEA 2YDIA 3QQUA 1UNLA 2W99B 4YGAA 2ZM3A 5EDRA 4YHFA 3FHRA 2IVVA 3ORPA 4FNWA 4IDVA 3FI4A 4CKIA 5GNKA 1XHAA 4M69A 2O2UA 2QOLA 2PE1A 3PP0A 3QD3A 5E8WA 2JFLA 3OP5A 4DFBA 4ZS4A 3SRVB 2V62A 2F7EE 3OFMA 3QKLA 3ULIA 4BHZA 4O7NA 3MTFA 4Y5HA 3DNEA 4RG0A 3WE8A 4IJPA 2BFYA 2F2CB 2G15A 4WKQA 3ZSHA 4XCUA 5CS6A 4EUTA 3A4PA 4WNPA 3E8NA 4TY1A 4QP4A 4XG4A 3ZUVA 4OTQA 1PRYA 2C6EA 4G3FA 2VTNA 4O2ZA 4FV1A 3UPZA 4D1ZA 1I44A 4U80A 2RG5A 3OUKA 4UXLA 4YZ9A 4AZSA 4BB4A 1QCFA 2YM7A 2F57A 4FBXA 3LLTA 3ELJA 4TYHA 4AW0A 3NGAA 3W10A 3DK6A 5CEMA 2WMBA 4FNYA 2HZ4A 4OTWA 2QC6A 3HUBA 2QLQA 3P7AA 4JRNA 4NW5A 2W1DA 3EFJA 3NIZA 2JDVA 3R8PA 1H1RA 3HA6A 3ZC5A 3ZRKA 4IM3A 3ANRA 3M42A 5AAEA 1PXOA 4EOMA 4S33A 2C3LA 5CZHA 5F1ZA 3JPVA 1FQ1B 2HELA 3EN5A 5AR4A 4GEOA 3BEAA 3FZSA 3MIYA 4QTAA 4V0GB 3NYOA 5IUHA 5EOLA 5EYDA 5L4QA 4RFMA 3T3VA 4DCEA 3AC3A 1R1WA 3PJCA 3TI1A 4PL5A 5BNJA 3TL8A 2XM9A 4QP1A 2HW6A 3ORTA 5EHLA 4MKCA 2VWIA 2XNGA 2J6MA 4G2FA 1Q41A 2BTRA 3QX2A 5GHVA 5CAUA 3REPA 1JSUA 5E92A 4F6WA 4JDJA 2GHLA 1OVEA 3QXPA 4FG7A 5CF5A 2JAVA 2YCRA 2QOCA 4X2JA 5GZAA 2VU3A 5C26A 1CTPE 2QO7A 3TDVA 3QYZA 3CLYA 3H9RA 2DS1A 4WO5A 3C51A 3KMUA 4X3JA 3IW4A 4GIHA 2O65A 4PMSA 3VVHA 2J90A 3K3IA 4EEVA 5L8JA 3ZDUA 4FKRA 4BDIA 3M11A 3MPTA 4GW8A 5LMBA 3L8VA 4QMUA 1BX6A 1YQJA 2H9VA 2QOKA 4EYJA 3HV4A 4ZMEA 3PY1A 3QALE 4ANBA 4U81A 3CIKA 4WBOA 3TTJA 3UG2A 3ZM4A 3R9HA 1FPUA 4UYNA 1H25A 2VWUA 2JIIA 2QVSE 4GVAA 3OG7A 3F5PA 3FE3A 3LZBA 3CJGA 2A0CX 3OOGA 1PJKA 3NUAA 2J5EA 4DH5A 3TACA 4W4VA 2PL0A 2CGUA 4OTPA 3CQEA 4MF0A 4RC4A 2B9HA 2XF0A 3R6XA 5KZ0A 3T3UA 5A46A 3FZRA 3TJDA 4MXAA 4CKJA 5KHXA 5I3OA 4U43A 2RF9A 3OT8A 3T9IA 4B0GA 3GFEA 4IAKA 2ZVAA 4APPA 2W7XA 5M4FA 4RLKA 3UIBA 2QU5A 2WD1A 3G9NA 2C5YA 4GJ3A 2O3PA 3D94A 3QTRA 3UOHA 4EJNA 3F5UA 5CI6A 4Y73A 5AIKA 4EOPA 3O0GA 5JKGA 4F9WA 5ACBC 5DA3A 4YJVA 2GQGA 2PVFA 4H3BA 2PUIA 3ID6C 4F1OA 4AU8A 1GIIA 4CFNA 3OCTA 2IZUA 2YA9A 1ZY4A 3WI6A 2FA2A 1P2AA 2VTSA 4E93A 3HUCA 1S9IA 3ZH8A 4YO6A 4UWYA 4UEUA 1AD5A 3DKGA 4BICA 3EQGA 4FKGA 3MY1A 4F70A 3HMNA 5AX3A 1IAHA 4C34A 5JQ8A 2IPXA 3KMMA 5IPJA 2C6LA 3VULA 1XBAA 2OZAA 3AC4A 4HVGA 4KS7A 3H30A 5TOZA 3Q53A 3DXPA 5HBHA 5FTGA 4GJ2A 3BLRA 4RRVA 5AP6A 4IJ9A 4L42A 4CG9A 2WTJA 2WMXA 1YI4A 3ZSIA 5DT0A 2VTAA 4H3QA 4EQMA 3LFSA 4DEHA 2ITPA 4O7RA 5E8SA 2ITZA 4E3CA 3LHJA 4AF3A 5A14A 2HWOA 1E9HA 2X8EA 5CEPA 4AX8A 4RPVA 2J0IA 3NW6A 4IM0A 4QPSA 4BIBA 3IDBA 4FVPA 4I5PA 4W9XA 4DGOA 4O6EA 5CT0A 5FD2A 5CF6A 4FKWA 4YJOA 5IG1A 3RPRA 1F0QA 2NRYA 4KIKA 4N0SA 3ALNA 1QPEA 3GEQA 5K3YA 2OLCA 4JBVA 4CT2A 3I7BA 3WOWA 5BQ0A 4C4JA 5KMIA 4ASDA 1O6KA 5B2KA 1RE8A 3WF5A 2R3PA 4BCJA 3A8XA 4PMTA 3RVGA 3QU0A 4DH7A 2PTKA 3GT8A 4J96A 3RPSA 4E20A 5DEYA 3H9FA 1U5QA 1OUKA 1NVSA 3NW5A 4G5JA 3BLQA 4NCTA 3QWJA 2XNBA 3PSBA 4F9BA 3PA3A 4QQJA 4DFUA 4BIDA 3IG7A 3U4UA 3BU6A 3RJCA 3AGLA 2E9NA 4FT0A 4OTDA 2PVHA 4H3PA 3GNIB 2HK5A 5AUWA 3SD0A 4DEIA 4IFGA 3MPAA 1BMKA 4FSRA 2UW4A 5KNJA 3S1HA 2IN6A 4O27B 3R83A 4C3FA 4MQ2A 1DM2A 3G0FA 5FG8A 3UG1A 4MNEA 4FT5A 1SMHA 3R8ZA 5LXMA 4I4FA 4ANNA 2AC5A 3SOCA 5EHOA 1J91A 1UNHA 1Q61A 2VWYA 2RIOA 2XH5A 3UVPA 3PXYA 3I1AA 3ZLYA 4EOQA 4X6QC 3TNIA 3E7VA 1DS5A 5AFVA 4B99A 4F9YA 1H28A 5FP5A 4ZJVA 4E4MA 4DT8A 5J7HA 1JKSA 5CF8A 3ACJA 2I0HA 4V05A 5FWKK 3RWQA 4IVCA 2QOIA 3UYSA 4ZJIA 4GSBA 1QL6A 1SZMA 5BVNA 4A9RA 4FKVA 2PZRA 5HIEA 4YZCA 2ETKA 2C6TA 2BDWA 2C3KA 4K8AA 2VTTA 3VWAA 3LFDA 3W2PA 3MY5A 4EZ7A 3U6IA 4O0UA 4A9YA 4A4LA 2XYUA 4BZOA 3FMKA 3EYGA 4I24A 2BIYA 2Z60A 3FMLA 4KUJA 2OXXA 3GU8A 1PYEA 3VUMA 5D7VA 3VUGA 3EN7A 4I22A 3UIUA 3K3JA 4FEXA 2QO2A 5KMKA 4RQKA 1QPJA 2FB8A 2UW3A 3EZRA 4MD9E 3DT1A 1IRKA 5AR8A 4A9UA 5KMMA 3P4KA 2IJMA 4USEA 3U6JA 3AXWA 4FT3A 5I9YA 4BWKA 3TUDA 3UIMA 3SC1A 1OL1A 1W7HA 4RIOA 2X0GA 3KXMA 5EI8A 1HOWA 2XP2A 3H4JA 1VYWA 5AUXA 5IA0A 4AGUA 4RX5A 4KSQA 5HBJA 5C4KA 3BHVA 1OKVA 5AUYA 4EH5A 4FMQA 4OTIA 3O7LB 2UZTA 3W18A 4W9WA 5IQCA 4IMYA 2V5QA 5L2SA 2VX1A 5AP4A 5HD7A 2Z02A 4O7SA 2JIUA 3QQHA 5HCXA 4D4RA 4OAVB 2O0UA 5M08A 4FTKA 4AZWA 1FGIA 1SNXA 4HGLA 4QP8A 2QOOA 2UZLA 3FZOA 4OLIA 5CI7A 4BC6A 3D9VA 3WARA 5EG3A 3VS7A 4ZY4A 3F3VA 2H96A 3OW3A 3FLYA 4FZFB 1J7UA 4ZY5A 3SKCA 4PPCA 4I23A 3WE4A 1YDRE 2WU7A 4BKZA 4NL0A 4CFVA 2WTWA 1UU8A 3KN5A 5IMXA 3B2TA 1XJDA 2IWIA 5CWZA 4BR3A 4AW2A 5FDPA 5HG7A 4QQ5A 3TNHA 1OITA 3UVRA 1UKIA 1ZARA 2VUWA 4MTAA 5ANJA 4J7BA 4ZSEA 2ETMA 3UJGA 5I5ZA 3HV6A 4ZTLA 1TQPA 2PMNX 3QL8A 3O23A 4XOZA 4YHTA 4LGHA 4DTKA 5IDNA 3PIXA 4QMSA 4CCBA 3BGPA 4HCTA 3IQ7A 3LQ5A 4RJ5A 4GK4A 4U97A 2YDJA 4GU9A 3O8TA 4NM3A 3A7IA 2JFMA 3OC1A 4O2PA 2WQMA 3FMHA 3V5TA 4GCJA 2UW0A 3D5WA 5J95A 5HU3A 4BCMA 2P3GX 4U3ZA 4OGRA 5LOHA 3Q2JA 3R8MA 2WFYA 4K0YA 3TKUA 4NH1A 5CSHA 3UZPA 5KKRC 3LM5A 4NM7A 4FG9A 3U55A 3F2AA 2WXVA 4K33A 3A8WA 2VO0A 4IH8A 5F4NA 4E8AA 1AQ1A 3FSFA 3OT3A 3UQFA 2B7AA 1H1SA 2X9EA 1M52A 3VBWA 5CSVA 4CLIA 2WO6A 3TV6A 3R9OA 5H8EA 4CQGA 3COHA 2Y4IB 4XG8A 3DJ7A 4O6LA 3UC4A 4ITIA 1M2QA 4IAZA 4NIFA 5ANIA 4IFCA 4IX3A 4C2VA 4DBNA 4QMOA 5BVOA 2VTPA 3R7UA 5L3AA 3N4TA 3MSSA 3QAME 2C1BA 4DCAA 3LJ0A 5IKWA 3RK5A 5AV2A 2DWBA 2R3QA 3DJ5A 3L8XA 4IAIA 5CY3A 5DPVA 4EZ3A 3IPHA 3H3CA 4XNEA 4AS0A 1OB3A 4LG4A 3VUKA 4FSNA 4L52A 3GXLA 4EK8A 4EOIA 2FO0A 3AMBA 5G1XA 3TKIA 1R0EA 4PNKA 3I5ZA 4R78A 2YM5A 4E1ZA 3P9JA 4TYGA 4JLCA 1U46A 2VTHA 2W5AA 4C4IA 4PDSA 1ZLTA 4KRCA 5DEWA 4DFYA 4TYIA 5A6NA 1E1XA 4EK4A 1TVOA 4PNIA 5EM6A 1H26A 5BVKA 2OIBA 3CPCA 1YW2A 3EN4A 2JKKA 4B7TA 3GVUA 2VD5A 2Z7LA 4ACHA 4ZLZA 3SQQA 5C1QB 5CEKA 4GVJA 4YJUA 3N4VA 1J1BA 4B8MA 5IEVA 4RIWB 4ZSGA 2XK3A 3U51A 5JRQA 4EL9A 2WQOA 1CKIA 4ENXA 3R9NA 4DLIA 4X7QA 1JKTA 3Q9ZA 4YC6A 4CYIA 5BVFA 4J52A 4Q5EA 5AP0A 4F65A 5IA5A 2OF4A 3MPMA 5FUTA 4MBIA 3NNUA 3F6XA 4FL2A 3VBYA 3Q4UA 3NLBA 4ZOGA 4GFOA 5HNBA 4DYMA 2WMQA 3HV3A 1DI9A 4E4NA 3CJFA 1UU9A 5BVDA 2XJ1A 4O0SA 3EN6A 4Q2AA 4BY9E 2C0TA 4UY9A 1L3RE 3NX8A 3ROCA 4PP9A 4BDHA 1ZOGA 3JR1A 3RHKA 4FTNA 4GG7A 4HGEA 2RFSA 3PE1A 3LCOA 4U7ZA 2X7OA 5E8YA 4K18A 5LVLA 2OSCA 3PYYA 4I6BA 4CEGA 5AR7A 5D9HA 3DKCA 3PPZA 4XP0A 5K5NA 4LRMA 4BCPA 1TQIA 2XK8A 4MH7A 2C3IB 3FBVA 3POZA 5E8VA 4N70A 4IX6A 4YZNA 3V5PA 3UP7A 2OFUA 4NZWB 2BDJA 2OJIA 3RM7A 5ETFA 1PXLA 2P0CA 1ZYDA 1FBNA 4O96A 3KRWA 3C4CA 4G9CA 2Y9QA 4M69B 3FYJX 4FA2A 3MVLA 4WHZA 5HU9A 1U59A 5LVOA 4DLJA 5CU2A 2GDOA 3IO7A 2UZDA 3PVUA 4FV3A 2YM8A 5AMNA 3KCFA 4NWMA 5G6VA 1L8TA 4TL0A 5IMEA 2JAMA 2QODA 3KQ7A 3MVMA 3DKFA 3LXNA 2W5HA 4Y85A 5IH4A 2GS6A 3C5IA 4PDYA 3N9XA 2CDZA 5BYZA 3SXSA 4AT5A 5LMKC 1XH8A 2X6DA 2VGPA 1JPAA 5CTPA 1QPDA 4WG3A 2P33A 3ZFMA 5M06A 4DG3E 2OJ9A 3NNWA 2FSMX 5J79A 1P4OA 3DBFA 1YXXA 4IC8A 3OBJA 2CLQA 3PPKA 3EL8A 4J71A 4NSTA 4TYHB 2BILB 4FTCA 3CBLA 4BTKA 3LFEA 1NT2A 2G01A 1J1CA 3I5NA 3PSCA 5FXSA 3V51A 2UW9A 4EKKA 5IQEA 1FVVA 3NR9A 4MEDA 4E6CA 3UNJA 4C4FA 3CP9A 4YJRA 2EB2A 2R9SA 5FXQA 5T6KA 3RPYA 2GQRA 1U54B 1PMUA 4P5QA 2BRHA 4JXFA 3TNQB 5KBQA 1H01A 3BV2A 3QX4A 3VIDA 2CKOA 3PVWA 3FI8A 1OBGA 1BI7A 2CKEA 3VHEA 4FL1A 2HOGA 4M8TA 3FI2A 2FSTX 1KWPA 5F20A 4ASXA 4R3PA 5HLWA 3DXQA 2I0VA 1WZYA 4B8LA 2J7TA 4C38A 4GT4A 3PZHA 4EOLA 2B52A 2CCHA 2R3HA 4EHGA 4NTSA 1SYKA 4U5JA 4ANMA 1RDQE 1Z9XA 3I0OA 3P08A 4BL1A 3UOJA 3C4ZA 3PY0A 4L44A 2YERA 2VWVA 5E8XA 4FEVA 3N51A 2QI8A 3RI1A 4QMNA 2IO6A 3I79A 2W1FA 3QBNA 4IVAA 3R71A 4UMPA 4L3LA 1UU7A 3IECA 5HI2A 1KSWA 2YM6A 3UNKA 2E9PA 4EBWA 5AUZA 3EQCA 3VF8A 3R63A 2OK1A 1ZAOA 2J9MA 4ASEA 4F7NA 4PX6A 3C4WA 5A4CA 2OFVA 5A4EA 5HESA 3BWFA 2OGVA 4RGJA 3CEKA 5AP1A 4PTGA 4MBJA 3QKMA 2HZNA 3GQLA 3EL7A 2WEVA 1UWHA 2WZJA 5AA8A 4CZYB 3UZRA 4PTEA 3ATTA 3BWJA 3O8UA 5EM5A 3E88A 2OXYA 5IF1A 3S95A 4DITA 3LKMA 1PKDA 4N57A 3TWJA 5CALA 4A9SA 3F3WA 5J5TA 4R7BA 5GJDA 5BUJA 4R3CA 2PVJA
chains in the Genus database with same CATH superfamily
3H0YA 4PUZA 1FMOE 1W82A 3BLHA 4FNXA 4G3DA 4AGDA 5J9ZA 1WBPA 3GU5A 4RIYA 4DAWA 1SVHA 5HEZA 3MESA 3FLNC 5DR2A 4X2NA 3R28A 4HVDA 3ZLXA 2QO9A 5M53A 4L01A 1JNKA 3ZONA 3EHAA 3ALOA 3OCSA 4U42A 4BCGA 4C0TA 1BL6A 4FV4A 3CTQA 3P5KA 2HENA 4WNKA 3BU3A 5CNNA 3T9TA 4TN6A 4N4SA 2W1GA 5HE2A 4C4HA 4GK2A 4RA5A 4JQ7A 4O21A 2JKOA 1OM1A 4O7WA 2YWPA 3A7HA 4QP7A 3ZS5A 4ZAUA 4FG8A 1W0XC 3MV5A 3PLSA 5AV0A 4I6HA 4IEBA 3WIGA 4AW1A 1ZYCA 4AE9A 5EQPA 4M0ZA 2VO3A 4Z9LA 3W2CA 1SM2A 3BHUA 3W0PA 4BDAA 4CCUA 3Q2MA 3AQVA 4PL4A 1HCLA 3RBWA 4DEBA 2BZIB 3F3UA 5CU4A 4I3ZA 2UW8A 4GG5A 3ZYAA 3LQ3A 4IACA 4H05A 2BKZA 4O82A 4KIPA 4C62A 1WCCA 4BCKA 3DK7A 3GU6A 5EOBA 4CLJA 1JWHA 5J9YA 5FQDC 3COMA 3F88A 5DFPA 5FDXA 3HRFA 4WG4A 2JC6A 2BPMA 2I40A 2OJJA 3FC1X 3BCEA 2BUJA 4BI1A 4NEUA 4XRJA 1B38A 2V55A 4XBUA 4C3RA 1MP8A 1SVEA 4NJDA 4AGWA 4QPMA 4JRVA 3VQHA 3IK3A 1XH9A 3FL4A 3PXRA 2ITNA 3D7TB 3W8QA 2Y6MA 4DFZE 2W9FB 4QP2A 4QEBA 2GNIA 4A7CA 1UWJA 3D5VA 3QZIA 4RX8A 1NA7A 3OXIA 4QO9A 3W2SA 4BBMA 4DHZA 2YM3A 4K6ZA 3W8LA 4AA4A 4HVIA 5EI6A 3F9NA 1G5SA 1CSNA 3FV8A 2O5KA 3DA6A 3WF9A 4I41A 4AQCA 5L6PA 2CN5A 4IHPA 1XH4A 4FV7A 1Y6BA 1TZDA 2PMOX 3BKBA 2BFXA 4KIKB 4FIFA 4ZTSA 4EH9A 3AT3A 2JKQA 5D11A 3TJCA 3DS6A 4ASZA 4AWIA 3KCKA 3ROYA 5M44A 4FEWA 2ONLC 4LYNA 5IQIA 3CTJA 3TT0A 3WIKA 4WUAA 4PF4A 2C5XA 4QYYA 4BDDA 4CTBA 3PA4A 5L2TA 4QTBA 3GC0A 4L43A 5EYCA 4ZJJA 2GSFA 5M57A 4AE6A 1YHVA 4D9TA 2LGCA 4M13A 2OU7A 3VS2A 1FINA 4FK6A 3K2LA 2UUEA 4AW5A 5E91A 1RQQA 2QURA 4QTDA 4ZTMA 4U9AA 2JDRA 3R2YA 4Q9ZA 2DUVA 3G15A 3CGFA 1ZRZA 2EU9A 2ZB1A 4DGGA 4F6UA 3KK9A 4RJ8A 5KE0A 4HW7A 4P4CA 2BVAA 5DIAA 4D2SA 3P7BA 3PXZA 5CXZA 3AC8A 2WB8A 4XUFA 4Z16A 4MXCA 1MUOA 4OTRA 4XG2A 3V01A 3O96A 4EOOA 3DV3A 4O4DA 3W0OA 3E3PA 4JG8A 4TWNA 3JXWA 3VW6A 4O1PA 2WKMA 4M66A 4YBJA 3AD6A 3DU8A 5EW3A 4E5WA 2HXQA 4D0WA 2OKRA 4Y72A 2QKWB 2UZNA 5L8KA 2Z8CA 4NU1A 2XK7A 4ZZNA 2WMWA 3CS9A 4LMUA 3VS5A 4QDEA 3OWPA 3U8WA 3UNZA 3PJ1A 4ZY6A 2RKUA 4FX3A 3NW7A 4I6FA 3HRBA 3U54A 2ZMCA 3DBCA 3ZBXA 3IOKA 4HZRA 1ZYSA 3TZMA 1Y8GA 3DB8A 2WTCA 2GNJA 3PIYA 3QGYA 4XYFA 5DG5A 3RPOA 2R2PA 3UO4A 2YAKA 3ZUUA 2PUNA 1VYZA 4CSVA 2QOQA 1YOMA 4JL9A 2PZYA 3ZZEA 4HVSA 4F99A 4JIKA 4E5AX 5E4HA 3U6HA 3EFKA 5JT2A 2VZ6A 2XAOA 3ORKA 3S2PA 2HWPA 3PY3A 4TWOA 4O0WA 4W4WA 5JFSA 1GJOA 3R8VA 3ZFXA 4EC8A 5BVWA 4PMPA 5CF4A 2PVMA 3CD8A 3CPBA 3ATSA 5C8KA 2BRGA 3GUBA 2BMCA 3IGOA 5AA9A 1LEZA 3R7OA 3CGOA 2A2AA 3MH0A 4GK3A 2I0YA 4UMUA 3L8SA 2X4FA 4GH2A 2BALA 2BKKA 1PW2A 2Z2WA 4BTMA 3QTUA 1KOAA 2IZRA 3NYVA 4EWQA 5KMLA 3C9WA 2WTKB 2Z7RA 3FJQE 1APME 3D4QA 3ZLWA 2ACXA 4BI2A 1WBTA 3FY2A 4L6QA 3B8RA 4GKHA 2R3GA 4EH6A 3RPVA 4ARKA 1WVXA 2WPAA 4FSTA 3FLWA 2C5OA 1EH4A 5JFXA 2XKFA 2BRNA 4K77A 5EFQA 4QOXA 3AGMA 4C37A 3UDZA 2BAKA 2CMWA 2YHVA 1V0BA 3BGZA 3P7CA 4TKSA 4TXCA 2C5NA 2C6IA 1GZNA 2P2HA 2YCFA 3L9NA 5T3QA 4KD1A 4I20A 3I6UA 1B39A 2W9ZB 3F5GA 2R4BA 3VAPA 5JZJA 5A4QA 3TM0A 3N4UA 2PE2A 1OIUA 2XKEA 2RL5A 2XK6A 2AEGA 2PYWA 4YUQA 4AZFA 4YC3A 4OTHA 3EB0A 2F7XE 2YCSA 3D83A 2Y7JA 1W8CA 4W8DA 4WBBB 4R77A 2JDOA 3P0MA 1H24A 1IA8A 1OUYA 3LMIA 3MA6A 3L8PA 3BYVA 3CKXA 4K11A 4PRJA 1PYXA 2W1IA 2YABA 1KOBA 4GS6A 5FP6A 4DFNA 4IWQA 5HCZA 4MWHA 2AQXA 5CSPA 2IW9A 3F2NA 3VS3A 4O7TA 4AXDA 2X0OA 5DLSA 2R64A 3GOKA 1PXNA 4M84A 4F9AA 4F0IA 4ZTNA 1GY3A 1Q97A 4JBQA 2UZUE 1YXSA 2GHMA 3FMDA 4MXXA 4CFUA 4FTJA 1XBCA 4DA5A 4FVQA 4ACMA 4EBVA 5A9UA 5E8ZA 3VS1A 4F1MA 5IA1A 1I09A 4RC3A 3KULB 5C4LA 3F7WA 3TZ8A 4YPDA 3LMGA 3V5WA 3QLFA 1Y8YA 3QTIA 4ZXTA 3I4BA 1FMKA 4ZK5A 3RNIA 3LFNA 1GZKA 2W05A 2XBJA 3EN9A 4W4YA 2ZFYA 4O7ZA 5LARA 5C8MA 5T68A 4EWHA 1JOWB 2JEDA 4KKHA 4QQCA 4XS2A 5EQYA 2SRCA 4FVRA 2VRXA 4HYSA 4NIFB 4D5HA 4BGHA 4BDJA 3PVBA 3KC3A 3NAYA 3RCJA 2C6MA 4U79A 5HG9A 3E92A 1A9UA 2HIWA 4AN9A 4WA9A 3O50A 3VS0A 2XRWA 3DAKA 4G3CA 4L9IA 2PUPA 1YDTE 4UBAA 5IQFA 3R1YA 4JQEA 3A2CA 3HMIA 5AR2A 3UMXA 4XMOA 3FZPA 1RJBA 3ZXTA 2X9FA 4F6SA 1M2RA 3FSKA 4BCOA 2R7IA 5I9XA 4IB5A 4A07A 2BAQA 3ZTXA 1BI8A 3DDQA 4MK0A 4LL5A 5E1SA 2X2KA 4DGMA 3QRJA 5M55A 2ITYA 2X6EA 3KRLA 2QD9A 3P1AA 2FUMA 3DNDA 4UB7A 3U9CA 5KCVA 2W1CA 3IOPA 4FKIA 3RGFA 3ULZA 5EQEA 2DQ7X 4BF2A 1GZ8A 1OKWA 3D7ZA 5HOAA 4ANLA 5B7VA 4I0TA 4D2TA 4DHFA 1XQZA 3FDNA 5IH5A 3TG1A 1WFCA 4IZ7A 5CVGA 2PMLX 4RFYA 3ZRMA 1LR4A 3FUPA 2XJ0A 4M0YA 2W17A 4F7SA 1UV5A 4BDEA 1TKIA 4C7TA 1VEBA 3S0OA 1LUFA 1PXMA 3D2KA 3DY7A 4ZLOA 4QNAA 1M17A 1PF8A 3KKVA 1VZOA 2BROA 3C50A 4RIXB 4HCVA 4X3FB 2XIXA 5TO8A 4N6YA 2CJMA 3SRVA 2B55A 3A7GA 4DDGA 1OPJA 2GCDA 5K4JA 3FKLA 4GMYA 1KE9A 3DTCA 4Z55A 3IGGA 3HV7A 1YWNA 3R1NA 4M12A 4ENYA 3O7LD 5DI1A 3PSDA 5FTQA 4FR4A 3PTGA 4M67A 4HGSA 2QOHA 3SVVA 3DAEA 3G90X 4M7IA 3GCVA 3QQLA 1OZ1A 2ETRA 4BI0A 2VO7A 3OS3A 3OTVA 4Y8DA 3DQWA 3PJ3A 3SV0A 4JOAA 5DWRA 4FTTA 5CAPA 5HG8A 2EXCX 1R78A 4AN2A 3EWHA 1BL7A 3NCGA 3PVGA 4Y83A 5M4CA 4BDBA 4JQ8A 1NVRA 4YU2A 4IXPA 2GQSA 4G6NA 3A61A 4DFXE 3QA0A 5IQBA 3PJ8A 2J0KA 4FSWA 5J1WA 3E5AA 3KXNA 1Q4LA 3R04A 4WIHA 3OWJA 1JBPE 2WTKC 4DC2A 5ETAA 2CNVA 2E9UA 3UO6A 3LJ1A 5AP7A 4Q5HA 4YNEA 4UZDA 2ITQA 2XK9A 4FEUA 4ANQA 2VGOA 2HYYA 1T46A 1R0PA 1P5EA 4CFFA 4RVMA 2WELA 3HMOA 2C6OA 1QPCA 2WOTA 3UOKA 4F0GA 4IVBA 2ZDTA 3OCBA 2J4ZA 3OW4A 2IEWA 3FEGA 1M7QA 5AM6A 1W2CA 5C27A 3W16A 1NW1A 4TPTA 1DAYA 1FVTA 2X2MA 5AP5A 4XV2A 5JEBA 1S9JA 4BIEA 4A06A 4C3PA 2X8DA 1CM8A 2UVXA 4FZAB 4LV5A 4N6ZA 3RK7A 4XV9A 4I21A 4RJ4A 4EORA 3CTHA 3QQFA 4M68A 3GBZA 4YLJA 5AX9A 5KZIA 3HRCA 3Q9XA 5AAGA 4BTFA 3A7JA 3EYHA 3G0EA 3VUDA 2HY0A 3ZRLA 3LJ2A 1WAKA 5AP3A 3GCPA 4QMQA 5LWMA 5TKDA 1Q99A 1PMEA 3ORXA 1GZOA 4KIQA 3QQJA 3OWKA 4FKTA 3SXFA 4FSMA 4IB1A 3PJ2A 5KMOA 2WQBA 1PMVA 4FICA 4Q9SA 3PPJA 4I5CA 2AC3A 2F7ZE 4CV8A 3BRBA 5DT4A 4BGGA 3VBQA 5L2QA 5HNGA 4BCHA 4YPSA 4JNWA 4C4EA 4TT7A 4LL0A 3BL9A 1Q62A 4AXFA 1H00A 2FSOX 1H0WA 3NUUA 4ZTQA 2XJ2A 5DHJA 4BDKA 4PL3A 1Y57A 2PUUA 5CVHA 4CD0A 2WGJA 2YZAA 3DOGA 4LUEA 4NTTA 4FV2A 3W2OA 3DLSA 1M14A 4FT9A 4NK9A 4NT4A 4HZSA 4OT5A 4YHJA 4YC8A 5AV4A 4FZDB 5F9EA 1REJA 4FTMA 4QYHA 4E5BA 3KGAA 4IB0A 4EH8A 5HNIX 3B2WA 4EH4A 1WVYA 3HDNA 4FV0A 4S31A 2OXDA 3MB6A 4CYJA 1ZZLA 4DGLC 2YFXA 3LVPA 3JY0A 2R3RA 2I1MA 4GUEA 3ORNA 2XZSA 3KF7A 4AT4A 3ZEPA 4L8MA 5M56A 4ALVA 3C5UA 3ZO3A 4JX7A 3CQUA 3KB7A 1YI6A 4FIHA 4DINA 2IG7A 5M07A 1OL5A 3BX5A 1V0OA 4BGQA 4IC7A 3FHIA 2F49A 4OBQA 1K3AA 4UALA 4LQMA 4L46A 3BHHA 4NUSA 1H8FA 3BHTA 4Z7GA 3BI6A 3CE3A 2OF2A 3OMVA 4OT6A 4TYEA 3QQKA 2X8IA 4YLKA 3KK8A 4JG7A 4O7VA 2X4ZA 4ZTHA 3ZUTA 3RALA 2W4OA 1U4DA 4D2RA 2R3KA 3Q04A 2YWVA 3UDTA 3OTUA 4G6LA 3A62A 2YCQA 4KINA 5CSWA 1KE5A 4FTUA 4K1BA 4H36A 4AXCA 4XG9A 4KAOA 2PVYA 3BYMA 2FVDA 2VWBA 4LOOA 4O4CA 3V8SA 3ZC6A 3F3ZA 4X2FA 4QRCA 2PPQA 4QTCA 3HECA 3L9LA 3MVHA 3C1XA 2E9VA 3D14A 5HE0A 4YSJA 4KKEA 5DR9A 4M14A 4X3FC 3LCTA 3CY2A 3OCGA 1WBWA 3FAAA 1IR3A 2VNWA 2AYPA 3AG9A 5BX0A 3ERKA 4ZTRA 4AXAA 4F08A 5AV1A 1TQMA 4IIRA 3PFQA 5FRIA 4H1JA 3RTPA 3GQIA 3R2BA 4O4EA 3R7YA 1ND4A 4BBEA 5HKMA 5AUVA 4BCQA 4D2PA 4EHVA 4DG0E 1NY3A 1YHSA 4QPAA 2QHMA 1GIJA 3DFCB 3M2WA 3PZEA 4GL9A 4ERKA 1CKJA 3DFAA 2IVTA 5BMMA 1O6YA 2XIRA 3FI3A 3NNXA 4ID7A 5E8UA 1KV1A 3ORIA 4BFMA 1JKLA 2WMSA 5KX8A 2QOFA 4D4VA 3W0RA 3QUPA 3P5JC 4FKSA 2QR7A 3BYUA 1OMWA 4JDIA 3NFFB 3JY9A 4AA0A 3SA0A 4XLIA 2PVLA 3DPKA 3TIZA 3MH3A 2WMVA 4LRKA 3MFUA 4NM5A 3D0EA 5IEYA 4EH7A 1ATPE 4NKAA 3AD4A 5CNOA 2RSVA 4KA3A 4FJVA 4UZHA 3WF6A 3QUEA 5I3RA 5ANOA 1W84A 4MBLA 5I9WA 3NS9A 4XEYA 3MH2A 3OUNB 3VJNA 3HV5A 1OL6A 2WQNA 5H8GA 2X39A 2YIQA 3QYWA 4ZS0A 3UVQA 4NFNA 2BIKB 2EWAA 3MBLA 4RZWA 5GJGA 3EJ1A 2F2UA 4UN0C 4X21A 4CVAA 4D4YA 4II5A 1ZMUA 1PY5A 4DEEA 3VJOA 3O71A 4R7IA 3FMMA 5J9LA 2PVRA 3RAKA 4MQ1A 3BU5A 3EKKA 2QKRA 3Q60A 4AAAA 3EQFA 3EOCA 2YIRA 3IW5A 2IZSA 3EZVA 4J95A 4G1WA 4YTFA 2ZB0A 4FSYA 3HYHA 3BYOA 3FPMA 5B0XA 4F7LA 2C30A 3NWWA 3ML1A 3DBQA 2RFEA 4XG7A 5DYJA 4FKJA 1YDSE 4FTQA 4CMOA 4O0XA 1FOTA 4XG6A 1W2FA 2JGZA 1OKZA 2Y4PA 5DNRA 4C57A 2ZAZA 4QMPA 4YJTA 4YR8A 4IM2A 5HLNA 4ANSA 3KVWA 4QMVA 1H1PA 4MAOA 2VTIA 5AP2A 1FVRA 5IU2A 2GNHA 3TEIA 4FGBA 4TTHB 5CEOA 2C0OA 2BDFA 5IA3A 3E64A 1Q8UA 3LXPA 5IUGA 2YEXA 3UZTA 2QCSA 5I9UA 4IX5A 5KMNA 1H0VA 4ZIMA 4IADA 1BYGA 3QD4A 1DAWA 4JR7A 5FBNC 4MF1A 5IDPA 2NPQA 4BYIA 4YNOA 5A6OA 2CPKE 3P23A 3BGQA 4OBPA 3WYXA 1R3CA 4PTCA 4AFJA 3EMGA 4AAYA 3ZXZA 3W2QA 3MFSA 1H27A 4OR5A 4UWCA 4JT3A 4JVGA 3EQPA 3NMUF 4UMQA 3R7IA 5LMKA 3W0QA 3W55A 4JAIA 2FSLX 2XA4A 2Y4IC 4KBAA 3FLQA 2E9OA 5EW8A 5I0BA 4ZZOA 1YKRA 4YLLA 3DKOA 4FK3A 4H39A 4ITHA 2UZBA 4W4XA 3ZZWA 4EKLA 2ZJWA 1Z57A 3HMMA 3KA0A 3TXOA 4CQEA 4F4PA 2W06A 3LFAA 2UZVA 2B9FA 4WSYA 4FNZA 2OH4A 3FQEA 4IX4A 4J8NA 3S3IA 3Q6UA 3TV4A 2GS2A 3V6RA 4XH6A 3ENMA 1YWVA 4MD7E 4EK3A 2HXLA 3MJ1A 3OXTA 1OIRA 2YDKA 4BDFA 3H9OA 4RWIA 1XO2B 3MH1A 3FPQA 4FODA 5JGAA 4GKIA 2VTOA 2A27A 4J98A 5J87A 5CEQA 2JKMA 4ITJA 2Y6OA 2QHNA 5B2LA 4FV8A 4DBXA 3A99A 1ZWSA 3MN3A 2YIWA 4DTBA 3SW4A 4JDHA 3E8CA 4MVFA 4DHIB 1STCE 2P55A 3BIZA 5EDPA 3PDTA 4DF3A 2JD5A 5CXHA 3GI3A 3K54A 4E4XA 3BBTB 5H2UA 5AJQA 3CQWA 2ZM4A 3D5XA 5I4NA 3G9LX 4CMUA 2A19B 2I6LA 1M7NA 4ZSLA 1VR2A 3MIAA 4TW9A 3IW7A 4HVHA 4U45A 4BJJA 4GUBA 4E7WA 4EHEA 4I0RA 3F82A 4AOJA 2GNFA 3BQCA 1P14A 2XNMA 5BPYA 5M4IA 3MS9A 2QONA 2ZMDA 2WQEA 4ZSJA 2JDTA 5HIBA 3VONA 3QCSA 2XUUA 3MGYA 3O51A 3AC2A 3EQIA 4APCA 5HG5A 2J50A 1X8BA 3ORLA 3WZDA 1FGKA 5JQ5A 5CU0A 1JSTA 1BLXA 5HORA 3VBXA 4QP3A 4O0RA 4BWXA 1Q8WA 2W4KA 4ZMFA 2W1ZA 3NUPA 2YACA 2NNWB 1ZZ2A 3EKNA 4FOCA 4R5SA 2G2HA 1GIHA 2X1NA 3IW6A 3HL7A 4WD5A 2Y0AA 2XIYA 3AMYA 3Q9WA 2J0MB 4O7YA 2QR8A 5GIPE 4TRLA 5AEPA 2EUFB 2GFCA 5BUEA 2OZAB 4IE9A 1JQHA 2JLDA 2G2FA 2YISA 3Q3BA 4RFZA 4XHKB 4CRLA 5JFVA 3ET7A 5TE0A 1OKYA 3SHEA 3KXZA 3F66A 4F9CA 5GIOE 5HO8A 2XNPA 3I0QA 2OIQA 5AAFA 2ZM1A 1QMZA 2BRMA 2BZHB 3JVRA 4LMNA 4RVTA 1BUHA 4FUYA 3PRIA 3AD5A 4BCIA 2OWBA 1KE7A 3O17A 3SX9A 4FTOA 5CX9A 4BYJA 5J5SA 1UKHA 2UV2A 5FTOA 4NFMA 4L3JA 1H1WA 3UOLA 4CFXA 4ZEGA 4F78A 2AUHA 5JMSA 4WSQA 1CDKA 2CGVA 3R0TA 4TZRA 4WG5A 4ZZMA 3GCQA 3NYNA 4FKUA 4CT1A 5J1VA 2KULA 2XEYA 5CU6A 3GFWA 1UNGA 1ERKA 3R9DA 4EI4A 5LCKA 4QT1A 3C0IA 2O63A 4EONA 4CTCA 4YURA 2J0JA 3V04A 4BHNA 2C1AA 4DH1A 4QYFA 4F63A 4G3EA 4RWKA 2XB7A 2XNNA 3AT2A 3KF4A 1WMKA 2X0QA 3PA5A 4O0TA 2IVUA 2OH0E 5CYIA 3LAUA 3VHKA 3QTWA 2WTVA 5DMZA 5K4IA 3GB2A 5BYLA 3W32A 1MRYA 2REIA 4RX7A 2JBOA 2W5BA 2VX3A 3VS4A 1OIQA 2B4SB 2C6DA 1IEPA 3TIYA 3Q5ZA 4AUAA 2XK4A 3C7QA 3TNPC 3VBVA 3FZTA 4R7HA 4AG8A 4EJ7A 1MRUA 4E26A 3D2IA 3F3TA 4DTAA 5CQUA 4O7LA 4R5YA 5C01A 2OG8A 4MXZA 2J0LA 3LCSA 2OW3A 4MNFA 5ETCA 2BAJA 3FLZA 3W0SA 4XP3A 4L00A 2YITA 4MNEB 4R6VA 4D9UA 3WF8A 2HZIA 2B53A 4EUUA 3Q32A 5DN3A 3QLGA 4CGAA 1E1VA 2Q83A 2ITWA 2ERZE 1YHWA 4XJ0A 3RK9A 4S34A 5AUTA 4FZ7A 2C47A 4PPBA 4KIOA 3HP2A 4C33A 4EC9A 4ERWA 4OAUC 4I6LA 1J7LA 4K2RA 1JVPP 4IWDA 3RKBA 4MXOA 2ZV7A 3COIA 4P2KA 3RNYA 4AACA 4CFWA 3NUXA 4ZP5A 4DEAA 3TMOA 2ONLA 2X81A 4R1YA 4JX3A 3MB7A 4FI1A 1J3HA 3KU2A 3MYGA 5EK7A 5ANEA 5GZ9A 3PE2A 3QD0A 3NRMA 3QRIA 3QGWA 2FGIA 3K5VA 4RVKA 1AGWA 3FMEA 3FL5A 4XBRA 5D10A 5DVRA 1XH7A 4FSZA 4EOKA 3UDSA 3RAHA 1OPLA 4QMMA 4QMTA 2GPHA 2PWLA 2BZJA 3GCUA 2J5FA 4FOBA 4G31A 4K9YA 1V1KA 4FSQA 3ZEWA 3DQXA 2O64A 1YI3A 1VJYA 3QZFA 3ZDIA 2C5VA 5CASA 2VX0A 2VN9A 4O0YA 3OZ6A 4KNBA 1M2PA 3TUBA 4FV5A 2WMRA 3ANQA 4BVUA 3UIXA 4D55A 3OEZA 3SW7A 3NDMA 4PDPA 4U40A 1U54A 3F5XA 4WRSA 3DBDA 3FMJA 2IVSA 3R00A 3DBEA 5K0XA 4DDIA 3RZFA 2BR1A 2CNUA 4BN1A 4GIIA 3TNWA 3QRUA 3D5UA 3JYAA 4LGGA 4USDA 3FZ1A 4C4GA 3IW8A 3DDPA 3WZJA 4Z7HA 5M09A 1WBOA 2R3NA 5HO6A 4RMZA 4KWPA 5L2WA 4FE2A 2EVAA 4P7EA 2H34A 3OF0A 5EM7A 2OIDA 3NUSA 4OTFA 3ORZA 5AADA 4FZ6A 3UYTA 3ACKA 1YVJA 1MQBA 2C69A 3EQBA 3HKOA 2PVKA 5L6OA 4MXYA 1OL2A 2UZWE 2EXMA 3IDCA 4Y46A 1SVGA 2R3IA 3PIZA 5FEQA 4CZTA 5DR6A 3LLAA 4ORKA 4CNHA 2UVYA 3QUDA 3SAYA 3D15A 3ZOSA 2HY81 3U9NA 2OZOA 3E7OA 1XWSA 3ODZX 4HJOA 4H58A 5H3QA 4EH3A 3ETAA 1G8AA 2G2IA 2VTJA 3TYKA 5IZFA 4C36A 4RJ7A 5DOSA 3LOKA 4D28A 4TWPA 1URCA 3H10A 1LP4A 2O8YA 3R7GA 4AZEA 4EQUA 3MA3A 4NW6A 3E62A 4FYOA 5D41A 2UW5A 4YZDA 4G34A 3LCKA 5ANDA 4MUQA 4QNYA 1CMKE 2FH9A 3JVSA 3GGFA 2GS7A 4QYEA 3FQHA 3LFFA 4S32A 3UE4A 2CKPA 3DZQA 2QQ7A 3LQ8A 3VRYA 4AP7A 4WNMA 3KXGA 1ZMWA 4FV6A 4MCVA 2WMUA 4XV1A 1K2PA 5EYKA 3F69A 4OBOA 2E2BA 5CLPA 4D0XA 3SG9A 5CAVA 3Q6WA 4DT9A 3PLAE 1DI8A 2R3JA 4FC0A 3SXRA 3OXZA 5HCYA 5TF9A 4RQVA 3R7EA 3F7ZA 4D2WA 2OI4X 2Z7SA 4I92A 2OBJA 2WNTA 3KFAA 3QTSA 5DH3A 2NO3A 4IVDA 4S30A 5EYMA 2I7QA 3QCXA 4GV1A 5B2MA 1UVRA 4O0VA 4PV0A 3T8OA 1Q3DA 1Q3WA 2IW8A 3UP2A 4UX9A 3POOA 4NCTC 3A7FA 4ONAA 3VN9A 1UA2A 2VNYA 4M97A 3II5A 2VTRA 4DEDA 2CCIA 3GC8A 4QP9A 5H9BA 3KRXA 3L1SA 3C0HA 1WBSA 2YLFA 3OY3A 5HO7A 3QC4A 3ENHA 3K5UA 5DBXA 4I93A 4CKRA 3E87A 4J1RA 4XP2A 3D7TA 1PHKA 4L68A 3OROA 2EXEA 5GJFA 5FM2A 4TNBA 5ANGA 5FXRA 5JGBA 4O86A 3KN6A 3HNGA 5ITAA 1IA9A 3I7CA 4JS8A 4J99A 4XX9A 4RX9A 3HLLA 3QHWA 4BBFA 3HAVA 3C4FA 4BDCA 4RBLA 2CLXA 5KKRB 5CVFA 3V8TA 4C02A 5F95A 2XMYA 4C35A 1NVQA 1REKA 2VWZA 2XBAA 2P2IA 2CSNA 2XYNA 3R22A 4D1XA 4EYMA 4I6QA 5JN2A 5LVMA 3UQGA 3V8WA 1MQ4A 3RM6A 3Q9YA 5HTCA 3NVMB 3NIEA 3NEWA 2RFDA 3V5QA 4RJ3A 3ZCLA 3ITZA 3VNTA 5E8TA 5A3XA 3GP0A 4IANA 4WT6A 3OBGA 3F61A 2X7GA 4RJ6A 1KE8A 4JBPA 4A4XA 2PZPA 2PHKA 2JDSA 3DCVA 3WZUA 2FYSA 5HVKA 1Y6AA 2X7FA 3Q96A 4UMTA 3VUTA 5LQFA 2F4JA 3IDPA 5E7RA 5GZ8A 2XM8A 3BQRA 5AIRA 2WU6A 3VO3A 2XNOA 5M51A 4IZ5A 5FBOA 3ZU7A 3RINA 1OPKA 4CZUA 3Q5IA 3W0MA 1XBBA 1KE6A 2R0IA 4PY1A 4ACDA 1SNUA 1Q5KA 2YJSA 3FKNA 3L9PA 4MYGA 4RVLA 5JK3A 4L7SA 1ST0A 4E6AA 3I60A 1ZOHA 3MY0A 5ICPA 4BTJA 3RHXA 4C59A 2VTLA 3QTZA 3UODA 5FEEA 5HBEA 4FKLA 1H08A 5BUIA 4PPAA 5DRBA 2GHGA 3QTQA 3R1SA 4QMLA 3G51A 3EFLA 3WF7A 4F0FA 1GOLA 2ITVA 3LFCA 1ZMVA 2PVNA 4D5KA 4UWBA 5M4UA 2BRBA 2X2LA 3FYKX 3BPRA 2GU8A 1XR1A 4DN5A 3A60A 3ZFYA 2R3MA 2XCHA 5IISA 3AT4A 1Q24A 5HE1A 4JDKA 4D2VA 3LXLA 4LDTA