3ZUVA

Crystal structure of a designed selected ankyrin repeat protein in complex with the phosphorylated map kinase erk2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
359
structure length
357
Chain Sequence
HAMAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLEVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 1
publication title Structural and Functional Analysis of Phosphorylation-Specific Binders of the Kinase Erk from Designed Ankyrin Repeat Protein Libraries.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags De novo protein/transferase
total genus 113
structure length 357
sequence length 359
chains with identical sequence C
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zuvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zuvA01
4HNFA 4U3ZA 5EDQA 3WOWA 2J7TA 3ZO2A 4S2ZA 1NVQA 1OIYA 3ZEPA 2VWBA 4Q5EA 4TWPA 4KSQA 5AIRA 2J50A 3RNYA 4G3CA 3QUEA 3TNIA 5A9UA 5C8KA 3FMEA 4IC8A 4FZ7A 5AV0A 2C6EA 3VUDA 4EZ5A 3MDYA 4IX6A 4ACDA 4BZDA 5FG8A 4O6LA 5AUYA 3ALOA 4C0TA 2CGVA 3K5UA 3UIXA 1IAJA 3NUPA 4CMTA 3DDPA 3REPA 3JXWA 4O7NA 3AC1A 3M2WA 1G8SA 1LPUA 1M17A 2XNPA 4YO6A 2NP8A 3C13A 3I7BA 3WF8A 4N57A 4ZZOA 3SLSA 3ZBXA 4PMPA 3G9NA 4JDJA 4ZK5A 4G3GA 2AUHA 3PXFA 3F88A 3LLTA 3A7IA 3GGFA 4UXLA 4OAVB 4FKJA 5A46A 4TYIA 5IKWA 4HVSA 4QP9A 3Q9WA 4ZJIA 1OL1A 3AD5A 5KO1A 3FSFA 5LXMA 2C6IA 4XG2A 1UNHA 4QMLA 4FG7A 5CWZA 4FTUA 2VZ6A 3NNXA 1L8TA 5EYDA 4D5HA 3PPZA 3PIYA 4GUEA 3PA5A 5JFWA 3BU6A 4R1YA 3IO7A 4HYHA 4L68A 2OSCA 3H0YA 4IH8A 3IDCA 3LCOA 3R1SA 4C58A 4NW6A 5EK7A 1ZYDA 4F9WA 5AV2A 3QD2B 2BR1A 1FQ1B 4UMQA 2R3IA 4F09A 2JIVA 3AOXA 4FSMA 4RWJA 3MFSA 4A4XA 2Q0BA 3DZQA 5I3OA 3HNGA 2UZNA 4YNEA 3F7WA 4M66A 3W2SA 1Q97A 3FE3A 4WO5A 3EQGA 5M44A 1TQPA 3VHEA 3O23A 3W8QA 3U51A 4ASXA 4AWIA 5LWMA 5AFVA 3A7GA 5FWKK 2PYWA 2PE0A 3LCKA 5ETAA 3BI6A 3UGCA 4UYAA 5LQFA 2W4JA 4JAIA 4BGQA 2IZTA 5AM7A 3HV6A 2HWPA 1Q41A 2C1AA 5BUIA 3MV5A 4C37A 3DQXA 4YJUA 4FOCA 3FZRA 2EVAA 4WRSA 1AD5A 2EXMA 1W98A 3SOCA 3H9OA 3MS9A 1MUOA 4BVUA 4FKWA 2XKDA 3OD6X 5IA1A 3BV3A 1FVVA 5HE1A 3BQCA 2W1ZA 2BTRA 2WIHA 3ANRA 3OWKA 4JRVA 3RK9A 4MQ2A 4MQ1A 3V04A 3ZO1A 5JQ5A 1J7LA 4DFXE 3NYXA 3JR1A 1YWVA 4ITIA 2B4SB 2WMQA 3F3VA 1Q99A 4IAFA 4WIHA 3VRYA 3L9PA 4DEGA 3NYVA 5BNJA 3E5AA 5ETCA 3A62A 3QZIA 4AZEA 2BAKA 4DLJA 1JLUE 2BRBA 2C6MA 3DPKA 3L8SA 1OUYA 1Q8YA 5EW8A 2RFEA 5HO6A 3OG7A 4R77A 2VGPA 3ZRLA 3MVMA 3R21A 4FE2A 2YN8A 4FKPA 5BVFA 3GP0A 1ZLTA 5FP5A 4XV2A 3JUHA 3LFAA 5AADA 4ZSJA 4QP3A 2FSOX 1KE5A 4KIKB 5B0XA 3P9JA 2GNHA 4TYHA 3W55A 5KKRB 5CF8A 1PYXA 3GNIB 3KXZA 2R7BA 1PHKA 2CCIA 2VWIA 5AEPA 5I9ZA 4LMNA 4QRCA 3TZ9A 2JKKA 2LAVA 1P14A 4RLLA 1JNKA 1YXXA 3VWAA 2ESMA 3AC8A 5KNJA 3Q5IA 4II5A 2Y4IB 4NT4A 4IADA 4YHFA 3EFJA 4AZVA 4D1ZA 3N9XA 3ZUVA 3VO3A 4XG9A 4G17A 4RWIA 3RAHA 3ZS5A 4L67A 4EH6A 5IISA 2UZUE 3RPOA 5DRBA 4FSNA 3C9WA 1WVYA 1FGIA 3ORZA 2VO3A 4AGDA 3G90X 2JKOA 2VD5A 3H4JA 3P5KA 2YFXA 5FDXA 4BZOA 2O65A 5DR9A 5FTQA 1A48A 1H8FA 5CI6A 4CFVA 3D15A 4CV8A 2G01A 3L8VA 5KHXA 4X3FA 3G33A 4FIGA 4QYYA 1Q3WA 3O8PA 2XK4A 3UP7A 3FMKA 5E8WA 5DMZA 2C68A 1SM2A 3EQFA 2XYUA 3ATTA 2OW3A 5A6NA 2CMWA 3SAYA 4YJPA 3FI8A 5B2LA 4QTBA 5IA4A 3OY1A 5ANEA 4D2VA 4B6LA 5FXRA 3G9LX 3OCTA 1KE9A 2WELA 4LOPA 1JBPE 4BCKA 3UIUA 3GUBA 5CSWA 4HPTE 4HGEA 4HNIA 4X3FC 4CXAA 4EK8A 5KKRC 2RFSA 4EOPA 4GKHA 1OL6A 2VU3A 3EN7A 3MTFA 2ZYBA 2V22A 2X7OA 1LEZA 5CS6A 3BYUA 5KBRA 4UWYA 2YWPA 5AR4A 5CLPA 4KAOA 4FSTA 3R8UA 4FV8A 3QWJA 5IDPA 1ND4A 1H26A 4BKZA 2HIWA 4YJTA 3IGGA 4G6LA 3A60A 5IUGA 2O64A 4PMSA 5FLFA 3ORTA 3VAPA 3R7IA 3AMBA 4OW8A 4FYOA 1O6YA 3BBTB 3OMVA 4JS8A 4H3QA 5LJJA 3TM0A 4TY1A 3N4TA 2OZAB 2PE1A 3BGQA 1OL5A 2OIQA 5AWMA 3UBDA 3CGFA 4FTOA 4F99A 3LAUA 3L8PA 3TNQB 4E8AA 1F3MC 4JR3A 5CY3A 4WG3A 5D1JA 2CKOA 3S3IA 2ERZE 1XH8A 2CN8A 2PVFA 3SG9A 5H8GA 2G9XA 2ZOQA 4DN5A 3E87A 4E93A 4D5KA 5CEPA 4B0GA 2VTTA 2YIWA 3PJ3A 3C5UA 3BWJA 3O96A 4I4EA 4IIRA 3UOLA 3VULA 4MTAA 3EIDA 4D4VA 1B39A 2F9GA 4FV7A 5E8YA 1E9HA 1JSVA 2J9MA 4EOQA 1OL7A 2IN6A 5F20A 3DFCB 4NJ3A 3ZHPC 3FJQE 4GKIA 4I5MA 5E90A 2WOTA 2W1IA 4UYNA 4YJVA 5AR3A 4DEHA 3OF0A 3V8SA 4YTIA 1YOMA 2WAJA 3KK9A 3LFSA 3MY1A 5KCVA 2WU6A 3EZRA 2EB2A 4Q2AA 2BFYA 3QQKA 1H1PA 4FI1A 4FKVA 3NPCA 1S9IA 4MBLA 4MCVA 2E9NA 3KXHA 2OIBA 4R5SA 4U41A 4EUTA 2NO3A 1WCCA 2V7OA 2BAQA 1ZMWA 3IQ7A 3R7VA 3ODZX 3NRMA 2C69A 2JGZA 2R3JA 2RKUA 3GB2A 4GJ3A 4GK4A 4RC3A 3TJCA 4O7LA 3DS6A 3OUNB 3NCGA 3LQ5A 3TKHA 2BPMA 3Q32A 5KMLA 4ZY6A 3E3BX 4NCTA 2OJIA 5DEWA 1WBTA 4U40A 3HVCA 4IANA 5KZIA 5BMMA 3PA4A 4M97A 5I9YA 3QTXA 3RBWA 3VBVA 4R78A 5EW9A 3BYSA 3DDQA 1PMUA 4A9SA 4C3RA 4DH1A 3IW6A 5HVYA 5HX6A 1TKIA 3UDBA 2QU5A 3QHWA 1FMOE 2ZB1A 2YM5A 3FY0A 5EYKA 3RCJA 2EXEA 4ANSA 3FKOA 2C30A 3ZXTA 4GVJA 2PVLA 3LXNA 3ORLA 3SHEA 2R64A 3UVRA 3W10A 4EH8A 4PPBA 3R04A 1H0VA 4CCBA 3HDNA 2GNJA 2QU6A 3FPQA 2YIQA 4KBKA 1XH5A 4OR5A 4KA3A 3RTPA 3QD3A 5HU9A 5TKDA 1O6KA 2ITTA 3HUCA 4RIWA 2DUVA 3E63A 2FVDA 2GS2A 2VO7A 4IEBA 4IAYA 4EH3A 4F7NA 1FOTA 2YM4A 5CZIA 1JVPP 4AU8A 3CC6A 3EN4A 4RWKA 4O38A 3QKKA 2H6DA 4NFMA 3LFDA 4XV3A 3DAJA 1WAKA 1YQJA 2GDOA 2IZRA 2XA4A 4AN3A 4OLIA 4W4VA 3R1YA 4BR3A 4FIEA 5DLSA 1HOWA 4FC0A 2IVVA 4YZMA 5ACKA 5C8MA 4O84A 4PUZA 4HPUE 4BDGA 4XHKB 4J96A 1HCLA 3PXZA 3EQBA 4AX8A 4YJNA 3EFLA 1M2RA 4BDJA 5IEXA 2PPQA 5KMOA 5C26A 2ITQA 4F9AA 3QD4A 3R00A 3U6JA 3MI9A 4I0TA 2HW6A 5HLWA 3SXRA 3HYHA 1ERKA 4O86A 4RIYA 3R1QA 3F5XA 3R22A 4RVLA 1KOBA 2JAVA 4E26A 1ZYSA 3ZBFA 3RAKA 4DGLC 3DLZA 2J6MA 1KE8A 2B7AA 4X21A 5GJDA 3VUHA 4EH9A 2ITYA 3DCVA 4GYGA 3FI2A 2GMXA 2PVKA 5DOSA 3BE9A 4FZAB 1Y91A 4F4PA 3ZUTA 3RCDA 2C5OA 2YZLA 4X6QC 3QF9A 5K4IA 3O2MA 4CEGA 3G0FA 5BVKA 2X0GA 4YMJA 4NWMA 2XK3A 1QPJA 2JFLA 3AD4A 4HW7A 3QLGA 2BRMA 3JY0A 4BDHA 2OZOA 2WMSA 4DBNA 4F7LA 3Q4ZA 2J5FA 3S95A 2PUIA 4RFYA 5C8NA 2GQSA 4RVTA 4AACA 1GZ8A 4YC3A 3VUKA 2BRGA 4XRLA 3C4WA 4DGOA 3HMIA 5JH6A 4R1VA 5K0XA 1FMKA 4A4LA 2I0YA 3U87A 4BCJA 3RALA 3A4PA 4ITHA 2GU8A 4DH3A 1KOAA 1OPKA 3D5UA 4TWOA 1ATPE 4GL9A 4BTFA 4M8TA 2ETRA 1JKKA 3A8WA 4RRVA 3IONA 3C4EA 5DR6A 5K3YA 2BAJA 4WSYA 3R8ZA 3UOHA 3TEIA 3F5PA 4IACA 3ZRKA 4F0IA 4FKOA 5J1VA 2NPQA 4FV5A 4X0MA 4AZSA 5CSXA 1T46A 2HOGA 2VTMA 2X81A 3SC1A 1YW2A 2W1CA 4U6RA 4HYSA 4U79A 2BROA 2ONLA 2W05A 3MFRA 2X2LA 2Z7RA 4X7QA 5BX0A 3BYMA 3S1HA 1STCE 3W32A 3BU5A 5IA0A 2GFCA 2X1NA 3RMFA 3LMIA 4XBUA 2B9FA 4AOJA 1K3AA 3U9NA 3ORMA 4C4HA 5K9IA 4D2RA 1G5SA 2UV2A 4K1BA 4YGAA 2ONLC 5BVOA 2JDOA 2J2IB 3CJFA 3MPTA 3Q5ZA 4C57A 3EHAA 4CFXA 3N51A 1SNUA 3K5VA 3HV7A 5EOBA 4FT5A 3RPVA 1H25A 4KWPA 4EWQA 3R7OA 2WO6A 5HNBA 2PWLA 2O5KA 3W2QA 4BI1A 1UKIA 4HVGA 3V5WA 4GMYA 3DNEA 4M69B 4ACGA 2IG7A 3II5A 2OG8A 4KSPA 1Y8YA 4YZ9A 5E92A 3UOKA 1H0WA 3T9IA 3AXWA 2B54A 3HLLA 5E1EA 3GU8A 5HG8A 4FV2A 4HGTA 4BKJA 4U80A 4IBMA 2DWBA 2RG6A 2R3FA 3PXYA 1OBGA 4OTRA 5C4LA 4BB4A 2BHEA 2J51A 1ZOHA 4BCFA 4R3RA 4F6UA 3P0MA 2HXLA 4YBKA 4IB1A 4L9IA 5FP6A 3Q52A 5AP5A 5C03A 4PV0A 4AZWA 5JZJA 4IZ7A 5GNKA 4OBOA 4O27B 3BEAA 3ORNA 4EK5A 4ZTQA 3V51A 3A8XA 5KUPA 5BUEA 2XNEA 4O0YA 1P4OA 4XP0A 5CEIA 5K5XA 1DS5A 3AT4A 1XH7A 1OL2A 2ITUA 3NZ0A 1GIHA 4FEWA 2VN9A 3KXXA 4XX9A 2SRCA 2Y6MA 3DKGA 3PE2A 3TNWA 2HAKA 3SD0A 4TWNA 4JX3A 3MBLA 4DFZE 3ZCLA 3CQWA 5DT3A 3KCKA 5DA3A 3WIGA 5EM8A 4O96A 2WEVA 5HTIA 5I5ZA 4S33A 4M68A 4YHTA 5T3QA 2ITVA 4DITA 3KN5A 3NUAA 2B9HA 1J1CA 3FKLA 4I5CA 3JVRA 4QMPA 4YPSA 4D55A 1ZMUA 2JDRA 1FGKA 4PF4A 5GJFA 2QG5A 2R3NA 5GZAA 4X2NA 2JBPA 2DYLA 3LJ2A 4TXCA 4WNPA 1W84A 2ETKA 4M15A 4HVHA 4FTLA 3FMJA 2AC5A 4D0XA 1UU3A 3UPZA 5GJGA 4BCQA 4KKHA 4MWHA 4DH8A 2PZYA 4H36A 2QD9A 3SXFA 4DGMA 4NW5A 3LJ0A 3HV4A 4DH5A 3PSBA 3WYYA 2A4LA 2Z7LA 3FAAA 4JQ8A 4PX6A 3EOCA 4CKRA 5FQDC 3MJ2A 4HVIA 4HCTA 4DFYA 5LVMA 2W1DA 3DXNA 3V6RA 4GG5A 2HZNA 2CNVA 1AGWA 4JIKA 2R3LA 3QC9A 1XKKA 4S32A 2Q83A 2ERKA 3KRLA 3WE4A 2PZRA 1GY3A 4CGAA 2R3PA 1YRPA 4DT9A 3NW5A 4IX5A 3LHJA 4IJPA 4OTFA 3HMMA 1DI8A 5CVHA 3LQ8A 4O1OA 1PMNA 4APCA 1NVRA 2H9VA 1UKHA 2G2IA 3GT8A 4UY9A 2IZSA 3B2TA 3R02A 3QLFA 2JLDA 4YNOA 3OFMA 4I41A 5LMKA 2P2HA 3GCPA 3QA0A 5CEMA 5CQWA 3L1SA 2OXXA 4TN6A 4LQMA 5DVRA 4D4RA 4ZTMA 4DFUA 4L3LA 3T3VA 2AC3A 5EI8A 3VS7A 3SGCA 1H27A 5M07A 1YI6A 4IX4A 4ZY4A 1Q24A 2PUUA 3ZZEA 3KMMA 1GZNA 2QLUA 2ITZA 4NH1A 4W4WA 3HEGA 3PJ8A 4WD5A 1H07A 3MFTA 4Z16A 3FMNA 3VBWA 4OBPA 3FSKA 4ZAUA 3SV0A 4BWPA 5LMKC 3CCNA 3OUKA 3WF6A 3FQSA 3KRXA 3Q04A 2R5TA 4IDTA 4XNEA 5M08A 4O2ZA 3RPYA 2FYSA 3MA6A 3EB0A 3DBEA 4EOKA 3MPAA 1MRYA 4YUQA 2BDJA 2QO9A 2PVNA 4MH7A 1Q8WA 2VTOA 5CQUA 3T3UA 2G2FA 1KUTA 4GU9A 2B55A 3SW4A 4FZDB 4U8ZA 3DK6A 4AS0A 1UWJA 2WGJA 4BY9E 4NL0A 3E88A 3UMXA 5JKGA 1V0BA 1OM1A 1QL6A 1SVEA 2QKRA 4OTWA 5J5TA 3QA8A 4NUSA 3F3TA 3WF5A 4FTNA 4QTDA 4RMZA 4MBIA 4BC6A 2VO6A 3U55A 3BYOA 4Q9SA 2BILB 4QMTA 3GCSA 5IDNA 5C4KA 1OIRA 5EM7A 4WKQA 3F66A 4A9UA 3P78A 1KV2A 4CT2A 4D9TA 3H9RA 5JFSA 4I23A 2VTPA 3FXZA 3C50A 4G6NA 3U8WA 1H1QA 3P7BA 1BYGA 3DAKA 5CX9A 3U6IA 2P55A 3TNHA 2UVZA 3BU3A 3O71A 4KABA 4YURA 4C4EA 4M7IA 4EYJA 4P7EA 3OROA 2C5VA 4RQKA 4Z55A 3TJDA 2YACA 2GFSA 5FBOA 5DI1A 2NNWB 3S00A 3EQDA 4EH4A 3LFNA 2I6LA 1G3NA 5E8VA 4PTEA 4WUNA 4YTHA 3V8WA 3IW8A 4RC4A 3ZDIA 3LE6A 5HE2A 4ANNA 5CAOA 4DTBA 3LMHA 4XBRA 3UYTA 3I0QA 1FVTA 4M13A 4DLIA 4FVPA 4J98A 4ZTHA 5CEQA 4D2SA 3DK7A 5JGBA 4P5ZA 3CTJA 3ORXA 2BRHA 1ZZ2A 4JG7A 4AF3A 1PXIA 1R0EA 2WFYA 4K77A 4C8BA 5G6VA 3NIEA 4A7CA 2QI8A 5AP2A 2F4JA 3KULA 4A9RA 4CKJA 2QC6A 5EQPA 5BVDA 3LM0A 4QMZA 2WXVA 2ZB0A 2R0UA 3BHVA 2WHBA 2P0CA 3FZPA 4Q5HA 1IG1A 4RJ4A 4AW0A 5JSMA 1PF8A 1Z9XA 2I0VA 3UQFA 1ZOEA 2YIRA 2VAGA 3CP9A 4KNBA 4UN0C 4YO4A 3D2KA 3A7FA 4O82A 3GQLA 4F1MA 5KMIA 4O7VA 4BN1A 5IQIA 4GT3A 3VIDA 4FL3A 4XJ0A 4EHEA 3F6XA 2G2HA 4ZJVA 2R7IA 5H2UA 3DXQA 4WHZA 2GNGA 2WQNA 3P08A 4HGLA 3WE8A 3NAXA 3OXTA 3QU0A 4FKIA 1OKZA 4K9YA 4QD6A 4UZDA 5AX3A 4QT1A 3LFCA 3F9NA 1WFCA 3RK5A 5ANDA 4IB0A 3EZVA 3NUYA 4YZCA 5L2TA 2P33A 2ZM4A 3UP2A 1ZAOA 2XNGA 5C1QB 2B0QA 3W2RA 5F1ZA 4E4NA 5L3AA 3IW5A 3OXIA 1CKPA 4O91A 4PDPA 2R3RA 1YOLA 5HD7A 3W8LA 3E7OA 1J7UA 1O6LA 4QP2A 1JKLA 2QLQA 2VTAA 3GFWA 3E62A 3KA0A 4JVGA 4LGGA 3BKBA 2PK9A 4ENXA 2CNUA 4E7WA 2OKRA 3NSZA 2J0IA 3LIJA 2ZV8A 3A61A 4AGUA 4RJ6A 2RSVA 2XIRA 4OTGA 4QP8A 3BGPA 3OCBA 4RBLA 5IEYA 5IQDA 2QKWB 3H10A 5ETIA 1UU9A 4FV4A 4BBMA 3MIAA 3MTLA 4UEUA 2OGVA 1UNLA 1JAMA 4LI5A 2XP2A 2BDWA 2QODA 4QMVA 3LXLA 4L00A 1XBAA 3KMUA 3QQUA 1LR4A 1ZZLA 4EBVA 4CG9A 3V01A 3OWJA 3UQCA 4B8LA 2NRYA 4XP2A 3V6SA 3U9CA 4AA5A 3R63A 3SOAA 4O83A 1LEWA 4C36A 3ATSA 1Z5MA 3CE3A 4MNFA 3WZDA 1G8AA 1JOWB 3JS2A 3OEFX 4OTPA 5L2QA 3BBWA 2OU7A 3TI1A 5J5SA 4AT5A 2ITWA 4ZY5A 2IPXA 4GU6A 4BDAA 1WBSA 1M7QA 2VTRA 2C3KA 4AQCA 2Y9QA 1PXLA 4ZSLA 4R5YA 1ZRZA 2W06A 5FXSA 4QTCA 4BTJA 5IUHA 3ROCA 4JQEA 5K4JA 2BALA 3HGKA 3PVWA 4F9YA 4GJ2A 2UW6A 1ZYLA 4BBFA 3ZO4A 3FI4A 1WBOA 3GEQA 5EOLA 5DH3A 3AD6A 4J95A 4OTQA 3WYXA 1NXKA 4ACMA 3PWYA 4QQJA 2ZMCA 3JY9A 2E9VA 5TF9A 1H1WA 4PWNA 4TYHB 2Y6OA 5AP6A 4FR4A 3F82A 3FDNA 5DGZA 4FT3A 2WTJA 2A1AB 2BZJA 2VX0A 4BDFA 3AGLA 2XM9A 3A99A 4MAOA 3WARA 3QALE 1DAWA 3GC7A 4FL1A 3ZOSA 4C2VA 2YITA 3TUDA 2OF2A 3TKUA 2BKZA 1DI9A 4BF2A 4GUBA 4JBVA 5DWRA 4BCMA 4BTMA 1Y6AA 2H96A 2PMLX 4O0XA 3HX4A 2ACXA 5DNRA 1AQ1A 4L53A 3FLQA 2C3JA 3O0GA 4EHZA 4X2KA 5H3QA 3PP1A 4PY1A 3ZM4A 4X2JA 2ZDUA 3G6HA 3G0EA 4H3PA 1OGUA 4IFGA 4RJ3A 3CEKA 3QL8A 2Y8OA 4MD9E 5AP4A 5EFQA 3E7VA 5D10A 5GZ8A 2YLEA 3CLYA 4XLVA 1XH9A 3R6XA 3TNPC 3QRIA 4X3FB 2CGUA 5KE0A 4JQ7A 4HJOA 4BIBA 4JAJA 4DF3A 3B8RA 3KQ7A 3VS5A 2BDFA 2YLFA 1GIIA 3ZSIA 5J95A 4F63A 4KBAA 4GG7A 4XG6A 4FTTA 2UW4A 2HY81 2WD1A 1JPAA 4FIHA 2I0EA 3W2PA 3NR9A 5BVNA 3DNDA 5CNNA 5CXHA 4FT9A 4FZFB 1WBWA 4OTIA 3QKLA 1URWA 4NJDA 5EW3A 4ZLYA 3OT8A 4I6FA 4O7ZA 3WZUA 3F3UA 4DT8A 3PJ2A 2ZV2A 2WTDA 3OOMA 4NM7A 3T9TA 3GCQA 4QQTA 5HIDA 3FMMA 1OPLA 4PPCA 4QP6A 1ZWSA 1BUHA 1T45A 3DJ6A 3MW1A 3PY0A 2KULA 1WMKA 4FF8A 1V0PA 5D41A 4USEA 5LVPA 1R39A 2HYYA 4DEBA 2GS7A 3QX2A 1M2QA 3UZRA 5T6KA 4U43A 3C5IA 4FA2A 3GOPA 2J4ZA 3VUTA 4A07A 2RF9A 4HYIA 4RZVA 2W7XA 5IQFA 4AW5A 3NX8A 1DM2A 3ROYA 4M0YA 4FVQA 3RWPA 3UODA 2B52A 3D5VA 4XV1A 4BCIA 4AW2A 3EL8A 2F57A 2FO0A 3FYKX 4GEOA 4G31A 5E7RA 3ZU7A 4EEVA 2IW8A 4U3YA 2C5XA 3KRRA 4MKCA 4QMUA 3VN9A 3WZEA 2GQGA 3G15A 5DFPA 1R0PA 1REKA 1IAHA 5EDRA 3PDTA 4M3QA 1Q5KA 3EQPA 2VWWA 4LGHA 4JI9A 1H28A 1W83A 4YR8A 4BGHA 1UVRA 4L8MA 4P5QA 1FBNA 1X8BA 3CD8A 5IQEA 3GENA 1ZYCA 4FG8A 4QP7A 3R2YA 3SRVA 4FTKA 4M14A 1BL6A 4MD7E 5CT0A 1U5RA 3VS2A 1KV1A 4W4YA 4GT4A 3N4UA 3L9LA 2DS1A 4FIFA 5D7AA 2WMAA 3WBLA 3V5JA 1QPCA 5E8XA 4L7FA 3I4BA 3R9NA 4HYUA 2WTVA 5AM6A 4PPAA 3PJCA 4CV9A 2HZIA 4PL4A 4RJ7A 4AZTA 4CZUA 1P5EA 2F7XE 5J8IA 2X8IA 5JT2A 4NKSA 3MESA 4FKGA 1UNGA 5KMNA 3PZHA 3QCQA 2V62A 3S2PA 5HZNA 3CSVA 1OKYA 4LM5A 5ANKA 3R9OA 4H58A 3UG2A 3IGOA 4XG7A 3R01A 1UU7A 3MYGA 3ODYX 5AAFA 4C35A 4B99A 3PP0A 4G16A 4L52A 2F7ZE 4EQUA 2BMCA 2C4GA 5A14A 5HLNA 2CJMA 2CNQA 1IR3A 3UO6A 3LCDA 5F94A 5CU3A 3FEGA 3QRJA 4BDCA 1Z57A 3MGYA 3EMGA 3L8XA 5DR2A 3L9MA 2J90A 2R3QA 2YZAA 3PFQA 4FKQA 3TV4A 3O8UA 2IJMA 3Q9XA 4J97A 3QRTA 4D9UA 4LL0A 5JFXA 4E5BA 3TXOA 1ZMVA 4IVCA 5CU2A 5L6PA 2X8EA 2F2CB 4F6SA 4AN2A 5LMBA 3MH2A 5CZHA 5ACBC 3BGZA 3CTHA 3ZSGA 3VQUA 4RIWB 2UZVA 1WBVA 4O2PA 5I9WA 1OI9A 4E6AA 1U54B 1A9UA 4FSWA 1IEPA 4G3EA 4EOOA 4PMTA 5E9EA 4QPMA 4QMSA 2VWYA 4EWHA 5FDPA 2CKEA 2QURA 2WTCA 4U7ZA 4AT3A 1B38A 4NCTC 3NUUA 2YCSA 1XR1A 2BRNA 2W5BA 3Q2MA 3PRFA 3QKMA 2OK1A 4JT3A 4QYEA 4RLKA 3TIYA 3TIZA 4BDDA 1SNXA 4IC7A 3LLAA 3PIXA 3FLSA 2V7AA 3NNVA 4AN9A 3R71A 3GU5A 5DBXA 3UNJA 3ZO3A 1H00A 5K5NA 1VJYA 4N70A 5KMMA 4IDVA 2OO8X 2X2MA 3DTCA 4ZTRA 4DTAA 4RIYB 1MQBA 2CKPA 4K0YA 2QOOA 4ORKA 4PP7A 2O63A 1U54A 4YHJA 4ASZA 5J7BA 3LFQA 1FPUA 1CSNA 4JNWA 4LMUA 2XNMA 3AC5A 3OXZA 3BHHA 3R30A 5HICA 4AGWA 4YLJA 4EK3A 5JRQA 2BTSA 2XJ2A 4ALVA 4CRSA 3KXNA 1ZY4A 2IZUA 4J1RA 4N6ZA 2YM6A 3CIKA 4PRJA 4O0TA 5C27A 5CEOA 2YDJA 2ZJWA 4WBOA 3RVGA 3QXPA 2XEZA 3AC2A 3VUIA 2JITA 3GC0A 2QHMA 2HCKA 2O3PA 5AMNA 3G2FA 4PDSA 3LKMA 1YOJA 4JOAA 4DA5A 3GVUA 4KUJA 2OWBA 5BYYA 4UB7A 3QHRA 4I0RA 3VUGA 5HX8A 3O50A 5HBEA 1Y8GA 4BIDA 5CU0A 4YLLA 3RHKA 4EC8A 2C6TA 4DCEA 4QYGA 4X2GA 5GZ9A 2OXYA 3LXKA 2RGPA 5CU4A 4MNEA 1SMHA 1SZMA 2QOIA 3DBQA 3F69A 3DU8A 3ITZA 4IZ5A 3OWLA 3CY3A 4IWPA 4L44A 4ZS0A 3PSCA 4F9CA 4JDHA 4QYFA 4EH5A 4YC8A 2YM3A 4QYHA 4DCAA 3FL5A 2C5NA 4Y85A 3VBQA 5JZNA 3ZH8A 3MVLA 3FZOA 3QAME 4QPSA 3FC2A 4E6DA 4FSRA 2UZBA 4OGRA 4EOIA 4E73A 4E6CA 3COKA 2YAKA 1ZY5A 3E92A 5HKMA 4NTSA 4HGSA 4JBOA 3VS6A 3WZKA 4QTEA 3QRKA 4K18A 2IO6A 2HXQA 1WBPA 3TTJA 4TTHB 4IJ9A 3GI3A 4LUDA 4RJ8A 4ITJA 5J9LA 5I4NA 3F2RA 3RINA 3AG9A 4JLCA 1YHVA 2W5AA 3NIZA 1PXMA 3GCUA 3QQHA 1PW2A 5CU6A 3S4QA 3W2CA 3PXQA 2QR8A 3DKOA 3O7LD 2BCJA 5FTGA 4GV1A 5JGAA 1MQ4A 4MYGA 1JWHA 1HCKA 1H24A 1YXVA 2UW5A 4IM3A 4HZRA 3QFVA 2GHLA 1H4LA 2CGXA 4G3FA 3AMYA 3CXWA 5HIEA 2OJFE 5HQ0A 4MWIA 5FD2A 5HG7A 4C34A 2R2PA 5AV3A 4EH7A 3OP5A 2XK8A 3KY2A 3LFEA 5B7VA 3L9NA 3BCEA 3PZEA 3NNUA 4O7SA 2F2UA 2ZV9A 3IKAA 3QZGA 3MWUA 4RFZA 4MVFA 4RT7A 3ZFXA 5IG1A 5JEBA 3A4OX 2ZAZA 3W33A 2BZIB 1UV5A 4U42A 4DEDA 3KN6A 4FVRA 3C51A 5L2IA 4D28A 4W9XA 4F1TA 4DEAA 3ANQA 1A06A 3WI6A 1VYZA 4UMUA 4I1ZA 2YM7A 3R8MA 2IW6A 2PVJA 3TL8A 1CM8A 2R3MA 4H1JA 5LVOA 3I60A 4R7BA 2JAMA 2XB7A 5M4FA 2WMRA 4H05A 3D4QA 4QTAA 3DBDA 2WTKB 3DV3A 3DTWA 4IXPA 4Y73A 4FK3A 2Y0AA 3D5XA 4O21A 4RC2A 2OLCA 4ANOA 4GS6A 5F9EA 4C2WA 4I0SA 5CI7A 5IA5A 2WMVA 1RDQE 2QOLA 5ICPA 1Q62A 3DQWA 4ERKA 1PRYA 1YXUA 2HW7A 2PZPA 2C6LA 2UZWE 4JRNA 3OHTA 4N0SA 5DHJA 3SX9A 4WNMA 3VRZA 4PNKA 4TZRA 3QC4A 5HVJA 3R9HA 4FICA 2B53A 5L8LA 3HRFA 3FZSA 5HE0A 4ZS4A 3MA3A 4PNIA 4MXYA 4O0UA 4O22A 3Q3BA 2UW7A 3FXXA 3Q9ZA 3E8NA 3QGWA 3R9DA 4USFA 3PY1A 4TPTA 1OVEA 3HP5A 3HZTA 3KRJA 3ZLXA 3COHA 5LVLA 4YJQA 5L2SA 4FGRA 3BHUA 3ETAA 3BEGA 3C0IA 4MF1A 2H34A 3DZOA 3G51A 4WT6A 5CAQA 3HUBA 4Y83A 4RGJA 3RPSA 1M2PA 3CQEA 3HDMA 4DTKA 4E1ZA 3QQLA 4BCOA 2GHMA 4MEDA 1WBNA 2VTIA 3OZ6A 4BGGA 1YHWA 2I0HA 3NUSA 4LV8A 5EYCA 4QMOA 1WZYA 4WG5A 3UIMA 3ZUUA 4AUAA 2W9ZB 3ULZA 2WTKC 3HMPA 3R28A 4CFWA 4U97A 2FSTX 3A7HA 3DLSA 1W82A 2VV9A 3NLBA 4XCUA 4S34A 3LQ3A 3GXLA 3P79A 5TT7A 4E5AX 4RX5A 5AV4A 3V5TA 3BRBA 4KKEA 1Q61A 4L3PA 3RJCA 3QBNA 4LV5A 3CR0A 2W1FA 2YAAA 4QQ5A 4BKYA 4DFBA 3GC8A 1LUFA 3OT3A 2C6KA 3ORPA 3FI3A 3ZDUA 3TUCA 2OBJA 2Z7QA 4FTCA 4R6VA 1OBDA 3ACKA 4GSBA 1NT2A 1UA2A 3VBTA 3C4FA 3JVSA 4A9TA 3PYYA 4C59A 3FBVA 4IZYA 4Y72A 2OJGA 4DGGA 3KU2A 4TYEA 2WQOA 3QCSA 2HK5A 2VX3A 4D58A 3ZLSA 1NA7A 2XJ0A 4UWBA 4LG4A 2PUNA 4ZMEA 5AAGA 3CY2A 2PMIA 2YERA 4G1WA 3RNIA 4PP9A 4EK6A 5AA8A 3NUNA 3HA8A 4NM0A 5CVFA 3ZZWA 1VEBA 4JL9A 2CLQA 3NEWA 3HV3A 3KXMA 1WVWA 4H3BA 3TN8A 5CAVA 3HAMA 4UBAA 3OBJA 4E3CA 2VTSA 4Z9LA 3NW6A 3WILA 5A4LA 3RWQA 2ITOA 5JQ8A 5EQEA 3ID6C 1O9UA 3GFEA 2UVYA 2XNBA 1F0QA 3C4XA 4O7TA 2PVHA 3BHTA 4LRJA 4RVKA 1KE6A 2XRWA 5AR5A 5D7VA 1XHAA 3DKFA 2CDZA 3KL8A 3FWQA 4JR7A 4KIPA 5D9HA 1PY5A 2WMBA 3CJGA 1CKIA 3PPJA 4FSYA 4A06A 4ASEA 1PXKA 5HNIX 3EFKA 4RPVA 5FBNC 1MRUA 4BZNA 3TACA 4FEXA 5AUXA 5AA9A 2WZJA 3KVXA 4QP1A 4EHVA 1GJOA 2UZLA 4O0RA 5L6WL 5M56A 2WQBA 3QTWA 5L2WA 4DBXA 2W5HA 3DK3A 2CGWA 4GIIA 4ZP5A 4EKKA 4G2FA 1PMVA 3VC4A 5M06A 2OJ9A 3QTZA 4MXXA 4QMWA 5HIBA 4LUEA 4OT6A 5BMSA 3LM5A 4FEVA 4RG0A 5LWNA 4QO9A 1QCFA 3H9FA 1GZOA 3VF8A 4C4IA 3PXKA 3VNTA 3D7TA 4KB8A 3RK7A 4FIJA 3ZRMA 4V0GA 3WF9A 1H1SA 3M1SA 5H9BA 4JBQA 1XJDA 3A7JA 4HCVA 3OCSA 4J52A 4J99A 1YWNA 5ANJA 4IWDA 5TE0A 4USDA 1KWPA 4V05A 5HCXA 4KBCA 2E9OA 2OI4X 3PWDA 3QQFA 4I5PA 4CMOA 2GTMA 3TT0A 1NVSA 4R8QA 3P4KA 4OT5A 4FKTA 2WTIA 5DEYA 3I0OA 5AX9A 3UNZA 1RE8A 2XH5A 4S31A 4UWCA 3RHXA 3HKOA 2XVDA 2IVTA 2HY0A 3Q6WA 2JDTA 4LRMA 4XV9A 3C0GA 4B7TA 3HRBA 5FM3A 5I0BA 4PTCA 2UZDA 5A4TA 2FH9A 3HV5A 5HCZA 4AFJA 2W0JA 4D0WA 4G9RA 2J0KA 5IQHA 1RQQA 5K0KA 3Q4CA 1YXTA 3KULB 3O51A 4L3JA 4Z3VA 2PSQA 2XZSA 3NW7A 3R2BA 4RIXA 4RQVA 2QOQA 3TZ7A 1H08A 2OJJA 5LCJA 3I1AA 3ET7A 2PVRA 3FMLA 3BE2A 1R1WA 2VTHA 5AP7A 5HTCA 3DGKA 4IAKA 2PZIA 3UVPA 2HZ4A 4C4GA 2GHGA 2UW9A 2VWXA 4FG9A 5HG5A 3EQRA 1JKTA 3QZHA 3E8DA 2WB8A 3MPMA 4FV1A 3SXSA 4QNYA 5J7HA 3LZBA 4KIOA 5H8EA 5HVKA 3F3WA 5GINE 3C7QA 5EI2A 3GQIA 4EJNA 3ZFMA 2WU7A 2VNWA 2E9UA 4ENYA 5FM2A 5EHYA 4DHFA 4IWOA 2VX1A 3EN9A 5M57A 3FZTA 2R0IA 4ZXTA 5HG9A 3BLRA 2P2IA 5M4CA 5HORA 2ITPA 2C3LA 4Z7GA 5IZFA 4PDOA 2BZKB 3I7CA 3W1FA 5IMXA 3DA6A 5AJQA 5KHWA 3FUPA 3D7ZA 4KKGA 4NKAA 3WF7A 3MJ1A 2YWVA 4JX7A 3DXPA 3BPRA 1Q4LA 3BLHA 2PVMA 3O8TA 4DEEA 4FZ6A 4CRLA 5CAPA 4A4OA 4RA4A 4TKSA 4XS2A 3TV7A 3PSDA 2WMXA 5FGKA 3MY0A 3LOKA 5C01A 3EL7A 1RJBA 4F1OA 4FNWA 3FY2A 2BKKA 1E1XA 3R73A 5HBHA 5C9CA 1V0OA 4E5WA 2BUJA 2X7GA 2XRUA 4I21A 3KKVA 3PIZA 5DT0A 3UVQA 4O7YA 3UNKA 4W9WA 4C02A 1REJA 1CKJA 2Y7JA 3QTUA 3DB8A 3ZEWA 4CG8A 2PL0A 4EKLA 4GFGA 2E2BA 2RFDA 4ZLZA 5HCYA 3Q2JA 3COMA 3FXWA 1NY3A 1JSTA 4UMRA 1W8CA 3IPHA 3TUBA 3DAEA 3QQGA 3DOGA 4X6RA 1PYEA 4I6HA 4MHAA 3NWWA 3U4WA 4N6YA 2CKQA 4C7TA 3SA0A 5F95A 1S9JA 2J5EA 3R9RA 3QUPA 2EWAA 4PL5A 5F4NA 4LL5A 2QNJA 3CPBA 3I6UA 3MFUA 5TOZA 4QP4A 4UZHA 3O17A 5I9UA 3PTGA 4G5JA 4JDIA 4I4FA 3OEZA 1U46A 3RM6A 3ORKA 2W1GA 4J71A 2YJRA 4HVDA 4FKRA 4OUCA 3JPVA 3PA3A 3PUPA 4BDKA 3EJ1A 4FYNA 5E8TA 4CFMA 4D4YA 5A4QA 4NZWB 4TWCA 3SDJA 4V04A 4F65A 3VS3A 5CANA 3AMAA 1KE7A 2A2AA 1EH4A 4ZZNA 3QX4A 1I44A 2YDIA 4XUFA 2BIKB 4BRXA 1BI7A 1UWHA 3POZA 3DB6A 3FYJX 4UMTA 3OC1A 2QOCA 5M09A 2WMTA 3CKWA 4ALUA 5ITAA 4U81A 3VBXA 2GNLA 4JDKA 4NM3A 5ANGA 5AR8A 2W1EA 4F7SA 4GCJA 2XKEA 4IB3A 5A54A 4MXZA 4LOQA 2QCSA 2XYNA 5HGIA 2VWZA 4AW1A 2G15A 4FKLA 1K9AA 2QOHA 4HCUA 4I6QA 4NFNA 5IQBA 3R7YA 3P7CA 2WTWA 1CDKA 4A9YA 1P2AA 2VTLA 3ZSHA 3NDMA 5HOAA 1PKDA 3VBYA 2QO7A 3KC3A 3QTQA 4XYFA 4IFCA 4CQEA 2IW9A 3POOA 4DEIA 3FLWA 1BI8A 2X6EA 2O8YA 4QMMA 4ID7A 2X6DA 1KSWA 3BX5A 3W18A 4FNZA 3RGFA 4EOMA 4NYEA 3EN6A 4BYJA 5J9ZA 4LYNA 4TRLA 4BHZA 4MK0A 4ZTLA 3I5NA 5AP3A 5G1XA 4IVBA 4FUYA 5KX8A 4W4XA 3QTSA 4YU2A 3HMNA 4YTFA 3NCZA 3KGAA 4BBEA 4IM0A 1FINA 2C6DA 4DFLA 1PMEA 4F70A 1IRKA 5EQYA 4L43A 3UYSA 3FMHA 4IM2A 4IZAA 4YJOA 5E91A 4X3JA 2B9IA 2XKCA 3VF9A 5TR6A 3UTOA 5L8JA 4EZ7A 1R78A 4JJRA 2GPHA 3DY7A 3H3CA 3O7LB 2RFNA 4C3PA 4G3DA 5HU3A 3RM7A 5IQGA 5AUVA 3RI1A 4XP3A 2JEDA 3DKCA 1TVOA 2PHKA 2QO2A 2GNIA 5EYMA 4FEQA 1YVJA 4AA0A 2R9SA 3P23A 2VWVA 4LGDA 2X2KA 4CTBA 2E9PA 3LMGA 3CS9A 5DT4A 4FNYA 3F61A 4XG3A 3LXPA 1H1RA 3NVKI 2ITNA 3CQUA 4EYMA 3QCYA 5JRSA 2GS6A 5T68A 4GK3A 4I6BA 4CYJA 4WG4A 3D83A 3K2LA 3K3IA 3R7GA 4L42A 2YM8A 4CZTA 2XK9A 2O2UA 4QNAA 4GT5A 4BTKA 2C0OA 3MB6A 4FODA 4DINA 4YSJA 5M4UA 3HAVA 3OVVA 3TWJA 2W4KA 3BZ3A 4BI2A 3BLQA 3VS4A 5J1WA 2PTKA 3SRVB 1M14A 2OIDA 5HI2A 1XH6A 4NK9A 4AE9A 5I3RA 1GZKA 4AG8A 3GU7A 1MRVA 5B2MA 2FB8A 4FTQA 3RKBA 3OS3A 1YHSA 4WOVA 2X9FA 2P4IA 3UO4A 4MF0A 4IAAA 2OXDA 3R7UA 5M4IA 4CTCA 4O0VA 5B2KA 3IDBA 3B2WA 3DBCA 3KFAA 3LPBA 4U0IA 4WA9A 5AP0A 4EZ3A 1W7HA 4G5PA 2Y4PA 3TDWA 3QCXA 4F0FA 1P4FA 4KIKA 3UG1A 5D12A 3R8VA 3PVGA 4IE9A 2I1MA 2JC6A 4MBJA 3UC3A 4U9AA 5CF5A 5CF6A 4GFMA 4CLJA 3EFWA 1K2PA 4G34A 5BUJA 3EH9A 4BWXA 5E8UA 3EQCA 4O0WA 5BVEA 3RPRA 5J9YA 3QTRA 4R3PA 4N4SA 4DH7A 4E6QA 4KRDA 3AQVA 4KD1A 4QMXA 5KMKA 3NMUF 1PJKA 1J7IA 2W96B 3AT2A 4RX9A 5M51A 1JQHA 2FUMA 2XCHA 3W2OA 4ONAA 1F5QA 2OH4A 4TNBA 2FSLX 3IK3A 4WSQA 3OWPA 2O0UA 1U59A 2XUUA 4QMQA 3OY3A 4EOJA 1IASA 2YDKA 3F5GA 3D0EA 5EM6A 2Y4IC 2B9JA 3FMDA 4BWKA 4DAWA 2R3HA 4ZSAA 4AOIA 3TZMA 4P2KA 4X2FA 1YDSE 2OFUA 3FL4A 4TYJA 4BL1A 4CFUA 3F2NA 4CMUA 4YTCA 3K54A 3SQQA 2BFXA 4U45A 5LVNA 3IW4A 1BMKA 4E4LA 4CFNA 4CZYB 3FHRA 1Q8ZA 3HA6A 4FMQA 3V5LA 2C1BA 3BHYA 4BCGA 4QQCA 4Y95A 4ZMFA 2HZ0A 2V55A 3IOPA 4JG8A 5FXQA 3THBA 3ZTXA 2X4FA 1J91A 4J8MA 5ETFA 3U54A 3LJ1A 3UQGA 3UZTA 4I24A 2OICA 3TDVA 5EHOA 1OKVA 3CPCA 5A4EA 4GRBA 4DE4A 4ZOGA 4FT7A 2IVSA 1VR2A 4XLIA 2XMYA 3MIYA 4W8EA 4BFMA 1APME 4CYIA 3CKXA 4YSMA 4IW0A 3G6GA 3V8TA 1OPJA 4CCUA 3FHIA 2VO0A 4R7HA 1PXJA 1TQIA 3VQHA 3E64A 2UW8A 4QPAA 3FQEA 3QYZA 3EN5A 3CBLA 5CF4A 1UU8A 3UJGA 3UPXA 2OZAA 4FV6A 5H8BA 2IWIA 1NW1A 5I9XA 5IF1A 2V5QA 2RIOA 3Q6UA 2Z02A 3UZPA 4D2WA 5CSHA 3C4CA 4C3FA 3UO5A 4FT0A 3VUMA 2EU9A 5IA2A 2F49A 2PUPA 5M53A 2C6OA 4FV9A 3TV6A 4XH6A 2JIIA 2WEIA 4IB5A 1OB3A 4XMOA 3ZLWA 4DG0E 3PLAE 4RX7A 2I7QA 4JIAA 4MX9A 3KF4A 3VW8A 5ANOA 2REIA 3KREA 1OZ1A 2YISA 2W9FB 2YA9A 2OFVA 2PULA 2GSFA 1U4DA 1LP4A 2XBJA 4YLKA 1XBBA 2OH0E 1BL7A 3IOKA 3ZONA 1U5QA 2X9EA 5J87A 4WNKA 4ALWA 3MN3A 4WRGA 3ELJA 5GHVA 5IMEA 3PRIA 5E8ZA 4CLIA 4RX8A 5HD4A 3NAYA 2J0LA 2YCFA 3PPKA 4MNEB 1YXSA 1SYKA 2C3IB 3QTIA 4L45A 4MXCA 5FEDA 5KZ0A 3MVHA 5I9VA 4FTIA 1OITA 3DBFA 4ZTNA 3ZXZA 4MD8E 3PVUA 4CQGA 2VTQA 3R1NA 2GCDA 2W4OA 4G6OA 3HECA 3QZFA 4XG8A 2JDSA 3BELA 4GYIA 2X39A 3Q4TA 3VVHA 1BKXA 3I81A 5LOHA 3TKIA 1YDRE 1QPEA 2XF0A 3PG1A 2QONA 3G5DA 4PTGA 5CYIA 2PE2A 3IW7A 4D2TA 3QQJA 5DG5A 4EOSA 4M12A 2JFMA 2XEYA 4K6ZA 1IA9A 3I5ZA 3MH1A 4RIOA 3VHKA 2WMUA 4EOLA 1GNGA 4OTHA 4YBJA 3GCVA 3NYNA 3ZM9A 1Q8TA 2PVYA 1QPDA 2PMOX 5AV1A 1B6CB 4RZWA 4NM5A 3HP2A 2YIYA 3N4VA 4BIEA 2J0JA 3AT3A 3UE4A 4NTTA 4W8DA 1Q3DA 2A0CX 2QR7A 4G9CA 2R3GA 5FUTA 2XS0A 5AUTA 2F7EE 4ERWA 4E4XA 3EQHA 5AP1A 2BZHB 1XH4A 2XIYA 5E4HA 2ZMDA 4K2RA 4TYGA 4OAUC 5IUIA 3F5UA 3V5QA 1W0XC 2H8HA 2VTJA 4GH2A 5JN2A 4PL3A 4QMYA 5HNGA 1H01A 4ANQA 4Y5HA 4AT4A 5IEVA 3MVJA 1CTPE 3NUXA 4CNHA 3R83A 4IMYA 5L8KA 3VJOA 4FX3A 3ERKA 4L01A 4I93A 3IG7A 3QXOA 5L4QA 5EKOA 4ACCA 4Z7HA 5KBQA 4EORA 4M67A 5M55A 4UV0A 1YDTE 2YCRA 3JYAA 2UZEA 1GOLA 3K3JA 3D9VA 3ULIA 3DFAA 1CMKE 4DFNA 3M11A 2UZTA 2BIYA 4U44A 3RP9A 3RZBA 2PZ5A 3Q4UA 3OTUA 4I94A 2JDVA 4GFOA 4L46A 3OCGA 4YZDA 5A6OA 2VTNA 4YJSA 5EG3A 4FTRA 2WOUA 3KVWA 1L3RE 4BYIA 5FEQA 1R3CA 3KRWA 2FSMX 5HLPA 4IHPA 2UZOA 4KINA 4B9DA 4F64A 1YKRA 1WVXA 4RWLA 4BI0A 3FZ1A 4DG3E 2XIKA 3FLNC 2R3OA 4WNOA 4LRKA 2BVAA 3Q60A 3DJ5A 1OKWA 4APPA 3PG3A 3Q96A 5BVWA 4O0SA 1SVGA 3R8LA 4ANLA 4JG6A 5DN3A 5AR7A 5AUUA 3VS1A 3KMWA 2G1TA 3BV2A 2UW3A 5D11A 4D1SA 3OTVA 4FSUA 4C38A 4BCNA 1E1VA 5CTPA 3QWKA 4LOOA 3QD0A 3NVMB 1BX6A 4AFEA 4IWQA 2XKFA 4MXOA 4O7RA 4LFIA 4RJ5A 4JBPA 3F3ZA 2R4BA 2VUWA 1VZOA 4OBQA 3H0ZA 4FGBA 5JFVA 2UW0A 4U5JA 5FRIA 4ZEGA 3QGYA 4XEYA 2KTYA 3TG1A 4NSTA 4JXFA 5BQ0A 3QYWA 5AUWA 4Q9ZA 5CSPA 1PXNA 4ZLOA 1ZARA 1BLXA 2PMNX 4XRJA 4O7WA 2CCHA 3B8QA 3V5PA 3VW6A 2XM8A 4YJRA 2R3KA 5FTOA 5GIOE 3FPMA 4KIQA 3PE1A 1OMWA 2J0MB 4GW8A 2HELA 4AA4A 3P86A 4O81A 4YP8A 3C0HA 5IQAA 2AYPA 2VNYA 5AUZA 3ZMMA 4CFFA 4E20A 5L6OA 3MSSA 4CD0A 3PXRA 2XNNA 4AZFA 1XWSA 5DYJA 4UMPA 2WQEA 3KK8A 5AR2A 2EB3A 4K11A 3AC4A 2A27A 2Z7SA 4EI4A 3GC9A 5BPYA 3LW0A 3BIZA 4M0ZA 2YIXA 5EM5A 4D4SA 3ORIA 3GU6A 4B4LA 5EDPA 5CVGA 4EQMA 3BWFA 2C0IA 4NEUA 4RA5A 4F08A 3R8PA 4C33A 3EQIA 2VGOA 2WQMA 3FLYA 1M52A 1OUKA 1V1KA 2YHVA 4H1MA 3V3VA 3WZJA 2DQ7X 4EONA 4J8NA 4AXAA 4QOXA 2GNFA 3MY5A 4I20A 3RZFA 1GAGA 1ZYJA 4FTJA 3SG8A 4ZZMA 2XCKA 4GIHA 2XIZA 4EBWA 2X4ZA 4M69A 4H39A 5DIAA 4DC2A 2ZDTA 1IA8A 5J79A 2ETMA 2Z8CA 2Q0NA 3FC1X 2QVSE 4AAAA 5HESA 5CASA 2IVUA 4F6WA 3BQRA 4WUAA 3D5WA 2XBAA 2CSNA 5KMJA 3HL7A 2ITXA 3LFFA 2W99B 3EKNA 2EXCX 4GVAA 3D14A 5HEZA 4BDEA 4UX9A 2WNTA 5CENA 3W16A 4EQCA 4XOZA 2A19B 2WIPA 2XNOA 3OOGA 4FL2A 4E4MA 4L6QA 3UMWA 4BHNA 2CPKE 4XG4A 1Y6BA 4DG2E 2B1PA 5JK3A 1J3HA 4ZTSA 3C4ZA 3OBGA 4P4CA 4BICA 4FTAA 4BDBA 4YZNA 3LCSA 1JSUA 4NU1A 4C4FA 1XO2B 4D2PA 3R7EA 1Y57A 2JD5A 3MH0A 4WBBB 4TW9A 5CAUA 3A2CA 2LGCA 2V0DA 3FLZA 4Y5QA 4ZSGA 2JBOA 4RVMA 4ASDA 5A4CA 4FEUA 2Z60A 4I92A 4ZJJA 3IS5A 4IQ6A 3RAIA 3RAWA 5EHLA 4QMNA 2XK7A 3DT1A 2C47A 3PLSA 4J7BA 4XOYA 4RFMA 1I09A 1FVRA 2X7FA 2W1HA 4RSSA 3UIBA 3D7TB 3ZFYA 4ACHA 4D1XA 4FK6A 4V0GB 5DE2A 4CT1A 4EC9A 3P7AA 2VRXA 4HZSA 3ACJA 3SKCA 1PKGA 3I6WA 5IH4A 3IECA 2XJ1A 4FIIA 2WPAA 5HE3A 2P3GX 1M7NA 2QHNA 5JGDA 4I5HA 5EKNA 4CSVA 4DYMA 4IAZA 4O1PA 3QRUA 1URCA 2RL5A 3P1AA 4FOBA 4YZBA 3F2AA 5IH6A 4C61A 1YWRA 1Q8UA 2NRUA 4I22A 5E8SA 3EYGA 1OIUA 3F7ZA 3IDPA 5CXZA 4K33A 1PXPA 3KB7A 4IX3A 4BCHA 2BHHA 4J53A 4C4JA 1QMZA 4EK4A 5IQCA 2CLXA 4V01A 4IVAA 5FEEA 2GQRA 4FNXA 4EUUA 2EUFB 4YC6A 3GU4A 5LARA 4AGCA 3U6HA 1GIJA 4FKUA 3OW3A 2FA2A 3FQHA 4R3CA 4RIXB 3KCFA 5LMAA 2C5YA 2FGIA 4ANBA 1ZOGA 2CHLA 3NS9A 3LVPA 3M42A 5HHWA 4GK2A 3UOJA 3TCPA 2VWUA 4FV3A 1J1BA 3U4UA 2YCQA 4HOKA 4K8AA 4R7IA 1YI3A 3MB7A 2WMWA 4P90A 4KRCA 3D94A 3CD3A 2QOFA 3BYVA 2W17A 4M84A 1MP8A 3TTIA 4EH2A 5CT7A 2Z2WA 3EKKA 4CKIA 5EI6A 5ANIA 4FUXA 3PJ1A 2JKQA 4F9BA 3D2IA 3AC3A 3NYOA 4ANMA 4KS8A 3SW7A 3KF7A 3R0TA 2HENA 2X8DA 4PMMA 5CALA 3VS0A 3LFBA 4AE6A 5HO7A 5BYLA 3MH3A 1OECA 2ZV7A 2GTNA 4FTMA 4O6EA 5DRDA 3ENHA 4ZSEA 4TNDA 5EH0A 3AGMA 1DAYA 2QOBA 4F0GA 4YPDA 3E8CA 3EYHA 1OIQA 4FSZA 3GOKA 2RG5A 4AP7A 1TQMA 2HWOA 1JKSA 3KXGA 2I40A 3TZ8A 5CEKA 4EL9A 2UVXA 3UC4A 4B8MA 5GIPE 2WKMA 4I3ZA 2YABA 2XIXA 4Y46A 5IPJA 4L7SA 4FBXA 3PY3A 3Q53A 2JKMA 5JMSA 5CNOA 3SVVA 4OTDA 3WIKA 2QG7A 5HO8A 3NGAA 5LCKA 3S0OA 4PQNA 5AIKA 3ZC5A 3T8OA 3ALNA 4AOTA 3GBZA 3LCTA 5TO8A 5BYZA 5DPVA 1SVHA 3PVBA 2CN5A 3ZC6A 4C62A 4CVAA 4BDIA 4FV0A 3NNWA 4UXQA 3VJNA 1XQZA 4FSQA 4IAIA 4NIFB 3ZLYA 2QQ7A 2UUEA 2PU8A 3I79A 5AAEA 3CGOA 2YEXA 3ENMA 4EJ7A 2QOKA 4ARKA 3E8EA 1XBCA 1ZXEA 2YJSA 3EWHA 4FKSA 3QUDA 5HBJA 5IA3A 1RW8A 5HTBA 3KEXA 5E1SA 4TL0A 2C0TA 4PDYA 3ZYAA 4KS7A 4Y8DA 5A3XA 3OW4A 1VYWA 4F7JA 5CSVA 3C1XA 4UALA 3HMOA 2ZM3A 4IVDA 2ZVAA 4TT7A 4DGNA 2OF4A 4MXAA 4S30A 4ZIMA 3H30A 1PXOA 3DJ7A 2XK6A 3COIA 3E3PA 2PY3A 3CTQA 5IU2A 4EHGA 5IH5A 3FV8A 3HRCA 4NIFA 2JIUA 2ZM1A 1YI4A 3FKNA 4BCPA 3Q9YA 3E93A
chains in the Genus database with same CATH superfamily
4HNFA 4U3ZA 5EDQA 3WOWA 2J7TA 3ZO2A 4S2ZA 1NVQA 1OIYA 3ZEPA 2VWBA 4Q5EA 4TWPA 4KSQA 5AIRA 2J50A 3RNYA 4G3CA 3QUEA 3TNIA 5A9UA 5C8KA 3FMEA 4IC8A 4FZ7A 5AV0A 2C6EA 3VUDA 2NYAA 4EZ5A 3MDYA 4IX6A 4ACDA 4BZDA 5FG8A 1XMLA 4O6LA 4LV7A 5AUYA 3ALOA 4C0TA 2CGVA 3K5UA 3UIXA 1IAJA 3NUPA 4CMTA 3DDPA 3REPA 3JXWA 4O7NA 3AC1A 3M2WA 1G8SA 1LPUA 1M17A 2XNPA 4YO6A 2NP8A 3C13A 3I7BA 3WF8A 4N57A 4ZZOA 3SLSA 3ZBXA 4PMPA 3G9NA 4JDJA 4ZK5A 4G3GA 2AUHA 3PXFA 3F88A 3LLTA 3A7IA 3GGFA 4UXLA 4OAVB 4FKJA 5A46A 4TYIA 5IKWA 4HVSA 4QP9A 3Q9WA 4ZJIA 1OL1A 3AD5A 5KO1A 3FSFA 5LXMA 2C6IA 4XG2A 1UNHA 4QMLA 4FG7A 5CWZA 4FTUA 2VZ6A 3NNXA 1L8TA 5EYDA 4D5HA 3PPZA 3PIYA 4GUEA 3PA5A 5JFWA 3BU6A 4R1YA 3IO7A 4HYHA 4L68A 2OSCA 3H0YA 4IH8A 3IDCA 3LCOA 3R1SA 4C58A 4NW6A 5EK7A 1ZYDA 4F9WA 5AV2A 3QD2B 2BR1A 1FQ1B 4UMQA 2R3IA 4F09A 2JIVA 3AOXA 4FSMA 4RWJA 3MFSA 4A4XA 2Q0BA 3DZQA 5I3OA 3HNGA 2UZNA 4YNEA 3F7WA 4M66A 3W2SA 1Q97A 3FE3A 4WO5A 3EQGA 5M44A 1TQPA 3VHEA 3O23A 3W8QA 3U51A 4ASXA 4AWIA 5LWMA 5AFVA 3A7GA 5FWKK 2PYWA 2PE0A 3LCKA 5ETAA 3BI6A 3UGCA 4UYAA 5LQFA 2W4JA 4JAIA 4BGQA 2IZTA 5AM7A 3HV6A 2HWPA 1Q41A 2C1AA 5BUIA 3MV5A 4C37A 3DQXA 4YJUA 4FOCA 3FZRA 2EVAA 4WRSA 1AD5A 2EXMA 1W98A 3SOCA 3H9OA 3MS9A 1MUOA 4BVUA 4FKWA 2XKDA 3OD6X 5IA1A 3BV3A 1FVVA 5HE1A 3BQCA 2W1ZA 2BTRA 2WIHA 3ANRA 3OWKA 4JRVA 3RK9A 4MQ2A 4MQ1A 3V04A 3ZO1A 5JQ5A 1J7LA 4DFXE 3NYXA 3JR1A 1YWVA 4ITIA 2B4SB 2WMQA 3F3VA 1Q99A 4IAFA 4WIHA 3VRYA 3L9PA 4DEGA 3NYVA 5BNJA 1XMMA 4O4FA 3E5AA 5ETCA 3A62A 3QZIA 4AZEA 2BAKA 4DLJA 1JLUE 2BRBA 2C6MA 3DPKA 3L8SA 1OUYA 1Q8YA 5EW8A 2RFEA 5HO6A 3OG7A 4R77A 2VGPA 3ZRLA 4QEBA 3MVMA 3R21A 4FE2A 2YN8A 4FKPA 5BVFA 3GP0A 1ZLTA 5FP5A 4XV2A 4O4EA 3JUHA 3LFAA 5AADA 4ZSJA 4QP3A 2FSOX 1KE5A 4KIKB 5B0XA 3P9JA 2GNHA 4TYHA 3W55A 5KKRB 5CF8A 1PYXA 3GNIB 3KXZA 2R7BA 1PHKA 2CCIA 2VWIA 5AEPA 5I9ZA 4LMNA 4QRCA 3TZ9A 2JKKA 2LAVA 1P14A 4RLLA 1JNKA 1YXXA 3VWAA 2ESMA 3AC8A 5KNJA 3Q5IA 4II5A 2Y4IB 4NT4A 4IADA 4YHFA 3EFJA 4AZVA 4D1ZA 3N9XA 2XANA 3ZUVA 3VO3A 4XG9A 4G17A 4RWIA 3RAHA 3ZS5A 4L67A 4EH6A 5IISA 4QDEA 2UZUE 3RPOA 5DRBA 4FSNA 3C9WA 1WVYA 1FGIA 3ORZA 2VO3A 4AGDA 3G90X 2JKOA 2VD5A 3H4JA 3P5KA 2YFXA 5FDXA 4BZOA 3W0SA 2O65A 5DR9A 5FTQA 1A48A 1H8FA 5CI6A 4CFVA 3D15A 4CV8A 2G01A 3L8VA 5KHXA 4X3FA 3G33A 4FIGA 4QYYA 1Q3WA 3O8PA 2XK4A 3UP7A 3FMKA 5E8WA 5DMZA 2C68A 1SM2A 3EQFA 2XYUA 3ATTA 2OW3A 5A6NA 2CMWA 3SAYA 4YJPA 3FI8A 5B2LA 4QTBA 5IA4A 3OY1A 5ANEA 4D2VA 4B6LA 5FXRA 3G9LX 3TMOA 3OCTA 1KE9A 2WELA 4LOPA 1JBPE 4BCKA 3UIUA 3GUBA 5CSWA 4HPTE 4HGEA 4HNIA 4X3FC 4CXAA 4EK8A 5KKRC 2RFSA 4EOPA 4GKHA 1OL6A 2VU3A 3EN7A 3MTFA 2ZYBA 2V22A 2X7OA 1LEZA 5CS6A 3BYUA 5KBRA 4UWYA 2YWPA 5AR4A 5CLPA 4KAOA 4FSTA 3R8UA 4FV8A 3QWJA 5IDPA 1ND4A 1H26A 4BKZA 2HIWA 4YJTA 3IGGA 4G6LA 3A60A 5IUGA 2O64A 4PMSA 5FLFA 3ORTA 3VAPA 3R7IA 3AMBA 4OW8A 4DHIB 4FYOA 1O6YA 3BBTB 3OMVA 4JS8A 4H3QA 5LJJA 3TM0A 4TY1A 3N4TA 2OZAB 2PE1A 3BGQA 1OL5A 2OIQA 5AWMA 3UBDA 3CGFA 4FTOA 4F99A 3LAUA 3L8PA 3TNQB 4E8AA 1F3MC 4JR3A 5CY3A 4WG3A 5D1JA 2CKOA 3S3IA 2ERZE 1XH8A 2CN8A 2PVFA 3SG9A 5H8GA 2G9XA 2ZOQA 4DN5A 3E87A 4E93A 4D5KA 5CEPA 4B0GA 2VTTA 2YIWA 3PJ3A 3C5UA 3BWJA 3O96A 4I4EA 4IIRA 3UOLA 3VULA 4MTAA 3EIDA 4D4VA 1B39A 2F9GA 4FV7A 5E8YA 1E9HA 1JSVA 2J9MA 4EOQA 1OL7A 3NFFB 3W0QA 2IN6A 5F20A 3DFCB 4NJ3A 3ZHPC 3FJQE 4GKIA 4I5MA 5E90A 2WOTA 2W1IA 4UYNA 4YJVA 5AR3A 4DEHA 3OF0A 3V8SA 4YTIA 1YOMA 2WAJA 3KK9A 3LFSA 3MY1A 5KCVA 2WU6A 3EZRA 2EB2A 4Q2AA 2BFYA 3QQKA 1H1PA 4FI1A 4FKVA 3NPCA 1S9IA 4MBLA 4MCVA 2E9NA 3KXHA 2OIBA 4R5SA 4U41A 4EUTA 2NO3A 1WCCA 2V7OA 2BAQA 1ZMWA 3IQ7A 3R7VA 3ODZX 3NRMA 2C69A 2JGZA 2R3JA 2RKUA 3GB2A 4GJ3A 4GK4A 4RC3A 3TJCA 4O7LA 3DS6A 3OUNB 3NCGA 3LQ5A 3TKHA 2BPMA 3Q32A 5KMLA 4ZY6A 3E3BX 4NCTA 2OJIA 5DEWA 1WBTA 4U40A 3HVCA 4IANA 5KZIA 5BMMA 3PA4A 4M97A 5I9YA 3QTXA 3RBWA 3VBVA 4R78A 5EW9A 3BYSA 3DDQA 1PMUA 4A9SA 4C3RA 4DH1A 3IW6A 5HVYA 5HX6A 1TKIA 3UDBA 2QU5A 3QHWA 1FMOE 2ZB1A 2YM5A 3FY0A 5EYKA 3RCJA 2EXEA 4ANSA 3FKOA 2C30A 3ZXTA 4GVJA 2PVLA 3LXNA 3ORLA 3SHEA 2R64A 3UVRA 3W10A 4EH8A 4PPBA 3R04A 1H0VA 4CCBA 3HDNA 2GNJA 2QU6A 3FPQA 2YIQA 4KBKA 1XH5A 4OR5A 4KA3A 3RTPA 3QD3A 5HU9A 5TKDA 1O6KA 2ITTA 3HUCA 4RIWA 2DUVA 3E63A 2FVDA 2GS2A 2VO7A 4IEBA 4IAYA 4EH3A 4F7NA 1FOTA 2YM4A 5CZIA 1JVPP 4AU8A 3CC6A 3EN4A 4RWKA 4O38A 3QKKA 2H6DA 4NFMA 3LFDA 4XV3A 3DAJA 1WAKA 1YQJA 2GDOA 2IZRA 2XA4A 4AN3A 4OLIA 4W4VA 3R1YA 4BR3A 4FIEA 5DLSA 1HOWA 4FC0A 2IVVA 4YZMA 5ACKA 5C8MA 4O84A 4PUZA 4HPUE 4BDGA 4XHKB 4J96A 1HCLA 3PXZA 3EQBA 4AX8A 4YJNA 3EFLA 1M2RA 4BDJA 5IEXA 2PPQA 5KMOA 5C26A 2ITQA 4F9AA 3QD4A 3R00A 3U6JA 1W2CA 3MI9A 2HW6A 4I0TA 3SXRA 5HLWA 3HYHA 1ERKA 4O86A 4RIYA 3R1QA 3F5XA 2X0QA 3R22A 4RVLA 1KOBA 2IF8A 2JAVA 4E26A 1ZYSA 3ZBFA 3RAKA 4DGLC 3DLZA 2J6MA 1KE8A 2B7AA 4X21A 5GJDA 3VUHA 4EH9A 2ITYA 3DCVA 4GYGA 3FI2A 2GMXA 2PVKA 5DOSA 3BE9A 4FZAB 1Y91A 4F4PA 3ZUTA 3RCDA 2C5OA 2YZLA 4X6QC 4FJVA 3QF9A 5K4IA 3O2MA 4CEGA 3G0FA 5BVKA 2X0GA 4YMJA 4NWMA 2XK3A 1QPJA 2JFLA 3AD4A 4HW7A 3QLGA 2BRMA 3JY0A 4BDHA 2OZOA 2WMSA 4DBNA 4F7LA 3Q4ZA 2J5FA 3S95A 2PUIA 4RFYA 5C8NA 2GQSA 3NFGB 4RVTA 4AACA 1GZ8A 4YC3A 3VUKA 2BRGA 4XRLA 4AAYA 3C4WA 4DGOA 3HMIA 5JH6A 4R1VA 5K0XA 1FMKA 4A4LA 2I0YA 3U87A 4BCJA 3RALA 3A4PA 4ITHA 2GU8A 4DH3A 1KOAA 1OPKA 3D5UA 4TWOA 1ATPE 4GL9A 4BTFA 4M8TA 2ETRA 1JKKA 3A8WA 4RRVA 3IONA 3C4EA 5DR6A 5K3YA 2BAJA 4WSYA 3R8ZA 3UOHA 3TEIA 3F5PA 4IACA 3ZRKA 4F0IA 4FKOA 5J1VA 2NPQA 4FV5A 4X0MA 4AZSA 5CSXA 1T46A 2HOGA 2VTMA 2X81A 3SC1A 1YW2A 2W1CA 4U6RA 4HYSA 3VONA 4U79A 2BROA 2ONLA 2W05A 3MFRA 2X2LA 2Z7RA 4X7QA 5BX0A 3BYMA 3S1HA 1STCE 3W32A 3BU5A 5IA0A 2GFCA 2X1NA 3W0NA 3RMFA 3LMIA 4XBUA 2B9FA 4AOJA 1K3AA 3U9NA 3ORMA 4C4HA 5K9IA 4D2RA 1G5SA 2UV2A 4K1BA 4YGAA 2ONLC 5BVOA 2JDOA 2J2IB 3CJFA 3MPTA 3Q5ZA 4C57A 3EHAA 4CFXA 3N51A 1SNUA 3K5VA 3HV7A 5EOBA 4FT5A 3RPVA 1H25A 4KWPA 4EWQA 3R7OA 2WO6A 5HNBA 2PWLA 2O5KA 3W2QA 4BI1A 1UKIA 4HVGA 3V5WA 4GMYA 3DNEA 4M69B 4ACGA 2IG7A 3II5A 2OG8A 4KSPA 1Y8YA 4YZ9A 5E92A 3UOKA 1H0WA 3T9IA 3AXWA 2B54A 3HLLA 5E1EA 3GU8A 5HG8A 4FV2A 4HGTA 4BKJA 4U80A 4IBMA 2DWBA 2RG6A 2R3FA 3PXYA 1OBGA 4OTRA 5C4LA 4BB4A 2BHEA 2J51A 1ZOHA 4BCFA 4R3RA 4F6UA 3P0MA 2HXLA 4YBKA 4IB1A 4L9IA 5FP6A 3Q52A 5AP5A 5C03A 4PV0A 4AZWA 5JZJA 4IZ7A 5GNKA 4OBOA 4O27B 3BEAA 3ORNA 4EK5A 1ST0A 4ZTQA 3V51A 3A8XA 5KUPA 5BUEA 2XNEA 4O0YA 1P4OA 4XP0A 5CEIA 5K5XA 2AEGA 1DS5A 3AT4A 1XH7A 1OL2A 2ITUA 3NZ0A 1GIHA 4FEWA 3W0MA 2VN9A 3KXXA 4XX9A 2SRCA 2Y6MA 3DKGA 3PE2A 3TNWA 2HAKA 3SD0A 4TWNA 4JX3A 3MBLA 4DFZE 3ZCLA 3CQWA 5DT3A 3KCKA 5DA3A 3WIGA 5EM8A 4O96A 2WEVA 5HTIA 5I5ZA 4S33A 4M68A 4YHTA 5T3QA 2ITVA 4DITA 3KN5A 3NUAA 2B9HA 1J1CA 3FKLA 4I5CA 3JVRA 4QMPA 4YPSA 4D55A 1ZMUA 2JDRA 1FGKA 4PF4A 5GJFA 2QG5A 2R3NA 5GZAA 4X2NA 2JBPA 2DYLA 3LJ2A 4TXCA 4WNPA 1W84A 2ETKA 4M15A 4HVHA 4FTLA 3FMJA 2AC5A 4D0XA 1UU3A 3UPZA 5GJGA 4BCQA 4KKHA 4MWHA 4DH8A 2PZYA 4H36A 2QD9A 3SXFA 4DGMA 4NW5A 3LJ0A 3HV4A 1TFFA 4DH5A 3PSBA 3WYYA 2A4LA 2Z7LA 3FAAA 4JQ8A 4PX6A 3EOCA 4CKRA 5FQDC 3MJ2A 4HVIA 3KIOC 4HCTA 4DFYA 5LVMA 2W1DA 3DXNA 3V6RA 4GG5A 2HZNA 2CNVA 1AGWA 4JIKA 2R3LA 3QC9A 1XKKA 4S32A 2Q83A 2ERKA 3KRLA 3WE4A 2PZRA 1GY3A 4CGAA 2R3PA 1YRPA 4DT9A 3NW5A 4IX5A 3LHJA 4IJPA 4OTFA 3HMMA 1DI8A 5CVHA 3LQ8A 4O1OA 1PMNA 4APCA 1NVRA 2H9VA 1UKHA 2G2IA 3GT8A 4UY9A 2IZSA 3B2TA 3R02A 3QLFA 2JLDA 4YNOA 3OFMA 4I41A 5LMKA 2P2HA 3GCPA 3QA0A 5CEMA 5CQWA 3L1SA 2OXXA 4TN6A 4LQMA 5DVRA 4D4RA 4ZTMA 4DFUA 4L3LA 3T3VA 2AC3A 5EI8A 3VS7A 3SGCA 1H27A 5M07A 1YI6A 4IX4A 4ZY4A 1Q24A 2PUUA 3ZZEA 3KMMA 1GZNA 2QLUA 2ITZA 4NH1A 4W4WA 3HEGA 3PJ8A 4WD5A 1H07A 3MFTA 4Z16A 3FMNA 3VBWA 4OBPA 3FSKA 4ZAUA 3SV0A 4BWPA 5LMKC 3CCNA 3OUKA 3WF6A 3FQSA 3KRXA 3Q04A 2R5TA 4IDTA 4BJJA 4XNEA 5M08A 4O2ZA 3RPYA 2FYSA 3MA6A 3EB0A 3DBEA 4EOKA 3MPAA 1MRYA 4YUQA 2BDJA 2QO9A 2PVNA 4MH7A 1Q8WA 2VTOA 5CQUA 3T3UA 2G2FA 1KUTA 4GU9A 2B55A 3SW4A 4FZDB 4U8ZA 3DK6A 4AS0A 1UWJA 2WGJA 4BY9E 4NL0A 3E88A 3UMXA 5JKGA 1V0BA 1OM1A 1QL6A 1SVEA 2QKRA 4OTWA 5J5TA 3QA8A 4NUSA 3F3TA 3WF5A 4FTNA 4QTDA 4RMZA 4MBIA 4BC6A 2VO6A 3U55A 3BYOA 4Q9SA 2BILB 4QMTA 3GCSA 5IDNA 5C4KA 1OIRA 5EM7A 4WKQA 3F66A 4A9UA 3P78A 1KV2A 4CT2A 4D9TA 3H9RA 5JFSA 4I23A 2VTPA 3FXZA 3C50A 4G6NA 3U8WA 1H1QA 3P7BA 1BYGA 3DAKA 5CX9A 3U6IA 2P55A 3TNHA 2UVZA 3BU3A 3O71A 4KABA 4YURA 4C4EA 2X0PA 4M7IA 4EYJA 4P7EA 3OROA 4O4DA 2C5VA 4RQKA 4Z55A 3TJDA 2YACA 2GFSA 5FBOA 5DI1A 2NNWB 3S00A 3EQDA 4EH4A 3LFNA 2I6LA 1G3NA 5E8VA 4PTEA 4WUNA 4YTHA 3V8WA 3IW8A 4RC4A 3ZDIA 3LE6A 5HE2A 4ANNA 5CAOA 4DTBA 3LMHA 4XBRA 3UYTA 3I0QA 1FVTA 4M13A 4DLIA 4FVPA 4J98A 4ZTHA 5CEQA 4D2SA 3DK7A 5JGBA 4P5ZA 3CTJA 3ORXA 2BRHA 1ZZ2A 4JG7A 4AF3A 1PXIA 1R0EA 2WFYA 4K77A 4C8BA 5G6VA 3NIEA 4A7CA 2QI8A 5AP2A 2F4JA 3KULA 4AXDA 4A9RA 4CKJA 2QC6A 5EQPA 5BVDA 3LM0A 4QMZA 2WXVA 2ZB0A 2R0UA 3BHVA 2WHBA 2P0CA 3FZPA 4Q5HA 1IG1A 4RJ4A 4AW0A 5JSMA 1PF8A 1Z9XA 2I0VA 3UQFA 1ZOEA 2YIRA 2VAGA 3CP9A 4KNBA 4UN0C 4YO4A 3D2KA 3A7FA 4O82A 3GQLA 4F1MA 5KMIA 4O7VA 4BN1A 5IQIA 4GT3A 3VIDA 4FL3A 4XJ0A 4EHEA 3F6XA 2G2HA 4ZJVA 2R7IA 5H2UA 3DXQA 4WHZA 2GNGA 2WQNA 3P08A 4HGLA 3WE8A 3NAXA 3OXTA 3QU0A 4FKIA 1OKZA 4K9YA 4QD6A 4UZDA 5AX3A 4QT1A 3LFCA 3F9NA 1WFCA 3RK5A 5ANDA 4IB0A 3EZVA 3NUYA 4YZCA 5L2TA 2P33A 2ZM4A 3UP2A 1ZAOA 2XNGA 5C1QB 2B0QA 3W2RA 5F1ZA 4E4NA 5L3AA 3IW5A 3OXIA 1CKPA 4O91A 4PDPA 2R3RA 1YOLA 5HD7A 3W8LA 3E7OA 1J7UA 1O6LA 4QP2A 1JKLA 2QLQA 2VTAA 3GFWA 3E62A 3KA0A 4JVGA 4LGGA 3BKBA 2PK9A 4ENXA 2CNUA 4E7WA 2OKRA 3NSZA 2J0IA 3LIJA 2ZV8A 3A61A 4AGUA 4RJ6A 2RSVA 2XIRA 4OTGA 4QP8A 3BGPA 3OCBA 4RBLA 5IEYA 5IQDA 2QKWB 3H10A 5ETIA 1UU9A 4FV4A 4BBMA 3MIAA 3MTLA 4UEUA 2OGVA 1UNLA 1JAMA 4LI5A 2XP2A 2BDWA 2QODA 4QMVA 3LXLA 4L00A 1XBAA 3KMUA 3QQUA 1LR4A 1ZZLA 4EBVA 4CG9A 3V01A 3OWJA 3UQCA 4JMQA 4B8LA 2NRYA 4XP2A 3V6SA 3U9CA 4AA5A 3R63A 3PFYA 3SOAA 4O83A 1LEWA 4C36A 3ATSA 1Z5MA 3CE3A 4MNFA 3WZDA 1G8AA 1JOWB 3JS2A 3OEFX 4OTPA 5L2QA 3BBWA 2OU7A 3TI1A 5J5SA 4AT5A 2ITWA 4ZY5A 2IPXA 4GU6A 4BDAA 1WBSA 1M7QA 2VTRA 2C3KA 4AQCA 2Y9QA 1PXLA 4ZSLA 4R5YA 1ZRZA 2W06A 5FXSA 4QTCA 4BTJA 5IUHA 3ROCA 4JQEA 5K4JA 2BALA 3HGKA 3PVWA 4F9YA 4GJ2A 2UW6A 1ZYLA 4BBFA 3ZO4A 3FI4A 1WBOA 3GEQA 5EOLA 5DH3A 3AD6A 4J95A 4OTQA 3WYXA 1NXKA 4ACMA 3PWYA 4QQJA 2ZMCA 3JY9A 2E9VA 5TF9A 1H1WA 4PWNA 4TYHB 2Y6OA 5AP6A 4FR4A 3F82A 3FDNA 5DGZA 4FT3A 2WTJA 2A1AB 2BZJA 2VX0A 4BDFA 3AGLA 2XM9A 3A99A 4MAOA 3WARA 3QALE 1DAWA 4DDIA 3GC7A 4FL1A 3ZOSA 4C2VA 2YITA 3TUDA 2OF2A 3TKUA 2BKZA 1DI9A 4BF2A 4GUBA 4JBVA 5DWRA 4BCMA 4BTMA 1Y6AA 2H96A 2PMLX 4O0XA 3HX4A 2ACXA 5DNRA 1AQ1A 2ZFYA 4L53A 3FLQA 4DHJA 2C3JA 3O0GA 4EHZA 4X2KA 5H3QA 3PP1A 4PY1A 3ZM4A 4X2JA 2ZDUA 3G6HA 3G0EA 4H3PA 1OGUA 4IFGA 4RJ3A 3CEKA 3QL8A 2Y8OA 4MD9E 5AP4A 5EFQA 3E7VA 5D10A 5GZ8A 2YLEA 3CLYA 3TYKA 4XLVA 1XH9A 3R6XA 3TNPC 3QRIA 4X3FB 2CGUA 5KE0A 4JQ7A 4HJOA 4BIBA 4JAJA 4DF3A 3B8RA 3KQ7A 3VS5A 2BDFA 2YLFA 1GIIA 3ZSIA 5J95A 4F63A 4KBAA 4GG7A 4XG6A 4FTTA 2UW4A 2HY81 2WD1A 1JPAA 4FIHA 2I0EA 3W2PA 3NR9A 5BVNA 3DNDA 3P5JC 5CNNA 5CXHA 4FT9A 4FZFB 1WBWA 4OTIA 3QKLA 1URWA 4NJDA 5EW3A 4ZLYA 3OT8A 4I6FA 4O7ZA 3WZUA 3F3UA 4DT8A 3PJ2A 2ZV2A 2WTDA 3OOMA 4NM7A 3T9TA 3GCQA 4QQTA 5HIDA 3FMMA 1OPLA 4PPCA 4QP6A 1ZWSA 1BUHA 1T45A 3DJ6A 3MW1A 3PY0A 2KULA 1WMKA 4FF8A 1V0PA 5D41A 4USEA 5LVPA 1R39A 2HYYA 4DEBA 2GS7A 3QX2A 1M2QA 3UZRA 5T6KA 4U43A 3C5IA 4FA2A 3GOPA 2J4ZA 3VUTA 4A07A 2RF9A 4HYIA 4RZVA 2W7XA 5IQFA 4AW5A 3NX8A 1DM2A 3ROYA 4M0YA 4FVQA 3RWPA 3UODA 2B52A 3D5VA 4XV1A 4BCIA 4AW2A 3EL8A 2F57A 2FO0A 3FYKX 4GEOA 4G31A 5E7RA 3ZU7A 4EEVA 2IW8A 3W0PA 4U3YA 2C5XA 3KRRA 4MKCA 4QMUA 3VN9A 3WZEA 2GQGA 3G15A 5DFPA 1R0PA 1REKA 1IAHA 5EDRA 3PDTA 4M3QA 1Q5KA 3EQPA 2VWWA 4LGHA 4JI9A 1H28A 1W83A 4YR8A 4BGHA 1UVRA 4L8MA 4P5QA 1FBNA 1X8BA 3CD8A 5IQEA 3GENA 1ZYCA 4FG8A 4QP7A 3R2YA 3SRVA 4FTKA 4M14A 1BL6A 4MD7E 5CT0A 1U5RA 3VS2A 1KV1A 4W4YA 4GT4A 3N4UA 3L9LA 2DS1A 4FIFA 5D7AA 2WMAA 3WBLA 3V5JA 1QPCA 5E8XA 4L7FA 3I4BA 3R9NA 4HYUA 2WTVA 5AM6A 4PPAA 3PJCA 4CV9A 2HZIA 4PL4A 4RJ7A 4AZTA 4CZUA 1P5EA 2F7XE 5J8IA 2X8IA 5JT2A 4NKSA 3MESA 4FKGA 1UNGA 5KMNA 3PZHA 3QCQA 2V62A 3S2PA 5HZNA 3CSVA 1OKYA 4LM5A 5ANKA 3R9OA 4H58A 3UG2A 3IGOA 4XG7A 5BV3A 3R01A 1UU7A 3MYGA 3ODYX 5AAFA 4C35A 4B99A 3PP0A 4G16A 4L52A 2F7ZE 4EQUA 2BMCA 2C4GA 5A14A 5HLNA 2CJMA 2CNQA 1IR3A 3UO6A 3LCDA 5F94A 5CU3A 3FEGA 3QRJA 4BDCA 1Z57A 3MGYA 3W0OA 3EMGA 3L8XA 5DR2A 3L9MA 2J90A 2R3QA 2YZAA 3PFQA 4FKQA 3TV4A 3O8UA 2IJMA 3Q9XA 4J97A 3QRTA 4D9UA 4LL0A 5JFXA 4E5BA 3TXOA 1ZMVA 4IVCA 5CU2A 5L6PA 2X8EA 2F2CB 4F6SA 4AN2A 5LMBA 3MH2A 5CZHA 5ACBC 3BGZA 3CTHA 3ZSGA 3VQUA 4RIWB 2UZVA 1WBVA 4O2PA 5I9WA 1OI9A 4E6AA 1U54B 1A9UA 4FSWA 1IEPA 4G3EA 4EOOA 4PMTA 5E9EA 4QPMA 4MUQA 4QMSA 2VWYA 4EWHA 5FDPA 2CKEA 2QURA 2WTCA 4U7ZA 4AT3A 1B38A 4NCTC 3NUUA 2YCSA 1XR1A 2BRNA 2W5BA 3Q2MA 3PRFA 3QKMA 2OK1A 4JT3A 4QYEA 4RLKA 3TIYA 3TIZA 4BDDA 4AXEA 1SNXA 4IC7A 3LLAA 3PIXA 3FLSA 2V7AA 3NNVA 4AN9A 3R71A 3GU5A 5DBXA 3UNJA 3ZO3A 1H00A 5K5NA 1VJYA 4N70A 5KMMA 4IDVA 2OO8X 2X2MA 3DTCA 4ZTRA 4DTAA 4RIYB 1MQBA 2CKPA 4K0YA 2QOOA 4ORKA 4PP7A 2O63A 1U54A 4YHJA 4ASZA 5J7BA 3LFQA 1FPUA 1CSNA 4JNWA 4LMUA 2XNMA 3AC5A 3OXZA 3BHHA 3R30A 5HICA 4AGWA 4YLJA 4EK3A 5JRQA 2BTSA 2XJ2A 4ALVA 4CRSA 3KXNA 1ZY4A 2IZUA 4J1RA 4N6ZA 2YM6A 3CIKA 4PRJA 4O0TA 5C27A 5CEOA 2YDJA 2ZJWA 4WBOA 3RVGA 3QXPA 3BL9A 2XEZA 3AC2A 3VUIA 2JITA 3GC0A 1G8KA 2QHMA 2HCKA 4AXCA 2O3PA 5AMNA 3G2FA 4PDSA 3LKMA 1YOJA 4JOAA 4DA5A 3GVUA 4KUJA 2OWBA 5BYYA 4UB7A 3QHRA 4I0RA 3VUGA 5HX8A 3O50A 5HBEA 1Y8GA 4BIDA 5CU0A 4YLLA 3RHKA 4EC8A 2C6TA 4DCEA 4QYGA 4X2GA 5GZ9A 2OXYA 3LXKA 2RGPA 5CU4A 4MNEA 1SMHA 1SZMA 2QOIA 3DBQA 3F69A 3DU8A 3ITZA 4IZ5A 3OWLA 3CY3A 4IWPA 4L44A 4ZS0A 3PSCA 4F9CA 4JDHA 4QYFA 4EH5A 4YC8A 2YM3A