3ZUVA

Crystal structure of a designed selected ankyrin repeat protein in complex with the phosphorylated map kinase erk2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
359
structure length
357
Chain Sequence
HAMAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLEVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein/transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 1
publication title Structural and Functional Analysis of Phosphorylation-Specific Binders of the Kinase Erk from Designed Ankyrin Repeat Protein Libraries.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 113
structure length 357
sequence length 359
chains with identical sequence C
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zuvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zuvA01
2GTNA 4J99A 3GC0A 3UZRA 1U5RA 2CGXA 2GMXA 3EL7A 2YWVA 3OG7A 3QTWA 5JQ8A 3R8LA 3P4KA 3PVUA 3W2CA 4FKGA 1ZRZA 2R3RA 5HG8A 3RM7A 4DGLC 1OM1A 2F7ZE 3C0GA 4ZSJA 3V5TA 1JNKA 3BGZA 4CZTA 4G2FA 5HBJA 4DCAA 1OZ1A 4RWLA 5I3OA 3UIMA 3R1NA 2LGCA 3GCPA 4C61A 3T9TA 3D5XA 5DBXA 5IEYA 3P1AA 3WIGA 4BDGA 3AGLA 4FIIA 5HGIA 5A6OA 1KE9A 4CD0A 1PJKA 4LUDA 4MWHA 1PXOA 2B1PA 5L2TA 3HMPA 3VO3A 3W16A 4FIFA 3ZEWA 1JVPP 3A62A 5TO8A 3ATSA 4JI9A 2ZDUA 2XYNA 2ITXA 3HAVA 2OXXA 5E7RA 2J5EA 2JKMA 2PY3A 3UMWA 1M52A 1M7QA 5AWMA 5TOZA 5HVYA 3HYHA 5BUJA 2ACXA 3FLYA 3D7ZA 3L8PA 4JRNA 3PLAE 1A9UA 3GP0A 2VWVA 3BWJA 4IVBA 4DFLA 1OKVA 4CFMA 1Y6AA 1Y6BA 4G5JA 1REKA 1DM2A 5M4CA 5DEWA 4L67A 4P7EA 4O7ZA 2QD9A 1IG1A 4QYFA 3LCOA 1GZ8A 4FA2A 5DRBA 2XUUA 2ONLC 2BIKB 1XQZA 2R3MA 3LIJA 3U9NA 1ZOGA 4C2WA 2WEIA 3OOGA 5KMOA 4YTCA 2UZBA 4FT9A 1IAHA 3VRZA 4YC3A 3V5WA 1R78A 3II5A 4RJ5A 4L44A 4QMUA 3ROCA 5FXRA 5JT2A 3DXNA 2HY81 2IZUA 3FXWA 4R8QA 4RC4A 3B2WA 2VWIA 4RLLA 5IA0A 1PY5A 2VWBA 2RG6A 4DG0E 3CEKA 1LR4A 5BX0A 4U97A 1JLUE 2YLEA 2OF2A 2FB8A 4QPSA 1E9HA 4FSNA 1FMKA 4IH8A 2EU9A 4WG5A 3UODA 2R3HA 3NAYA 2VD5A 4TYHA 2O5KA 1Q99A 3RI1A 1SVEA 2PVLA 2WMVA 3IDBA 4EHEA 3V6RA 3KMUA 3G2FA 4TPTA 4MXXA 5A54A 4EZ3A 3KQ7A 3JPVA 3QYZA 2XNBA 3HVCA 2CLXA 3FMDA 3Q4TA 3UVPA 3BU3A 3HMIA 4TY1A 3MS9A 3RPVA 3RWPA 4FKTA 4C59A 5CF5A 1FMOE 4DYMA 2OF4A 2BFXA 1M17A 4WBOA 4AT3A 1NW1A 4APPA 1DAYA 3OCTA 4TYJA 3N4UA 4GVJA 2XCHA 4BY9E 3R7OA 5AR3A 1AGWA 4N0SA 5CU4A 5AR8A 3MGYA 1J7LA 3F7ZA 3QQFA 3BHVA 3MH1A 3SOAA 1MP8A 2J0LA 1Y91A 2Y0AA 4QP6A 3NSZA 4NU1A 3C5UA 3V5LA 2OJGA 2QCSA 3KXHA 4YNEA 3D5UA 3P7CA 4ZJJA 5CF8A 3TNWA 4D2SA 1MQBA 4QYYA 4E4LA 4FTKA 3H10A 3MTFA 3H9FA 3SOCA 5DH3A 3ZBXA 2CN5A 2CKEA 3FHIA 1FVVA 5AUUA 3VS4A 3ZSHA 5A4TA 4MEDA 5IMXA 4AE9A 2ESMA 4XLIA 2J5FA 3EQDA 3FV8A 4X6QC 2OJJA 4UMUA 4A9RA 5L8KA 4Q5HA 3NAXA 2VTJA 2W1ZA 3QC9A 3MBLA 4O21A 4OUCA 4QMNA 3VS7A 5AAEA 4ZSGA 3R7YA 2XB7A 2IPXA 3R8PA 3SG8A 3UIXA 3EKKA 4YLJA 2Y4PA 4XBUA 3PXYA 3PA4A 3E8CA 4GFOA 4CFNA 5I9XA 1H26A 5FTGA 3QRUA 2OH0E 3DKGA 3QKMA 5IZFA 4FV7A 4IZ7A 3HLLA 2ERZE 5AAFA 3W10A 1CM8A 4YZBA 5CTPA 3U6IA 5FXSA 3BLQA 1UU3A 2VZ6A 3FWQA 4GKIA 4DITA 4GK2A 2QR7A 5IDNA 4AQCA 2CGVA 4RX8A 5E8TA 1Q62A 5J7BA 4J97A 4E26A 3LQ5A 3R6XA 4C4HA 5EQEA 2QO2A 3FZPA 2XNNA 3SG9A 2QG7A 2P2IA 2R3GA 1BL6A 2G2IA 4BCHA 1PXKA 3VS1A 4WSQA 3VBQA 4M0YA 1QPEA 4USDA 3I6WA 3OTVA 4IM0A 4LI5A 3IK3A 5CEMA 3NNXA 3FMMA 2W7XA 2X4ZA 3MJ1A 2WTWA 3PJ3A 4JAJA 4L3LA 4RVLA 4X3FC 4YGAA 3EFKA 3TIZA 3U9CA 4TWOA 3L9PA 4NM3A 1ZZLA 3NW6A 4FOBA 3NUSA 4KIKB 3D7TB 4ZZOA 3HMOA 3C4CA 4ANSA 2PPQA 2SRCA 5K3YA 4DHFA 3FMLA 4YNOA 2PVYA 3PY0A 3QTQA 4I0SA 4U44A 4XP0A 3SXSA 4F65A 2VTRA 5BVDA 3DK7A 2JAVA 4FSZA 3FI8A 3R7EA 5DR2A 5EK7A 2XKEA 1FPUA 2OBJA 4WO5A 4HGLA 4C4IA 5FD2A 4GU9A 3KXNA 3NLBA 4LOQA 4X2KA 4ACGA 1M2RA 4E5WA 4E6CA 3QAME 3QQGA 4TKSA 4F9YA 3TZ8A 4MBIA 2PUIA 2GDOA 2B4SB 1WBWA 4GYIA 3ZMMA 4JRVA 4C35A 2WGJA 4QP8A 4D5KA 4RVMA 3MH3A 3DNDA 1P2AA 1U59A 4QMZA 4YPSA 3SXRA 4L3PA 5FDXA 4ALUA 4ZJVA 2W4JA 4EYJA 1O6LA 4RZVA 2HCKA 2ZB0A 4OW8A 2F7XE 1M2PA 2J6MA 3ORPA 5H9BA 4ANLA 4EEVA 3KU2A 3GXLA 3OMVA 3L9LA 3VBTA 2GHLA 5JN2A 1Z57A 2X6DA 3DFCB 4LUEA 1U54A 2UW9A 4HPUE 3TJCA 4D58A 3ZO2A 3A4PA 2QOQA 4HZRA 4FTQA 1O6KA 1FQ1B 1FGIA 1STCE 4FF8A 4U42A 5CLPA 5HG5A 4C0TA 5DHJA 4KRCA 3FDNA 5AR4A 4BWPA 3F2RA 4FODA 4OBPA 3UO6A 2CNUA 5FP5A 3EN5A 5LVNA 4E5AX 4O0UA 1K3AA 3PZHA 4RX7A 3ZUTA 1PMEA 2X2LA 1F0QA 4WUAA 4U40A 4MXCA 5AX9A 5LOHA 4KD1A 5DT3A 3QXOA 5A9UA 4O7LA 3MFSA 3VF8A 3DJ7A 3NUPA 5CAUA 2UZNA 4U80A 3UOLA 5IUHA 3HRCA 3NEWA 3QZHA 3HA6A 4I3ZA 3LVPA 5AV4A 2UZTA 4X2JA 3UP2A 3WI6A 2BFYA 3EQGA 4RPVA 4A4XA 1OBDA 2G9XA 4FV3A 4IAZA 4C4EA 3H0YA 2A0CX 2AYPA 2R3PA 4RIYB 3WE4A 2C3JA 2C68A 4JXFA 5BVWA 4BDFA 4NJ3A 1W7HA 2C0IA 4I5MA 4HW7A 5HVKA 3ZLSA 2RFNA 3NYVA 3WZDA 3PZEA 2IVTA 4YZMA 4A4LA 1ZOEA 2ITVA 4XCUA 4FEUA 4I6BA 2VO6A 1K9AA 3G6GA 3RPYA 4S34A 5F4NA 4DGMA 5JFWA 1QMZA 1RQQA 2BUJA 3RK7A 2W1DA 1Q8ZA 4J1RA 5FTQA 3FMNA 4ZMEA 4Y95A 3IW6A 5A3XA 4PTCA 2JIUA 1H4LA 3V5JA 4W4VA 3BYMA 4EH6A 3PSDA 2XCKA 4MF1A 5BPYA 1YXSA 2WZJA 4FNYA 5EW9A 5M56A 3KVXA 3HX4A 5C9CA 4MK0A 3PJ1A 3VBVA 4AN3A 1J7IA 4PP7A 5LMKC 1B39A 2VNWA 4EH5A 1ZMVA 2BKKA 1OL5A 5ANJA 5IQCA 4KSQA 4USEA 3G15A 3O7LB 2QLQA 5BVFA 3R1QA 1GNGA 3BYOA 1QPCA 4LMUA 4J53A 5CEIA 4ZJIA 2R64A 2UUEA 3NDMA 4WNKA 4R1YA 3RHKA 3W2QA 4EH4A 4DA5A 4D4SA 3M42A 1MQ4A 3GU7A 4FTCA 5KE0A 5CANA 5KMLA 4OAVB 1FGKA 4DH1A 3V8WA 1V0OA 2HZIA 3ZTXA 4V05A 3UPXA 3AC2A 5E8ZA 3UOHA 1UWHA 3E3BX 3R8ZA 1KUTA 3SQQA 3IOPA 4E20A 4NL0A 3CTJA 2WEVA 2F57A 3MV5A 3ORXA 4K77A 4XRLA 3V5QA 2C6EA 4I22A 2OU7A 4NW5A 2JDOA 2ZMDA 5HU9A 4AWIA 2UVXA 3B8QA 2WIHA 3R7VA 4F6UA 3QUEA 4ITHA 2V5QA 4S33A 4BZDA 3ITZA 2PHKA 3QLFA 4FT5A 5M55A 4DG3E 2UW0A 3O51A 4JBOA 5HCYA 1QL6A 5CU3A 1URWA 2BMCA 3COIA 4W4YA 5E1EA 3C50A 4AOIA 5K4JA 3EOCA 5AA9A 4ALWA 3NW5A 2NRYA 4KSPA 2I0HA 3IONA 5LVOA 4FIHA 1PXMA 4QT1A 3P08A 5IUIA 3VULA 1ND4A 3QC4A 5DEYA 4I0RA 4D55A 3IECA 3R21A 5ANEA 4EORA 1P14A 3QYWA 2GNGA 4BDDA 4DTKA 3BZ3A 4RFZA 3BU5A 2VU3A 4GFGA 4F7JA 5ANIA 5AMNA 3DXPA 2EXCX 4QMSA 2QOFA 1H1RA 4ANOA 4IAAA 5HKMA 2RG5A 5J9ZA 3EJ1A 3VWAA 3HNGA 2BROA 4L46A 3EWHA 3ROYA 4TN6A 4ZTNA 4EOKA 1YI3A 3AD4A 3KK8A 4MCVA 1YWVA 3NW7A 3UNZA 5IQHA 1H01A 3PSCA 3FYKX 2A2AA 4G5PA 4KAOA 3DBEA 4TL0A 2YIYA 4DH3A 1OUYA 4RJ4A 1TQPA 4N57A 4IWPA 2XRUA 3ZFMA 3VW8A 4NFMA 4Z7HA 5DYJA 3PJ2A 3OBJA 4LGGA 3NRMA 4CQEA 4CTBA 5AR7A 4PPAA 4BCPA 5AP0A 4ZTMA 3DDPA 3OCGA 4H3BA 4G17A 4GG5A 4I93A 4FSWA 5GZ9A 2ZYBA 3D4QA 4AW5A 4DGOA 2X39A 5JMSA 4RIWA 3PVBA 5KBRA 1VZOA 4Y5QA 1YI4A 3OVVA 3DLZA 3HZTA 2C3IB 3GBZA 4O7NA 3HV3A 4H1MA 1ZYLA 3TI1A 1CTPE 2J7TA 3AT2A 1I09A 2OJ9A 4S31A 3U6JA 5EKOA 3S3IA 4FKRA 5CVHA 4CMUA 3BE2A 4PUZA 2NNWB 3PWDA 5ANDA 3AD5A 4AUAA 4CQGA 3NZ0A 4JX3A 4Z9LA 3RPSA 2JBPA 2OFUA 3SC1A 3NVKI 3AC1A 4ACCA 4F9AA 3TKIA 3LMGA 4EOIA 3I7CA 3O23A 4YZDA 2RGPA 4B99A 4L52A 4QMLA 1R0EA 1PYXA 3BQCA 5HE1A 4AP7A 4ZS4A 4YJQA 5K0XA 4TRLA 2QOLA 3H0ZA 3V51A 3Q2MA 4CCBA 3FL4A 2C6KA 3R9RA 3GC8A 4IANA 3ALOA 2PVNA 3DJ5A 3MY1A 4CV8A 1OIUA 1JKKA 2C4GA 4FNWA 5EHLA 2JIVA 3RP9A 4O91A 2YDKA 5FXQA 2F49A 3OF0A 3FHRA 3TDVA 4O0SA 5EDPA 3M1SA 5ACBC 4EYMA 2V7AA 3PPZA 4F63A 4XLVA 3ZHPC 2CPKE 3P79A 4HNIA 3Q9XA 4KA3A 4RZWA 3UIUA 4EJNA 5BMSA 2WOUA 5EFQA 2WMBA 4ZY5A 3KXXA 3MJ2A 3TM0A 4I20A 5J87A 3KVWA 2YEXA 4I4FA 4H39A 1FVTA 4RGJA 2E2BA 5B0XA 3QTUA 4U9AA 3ZSIA 4WIHA 1YHSA 3HUCA 2QO9A 3G9LX 3R7GA 2FSTX 5GINE 2PTKA 3TUCA 2E9OA 1VJYA 4GT4A 3VQHA 3C0IA 3C4XA 3Q53A 2C3LA 3R01A 4RA5A 5DMZA 3MWUA 3D5WA 3ZZEA 4N70A 3UG1A 1YHVA 1YWNA 5JFSA 4JLCA 4X3JA 2WU6A 4CYIA 4IB3A 2E9NA 3E63A 3PPKA 3F5XA 4FYNA 1UV5A 4EQUA 3MH0A 2C0OA 2PZ5A 3ENHA 3I81A 4WHZA 5IA2A 2X7OA 4PNIA 3RZBA 3KXZA 5LVLA 1PMVA 3SRVB 4JG7A 3U54A 3RAKA 1MRUA 4M69A 5EOBA 5FEDA 1A06A 3SVVA 1H0VA 3MVLA 5HX8A 5K9IA 4PF4A 2A1AB 3EYGA 4RLKA 4I0TA 3TEIA 1H25A 5KZIA 2XM9A 3LJ2A 3WOWA 3RVGA 3VBXA 3ZXZA 5KMKA 2P0CA 2E9UA 3UZPA 4LV5A 1H00A 1OL2A 4OTGA 2CDZA 3VS5A 3FKNA 3F3WA 3FUPA 3MVJA 3PP0A 4RIXB 3LFEA 2R7IA 4M97A 5CASA 4FIGA 4L6QA 4WUNA 1PXPA 4FUYA 2F7EE 4A07A 4D0XA 4AT4A 2UV2A 4FTMA 4HGEA 5E90A 4DEDA 4Y83A 3BV3A 4D2WA 2XK4A 3QL8A 3UJGA 4CG8A 2ERKA 3RM6A 1F5QA 4I6QA 3QKKA 4ZTHA 1KWPA 3Q60A 4Y46A 4RX5A 5CT0A 3DV3A 3LXPA 2XP2A 3E88A 2BR1A 3F7WA 3NNUA 4FSUA 4IZAA 5BVNA 3IQ7A 3I5NA 3O71A 5J95A 4O7RA 2VTPA 3DJ6A 1WVYA 4WKQA 3DY7A 4CEGA 3NVMB 2DQ7X 1OKWA 3WARA 1WMKA 4O0TA 4TYIA 4KNBA 4F0GA 3L9NA 3FL5A 4FKJA 4BFMA 1W98A 3A8WA 4MXYA 2NRUA 4CMTA 1SYKA 5B7VA 1LEWA 2VX1A 4GT3A 4X3FA 3ORMA 2XIYA 4R7BA 4ZLYA 3JR1A 2X7FA 2XK7A 4JIAA 4BDCA 1V0BA 4UWYA 4JBPA 3UQGA 1OIRA 3THBA 1M2QA 4DEEA 3QTIA 4TWPA 3QQJA 4XNEA 2W1GA 3WZEA 5L6WL 4FK6A 2J4ZA 5JQ5A 3ACKA 4MNEB 3TUBA 4BTJA 4IXPA 4E4NA 4C3FA 4EL9A 1VYZA 4BCMA 3E62A 5AJQA 4FK3A 4BI1A 5AUTA 5A46A 5HCZA 4XG8A 4A9YA 2WFYA 2JGZA 4NKSA 4C34A 4FTAA 4MHAA 4X6RA 2YAAA 3CPBA 3NX8A 4AGCA 5CVFA 5I4NA 3DCVA 3OWLA 3GU4A 4C36A 4QNYA 3CJFA 3EQHA 4C3PA 5HTIA 3Q96A 4DGGA 2ZOQA 4C3RA 3CCNA 3ZLWA 3ZOSA 5DWRA 4H05A 4YJVA 3E64A 4MXAA 4XBRA 3WYYA 2Z8CA 4AFJA 5AA8A 3TNIA 3CPCA 2Z7LA 3NNWA 4A4OA 3UBDA 4R3CA 4BF2A 4FV4A 2GCDA 4EH7A 3RNIA 1ZLTA 3Q9YA 4FNXA 2EXEA 5HICA 5M57A 2ZAZA 4WRSA 5FBOA 5KMMA 2YAKA 1XBBA 4FGBA 2QU6A 5KMIA 2AUHA 2GU8A 3D14A 2QQ7A 3FAAA 2VO7A 1E1VA 2JDSA 3LJ0A 3PXRA 4R7HA 3KFAA 2C1BA 4FC0A 4KB8A 5T6KA 2F2UA 3OXTA 4H3QA 3A8XA 4L45A 2ITTA 2W1IA 3RAHA 3PY3A 4J52A 2UW7A 1H1WA 3G0FA 2JD5A 2PMIA 4YC6A 1XHAA 2BRBA 5E8VA 3VUDA 3ZDUA 4XG3A 4EOLA 2WQNA 4MQ2A 2PVMA 4YJOA 4IB5A 2VNYA 3BRBA 3DBCA 3PIZA 3ZH8A 3CSVA 1F3MC 4NUSA 4RWIA 1YKRA 4FICA 3EZVA 1G8SA 5EM7A 4O83A 1SZMA 4BIEA 4BGQA 4EOMA 5FM3A 3OW4A 4AAAA 2QR8A 4BWKA 4HCTA 1R3CA 4YURA 4C2VA 1BL7A 2QHNA 1NXKA 4FV9A 1VEBA 3UNKA 4QMOA 1XBCA 4X7QA 5CX9A 5FEEA 2VTIA 1A48A 2CKQA 3Q4ZA 2PUPA 3BKBA 3FXZA 4Q9SA 4S32A 4HPTE 2XEZA 1Y57A 4FT0A 4DINA 2YLFA 2PK9A 2X9EA 4G9RA 5HG9A 4G31A 2HY0A 3BV2A 4ZTLA 5TF9A 2BZJA 3WF6A 2IW8A 3VAPA 5JGAA 3TUDA 4WNMA 4PMPA 1J3HA 2WNTA 4QTCA 3UGCA 3OBGA 2LAVA 5ACKA 4CFVA 5FWKK 3FLSA 2XJ0A 5AFVA 1WBOA 3NWWA 5CQWA 1R1WA 2F9GA 3KCFA 2QI8A 3TN8A 1P4FA 3OY1A 1OIYA 4N6YA 2XNPA 4IW0A 3KRXA 4K18A 2ZV8A 1BUHA 1QCFA 2WQOA 3AT4A 3F69A 4PDSA 2Y8OA 5LARA 3C4EA 4BTMA 4EH2A 4Y5HA 2QOHA 1IA8A 4YHTA 1OL6A 2EUFB 1JWHA 4DH5A 3KN6A 4IE9A 2QKWB 3N51A 4QTAA 4QPAA 4A7CA 2NP8A 4F0FA 3QFVA 4J7BA 2JDVA 4WBBB 3E7VA 3L1SA 5HO6A 4E7WA 1CDKA 4TNDA 3HDNA 1CKIA 4FR4A 2QLUA 4EUUA 5CEPA 3A4OX 4QTDA 4TTHB 5AIKA 5KCVA 4RVKA 4ANQA 2C6IA 4DEIA 2HENA 4IC8A 5EI6A 3P9JA 1GZKA 4N6ZA 2H96A 3GC9A 4XG9A 4D28A 2R3OA 2HIWA 4O82A 4M3QA 3MY0A 3DB8A 5TKDA 4CG9A 1OVEA 4IC7A 1JSTA 4NEUA 4RSSA 2QNJA 3KC3A 5L2IA 4CLIA 4DT9A 5AP2A 5EM6A 1H24A 1P4OA 1SNXA 2YM5A 4KKEA 2PUNA 1MRYA 2G15A 2OXDA 3PPJA 1UNLA 5DOSA 5FGKA 4IAYA 4KIQA 3R9NA 3TZ9A 1JKSA 5IQFA 2ITQA 3FSKA 3H9OA 3PA3A 3R8VA 3KRWA 2X81A 4M69B 4CNHA 2F4JA 4GFMA 1XBAA 5IH4A 4PPCA 5FDPA 3COHA 1LEZA 3V6SA 3W1FA 5FEQA 2GSFA 2WMSA 1FBNA 1YXUA 2EVAA 3OW3A 4UWCA 3NR9A 2YM3A 3PSBA 4C57A 5TE0A 3OWKA 2HWPA 3C4FA 2AC5A 4O2PA 4U45A 5FUTA 2VWXA 2GPHA 4LL5A 5ANGA 2I1MA 4FIEA 4FKWA 4B4LA 3DK3A 4B8LA 4U3ZA 5AR5A 1WVXA 5TT7A 2XK3A 5L4QA 3RAWA 2O3PA 2O8YA 3PRFA 3AGMA 5CI6A 1Q61A 2Y6OA 3EL8A 5M44A 1YOLA 3FSFA 4JR3A 3U55A 3A2CA 2H9VA 4K8AA 4LYNA 4A9UA 3TZMA 4ANNA 3F5GA 3C5IA 3OUNB 1UVRA 4FEXA 5H2UA 2WKMA 4Y85A 2ZM1A 4FT7A 1OECA 4ZSEA 3KEXA 2RFSA 1GZOA 3CD3A 4OT6A 3HAMA 3KN5A 2UW4A 4II5A 2CKPA 1WBVA 4AZSA 3QQKA 2QURA 4TWCA 2UZOA 3MDYA 3BYSA 4YO6A 4ASZA 1H1PA 4GJ3A 3SW7A 1UU7A 5C4KA 4C4FA 4PDPA 1GIHA 2NPQA 3UYSA 4AACA 4E73A 4BC6A 3BLRA 3FQEA 3IPHA 3SXFA 3U4UA 5ETIA 4UMPA 1U46A 2WMRA 2GQRA 3QGWA 2WU7A 4ZTRA 2GFSA 3VF9A 3KRLA 3P78A 2BIYA 4A9SA 4HVGA 4FKVA 4UMTA 2PWLA 4GRBA 4JDHA 4RT7A 4XV1A 4BCQA 5LWNA 4XV9A 4TYEA 2QOOA 3QRIA 2Q0NA 1HCLA 2GQSA 4L7SA 3GCSA 3MPMA 1I44A 3I60A 2XKDA 3G6HA 3R8MA 2BAKA 4IBMA 3QZGA 5D9HA 3CJGA 2IG7A 3K3JA 4IWDA 2ITZA 1H1SA 5CNOA 5HE3A 3NCZA 4QP9A 3EN4A 5B2LA 4YJPA 4E8AA 4X2NA 1H08A 3COKA 4LOPA 5BYZA 5HESA 2C47A 4QTBA 4AN2A 5IF1A 3REPA 4W4WA 2RL5A 4PDYA 3BIZA 2V7OA 3QZFA 3PE1A 5T3QA 5JGDA 4MD8E 2UZLA 4YJSA 2Z2WA 3FPQA 3Q32A 4BCJA 3HL7A 4FKOA 2VWWA 2R9SA 4JG6A 4U43A 5HE2A 3BHTA 2HYYA 4BZOA 3OCBA 3MA3A 4FZFB 2ETMA 3TTJA 5CAPA 4FL1A 5AV2A 4YBKA 3R8UA 4IFGA 4FSMA 3PE2A 3HKOA 3F5UA 4MF0A 2UZEA 4U6RA 3S0OA 3FPMA 5AIRA 3MVHA 3PP1A 4IHPA 4KRDA 4WNOA 4FKQA 2OJIA 4FVQA 3OWJA 3KCKA 4K33A 5CS6A 4BDKA 2PSQA 4IAKA 5CSHA 2R0UA 4APCA 2O65A 5LCKA 4EH3A 4NCTA 3LPBA 5HO7A 3UVQA 3CY2A 2J90A 3A7IA 4J98A 1Z9XA 4FZDB 5AUXA 5LXMA 2B54A 5A4EA 1RE8A 5CZHA 4DH7A 5M53A 4R77A 1ZZ2A 3EQFA 4W8EA 5M08A 2E9PA 4RIOA 3AMYA 4PL5A 2GNJA 2Q83A 2R0IA 3QF9A 4XRJA 5K4IA 2XK9A 3O7LD 3ACJA 3EQCA 4FV2A 2X2KA 4G3GA 3AMAA 4I21A 2W1FA 5GJDA 3IGGA 5ICPA 4O38A 4YLLA 3MFRA 4A06A 4H3PA 2UZVA 4BIBA 5C8NA 3TNQB 4CMOA 1G8AA 4EQCA 4C02A 4IVDA 2VTLA 3BYVA 3LCTA 4EK8A 5IQDA 4RRVA 4D1XA 3BHHA 3IGOA 4LG4A 4ONAA 3QTZA 4CFUA 3GFEA 4L68A 1YXVA 3KB7A 3FY0A 3TCPA 4ZLOA 3E8NA 5JFXA 2J50A 2RFDA 3MESA 3OEFX 4BCGA 5HTBA 3OC1A 3VBWA 2JAMA 3MW1A 4ZK5A 3BHYA 3I5ZA 4FUXA 1YWRA 4OT5A 4QQCA 3E5AA 1LP4A 2ETKA 2XIRA 4YPDA 5E4HA 3I4BA 3ZEPA 1OKZA 1Q4LA 3R7UA 2PZRA 2VWYA 1V1KA 1YDSE 1CKJA 3FC2A 3EHAA 3HMNA 3MSSA 3PYYA 2XM8A 3D94A 4IVAA 1ZARA 2OJFE 2RIOA 3DAKA 4CZUA 3K3IA 4Z7GA 3ZC5A 3NUXA 3D2KA 4LFIA 5M4IA 3DKCA 3K5UA 2W5AA 3LFAA 3DK6A 3PY1A 3Q4UA 4GL9A 1P5EA 4OLIA 4AOJA 4FNZA 4Q9ZA 5KKRB 3CQEA 2H6DA 3FZTA 2XK6A 1PXJA 3MY5A 5CEQA 2YIRA 3FQHA 3OCSA 4QMPA 3WF7A 5FP6A 5CEKA 5HEZA 2GNFA 4BTKA 4ALVA 2BHHA 4OTFA 4DFUA 1XH9A 4IZ5A 3C1XA 3DAEA 1XKKA 3P23A 3Q5IA 2HOGA 4DGNA 4V01A 4EH9A 4F1OA 4XUFA 4QP7A 4L43A 3HA8A 5LVMA 1Q8UA 3V8SA 4GV1A 4PP9A 1J7UA 2YA9A 3MA6A 1DI8A 1OB3A 1JAMA 5HBHA 3EFLA 1GIJA 4L3JA 3SGCA 4FG9A 4YLKA 4FEWA 4F6SA 1ERKA 3AQVA 5CU6A 5FLFA 4JDJA 4F9CA 4YO4A 4OTHA 1Y8GA 3AOXA 1KE5A 3FMEA 3CKXA 3QBNA 3V01A 5IH5A 5J79A 4FTLA 3GUBA 4EKKA 5CALA 2OZAA 5IU2A 2QOBA 3QCSA 5KX8A 4M14A 5FQDC 3RCJA 3RZFA 1TQMA 5H8GA 2Z7QA 3CR0A 1JSVA 1WCCA 3F3TA 3I6UA 4NH1A 4PTEA 4Y72A 2C3KA 5CAVA 1H0WA 1ZYJA 4NM0A 2IVSA 3ORLA 2WPAA 3LQ8A 2HZNA 3VS6A 4ANBA 4NZWB 2HXLA 2XH5A 4RC3A 4UYNA 4X2GA 3Q6WA 4YTIA 5DN3A 3UMXA 3N4TA 4G6OA 4TYHB 3FI4A 1O6YA 1ZYSA 3B8RA 2IZTA 3VS3A 3SHEA 2YACA 2XA4A 3GT8A 4JS8A 4W9WA 4U79A 3EYHA 4QPMA 3O8UA 3DPKA 3RALA 3ZDIA 4EZ5A 5LVPA 4AZEA 5HVJA 5IG1A 1U4DA 1RDQE 4GW8A 2ZDTA 2J0JA 1H07A 4FL3A 5IH6A 4UX9A 1FOTA 2E9VA 5FBNC 4ANMA 3PUPA 4PTGA 4AZFA 4QQJA 3IW8A 4IWQA 2EXMA 4LRJA 1ZMWA 5IUGA 5JSMA 3MB6A 1JPAA 4M84A 1XH4A 3OXZA 2W06A 3WE8A 2R3JA 5I9VA 3A99A 4DG2E 2WO6A 4DBNA 4CLJA 5GZ8A 3BGQA 5HIEA 5IEXA 2FSLX 1J1CA 3P7AA 4O96A 4DN5A 4BRXA 3PFQA 3W8LA 1JSUA 2PU8A 1YW2A 3F2AA 1PXLA 5KBQA 4PPBA 5EKNA 4IQ6A 2HZ0A 4IADA 1S9JA 1W84A 3EZRA 2X8IA 3FLWA 3R0TA 4CCUA 5AP3A 2DS1A 5EQYA 4BBEA 4UMQA 4EI4A 3MN3A 3RHXA 3ANRA 4PX6A 4QD6A 3VJOA 2UW6A 3BX5A 5BVOA 3VRYA 4DTAA 2W17A 4HZSA 2PZYA 4XH6A 4O7VA 4JR7A 1WBNA 4F7NA 4ERWA 2G2FA 3OOMA 1SMHA 3QHRA 4RX9A 4O7TA 3ZXTA 4QMVA 3QALE 3DQWA 5HNBA 3UYTA 4O7SA 4XX9A 5K0KA 4LQMA 4ENXA 4CYJA 4TNBA 5JK3A 3LQ3A 5L8LA 4R7IA 3PRIA 4G3DA 4EC8A 2J9MA 4BKJA 4QMWA 2PZIA 3FLZA 5G1XA 3I0QA 4CFXA 2P4IA 3R04A 2CCIA 1GJOA 3PXZA 4FSTA 4IACA 2PVKA 4V0GA 5J5SA 3S2PA 2PE1A 5BQ0A 3KGAA 4KBCA 4QNAA 3ATTA 1XH5A 4CVAA 4PV0A 4BR3A 3P7BA 5A4CA 3QTXA 4XYFA 4ZY6A 1PMNA 3HMMA 4BDHA 5HZNA 4ZP5A 5JZJA 4FVRA 1WZYA 5IMEA 3EB0A 3OWPA 2IJMA 4AOTA 4IX4A 3E93A 2W05A 3EKNA 4QMTA 4XG4A 4DEBA 1UWJA 3UOJA 3DU8A 1AD5A 4JVGA 1IA9A 4BDBA 4ID7A 2R4BA 4PMSA 4YZ9A 1TKIA 3WF5A 4C58A 4F64A 5HNIX 4U5JA 4DLIA 1XR1A 4UMRA 4H1JA 4GMYA 2CN8A 5KHXA 3LMHA 2A19B 5AP5A 3CE3A 3RK9A 3F82A 5GNKA 3TZ7A 3PXFA 4ZY4A 3VHEA 5E9EA 4JNWA 2X1NA 3LM5A 5JFVA 4KBKA 4YU2A 4XMOA 2JBOA 5BYYA 4XG7A 3CIKA 4IJ9A 4XG6A 2PE2A 2I0YA 1GZNA 5ETFA 2WB8A 3PVGA 2WTKB 4D1SA 5DVRA 3QHWA 4FKLA 4O0YA 2ONLA 4NJDA 4X2FA 3ANQA 3LLAA 3ZUVA 5ITAA 2FSOX 1NVRA 3R1YA 5D12A 3OY3A 2VTTA 2NO3A 3ORTA 2P33A 1WBSA 4MX9A 4I5HA 3ZO4A 1YRPA 3PVWA 2XIXA 1U54B 4CRSA 2ZMCA 1B6CB 2EWAA 3GB2A 3R63A 4R1VA 2Z7RA 2EB2A 3G0EA 4CGAA 4JQ8A 2QONA 4G16A 4NTTA 5B2KA 3VBYA 4WSYA 4GKHA 3B2TA 5EYMA 3WIKA 5HHWA 2OW3A 2B9JA 3KF4A 4WOVA 5AUVA 4O22A 4DF3A 4JX7A 2W96B 3TKUA 4GYGA 5CYIA 4JQEA 4FZ6A 4YHFA 3FZOA 3FMHA 4F7LA 3DKOA 4BDIA 5J1VA 4AN9A 4BWXA 5D1JA 2W1EA 5I9YA 2HW7A 3TV6A 2WTCA 4EOOA 3I79A 2DUVA 3I0OA 4OBQA 2WMWA 4AFEA 2V0DA 3HECA 3M11A 3S1HA 5I9ZA 3KKVA 4O1PA 2W4KA 4BI0A 1W82A 3R00A 3GCVA 4RJ8A 5EYKA 2XJ2A 4RBLA 2VTMA 3K2LA 4RMZA 3QU0A 1TQIA 5HIBA 2VTOA 2FH9A 2A27A 5C26A 3I7BA 2Y9QA 4NYEA 2R5TA 1IRKA 5JRSA 1BX6A 3OROA 3KXGA 4JOAA 3VIDA 2VO0A 2WQEA 1PF8A 3CC6A 1U5QA 4LGDA 3VC4A 4U7ZA 4K2RA 2XBJA 2ZV7A 5CAQA 2UVYA 4B8MA 3F61A 3QRTA 3QD4A 3ZS5A 4FEVA 1Q8YA 3IO7A 4FTOA 5JRQA 3F88A 5LMBA 4FGRA 3R30A 4HYUA 3BE9A 4TW9A 3W2SA 4MQ1A 3GU6A 4J95A 1KSWA 3DB6A 3DGKA 5AP4A 1ZMUA 1YDTE 3QQLA 4DEGA 3LFNA 2J2IB 4NK9A 4BL1A 5AEPA 5CF4A 4IEBA 2CMWA 2BDJA 3OHTA 2I6LA 3QLGA 4F1TA 2Z02A 5F94A 3LHJA 3ORIA 4EOPA 4DT8A 1ZOHA 2CJMA 3Q5ZA 4R3RA 4S2ZA 3SKCA 3GGFA 3GNIB 3VS2A 2WTDA 3NYNA 2YHVA 4C33A 1Q3DA 2UW8A 3ZCLA 3NPCA 4LRKA 2W5BA 1KV2A 1JKLA 3NUYA 4UYAA 5E1SA 4ZTSA 3D5VA 5HQ0A 1SNUA 4MBJA 2WAJA 3BBTB 3VUGA 5M07A 2W99B 1REJA 4L01A 4D2VA 4UN0C 3QWJA 3ENMA 4M68A 3EFWA 4CFWA 3RAIA 3I1AA 2BRMA 4WT6A 3QD3A 5G6VA 3VJNA 4D0WA 5AUYA 4LMNA 1BI8A 4Z55A 3R71A 4U81A 5KMJA 2J0IA 2R3KA 2UZWE 4UB7A 4FG8A 1L3RE 2B7AA 4WG4A 4G6NA 4E6QA 1EH4A 1SVGA 2PYWA 2KULA 1OKYA 2BAJA 3NMUF 4XG2A 2YM8A 2YIWA 4FSRA 5A14A 3CTQA 4ACHA 3VUIA 5HBEA 4MVFA 4XHKB 4O1OA 3MYGA 1H28A 4EOQA 3HP5A 1UU8A 5KZ0A 1GIIA 2JDRA 5M51A 1ZXEA 4I6HA 4ITIA 3DBDA 2BZIB 3IKAA 4FKUA 4NTSA 2WMUA 2QOKA 2G1TA 4GK3A 3ZFXA 3UVRA 4FG7A 5DFPA 4EHVA 3C51A 1OITA 4KKHA 4KBAA 4IMYA 3KXMA 5HX6A 4H36A 2Y6MA 3LFDA 2YDIA 3KK9A 4W9XA 1KOBA 1ZAOA 3FE3A 3PG3A 4QYHA 5EW8A 4BYJA 3L8VA 4FKIA 1YQJA 1Z5MA 3LM0A 3HV6A 3BYUA 3F66A 3QRKA 4J8MA 2XRWA 2JDTA 3PTGA 2HAKA 5AP1A 4I24A 4BZNA 5I3RA 5IA4A 4E6AA 5EYCA 4AX8A 4LV8A 3FLNC 4YTFA 5KNJA 4O86A 3KREA 2B52A 4HOKA 1ZWSA 4FBXA 2YISA 2C6LA 3BHUA 3JVRA 3MH2A 4MTAA 4Y73A 4BIDA 3QQUA 4JBQA 4DCEA 4KIKA 3D7TA 4EBWA 1W83A 3NCGA 4R78A 4CSVA 3BCEA 1KE8A 4UBAA 4R5YA 5LWMA 4OGRA 5IQEA 1YOMA 2BKZA 3CQUA 5DPVA 3ZO3A 3NGAA 2FSMX 3RJCA 2QVSE 4F08A 4F6WA 2QOIA 4FV5A 4C38A 4GH2A 4L9IA 3AC4A 3AC3A 4RWJA 1W0XC 1YDRE 4PQNA 3LCSA 1CSNA 2VO3A 5DNRA 1RW8A 4GU6A 3F9NA 4MBLA 5DRDA 4K6ZA 3HGKA 4RIWB 2A4LA 2O2UA 3IG7A 1OL1A 2ITUA 2XIKA 4BHNA 2BCJA 3Q6UA 2X9FA 4TXCA 3NYXA 1BMKA 3RBWA 2XNOA 1V0PA 4O0WA 2CNQA 2W0JA 2PL0A 3KMMA 3V5PA 3WZJA 4BCFA 2DWBA 2P2HA 3ORKA 1G3NA 1DS5A 2R3IA 5H3QA 4BYIA 4DFXE 5KO1A 4FKPA 2BRGA 4FV0A 4RJ6A 4YSMA 4DFNA 2WTIA 1PRYA 4GEOA 3ZZWA 5L6OA 3JS2A 4DFBA 4I92A 1IAJA 3OD6X 3WILA 1YVJA 3PIYA 4XS2A 4FZ7A 1PW2A 3H9RA 2ITWA 4D4RA 2XMYA 1B38A 5HU3A 5BVEA 2C5YA 4P90A 1YXTA 2QC6A 4IX6A 4JQ7A 3DA6A 1H27A 5BUIA 3RINA 2GHGA 1FVRA 3KA0A 3L8XA 3LFBA 4ZZMA 3FKOA 5DE2A 4IX5A 3CY3A 2VGPA 3IDPA 1WAKA 4GK4A 4U41A 5HCXA 4ASEA 5HTCA 3VVHA 5EOLA 5LMKA 5FTOA 5L8JA 3QD2B 4GT5A 4WRGA 2OO8X 3TWJA 3W18A 2OI4X 2VX0A 2XF0A 4BDEA 2X8DA 3PJ8A 2QHMA 3IW5A 3LE6A 4ZEGA 4FKSA 2GNLA 3AG9A 3S00A 5AM7A 3ZU7A 1YI6A 5BNJA 1BYGA 3FMJA 4OTRA 4C8BA 4BBFA 2PVFA 4CKRA 4KINA 2YM7A 4M15A 3Q9ZA 4WD5A 3FI3A 3T9IA 4RIYA 3PXKA 4OAUC 4HYSA 4CFFA 5HLNA 3MFTA 3KRRA 1UU9A 4E4MA 3DAJA 2IVUA 4IB1A 1KV1A 2VWUA 4EHGA 3EQRA 3EQIA 4X21A 3CGOA 3R9DA 1ATPE 2JKKA 4QMYA 2I0EA 3O8PA 1OIQA 1XH6A 4I41A 4M0ZA 4BKYA 1WBPA 4O0VA 3NUAA 2Z7SA 2ZJWA 4NIFA 4C4GA 2JIIA 5CU0A 4IFCA 3AMBA 4MNFA 4XOYA 3BQRA 4GVAA 4MD7E 1IR3A 4NM7A 5DGZA 4M12A 5AV3A 4EUTA 5GIPE 5I9WA 2YWPA 3DKFA 3MTLA 2BVAA 4PWNA 4FTTA 3O17A 4XV2A 4DH8A 2R2PA 3FEGA 4YSJA 2AC3A 4KUJA 5ETCA 2FVDA 4CXAA 3GEQA 4CTCA 2PMLX 4KWPA 3GI3A 3OZ6A 3FLQA 3DT1A 4BCIA 4D9UA 2BTRA 4JAIA 4RWKA 5CSWA 3UDBA 4L53A 3F6XA 4FV1A 4ZS0A 4AGDA 4C37A 4I94A 2XNMA 5DLSA 2B0QA 2YIXA 2PE0A 2C6DA 3RCDA 1HOWA 4IB0A 5A4QA 2BRHA 3SLSA 3E92A 4E4XA 3HRBA 3E3PA 4FI1A 1TVOA 4FZAB 4N4SA 2CHLA 2X6EA 1XWSA 1NVQA 4XV3A 3W8QA 4F99A 2PVHA 4G9CA 2HK5A 4NKAA 3RMFA 2O64A 5BMMA 4J71A 3QCYA 3HV7A 2C6MA 2YN8A 3R02A 5IA5A 2VUWA 2CGWA 1WBTA 4X3FB 3ALNA 3HEGA 4ZOGA 2B9HA 4QMMA 4TT7A 1NA7A 3DDQA 3E8DA 4UZDA 4O0XA 5CXZA 3PJCA 4JBVA 1KE6A 4G3FA 4IZYA 4JT3A 1BKXA 2GNIA 2X0GA 2XKFA 2C30A 2CGUA 3D2IA 5EM5A 2ZV2A 4KS8A 3OT3A 3A61A 3N4VA 3LLTA 2KTYA 4P4CA 2ITOA 3ZC6A 4K1BA 2C5OA 2X2MA 5J9LA 4GSBA 3O8TA 3EH9A 4B6LA 4BBMA 2OICA 4PMTA 5L2QA 2BDFA 1PHKA 3T3UA 3IW4A 5ETAA 5C8KA 3F5PA 1JBPE 5CENA 3SX9A 3DXQA 3LXKA 3BLHA 3AXWA 3BPRA 1Q41A 5C8MA 3EMGA 3BEGA 4YJUA 4BCKA 5HOAA 4D2RA 1OMWA 2GS7A 4D2PA 4DEHA 4FEQA 2XYUA 3C13A 5E91A 4ITJA 3OUKA 2WMXA 1VR2A 3TXOA 4BGGA 5CAOA 1Q5KA 2VTSA 4IDVA 4LOOA 5HNGA 2XIZA 4O2ZA 4PDOA 4TWNA 3D15A 2R3NA 4MAOA 4YP8A 5HE0A 2XEYA 3GVUA 3UPZA 3LXLA 5A4LA 3GCUA 5F95A 3DS6A 3QUDA 2PMNX 4K0YA 4P5QA 1X8BA 5DIAA 5HD7A 4AGUA 3FMKA 2VTNA 2OGVA 3GOKA 4GUBA 4YJRA 2W9ZB 3TV4A 3TNHA 4HVHA 2H8HA 5HLPA 1GAGA 4IIRA 2VN9A 5LQFA 5GIOE 4MYGA 4BDJA 5I9UA 4ASXA 2R7BA 3CKWA 2BZHB 2XVDA 3VS0A 3LAUA 2J51A 3ZM4A 4EOSA 1WFCA 5EM8A 4AZVA 4BVUA 1PXNA 4ZSAA 5J1WA 4TYGA 3UC3A 2XZSA 3P5KA 5CSPA 5AR2A 3TV7A 3NUUA 4AZWA 4O7YA 1JOWB 2VTAA 3R73A 4QP2A 5JZNA 3QRJA 3F3UA 3G90X 3LFFA 5E8XA 2PMOX 3QTSA 2BHEA 1R39A 3TG1A 3TTIA 3UO5A 4KIOA 3QXPA 3S95A 4F9WA 2I7QA 2EB3A 3GC7A 4UZHA 4QTEA 1IEPA 2V55A 4O0RA 5EW3A 2OLCA 4ZMFA 3PWYA 2CLQA 3OTUA 2BPMA 1BI7A 2CSNA 3QD0A 4HJOA 5EDRA 3FJQE 3SDJA 3LMIA 3A7GA 3PDTA 4IJPA 3MB7A 3UTOA 3LJ1A 4Z16A 5J5TA 1NVSA 3DBFA 5ANKA 2B55A 3LFQA 4M66A 1RJBA 4MKCA 3MPTA 3QKLA 2REIA 3OFMA 4JL9A 4QP1A 4B0GA 4EBVA 2UW3A 4XP3A 3O50A 5C27A 1URCA 3QTRA 4G3CA 4KKGA 3Q9WA 2JKQA 4IM3A 5CVGA 2HXQA 5IKWA 4YJNA 4AG8A 3TDWA 3ZBFA 2Y4IB 3O96A 1NY3A 3AD6A 2PVJA 4E5BA 1FINA 3U8WA 3VQUA 4BHZA 3WF8A 2IW9A 3CP9A 3EQPA 3LW0A 2JKOA 5IQGA 3KMWA 1OPKA 2BALA 4IAFA 3KL8A 3KF7A 3MVMA 3MFUA 4WG3A 2X8EA 3UO4A 4EK3A 4R5SA 2R3QA 2IVVA 2YM4A 1ZY5A 3DQXA 2B53A 2ITPA 2DYLA 3WZUA 3LFSA 3ZRLA 4HCUA 2WMTA 3PG1A 1HCKA 4YBJA 2RFEA 2QO7A 4DTBA 4LGHA 4QMXA 3RWQA 5E8WA 3MIAA 2XBAA 5C01A 3ET7A 4I1ZA 4EH8A 3FZ1A 4CKJA 3CTHA 3ETAA 3COMA 5EI8A 1OPLA 3CGFA 2WMQA 4UEUA 5AM6A 3QQHA 4PMMA 5M4FA 4HGSA 3NS9A 3K54A 3P86A 4KIPA 5FG8A 4RJ7A 2YJRA 3SRVA 3VUTA 4AXAA 3ULIA 5A6NA 3W2PA 4NM5A 4HYHA 4CT2A 4S30A 3GU5A 5DT0A 2BZKB 4BN1A 1J1BA 5IQAA 3JY0A 4NIFB 1PKDA 4MWIA 4EC9A 2OWBA 3BGPA 4KABA 4UV0A 3D0EA 4FL2A 4D4YA 2ZB1A 2HWOA 4AA5A 4G3EA 4JJRA 2O0UA 3TACA 4RIXA 2OG8A 5HORA 5GJFA 4ACDA 4PL3A 1ZYDA 5KKRC 4PRJA 4OR5A 3UIBA 4EOJA 2Y4IC 4D1ZA 5CY3A 5JH6A 1JQHA 3EN9A 3NIZA 4GIIA 4D2TA 3QUPA 4Q5EA 1PKGA 3BI6A 3Q3BA 4I5PA 4F7SA 3MIYA 4ZLZA 4ZXTA 2Q0BA 4I23A 3LXNA 2HELA 1T46A 2YITA 3V8TA 2G2HA 4P5ZA 4ORKA 4IVCA 1WVWA 2GTMA 1OPJA 4Z3VA 4LM5A 2R3FA 5TR6A 3NNVA 3FYJX 1DAWA 3DFAA 2HZ4A 4U3YA 4YC8A 5M4UA 3RGFA 3R22A 5T68A 4CKIA 4RQVA 5H8EA 3BEAA 4EQMA 3GQLA 3JVSA 3A60A 5H8BA 4I5CA 4GG7A 5D10A 4J8NA 4DC2A 5F9EA 4IX3A 3G5DA 5KUPA 3DOGA 3ORNA 3DZOA 3G51A 2WTVA 4X0MA 4DFYA 5E8SA 4H58A 3NIEA 1ZY4A 2P3GX 3TIYA 4MXOA 4A9TA 5D41A 1UNHA 4J96A 1GOLA 5D7AA 3P0MA 5DT4A 2WTJA 1OL7A 4E93A 3W2RA 4F0IA 4Y8DA 4D4VA 3DLSA 3DTCA 3JXWA 3Q2JA 2UW5A 2WOTA 4MNEA 1SM2A 4HCVA 2JC6A 3W32A 4YR8A 3TNPC 3ZUUA 4WA9A 4OTIA 4RFYA 4EWHA 2FUMA 4Q2AA 1OUKA 4O84A 2XKCA 4BDAA 3OEZA 3ZFYA 2W1CA 5D7VA 4AU8A 5B2MA 5BUEA 2GNHA 5J8IA 4FMQA 2ZM4A 1BLXA 2ZV9A 4UXLA 3NUNA 3C4ZA 2C6TA 4FYOA 3VUKA 2O63A 2QODA 1GY3A 3F3VA 1PXIA 1M14A 5CSXA 1CMKE 4YJTA 5DG5A 5EHYA 3VHKA 3QWKA 4U0IA 2B9IA 4OTWA 1APME 2YJSA 3RK5A 4BB4A 3SA0A 4USFA 3G33A 4F1MA 1XJDA 4PNKA 5AADA 5HI2A 1Q8WA 3POOA 5E8YA 1LUFA 5E8UA 4G6LA 3KULA 3ZSGA 5AP7A 2BILB 1E1XA 2CCHA 2OK1A 3EN7A 3OP5A 3WZKA 2GHMA 4YUQA 5LCJA 1MRVA 3ODZX 4R6VA 1Q8TA 3VN9A 3PXQA 4E6DA 4M67A 5EYDA 4HVIA 4EZ7A 3ZYAA 3GENA 5L6PA 5DR9A 3QCXA 2IO6A 3FBVA 4I6FA 5C1QB 1NT2A 5C03A 1PYEA 4M8TA 5HIDA 3PIXA 4C7TA 4JDKA 2C6OA 4M13A 5DA3A 3GCQA 5FM2A 2VV9A 3R9HA 3ZLYA 4AW0A 2UVZA 4DAWA 1DI9A 2W9FB 3AC8A 3KY2A 3TKHA 3VUMA 4XOZA 3AT3A 5CEOA 4OTDA 4FOCA 4FE2A 5C4LA 4EKLA 1O9UA 2YIQA 4B9DA 4EK5A 4F4PA 3IW7A 4RFMA 1XH7A 2G01A 3ULZA 2ETRA 5CQUA 3JYAA 4CV9A 1KOAA 4IWOA 1QPJA 2WELA 1XH8A 5HD4A 2OH4A 5IDPA 4EONA 4ZTQA 5L2SA 3HV4A 3QX4A 2C0TA 2IN6A 5EHOA 2XNGA 4O6LA 2ITYA 5CWZA 5J9YA 2YERA 4ENYA 3R9OA 3QA8A 3FZSA 4QP3A 5FRIA 2WQMA 3TJDA 3IS5A 4DFZE 4C4JA 5CI7A 3VUHA 4XP2A 1UKIA 4UY9A 3O2MA 2OZOA 4FV6A 3RNYA 5DR6A 5CXHA 3DBQA 3BU6A 3RTPA 3M2WA 4AGWA 4BI2A 3JUHA 4YMJA 5CZIA 4BCNA 3UP7A 4DLJA 5IEVA 2YZLA 2YCQA 2C5XA 2P55A 1Q3WA 2OXYA 3WBLA 2X4FA 5EQPA 2JLDA 2BTSA 1UKHA 2W4OA 3ELJA 3G9NA 2UZUE 3LCKA 3QCQA 5DI1A 5AV0A 3U6HA 3TT0A 3LKMA 5I0BA 5L3AA 4FX3A 4BICA 4CRLA 2WQBA 2Z60A 3K5VA 3TL8A 3EIDA 3S4QA 5GJGA 4HVSA 3LOKA 4JDIA 5CF6A 2YCRA 5AUWA 4FT3A 4QMQA 3U51A 3HRFA 4HGTA 1UA2A 5K5NA 3F2NA 3PA5A 4NW6A 4EHZA 2VGOA 2YCSA 2FO0A 3RPOA 2WIPA 3L9MA 3R1SA 4XEYA 5GHVA 2C5VA 2OFVA 3CLYA 4YZNA 3U4WA 3DZQA 4NCTC 5LJJA 4HYIA 2C69A 5CNNA 4QO9A 4AS0A 2IZRA 4ZAUA 1JKTA 3QZIA 3R83A 4EK6A 1Q24A 3E8EA 5KMNA 3IDCA 2CKOA 2V62A 4MXZA 1OBGA 2WTKC 2YDJA 4LRMA 2YZAA 4EK4A 5E92A 3D9VA 3H30A 3MPAA 5EH0A 2ZM3A 4C62A 3UOKA 4DE4A 2I40A 2OIDA 3Q52A 4XJ0A 4BTFA 3SV0A 1QPDA 3H4JA 3HDMA 4K9YA 3SD0A 3T8OA 4P2KA 4FTNA 2QG5A 3MI9A 4RVTA 5ANOA 3FKLA 1M7NA 4MH7A 4YTHA 5M09A 1PMUA 2OZAB 2IW6A 2PULA 2VTQA 2QU5A 1R0PA 3E7OA 5JGBA 3ERKA 2CNVA 1KE7A 2J0MB 4HNFA 3E87A 3R28A 3FQSA 4W4XA 4UWBA 2W5HA 4IM2A 5BVKA 4OBOA 4ASDA 1XO2B 4FVPA 1L8TA 3ODYX 2R3LA 3H3CA 3OS3A 4RJ3A 2B9FA 3CBLA 3GU8A 3VNTA 4GIHA 2GS2A 4RA4A 5AX3A 2JFMA 4QP4A 5I5ZA 3Q04A 2IWIA 3BBWA 4I4EA 4IAIA 3FZRA 4QYEA 3HV5A 4E1ZA 3FXXA 2RF9A 3BELA 4OTPA 3O0GA 4RG0A 1OI9A 4CT1A 3AC5A 2YFXA 4GUEA 4DEAA 4EJ7A 2VX3A 1LPUA 3ORZA 4QOXA 2OIBA 1MUOA 2JEDA 3V3VA 5JEBA 4UALA 5IISA 3CS9A 2OKRA 4UXQA 1T45A 4JIKA 4QQTA 5AP6A 2C5NA 2IZSA 5KHWA 3A7FA 2PZPA 3GQIA 4QRCA 4O7WA 2WD1A 5EI2A 3UG2A 5JKGA 5F1ZA 1S9IA 1W8CA 3A7HA 2VWZA 3N9XA 4RQKA 5HO8A 3FY2A 3KRJA 4F9BA 4FIJA 5IA3A 2WHBA 4O27B 3DNEA 1H1QA 3DTWA 4G34A 4PL4A 3U87A 1H8FA 5AAGA 4ZIMA 3QGYA 2GQGA 4LL0A 4D9TA 4L8MA 3V04A 5HLWA 5IQIA 2I0VA 4WNPA 2PUUA 3Q4CA 3OT8A 4NWMA 4K11A 2WXVA 4AZTA 3W2OA 1YXXA 3D83A 3VW6A 1K2PA 1YOJA 4AW1A 3POZA 5CT7A 1UNGA 1SVHA 2W1HA 4FSQA 5LMAA 4MD9E 1ZYCA 3ZRKA 4V04A 5M06A 2FA2A 2Y7JA 1YHWA 2QOCA 4O6EA 4EWQA 3SW4A 4AA0A 4FTUA 3ZM9A 4NT4A 4TZRA 3C7QA 4GJ2A 3JY9A 3QX2A 4R3PA 3EN6A 3RPRA 2PVRA 3W55A 1VYWA 3HUBA 2QKRA 3R2YA 5EG3A 3T3VA 3ZO1A 2F2CB 5GZAA 3C0HA 3BWFA 2H34A 2YCFA 3FC1X 5IA1A 5EDQA 3FI2A 2JFLA 2VRXA 3LFCA 4BCOA 2ZVAA 4OTQA 3SAYA 2GFCA 3C9WA 5K5XA 2XK8A 4GS6A 2JITA 2RKUA 3IOKA 4U8ZA 4PY1A 4V0GB 2WMAA 4JG8A 5AV1A 3ZONA 4O81A 2UZDA 5CSVA 1IASA 3QA0A 3C4WA 2BAQA 4F09A 1OGUA 2BDWA 3L8SA 3PLSA 2XNEA 4NFNA 4FTIA 3EFJA 4B7TA 3UQCA 3EQBA 4FSYA 2HW6A 5CU2A 4W8DA 3UQFA 4G1WA 4AT5A 1Y8YA 4BGHA 3CXWA 2RSVA 3KULB 4FV8A 2OIQA 2X7GA 3WF9A 4KS7A 3R7IA 4FTRA 4AE6A 2YABA 4L42A 4AF3A 2C1AA 5IQBA 3F3ZA 5F20A 3ZLXA 4E3CA 3CD8A 3CQWA 3GOPA 1G5SA 3R2BA 3ZRMA 5J7HA 3LCDA 3WYXA 2ITNA 4BKZA 2V22A 2YM6A 3W33A 4ARKA 2J0KA 4L7FA 3UC4A 1AQ1A 4ACMA 3RKBA 5HG7A 4D5HA 4ERKA 5BYLA 3A7JA 2BRNA 1CKPA 4ZSLA 2XS0A 4HVDA 4AA4A 3UZTA 4IDTA 2GS6A 4FTJA 4YZCA 4DBXA 3UNJA 4F70A 5L2WA 3GFWA 2VAGA 4RC2A 3NYOA 4M7IA 4CZYB 5D11A 2VTHA 5IPJA 4AW2A 4NSTA 4QYGA 2XJ1A 1J91A 2OSCA 3LZBA 4GCJA 4YHJA 5AUZA 3ID6C 4QQ5A 3OXIA 4L00A 3UE4A 2FYSA 3HP2A 4ZZNA 1Q97A 2FGIA
chains in the Genus database with same CATH superfamily
2GTNA 4J99A 3GC0A 3UZRA 1U5RA 2CGXA 2GMXA 3EL7A 2YWVA 3OG7A 3QTWA 5JQ8A 3R8LA 3P4KA 3PVUA 3W2CA 3O5AA 4FKGA 1ZRZA 2R3RA 5HG8A 3RM7A 4DGLC 1OM1A 2F7ZE 3C0GA 3P5JC 4ZSJA 3V5TA 1JNKA 3BGZA 4CZTA 4G2FA 5HBJA 4DCAA 1OZ1A 4RWLA 5I3OA 3UIMA 3R1NA 2LGCA 3GCPA 4C61A 3T9TA 3D5XA 5DBXA 5IEYA 3P1AA 3WIGA 4BDGA 3AGLA 4FIIA 5HGIA 5A6OA 1KE9A 4CD0A 1PJKA 4LUDA 4MWHA 1PXOA 2B1PA 5L2TA 3HMPA 3VO3A 3W16A 4FIFA 3ZEWA 1JVPP 3A62A 5TO8A 3ATSA 4JI9A 2ZDUA 2XYNA 2ITXA 3HAVA 2OXXA 5E7RA 2J5EA 2JKMA 2PY3A 3UMWA 1M52A 1M7QA 5AWMA 5TOZA 5HVYA 3HYHA 5BUJA 2ACXA 3FLYA 3D7ZA 3L8PA 4JRNA 3PLAE 1A9UA 3GP0A 2VWVA 3BWJA 4IVBA 4DFLA 1OKVA 4CFMA 1Y6AA 1Y6BA 4G5JA 1REKA 1DM2A 5M4CA 5DEWA 4L67A 4P7EA 4O7ZA 2QD9A 1IG1A 4QYFA 3LCOA 1GZ8A 4FA2A 5DRBA 2XUUA 2ONLC 2BIKB 1XQZA 2R3MA 3LIJA 3U9NA 1ZOGA 4C2WA 2WEIA 3OOGA 5KMOA 4YTCA 2UZBA 4FT9A 1IAHA 3VRZA 4YC3A 3V5WA 1R78A 3II5A 4RJ5A 4L44A 4QMUA 3ROCA 5FXRA 5JT2A 3DXNA 2HY81 2IZUA 3FXWA 4R8QA 4RC4A 3B2WA 2VWIA 4RLLA 5IA0A 1PY5A 2VWBA 2RG6A 4DG0E 3CEKA 1LR4A 5BX0A 4U97A 1JLUE 2YLEA 2OF2A 2FB8A 4QPSA 1E9HA 4FSNA 1FMKA 4IH8A 2EU9A 4WG5A 3UODA 2R3HA 3NAYA 2VD5A 4TYHA 2O5KA 1Q99A 3RI1A 1SVEA 2PVLA 2WMVA 3IDBA 4EHEA 4AXDA 3V6RA 3KMUA 3G2FA 4TPTA 4MXXA 5A54A 4EZ3A 3KQ7A 3JPVA 3QYZA 2XNBA 3HVCA 2CLXA 3FMDA 3Q4TA 3UVPA 3BU3A 3HMIA 4TY1A 3MS9A 3RPVA 3RWPA 4FKTA 4C59A 5CF5A 1FMOE 4DYMA 2OF4A 2BFXA 1M17A 4WBOA 4AT3A 1NW1A 4APPA 1DAYA 3OCTA 4TYJA 3N4UA 4GVJA 2XCHA 4BY9E 3R7OA 5AR3A 1AGWA 4N0SA 5CU4A 5AR8A 3MGYA 1J7LA 3F7ZA 3QQFA 3BHVA 3MH1A 3SOAA 1MP8A 2J0LA 1Y91A 2Y0AA 4QP6A 3NSZA 4NU1A 3C5UA 3V5LA 2OJGA 2QCSA 3KXHA 4YNEA 3D5UA 3P7CA 4ZJJA 1W2FA 5CF8A 3TNWA 4D2SA 1MQBA 4QYYA 4E4LA 4FTKA 3H10A 3MTFA 3H9FA 3SOCA 5DH3A 3ZBXA 2CN5A 2CKEA 3FHIA 1FVVA 5AUUA 3VS4A 3ZSHA 5A4TA 4MEDA 5IMXA 4AE9A 2ESMA 4XLIA 2J5FA 3EQDA 3FV8A 4X6QC 3W0RA 2OJJA 4UMUA 4A9RA 5L8KA 4Q5HA 3NAXA 2VTJA 2W1ZA 3QC9A 3MBLA 4O21A 4OUCA 4QMNA 3VS7A 5AAEA 4ZSGA 3R7YA 2XB7A 2IPXA 3R8PA 3SG8A 3UIXA 3EKKA 4YLJA 2Y4PA 4XBUA 3PXYA 3PA4A 2XARA 3E8CA 4GFOA 4CFNA 5I9XA 1H26A 5FTGA 3QRUA 2OH0E 3DKGA 3QKMA 5IZFA 4FV7A 4IZ7A 3HLLA 2ERZE 5AAFA 3W10A 1CM8A 4YZBA 5CTPA 3U6IA 5FXSA 3BLQA 1UU3A 2VZ6A 3FWQA 4GKIA 4DITA 4GK2A 2QR7A 5IDNA 4AQCA 2CGVA 4RX8A 5E8TA 1Q62A 5J7BA 4J97A 4E26A 3LQ5A 3R6XA 4C4HA 5EQEA 2QO2A 3FZPA 2XNNA 3SG9A 2QG7A 2P2IA 2R3GA 1BL6A 2G2IA 4BCHA 1PXKA 3VS1A 4WSQA 3VBQA 4M0YA 1QPEA 4USDA 3UDSA 3I6WA 3OTVA 4IM0A 4LI5A 3IK3A 5CEMA 3NNXA 3FMMA 2W7XA 2X4ZA 3MJ1A 2WTWA 3PJ3A 4JAJA 4L3LA 4RVLA 4X3FC 4YGAA 3EFKA 3TIZA 3U9CA 4TWOA 3L9PA 4NM3A 1ZZLA 3NW6A 4FOBA 3NUSA 4KIKB 3D7TB 4ZZOA 3HMOA 3C4CA 4ANSA 2PPQA 2SRCA 5K3YA 4DHFA 3FMLA 4YNOA 2PVYA 3PY0A 3QTQA 4I0SA 4U44A 4XP0A 3SXSA 4F65A 2VTRA 5BVDA 3DK7A 2JAVA 4FSZA 3FI8A 3R7EA 5DR2A 5EK7A 2XKEA 1FPUA 2OBJA 4WO5A 4HGLA 4C4IA 5FD2A 4GU9A 3KXNA 3NLBA 2X0QA 4LOQA 4X2KA 1M2RA 4ACGA 4E5WA 4E6CA 3QAME 3QQGA 4TKSA 4F9YA 3TZ8A 4MBIA 2PUIA 2GDOA 2B4SB 1WBWA 4GYIA 3ZMMA 4JRVA 4C35A 2WGJA 4QP8A 4D5KA 4RVMA 3MH3A 3DNDA 1P2AA 1U59A 4QMZA 4YPSA 3SXRA 4L3PA 5FDXA 4ALUA 4ZJVA 4BJJB 2W4JA 4EYJA 1O6LA 4RZVA 2HCKA 2ZB0A 4OW8A 2F7XE 1M2PA 2J6MA 3ORPA 5H9BA 4ANLA 4EEVA 3KU2A 3GXLA 3OMVA 3L9LA 3VBTA 2GHLA 5JN2A 1Z57A 2X6DA 3DFCB 4LUEA 1U54A 2UW9A 4HPUE 3TJCA 4D58A 3ZO2A 3A4PA 2QOQA 4HZRA 4FTQA 1O6KA 1FQ1B 1FGIA 1STCE 4FF8A 4U42A 5CLPA 5HG5A 4C0TA 5DHJA 4KRCA 3FDNA 5AR4A 4BWPA 3F2RA 4FODA 4OBPA 3UO6A 2CNUA 5FP5A 3EN5A 5LVNA 4E5AX 4O0UA 1K3AA 3PZHA 4RX7A 3ZUTA 1PMEA 2X2LA 1F0QA 4WUAA 4U40A 4MXCA 5AX9A 5LOHA 4KD1A 5DT3A 3QXOA 5A9UA 4O7LA 3MFSA 3VF8A 3DJ7A 3NUPA 5CAUA 2UZNA 4U80A 3UOLA 5IUHA 3HRCA 3NEWA 3QZHA 3HA6A 4I3ZA 3LVPA 5AV4A 2UZTA 4X2JA 3UP2A 3WI6A 2BFYA 3EQGA 4RPVA 4A4XA 1OBDA 2XAOA 2G9XA 4FV3A 4IAZA 4C4EA 3H0YA 3NFGB 2A0CX 2AYPA 2R3PA 4RIYB 3WE4A 2C3JA 2C68A 4JXFA 5BVWA 4BDFA 4NJ3A 1W7HA 2C0IA 4I5MA 4HW7A 5HVKA 3ZLSA 2RFNA 3NYVA 3WZDA 3PZEA 2IVTA 4YZMA 4A4LA 1ZOEA 2ITVA 4XCUA 4FEUA 4I6BA 2VO6A 1K9AA 3G6GA 3RPYA 4S34A 5F4NA 4DGMA 5JFWA 1QMZA 1RQQA 2BUJA 3RK7A 2W1DA 1Q8ZA 4J1RA 5FTQA 3FMNA 4ZMEA 4Y95A 3IW6A 5A3XA 4PTCA 2JIUA 1H4LA 3V5JA 4W4VA 3BYMA 4EH6A 3PSDA 2XCKA 4MF1A 5BPYA 1YXSA 2WZJA 4FNYA 5EW9A 5M56A 3KVXA 3HX4A 5C9CA 4MK0A 3PJ1A 3VBVA 4AN3A 3W0MA 1J7IA 4PP7A 5LMKC 1B39A 2VNWA 4EH5A 1ZMVA 2BKKA 1OL5A 5ANJA 5IQCA 4KSQA 4USEA 3G15A 3O7LB 2QLQA 5BVFA 3R1QA 1GNGA 3BYOA 1QPCA 4LMUA 4J53A 5CEIA 4ZJIA 2R64A 2UUEA 3NDMA 4WNKA 4R1YA 3RHKA 3W2QA 4EH4A 4DA5A 4D4SA 3M42A 1MQ4A 3GU7A 4FTCA 5KE0A 5CANA 5KMLA 4OAVB 1FGKA 4DH1A 3V8WA 1V0OA 2HZIA 3ZTXA 4V05A 3UPXA 3AC2A 5E8ZA 3UOHA 1UWHA 3E3BX 3R8ZA 1KUTA 3SQQA 3IOPA 4E20A 4NL0A 3CTJA 2WEVA 2F57A 3MV5A 3ORXA 4K77A 4XRLA 3V5QA 1XMMA 2C6EA 4I22A 2OU7A 4NW5A 2JDOA 2ZMDA 5HU9A 4AWIA 2UVXA 3B8QA 2WIHA 3R7VA 4F6UA 3QUEA 4ITHA 2V5QA 4S33A 4BZDA 3ITZA 2PHKA 3QLFA 4FT5A 5M55A 4DG3E 2UW0A 3O51A 4JBOA 5HCYA 1QL6A 5CU3A 1URWA 2BMCA 3COIA 4W4YA 5E1EA 3C50A 4AOIA 5K4JA 3EOCA 5AA9A 4ALWA 3NW5A 2NRYA 4KSPA 2I0HA 3IONA 5LVOA 4FIHA 1PXMA 4QT1A 3P08A 5IUIA 3VULA 1ND4A 3QC4A 5DEYA 4I0RA 4D55A 3IECA 3R21A 5ANEA 4EORA 1P14A 3QYWA 2GNGA 4BDDA 4DTKA 3BZ3A 4RFZA 3BU5A 2VU3A 4GFGA 4F7JA 5ANIA 5AMNA 3DXPA 2EXCX 4QMSA 4DDGA 2QOFA 1H1RA 4ANOA 4IAAA 2AQXA 5HKMA 2RG5A 5J9ZA 3EJ1A 3VWAA 3HNGA 2BROA 4L46A 3EWHA 3ROYA 4TN6A 4ZTNA 4EOKA 1YI3A 3AD4A 3KK8A 4MCVA 1YWVA 3NW7A 3UNZA 5IQHA 1H01A 3PSCA 3FYKX 2A2AA 4G5PA 4KAOA 3DBEA 4TL0A 2YIYA 4DH3A 1OUYA 4RJ4A 1TQPA 4N57A 4IWPA 2XRUA 3ZFMA 3VW8A 4NFMA 4Z7HA 5DYJA 3PJ2A 3OBJA 4LGGA 3NRMA 4CQEA 4CTBA 5AR7A 4PPAA 4BCPA 5AP0A 4ZTMA 3DDPA 3OCGA 4H3BA 4G17A 4GG5A 4I93A 4FSWA 5GZ9A 2ZYBA 3D4QA 4AW5A 4DGOA 2X39A 5JMSA 4RIWA 3PVBA 5KBRA 1VZOA 4Y5QA 1YI4A 3OVVA 3DLZA 3HZTA 2C3IB 3GBZA 4O7NA 3HV3A 4H1MA 1ZYLA 3TI1A 1CTPE 2J7TA 3AT2A 1I09A 2OJ9A 4S31A 3U6JA 5EKOA 3S3IA 4FKRA 5CVHA 4CMUA 3BE2A 4PUZA 4FJVA 2NNWB 3PWDA 5ANDA 3AD5A 4AUAA 4CQGA 3NZ0A 4JX3A 4Z9LA 3RPSA 2JBPA 2OFUA 3SC1A 3NVKI 3AC1A 4ACCA 4F9AA 3TKIA 3LMGA 4EOIA 3I7CA 3O23A 4YZDA 2RGPA 4B99A 4L52A 4QMLA 1R0EA 1PYXA 3BQCA 5HE1A 4AP7A 4ZS4A 4YJQA 5K0XA 4TRLA 2QOLA 3H0ZA 3V51A 3Q2MA 4CCBA 3FL4A 2C6KA 3R9RA 3GC8A 4IANA 3ALOA 2PVNA 3DJ5A 3MY1A 4BJJA 4CV8A 1OIUA 1JKKA 2C4GA 4FNWA 5EHLA 2JIVA 3RP9A 4O91A 2YDKA 5FXQA 2F49A 3OF0A 3BL9A 3FHRA 3TDVA 4O0SA 5EDPA 3M1SA 5ACBC 4EYMA 2V7AA 3PPZA 4F63A 4XLVA 3ZHPC 2CPKE 3P79A 4HNIA 3Q9XA 4KA3A 3TYKA 4RZWA 3UIUA 4EJNA 5BMSA 2WOUA 5EFQA 2WMBA 4ZY5A 2X0OA 3KXXA 3MJ2A 3TM0A 4I20A 5J87A 3KVWA 2YEXA 4I4FA 4H39A 1FVTA 4RGJA 2E2BA 5B0XA 3QTUA 4U9AA 3ZSIA 4WIHA 1YHSA 3HUCA 2QO9A 3G9LX 3R7GA 2FSTX 5GINE 2PTKA 3TUCA 2E9OA 3VONA 1VJYA 4GT4A 3VQHA 3C0IA 3C4XA 3Q53A 2C3LA 3R01A 4RA5A 5DMZA 3MWUA 3D5WA 3ZZEA 4N70A 3UG1A 1YHVA 1YWNA 5JFSA 4JLCA 4X3JA 2WU6A 4CYIA 4IB3A 2E9NA 3E63A 3PPKA 3F5XA 4FYNA 1UV5A 4EQUA 3MH0A 2C0OA 2PZ5A 3ENHA 3I81A 4WHZA 5IA2A 2X7OA 4PNIA 3RZBA 3KXZA 5LVLA 1PMVA 3SRVB 4JG7A 3U54A 3RAKA 1MRUA 4M69A 5EOBA 5FEDA 1A06A 3SVVA 1H0VA 3MVLA 5HX8A 5K9IA 2XAMA 4PF4A 2A1AB 3EYGA 4RLKA 4I0TA 3TEIA 1H25A 5KZIA 2XM9A 3LJ2A 3WOWA 3RVGA 3VBXA 3ZXZA 5KMKA 2P0CA 2E9UA 3UZPA 4LV5A 1H00A 1OL2A 4OTGA 2CDZA 3VS5A 3FKNA 3BL7A 3F3WA 3FUPA 3MVJA 3PP0A 4RIXB 3LFEA 2R7IA 4M97A 5CASA 4FIGA 4L6QA 4WUNA 1PXPA 1VLRA 4FUYA 2F7EE 4A07A 4D0XA 4AT4A 2UV2A 4FTMA 4HGEA 5E90A 4DEDA 4Y83A 3BV3A 4D2WA 2XK4A 3QL8A 3UJGA 4CG8A 2ERKA 3RM6A 1F5QA 4I6QA 1XMLA 3QKKA 4ZTHA 3TMOA 1KWPA 3Q60A 4Y46A 4RX5A 5CT0A 3DV3A 3LXPA 2XP2A 3E88A 2BR1A 3F7WA 3NNUA 4O4DA 4FSUA 4IZAA 5BVNA 3IQ7A 3I5NA 3O71A 5J95A 4O7RA 2VTPA 3DJ6A 1WVYA 4WKQA 3DY7A 4CEGA 3NVMB 2DQ7X 1OKWA 3WARA 1WMKA 4O0TA 4TYIA 4KNBA 4F0GA 3L9NA 3FL5A 4FKJA 4BFMA 1W98A 3A8WA 4MXYA 2NRUA 4CMTA 1SYKA 5B7VA 1LEWA 2VX1A 4GT3A 4X3FA 3ORMA 2XIYA 4R7BA 4ZLYA 3JR1A 2X7FA 2XK7A 4JIAA 4BDCA 1V0BA 4UWYA 4JBPA 3UQGA 1OIRA 3THBA 1M2QA 4DEEA 3QTIA 4TWPA 3QQJA 4XNEA 2W1GA 3WZEA 5L6WL 4FK6A 2J4ZA 5JQ5A 3ACKA 4MNEB 3TUBA 4BTJA 4IXPA 4E4NA 4C3FA 4EL9A 1VYZA 4BCMA 3E62A 5AJQA 4FK3A 4BI1A 5AUTA 5A46A 5HCZA 4XG8A 4A9YA 2WFYA 2JGZA 4NKSA 4C34A 4FTAA 4MHAA 4X6RA 2YAAA 3CPBA 3NX8A 4AGCA 5CVFA 5I4NA 3DCVA 3OWLA 3GU4A 4C36A 4QNYA 3CJFA 3EQHA 4C3PA 5HTIA 3Q96A 4DGGA 2ZOQA 4C3RA 3CCNA 3ZLWA 3ZOSA 5DWRA 4H05A 4YJVA 3E64A 4MXAA 4XBRA 3WYYA 2Z8CA 4AFJA 5AA8A 3TNIA 3CPCA 2Z7LA 3NNWA 4A4OA 3UBDA 4R3CA 4BF2A 4FV4A 2GCDA 4EH7A 3RNIA 1ZLTA 3Q9YA 4FNXA 2EXEA 5HICA 5M57A 2ZAZA 4WRSA 5FBOA 5KMMA 4F78A 2YAKA 1XBBA 4FGBA 2QU6A 5KMIA 2AUHA 2GU8A 3D14A 2QQ7A 3FAAA 2VO7A 1E1VA 2JDSA 3LJ0A 3PXRA 4R7HA 3KFAA 2C1BA 4FC0A 4KB8A 5T6KA 2F2UA 3OXTA 4H3QA 3A8XA 4L45A 2ITTA 2W1IA 3RAHA 3PY3A 4J52A 2UW7A 1H1WA 3G0FA 2JD5A 2PMIA 4YC6A 1XHAA 2BRBA 5E8VA 3VUDA 3ZDUA 4XG3A 4EOLA 2WQNA 4MQ2A 2PVMA 4YJOA 4IB5A 2VNYA 3BRBA 3DBCA 3PIZA 3ZH8A 3CSVA 1F3MC 4NUSA 4RWIA 1YKRA 4FICA 3EZVA 1G8SA 5EM7A 4O83A 1SZMA 4BIEA 4BGQA 4EOMA 5FM3A 3OW4A 4AAAA 2QR8A 4BWKA 4HCTA 1R3CA 4YURA 4C2VA 1BL7A 2QHNA 1NXKA 4FV9A 1VEBA 3UNKA 4QMOA 1XBCA 4X7QA 5CX9A 5FEEA 2VTIA 1A48A 2CKQA 3Q4ZA 2PUPA 3BKBA 3FXZA 4Q9SA 4S32A 4HPTE 2XEZA 1Y57A 4FT0A 4DINA 2YLFA 2PK9A 2X9EA 4G9RA 5HG9A 4G31A 2HY0A 3BV2A 4ZTLA 5TF9A 2BZJA 3WF6A 2IW8A 3VAPA 5JGAA 3TUDA 4WNMA 4PMPA 1J3HA 2WNTA 4QTCA 3UGCA 3OBGA 2LAVA 5ACKA 4CFVA 5FWKK 3FLSA 2XJ0A 5AFVA 1WBOA 3NWWA 5CQWA 1R1WA 2F9GA 3KCFA 2QI8A 3TN8A 4QDVA 1P4FA 3OY1A 1OIYA 4N6YA 2XNPA 4IW0A 3KRXA 4K18A 2ZV8A 1BUHA 1QCFA 2WQOA 3AT4A 3F69A 4PDSA 2Y8OA 5LARA 3C4EA 4BTMA 4EH2A 4Y5HA 2QOHA 1IA8A 4YHTA 1OL6A 2EUFB 1JWHA 4DH5A 3KN6A 4IE9A 2QKWB 3N51A 4QTAA 4QPAA 4A7CA 2NP8A 4F0FA 3QFVA 4J7BA 2JDVA 4WBBB 3E7VA 3L1SA 5HO6A 4E7WA 1CDKA 4TNDA 3HDNA 1CKIA 4FR4A 2QLUA 4EUUA 5CEPA 3A4OX 4QTDA 4TTHB 5AIKA 5KCVA 4RVKA 4ANQA 2C6IA 4DEIA 3UDZA 2HENA 4IC8A 5EI6A 3P9JA 1GZKA 4N6ZA 2H96A 3GC9A 4XG9A 4D28A 2R3OA 2HIWA 2NYAA 4M3QA 2AEGA 4O82A 3MY0A 3DB8A 5TKDA 4CG9A 1OVEA 4IC7A 1JSTA 4NEUA 4RSSA 2QNJA 3KC3A 5L2IA 4CLIA 4DT9A 5AP2A 5EM6A 1H24A 1P4OA 1SNXA 2YM5A 4KKEA 2PUNA 1MRYA 2G15A 3PUFC 2OXDA 3PPJA 1UNLA 5DOSA 5FGKA 4IAYA 4KIQA 3R9NA 3TZ9A 4FRFA 1JKSA 5IQFA 2ITQA 3FSKA 3H9OA 3PA3A 3R8VA 3KRWA 2X81A 4M69B 4CNHA 2F4JA 4GFMA 1XBAA 5IH4A 4PPCA 5FDPA 3COHA 1LEZA 3V6SA 3W1FA 5FEQA 2GSFA 2WMSA 1FBNA 1YXUA 2EVAA 3OW3A 4UWCA 3NR9A 2YM3A 3PSBA 4C57A 5TE0A 3OWKA 2HWPA 3NFFB 3C4FA 2AC5A 4O2PA 4U45A 5FUTA 2VWXA 2GPHA 4LL5A 5ANGA 2I1MA 4FIEA 4FKWA 4B4LA 3DK3A 4B8LA 4U3ZA 5AR5A 1WVXA 5TT7A 2XK3A 5L4QA 3RAWA 2O3PA 2O8YA 3PRFA 3AGMA 5CI6A 1Q61A 2Y6OA 3EL8A 5M44A 1YOLA 3FSFA 4JR3A 3U55A 3A2CA 2H9VA 4K8AA 4LYNA 4A9UA 3AKKA 3TZMA 4ANNA 3F5GA 3C5IA 3OUNB 1UVRA 4FEXA 5H2UA 2WKMA 4Y85A 2ZM1A 4FT7A 1OECA 4ZSEA 3KEXA 2RFSA 1GZOA 3CD3A 4OT6A 3HAMA 3KN5A 2UW4A 4II5A 2CKPA 1WBVA 4AZSA 3QQKA 2QURA 4TWCA 2UZOA 3MDYA 3BYSA 4YO6A 4ASZA 1H1PA 4GJ3A 3SW7A 1UU7A 5C4KA 4C4FA 4PDPA 1GIHA 2NPQA 3UYSA 4AACA 4E73A 4BC6A 3BLRA 3FQEA 3IPHA 3SXFA 3U4UA 5ETIA 4UMPA 1U46A 2WMRA 2GQRA 3QGWA 2WU7A 4ZTRA 2GFSA 3VF9A 3KRLA 3P78A 2BIYA 4A9SA 4HVGA 4FKVA 4UMTA 2PWLA 4GRBA 4JDHA 4RT7A 4XV1A 4BCQA 5LWNA 4XV9A 4TYEA 2QOOA 3QRIA 2Q0NA 1HCLA 2GQSA 4L7SA 3GCSA 3MPMA 1I44A 3I60A 2XKDA 3G6HA 3R8MA 2BAKA 4IBMA 3QZGA 5D9HA 3CJGA 2IG7A 3K3JA 4IWDA 4O4BB 2ITZA 1H1SA 5CNOA 5HE3A 3NCZA 4QP9A 3EN4A 5B2LA 4YJPA 4E8AA 4X2NA 1H08A 3COKA 4LOPA 5BYZA 5HESA 2C47A 4QTBA 4AN2A 5IF1A 3REPA 4W4WA 2RL5A 4PDYA 3BIZA 2V7OA 3QZFA 3PE1A 5T3QA 5JGDA 4MD8E 2UZLA 4YJSA 2Z2WA 3FPQA 3Q32A 4BCJA 3HL7A 4FKOA 2VWWA 2R9SA 4JG6A 4U43A 5HE2A 3BHTA 2HYYA 4BZOA 3OCBA 3MA3A 4FZFB 2ETMA 3TTJA 5CAPA 4FL1A 5AV2A 4YBKA 3R8UA 4IFGA 4FSMA 3PE2A 3HKOA 3F5UA 4MF0A 2UZEA 4U6RA 3S0OA 3FPMA 5AIRA 3MVHA 3PP1A 4IHPA 4KRDA 4WNOA 4FKQA 2OJIA 4FVQA 3OWJA 3KCKA 4K33A 5CS6A 4BDKA 2PSQA 4IAKA 5CSHA 2R0UA 4APCA 1TFFA 2O65A 5LCKA 4EH3A 4NCTA 3LPBA 5HO7A 3UVQA 3CY2A 2J90A 3A7IA 4J98A 1Z9XA 4FZDB 5AUXA 5LXMA 2B54A 5A4EA 1RE8A 5CZHA 4DH7A 5M53A 4R77A 1ZZ2A 3EQFA 4W8EA 5M08A 2E9PA 4RIOA 3AMYA 4PL5A 2GNJA 2Q83A 2R0IA 3QF9A 4XRJA 5K4IA 2XK9A 3O7LD 3ACJA 3EQCA 4FV2A 2X2KA 4G3GA 3AMAA 4I21A 2W1FA 5GJDA 3IGGA 5ICPA 4O38A 4YLLA 3MFRA 4A06A 4H3PA 2A98A 2UZVA 4BIBA 5C8NA 3TNQB 4CMOA 1G8AA 4EQCA 4C02A 4IVDA 2VTLA 3BYVA 3LCTA 4EK8A 5IQDA 4RRVA 4D1XA 3BHHA 3IGOA 4LG4A 4ONAA 3QTZA 4CFUA 3GFEA 4L68A 1YXVA 3KB7A 3FY0A 3TCPA 4ZLOA 3E8NA 5JFXA 2J50A 2RFDA 3MESA 3OEFX 4BCGA 5HTBA 3OC1A 3VBWA 2JAMA 3MW1A 4ZK5A 3BHYA 3I5ZA 4FUXA 1YWRA 4OT5A 4QQCA 3E5AA 1LP4A 2ETKA 2XIRA 4YPDA 5E4HA 3I4BA 3ZEPA 1OKZA 1Q4LA 3R7UA 2PZRA 2VWYA 1V1KA 1YDSE 1CKJA 3FC2A 3EHAA 3HMNA 3MSSA 3PYYA 2XM8A 3D94A 4IVAA 1ZARA 2OJFE 2RIOA 3DAKA 4CZUA 3K3IA 4Z7GA 3ZC5A 3NUXA 3D2KA 4LFIA 5M4IA 3DKCA 3K5UA 2W5AA 3LFAA 3DK6A 3PY1A 3Q4UA 4GL9A 1P5EA 4OLIA 4AOJA 4FNZA 4Q9ZA 5KKRB 3CQEA 2H6DA 3FZTA 2XK6A 1PXJA 3MY5A 5CEQA 3W0QA 2YIRA 3FQHA 3OCSA 4QMPA 3WF7A 5FP6A 5CEKA 5HEZA 2GNFA 4BTKA 4ALVA 2BHHA 4OTFA 4DFUA 1XH9A 4IZ5A 3C1XA 3DAEA 1XKKA 3P23A 3Q5IA 2HOGA 4DGNA 4V01A 4EH9A 4F1OA 4XUFA 4QP7A 4L43A 3HA8A 5LVMA 1Q8UA 3V8SA 4GV1A 4PP9A 4O4CA 1J7UA 2YA9A 3MA6A 1DI8A 1OB3A 1JAMA 5HBHA 3EFLA 1GIJA 4L3JA 3SGCA 4FG9A 4YLKA 4FEWA 4F6SA 1ERKA 3AQVA 5CU6A 5FLFA 4JDJA 4F9CA 4YO4A 4LDTA 4OTHA 1Y8GA 3AOXA 1KE5A 3FMEA 3CKXA 3QBNA 3V01A 5IH5A 5J79A 4FTLA 1OGYA 3GUBA 4EKKA 5CALA 2OZAA 5IU2A 2QOBA 3QCSA 5KX8A 4M14A 5FQDC 3RCJA 3RZFA 1TQMA 5H8GA 2Z7QA 3CR0A 1JSVA 1WCCA 3F3TA 3I6UA 4NH1A 4PTEA 4Y72A 2C3KA 5CAVA 1H0WA 1ZYJA 4NM0A 2IVSA 3ORLA 2WPAA 3LQ8A 2HZNA 3VS6A 4ANBA 4NZWB 2HXLA 2XH5A 4RC3A 4UYNA 4X2GA 3Q6WA 4YTIA 5DN3A 3UMXA 3N4TA 4G6OA 4TYHB 3FI4A 1O6YA 1ZYSA 3B8RA 2IZTA 3VS3A 3SHEA 2YACA 2XA4A 3GT8A 4JS8A 4W9WA 4U79A 3EYHA 4QPMA 3O8UA 3DPKA 3RALA 3ZDIA 4EZ5A 5LVPA 4AZEA 2XALA 5HVJA 5IG1A 1U4DA 1RDQE 4GW8A 2ZDTA 2J0JA 1H07A 4FL3A 5IH6