3ORMA

Mycobacterium tuberculosis pknb kinase domain d76a mutant
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
280
structure length
266
Chain Sequence
RYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYATGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIATAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine protein kinase
publication title Allosteric activation mechanism of the Mycobacterium tuberculosis receptor Ser/Thr protein kinase, PknB.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 78
structure length 266
sequence length 280
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ormA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ormA01
4BHNA 4O0WA 3FUPA 4D2RA 4PL3A 4E6DA 3KEXA 2EB2A 2I0EA 3F5UA 5JFVA 4FKLA 2P0CA 3OCGA 4AXAA 2YEXA 4DTKA 3V8TA 5J5SA 4QPSA 4L52A 4CKRA 3F5PA 3CD3A 4F08A 3JVSA 4OBQA 4UY9A 4XS2A 5EK7A 4D1ZA 4PL5A 3KXXA 3NUNA 3R1QA 4XV9A 3TKIA 5JN2A 2WFYA 3LLAA 4FTQA 4YTFA 4XCUA 4FSWA 3ET7A 2YLFA 3OF0A 2UV2A 4IFCA 4MD8E 5D12A 4DGOA 4QO9A 3S95A 2CNVA 4XLVA 2IZSA 3MW1A 4CG9A 1PXOA 4APCA 4FTRA 3TNIA 4O0SA 4BCGA 4CRLA 1UV5A 4S33A 2Z7SA 4D4RA 3R7IA 1UNHA 3Q4CA 4E5WA 1WFCA 2R3LA 3R22A 4XG6A 3ZLXA 5FRIA 5HI2A 3COKA 3LJ0A 4C38A 3FZSA 4GV1A 4RSSA 4ZS4A 1P2AA 4FSUA 4NM3A 5DOSA 3TTJA 3GB2A 4ACDA 2A27A 4KKGA 4UYAA 2V7OA 2WOTA 2BVAA 5AX9A 3OOMA 3ZLWA 4NSTA 3WF9A 2XH5A 1ZMUA 1GOLA 2XNEA 1KE6A 4OW8A 1HCLA 2YA9A 5CS6A 4FA2A 3UOHA 4O7RA 3SG8A 2HWPA 3NUXA 4AGUA 4ERKA 1YHVA 2QNJA 3A99A 2QOKA 2VWBA 3AC1A 3P08A 4D0XA 4AWIA 4G3EA 2XRWA 1R3CA 3Q60A 4UALA 4X2GA 3ULIA 4QQTA 3TV7A 3PY3A 4BTKA 3POOA 2O63A 3BIZA 5IA1A 5K4JA 4LGHA 3ATSA 3D5WA 5HG8A 4FV2A 4UWBA 4WRGA 2BIYA 3NPCA 4IEBA 1MRUA 2OZAA 2J90A 2XKDA 3O8TA 3ORXA 4BCPA 2Y4PA 4KIKA 5BQ0A 4RC3A 4WNMA 4NIFA 5CY3A 4M67A 3NMUF 4J97A 1R78A 2GCDA 3EYGA 3FLQA 4ZSJA 3CS9A 3IW4A 3R1NA 4ZTNA 4ZSLA 5TKDA 3QGWA 3HNGA 2YWPA 1MRVA 3H0YA 5GJDA 2WAJA 5AV1A 4DEAA 3EWHA 3AMBA 3LCTA 2O2UA 4AA5A 5JGDA 2OIDA 2PU8A 1MUOA 3BYOA 4QP8A 4YJQA 2PVLA 2ZMCA 4ITJA 4PX6A 4M12A 3PPKA 5HZNA 3NVMB 5LCJA 3LE6A 2REIA 2QOIA 3DAEA 4XV1A 3VRZA 4FV0A 5IF1A 2IPXA 5HLPA 3RAKA 3NZ0A 2BHHA 4OT5A 4HGLA 5CASA 3PXQA 1UNGA 1VJYA 3R21A 4K9YA 1L8TA 2FUMA 3QKMA 4USEA 1A06A 3HEGA 3O7LD 4CFMA 1OIQA 4DHFA 5CXZA 3OCTA 2C0OA 5CVFA 5ANEA 5HG5A 4J7BA 3ZCLA 3QCQA 1YW2A 4ZSGA 4B99A 4FKVA 2HCKA 4O7YA 5DNRA 5G1XA 4W9WA 3TUDA 4NFMA 3PDTA 3G51A 1W7HA 3IGGA 2X9EA 2QONA 3V01A 5BYLA 5IQAA 4IB0A 3TKUA 4IBMA 1J7UA 1CSNA 3MPTA 3OD6X 4UEUA 3Q52A 4EZ5A 2YZLA 1H28A 2PMLX 3K5VA 4EH3A 5C4KA 4HVIA 3CJGA 4OR5A 5AR7A 2NPQA 3W2SA 1E1XA 4QMUA 4C7TA 3U9NA 3UC4A 5M55A 4E73A 2YIQA 3AQVA 3SV0A 3C51A 3A8XA 5J9LA 3RJCA 1HCKA 3Q9ZA 5A4QA 2WQOA 2E9UA 4ZZMA 3QBNA 4DLJA 1SVEA 4FKUA 5CVHA 4BIBA 4NM0A 4AP7A 1NY3A 1WBVA 3VBTA 1XH8A 3W33A 1FVVA 4O7VA 5JSMA 4O82A 5IEXA 3VF8A 2V55A 4JVGA 2X2LA 4F09A 2XJ0A 3E5AA 3OW4A 2W06A 3I6WA 3NW5A 5DR9A 4G2FA 3Q5ZA 4F65A 3LMHA 3GC0A 3PE2A 3AD4A 4JG8A 4CQGA 5JZJA 4FV8A 1Q3WA 4ANOA 2R0IA 4XBUA 2R0UA 4J95A 4L68A 5AP6A 4D5HA 4UZDA 4E6CA 4O83A 3QC9A 4IH8A 4RVLA 4EONA 2X7OA 4KS7A 2WTKC 2HK5A 2PUUA 3CKXA 3LIJA 4FL3A 4GRBA 2ZM4A 4TPTA 3IOPA 3WZEA 3RI1A 2FSLX 4O21A 2WELA 2ZB1A 3BE9A 2XF0A 4L6QA 5AMNA 4NEUA 2O64A 4DTBA 1VR2A 3ORTA 4E1ZA 1PXNA 1NVRA 3UO4A 3WZDA 4QQCA 3OCSA 5HVKA 3FMEA 2B0QA 2XYNA 4FT9A 1Q8ZA 5FTOA 4PTCA 2QOBA 3O0GA 4ASZA 3L1SA 3RHKA 2C30A 3M42A 4C62A 4FZDB 4BKZA 4RVMA 3LXPA 1OPLA 3U8WA 4EOIA 3ZUTA 5EW9A 4GW8A 2FA2A 1ZRZA 1WBPA 3MH0A 1ZXEA 2VWYA 3S4QA 4FV7A 2JDTA 4XRLA 2EXEA 2DWBA 4DITA 4BY9E 1K2PA 4GUBA 5CQUA 3PVBA 4Q2AA 2I0VA 4XOYA 5F94A 1XKKA 5EKOA 5HLWA 3DAJA 3OUNB 5KX8A 3BU5A 4YZNA 3FLSA 2R3PA 3ETAA 3ZC6A 3ID6C 4RQVA 2Z7LA 4AA0A 3RTPA 2E9OA 3BRBA 3OBGA 4DH1A 1PXJA 3LKMA 4C61A 4ANLA 4FKSA 3TL8A 1OM1A 5I5ZA 3CEKA 3GU4A 3F5GA 3PTGA 5HE3A 1QL6A 1XR1A 3QUPA 4KKHA 2GNFA 4GT4A 3NIZA 4MXAA 4EZ7A 3E62A 3FAAA 4FC0A 3BLQA 4FZFB 4M84A 4QQ5A 5ETFA 5HCYA 4KABA 1OBGA 3UNJA 4ACMA 3CD8A 1V0PA 1YXXA 1J7IA 4DFNA 4QOXA 2ETMA 3P86A 3PXYA 2V0DA 5JQ5A 5B0XA 3EQFA 2IZTA 1JAMA 3F88A 2WOUA 3O51A 4TWNA 4QMYA 4X3JA 4D4YA 4XG4A 3AT3A 4IAZA 4N4SA 4DYMA 4JBVA 4WG4A 5T68A 4O84A 4BDIA 4L46A 3TJDA 1JQHA 4YTIA 2WTKB 3DKFA 3EL8A 3QCSA 2OJJA 4IIRA 3FHIA 4BDHA 2QOLA 3CTQA 5CEOA 2I0YA 3SVVA 4K18A 5DT4A 2W7XA 1IAHA 2O0UA 3NNXA 2OJGA 2F49A 5AP2A 1OB3A 5E7RA 3RP9A 5ITAA 1OITA 5CANA 5FEEA 3PIXA 1VZOA 5J95A 3FI3A 3PXFA 3QC4A 2PZPA 3QQKA 3LCSA 4BF2A 3E3PA 4C34A 2BIKB 4QMZA 3COMA 4I5CA 3LW0A 5E9EA 4KUJA 4F4PA 1ZYCA 4YZMA 1Y6BA 3VS7A 2VGPA 4EOKA 4WHZA 2J0KA 4FMQA 3V5LA 4V04A 4A9TA 3LM0A 4C3FA 3BPRA 3EQGA 3F3ZA 5BUEA 2ZM1A 4QYGA 4E3CA 2PZIA 5BMSA 4KSQA 3ZSGA 3HUCA 2UW5A 3I6UA 3R83A 3ZSHA 5IMEA 1G3NA 4I6HA 5ANOA 3MFRA 1ZOEA 4O22A 3OS3A 2ZOQA 1H07A 2J5EA 5IA5A 1NT2A 2ETKA 4U43A 1W82A 3O8UA 2GQSA 4O7SA 4FKTA 4AN2A 5IQIA 3Q53A 1JKTA 5D7VA 4XX9A 2IZUA 4UB7A 2PVRA 3DK7A 1U54B 4RWIA 4WRSA 2A4LA 4LV5A 4YO4A 5IUGA 3IK3A 4RBLA 4PWNA 3Q6WA 1REKA 5HLNA 2IZRA 4APPA 5IQEA 3VBQA 1KE5A 5K0KA 5A4LA 3NUSA 3SGCA 3VJNA 2W17A 2XEYA 4DEDA 2QU5A 3W10A 3KMWA 3RAWA 5C8KA 2XP2A 2B54A 2VTJA 2OJFE 4C3RA 3F5XA 1JLUE 2GQGA 2QD9A 2V5QA 2WIHA 4O6EA 3JR1A 3TDVA 4IM2A 5LVLA 2G2HA 4JBOA 4ZS0A 3OCBA 4FBXA 5BVEA 5AFVA 3K3JA 5E8XA 3VUGA 4UXQA 5AR5A 5F1ZA 1UWHA 2GS2A 2RFSA 4IWQA 5LARA 3U6JA 2UVYA 3FQEA 2J0LA 3LFNA 5HO6A 2XCHA 2YWVA 4F9AA 3E8NA 3EN6A 1XBAA 3CGOA 2Y7JA 3KRLA 4GVAA 3VWAA 4I0SA 3GU5A 4L44A 4PMMA 4U41A 5DRBA 3SD0A 3W55A 1YOJA 4Y5HA 4HVDA 2ZV8A 2CLXA 2CDZA 3ZRKA 3K3IA 5C01A 2C0TA 4L42A 4WUNA 5EG3A 5LXMA 5EYKA 4EC9A 4ANQA 2E9NA 4IW0A 3QHRA 4GKIA 1YXUA 2J2IB 3W1FA 4GFOA 4P4CA 5E8TA 3Q96A 2JITA 5J7BA 2CKQA 4KAOA 4O7TA 4ZAUA 1UVRA 3LVPA 4UWCA 2P55A 3UOJA 3PIYA 2WQEA 2W0JA 1M17A 3HX4A 1FMOE 4GS6A 5HEZA 3UQFA 2PUNA 1YQJA 3R9OA 3HMPA 4MCVA 2C5VA 3FV8A 4KA3A 2O65A 4G5JA 1URWA 2B4SB 5JGBA 2BUJA 2XNNA 1T45A 4L43A 5IDPA 3E7VA 4FTIA 2R3GA 4QP7A 3C50A 5IQFA 4AACA 3HECA 4P90A 2YJRA 3QZFA 4YGAA 4I41A 3FXXA 4OTFA 1TQPA 4RJ7A 4PPCA 3R7EA 3UZTA 2Q83A 4FKOA 4X2FA 3FMJA 3RPVA 5AV3A 5L6WL 4BC6A 3OEZA 3E8CA 2C0IA 5AIRA 3FL5A 4LL5A 2HWOA 2WTDA 3PA4A 4ALWA 3ZXZA 4OT6A 4JNWA 4BICA 5CSWA 1H25A 4CRSA 2WO6A 3GOPA 3KN6A 3R04A 3DT1A 4QTDA 4U45A 4G1WA 3AGMA 3VBYA 2WMSA 5IUIA 2R3IA 1IR3A 4QYHA 4AZSA 4AT4A 2DS1A 4EJNA 4UYNA 4ALUA 5BVDA 2ITZA 4F63A 2A1AB 3FDNA 4MXOA 4BKYA 3ZUVA 4N0SA 3RHXA 2BTRA 4DFXE 4RA5A 3ZO2A 4B8MA 4EH5A 1PMVA 2BILB 3T8OA 4YURA 3TZMA 4AOJA 1H00A 3ZO1A 4V0GB 2W9FB 4FV6A 2J7TA 1CKPA 1U54A 1MRYA 3GC7A 3UO5A 2PTKA 2QG7A 4ZTSA 3HAVA 4KIOA 4MQ2A 4DC2A 2WZJA 5FG8A 3VS4A 4AN3A 5HTBA 4I6FA 2H34A 2X8EA 2BDFA 4EZ3A 5L3AA 2Z60A 4AW2A 2XUUA 3ZXTA 5EQPA 4C3PA 3QQHA 4DG0E 4TL0A 4JR7A 3AT4A 4OTWA 3PYYA 4DBNA 5GIOE 1JKSA 4YBJA 4H3BA 4NFNA 5CAOA 3W32A 1PXKA 1H0WA 1W98A 3WE4A 4YJSA 4DCEA 2PYWA 3N4UA 2ERZE 4U3ZA 3WYYA 1OUYA 4GK3A 3R7UA 2B1PA 2GFSA 4JQ7A 4M8TA 3Q9YA 5A6OA 1YDRE 3EFJA 3ZDUA 3KY2A 5HX6A 1QPEA 1OPKA 3FQHA 3P5KA 5FBOA 5HIDA 4OTPA 5J8IA 5JQ8A 5EQEA 3WARA 4RWJA 5HICA 3E92A 3CPBA 3KXHA 4FKGA 1K9AA 1ZYJA 4GCJA 3DBEA 3TNWA 4HPUE 3S3IA 2QOHA 5AAEA 3VQHA 1SVHA 4HGSA 4KD1A 4DE4A 5AV0A 4N70A 4GT5A 4HZSA 2ONLC 2QOOA 5KHXA 4YJNA 3UIMA 4ZJVA 4NWMA 1H1PA 2G9XA 4KINA 4XG9A 3UNZA 4EHVA 4F9WA 3QU0A 5M56A 4G3GA 5IQHA 5CU3A 5CAVA 3GP0A 1RDQE 3PG1A 4MK0A 4MWIA 2XJ1A 5IEYA 5AJQA 2OIBA 5F9EA 1OL2A 4PUZA 2WQNA 1FPUA 2PMNX 4PDSA 2ETRA 4X6QC 3O7LB 4XH6A 4F1TA 3HYHA 5FBNC 5AUVA 3V3VA 3R7GA 1FMKA 4XNEA 4ANBA 3UMWA 3KCFA 3DTCA 3C5IA 2HZ0A 5AUWA 5FP5A 1M52A 1STCE 2YIXA 4R1VA 5E90A 2O3PA 3IONA 3HDNA 5HVYA 4PNIA 3I5ZA 3NWWA 4I20A 4MF1A 1AQ1A 5HHWA 4HPTE 2JDSA 5L8KA 3V5JA 2WTJA 2OLCA 3JUHA 2YABA 2XCKA 5KMNA 4GK4A 2RF9A 4BYJA 4WBOA 4I24A 3VIDA 4OTRA 5FGKA 5EW3A 4C59A 4YC6A 5GZ8A 2OWBA 4YHTA 3ULZA 3VS3A 4IACA 2W1GA 3WILA 4A9RA 3RK5A 4UZHA 3OG7A 1WBWA 4QTAA 3FY2A 4AN9A 4XHKB 2YHVA 4L45A 2C6TA 3KVWA 3OWLA 4V0GA 4I21A 4UBAA 3DFAA 5TT7A 3SQQA 2J51A 2JC6A 4PDYA 5HNGA 4JQ8A 3C9WA 3DS6A 1W8CA 2KULA 4XUFA 4JG7A 2J9MA 4RFZA 5ACKA 4R3PA 5BUJA 4QD6A 3NYVA 2JIIA 2JEDA 3PG3A 4MEDA 2XA4A 2YN8A 3TEIA 4YU2A 2CGVA 2E9VA 2ERKA 4FGRA 4JRVA 4XLIA 1GZOA 3E3BX 4BCFA 4QNYA 1OL6A 3OHTA 1KV1A 4IX5A 3SX9A 4R6VA 5IMXA 2GSFA 3RPRA 2YACA 4F0GA 4QTEA 3BGZA 2PMIA 3TV4A 2YIYA 4DEBA 5FQDC 1KE9A 5KZIA 4UMUA 2J6MA 2XK7A 4DH3A 4EBVA 1A9UA 2BFXA 5L2SA 2I0HA 1E9HA 4KNBA 3RCJA 3UIXA 1F5QA 2QKRA 5CF4A 3L9MA 3LCKA 4GT3A 2WTCA 3ZRLA 4EOSA 4QP1A 4QPAA 4YSMA 3F3TA 3G5DA 2B9HA 4BGGA 1ZWSA 3DZQA 3EIDA 5J79A 2X1NA 5CI6A 3R8UA 4DGLC 2WMXA 3TI1A 1DAWA 5DRDA 4FTTA 4QP2A 3CQUA 3W2RA 2PE2A 4ZTQA 3WF6A 4NJDA 3ORPA 4QTCA 3G9NA 3ODZX 3Q4UA 4O0UA 4RZVA 4UV0A 4AOTA 4PY1A 1KE8A 2VWXA 2Z7QA 4IJ9A 5EI8A 2BDWA 2X7FA 3EMGA 4IE9A 3OUKA 3FZTA 3BV2A 2W1IA 4FTNA 4NUSA 4BL1A 3GCSA 1O6KA 3QKKA 1BL7A 3HVCA 2JDRA 2Y8OA 3F3UA 3NAYA 5DWRA 4HYHA 5L2QA 5EM6A 1IASA 3UOKA 4C4JA 1RW8A 4QMXA 2OJ9A 4U7ZA 4Y8DA 3UPXA 4M7IA 3EB0A 3FI8A 2J4ZA 5EOLA 4FNZA 4BCOA 2BRBA 1JKLA 2RGPA 3MBLA 3MESA 4PPAA 4TYHB 4CCBA 5GNKA 2BTSA 5AP7A 5CF6A 3A7GA 5CTPA 4MXXA 4EI4A 4CTBA 3A4PA 4RGJA 4ZTHA 4DFBA 3OXIA 2OGVA 3V6RA 3E64A 5DEWA 1FGKA 4CYJA 4KWPA 3I7BA 4F9CA 2ZM3A 1JSUA 2Q0BA 3FQSA 2PPQA 3V04A 4F0IA 4AOIA 4GVJA 1GZKA 4JG6A 1VYZA 3OC1A 3QCXA 2CN5A 4D58A 5CF8A 4CVAA 2PY3A 5AAFA 4AX8A 4DH5A 3PIZA 3C0HA 3VF9A 3D14A 4IANA 2QOQA 4ZZNA 5JMSA 3OZ6A 3WE8A 3TNQB 2W4KA 3HP5A 3DKOA 4MVFA 3BGQA 2OFVA 4LYNA 2OXDA 2WMVA 2XEZA 3SAYA 3PLSA 5JEBA 4PP9A 5GINE 4BI1A 2C6KA 4DTAA 3LFAA 3R00A 5CU2A 5DEYA 3EQRA 4X2JA 4ZOGA 4QMVA 4EH4A 4RJ3A 4WNOA 3ZEWA 4JI9A 5I3OA 3W18A 2WB8A 1J7LA 4G3FA 4I92A 2XK8A 3RNIA 3I1AA 3ENHA 2OJIA 3BQRA 3MTFA 3EQCA 4XG7A 2Y4IC 1H1RA 3FKLA 5KMKA 4D28A 4HVHA 4QNAA 1H27A 3LXKA 4YLKA 4HYUA 4TRLA 2C6OA 2LAVA 2JDVA 4R78A 3UYTA 2PHKA 5AUZA 3DU8A 2JKMA 2ONLA 4C8BA 3DJ6A 1ZOGA 4H3QA 3W8QA 5AUUA 1XO2B 3G15A 4AZVA 3SC1A 1H26A 1L3RE 3NLBA 5A14A 5IA0A 5JKGA 5HKMA 5M09A 4PF4A 2XNGA 5DGZA 1Q8WA 4I22A 2WEVA 4ZMEA 1JSTA 2JGZA 3NCZA 4UMPA 5CALA 4DINA 1JSVA 4CLIA 1SMHA 3ODYX 3MV5A 3PP1A 5DA3A 4LG4A 4FKIA 3PRIA 2YIWA 4ZMFA 3FZ1A 2R4BA 2G15A 4IZAA 4BDDA 3EYHA 3DZOA 1TKIA 4G9CA 4OGRA 3UG2A 2X0GA 2XM8A 3FLZA 3H9OA 2QC6A 3BELA 3OY3A 4FIEA 5AA8A 5DBXA 2YZAA 4J99A 4FSMA 4KBKA 5H8GA 2JLDA 1M2QA 3MFTA 5K4IA 1FINA 2HZIA 2R7BA 4S34A 4BDKA 3FBVA 3KULA 4FTUA 4FTMA 4TYHA 1OPJA 4ENXA 1B38A 2F2CB 3GFWA 5C26A 2XNMA 1I44A 2W1HA 3HUBA 3CGFA 5CSPA 2V62A 3LCDA 2C5YA 4I93A 2XK9A 1DS5A 1ZY5A 4JJRA 4EOOA 5BVNA 3LXNA 4EL9A 2Z8CA 3P1AA 3FYJX 4DFYA 3NUUA 2X7GA 3GXLA 4Y73A 2XIYA 4YPSA 3R8PA 1GJOA 2UZVA 2XJ2A 4RWLA 5BVKA 4C37A 1PYEA 1H24A 4D0WA 4OLIA 5C8MA 4MXZA 1ZAOA 4JLCA 3KK8A 4M68A 2HYYA 5JZNA 4EH6A 3PY0A 4EQUA 4QMOA 4H05A 4E4MA 3D9VA 3JPVA 3UIUA 2BZHB 5HE2A 2Y4IB 5M51A 3DNDA 5EHOA 5M08A 3CC6A 2WMRA 4I6BA 4QMNA 4YMJA 3VULA 3IW7A 3F9NA 4Z16A 2QLUA 2X6EA 2WD1A 2XKEA 3ROYA 3COHA 2OU7A 4FSRA 2BRNA 3BYSA 3QD4A 5CEIA 5DE2A 2GHGA 5CAUA 5CEMA 2C4GA 3A7IA 4W4YA 1OUKA 4MNFA 4F99A 4LMUA 5M06A 4IZ7A 4TYIA 3PLAE 2C3LA 4AUAA 1CTPE 4IFGA 4EH7A 3RK7A 4E4LA 2AC5A 2UUEA 2G2IA 3HDMA 5AM6A 4BBFA 2YDJA 3S1HA 3TM0A 5EDRA 3SHEA 4O0RA 3BBTB 4FK3A 4WG5A 5CU6A 3UZPA 1W0XC 4XP2A 2X8DA 3TACA 4FT0A 3UODA 5AAGA 2CNQA 1XH9A 4BCMA 2HZNA 1UU3A 3QRUA 4CFWA 3O71A 4NT4A 4OBOA 1J1CA 2R3HA 2WQMA 3P79A 5H8BA 4D4SA 5IQBA 3PZHA 1NVQA 2VTPA 3TT0A 1Y8GA 3N9XA 3D4QA 2QI8A 1URCA 4LOPA 5J7HA 3G0EA 1M2PA 4GJ3A 1QMZA 4W4VA 1J91A 4NK9A 5DLSA 3NVKI 4R5SA 2HY81 1WAKA 1LEWA 3LHJA 3VUHA 3AGLA 3I0OA 4GFGA 4U3YA 4GYGA 1Q8YA 2H9VA 5DHJA 5BMMA 3VUIA 3CJFA 5EM5A 1UA2A 4ZEGA 4QMSA 2GTNA 1H0VA 5HBHA 3MWUA 3FLWA 2ITYA 4BIDA 4HVSA 3CTJA 3R2YA 3CCNA 5H3QA 2JIUA 3ALOA 4LRMA 4QP4A 3CKWA 3HV4A 4FVQA 3GENA 3ZFYA 4HZRA 3F3VA 4C4FA 4FTAA 1OL7A 3QTSA 5HG9A 1U5QA 4V05A 4AU8A 4KB8A 5A3XA 4EK8A 3D2KA 4X21A 1NXKA 4QYFA 3TV6A 4F70A 2B9IA 3OWJA 3P4KA 3PJ2A 5CU4A 1P4FA 3PZEA 3V5WA 4U80A 4XBRA 4E5BA 5I3RA 2C3KA 2YCSA 3QRIA 4K11A 3ZFXA 2CMWA 4IAIA 4DFUA 5HCZA 3MB7A 4LQMA 3Q2JA 4FUYA 3Q4TA 4CMTA 5IUHA 5CT7A 3EN9A 4AZEA 4UMTA 3WF8A 2IVSA 4CMUA 2JBPA 4RFYA 4FSTA 2W96B 3DK3A 4WBBB 5ANGA 4FIGA 3FXZA 5A9UA 3I0QA 5EHLA 3OROA 5AP0A 2FSTX 4RMZA 5EI6A 1H8FA 2VZ6A 3DA6A 3NGAA 3LJ2A 3QRKA 4K6ZA 4YPDA 4QMQA 1OL1A 4EJ7A 3KRRA 3FJQE 4G3CA 5EYMA 3DJ5A 5HIBA 4PMSA 4FZ7A 5FXRA 3UVRA 2QG5A 3NS9A 3ZC5A 5IQCA 3KF4A 5E8UA 4E5AX 2CCIA 4MD9E 4ACGA 5AV4A 3DOGA 4Y85A 3FC2A 3UNKA 2UZUE 4LV8A 4BVUA 4Y72A 3UQCA 5C9CA 5J9ZA 5HNBA 3PSBA 4FT7A 3KGAA 4C0TA 5JFXA 2YDKA 1OBDA 3RAHA 2R7IA 4UXLA 3BU6A 4EH2A 1ZARA 4FEUA 2C5XA 4XYFA 2OXXA 3NSZA 1XWSA 4GK2A 4I6QA 1B39A 4XG3A 1TVOA 4I23A 4TN6A 4AG8A 4HW7A 3VS5A 3BHHA 2QURA 3ZTXA 4Z3VA 3AOXA 1YOMA 3BU3A 1Y57A 3G0FA 3MFUA 1JKKA 3OTVA 3QKLA 4FG8A 4YNOA 5DYJA 4DAWA 3IW8A 3BHYA 4C58A 5DN3A 2GTMA 3SDJA 1RJBA 3RPOA 4XV3A 4I0TA 4AAAA 1KUTA 2JBOA 4FEVA 4GKHA 2GPHA 3SW4A 1GNGA 2ZAZA 4B4LA 3I4BA 4AS0A 2PE1A 2GDOA 2YCRA 2PSQA 5AA9A 3EJ1A 3UZRA 1PMEA 4FKJA 1BI7A 3R9RA 3QXOA 1ZOHA 4M0YA 4QYEA 3KXGA 2BAKA 4YC8A 1J3HA 3UP7A 3Q04A 2W1DA 2QOFA 1JPAA 5BVFA 4IDTA 4K33A 3PPZA 4YJOA 4ASXA 2OICA 2XRUA 2R3OA 5I9XA 4PP7A 3FKOA 4YO6A 3U51A 5I9VA 4CG8A 4R8QA 3VBWA 4WKQA 4A4LA 3B2WA 4D5KA 1QPCA 1OL5A 3BBWA 4YZCA 3ZLYA 3C4EA 1IA9A 4QMTA 4V01A 2C6IA 1Y6AA 4E6QA 4EHZA 3R8MA 4JS8A 2VO7A 4NTSA 1XH6A 5KMLA 3PXRA 3ORKA 3K54A 4L3LA 2JFLA 3FZRA 2F9GA 2PVJA 3SKCA 3ZH8A 5C27A 3ROCA 4UWYA 4G34A 4Q5EA 3W2PA 2XM9A 4A9UA 4YTCA 4IM0A 4JIAA 2PVFA 1BUHA 4YHJA 5HO8A 4E4XA 4X3FC 4K8AA 3MYGA 2I40A 4K0YA 4BDFA 3DBFA 4MHAA 1AD5A 2VTOA 5B2LA 3KN5A 3PPJA 1Q3DA 3DXNA 2W99B 3FWQA 5E8VA 5F95A 4R7IA 3VUMA 5LWMA 3R2BA 4GG7A 4IWPA 5I0BA 5IPJA 4BCQA 1ZMVA 2PMOX 4FIJA 1FBNA 3HMNA 4BR3A 1M14A 3GCQA 3R8ZA 5EKNA 4MH7A 5LQFA 4IAKA 2ITVA 3T3UA 4II5A 2WGJA 3QRJA 2B9FA 2XIZA 4L9IA 4IAYA 3BCEA 3CR0A 5D7AA 4GSBA 2J5FA 2CSNA 4TNDA 2PZYA 1IG1A 3H9RA 4FKRA 3QALE 3QQGA 4KBCA 5FTGA 4W4XA 3TZ8A 4MD7E 2ZMDA 3DKCA 4FV3A 3IQ7A 1JVPP 3MY1A 4FIHA 4MBLA 4YJPA 5HE0A 2RL5A 5LMBA 2OW3A 4H3PA 5F4NA 3MB6A 5ETIA 1RE8A 3E87A 4I3ZA 2GFCA 1WVWA 2J0JA 5HQ0A 4FV4A 5K9IA 2Y0AA 3E63A 3D7TB 4RA4A 4IZYA 2OIQA 3E93A 4I5MA 3WZUA 4CKJA 5E91A 3VAPA 3QYWA 2UW4A 2C6LA 3QCYA 5FEDA 4RC2A 4CT2A 5BUIA 3N51A 4BDGA 5K5XA 2H6DA 2IW8A 3E88A 5EM7A 2CLQA 3B8RA 4IAAA 2IVUA 3U6IA 3RWQA 5IH5A 5LVNA 5HESA 4GG5A 2YCFA 3D15A 2JIVA 1GZ8A 4RIWB 2IW9A 5KMJA 3NDMA 4NTTA 3QHWA 2XIKA 3QTIA 2VTNA 1OI9A 3BHVA 4WD5A 4W8EA 4A4OA 3OWKA 2C69A 5HVJA 1SYKA 3VN9A 5CU0A 3BV3A 1YWVA 1SM2A 5ANDA 3LFCA 4RJ6A 2DQ7X 5H9BA 4IWOA 3QD0A 4X3FB 3F2AA 4PDPA 4DLIA 2O5KA 1F0QA 2NRUA 3WIGA 2XK4A 1YXSA 1GZNA 4ZTRA 5DPVA 4F9YA 3AC5A 3NYOA 3P7AA 3DB8A 3PVGA 4IAFA 2W4JA 4PMTA 3WYXA 4ZZOA 1G8SA 5IU2A 2IW6A 3FL4A 3A60A 3SOCA 4DG2E 5HU9A 3BWJA 2PVNA 3KL8A 2YFXA 2YJSA 2R5TA 3KXNA 4QQJA 2VO3A 2WQBA 3MPMA 5FM3A 4D2SA 4IM3A 4C4GA 1H1SA 5DVRA 4J1RA 3VBVA 4L00A 3R9DA 4O96A 1NA7A 3MA3A 2IVTA 3MY5A 3R8LA 2X4ZA 3UO6A 5L2IA 3GC9A 5CYIA 5BX0A 2C6MA 4YR8A 2UW3A 4DEEA 3H10A 4ANNA 4J8MA 1K3AA 3FEGA 1Z9XA 3VUDA 4IB1A 5AR3A 4BTMA 4IJPA 5T3QA 3SXSA 4ASDA 4RX5A 4BRXA 1Q97A 3C1XA 3AD6A 3DBQA 4TY1A 4CV8A 4D4VA 1WMKA 3PJCA 5HIEA 2WU6A 5GZ9A 1ND4A 4CZUA 3OW3A 4FYNA 1LP4A 3K2LA 5IQDA 3FMKA 4PTGA 3EQPA 3O17A 1M2RA 3FKNA 5TR6A 3SXFA 2P33A 3UGCA 3C4FA 3LFFA 4G9RA 3DNEA 3MSSA 1X8BA 4AT3A 2F57A 4FF8A 3KREA 3OEFX 4MYGA 2VTQA 4USDA 3W8LA 3AT2A 4TYGA 3F82A 2GMXA 3I5NA 4J53A 2BZIB 2IO6A 2Y9QA 1YKRA 2X81A 4ID7A 5E92A 5FM2A 2DYLA 4RVTA 4CFXA 2VGOA 5JK3A 2NNWB 3RM6A 5K5NA 3E8DA 5HBJA 3QF9A 4FKPA 4BKJA 1GIJA 1BX6A 3JYAA 4WNKA 4XEYA 5DR6A 4YZBA 4NH1A 2CKPA 1Q5KA 2ITQA 4FI1A 2QODA 4EK6A 3ORNA 4BN1A 2EXMA 4AZFA 1PF8A 3C0IA 3L8XA 2W4OA 4HNIA 3TIYA 3ZZEA 5IA3A 5LMKC 3MVLA 3R01A 4FTOA 2VWUA 3EKNA 4Y83A 2WTVA 1P14A 4WA9A 2R3FA 2UW9A 2F7EE 4L7FA 5DIAA 4ENYA 2XK6A 2UZNA 3F6XA 1R39A 3QAME 3LOKA 4J96A 5AIKA 3MPAA 2LGCA 4RIWA 2PUIA 3NUAA 3C5UA 3S2PA 1BKXA 1G8AA 5KMMA 3NNVA 3TDWA 5D9HA 3N4VA 4A07A 5HTCA 4B7TA 3CIKA 3PUPA 3EHAA 1PXLA 1YHSA 2OBJA 4IVBA 1A48A 4IX6A 4JT3A 3DXPA 4X3FA 4BDEA 1FVRA 2BKZA 3MH1A 4FZ6A 4PTEA 5GJGA 3SXRA 3PJ3A 3R7OA 3MH3A 4WG3A 4CFNA 1XBCA 2BMCA 4QTBA 4X6RA 4YLLA 1S9JA 3CQWA 4A7CA 4I0RA 4F64A 3VJOA 3EQHA 3FI4A 4XG2A 2B55A 2ZYBA 1BYGA 3LFBA 3DXQA 3BGPA 4CSVA 3PRFA 3V51A 2R64A 4WT6A 4YC3A 4RC4A 2ZV9A 4CEGA 4EHEA 3IKAA 3MI9A 4EWQA 4DEHA 5E1SA 5LVMA 2GNGA 2BHEA 2UVXA 4Q5HA 3Q4ZA 2BPMA 1KV2A 3FMNA 4DFLA 2WPAA 2HELA 5C8NA 1SZMA 4IB3A 5L8JA 2PUPA 2A2AA 2P3GX 4EWHA 3ACJA 3G6HA 4P5QA 4BHZA 3UDBA 2FGIA 2OFUA 2VTRA 3RWPA 3RBWA 4BDBA 1JNKA 1H01A 3FE3A 4NKSA 3OVVA 3TUCA 4I5PA 2RG5A 3KVXA 2UZTA 3Q5IA 4FTKA 4BBMA 4BZDA 3TCPA 4EUTA 4F7NA 3LQ5A 4NKAA 3VO3A 3NIEA 5GZAA 2VWIA 4C35A 5EI2A 4FODA 4BTJA 5FLFA 2CPKE 4W9XA 3WZJA 2VX1A 4G5PA 2X9FA 1OKYA 5AP4A 4RJ5A 2UW0A 4U5JA 4BGHA 2XMYA 2YM5A 4ASEA 1NW1A 3MDYA 4MBJA 5ICPA 4U8ZA 1KWPA 4HCVA 4TZRA 4EKLA 3SG9A 4P5ZA 2J50A 3MIYA 4LUEA 3MVJA 4PV0A 3C4XA 3EQDA 3PVWA 4CFUA 4L53A 5L6PA 5DR2A 5KMIA 1PMUA 3QYZA 2P4IA 3EFKA 5LWNA 2QR7A 4LGGA 4W4WA 4E93A 2EUFB 4GIHA 4BCIA 3QGYA 2W1EA 4GYIA 3REPA 3ZBXA 2ZDUA 1Q8UA 2UZOA 3AD5A 1DI8A 2XYUA 4P2KA 3QQJA 2YDIA 4IMYA 1PHKA 2YERA 4JAJA 3QA8A 5EYDA 5AM7A 3AC4A 3SW7A 2PZRA 3KMUA 3B8QA 3QUDA 3GQIA 3EKKA 3GBZA 4PQNA 3PFQA 4MX9A 3TZ9A 4FEXA 2EB3A 5AP1A 2B52A 1H4LA 4S30A 4D2TA 1YWRA 4EOJA 3GNIB 3U4WA 1H1WA 2C1AA 4LMNA 1F3MC 1YI4A 5JFWA 1XH7A 4N57A 2C6DA 3P7BA 4FE2A 4MAOA 2GHMA 4A9SA 5KMOA 3QTRA 5BYYA 3ORMA 4ACHA 4NCTC 3C4WA 1OIUA 5HOAA 4BYIA 3WZKA 1I09A 3MVHA 5I9YA 2X6DA 3A2CA 1S9IA 3PY1A 2OF2A 3NNUA 3TXOA 3ATTA 5AUYA 3BWFA 4HGEA 3ZEPA 1O9UA 5B2KA 3GGFA 3FMDA 4WIHA 3D5XA 5LVOA 2I7QA 4FIIA 3C13A 2XVDA 3HMIA 4KS8A 4C33A 3HV3A 4IHPA 4JDKA 5CLPA 5KUPA 5CZIA 4DN5A 4Z7HA 2HW7A 4RJ4A 4LI5A 4NM5A 5EW8A 3E7OA 4CFVA 2VO0A 2FYSA 4YP8A 5T6KA 4ANMA 4ZP5A 3DB6A 2C3IB 3MJ2A 5D10A 4BFMA 5HTIA 5LMAA 3ZSIA 4ZLYA 4KIKB 2XIRA 4TYJA 4FL2A 5JRSA 3IDPA 2BCJA 3OP5A 5FWKK 4CYIA 1GIIA 1Y91A 3TJCA 3JS2A 5F20A 1JWHA 3AC3A 4MF0A 3UIBA 5M53A 4FL1A 1DI9A 2C47A 3ALNA 3R02A 4WO5A 4F1MA 4AGCA 1LR4A 5ANIA 2QO2A 2YISA 3A7HA 2WNTA 3C4CA 3EOCA 4BIEA 3VNTA 1Q8TA 4PNKA 5CSXA 4G31A 3V5QA 4CFFA 3DKGA 3T9IA 4H1JA 3VRYA 4FEQA 4E4NA 2CKOA 5I9UA 1YWNA 4AGWA 2GS6A 5LMKA 3H9FA 2QQ7A 2VWWA 5CAQA 3VHKA 4FTLA 4F9BA 2R3RA 2ITTA 3TUBA 3EN7A 3UQGA 4TNBA 1WZYA 4PL4A 4QP9A 5KBQA 4A06A 1Z57A 2QCSA 2QLQA 2VV9A 4Y95A 4FNXA 2R3KA 5CZHA 4O7LA 2WTWA 2RSVA 4IVCA 4QT1A 5CSHA 2F7XE 4HNFA 1IEPA 4L67A 4LM5A 4BBEA 4EYMA 4WOVA 4R77A 3M1SA 2C6EA 5ETAA 1APME 1CDKA 1E1VA 2XS0A 3IGOA 3VHEA 3Q32A 3R28A 3HP2A 5A4EA 4KSPA 4NL0A 5KE0A 3W2OA 2BRMA 4NJ3A 2QOCA 4DGMA 4FKQA 5IA4A 2GNHA 3O96A 1RQQA 3IDBA 1CMKE 4YNEA 4F7LA 2VN9A 4I5HA 2R3QA 5AR2A 4C2WA 3NW7A 4D2WA 4EUUA 2GHLA 1OKWA 3H30A 2P2HA 2WMAA 3FMLA 1V1KA 3DGKA 3U54A 3UP2A 3KXMA 4TWOA 4O86A 2WHBA 3OT8A 2J0MB 3V8SA 4RWKA 5K3YA 4KRCA 4RX8A 4BI0A 4OAVB 3ITZA 3QTWA 2PK9A 4O0XA 2BZJA 1WVYA 2QHNA 4FV9A 3QZIA 3GQLA 2PULA 5DH3A 3KXZA 3OBJA 2OH4A 2QKWB 3ZRMA 2HIWA 3QQFA 4K1BA 2WMUA 2XKCA 4KRDA 2UZBA 4EBWA 3LFSA 3NUPA 3F2RA 2G01A 5IG1A 3RALA 2VWZA 5EFQA 3U4UA 3F61A 3ZO3A 3ZONA 5BPYA 5HG7A 4JL9A 5BVOA 3QA0A 5AP3A 3R63A 3QRTA 3LLTA 2CHLA 2QO9A 2YM4A 3D5UA 1O6YA 4ZLZA 2RFNA 3FHRA 2QR8A 3OWPA 3Q9XA 5CWZA 3PSDA 3EN5A 2OH0E 1YI3A 1ZYSA 3AC2A 5C03A 2JD5A 4FVRA 3EQIA 2XBAA 2YIRA 4AGDA 4D9UA 2RG6A 1OKZA 1OKVA 2H8HA 5HD7A 2XZSA 4RVKA 4HYSA 4RLLA 5FXSA 4X0MA 2ESMA 3NUYA 5CVGA 2R3NA 5CQWA 3D2IA 4M69B 3VQUA 4ARKA 2X2MA 4X2NA 3ZBFA 1UU9A 4O2PA 3L8VA 3HMMA 5HCXA 4N6ZA 4Q9SA 4AT5A 2GNJA 4LUDA 4TT7A 1YXTA 5D41A 1Q24A 3VUTA 2W1CA 3ZS5A 3Q2MA 2NRYA 3DLSA 4GEOA 2R2PA 3VVHA 3W16A 4BCNA 4GH2A 5FD2A 4BB4A 5KBRA 1WBSA 2FB8A 1SNXA 3ZOSA 1UWJA 4FG7A 2F7ZE 3UOLA 4AZTA 3G33A 3GC8A 5J1WA 4FZAB 1ZMWA 3GEQA 3O2MA 1XH5A 4IC7A 3UVPA 3A62A 2A0CX 3E8EA 1PXMA 2OKRA 4MXYA 3MS9A 3QLGA 5AP5A 1WBNA 4BDAA 4ZIMA 5CEQA 4QYYA 4EK4A 1PJKA 3RK9A 3F7WA 2VU3A 4DT9A 2JKQA 2ITUA 1MQBA 3GU8A 3IG7A 4UN0C 3ZZWA 3OTUA 4GUEA 4H36A 3MN3A 4ZTMA 2ITPA 2VD5A 4O7WA 3QWKA 2OK1A 2CGWA 3EFLA 4YUQA 2ZJWA 3OT3A 4WUAA 4ZJJA 1Q4LA 3D7ZA 4DEIA 4E6AA 3EZRA 5CNOA 4M14A 3CP9A 2P2IA 3BQCA 2RFEA 3DLZA 2CCHA 3TKHA 2BALA 2BAJA 2JAVA 2Y6MA 3AMYA 3HV5A 3II5A 3LMGA 4TWPA 4FUXA 3SRVB 3KC3A 3KCKA 4BGQA 4U6RA 4RRVA 3R6XA 5D11A 3ZHPC 4XG8A 3HRCA 4EQCA 5M4FA 4H39A 4YSJA 3PP0A 2X39A 4NCTA 5E4HA 2VTAA 3TNPC 2YM3A 4M13A 1O6LA 3R9HA 4O7NA 3CSVA 1BLXA 3KQ7A 4D1XA 4S32A 4LRKA 2X4FA 3MJ1A 4H1MA 4IDVA 4LGDA 2CN8A 4LRJA 1FGIA 3D83A 2EWAA 5HX8A 3JVRA 5I4NA 3KFAA 1GAGA 2XIXA 3W2QA 1XQZA 2IN6A 4ORKA 4BWKA 1QPJA 4DF3A 2HAKA 2UW7A 4O2ZA 4U79A 2DUVA 5M57A 4UX9A 2PL0A 4YJVA 4NW5A 3PXKA 1Q99A 2PVMA 3K5UA 5KCVA 2WMBA 4FTCA 5GHVA 4R7HA 2IWIA 5M4IA 3Q9WA 1PRYA 3HA6A 1WBOA 4DH8A 1V0BA 4UMRA 3RINA 4AFJA 1TQIA 3FZOA 3KRWA 4TYEA 1OGUA 1U5RA 3HRBA 4F6WA 1BL6A 2HOGA 4X7QA 5AADA 2WU7A 4R5YA 4DBXA 2H96A 5IQGA 3EL7A 3DY7A 5C1QB 4BZOA 2JFMA 3KU2A 1YHWA 1SNUA 2E9PA 2OSCA 3ORLA 4K2RA 1FVTA 4RFMA 4GJ2A 1DM2A 2VX3A 3JXWA 1KOBA 4M66A 4R7BA 3FXWA 4EOQA 4M15A 2Q0NA 4FT5A 3ACKA 1ZLTA 2OXYA 2X8IA 5AR4A 5CEKA 4U44A 5IZFA 4ITHA 4HCTA 5KZ0A 4M69A 4OTHA 5HO7A 5B2MA 5L2TA 2FO0A 3HZTA 3KF7A 3HA8A 3P0MA 4MBIA 4QRCA 4Y46A 4CNHA 4ZJIA 5B7VA 2VTTA 2VRXA 3KB7A 3RZBA 1P5EA 5E8YA 3L9NA 5E8ZA 4JDHA 5H2UA 3R8VA 2HZ4A 5TE0A 4FNWA 2GS7A 2ITXA 5E1EA 4HJOA 4IVDA 1H08A 1UKIA 3VS2A 2RFDA 5FEQA 4WSYA 4YJRA 1ZYLA 4RLKA 4X2KA 2FSMX 3GCUA 2C68A 2CKEA 3RCDA 2XNBA 3Q6UA 3IW6A 4HVGA 1ATPE 3PE1A 4BTFA 3ANQA 1KSWA 4XP0A 3A7JA 3G6GA 1PW2A 1ZZLA 2BAQA 3G2FA 4TXCA 5E8WA 4EK3A 5AR8A 2BROA 3ENMA 3POZA 1UNLA 4NU1A 3FLNC 3O23A 3PVUA 4B0GA 5L6OA 3MY0A 4FICA 5FUTA 1V0OA 2AYPA 2UZWE 2YM6A 3NX8A 5EH0A 3FLYA 3SRVA 5IDNA 3BHTA 2QHMA 2GQRA 4RIXB 5CAPA 1GY3A 5JT2A 3B2TA 3GU7A 1U4DA 3WOWA 4AW0A 4FIFA 4C36A 2VAGA 1OVEA 4DCAA 5JRQA 3DV3A 3QTQA 3QL8A 4B8LA 4J8NA 2VTMA 3RMFA 2ACXA 4R1YA 3IS5A 4C57A 3HLLA 4PDOA 4EORA 2R3JA 1P4OA 1ERKA 3MVMA 1WBTA 2GNLA 3MFSA 3ZFMA 5E8SA 4NM7A 5L2WA 2PWLA 2IVVA 1T46A 3R7VA 2R9SA 3C0GA 3DFCB 4YZ9A 1VEBA 4BZNA 3DPKA 3QZHA 4G3DA 4I94A 4JBPA 1EH4A 4YHFA 4CZTA 1YRPA 4HOKA 3FZPA 4U42A 1OECA 5CENA 3CBLA 2GNIA 4JBQA 4ZXTA 4EOMA 4FV5A 3LAUA 3QTUA 3NYXA 2ZV2A 3F7ZA 4O0VA 2IG7A 4Y5QA 3I7CA 3M11A 4B6LA 2EVAA 3EH9A 3JY9A 1Q62A 4B9DA 5HU3A 1PXIA 2X2KA 3P9JA 3QQLA 2V22A 5ETCA 4EEVA 5LVPA 2I6LA 4L7SA 4OUCA 4GL9A 3SLSA 3I60A 5A46A 3RPSA 5M4CA 3UPZA 3EZVA 4RIYB 2ITOA 2NP8A 4L3PA 3DBDA 4F7JA 3BI6A 2HENA 3NYNA 4FSQA 4HGTA 4PPBA 4S2ZA 5CSVA 5AWMA 3THBA 1Q41A 2VTSA 5CEPA 3N4TA 2QU6A 5ACBC 2PVYA 2XK3A 5DT3A 4NZWB 4NYEA 5BYZA 4RZWA 3TWJA 5AV2A 2YITA 3UC3A 4N6YA 4BDJA 2WKMA 1REJA 1U59A 3FSFA 3LM5A 5L8LA 4HYIA 3EFWA 3HL7A 3ZDIA 3AMAA 4D1SA 4M0ZA 3VS0A 1JOWB 4FSNA 4GU6A 4TW9A 4I1ZA 5DI1A 1MP8A 2WMTA 5IEVA 4ZY4A 4RPVA 5EHYA 4IZ5A 4FGBA 2UZLA 4O91A 2JAMA 3FY0A 3DQWA 4AA4A 5J9YA 1G5SA 2VWVA 4XP3A 3ZUUA 1Y8YA 3ANRA 4QMMA 4CTCA 2BRGA 1W84A 2VNYA 3OOGA 4FG9A 4RIXA 3RAIA 3TZ7A 5CNNA 2BR1A 3WF7A 5L4QA 4C4HA 3SA0A 3I81A 4LOQA 4ZLOA 4MTAA 4ERWA 4UMQA 3UJGA 1XH4A 1ZYDA 3VW6A 3IW5A 5H8EA 4DG3E 4EH9A 4OBPA 4CV9A 3BEGA 4LL0A 5IKWA 3RM7A 2YM7A 4M3QA 4O0YA 3IO7A 4IWDA 3T3VA 5J87A 3A61A 1R1WA 3QUEA 2XNPA 4FK6A 3PA3A 3QWJA 5GIPE 3LFDA 4BCJA 2W5AA 4E7WA 2ITWA 4R3CA 4TKSA 2W5BA 3QD2B 3FYKX 1J1BA 3DDPA 5IISA 2F2UA 1QCFA 3DCVA 4USFA 2O8YA 3NEWA 3CE3A 3ZU7A 1PYXA 2Y6OA 4QP6A 4RQKA 4AF3A 4ONAA 1IRKA 1UKHA 3RGFA 1QPDA 2EXCX 2PVKA 3PJ1A 5JGAA 4BDCA 1PMNA 5G6VA 3AXWA 2B53A 3ZLSA 3QX2A 4E26A 4AQCA 4D9TA 5A4CA 2RIOA 1ZY4A 3GCVA 4ANSA 2W9ZB 4EC8A 4KKEA 2HW6A 5D1JA 4ACCA 3UE4A 3LPBA 2W5HA 5CXHA 4F6UA 4QP3A 3R71A 3BX5A 3CQEA 2AUHA 2UZEA 2GU8A 4Z9LA 3PA5A 5HBEA 3V5TA 5IH4A 5CX9A 3DDQA 5A6NA 3GI3A 4DFZE 1YI6A 3C7QA 3OXZA 5J5TA 2C3JA 3U55A 3LCOA 3EQBA 1HOWA 4RIYA 3KKVA 4NW6A 4LOOA 3I79A 3HMOA 4C4EA 3NR9A 5J1VA 3A7FA 4WSQA 4OAUC 2ITNA 5FTQA 4LFIA 4MWHA 2BFYA 3O50A 3U87A 3BKBA 3VUKA 3QZGA 4A4XA 3NCGA 3VW8A 5M44A 3DTWA 4MQ1A 5AX3A 5CI7A 4H58A 2XB7A 3FI2A 4IC8A 3L9LA 1BMKA 4IQ6A 3S00A 3CPCA 1NVSA 3S0OA 2C1BA 3CLYA 3BYUA 4FV1A 3LQ8A 3U9CA 3LQ3A 3UTOA 4EOLA 4BI2A 4BWPA 3PWYA 3BLHA 3FSKA 1KOAA 4E20A 5DG5A 1DAYA 1YDTE 3MH2A 3PXZA 3UVQA 3BEAA 1YDSE 2R3MA 2W05A 4XRJA 3RNYA 5KKRC 4EOPA 4ZK5A 5I9WA 2AC3A 1M7NA 3R1SA 1YOLA 3ZMMA 4KBAA 4KIQA 2ZB0A 4M97A 5LCKA 3JY0A 4CT1A 2PVHA 1B6CB 2YCQA 3R0TA 4W8DA 2PZ5A 4FX3A 2HXLA 4IVAA 3ZM4A 4DA5A 3W2CA 5EYCA 5JH6A 4HCUA 3HKOA 2FSOX 4MKCA 4U81A 3ELJA 5DMZA 1LEZA 2UVZA 2XBJA 3HV6A 1SVGA 4O27B 4S31A 4YBKA 3TIZA 3L8PA 3D7TA 3QTXA 4JOAA 4OTQA 4XOZA 3GU6A 4MXCA 2EU9A 4CD0A 2CGXA 4MNEB 2WTIA 4Z7GA 4FTJA 3ERKA 4JRNA 3KRJA 3V5PA 2BDJA 2VTLA 3VBXA 4G6NA 3O8PA 3LZBA 4F1OA 4JIKA 5K0XA 2WEIA 5M4UA 3IPHA 3F66A 1OIRA 2JKKA 4QMWA 3R9NA 4TWCA 4RX9A 3TTIA 3MGYA 4C02A 4DGGA 4RX7A 4YJUA 4CZYB 4J52A 4U97A 3WF5A 4EYJA 3GOKA 5KNJA 1CKJA 3NNWA 4DGNA 4EHGA 1LUFA 3P7CA 2ZDTA 2QVSE 4FNYA 3IOKA 3LXLA 2SRCA 3DBCA 2Z02A 2WMQA 5DFPA 5IA2A 4FKWA 4FVPA 4EK5A 5JFSA 3V6SA 3AC8A 4AE9A 4YZDA 1UU8A 4AW5A 4RG0A 4DH7A 4ITIA 5KHWA 3BZ3A 5LOHA 5A54A 4FT3A 4D2VA 3ORIA 4YJTA 3H4JA 4L3JA 4U9AA 3MA6A 1BI8A 5A4TA 3HAMA 5HE1A 4FSZA 4AW1A 3EN4A 2VX0A 4O6LA 5KO1A 4YTHA 3BYVA 2UW6A 3H3CA 4JDIA 4WNPA 3WI6A 3CY3A 2W1ZA 4EQMA 3R7YA 3A4OX 2WXVA 4I4FA 1WVXA 3L8SA 4XJ0A 4IX4A 3T9TA 2JKOA 1YXVA 1H1QA 1FOTA 3CY2A 1WCCA 2HY0A 1VYWA 2V7AA 5KKRB 4D2PA 4GU9A 1LPUA 3UYSA 2G1TA 5GJFA 5TO8A 4JDJA 4FR4A 4CLJA 4OTDA 5BNJA 4CKIA 4F0FA 3BLRA 4E8AA 5TF9A 3RPYA 3TNHA 1JBPE 4FEWA 2YAKA 3F3WA 1UU7A 4KIPA 1XJDA 3OFMA 5DT0A 4O81A 2CJMA 3QLFA 2C5NA 1M7QA 2NO3A 3LFQA 4AFEA 4C2VA 5HNIX 5AUXA 4OTGA 4IXPA 4A9YA 3FPQA 1W83A 3D0EA 4F6SA 3ZM9A 2C5OA 3FMMA 1OZ1A 3HV7A 4O1OA 3RVGA 3RZFA 2YLEA 3GUBA 5I9ZA 1CM8A 1Q61A 2JDOA 3P23A 2XKFA 3P78A 4BWXA 3QTZA 5M07A 3IECA 3FPMA 5EQYA 4ZSAA 1GIHA 4J98A 4OTIA 5EOBA 2ZV7A 1Z5MA 4XMOA 4JR3A 4D55A 3DJ7A 3C4ZA 5HORA 3LFEA 3QXPA 3UBDA 3VC4A 3BE2A 3IDCA 3MIAA 2VNWA 2WMWA 5EDPA 5LJJA 3HGKA 4U40A 5AEPA 3GCPA 1R0EA 3BYMA 4RJ8A 2HXQA 4JAIA 4CCUA 2CGUA 3F2NA 3ZO4A 4MNEA 4DT8A 1PKGA 1KE7A 3H0ZA 4CQEA 1PKDA 4TTHB 3UMXA 3PJ8A 3KA0A 3OMVA 2B9JA 4IX3A 2VUWA 3ZYAA 1YVJA 4FSYA 3R73A 2FVDA 3NRMA 4L01A 2VTHA 2Z2WA 3NW6A 3WBLA 4AE6A 2VO6A 4AZWA 3DAKA 3L9PA 2Z7RA 4QMPA 5FDPA 3QD3A 4U0IA 2OZOA 3CTHA 1CKIA 4IADA 2ZVAA 1OIYA 5ANKA 1OMWA 4Q9ZA 2E2BA 4ZY5A 4GIIA 1PY5A 4O38A 2F4JA 4ZTLA 3FC1X 4O7ZA 3U6HA 4G16A 5BVWA 3V8WA 4QPMA 2YM8A 3UG1A 4CGAA 3MTLA 4GFMA 3A8WA 3QFVA 3ORZA 3BHUA 3OXTA 2RKUA 3DQXA 3HRFA 3M2WA 3R30A 2G2FA 2OO8X 5FDXA 5IH6A 4RIOA 4JX3A 3KK9A 4JXFA 1IA8A 3KMMA 3QQUA 4Z55A 3DK6A 5FP6A 3CXWA 4C4IA 4PRJA 2W1FA 2KTYA 5C4LA 4JQEA 4XV2A 3KULB 3F69A 3OY1A 4BCKA 4P7EA 4R3RA 2BZKB 4O1PA 3GT8A 1PXPA 2UW8A 4RT7A 3PSCA 3VS1A 5TOZA 2FH9A 4L8MA 3SOAA 4G17A 4J71A 1R0PA 2YAAA 4I4EA 2QO7A 4DEGA 2OZAB 5CF5A 3TG1A 3D94A 3LJ1A 2BRHA 2OF4A 5EDQA 2BKKA 4EKKA 1TQMA 1XBBA 4NIFB 4FOBA 4IB5A 3AG9A 2IJMA 3GVUA 3PWDA 3Q3BA 4G6LA 2I1MA 2J0IA 1IAJA 2OG8A 5EM8A 2UZDA 2OI4X 4GMYA 1MQ4A 4O0TA 4ZY6A 3G9LX 3G90X 3R1YA 1XHAA 1U46A 3KRXA 2A19B 2CNUA 2XNOA 3QX4A 2VTIA 4FOCA 4FYOA 5FXQA 3GFEA 4F7SA 3COIA 3D5VA 2WIPA 3WIKA 5HGIA 4K77A 5CT0A 5HD4A 4G6OA 4YLJA 4EH8A 3FMHA 4BCHA 4ALVA 4ZSEA 1ZZ2A 4JX7A 4CXAA 3VS6A 5ANJA 5AUTA 4CMOA 3LMIA 3NAXA 2B7AA 3TN8A 4PMPA 1FQ1B 3RKBA 2PE0A 4QMLA 1AGWA
chains in the Genus database with same CATH superfamily
4BHNA 4O0WA 3FUPA 4D2RA 4PL3A 3KIOC 4E6DA 3KEXA 2EB2A 2I0EA 3F5UA 5JFVA 4FKLA 2P0CA 3OCGA 4AXAA 2YEXA 4DTKA 3V8TA 5J5SA 4QPSA 4L52A 4CKRA 3F5PA 3CD3A 4F08A 3JVSA 4OBQA 4UY9A 4XS2A 5EK7A 4D1ZA 4PL5A 3KXXA 3NUNA 3R1QA 4XV9A 3TKIA 5JN2A 2WFYA 3LLAA 4FTQA 4YTFA 4XCUA 4FSWA 3ET7A 2YLFA 3OF0A 2UV2A 4IFCA 4MD8E 5D12A 4DGOA 4QO9A 3S95A 2CNVA 4XLVA 2IZSA 3MW1A 4CG9A 1PXOA 4APCA 4FTRA 3TNIA 4O0SA 4BCGA 4CRLA 1UV5A 4S33A 2Z7SA 4D4RA 3R7IA 1UNHA 3Q4CA 4E5WA 1WFCA 2R3LA 3R22A 4XG6A 3ZLXA 5FRIA 5HI2A 3COKA 3LJ0A 4C38A 3FZSA 4GV1A 4RSSA 4ZS4A 1P2AA 4FSUA 4NM3A 5DOSA 3TTJA 3GB2A 4ACDA 2A27A 4KKGA 4UYAA 2V7OA 2WOTA 2BVAA 5AX9A 3OOMA 3ZLWA 4NSTA 3WF9A 2XH5A 1ZMUA 1GOLA 2XNEA 1KE6A 4OW8A 1HCLA 2YA9A 5CS6A 4FA2A 3UOHA 4O7RA 3SG8A 2HWPA 3NUXA 4AGUA 4ERKA 1YHVA 3TMOA 2QNJA 3A99A 2QOKA 2VWBA 3AC1A 3P08A 4D0XA 4AWIA 4G3EA 2XRWA 1R3CA 3Q60A 4UALA 4X2GA 3ULIA 4QQTA 3TV7A 3PY3A 4BTKA 3POOA 2O63A 3BIZA 5IA1A 5K4JA 4LGHA 3ATSA 3D5WA 5HG8A 4FV2A 4UWBA 4WRGA 2BIYA 3NPCA 4IEBA 1MRUA 2OZAA 2J90A 2XKDA 3O8TA 3ORXA 4BCPA 2Y4PA 4KIKA 5BQ0A 4RC3A 4WNMA 4NIFA 5CY3A 4M67A 3NMUF 4J97A 1R78A 2GCDA 3EYGA 3FLQA 4ZSJA 3CS9A 3IW4A 3R1NA 4ZTNA 4ZSLA 5TKDA 3QGWA 3HNGA 2YWPA 1MRVA 3H0YA 5GJDA 2WAJA 5AV1A 4DEAA 3EWHA 3AMBA 3LCTA 2O2UA 4AA5A 5JGDA 2OIDA 2PU8A 1MUOA 3BYOA 4QP8A 4YJQA 2PVLA 2ZMCA 4ITJA 4PX6A 4M12A 3PPKA 5HZNA 3NVMB 5LCJA 3LE6A 2REIA 2QOIA 3DAEA 4XV1A 3VRZA 4FV0A 5IF1A 2IPXA 5HLPA 3RAKA 3NZ0A 2BHHA 4OT5A 4HGLA 5CASA 3PXQA 1UNGA 1VJYA 3R21A 4K9YA 1L8TA 2FUMA 3QKMA 4USEA 1A06A 3HEGA 3O7LD 4CFMA 1OIQA 4DHFA 5CXZA 3OCTA 2C0OA 5CVFA 5ANEA 5HG5A 4J7BA 3ZCLA 3QCQA 1YW2A 4ZSGA 4B99A 4FKVA 2HCKA 4O7YA 5DNRA 5G1XA 4W9WA 3TUDA 4NFMA 3PDTA 3G51A 1W7HA 3IGGA 2X9EA 2QONA 3V01A 5BYLA 5IQAA 4IB0A 3TKUA 4IBMA 1J7UA 1CSNA 3MPTA 3OD6X 4UEUA 3Q52A 4EZ5A 2YZLA 1H28A 2PMLX 3K5VA 4EH3A 5C4KA 4HVIA 3CJGA 4OR5A 5AR7A 2NPQA 3W2SA 1E1XA 4QMUA 4C7TA 3U9NA 3UC4A 5M55A 4E73A 2YIQA 3AQVA 3SV0A 3C51A 3A8XA 5J9LA 3RJCA 1HCKA 3Q9ZA 5A4QA 2WQOA 2E9UA 4ZZMA 3QBNA 4DLJA 1SVEA 4FKUA 5CVHA 4BIBA 4NM0A 4AP7A 1NY3A 1WBVA 2X0PA 3VBTA 1XH8A 3W33A 1FVVA 4O7VA 5JSMA 4O82A 5IEXA 3VF8A 2V55A 2XAOA 4JVGA 2X2LA 4F09A 2XJ0A 3E5AA 3OW4A 2W06A 3I6WA 3NW5A 5DR9A 4G2FA 3Q5ZA 4F65A 3LMHA 3GC0A 3PE2A 3AD4A 4JG8A 4CQGA 5JZJA 4FV8A 1Q3WA 4ANOA 2R0IA 4XBUA 2R0UA 4J95A 4L68A 5AP6A 4D5HA 4UZDA 4E6CA 4O83A 3QC9A 4IH8A 4RVLA 4EONA 2X7OA 4KS7A 2WTKC 2HK5A 2PUUA 3CKXA 3LIJA 4FL3A 4GRBA 2ZM4A 4TPTA 3IOPA 3WZEA 3RI1A 2FSLX 4O21A 2WELA 2ZB1A 3BE9A 2XF0A 4L6QA 5AMNA 4NEUA 2O64A 4DTBA 1VR2A 3ORTA 4E1ZA 1PXNA 1NVRA 3UO4A 3WZDA 4QQCA 3OCSA 5HVKA 3FMEA 3BLAA 2B0QA 2XYNA 4FT9A 1Q8ZA 5FTOA 4PTCA 2QOBA 3O0GA 4ASZA 3L1SA 3RHKA 2C30A 3M42A 4C62A 4FZDB 4BKZA 4RVMA 3LXPA 1OPLA 3U8WA 4EOIA 3ZUTA 5EW9A 4GW8A 2FA2A 1ZRZA 1WBPA 3MH0A 1ZXEA 2VWYA 3S4QA 4FV7A 2JDTA 4XRLA 2EXEA 2DWBA 4DITA 4BY9E 1K2PA 4GUBA 5CQUA 3PVBA 4Q2AA 2I0VA 4XOYA 5F94A 1XKKA 5EKOA 5HLWA 3DAJA 3OUNB 5KX8A 3BL9A 3BU5A 4YZNA 3FLSA 2R3PA 3ETAA 3ZC6A 3ID6C 4RQVA 2Z7LA 4AA0A 3RTPA 2E9OA 3BRBA 3OBGA 4DH1A 1PXJA 1W2FA 3LKMA 4C61A 4ANLA 4FKSA 3TL8A 1OM1A 5I5ZA 3CEKA 3GU4A 3F5GA 3PTGA 5HE3A 1QL6A 1XR1A 3QUPA 4KKHA 2GNFA 4GT4A 3NIZA 4MXAA 4EZ7A 3E62A 3FAAA 4FC0A 3BLQA 4FZFB 4M84A 4QQ5A 5ETFA 5HCYA 4KABA 1OBGA 3UNJA 4ACMA 3CD8A 1V0PA 1YXXA 1J7IA 4DFNA 4QOXA 2ETMA 3P86A 3PXYA 2V0DA 5JQ5A 5B0XA 3EQFA 2IZTA 1JAMA 3F88A 2WOUA 3O51A 4TWNA 4QMYA 4X3JA 4D4YA 4XG4A 3AKLA 3AT3A 4IAZA 4N4SA 4DYMA 4JBVA 4WG4A 5T68A 4O84A 4BDIA 4L46A 3TJDA 1JQHA 4YTIA 2WTKB 3DKFA 3EL8A 3QCSA 2OJJA 4IIRA 3FHIA 4BDHA 2QOLA 3CTQA 5CEOA 2I0YA 3SVVA 4K18A 5DT4A 2W7XA 1IAHA 2O0UA 3NNXA 2OJGA 2F49A 5AP2A 1OB3A 5E7RA 3RP9A 5ITAA 1OITA 5CANA 5FEEA 3PIXA 1VZOA 5J95A 3FI3A 3PXFA 3QC4A 2PZPA 3QQKA 3LCSA 4BF2A 3E3PA 4C34A 2BIKB 4QMZA 3COMA 4I5CA 3LW0A 5E9EA 4KUJA 4F4PA 1ZYCA 4YZMA 1Y6BA 3VS7A 2VGPA 4EOKA 4WHZA 2J0KA 4FMQA 3V5LA 4V04A 4A9TA 3LM0A 4C3FA 4AXFA 3BPRA 3EQGA 3F3ZA 5BUEA 2ZM1A 4QYGA 4E3CA 2PZIA 5BMSA 4KSQA 3ZSGA 4AXCA 3HUCA 2UW5A 3I6UA 3R83A 3ZSHA 5IMEA 1G3NA 4I6HA 5ANOA 3MFRA 1ZOEA 4O22A 3OS3A 2ZOQA 1H07A 2J5EA 5IA5A 1NT2A 2ETKA 4U43A 1W82A 3O8UA 2GQSA 4O7SA 4FKTA 4AN2A 5IQIA 3Q53A 1JKTA 5D7VA 4XX9A 2IZUA 4UB7A 2PVRA 3DK7A 1U54B 4RWIA 4WRSA 2A4LA 4LV5A 4YO4A 5IUGA 3IK3A 4RBLA 4PWNA 3Q6WA 1REKA 5HLNA 2IZRA 4APPA 5IQEA 3VBQA 1KE5A 5K0KA 5A4LA 3NUSA 3SGCA 3VJNA 2W17A 2XEYA 4DEDA 2QU5A 3W10A 3KMWA 3RAWA 5C8KA 2XP2A 2B54A 2VTJA 2OJFE 4C3RA 3F5XA 1JLUE 2GQGA 2QD9A 2V5QA 2WIHA 4O6EA 3JR1A 3TDVA 4IM2A 5LVLA 2G2HA 4JBOA 4ZS0A 3OCBA 4FBXA 5BVEA 5AFVA 3K3JA 5E8XA 3VUGA 4UXQA 5AR5A 5F1ZA 1UWHA 2GS2A 2RFSA 4IWQA 5LARA 3U6JA 2UVYA 3FQEA 2J0LA 3LFNA 5HO6A 2XCHA 2YWVA 4F9AA 3E8NA 3EN6A 1XBAA 3CGOA 2Y7JA 3KRLA 4GVAA 3VWAA 4I0SA 3GU5A 4L44A 4PMMA 4U41A 5DRBA 3SD0A 3W55A 1YOJA 4Y5HA 4HVDA 2ZV8A 2CLXA 2CDZA 3ZRKA 3K3IA 5C01A 2C0TA 4L42A 4WUNA 5EG3A 5LXMA 5EYKA 4EC9A 4ANQA 2E9NA 4IW0A 3QHRA 4GKIA 1YXUA 2J2IB 3W1FA 4GFOA 4P4CA 5E8TA 3Q96A 2JITA 5J7BA 2CKQA 4KAOA 4O7TA 4ZAUA 1UVRA 3LVPA 4UWCA 2P55A 3UOJA 3PIYA 2WQEA 2W0JA 1M17A 3HX4A 1FMOE 4GS6A 5HEZA 3UQFA 2PUNA 1YQJA 3R9OA 3HMPA 4MCVA 2C5VA 3FV8A 4KA3A 2O65A 4G5JA 1URWA 2B4SB 5JGBA 2BUJA 2XNNA 1T45A 4L43A 5IDPA 3E7VA 4FTIA 2R3GA 4QP7A 3C50A 5IQFA 4AACA 3HECA 4P90A 2YJRA 3QZFA 4YGAA 4I41A 3FXXA 4OTFA 1TQPA 4RJ7A 4PPCA 3R7EA 3UZTA 2Q83A 4FKOA 4X2FA 3FMJA 3RPVA 5AV3A 5L6WL 4BC6A 3OEZA 3E8CA 2C0IA 5AIRA 3FL5A 4LL5A 2HWOA 2WTDA 3PA4A 4ALWA 3ZXZA 4OT6A 4JNWA 4BICA 5CSWA 1H25A 4CRSA 2WO6A 3GOPA 3KN6A 3R04A 3DT1A 4QTDA 4U45A 4G1WA 3AGMA 3VBYA 2WMSA 5IUIA 2R3IA 1IR3A 4QYHA 4AZSA 4AT4A 2DS1A 4EJNA 4UYNA 4ALUA 5BVDA 2ITZA 4F63A 2A1AB 3FDNA 4MXOA 4BKYA 3ZUVA 4N0SA 3RHXA 2BTRA 4DFXE 4RA5A 3ZO2A 4B8MA 4EH5A 1PMVA 2BILB 3T8OA 4YURA 3TZMA 4AOJA 1H00A 3ZO1A 4V0GB 2W9FB 4FV6A 2J7TA 1CKPA 1U54A 1MRYA 3GC7A 3UO5A 2PTKA 2QG7A 4ZTSA 3HAVA 4KIOA 4MQ2A 4DC2A 2WZJA 5FG8A 3VS4A 4AN3A 5HTBA 4I6FA 2H34A 2X8EA 2BDFA 4EZ3A 5L3AA 2Z60A 4AW2A 2XUUA 3ZXTA 5EQPA 4C3PA 3QQHA 4DG0E 4TL0A 4JR7A 3AT4A 4OTWA 3PYYA 4DBNA 5GIOE 1JKSA 4YBJA 4H3BA 4NFNA 5CAOA 3W32A 1PXKA 1H0WA 1W98A 3WE4A 4YJSA 4DCEA 2PYWA 3N4UA 2ERZE 4U3ZA 3WYYA 3NFFB 1OUYA 4GK3A 3R7UA 2B1PA 2GFSA 4JQ7A 4M8TA 3Q9YA 5A6OA 1YDRE 3EFJA 3ZDUA 3KY2A 5HX6A 1QPEA 1OPKA 3FQHA 3P5KA 5FBOA 4O4FA 4OTPA 5HIDA 5J8IA 5JQ8A 3WARA 5EQEA 4RWJA 5HICA 3E92A 3CPBA 3KXHA 4FKGA 1K9AA 1ZYJA 4GCJA 3DBEA 3TNWA 4HPUE 3S3IA 2QOHA 5AAEA 3VQHA 1SVHA 4HGSA 4KD1A 4DE4A 5AV0A 4N70A 4GT5A 4HZSA 2ONLC 2QOOA 5KHXA 4YJNA 3UIMA 4ZJVA 2IF8A 4NWMA 1H1PA 2G9XA 4KINA 4XG9A 3UNZA 4EHVA 4F9WA 3QU0A 5M56A 4G3GA 3AKKA 5IQHA 5CU3A 5CAVA 3GP0A 1RDQE 3PG1A 4MK0A 4MWIA 2XJ1A 5IEYA 5AJQA 2OIBA 5F9EA 1OL2A 4PUZA 2WQNA 1FPUA 2PMNX 4PDSA 2ETRA 4X6QC 3O7LB 4XH6A 4F1TA 3HYHA 5FBNC 5AUVA 3V3VA 3R7GA 1FMKA 4XNEA 4ANBA 3UMWA 3KCFA 3DTCA 3C5IA 2HZ0A 5AUWA 5FP5A 1M52A 1STCE 2YIXA 4R1VA 5E90A 2O3PA 3IONA 3HDNA 5HVYA 4PNIA 3I5ZA 3NWWA 4I20A 4MF1A 1AQ1A 5HHWA 4HPTE 2JDSA 5L8KA 3V5JA 2WTJA 2OLCA 3JUHA 2YABA 2XCKA 5KMNA 4GK4A 2RF9A 4BYJA 4WBOA 4I24A 3VIDA 4OTRA 5FGKA 5EW3A 4C59A 4YC6A 5GZ8A 2OWBA 4YHTA 3ULZA 3VS3A 4IACA 2W1GA 3WILA 4A9RA 4FJVA 3RK5A 4UZHA 3OG7A 1WBWA 4QTAA 3FY2A 4AN9A 4XHKB 2YHVA 4L45A 2C6TA 3KVWA 3OWLA 4V0GA 4I21A 4UBAA 3DFAA 5TT7A 3SQQA 2J51A 2JC6A 4PDYA 5HNGA 4JQ8A 3C9WA 3DS6A 1W8CA 2KULA 4XUFA 4JG7A 2J9MA 4RFZA 5ACKA 4R3PA 5BUJA 4QD6A 3NYVA 2JIIA 2JEDA 3PG3A 4MEDA 2XA4A 2YN8A 3TEIA 4YU2A 2CGVA 2E9VA 2ERKA 4FGRA 4JRVA 4XLIA 1GZOA 3E3BX 4BCFA 4QNYA 1OL6A 3OHTA 1KV1A 4IX5A 3SX9A 4R6VA 5IMXA 2GSFA 3RPRA 2YACA 4F0GA 4QTEA 3BGZA 2PMIA 3TV4A 2YIYA 4DEBA 5FQDC 1KE9A 5KZIA 4UMUA 2J6MA 2XK7A 4DH3A 4EBVA 1A9UA 2BFXA 5L2SA 2I0HA 1E9HA 4KNBA 3RCJA 3UIXA 1F5QA 2QKRA 5CF4A 3L9MA 3LCKA 4GT3A 2WTCA 3ZRLA 4EOSA 4QP1A 4QPAA 4DDIA 4YSMA 3F3TA 3G5DA 2B9HA 4BGGA 1ZWSA 3DZQA 3EIDA 5J79A 2X1NA 5CI6A 3R8UA 4DGLC 2WMXA 3TI1A 1DAWA 5DRDA 4FTTA 4QP2A 3CQUA 3W2RA 2PE2A 4ZTQA 3WF6A 4NJDA 3ORPA 4QTCA 3G9NA 3ODZX 3Q4UA 4O0UA 4RZVA 4UV0A 4AOTA 4PY1A 1KE8A 2VWXA 2Z7QA 4IJ9A 5EI8A 2BDWA 2X7FA 3EMGA 4IE9A 3OUKA 3FZTA 3BV2A 2W1IA 4FTNA 4NUSA 3ML1A 4BL1A 2AQXA 3GCSA 1O6KA 3QKKA 1BL7A 3HVCA 2JDRA 2Y8OA 3F3UA 3NAYA 5DWRA 4HYHA 5L2QA 5EM6A 1IASA 3UOKA 4C4JA 1RW8A 4QMXA 2OJ9A 4U7ZA 4Y8DA 3UPXA 4M7IA 3EB0A 3FI8A 2J4ZA 5EOLA 4FNZA 4BCOA 2BRBA 1JKLA 2RGPA 3MBLA 3MESA 4PPAA 4TYHB 4CCBA 5GNKA 2BTSA 5AP7A 5CF6A 4DHJA 3A7GA 5CTPA 4MXXA 4EI4A 4CTBA 3A4PA 4RGJA 4ZTHA 4DFBA 3OXIA 2OGVA 3V6RA 3E64A 5DEWA 1FGKA 4CYJA 4KWPA 3I7BA 4F9CA 2ZM3A 1JSUA 2Q0BA 3FQSA 2PPQA 3V04A 4F0IA 4AOIA 4GVJA 1GZKA 4JG6A 1VYZA 3OC1A 3QCXA 2CN5A 4D58A 5CF8A 4CVAA 2PY3A 5AAFA 4AX8A 4DH5A 3PIZA 3C0HA 3VF9A 3D14A 4IANA 2QOQA 4ZZNA 5JMSA 3OZ6A 3WE8A 3TNQB 2W4KA 3HP5A 3DKOA 4MVFA 3BGQA 2OFVA 4LYNA 2OXDA 2WMVA 2XEZA 3SAYA 3PLSA 5JEBA 4PP9A 5GINE 4BI1A 2C6KA 4DTAA 3LFAA 3R00A 5CU2A 5DEYA 3EQRA 4X2JA 4ZOGA 4QMVA 4EH4A 4RJ3A 4WNOA 3ZEWA 4JI9A 5I3OA 3W18A 2WB8A 1J7LA 4G3FA 4I92A 2XK8A 3RNIA 3I1AA 3ENHA 2OJIA 3BQRA 3MTFA 3EQCA 4XG7A 2Y4IC 1H1RA 3FKLA 5KMKA 4D28A 4HVHA 4QNAA 1H27A 3LXKA 4YLKA 4HYUA 4TRLA 2C6OA 2LAVA 2JDVA 4R78A 3UYTA 2PHKA 5AUZA 3DU8A 3BL7A 2A98A 2JKMA 2ONLA 4C8BA 3DJ6A 1ZOGA 4H3QA 3W8QA 1TZDA 5AUUA 1XO2B 3G15A 4AZVA 3SC1A 1H26A 1L3RE 3NLBA 5A14A 5IA0A 5JKGA 5HKMA 5M09A 4PF4A 2XNGA 5DGZA 1Q8WA 4I22A 2WEVA 4ZMEA 1JSTA 2JGZA 3NCZA 4UMPA 5CALA 4DINA 1JSVA 4CLIA 1SMHA 3ODYX 3MV5A 3PP1A 5DA3A 4LG4A 4FKIA 3PRIA 2YIWA 4ZMFA 3FZ1A 2R4BA 2G15A 4IZAA 4BDDA 3EYHA 3DZOA 1TKIA 4G9CA 4OGRA 3UG2A 2X0GA 2XM8A 3FLZA 3H9OA 4BJJB 2QC6A 3BELA 3OY3A 4FIEA 5AA8A 5DBXA 2YZAA 4J99A 4FSMA 4KBKA 5H8GA 2JLDA 1M2QA 3MFTA 5K4IA 1FINA 2HZIA 2R7BA 4S34A 4BDKA 3FBVA 3KULA 4FTUA 4FTMA 4TYHA 1OPJA 4ENXA 1B38A 2F2CB 3GFWA 5C26A 2XNMA 1I44A 2W1HA 3HUBA 3CGFA 5CSPA 2V62A 3LCDA 2C5YA 4I93A 4DHZA 2XK9A 1DS5A 1ZY5A 4JJRA 4EOOA 5BVNA 3LXNA 4EL9A 2Z8CA 3P1AA 3FYJX 4DFYA 3NUUA 2X7GA 3GXLA 4Y73A 2XIYA 4YPSA 3R8PA 1GJOA 2UZVA 2XJ2A 4RWLA 5BVKA 4C37A 1PYEA 1H24A 4D0WA 4OLIA 5C8MA 4MXZA 1ZAOA 4JLCA 3KK8A 4M68A 2HYYA 5JZNA 4EH6A 3PY0A 4EQUA 4QMOA 4H05A 4E4MA 3D9VA 3JPVA 3UIUA 2BZHB 5HE2A 2Y4IB 5M51A 3DNDA 2NYAA 5EHOA 5M08A 3CC6A 2WMRA 4I6BA 4QMNA 4YMJA 3VULA 3IW7A 3F9NA 4Z16A 2QLUA 2X6EA 2WD1A 2XKEA 3ROYA 3COHA 2OU7A 4FSRA 2BRNA 3BYSA 3QD4A 5CEIA 5DE2A 2GHGA 5CAUA 5CEMA 2C4GA 3A7IA 4W4YA 1OUKA 4MNFA 4F99A 4LMUA 5M06A 4IZ7A 4TYIA 3PLAE 2C3LA 4AUAA 1CTPE 4IFGA 4EH7A 4O4DA 3RK7A 4E4LA 2AC5A 2UUEA 2G2IA 3HDMA 5AM6A 4BBFA 2YDJA 3S1HA 3TM0A 5EDRA 3SHEA 4O0RA 3BBTB 4FK3A 4WG5A 5CU6A 3UZPA 1W0XC 4XP2A 2X8DA 3TACA 4FT0A 3UODA 5AAGA 2CNQA 1XH9A 4BCMA 2HZNA 1UU3A 3QRUA 4CFWA 3O71A 4NT4A 4OBOA 1J1CA 2R3HA 2WQMA 3P79A 5H8BA 4D4SA 5IQBA 3PZHA 1NVQA 2VTPA 3TT0A 1Y8GA 3N9XA 3D4QA 2QI8A 1URCA 4LOPA 5J7HA 3G0EA 1M2PA 4GJ3A 1QMZA 4W4VA 1J91A 4NK9A 5DLSA 3NVKI 4R5SA 2HY81 1WAKA 1LEWA 3LHJA 3VUHA 3AGLA 3I0OA 4GFGA 4U3YA 4GYGA 1Q8YA 2H9VA 5DHJA 5BMMA 4BJJA 3VUIA 3CJFA 5EM5A 1UA2A 4ZEGA 4QMSA 2GTNA 1H0VA 5HBHA 3MWUA 4AQKA 3FLWA 2ITYA 4BIDA 4HVSA 3CTJA 3R2YA 3CCNA 5H3QA 2JIUA 3ALOA 4LRMA 4QP4A 3CKWA 3HV4A 4FVQA 3GENA 3ZFYA 4HZRA 3F3VA 4C4FA 4FTAA 1OL7A 3QTSA 5HG9A 1U5QA 4V05A 4AU8A 4KB8A 5A3XA 4EK8A 3D2KA 4X21A 1NXKA 4QYFA 3TV6A 4F70A 2B9IA 3OWJA 3P4KA 3PJ2A 5CU4A 1P4FA 3PZEA 3V5WA 4U80A 4XBRA 4E5BA 5I3RA 2C3KA 2YCSA 3QRIA 4K11A 3ZFXA 2CMWA 4IAIA 4DFUA 5HCZA 3MB7A 4LQMA 3Q2JA 4FUYA 3Q4TA 4CMTA 5IUHA 5CT7A 3W0OA 3EN9A 4AZEA 4UMTA 3WF8A 2IVSA 4CMUA 2JBPA 4RFYA 4FSTA 2W96B 3DK3A 4WBBB 5ANGA 4FIGA 3FXZA 5A9UA 3I0QA 5EHLA 3OROA 5AP0A 2FSTX 4LV7A 4RMZA 5EI6A 1H8FA 2VZ6A 3DA6A 3NGAA 3LJ2A 3QRKA 4K6ZA 4YPDA 4QMQA 1OL1A 4EJ7A 3KRRA 3FJQE 4G3CA 5EYMA 3DJ5A 5HIBA 4PMSA 4FZ7A 5FXRA 3UVRA 2QG5A 3NS9A 3ZC5A 5IQCA 3KF4A 5E8UA 4E5AX 2CCIA 4MD9E 4ACGA 5AV4A 3DOGA 4Y85A 3FC2A 3UNKA 2UZUE 4LV8A 4BVUA 4Y72A 3UQCA 5C9CA 5J9ZA 5HNBA 3PSBA 4FT7A 3KGAA 4C0TA 5JFXA 2YDKA 1OBDA 3RAHA 2R7IA 4UXLA 3BU6A 4EH2A 1ZARA 4FEUA 2C5XA 4XYFA 2OXXA 3NSZA 1XWSA 4GK2A 4I6QA 1B39A 4XG3A 1TVOA 4I23A 4TN6A 4AG8A 4HW7A 3VS5A 3BHHA 2QURA 3ZTXA 4Z3VA 3AOXA 1YOMA 3BU3A 1Y57A 3G0FA 3MFUA 1JKKA 3OTVA 3QKLA 4FG8A 4YNOA 5DYJA 4DAWA 3IW8A 3BHYA 4C58A 5DN3A 2GTMA 3SDJA 1RJBA 3RPOA 4XV3A 4I0TA 4AAAA 1KUTA 2JBOA 4FEVA 4GKHA 2GPHA 3SW4A 1GNGA 2ZAZA 4B4LA 3I4BA 4AS0A 2PE1A 2GDOA 2YCRA 2PSQA 4QDEA 5AA9A 3EJ1A 3UZRA 3W0PA 1PMEA 4FKJA 1BI7A 3R9RA 3QXOA 1ZOHA 4M0YA 4QYEA 3KXGA 2BAKA 4YC8A 1J3HA 3UP7A 3Q04A 2W1DA 2QOFA 1JPAA 5BVFA 4IDTA 4K33A 3PPZA 4YJOA 4ASXA 2OICA 2XRUA 2R3OA 5I9XA 4PP7A 3FKOA 4YO6A 3U51A 5I9VA 4CG8A 4R8QA 3VBWA 4WKQA 4A4LA 3B2WA 4D5KA 1QPCA 1OL5A 3BBWA 4QEBA 4YZCA 3ZLYA 3C4EA 1IA9A 4QMTA 4V01A 2C6IA 1Y6AA 4E6QA 4EHZA 3R8MA 4JS8A 2VO7A 4NTSA 1XH6A 5KMLA 3PXRA 3ORKA 4LDTA 3K54A 3UDZA 4L3LA 2JFLA 3FZRA 2F9GA 2PVJA 3SKCA 3ZH8A 5C27A 3ROCA 4UWYA 4G34A 4Q5EA 3W2PA 2XM9A 4A9UA 4YTCA 4IM0A 4JIAA 2PVFA 1BUHA 4YHJA 5HO8A 4E4XA 4X3FC 4K8AA 3MYGA 2I40A 4K0YA 4BDFA 3DBFA 4MHAA 1AD5A 2VTOA 5B2LA 3KN5A 3PPJA 1Q3DA 3DXNA 2W99B 3FWQA 5E8VA 5F95A 4R7IA 3VUMA 5LWMA 3R2BA 4GG7A 4IWPA 5I0BA 5IPJA 4BCQA 1G8JA 1ZMVA 2PMOX 4FIJA 1FBNA 3HMNA 4BR3A 1M14A 3GCQA 3R8ZA 5EKNA 4MH7A 5LQFA 4IAKA 2ITVA 3T3UA 4II5A 2WGJA 3QRJA 2B9FA 2XIZA 4I6LA 4L9IA 4IAYA 3BCEA 3CR0A 5D7AA 4GSBA 2J5FA 2CSNA 4TNDA 2PZYA 1IG1A 3H9RA 4FKRA 3QALE 3QQGA 4KBCA 5FTGA 4W4XA 3TZ8A 4MD7E 2ZMDA 3DKCA 4FV3A 3IQ7A 1JVPP 3MY1A 4FIHA 4MBLA 4YJPA 5HE0A 2RL5A 5LMBA 2OW3A 4H3PA 5F4NA 3MB6A 5ETIA 1RE8A 3E87A 4I3ZA 2GFCA 1WVWA 2J0JA 5HQ0A 4FV4A 5K9IA 2Y0AA 3E63A 3D7TB 4RA4A 4IZYA 2IEWA 2OIQA 3E93A 4I5MA 3WZUA 4CKJA 5E91A 3VAPA 3QYWA 2UW4A 2C6LA 3QCYA 5FEDA 4RC2A 4CT2A 5BUIA 3N51A 4BDGA 5K5XA 2H6DA 2AEGA 2IW8A 3E88A 5EM7A 2CLQA 3B8RA 4IAAA 2IVUA 3U6IA