3ZUVA

Crystal structure of a designed selected ankyrin repeat protein in complex with the phosphorylated map kinase erk2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
359
structure length
357
Chain Sequence
HAMAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLEVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 1
publication title Structural and Functional Analysis of Phosphorylation-Specific Binders of the Kinase Erk from Designed Ankyrin Repeat Protein Libraries.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags De novo protein/transferase
total genus 113
structure length 357
sequence length 359
chains with identical sequence C
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zuvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zuvA01
4GG7A 4MAOA 2PVNA 2C3JA 3HV7A 3FHIA 4FF8A 5KMJA 4MEDA 4HPUE 4CYIA 2JFMA 1XH7A 3KXNA 3LFEA 2J7TA 4RVKA 3KRWA 3QU0A 4C0TA 3DGKA 4AW5A 4D4YA 1ZMWA 2UZDA 4GJ3A 4GCJA 3A7JA 2EU9A 2RG6A 4A9UA 4EH9A 3TCPA 5M44A 2B1PA 2VNYA 3DAKA 4G3CA 1BMKA 2HZ0A 4YLLA 1OGUA 5I4NA 2WIHA 3UO6A 2W1IA 3IGGA 5DR9A 4F0GA 4MNEB 3HMNA 4WSQA 3EQFA 4LRMA 4R1YA 3PIYA 3QCSA 4ID7A 4E6AA 5ICPA 3SVVA 3OP5A 3QKKA 4FKUA 4ANBA 4EL9A 4K33A 4NYEA 1SNUA 2ERKA 3DBCA 3LIJA 4BZDA 2R0UA 1UA2A 2XJ2A 2W4JA 3Q9WA 2R3RA 3R02A 3R28A 2YJRA 4DFZE 2PVHA 4RC3A 3O8UA 2JKQA 3SRVB 4I5MA 5IZFA 2XRUA 2QVSE 2BRNA 2G9XA 5TT7A 2VO0A 2RKUA 1H01A 2YIYA 5AM6A 1VR2A 3D9VA 2C30A 3CP9A 3BYSA 4GW8A 4TNBA 1WBTA 1HCKA 3QWJA 5EOBA 4ACHA 5IQEA 3T8OA 3Q9ZA 3FY2A 3HMMA 3GCUA 3TTJA 3ZDIA 3QQLA 1PW2A 3FZSA 1XH4A 2QHMA 4KNBA 2FUMA 4PMMA 4OLIA 4QP3A 1YDSE 3R7UA 3QXOA 5HU3A 3FQHA 3PWYA 2HIWA 1PXMA 1H00A 4QTDA 3HA8A 4FKRA 1H1SA 2XKDA 3AGLA 1XBCA 4CZUA 2F49A 3QYWA 2YLFA 3EMGA 3W2OA 5HLNA 3BRBA 4IAKA 4IWPA 3TTIA 4O2PA 4ALUA 5HU9A 3ZH8A 2XK6A 4AGCA 3KCFA 3HYHA 1J1CA 1ZOEA 1UNGA 3ULIA 3VUMA 5CVFA 4H3PA 4NJ3A 3CD8A 3MV5A 2BZKB 3NIEA 4NUSA 3F2NA 3Q9YA 5KBQA 2Z60A 1CKPA 2VWUA 3PXFA 3TUCA 4DT8A 3CR0A 3FV8A 4FKOA 3COMA 2GNGA 4JLCA 2A1AB 4MD7E 4BIEA 2X9EA 5DR2A 3U87A 4UWCA 1YRPA 2R3FA 3GGFA 3HZTA 4J1RA 4R3RA 1GJOA 5AAEA 1R1WA 2PTKA 3REPA 5CQUA 3K5VA 3ZRKA 3NZ0A 5HD7A 2BVAA 1NXKA 3IDBA 5AR7A 4LFIA 5JFSA 4MTAA 3FMDA 3DFAA 4H36A 2QOQA 2ZOQA 2UW7A 3PTGA 1GIIA 3F9NA 4FKTA 1OPJA 3VF8A 4FT5A 4ZZMA 4AOTA 3DZOA 4NZWB 3MVLA 4ASZA 4G3DA 4BCPA 4DE4A 3R7GA 4XOYA 3R0TA 2AUHA 5HE2A 5IA5A 5BYZA 2CKQA 5E9EA 5FM3A 3LM0A 3UE4A 4C3RA 5J1WA 4EH6A 3SGCA 4ZTRA 1KV2A 1A48A 3BYUA 4E4MA 5CNOA 1GZKA 1OBGA 3ZMMA 3D83A 5HIDA 1ZARA 5LMBA 2J0KA 2QO7A 3TV4A 4GIHA 5BVOA 3NCZA 4YZCA 4QMLA 3EJ1A 2QODA 4PNIA 3L9PA 4DTBA 4QQTA 2VTHA 3POOA 2IVUA 4I4FA 3R04A 2IZUA 3EFKA 4HYUA 1IRKA 4FIHA 3ID6C 1HOWA 4L3JA 4QMWA 5L8JA 3NUAA 3D7TA 5H8EA 3UOKA 1ZYJA 1ZY4A 5M4FA 4RX5A 5EHYA 3T9IA 5DT4A 5A4LA 4UWBA 4AG8A 4FSWA 3S1HA 4EJNA 1PKDA 5DT0A 3KCKA 3RI1A 3KRLA 2W17A 2UZBA 3FL5A 1PHKA 2QLUA 4X2JA 2EXEA 2I0VA 5FBNC 3UZPA 4XG3A 3PY1A 3VO3A 5KHXA 5CVGA 4M69B 1KE8A 2GNLA 4FEWA 3DS6A 4CFVA 3ZUTA 4OBOA 4AOJA 3N4UA 4ARKA 4JVGA 1Q4LA 3T9TA 3E93A 3NCGA 3IQ7A 2QKWB 5C8MA 1G8AA 5DRBA 2VWXA 4EH3A 4XEYA 1WBPA 2PPQA 3EYGA 2O8YA 5H9BA 3OOGA 3THBA 1J7LA 3PA3A 4M67A 3U8WA 5IA2A 3FLZA 3BV2A 4MXZA 3F3ZA 3RM6A 1Q3WA 1JOWB 4QMZA 3A7GA 4MD8E 4F6UA 2HOGA 3LAUA 2I0HA 4JIAA 1OL6A 3ZHPC 4XLVA 2PHKA 4PY1A 2XIZA 4CMUA 4PNKA 3Q52A 5HQ0A 4IAZA 4DBXA 4FTQA 4BI0A 3GC8A 4YJVA 5LVPA 2ITQA 5L6OA 3VHKA 2Z02A 3BE2A 3EB0A 1YDTE 3QBNA 4H1MA 4HYIA 4PDPA 5L8KA 2IJMA 2VNWA 3WE8A 3HKOA 4B8LA 4BB4A 3E3PA 2WPAA 5FWKK 5HTBA 4O7TA 3SC1A 3LKMA 1AD5A 4FYOA 4CEGA 2Z7QA 3FQSA 3PJ2A 3PXKA 3V5QA 1PYEA 3IW7A 4LUEA 4U45A 5HZNA 3LCSA 4LL0A 4BDHA 2R3QA 5IA4A 5EQEA 4M0YA 3VQHA 5IA1A 3QC9A 1FBNA 3KN6A 3MH1A 2NPQA 5CS6A 4HNFA 3F88A 4DAWA 1M17A 3VS3A 1A06A 3UBDA 3TNHA 4D9TA 4JDJA 4WHZA 4FKVA 4QMSA 4G6OA 4E4XA 2C0TA 4QTCA 3R9OA 3LW0A 3LQ3A 4B9DA 2UZOA 3EFLA 4QRCA 1P2AA 4FT7A 4YPDA 4O7VA 3ORTA 3PPZA 4PUZA 2PZYA 3JVSA 3JY9A 5HLWA 4RC4A 4GJ2A 3GP0A 3RPOA 2PMIA 4RFYA 4BL1A 3RVGA 3QTXA 3FC2A 2KTYA 4WUNA 4MX9A 2QHNA 4ONAA 2HWPA 4DH5A 1FPUA 4EUUA 5L8LA 2IN6A 4YP8A 1OI9A 3DQXA 5BX0A 4C58A 1PF8A 3DA6A 3V8SA 3AD6A 1TQMA 1P14A 1WBWA 4ERWA 3FPMA 5D9HA 3SOCA 1OL2A 5TF9A 5B7VA 4R7BA 4S30A 1FVTA 1JBPE 2WMTA 5TR6A 4JNWA 2B9FA 3PP0A 4UN0C 1H1WA 3KU2A 5FLFA 3HAVA 1Q8UA 3QLGA 5M4UA 2CGWA 5HHWA 4FTTA 3OTVA 3SX9A 2OH4A 2BRBA 4MQ1A 5FM2A 3AMBA 1Q99A 4BCNA 4FOBA 1KE7A 4V04A 5CYIA 4MWHA 3FLYA 4BDEA 4JQ7A 4R7IA 4ZOGA 3H30A 1GZOA 3A8XA 4KS8A 2OJIA 3QX4A 4FL3A 4GT3A 2CJMA 2F2CB 3UO5A 4E26A 4QYEA 3I81A 3MESA 4ZZOA 5I0BA 1NA7A 1H24A 3L9NA 4J95A 2W1EA 1UU7A 4IFCA 3LFNA 4D4SA 4DYMA 1Q61A 3ZRMA 3WIKA 1H4LA 3FQEA 4ENXA 2YIRA 5HG8A 4QMUA 1R39A 1YDRE 2CMWA 3KMUA 2OWBA 5HKMA 4UY9A 3VRYA 4CKJA 4QPMA 5CEOA 2J0MB 3HRBA 4WNPA 3V5PA 5A4QA 3NPCA 4ZTLA 3UG1A 4M84A 2W06A 1F3MC 4OBQA 4QP4A 4FKLA 5A4CA 4J53A 2WQOA 3Q6UA 4FSRA 4I92A 5EDPA 4O7WA 4RWJA 3O51A 2GS7A 3GVUA 3P0MA 3UPZA 5J8IA 1YWVA 1QPEA 2CLQA 5A4EA 4FE2A 2F7ZE 3D0EA 4M3QA 3OOMA 3FEGA 4PL3A 1JPAA 2ITNA 2YHVA 3UZTA 2JKOA 3VUIA 3BHTA 2VTSA 3ULZA 2OF2A 2ETKA 3ZSGA 3R22A 4JDKA 3KMWA 1E1XA 3OROA 4FR4A 3PP1A 2FYSA 4FUYA 5D10A 5HO8A 4CQEA 5AX3A 3RMFA 3QA0A 4V01A 2O3PA 3KXZA 3E87A 3COKA 3BGZA 3P86A 4AA0A 4DFNA 4MXYA 4KAOA 1U4DA 3LFCA 5DR6A 3AMAA 5DT3A 4ZXTA 3ZZWA 4D2TA 2YZLA 3QD3A 4DN5A 2YA9A 3NYOA 4MBLA 4WO5A 2VRXA 2WIPA 2VTMA 5GJFA 3C50A 3OMVA 4ORKA 5J7BA 3FMJA 3LM5A 1SNXA 3ZXTA 3WZJA 1J7UA 4A06A 4O84A 2X4FA 3L8SA 2C5OA 3AC4A 5D1JA 5F94A 3W8QA 3MS9A 1ATPE 2GU8A 3F69A 4RX8A 4AZWA 2OF4A 4M15A 5KKRB 3BQCA 5FTGA 5KMMA 2FGIA 1I09A 3FZRA 2XK8A 3D14A 4IZYA 4IB0A 4NJDA 5EKNA 2PUNA 2VTNA 3SAYA 3VULA 2I0EA 4PTGA 3DU8A 3NAYA 4EQMA 3OCTA 5AMNA 4BKYA 4FKQA 4C3FA 3FMLA 5C26A 2W4OA 3SXRA 4O7ZA 5EM5A 3EZRA 3A60A 4YBJA 4E93A 2W5HA 3UVRA 2QOKA 5AP3A 4ENYA 2BZJA 3ZLWA 3HLLA 3QWKA 3LMHA 4M97A 2X39A 4EOSA 1AGWA 4FYNA 3WZEA 3G90X 4ZTNA 4UMRA 4TW9A 2C6EA 1GIJA 3GU6A 4IVBA 3BHYA 4O0RA 5CU3A 5DBXA 4B6LA 3P7BA 2XIXA 2XYUA 4UB7A 3Q2MA 5AIRA 2NO3A 3ZU7A 3OBJA 2JBOA 5AA8A 4KKGA 3S4QA 4L3PA 4BWXA 3U9NA 3VS6A 5HGIA 3NNWA 2QOFA 3MY1A 4I0RA 3ORLA 2BHHA 2PZPA 3EQGA 3KFAA 3QUDA 2ZM3A 4YZNA 3TV6A 3VC4A 3T3VA 4C34A 3E62A 4LM5A 3HV3A 3DLSA 3VUTA 2WMWA 5IQFA 2A19B 5M09A 1TKIA 4EH7A 3PDTA 2B54A 3GI3A 1O6YA 4D1ZA 5JEBA 4DFBA 2R4BA 3OVVA 4YUQA 3ENHA 3VVHA 2ZMDA 4Z16A 5M4CA 4GYGA 2XIYA 2UZVA 2WKMA 4P90A 5JGAA 1SVGA 4GYIA 2R2PA 4IMYA 4DHFA 4NM0A 3VAPA 1U5QA 4U44A 1Q8YA 1ZYLA 1PXJA 4AW2A 4J8NA 5IA3A 4TZRA 3NUUA 2Z7LA 3UQCA 3FZTA 2FH9A 1URCA 3BBTB 3R2YA 3GB2A 4DINA 4EOKA 2UZTA 4K11A 4YHFA 4FK3A 2XBJA 4BIDA 3QALE 4BDIA 4WUAA 4BYJA 4TKSA 4RBLA 3VBWA 3PSCA 2UW4A 4U42A 3RPRA 3CTHA 3L8XA 4TYJA 4NCTC 4DH7A 3CC6A 5BVEA 4F65A 5I9YA 3HV4A 4FV6A 4O0XA 1PKGA 3W32A 4HNIA 5CF8A 3KREA 3CD3A 4EK5A 2VZ6A 4IB3A 1WVYA 5DIAA 4F09A 5K9IA 3WARA 5JFWA 3DKFA 5CEQA 4X21A 4XNEA 3BGPA 1Y8YA 5FEEA 4BZOA 3IW5A 2Y6OA 4HCVA 4ANLA 4GG5A 4ANNA 3WF9A 1YOJA 4G1WA 3H0YA 4XG8A 3EL7A 4RIWB 2UZUE 1Y91A 3FLNC 5D41A 5ITAA 2GNHA 3TN8A 3DLZA 5D7AA 3KGAA 4QMQA 3CCNA 3PY3A 3R1QA 3FPQA 4KINA 2YCSA 2ETRA 4JT3A 4U0IA 3EFWA 3GOPA 3KK9A 4AXAA 4O86A 1H1QA 3IECA 3TXOA 4EK6A 1BKXA 2R3LA 5M56A 2NNWB 3F2AA 4J99A 4EKLA 4GK4A 4RFMA 3VBVA 1IA9A 4G2FA 3TKUA 4ACGA 2BDWA 4MNFA 3AG9A 3F7ZA 5LMKC 2W1HA 3BU6A 4KB8A 4Z9LA 1MRVA 4R77A 4QMNA 2QG7A 2VTQA 4U6RA 3O8TA 5IDNA 5LOHA 3MPTA 3O2MA 4GU6A 5E1EA 4ZZNA 4YTIA 4BBEA 4GFOA 1FVVA 5HVYA 3FI3A 4BBMA 4P7EA 3MVHA 2XKCA 4GUEA 4FODA 4IX6A 4KUJA 3GQIA 3WI6A 2OJFE 2SRCA 2XM8A 4OTRA 3ZDUA 1H0WA 3TNPC 3W2SA 4CFXA 2BROA 2HAKA 4HVDA 4ZLOA 3P23A 3RCDA 1PMVA 3O8PA 4S33A 4NW5A 3HMPA 4IE9A 3EOCA 4CGAA 4IEBA 4BY9E 3IG7A 3LVPA 3QAME 5KBRA 4UX9A 4OR5A 1DI8A 5FP5A 3ZBXA 3O7LB 3AC1A 4X0MA 4NM5A 3OZ6A 4B4LA 1H25A 2ITUA 2ZDTA 3DDQA 3EYHA 3CKXA 2VTLA 4KWPA 3RPYA 4CG8A 2BAKA 3QQJA 5CSVA 4ITIA 4F99A 3OCSA 4F6WA 1YWNA 3GCQA 4RWKA 4EOQA 3CEKA 4CYJA 3B8QA 3FI4A 4LMNA 5HBJA 1OVEA 1ZY5A 2WMBA 1WBNA 3NWWA 4DTKA 4NCTA 2WMSA 4CRSA 1OUYA 4DEHA 4U40A 3PSDA 1RW8A 2Z2WA 1UVRA 3ZSHA 3NUXA 3PSBA 3QUEA 5CNNA 2ITTA 1ZYDA 3OS3A 3C0HA 3P5KA 3SDJA 4R6VA 1Q97A 3V8WA 3TM0A 2BHEA 4ITJA 4R3CA 3LXNA 5LWNA 3FBVA 3KK8A 1Q3DA 4U7ZA 1OIUA 1X8BA 3F5UA 3OWJA 3PFQA 4KRDA 4LYNA 1P4OA 3DY7A 3W2CA 3ZLYA 4NEUA 1DS5A 2VTJA 4LI5A 4QMOA 5AP5A 1DAWA 2JAMA 5CX9A 4I21A 4JX3A 2C6IA 4JBOA 5ANIA 4Y5QA 3R8ZA 1REJA 5LVNA 3QRIA 4YHTA 1KV1A 4BFMA 2YITA 2J51A 5EKOA 5K0KA 1KE9A 3V5WA 4CSVA 4OTGA 1KOAA 2C6OA 2I0YA 3RHKA 2OIQA 4E6QA 2ZB0A 3ORMA 1WBOA 2PVYA 2JAVA 3W18A 4ANQA 4FICA 1M14A 2YM7A 3RAIA 2ZYBA 4JOAA 4RVMA 4FSQA 4BI2A 3UYTA 3U51A 5CVHA 4FVRA 4ZSGA 5AJQA 3ZTXA 2W1DA 3TT0A 4EH8A 5KMKA 5FQDC 5JK3A 3E92A 2H34A 2VWYA 4MKCA 3V5JA 5LMKA 3EN6A 4A9SA 3W2RA 2V0DA 5DEWA 2OU7A 3UIUA 1TQIA 3ZYAA 5KO1A 3D7ZA 5ACBC 4N57A 2Y6MA 4RZWA 3WZDA 5HICA 3DK7A 4C2WA 3NSZA 2PE2A 2XNGA 4KBCA 3RK9A 4LOQA 4F70A 3GBZA 3NGAA 3TNIA 1IAHA 1K9AA 3NNVA 4PTEA 2P3GX 1APME 5AP0A 4M12A 3QTRA 4D1XA 4USEA 4FUXA 3OT3A 1OKZA 4AFEA 5G1XA 4MXOA 4OAUC 2W1ZA 2VWWA 1ZYSA 1W0XC 4PP9A 5FRIA 2FO0A 4FL2A 2W9ZB 5JGBA 5J9YA 4RIYA 5LVOA 4FT0A 4JAIA 4WOVA 4Y85A 1UV5A 3M2WA 5J87A 3VWAA 2IVSA 4G17A 3UOLA 4RWIA 3HUBA 4XX9A 4YZMA 1M2RA 5IH4A 2P4IA 5CENA 1KE5A 4PWNA 1YXUA 1YI6A 1YW2A 2HW6A 4JBVA 5CF4A 3BU3A 3PXQA 4FC0A 2KULA 4IZAA 4L3LA 4YO6A 4C4FA 1U5RA 3FAAA 4H3BA 2HW7A 2QI8A 5CXHA 3QTZA 4CZTA 3NVKI 3QCQA 4YTCA 3QD0A 5FP6A 1FMKA 3MGYA 4EC8A 4B7TA 4RIYB 4NH1A 4EKKA 2GQGA 1YOMA 5EQYA 4C4HA 4O1PA 4WD5A 2C6MA 4KBKA 4NFNA 4EK4A 2UW5A 4WNKA 4W4XA 1LP4A 3GEQA 4NFMA 5A6NA 3IO7A 3WF6A 5IUGA 5E8UA 2JKMA 3TV7A 2G1TA 1NVRA 3MVJA 4X6QC 5ACKA 4FTLA 5DEYA 5C4LA 2R3PA 1XBAA 2ZV2A 3E5AA 4I6QA 2PZIA 4FTCA 3WYXA 3U6HA 2YLEA 4U5JA 4EJ7A 3S2PA 1Z5MA 3FZ1A 5H8BA 2QNJA 3KMMA 1MQ4A 1BYGA 1NY3A 4I5HA 4L6QA 5JQ5A 4C37A 4LOOA 2RFDA 4ZAUA 2E2BA 1UKIA 3BELA 3BLRA 3TZ8A 5AADA 4ITHA 1J7IA 3QKLA 2GFSA 3C4FA 1LPUA 2BDJA 3JUHA 4LGHA 5JGDA 4K1BA 2VO6A 1Q8TA 3OW3A 2GNJA 4IC8A 2E9OA 4YJOA 4RFZA 4EUTA 2BALA 5K4IA 3E8CA 4ZSJA 4LOPA 3SV0A 4DGMA 3DK3A 2IVTA 3R1YA 1Q24A 2WTKC 3DTWA 4B8MA 4E4LA 1WMKA 3E7VA 4J52A 2OK1A 2OBJA 5ETCA 1S9JA 4DG3E 2OXXA 1NT2A 5DOSA 1URWA 3OBGA 4NK9A 2PVJA 3ATTA 4EOMA 4D5KA 1OPLA 2A4LA 4JDIA 3GFEA 3RP9A 3TIZA 4W9WA 5KZIA 3MB7A 3SXFA 5IDPA 4RIOA 4XBRA 2ZMCA 3CE3A 1UWHA 4FTAA 1KOBA 2RFSA 3O50A 3LOKA 4UYNA 1WFCA 3G5DA 3GU4A 4JBQA 4FBXA 2DYLA 5I9ZA 3EN4A 2RFEA 3EKKA 5EHLA 2BIYA 5A3XA 2E9PA 3IW8A 2PMNX 5E8XA 2J0JA 1OMWA 3AD4A 1XBBA 3PPJA 2XIKA 4FKSA 3FJQE 5A14A 4NT4A 4XV9A 3RAHA 5CEKA 2I7QA 2BZIB 5FDXA 1VEBA 5IU2A 2WTIA 4KIOA 4QMMA 4RQKA 4C8BA 3MSSA 2VUWA 4W9XA 3BCEA 3CPCA 1W8CA 4HGSA 3UOHA 3VS7A 1YI3A 4GT5A 5FGKA 3OHTA 4H05A 3Q4ZA 3DBDA 3NYNA 4OW8A 4FNXA 2XCHA 4KD1A 4C4IA 3SW7A 5HCYA 5HNBA 4LRKA 1F5QA 3G6HA 3GCSA 3BEGA 4DH3A 2BKZA 3OXIA 4EC9A 2H6DA 3GOKA 1XH8A 2R3KA 2I6LA 2R7IA 3KL8A 4UBAA 4WT6A 5IUHA 2C4GA 4EQCA 3WILA 1E9HA 5EQPA 1OKYA 2YACA 4B99A 3SD0A 5JFVA 3MIAA 3FMEA 4AW0A 4R5SA 4TWPA 5ANDA 3UQFA 4WNOA 4YPSA 3WYYA 4BKZA 1B6CB 3LHJA 3LXKA 3NYVA 4IAIA 3G2FA 3KF7A 4CKIA 3BIZA 3F5XA 4CFWA 4JIKA 2HZNA 2C5XA 3U4UA 2IZTA 2CN8A 3IKAA 4Y5HA 3R7IA 3ZSIA 5AUVA 2X2MA 5E8SA 2YM3A 2CLXA 1PXIA 4XYFA 1T45A 4YR8A 4F9BA 5CEPA 3NDMA 1REKA 3MY5A 5HIBA 3Q04A 4FEVA 4IWDA 3RKBA 2OJGA 3I0OA 2LAVA 3CJFA 4QP7A 3KXMA 5FXRA 4PL5A 4CV9A 3O0GA 3O71A 4U9AA 4D4RA 2BPMA 2QG5A 4XP0A 3LCKA 2OW3A 2W5AA 3C51A 5IMEA 4EZ5A 1U59A 5F20A 3UC4A 2BFXA 3UNZA 3DXQA 3DNEA 4O0VA 5ANEA 4ACDA 2B9HA 3JYAA 4HW7A 4YHJA 3FHRA 3PZHA 3PVWA 5AIKA 4Q5EA 3CQEA 4GFGA 2VN9A 3KRRA 3UPXA 5GHVA 1PMNA 3KN5A 1H27A 2R3IA 3AXWA 2B9JA 3BBWA 4MWIA 5T6KA 3OW4A 3FMHA 4QNYA 1EH4A 5T3QA 3G0FA 4PQNA 4XG2A 3FXXA 3UMXA 3RALA 5GZ8A 2XNMA 5LVMA 4IWOA 1YHVA 3ORPA 1OIYA 4A4OA 1CM8A 3FKOA 2A0CX 4O91A 4NIFA 4YTHA 4FIFA 1W98A 3D7TB 3LLAA 3DT1A 5DGZA 3QTSA 1RE8A 2G2FA 4NM3A 4AT4A 4CXAA 4OAVB 4O1OA 5HNIX 3HEGA 2YM4A 5DLSA 4IDTA 5EH0A 2W1GA 4GUBA 3N51A 3DTCA 5B2LA 4XUFA 3TWJA 5CALA 2GQRA 4ZS4A 3KVXA 3FLQA 5DVRA 3Q60A 1UNHA 2BAQA 2GNIA 2XH5A 3AC5A 1CKJA 5AUYA 2ZV8A 3AC3A 5EG3A 2GHLA 4NIFB 2F7EE 4IWQA 3GU8A 3I4BA 2YERA 4NWMA 3DXNA 5CT7A 3VJOA 2CGUA 5E91A 4BYIA 3E8EA 3EZVA 3KEXA 1OECA 5AUZA 5GINE 3QGYA 3VN9A 3CGFA 1JQHA 4HCUA 3BHHA 3MPMA 1PMUA 4I0TA 3QXPA 2GMXA 3HX4A 3OG7A 4TY1A 5EI8A 3BYMA 3V5LA 4BWKA 4CG9A 2Y8OA 1PYXA 2JEDA 3CTJA 4RC2A 3PXYA 3UIMA 2PVLA 4MXAA 5EHOA 4O81A 3NUYA 2RIOA 3S95A 3P7CA 4RLKA 4BTJA 5KX8A 1H8FA 2X0GA 2O2UA 3HV5A 3MDYA 5F95A 2CSNA 2WEIA 3MFUA 5ANGA 4J8MA 3RNYA 4IXPA 4P4CA 4A9TA 1AQ1A 5CWZA 4X6RA 5GNKA 3DBEA 4WG5A 4B0GA 2WMQA 4FTOA 1GNGA 4G34A 5EYDA 4L8MA 4RRVA 4L42A 1U46A 2Y4IC 4XLIA 3ZS5A 4FG8A 4TYHA 2OXDA 4GK3A 5AV2A 4FV9A 4ZS0A 4HVGA 3UC3A 3TG1A 3MW1A 1WZYA 3MFTA 3JPVA 4UMQA 4A7CA 2VX3A 2OFVA 3TZ9A 3LFFA 4IQ6A 4Q2AA 5EW9A 2GSFA 3R73A 4BTFA 2XKFA 3MFRA 4NSTA 3PYYA 5JSMA 3FSKA 4MK0A 5BVFA 4RVLA 2BZHB 3BKBA 4A9RA 4GKHA 3VQUA 1ZAOA 3G9LX 5AWMA 4O7RA 4PPBA 5FXQA 4IX4A 2PVFA 4YBKA 5DN3A 5AEPA 2OXYA 1H28A 3NLBA 3DFCB 4FTUA 4AUAA 3ZLXA 2JD5A 1PXNA 2WO6A 3JXWA 3P4KA 4USFA 3IW6A 2OIBA 2IZSA 3KVWA 3RHXA 3V6SA 4NW6A 2F9GA 5D7VA 4JAJA 3TZMA 3MA6A 3EFJA 3UYSA 3OD6X 3CSVA 3RAKA 5B0XA 4ZTHA 4G16A 4L52A 4C4EA 4L46A 4RJ4A 2C69A 2CN5A 4YGAA 5JZJA 1W7HA 3DKOA 2R3OA 4ANOA 5CEMA 1PRYA 1GZ8A 5AR3A 2GFCA 3WOWA 4FOCA 4L7FA 5CY3A 4BBFA 4G6NA 3VJNA 4QNAA 3WE4A 4CKRA 3RM7A 1BX6A 3FDNA 4II5A 5LMAA 4O0SA 3NYXA 5M57A 4C35A 2P33A 2P55A 2HY81 5E92A 4O0UA 1RJBA 3R8VA 4EHGA 4G3GA 4DEEA 2VD5A 4N70A 2WB8A 4E3CA 3UOJA 5T68A 3UVPA 3F3TA 4RT7A 3OTUA 3ZRLA 4ANSA 1UU8A 5ANOA 2I1MA 2WQMA 2ZV9A 4RX9A 4TYEA 4YLKA 4ZSLA 4BCJA 5CU2A 3UZRA 2F2UA 4F1TA 5I3OA 3R63A 1ZYCA 2OIDA 4WBOA 4HVSA 3B2TA 3LCTA 3GENA 4LV5A 4XS2A 4YJRA 5EW8A 5LJJA 2X7GA 4BDDA 4IX3A 5CI6A 1JKLA 3MTLA 3GU5A 4QT1A 4WNMA 1BL7A 2GTNA 1VZOA 4IB5A 5LXMA 4CVAA 5CAVA 2XS0A 3NW6A 3RWQA 4JRNA 3ZC6A 3R2BA 2GHMA 4RVTA 3PPKA 4EWQA 4Q9ZA 3LFAA 4FKGA 1ZOGA 5EM6A 2X8EA 1YXVA 4U3ZA 3AMYA 1JNKA 3L8PA 2X4ZA 5EDRA 1O9UA 2Y0AA 1Q41A 2BIKB 3N9XA 4I41A 4BDKA 1OPKA 4U41A 3FZOA 3ZUUA 4I94A 5I3RA 4XRLA 2BDFA 3LJ0A 3K3JA 3WZKA 4PPCA 3NX8A 4FV1A 4BTKA 2JFLA 3U6JA 2PU8A 2BUJA 4MYGA 4QYFA 1UKHA 2QR7A 3M42A 5CLPA 3MIYA 3TL8A 1H1PA 3QQGA 4ZP5A 4H39A 5KMOA 3HL7A 3FLWA 4OTDA 4ANMA 2HK5A 4JQ8A 2QU5A 3DAJA 4D2PA 2QC6A 3I7CA 4N4SA 4HCTA 4NM7A 3EWHA 1ZZ2A 2XK7A 2EB3A 2XJ1A 3NW7A 2YIWA 4QYYA 3CTQA 4FTIA 4IVCA 2QQ7A 4MF0A 4P5QA 4BDFA 4BGGA 3MFSA 4Y73A 2Y4IB 2JITA 2WFYA 4JI9A 4M14A 4AOIA 3EL8A 4GU9A 3TDVA 5AP6A 1WAKA 2YDIA 2YABA 2QONA 4FT3A 5HVKA 5AP4A 4FZFB 3C0IA 1DAYA 1JVPP 2VTAA 2X9FA 2W7XA 4KA3A 4CMTA 4E6DA 2CNVA 5IQBA 3E7OA 4NL0A 4F08A 3R7VA 4IFGA 3VBTA 4D58A 5M4IA 3U6IA 5M08A 5IKWA 3DV3A 2X2LA 5HORA 5M07A 4EK3A 4DGGA 4E1ZA 3KY2A 4IDVA 3TJDA 5J9LA 4K0YA 1OKWA 1FGKA 1IASA 2C68A 3HECA 4U43A 3H4JA 4UXQA 2QCSA 3RGFA 3UMWA 4EWHA 3E8DA 3O23A 2ETMA 2ACXA 4GMYA 1V0BA 3F2RA 2UZNA 4KRCA 3DDPA 3PXRA 2BTRA 5C03A 4HVHA 3BWJA 4X2KA 4O7SA 2HELA 3BU5A 4O7NA 5GZ9A 2W5BA 5FXSA 4Z7GA 3ZLSA 3MY0A 3RBWA 5BVNA 3ORNA 2PE1A 2Y7JA 5EI6A 2YAAA 4FG9A 3QLFA 1JWHA 1LEWA 3Q5ZA 3EQPA 3QTIA 4I3ZA 3LCOA 4YURA 5CSHA 2DS1A 3IDCA 4YJPA 4OTPA 4CD0A 4BCMA 4N6YA 3DPKA 4EH5A 3OY3A 1NW1A 3FZPA 2X81A 3CXWA 3ZCLA 4OTIA 4UZHA 4BDBA 3F3WA 4IJPA 4I6HA 1HCLA 3NNUA 3PJCA 3FMKA 3TEIA 4D2RA 4Z7HA 1ND4A 3RAWA 4GKIA 2V62A 3U55A 1OL1A 2YCRA 2IW9A 2GQSA 3A62A 2YFXA 3LFDA 2UW6A 4FG7A 4O6EA 2GHGA 5AV0A 4AN3A 4ZTMA 5B2KA 4EQUA 4KABA 4FSYA 5AUXA 2ITPA 4IVAA 1NVQA 2HZ4A 4BDAA 4JX7A 3LQ5A 3WF8A 1Y8GA 4DEGA 2X8DA 3OF0A 4FTKA 4K18A 3TUBA 1R3CA 1UNLA 3PJ8A 3VNTA 1M2QA 2YN8A 3C13A 4F1OA 4I5CA 3ZFMA 3C7QA 3GQLA 4E4NA 4RSSA 3ORXA 2R3JA 4DCAA 4R7HA 4ZY4A 5F1ZA 2UW0A 3VUKA 2XM9A 4OUCA 5CSXA 4FEXA 3FMMA 2FSMX 4CLJA 5JRSA 3EQIA 3Q32A 3R9HA 4DITA 3N4VA 2XBAA 4APPA 3BX5A 4O2ZA 5K5NA 3FC1X 4D5HA 3QUPA 3SG8A 4FI1A 3L1SA 4HJOA 4YZDA 3UGCA 3VIDA 3IPHA 2GPHA 4F9CA 2HY0A 5CU0A 4BI1A 4CNHA 5DG5A 5TKDA 4F7SA 4FIEA 3EKNA 4DH8A 4BVUA 4PPAA 2VGOA 3UVQA 4DFXE 3LPBA 4DTAA 3QGWA 2XNEA 3RTPA 5IA0A 2QU6A 4RJ7A 1XH6A 3OUKA 5J79A 3CGOA 5BYLA 1GZNA 1SYKA 4EOIA 2CCIA 1JSUA 2E9VA 2WU6A 2BKKA 1G3NA 5DHJA 2JDVA 5C9CA 1K3AA 5HO7A 3DQWA 1ERKA 3QZGA 5CT0A 3ODYX 1JAMA 4TRLA 5FEQA 4QTAA 4CT1A 5HX6A 5KUPA 2BRMA 2X1NA 2WQNA 3ZXZA 3LFQA 3OCBA 3IONA 3QQKA 4RJ8A 4DEIA 3AT4A 2XNBA 4O38A 4QP8A 3P79A 3SG9A 1OL5A 3MWUA 4RA4A 1QPJA 4BWPA 4XOZA 3GXLA 2HXQA 2R0IA 3R8PA 4YZBA 2RG5A 3W8LA 4BCGA 4QYGA 4BCFA 1L3RE 5A54A 5KMNA 4PDYA 1KWPA 5EI2A 2X2KA 2YIQA 3H9FA 2W1FA 3EQBA 3OFMA 3PVGA 2YZAA 3MYGA 4MCVA 5EYCA 4BTMA 3JS2A 5LQFA 3HP2A 4O0YA 3C4CA 4CZYB 1V0PA 1SZMA 4YSMA 3NRMA 2BR1A 2X7OA 2AC5A 2WMVA 5M51A 3EQHA 3U9CA 3LFBA 4XV3A 3PXZA 5KZ0A 3V5TA 4AT3A 4I4EA 3W1FA 5G6VA 4OBPA 5DMZA 5KHWA 2XB7A 4D0WA 2XK9A 1JKKA 4FV7A 3ZO2A 2XJ0A 4JR3A 4E20A 4KKHA 4G3FA 2AYPA 2JC6A 4AZSA 2P0CA 4U8ZA 5EW3A 2OLCA 4E73A 2B0QA 1KE6A 2YAKA 5HE0A 4BGHA 3IW4A 4W8EA 4MXCA 2YM6A 3MTFA 4GH2A 1QPCA 3IOKA 1YHSA 4IIRA 3KXXA 1S9IA 3A4PA 3CPBA 3G9NA 2GS2A 3A61A 1BL6A 3F6XA 3GFWA 3OEFX 3PG3A 1JLUE 4YC8A 4YZ9A 3OC1A 4O21A 2XMYA 2QLQA 2FB8A 2J2IB 4M0ZA 3E8NA 4ZY6A 5JRQA 3NUNA 5EYMA 4XG9A 5H8GA 4DF3A 1M7NA 3CY2A 4DLIA 4C4JA 1DI9A 3MJ1A 5A46A 5HIEA 4QQ5A 2WXVA 4LGGA 4YJSA 3E3BX 1RQQA 2R3MA 3M11A 2R3HA 2WMRA 3KXHA 1OUKA 2ZB1A 4D28A 2O63A 3ZFYA 3I5NA 3Q6WA 2ITYA 4AZEA 5CU6A 1JKTA 2J0LA 4DGOA 5C8NA 3FL4A 5CANA 2ZM4A 4W4YA 3C5UA 5BVDA 3MH2A 4PRJA 4M7IA 3FMNA 4EBWA 5I5ZA 3FI2A 3R8MA 3R00A 4MBIA 4ZSAA 2PVRA 2VTTA 4FIJA 3VS2A 4FNWA 3BHVA 4X2FA 5IQAA 2QD9A 2Q0NA 3ITZA 3WBLA 5KE0A 4JQEA 3A8WA 3OCGA 5H3QA 4KSPA 4A4LA 4USDA 4G9CA 3WIGA 4EYMA 1PXLA 1CTPE 3A4OX 4IJ9A 1ZMVA 5HVJA 5JMSA 3C5IA 4J71A 4ZJIA 3QD4A 4UYAA 3RPVA 4BICA 1XWSA 2A27A 2HZIA 3AC8A 4OTWA 4IVDA 2CPKE 1VYWA 5E90A 5AP1A 5HG7A 3V3VA 4F9WA 3MH0A 1H1RA 1KUTA 5KCVA 1MRUA 1Z57A 2OH0E 4QQJA 2GDOA 3COIA 3QFVA 4FIIA 2NRUA 3CKWA 3KF4A 3LE6A 4FZAB 4IM2A 3PRFA 4LUDA 1OM1A 1PY5A 3ANQA 3IGOA 4JS8A 4D55A 2ZV7A 4JBPA 5DYJA 5HBHA 5DFPA 3AOXA 3CJGA 4TYIA 5HG9A 1TVOA 5L2QA 3QCXA 3C4WA 4QP6A 4AGDA 4CTBA 2BRGA 3PJ1A 3DKCA 4PF4A 4QP2A 4UALA 5E8VA 1GIHA 3ZONA 4ZLZA 3QTWA 3OWKA 5AR2A 3Q2JA 4EOOA 3C4EA 1RDQE 3U54A 2XNPA 4DFUA 3IS5A 4BC6A 4J98A 3OWLA 3EQRA 1P4FA 2WNTA 4FA2A 4QMVA 5HCXA 4AE9A 3ERKA 4U80A 5A9UA 2Z8CA 4HYSA 4L67A 3Q53A 5C27A 2CKEA 4GS6A 4C4GA 4EBVA 3A7HA 2PSQA 1XH5A 1YKRA 3FXWA 3KKVA 3LFSA 3QX2A 2W96B 2ZVAA 4FKJA 4XP3A 2C5VA 4TTHB 5ETIA 5B2MA 5CZIA 3D5VA 3COHA 5DE2A 2WMXA 4AX8A 5AUUA 1M52A 1XO2B 4IBMA 3F66A 3VHEA 3D2KA 4FSTA 4K6ZA 4ERKA 2PL0A 2C0IA 3ELJA 2XEZA 4P2KA 3SHEA 2W0JA 3VF9A 5BPYA 1JSTA 2J90A 3ZBFA 1YQJA 4FSNA 4Q9SA 4RIXA 2VO3A 4L45A 4RZVA 2G15A 2ITOA 5DI1A 2V22A 1XKKA 5IUIA 3UG2A 4A9YA 4AF3A 4AE6A 4CFMA 5L2WA 2X8IA 4UWYA 1Z9XA 5TO8A 2UZWE 4EOJA 4RWLA 3RZFA 5J1VA 3G6GA 2OJ9A 2Y4PA 5JQ8A 3AC2A 3DOGA 4LL5A 4CLIA 3P9JA 3MVMA 4CCBA 5AV1A 2PUUA 4EOPA 4IACA 3Q4TA 4NTSA 3M1SA 3HRCA 2WGJA 1IA8A 3QQUA 3ROYA 4IADA 2OKRA 4I6FA 3E63A 3ZZEA 4RIXB 1VYZA 2J6MA 4IW0A 4YNOA 4F0IA 4FK6A 2AC3A 5AFVA 2F4JA 5AR5A 4GK2A 3PRIA 4I0SA 2GCDA 4KKEA 4Y95A 3U4WA 4EZ7A 4TYGA 4D0XA 4MNEA 4QOXA 4F7LA 1Y6BA 1R78A 4E8AA 4QPSA 2IPXA 2ZJWA 2Y9QA 5EM7A 4F63A 3H9OA 4Q5HA 4L7SA 4CQGA 4FV0A 3BLQA 3QKMA 3QTQA 3W2QA 3QRUA 3AD5A 5IEVA 2Z7RA 5AUWA 4L68A 3FWQA 3D15A 4R3PA 4BN1A 3HP5A 3LQ8A 3SRVA 5IMXA 4M68A 4O7YA 3HRFA 3LXPA 2B55A 3L9LA 3QHWA 4ZTQA 3H10A 4C59A 3I1AA 4EONA 2C3KA 1O6LA 5BYYA 5HTCA 4C7TA 1QL6A 4IANA 4ZEGA 2XIRA 3QRKA 3W55A 3Q5IA 4QTBA 4DEAA 1WCCA 2F7XE 2XF0A 3CIKA 4RJ5A 3CY3A 3VBYA 2CGXA 4XJ0A 5CZHA 4U97A 1DM2A 4AU8A 2E9NA 4UMTA 2C6LA 5EDQA 2PVKA 2WQBA 3HGKA 3K3IA 4IHPA 4UZDA 3R7OA 5D11A 4ASXA 3I60A 4XV1A 2H9VA 4FSUA 1IR3A 4XG7A 1UWJA 5K4JA 4RJ6A 2VTPA 4AWIA 3A7IA 4FKWA 5ANJA 4E7WA 5IISA 4ALVA 5I9WA 2CCHA 4FKIA 4L44A 4WRGA 3DZQA 4X2NA 5JZNA 4FKPA 4FV2A 2WHBA 5L2TA 4NKAA 3GUBA 2IWIA 3C0GA 5M55A 5BUEA 5DH3A 4WSYA 4E5BA 2WTVA 4JL9A 5AAFA 2UUEA 2WU7A 3QTUA 5JKGA 1ZMUA 2R3NA 3NNXA 3ATSA 3NEWA 2J9MA 3ORKA 4TNDA 1FINA 2G01A 4FGBA 4K2RA 1IAJA 3FLSA 3LJ2A 5FDPA 2UW9A 4O0TA 4YSJA 5HG5A 3FYJX 5J5SA 3PG1A 5GJDA 1FGIA 5DNRA 3F61A 2C3LA 5CQWA 2PWLA 2W4KA 2JGZA 3BYOA 3PVBA 4EK8A 3BWFA 4FZ7A 4CCUA 4UEUA 4AS0A 3HMIA 1J3HA 4JR7A 3OXZA 4BDJA 2CDZA 4DLJA 3MBLA 5IQDA 2P2HA 4OT6A 4W8DA 5GIPE 1WVXA 3NAXA 3P08A 5CI7A 3KRXA 3GC0A 3KB7A 3LMGA 5L2SA 3QA8A 4O6LA 5AX9A 3RK5A 3TI1A 1W82A 4U81A 3VW8A 1MUOA 2VAGA 4JG6A 4RQVA 5AV3A 2UW3A 3BE9A 4G3EA 4I20A 4D9UA 5CAQA 2OG8A 3HUCA 3MJ2A 1UU9A 4G6LA 4IC7A 5AV4A 4FEUA 2QOHA 2PYWA 2EXCX 2ITXA 5E1SA 5CASA 5TOZA 5E8WA 3R9RA 5E7RA 4ZTSA 4X3FC 3UJGA 3VS5A 3LMIA 2VTRA 4I93A 1YWRA 4OGRA 4WRSA 1FVRA 4CRLA 3OEZA 1OIQA 4R8QA 5K3YA 2BTSA 4FL1A 3HDMA 3S00A 3BLHA 5J95A 2XP2A 4GL9A 2RFNA 4GRBA 3DJ6A 4K77A 3CQUA 4KIQA 4YC6A 5CF5A 4O7LA 2WMUA 4C61A 3FY0A 4XCUA 4L9IA 2OJJA 3RCJA 3V04A 4FNYA 2PUPA 1A9UA 5E4HA 3MI9A 2CNQA 4N6ZA 4M69A 2WTKB 4EHVA 2YJSA 4IM0A 1M7QA 3OXTA 4U79A 4OT5A 3ROCA 5HESA 4PX6A 3QQHA 3R6XA 3Q4UA 4FMQA 1H26A 3IOPA 3P78A 4OTFA 4C33A 5CXZA 5GIOE 1V0OA 1YXSA 5HCZA 4RGJA 4R5YA 4ACCA 1Q8ZA 2OICA 2GTMA 2PZRA 3UO4A 3UP2A 3WF5A 3D5XA 4AN9A 3UQGA 1BUHA 2OI4X 2X6EA 2C6DA 4QD6A 3V51A 4C38A 3PY0A 4K8AA 3NIZA 2HCKA 3PA5A 4TPTA 4MXXA 2E9UA 2XCKA 4DEBA 3ALOA 2WTWA 3CS9A 2B7AA 1CKIA 2EB2A 3UODA 5E8TA 1Q62A 2WMAA 2H96A 3F5PA 2ITZA 2ESMA 2ERZE 3GCPA 4G9RA 3HV6A 5KMLA 3VUDA 3G51A 3P7AA 4BRXA 3I6UA 4F9YA 4O27B 5BVWA 3FE3A 3TKHA 4BCHA 4Z3VA 3FYKX 1PXPA 4GVJA 2ITWA 3PLAE 2XKEA 1SM2A 2XK3A 4LMUA 1STCE 4AA5A 5HE3A 4BGQA 4KBAA 5I9VA 3F5GA 4QYHA 4TN6A 4DGNA 5IEYA 4H1JA 5CAUA 2C5YA 5LCKA 4E6CA 2O0UA 3HA6A 2LGCA 2OSCA 3D4QA 3PA4A 3R83A 4WIHA 3ZO4A 4ZK5A 2ZM1A 3D2IA 2P2IA 4HOKA 4MD9E 4F4PA 2VX1A 5BMMA 4E5WA 3RJCA 5E8YA 2BILB 4U3YA 4GSBA 4BDCA 5J7HA 5HTIA 3UIXA 2QOLA 3GU7A 5KKRC 1JKSA 5LVLA 4D1SA 3RPSA 1YVJA 4FTMA 2HXLA 2JIIA 3BZ3A 4TWNA 4G31A 2VV9A 4C62A 1PXKA 2CKOA 5J9ZA 4NKSA 2OZAA 2C1BA 4C57A 4TYHB 3O96A 1OIRA 3ACKA 4X3FA 4KIKA 3KXGA 2YDKA 4RPVA 1IEPA 4AZVA 3PJ3A 3EN7A 5BVKA 4R1VA 5CF6A 3VS1A 3RNIA 3BI6A 3ANRA 4HZSA 2C6TA 2I40A 5CSWA 2PUIA 3ALNA 3I6WA 2RSVA 2C1AA 2CGVA 4YO4A 4BKJA 1ZOHA 3UTOA 5CTPA 3K54A 4PV0A 3TNWA 2OZAB 2WZJA 4I24A 4YU2A 5I9XA 1JSVA 4PMTA 2X6DA 4X3FB 4A4XA 4JJRA 4KIKB 3JR1A 3SA0A 2ONLC 3DBQA 1F0QA 3DJ7A 3HNGA 3PZEA 4PMPA 4FVQA 1NVSA 5JH6A 4R78A 2YCQA 2Z7SA 3ZUVA 3LZBA 1BI8A 3H0ZA 3ET7A 1PXOA 4RLLA 4P5ZA 2R7BA 4WBBB 3QRTA 1GOLA 1OBDA 4YJUA 4YMJA 3RWPA 4O96A 4G5PA 4ZLYA 4M13A 5JFXA 2A2AA 3C4ZA 2OFUA 2X7FA 3R7EA 1J91A 5DWRA 4F7NA 4FGRA 2XYNA 3Q9XA 2QOCA 3CBLA 5FBOA 2WTDA 4MH7A 2XEYA 1R0EA 4CMOA 3A2CA 5AR8A 3BEAA 3V8TA 3TNQB 4X7QA 4MF1A 2F57A 3EH9A 1WBVA 2JDOA 1GY3A 1QCFA 5TE0A 2B53A 3I0QA 5C4KA 3R8LA 3KULA 1R0PA 5EOLA 4AA4A 1KSWA 1G8SA 3IDPA 4BHNA 3PE2A 4HZRA 4Y8DA 3ZM4A 5CSPA 3DXPA 5IQCA 1ZWSA 4EI4A 1W84A 3NUSA 2BCJA 3BYVA 4I22A 4PP7A 4W4WA 4DH1A 2Q0BA 4MQ2A 2WD1A 3G15A 1XR1A 5ETAA 3CLYA 4Y83A 4CT2A 2QKRA 3A99A 5M06A 4S31A 3S0OA 3I79A 3HDNA 1UU3A 4IZ5A 4HPTE 4PTCA 3W2PA 1ZLTA 1YI4A 2GS6A 2PULA 3KULB 4ASEA 1QMZA 4AGUA 4CFFA 4C02A 2V5QA 1BLXA 1MP8A 5JN2A 5IQHA 1PJKA 3ZO3A 4HYHA 2PZ5A 5HLPA 3LLTA 3ZOSA 4FTRA 4DG0E 3DK6A 4QP9A 4LGDA 3UNKA 3BHUA 4DC2A 3HVCA 1LEZA 3F3VA 5BUJA 5IH6A 2GNFA 2BAJA 3KC3A 4D2WA 3ZO1A 3NUPA 3BV3A 3DCVA 5AR4A 2WOUA 3TZ7A 2J5EA 3PWDA 5DA3A 4Z55A 3SW4A 3QRJA 2NRYA 4F7JA 5A6OA 2JBPA 4FV4A 2ZAZA 5K0XA 5HE1A 5IQIA 5AM7A 4NTTA 3GC9A 4D2VA 3PIXA 2FSTX 5H2UA 4O0WA 1OB3A 5IQGA 4AAAA 4TL0A 5HX8A 5K5XA 2FA2A 2QURA 4XV2A 3VW6A 5FTQA 4AACA 5A4TA 1Q8WA 4ALWA 4G5JA 3SOAA 1FQ1B 2VGPA 3KQ7A 4GT4A 4JDHA 4BZNA 5L6WL 2REIA 2ONLA 4AZFA 4DA5A 2IW6A 4CTCA 4J97A 4KSQA 4QQCA 3QZFA 3W10A 4BCQA 5L6PA 2NP8A 3LXLA 4AZTA 4FNZA 4ZJVA 2R5TA 3UIBA 2G2IA 4LV8A 2V55A 4X2GA 4EYJA 2VWVA 2VTOA 3VUHA 4ACMA 1Y57A 4V0GA 5LWMA 4C3PA 4JG8A 5FD2A 3L9MA 4ZJJA 4UMPA 2Q83A 3VUGA 4DFYA 4YJQA 2OO8X 5FUTA 3AGMA 2HENA 5J5TA 2XK4A 4N0SA 3MB6A 4OTHA 5AAGA 2J0IA 3Q4CA 1Y6AA 1YHWA 4YJNA 4I23A 2O65A 4O83A 1LUFA 4LG4A 3R9NA 1XHAA 2WOTA 3RK7A 4J96A 3B8RA 4JG7A 2V7OA 4V0GB 2UZLA 2EVAA 3EHAA 3K5UA 3ODZX 4PDSA 3I5ZA 3LCDA 4TWOA 3JY0A 4GVAA 1ZXEA 2FSOX 2UVXA 2QR8A 4L01A 2EUFB 2VU3A 4ZSEA 4XG4A 2VO7A 2YIXA 1B38A 3F3UA 4FIGA 5AP7A 3FKLA 4ZMEA 2QOOA 4BHZA 2BRHA 2XRWA 1MQBA 3DAEA 4FT9A 4DFLA 5FEDA 5HEZA 1PMEA 3R21A 2PVMA 5ANKA 3UNJA 5IH5A 5EYKA 2EXMA 2XUUA 4FV3A 3H9RA 5DRDA 4RA5A 3WF7A 1E1VA 4NU1A 1OL7A 5FTOA 4OTQA 2C5NA 2PY3A 3VS0A 2HWOA 2YEXA 4C36A 3ENMA 4AN2A 4FV8A 3PUPA 1M2PA 4QO9A 2W9FB 3Q96A 3DBFA 4HGEA 5F4NA 3GC7A 2C0OA 3GNIB 4TXCA 3POZA 5IG1A 1QPDA 3ACJA 4QMPA 4RIWA 4A07A 4BF2A 2B4SB 2WTCA 4DGLC 2IO6A 2R64A 3SXSA 3NVMB 2OGVA 4FEQA 5HBEA 1Q5KA 3E64A 5IF1A 2RF9A 1OITA 3BQRA 4WKQA 4FZDB 4YJTA 4I5PA 5BMSA 3LJ1A 4XHKB 3QZIA 3VRZA 3L8VA 5M53A 4WG4A 4QMXA 2RGPA 4IAAA 4YNEA 4CV8A 3CQWA 1GAGA 4LRJA 4H58A 3R1NA 1CSNA 1SMHA 5C01A 3T3UA 4XBUA 3A7FA 4GIIA 4XG6A 5JT2A 3EQDA 4AQCA 4FSMA 4M66A 4UMUA 3C4XA 3AT2A 3I7BA 3ZFXA 4DBNA 3DB6A 1H08A 5GJGA 2PMLX 1B39A 5E8ZA 1P5EA 4XP2A 3R8UA 3D94A 4YTFA 3D5WA 4QPAA 4X3JA 2V7AA 4EH2A 3C9WA 3DJ5A 3QC4A 5ETFA 4FTNA 4IB1A 2QO2A 4EZ3A 4L00A 1XQZA 3SLSA 3DB8A 2G2HA 4L53A 3ZC5A 2DWBA 1FMOE 1XH9A 1XJDA 3G33A 3VS4A 3R7YA 4RMZA 1G5SA 1K2PA 1U54A 3OUNB 3AT3A 2J4ZA 4FZ6A 5L3AA 3D5UA 5F9EA 3NMUF 3F82A 4IZ7A 2W05A 3ORZA 4FSZA 4WA9A 1BI7A 2IW8A 3W16A 4APCA 3TJCA 3BPRA 4HGTA 4HVIA 3BGQA 2JKKA 2B9IA 2YWVA 4E5AX 5KMIA 2HYYA 3MN3A 4BCIA 2ZDUA 3VBQA 2JDSA 2XZSA 4I1ZA 2VTIA 1ZRZA 3QQFA 4IAYA 3Q3BA 3DNDA 2UVYA 3TACA 1H07A 4TWCA 3RINA 5GZAA 5KNJA 4JRVA 1U54B 2JLDA 2JDRA 3DKGA 3EQCA 3QL8A 4D4VA 2ITVA 1W83A 4QP1A 5BUIA 4GV1A 1CMKE 2J5FA 2PE0A 3RZBA 5AUTA 4Y46A 1O6KA 3NS9A 2DUVA 2PMOX 4DEDA 5HD4A 1MRYA 2W99B 5AP2A 4CFUA 5L4QA 2YCFA 4I6BA 3QZHA 2QOIA 5CEIA 2IVVA 4V05A 3G0EA 1SVEA 2QOBA 2WTJA 3EIDA 4O22A 4D2SA 4ZY5A 4FV5A 3FXZA 4RJ3A 4ZMFA 5EM8A 3IK3A 4L43A 3QYZA 5DPVA 5BQ0A 3R1SA 3FSFA 2PK9A 3S3IA 4BIBA 4EORA 5CAPA 4IX5A 2BFYA 2R3GA 4HGLA 5LCJA 4YC3A 3TKIA 4BCKA 4F1MA 3ORIA 4EHEA 2WQEA 3QCYA 3R71A 3QF9A 3SQQA 2YM8A 5D12A 2W1CA 4F6SA 2QO9A 2DQ7X 3EN5A 2CNUA 3MA3A 2YM5A 3OY1A 2JIUA 4EHZA 2IZRA 4KS7A 4CFNA 2BMCA 4PL4A 2WAJA 3TIYA 2OZOA 2H8HA 2RL5A 5IPJA 2CKPA 5I9UA 3UDBA 4EH4A 4DG2E 4GFMA 4DCEA 5IEXA 4GEOA 3ZM9A 3P1AA 2UZEA 4UV0A 1OKVA 5EK7A 1CDKA 2VWZA 1SVHA 2EWAA 3MH3A 3OWPA 2JDTA 2O64A 4PMSA 4ASDA 4W4VA 3GT8A 3C1XA 1YOLA 2VWIA 3NR9A 4RX7A 3VBXA 5L2IA 3ZEWA 4FVPA 2O5KA 2C6KA 3O7LD 1L8TA 2XNOA 4YLJA 4EOLA 2UW8A 3O17A 5HI2A 5BNJA 1YXTA 2UV2A 4K9YA 3EN9A 3PVUA 4IAFA 3E88A 3ETAA 3TDWA 4QMYA 1OZ1A 2R9SA 3MPAA 3PIZA 3FI8A 4UXLA 1J1BA 2VX0A 1I44A 2XVDA 4F9AA 1V1KA 5C8KA 4F0FA 1WBSA 4S32A 5LARA 2JIVA 2IG7A 4DT9A 4FTJA 5AA9A 4MBJA 5CAOA 4Y72A 5EFQA 3W33A 4TT7A 3R01A 4F64A 3B2WA 2C47A 3F7WA 3FUPA 4JXFA 2VWBA 4M8TA 3UP7A 3AQVA 3II5A 4S2ZA 4XMOA 3SKCA 2XNNA 3OT8A 4BR3A 5HO6A 3HAMA 4XH6A 3WZUA 4QTEA 2YISA 5HNGA 4KIPA 4ZIMA 1VJYA 4AP7A 3KA0A 3V6RA 4MVFA 1IG1A 1TQPA 1WVWA 3K2LA 4BDGA 2YDJA 3R30A 1ZZLA 4IM3A 4EEVA 1YXXA 2B52A 3JVRA 4BCOA 2WEVA 5C1QB 4WG3A 3V01A 3H3CA 2J50A 2XA4A 4AW1A 5HOAA 3TUDA 3PLSA 3FKNA 4LQMA 4PDOA 4O82A 2WELA 3N4TA 3HMOA 2FVDA 3NW5A 4AT5A 3PE1A 4S34A 4MHAA 4J7BA 3KRJA 3GCVA 4FX3A 5FG8A 4AGWA 1LR4A 4RG0A 2YWPA 4XRJA 5CU4A 4C2VA 2FSLX 4H3QA 1H0VA 4QMTA 3QHRA 1T46A 1FOTA 2UVZA 3QD2B 4IH8A 3R9DA 4AFJA 3ZEPA 2C3IB 2CHLA
chains in the Genus database with same CATH superfamily
4GG7A 4MAOA 2PVNA 2C3JA 3HV7A 3FHIA 4FF8A 5KMJA 4MEDA 4HPUE 4CYIA 2JFMA 1XH7A 3KXNA 4MUQA 3LFEA 2J7TA 4RVKA 3KRWA 3QU0A 4C0TA 3DGKA 4AW5A 4D4YA 1ZMWA 2UZDA 4GJ3A 4GCJA 3A7JA 2EU9A 2RG6A 4A9UA 4EH9A 3TCPA 5M44A 2B1PA 2VNYA 3DAKA 4G3CA 1BMKA 2HZ0A 4YLLA 1OGUA 5I4NA 2WIHA 3UO6A 2W1IA 3IGGA 5DR9A 4F0GA 4MNEB 3HMNA 4WSQA 4FRFA 3EQFA 4LRMA 4R1YA 3PIYA 3QCSA 4ID7A 4E6AA 5ICPA 3ML1A 3SVVA 3OP5A 1W2DA 3QKKA 4FKUA 4ANBA 4EL9A 4K33A 4NYEA 1SNUA 2ERKA 3DBCA 3LIJA 4BZDA 2R0UA 1UA2A 4DHZA 2XJ2A 2W4JA 3Q9WA 2R3RA 3R02A 3R28A 2YJRA 4DFZE 2PVHA 4RC3A 5E9EA 3O8UA 2JKQA 3SRVB 4I5MA 5IZFA 2XRUA 2QVSE 2BRNA 2G9XA 5TT7A 2VO0A 2RKUA 1H01A 2YIYA 5AM6A 1VR2A 3D9VA 2C30A 3CP9A 3BYSA 4GW8A 4TNBA 1WBTA 1HCKA 3QWJA 5EOBA 4ACHA 5IQEA 3T8OA 3Q9ZA 3FY2A 3HMMA 3GCUA 3TTJA 3ZDIA 3QQLA 1PW2A 3FZSA 1XH4A 2QHMA 4KNBA 2FUMA 4PMMA 4OLIA 4QP3A 1YDSE 3R7UA 1XMLA 3QXOA 5HU3A 3FQHA 3PWYA 2HIWA 1PXMA 1G8JA 1H00A 4QTDA 3HA8A 4FKRA 1H1SA 2XKDA 3AGLA 1XBCA 4CZUA 2F49A 3QYWA 2YLFA 3EMGA 3W2OA 5HLNA 3BRBA 4IAKA 4IWPA 3TTIA 4O2PA 4ALUA 5HU9A 3ZH8A 2XK6A 4AGCA 3KCFA 3HYHA 1J1CA 1ZOEA 1UNGA 3ULIA 3VUMA 5CVFA 4H3PA 4NJ3A 3CD8A 3MV5A 2BZKB 3NIEA 4NUSA 3F2NA 3Q9YA 5KBQA 2Z60A 1CKPA 2VWUA 3PXFA 3TUCA 4DT8A 3CR0A 3FV8A 4FKOA 3COMA 2GNGA 4JLCA 2A1AB 4MD7E 4BIEA 2X9EA 5DR2A 3U87A 4UWCA 1YRPA 2R3FA 3GGFA 3HZTA 4J1RA 4R3RA 1GJOA 5AAEA 1R1WA 2PTKA 3REPA 5CQUA 3K5VA 3ZRKA 3NZ0A 5HD7A 2BVAA 1NXKA 3IDBA 5AR7A 4LFIA 5JFSA 4MTAA 3FMDA 3DFAA 4H36A 2QOQA 2ZOQA 2UW7A 3PTGA 2AEGA 1GIIA 3F9NA 4FKTA 1OPJA 3VF8A 4FT5A 4ZZMA 4AOTA 3DZOA 4NZWB 3MVLA 4ASZA 4G3DA 4BCPA 4DE4A 3R7GA 4XOYA 3R0TA 2AUHA 5HE2A 5IA5A 5BYZA 2CKQA 1ST0A 5FM3A 3LM0A 3UE4A 4C3RA 5J1WA 4EH6A 3SGCA 3W0NA 4ZTRA 1KV2A 1A48A 3BYUA 4E4MA 5CNOA 1GZKA 1OBGA 3ZMMA 3D83A 5HIDA 1ZARA 5LMBA 2J0KA 2QO7A 3TV4A 4GIHA 5BVOA 3NCZA 4YZCA 4QMLA 3EJ1A 2QODA 4PNIA 3L9PA 4DTBA 4QQTA 2VTHA 3POOA 2IVUA 4I4FA 3R04A 2IZUA 3EFKA 4HYUA 1IRKA 4FIHA 3ID6C 1HOWA 4L3JA 4QMWA 5L8JA 3NUAA 3D7TA 5H8EA 3UOKA 1ZYJA 1ZY4A 5M4FA 4RX5A 5EHYA 3T9IA 5DT4A 5A4LA 4UWBA 4AG8A 4FSWA 3S1HA 4EJNA 1PKDA 5DT0A 3KCKA 3RI1A 3KRLA 2W17A 2UZBA 3FL5A 1PHKA 2QLUA 4X2JA 2EXEA 2I0VA 5FBNC 3UZPA 4XG3A 3PY1A 3VO3A 5KHXA 5CVGA 4M69B 1KE8A 2GNLA 4FEWA 3DS6A 4CFVA 3ZUTA 4OBOA 4AOJA 3N4UA 4ARKA 4JVGA 1Q4LA 3T9TA 3E93A 3NCGA 3IQ7A 2QKWB 5C8MA 1G8AA 4BJJB 5DRBA 2VWXA 4EH3A 3W0SA 4XEYA 1WBPA 2PPQA 3EYGA 2O8YA 5H9BA 3OOGA 3THBA 1J7LA 3PA3A 4M67A 3U8WA 5IA2A 3FLZA 3BV2A 4MXZA 3F3ZA 3RM6A 1Q3WA 1JOWB 4QMZA 3A7GA 4MD8E 4F6UA 2HOGA 3LAUA 2I0HA 4JIAA 1OL6A 3ZHPC 4XLVA 2PHKA 4PY1A 2XIZA 4CMUA 4PNKA 3Q52A 5HQ0A 4IAZA 4DBXA 4FTQA 4BI0A 3GC8A 4YJVA 5LVPA 2ITQA 5L6OA 3VHKA 2Z02A 3BE2A 3EB0A 1YDTE 3QBNA 4H1MA 4HYIA 4PDPA 5L8KA 2IJMA 2VNWA 3WE8A 3HKOA 4B8LA 4BB4A 3E3PA 2WPAA 5FWKK 5HTBA 4O7TA 3SC1A 3LKMA 1AD5A 4FYOA 4CEGA 2Z7QA 3FQSA 3PJ2A 3PXKA 3V5QA 1PYEA 3IW7A 4LUEA 4U45A 5HZNA 3LCSA 4LL0A 4BDHA 2R3QA 5IA4A 5EQEA 4M0YA 3VQHA 5IA1A 3QC9A 1FBNA 3KN6A 3MH1A 2NPQA 5CS6A 4HNFA 3F88A 4DAWA 1M17A 3VS3A 1A06A 3UBDA 3TNHA 4D9TA 4JDJA 4WHZA 4FKVA 4QMSA 4G6OA 4E4XA 2C0TA 4QTCA 3R9OA 3LW0A 3LQ3A 4B9DA 2UZOA 3EFLA 4QRCA 1P2AA 4FT7A 4YPDA 4O7VA 3ORTA 3PPZA 4PUZA 2PZYA 3JVSA 3JY9A 5HLWA 4RC4A 4GJ2A 3GP0A 3RPOA 2PMIA 4RFYA 4BL1A 3RVGA 3QTXA 3FC2A 2KTYA 4WUNA 4MX9A 2QHNA 4ONAA 2HWPA 4DH5A 1FPUA 4EUUA 5L8LA 2IN6A 4YP8A 1OI9A 3DQXA 5BX0A 4C58A 1PF8A 3DA6A 3V8SA 3AD6A 1TQMA 1P14A 1WBWA 4ERWA 3FPMA 5D9HA 3SOCA 1OL2A 5TF9A 5B7VA 4R7BA 4S30A 1FVTA 1JBPE 2WMTA 5TR6A 4JNWA 2B9FA 3PP0A 4UN0C 1H1WA 3KU2A 5FLFA 3HAVA 1Q8UA 3QLGA 5M4UA 2CGWA 5HHWA 4FTTA 3OTVA 3SX9A 2OH4A 2BRBA 4MQ1A 5FM2A 3AMBA 1Q99A 4BCNA 4FOBA 1KE7A 4V04A 5CYIA 4MWHA 3FLYA 4BDEA 4JQ7A 4R7IA 4ZOGA 3H30A 1GZOA 3A8XA 4KS8A 2OJIA 3QX4A 4FL3A 4GT3A 2CJMA 2F2CB 3UO5A 4E26A 4QYEA 3I81A 3MESA 4ZZOA 5I0BA 1NA7A 1H24A 3L9NA 4J95A 2W1EA 1UU7A 4IFCA 3LFNA 4D4SA 4DYMA 1Q61A 3ZRMA 3WIKA 1H4LA 3FQEA 4ENXA 2YIRA 5HG8A 4QMUA 1R39A 1YDRE 2CMWA 3KMUA 2OWBA 5HKMA 4UY9A 3VRYA 4CKJA 4QPMA 5CEOA 2J0MB 3HRBA 4WNPA 3V5PA 5A4QA 3NPCA 4ZTLA 3UG1A 4M84A 2W06A 1F3MC 4OBQA 4QP4A 4FKLA 5A4CA 4J53A 2WQOA 3Q6UA 4FSRA 4I92A 5EDPA 4O7WA 4RWJA 3O51A 2GS7A 3GVUA 3P0MA 3UPZA 5J8IA 1YWVA 1QPEA 2CLQA 5A4EA 4FE2A 2F7ZE 3D0EA 4M3QA 3OOMA 3FEGA 4PL3A 1JPAA 2ITNA 2YHVA 3UZTA 2JKOA 3VUIA 3BHTA 2VTSA 3ULZA 2OF2A 2ETKA 3ZSGA 3R22A 4JDKA 3KMWA 1E1XA 3OROA 4FR4A 3PP1A 2FYSA 4FUYA 5D10A 5HO8A 4CQEA 5AX3A 3RMFA 3QA0A 4V01A 2O3PA 3KXZA 3E87A 3COKA 3BGZA 3P86A 4AA0A 4DFNA 4MXYA 4KAOA 1U4DA 3LFCA 5DR6A 3AMAA 5DT3A 4ZXTA 3ZZWA 4D2TA 2YZLA 3QD3A 4DN5A 2YA9A 3NYOA 4MBLA 4WO5A 2VRXA 2A98A 2VTMA 2WIPA 3C50A 3OMVA 5GJFA 4ORKA 5J7BA 3FMJA 3LM5A 1SNXA 3ZXTA 3WZJA 1J7UA 4A06A 4O84A 2X4FA 3L8SA 2C5OA 3AC4A 5D1JA 5F94A 3W8QA 3MS9A 1ATPE 2GU8A 3F69A 4RX8A 4AZWA 2OF4A 4M15A 5KKRB 3BQCA 5FTGA 5KMMA 2FGIA 1I09A 3FZRA 2XK8A 3D14A 4IZYA 4IB0A 4NJDA 5EKNA 2PUNA 2VTNA 3SAYA 3VULA 2I0EA 4PTGA 3DU8A 3NAYA 4EQMA 3OCTA 5AMNA 4BKYA 4FKQA 4C3FA 3FMLA 5C26A 2W4OA 3SXRA 4O7ZA 5EM5A 3EZRA 3A60A 4YBJA 4E93A 2W5HA 3UVRA 2QOKA 5AP3A 4ENYA 2BZJA 3ZLWA 3HLLA 3QWKA 3LMHA 4M97A 2X39A 4EOSA 1AGWA 4FYNA 3WZEA 3G90X 4ZTNA 4UMRA 4TW9A 2C6EA 1GIJA 3GU6A 4IVBA 3BHYA 4O0RA 5CU3A 5DBXA 4B6LA 3P7BA 2XIXA 2XYUA 4UB7A 3Q2MA 5AIRA 2NO3A 3ZU7A 3OBJA 2JBOA 5AA8A 4KKGA 3S4QA 4L3PA 4BWXA 3U9NA 3VS6A 5HGIA 3NNWA 2QOFA 1ST4A 3MY1A 4I0RA 3ORLA 2BHHA 2PZPA 3EQGA 3KFAA 3QUDA 2ZM3A 4YZNA 3TV6A 3VC4A 3T3VA 4C34A 3E62A 4LM5A 3HV3A 3DLSA 3VUTA 2WMWA 5IQFA 3NFFB 2A19B 5M09A 1TKIA 4EH7A 3PDTA 2B54A 3GI3A 1O6YA 4D1ZA 5JEBA 4DFBA 2R4BA 3OVVA 4YUQA 3ENHA 3VVHA 2ZMDA 4Z16A 5M4CA 4GYGA 2XIYA 2UZVA 2WKMA 4P90A 5JGAA 1SVGA 4GYIA 2R2PA 4IMYA 4DHFA 4NM0A 3VAPA 1U5QA 4U44A 1Q8YA 1ZYLA 1PXJA 4AW2A 4J8NA 5IA3A 4TZRA 3NUUA 2Z7LA 3UQCA 3FZTA 2FH9A 1URCA 3BBTB 3R2YA 3GB2A 4DINA 4EOKA 2UZTA 4K11A 4YHFA 4FK3A 2XBJA 4BIDA 3QALE 4BDIA 4WUAA 4BYJA 4TKSA 4RBLA 3VBWA 3PSCA 3ZBFA 2UW4A 4U42A 3RPRA 3CTHA 3L8XA 4TYJA 4NCTC 4DH7A 3CC6A 5BVEA 4F65A 5I9YA 3HV4A 4FV6A 4O0XA 1PKGA 3W32A 4HNIA 5CF8A 3KREA 3CD3A 4EK5A 2VZ6A 4IB3A 1WVYA 5DIAA 4F09A 5K9IA 3WARA 5JFWA 3DKFA 5CEQA 4X21A 4XNEA 3BGPA 1Y8YA 5FEEA 4BZOA 3IW5A 2Y6OA 4HCVA 4ANLA 4GG5A 4ANNA 3WF9A 1YOJA 4G1WA 3H0YA 4XG8A 3EL7A 4RIWB 2UZUE 1Y91A 3FLNC 5D41A 5ITAA 2GNHA 3TN8A 3DLZA 5D7AA 3KGAA 4QMQA 3CCNA 3PY3A 2X0OA 3R1QA 3FPQA 4KINA 2YCSA 2ETRA 4JT3A 4U0IA 3EFWA 3GOPA 3KK9A 4AXAA 4O86A 1H1QA 3IECA 3TXOA 4EK6A 1BKXA 2R3LA 5M56A 2NNWB 3F2AA 4J99A 4EKLA 4GK4A 4RFMA 3VBVA 1IA9A 4G2FA 3TKUA 4ACGA 2BDWA 4MNFA 3AG9A 3F7ZA 5LMKC 2W1HA 3BU6A 4KB8A 4Z9LA 1MRVA 4R77A 4QMNA 2QG7A 2VTQA 4U6RA 3O8TA 5IDNA 5LOHA 3MPTA 3O2MA 4GU6A 5E1EA 4ZZNA 4YTIA 4BBEA 4GFOA 1FVVA 5HVYA 3FI3A 4BBMA 4P7EA 3MVHA 2XKCA 4GUEA 4FODA 4IX6A 4KUJA 2XARA 3GQIA 3WI6A 2OJFE 2SRCA 2XM8A 4OTRA 3ZDUA 1H0WA 3TNPC 3W2SA 4CFXA 2BROA 2HAKA 4HVDA 4ZLOA 3P23A 3RCDA 1PMVA 3O8PA 4S33A 4NW5A 3HMPA 4IE9A 3EOCA 4CGAA 4IEBA 4BY9E 3IG7A 3LVPA 3QAME 5KBRA 4UX9A 4OR5A 1DI8A 5FP5A 3ZBXA 3O7LB 3AC1A 4X0MA 4NM5A 3OZ6A 4B4LA 1H25A 2ITUA 2ZDTA 3DDQA 3EYHA 3CKXA 2VTLA 4KWPA 3RPYA 4CG8A 2BAKA 3QQJA 5CSVA 4ITIA 4F99A 3OCSA 4F6WA 1YWNA 3GCQA 4RWKA 4EOQA 3CEKA 4CYJA 3B8QA 3FI4A 4LMNA 5HBJA 1OVEA 1ZY5A 2WMBA 1WBNA 3NWWA 4DTKA 4NCTA 2WMSA 4CRSA 1OUYA 4DEHA 4U40A 3PSDA 1RW8A 2Z2WA 1UVRA 3ZSHA 3NUXA 3PSBA 3QUEA 5CNNA 2ITTA 1ZYDA 3OS3A 3C0HA 3P5KA 3SDJA 4R6VA 1Q97A 3V8WA 3TM0A 2BHEA 4ITJA 4R3CA 3LXNA 5LWNA 3FBVA 3KK8A 1Q3DA 4U7ZA 1OIUA 1X8BA 3F5UA 3OWJA 3PFQA 4KRDA 4LYNA 1P4OA 3DY7A 3W2CA 3ZLYA 4NEUA 3BLAA 1DS5A 2VTJA 4LI5A 4QMOA 5AP5A 1DAWA 2JAMA 5CX9A 4I21A 4JX3A 2C6IA 4JBOA 5ANIA 4Y5QA 3R8ZA 1VLRA 1REJA 5LVNA 3QRIA 4YHTA 1KV1A 4BFMA 2YITA 2J51A 5EKOA 5K0KA 1KE9A 3V5WA 4CSVA 4OTGA 1KOAA 2C6OA 2I0YA 3RHKA 2OIQA 4E6QA 2ZB0A 3ORMA 1WBOA 2PVYA 2JAVA 3W18A 4ANQA 4FICA 1M14A 2YM7A 3RAIA 2ZYBA 4JOAA 4RVMA 4FSQA 4BI2A 3UYTA 3U51A 5CVHA 4FVRA 4ZSGA 5AJQA 3ZTXA 2W1DA 3TT0A 4EH8A 5KMKA 5FQDC 5JK3A 3E92A 2H34A 2VWYA 4MKCA 3V5JA 5LMKA 3EN6A 5BV3A 4A9SA 3W2RA 2V0DA 5DEWA 2OU7A 3UIUA 1TQIA 3ZYAA 5KO1A 3D7ZA 5ACBC 4N57A 2Y6MA 4RZWA 3WZDA 5HICA 3DK7A 4C2WA 1TZDA 3NSZA 2PE2A 2XNGA 4KBCA 3RK9A 4LOQA 4F70A 3GBZA 3NGAA 3TNIA 1IAHA 1K9AA 3NNVA 4PTEA 2P3GX 1APME 5AP0A 4M12A 3QTRA 4D1XA 4USEA 4FUXA 3OT3A 1OKZA 4AFEA 5G1XA 4MXOA 3PFYA 4OAUC 2W1ZA 2VWWA 1ZYSA 1W0XC 4PP9A 5FRIA 2FO0A 4FL2A 2W9ZB 5JGBA 5J9YA 4RIYA 5LVOA 4FT0A 4JAIA 4WOVA 4Y85A 1UV5A 3M2WA 5J87A 3VWAA 2IVSA 4G17A 3UOLA 4RWIA 3HUBA 4XX9A 4YZMA 1M2RA 5IH4A 2P4IA 5CENA 1KE5A 4PWNA 1YXUA 1YI6A 1YW2A 2HW6A 4JBVA 5CF4A 3BU3A 3PXQA 4FC0A 2KULA 4IZAA 4L3LA 4YO6A 4C4FA 1U5RA 3FAAA 4H3BA 2HW7A 2QI8A 5CXHA 3QTZA 4CZTA 3NVKI 3QCQA 4YTCA 3QD0A 5FP6A 1FMKA 3MGYA 4EC8A 4B7TA 4RIYB 4NH1A 4EKKA 2GQGA 1YOMA 5EQYA 3W0OA 4C4HA 4O1PA 4WD5A 2C6MA 2IEWA 4KBKA 4NFNA 4EK4A 2UW5A 4WNKA 4W4XA 1LP4A 3GEQA 4NFMA 5A6NA 3IO7A 3WF6A 5IUGA 5E8UA 2JKMA 3TV7A 2G1TA 1NVRA 3MVJA 4X6QC 5ACKA 4FTLA 5DEYA 5C4LA 2R3PA 1XBAA 2ZV2A 3E5AA 4I6QA 2PZIA 4FTCA 3WYXA 3U6HA 2YLEA 4U5JA 4EJ7A 3S2PA 1Z5MA 3FZ1A 5H8BA 2QNJA 3KMMA 1MQ4A 1BYGA 1NY3A 4I5HA 4L6QA 5JQ5A 4C37A 4LOOA 2RFDA 4ZAUA 2E2BA 1UKIA 3BELA 3BLRA 3TZ8A 5AADA 4ITHA 1J7IA 3QKLA 2GFSA 3C4FA 1LPUA 2BDJA 3JUHA 4LGHA 5JGDA 4K1BA 2VO6A 1Q8TA 3OW3A 2GNJA 4IC8A 2E9OA 4O4CA 4RFZA 4YJOA 4EUTA 2BALA 5K4IA 3E8CA 4ZSJA 4LOPA 3SV0A 4DGMA 3DK3A 4F78A 2IVTA 3R1YA 1Q24A 2WTKC 3DTWA 4B8MA 4E4LA 1WMKA 3E7VA 4J52A 2OK1A 2OBJA 5ETCA 1S9JA 4DG3E 2OXXA 1NT2A 5DOSA 1URWA 3OBGA 4NK9A 2PVJA 3ATTA 4EOMA 4D5KA 1OPLA 2A4LA 4JDIA 3GFEA 3RP9A 3TIZA 4W9WA 5KZIA 3MB7A 3SXFA 5IDPA 4RIOA 4XBRA 2ZMCA 3CE3A 1UWHA 4FTAA 1KOBA 2RFSA 3O50A 3LOKA 4UYNA 1WFCA 3G5DA 3GU4A 4JBQA 4FBXA 2DYLA 5I9ZA 3EN4A 2RFEA 3EKKA 5EHLA 2BIYA 5A3XA 2E9PA 3IW8A 2PMNX 5E8XA 2J0JA 2XANA 1OMWA 3AD4A 1XBBA 3PPJA 2XIKA 4FKSA 3FJQE 5A14A 4NT4A 4XV9A 3RAHA 5CEKA 2I7QA 4LV7A 2BZIB 5FDXA 1VEBA 5IU2A 2WTIA 4KIOA 4QMMA 4RQKA 4C8BA 3MSSA 2VUWA 4W9XA 3BCEA 3CPCA 1W8CA 4HGSA 3UOHA 3VS7A 1YI3A 4GT5A 5FGKA 3OHTA 4H05A 3Q4ZA 3DBDA 3NYNA 4OW8A 4FNXA 2XCHA 4KD1A 4C4IA 3SW7A 5HCYA 5HNBA 4LRKA 1F5QA 3G6HA 3GCSA 3BEGA 4DH3A 2BKZA 3OXIA 4EC9A 2H6DA 3GOKA 1XH8A 2R3KA 2I6LA 2R7IA 3KL8A 4UBAA 4WT6A 5IUHA 2C4GA 4EQCA 3WILA 1E9HA 5EQPA 1OKYA 2YACA 4B99A 3SD0A 5JFVA 3MIAA 3FMEA 4AW0A 4R5SA 4TWPA 5ANDA 3UQFA 4WNOA 4YPSA 3WYYA 4BKZA 1B6CB 3LHJA 3LXKA 3NYVA 4IAIA 3G2FA 3KF7A 4CKIA 3BIZA 3F5XA 4CFWA 4JIKA 2HZNA 2C5XA 3U4UA 2IZTA 2CN8A 3IKAA 4Y5HA 3R7IA 3ZSIA 4AXDA 5AUVA 2X2MA 5E8SA 2YM3A 2CLXA 1PXIA 4XYFA 1T45A 4YR8A 4F9BA 5CEPA 3NDMA 1REKA 3MY5A 5HIBA 3Q04A 4FEVA 4IWDA 3RKBA 2OJGA 3I0OA 2LAVA 3CJFA 4QP7A 3KXMA 5FXRA 4PL5A 1OGYA 3TMOA 4CV9A 3O0GA 3O71A 4U9AA 4D4RA 2BPMA 1XMMA 2QG5A 4XP0A 3LCKA 2OW3A 2W5AA 3C51A 5IMEA 4EZ5A 1U59A 5F20A 3UC4A 2BFXA 3UNZA 3DXQA 3DNEA 4O0VA 5ANEA 4ACDA 2B9HA 3JYAA 4HW7A 4YHJA 3FHRA 3PZHA 3PVWA 5AIKA 4Q5EA 3CQEA 4GFGA 2VN9A 3KRRA 3UPXA 5GHVA 1PMNA 3KN5A 1H27A 2R3IA 3AXWA 2B9JA 3BBWA 4MWIA 5T6KA 3OW4A 3FMHA 4QNYA 1EH4A 5T3QA 3G0FA 4PQNA 4XG2A 3FXXA 3UMXA 3RALA 5GZ8A 2XNMA 5LVMA 4IWOA 1YHVA 3ORPA 1OIYA 4A4OA 1CM8A 3FKOA 2A0CX 4O91A 4NIFA 4YTHA 4FIFA 1W98A 3D7TB 3LLAA 3DT1A 5DGZA 3QTSA 1RE8A 2G2FA 4NM3A 4AT4A 4CXAA 4OAVB 4O1OA 5HNIX 3HEGA 2YM4A 5DLSA 4IDTA 5EH0A 2W1GA 4GUBA 3N51A 3DTCA 5B2LA 4XUFA 3TWJA 5CALA 2GQRA 4ZS4A 2X0PA 3KVXA 3FLQA 5DVRA 3Q60A 1UNHA 2BAQA 2GNIA 2XH5A 3AC5A 1CKJA 5AUYA 2ZV8A 3AC3A 5EG3A 2GHLA 4NIFB 2F7EE 4IWQA 3GU8A 3I4BA 2YERA 4NWMA 3DXNA 5CT7A 3VJOA 2CGUA 5E91A 4BYIA 3E8EA 3EZVA 3KEXA 1OECA 5AUZA 5GINE 3QGYA 3VN9A 3CGFA 1JQHA 4HCUA 3BHHA 3MPMA 1PMUA 4I0TA 3QXPA 2GMXA 3HX4A 3OG7A 4TY1A 5EI8A 3BYMA 3V5LA 4BWKA 4CG9A 2Y8OA 1PYXA 2JEDA 3CTJA 4RC2A 3PXYA 3UIMA 2PVLA 4MXAA 5EHOA 4O81A 3NUYA 2RIOA 3S95A 3P7CA 4RLKA 4BTJA 5KX8A 1H8FA 2X0GA 2O2UA 3HV5A 3MDYA 5F95A 2CSNA 2WEIA 3MFUA 5ANGA 4J8MA 3RNYA 4IXPA 4P4CA 4A9TA 1AQ1A 5CWZA 4X6RA 5GNKA 3DBEA 4WG5A 4B0GA 2WMQA 4FTOA 1GNGA 4G34A 5EYDA 4L8MA 4RRVA 1TFFA 4L42A 1U46A 2Y4IC 4XLIA 3ZS5A 4FG8A 4TYHA 2OXDA 4GK3A 5AV2A 4FV9A 4ZS0A 4HVGA 3UC3A 3TG1A 3MW1A 1WZYA 3MFTA 3JPVA 4UMQA 4A7CA 2VX3A 2OFVA 3TZ9A 3LFFA 4IQ6A 3AKLA 4Q2AA 5EW9A 2GSFA 3R73A 4BTFA 2XKFA 3MFRA 4NSTA 3PYYA 3W0RA 5JSMA 3FSKA 4MK0A 5BVFA 4RVLA 2BZHB 3BKBA 4A9RA 4GKHA 3VQUA 1ZAOA 3G9LX 5AWMA 4O7RA 4PPBA 5FXQA 4IX4A 2PVFA 4YBKA 5DN3A 5AEPA 2OXYA 1H28A 3NLBA 3DFCB 4FTUA 4AUAA 3ZLXA 2JD5A 1PXNA 2WO6A 3JXWA 3P4KA 4USFA 3IW6A 2OIBA 2IZSA 3KVWA 3RHXA 3V6SA 4NW6A 2F9GA 5D7VA 4JAJA 3TZMA 3MA6A 3EFJA 3UYSA 3OD6X 3CSVA 3RAKA 5B0XA 4ZTHA 4G16A 4L52A 4C4EA 4L46A 4RJ4A 2C69A 2CN5A 4YGAA 5JZJA 1W7HA 3DKOA 2R3OA 4ANOA 5CEMA 1PRYA 1GZ8A 5AR3A 2GFCA 3WOWA 4FOCA 4L7FA 5CY3A 4BBFA 4G6NA 3VJNA 4QNAA 3WE4A 4CKRA 3RM7A 1BX6A 3FDNA 4II5A 5LMAA 4O0SA 3NYXA 5M57A 4C35A 2P33A 2P55A 2HY81 5E92A 4O0UA 1RJBA 3R8VA 4EHGA 4G3GA 4DEEA 2VD5A 4N70A 2WB8A 4E3CA 3UOJA 5T68A 3UVPA 3F3TA 4RT7A 3OTUA 3ZRLA 4ANSA 1UU8A 5ANOA 2I1MA 2WQMA 2ZV9A 4RX9A 4TYEA 4YLKA 4ZSLA 4BCJA 5CU2A 3UZRA 2F2UA 4F1TA 5I3OA 3R63A 1ZYCA 2OIDA 4WBOA 4HVSA 3B2TA 3LCTA 3GENA 4LV5A 4XS2A 4YJRA 5EW8A 5LJJA 2X7GA 4BDDA 4IX3A 5CI6A 1JKLA 3MTLA 3GU5A 4QT1A 4WNMA 1BL7A 2GTNA 1VZOA 2XALA 4IB5A 5LXMA 4CVAA 4DDIA 5CAVA 2XS0A 3NW6A 3RWQA 4JRNA 3ZC6A 3R2BA 2GHMA 4RVTA 3PPKA 4EWQA 4Q9ZA 3LFAA 4FKGA 1ZOGA 5EM6A 2X8EA 1YXVA 4U3ZA 3AMYA 1JNKA 3L8PA 2X4ZA 5EDRA 1O9UA 2Y0AA 1Q41A 2BIKB 3N9XA 4I41A 4BDKA 1OPKA 4U41A 3FZOA 3ZUUA 4I94A 5I3RA 4XRLA 2BDFA 3LJ0A 3K3JA 3WZKA 4PPCA 3NX8A 4FV1A 4BTKA 2JFLA 3U6JA 2PU8A 2BUJA 4MYGA 4QYFA 1UKHA 2QR7A 3M42A 5CLPA 3MIYA 3TL8A 1H1PA 3QQGA 4ZP5A 4H39A 5KMOA 3HL7A 3FLWA 4OTDA 4ANMA 2HK5A 4JQ8A 2QU5A 3UDSA 3DAJA 4D2PA 2QC6A 3I7CA