4IAZA

Structure of camp dependent protein kinase a in complex with high ba2+ concentration, adp and phosphorylated peptide psp20
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Insights into the Phosphoryl Transfer Catalyzed by cAMP-Dependent Protein Kinase: An X-ray Crystallographic Study of Complexes with Various Metals and Peptide Substrate SP20.
pubmed doi rcsb
source organism Mus musculus
total genus 110
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4iazA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4iazA02
4YGAA 3D5UA 5JH6A 1H27A 2ITTA 3EQIA 2JD5A 3BWJA 4HPTE 5CQUA 3V5WA 5J79A 5HI2A 1RJBA 1DS5A 4QP3A 4L01A 5FUTA 2PUIA 4JOAA 1H8FA 3O71A 4DFZE 1K2PA 3G0EA 2YCSA 1Y6AA 2BRGA 3K2LA 3ZHPC 4OAUC 1H1RA 3SRVB 5L8JA 2JEDA 4RMZA 4YLKA 1OL7A 1YHVA 3R02A 3BHTA 4LRKA 2CGXA 1U5QA 4IX5A 5IH6A 3O51A 5C27A 5I9ZA 2HY81 2R9SA 2XIYA 3KK8A 5JKGA 3I81A 5B2LA 2CGWA 1JNKA 1QL6A 2PUUA 4H05A 3I0QA 4DLIA 3ZLSA 4YZNA 1H01A 4X2FA 5L2TA 5LMBA 1RE8A 3IW5A 1TQPA 1Z5MA 3Q6UA 5A4LA 1IASA 4GUEA 1NA7A 2B55A 2BCJA 4NFMA 3R83A 4YJTA 3GENA 4WNMA 3VUMA 5HE3A 5IH4A 2OG8A 4ALWA 3ORXA 3Q96A 1XBBA 5CLPA 2HWOA 2JBPA 3RTPA 1XKKA 3C50A 4FIIA 3JVRA 3P7AA 3NCZA 2J0MB 2XM9A 3UZRA 3PY0A 5L3AA 3HMPA 4CFFA 2E2BA 5BUEA 3IW8A 3VUHA 5FXRA 3LOKA 3Q9WA 4E4NA 3PJ3A 4QYYA 3M42A 3FMNA 1JVPP 5IUIA 3ZC6A 4IWPA 4BDFA 3H3CA 4NJ3A 5JT2A 3ZOSA 3PY1A 4IHPA 3G90X 3N4TA 3VBXA 2C1BA 4L68A 5I9UA 4M15A 3U8WA 1OIYA 3HRFA 3F2RA 4GVJA 4HVSA 4FVQA 4LOPA 1FVRA 3QZGA 3OCGA 2PZPA 2WMBA 4IANA 3VULA 1LUFA 5IISA 1Z57A 3F88A 3RM6A 1UKIA 1ZLTA 3E64A 5C03A 1T46A 5IEXA 4Y73A 3F9NA 2QD9A 4MQ2A 4FSQA 2C0TA 3DQWA 1XHAA 4ZSLA 4FKLA 3GU6A 4J98A 5TT7A 3TNIA 4EH5A 3R8ZA 3UQGA 2F7EE 3W8QA 4ZSGA 4NW6A 2XEYA 3LIJA 5A4QA 3S0OA 2R3IA 1Y57A 4C58A 3PP1A 2W1DA 3FUPA 4FOCA 4I0RA 3UG2A 3D14A 5ICPA 3G6GA 2PY3A 3RNIA 2HXQA 3OCSA 2C6KA 1ZMVA 2JFLA 2VTQA 2VWYA 3KQ7A 2HZNA 3HMOA 3LFNA 4JQ8A 4ZK5A 4I4EA 2VV9A 5CEPA 3MPAA 3DDQA 2NPQA 2ZM4A 4XEYA 2EWAA 3DBEA 1KE8A 3MB7A 3FY0A 4BZOA 3OEZA 1J7UA 3OXIA 5LWNA 2XJ2A 2W7XA 3NCGA 4WNOA 2NRYA 3OWKA 5E8ZA 2PVLA 3N51A 3VS6A 2J51A 3IONA 4YHTA 3TTJA 3LLTA 5BVFA 5DYJA 1KE9A 3H10A 1YQJA 5CU4A 3TN8A 4FTQA 2BZJA 1FOTA 2HOGA 1ZYCA 5HIBA 1GZNA 4PQNA 4BHZA 5HOAA 2EXMA 4I5HA 2B9FA 5HNBA 3TV6A 3ETAA 3OY1A 4MD9E 5JQ5A 4RZWA 4FUYA 5BVDA 3EN9A 2QO7A 4BCMA 1CTPE 3G5DA 4FF8A 2OIBA 3PJ8A 3F5GA 4QP8A 1OKWA 5IA2A 3ACJA 4LGGA 2DUVA 2OFVA 5J8IA 4AGWA 4QQCA 2P4IA 5IQHA 3V8WA 5B2KA 3HV4A 3KMWA 1PXIA 3L9NA 5HLPA 1YHWA 3BGQA 3OW4A 3D5VA 2JLDA 4NWMA 3GT8A 1WVWA 5JZJA 2QI8A 3MW1A 4PRJA 2C6DA 5HZNA 2Y7JA 4RRVA 3VUIA 4OGRA 4GYGA 5DLSA 2R3QA 4DEHA 5I3OA 2ZB1A 5J7HA 3C4XA 4NUSA 4QMUA 2GPHA 2R3RA 3ZMMA 2WQEA 3WYYA 2YACA 4UMPA 2XEZA 4NU1A 4O0YA 5DT3A 3L8PA 1KV1A 3HKOA 4X0MA 3TCPA 3TEIA 3P0MA 4NCTA 2CKEA 4K11A 2E9NA 2HZIA 3WE4A 2JDVA 4B7TA 3JS2A 3UMXA 4ANOA 2C6IA 3KULA 4QMZA 3WYXA 3JY9A 2C6TA 4L44A 5A3XA 5FTOA 1JKLA 1OI9A 2XH5A 4MK0A 3R8MA 3PSDA 4WT6A 2IW9A 5J9ZA 4BIBA 5HO8A 1V0OA 2ZDUA 1GZOA 1PYXA 4AUAA 5KBRA 3ELJA 3F7ZA 5HNIX 3FMHA 3LFDA 3UIBA 3QZHA 2CN5A 3NNVA 3PSCA 2NP8A 3I6UA 4IC7A 2EXEA 4OTRA 2G9XA 5IQCA 4UYNA 5D41A 4Z7HA 3JY0A 1ZOHA 2PZIA 3CQUA 5DR6A 4K9YA 4ENXA 4QP1A 4MBIA 2QR7A 5AA9A 3DXPA 3GNIB 2B9HA 3HGKA 3COMA 3ORTA 3KGAA 2XRWA 4Q9SA 4QMOA 5HD7A 3OWPA 4YC6A 4QQJA 4QYFA 4AE9A 1HCKA 3R1SA 5BYZA 1Y6BA 5DHJA 1YDTE 3NUPA 3VC4A 2X7FA 4M8TA 5ANIA 2PVJA 3BYOA 1SVGA 3W10A 4CMTA 2XK3A 4F64A 5BVNA 5K0KA 3NUUA 5B7VA 3O96A 2QOHA 2YWPA 3G0FA 3KKVA 3L8VA 4FK3A 4IZYA 4Q5EA 5DRDA 3W2CA 4NK9A 4OTWA 1XR1A 4LV5A 1XO2B 4FSTA 4M7IA 4P90A 3ZO2A 5HTCA 4QYHA 4E4MA 4DA5A 3R1QA 3PLAE 3O23A 3RAIA 3IOPA 4MNEA 5EHYA 5GINE 2R4BA 5ETAA 2YLEA 3BWFA 1GY3A 3RZFA 5FQDC 4BFMA 3NW6A 4BCKA 3N4VA 1PMVA 1XH4A 3EL8A 4MXCA 5F94A 4NSTA 3UGCA 3ZRLA 2C5NA 5AR3A 1VYZA 5AR7A 4ZJJA 3LE6A 4KINA 3JR1A 4E5BA 2WQBA 2WIHA 5LVOA 2FSOX 2W1IA 4BDCA 4TYHB 4ZXTA 4F7SA 5LJJA 3QA0A 3QX2A 3Q53A 3QWJA 2IJMA 4XG3A 5CSHA 4D4YA 3F5PA 5FTQA 2YAKA 5HO6A 3TKIA 4ONAA 4OBQA 3KXGA 3KVXA 3RPRA 3ZSHA 3IDBA 2VX1A 3UVQA 4NYEA 3ID6C 3NPCA 4E73A 4BCIA 1ZYLA 3GFWA 3PPKA 2XK9A 3F2NA 3R9HA 3G15A 4XP3A 4PDSA 4IDVA 2I0YA 2X2LA 4ZTHA 3QCXA 4I21A 4W9XA 5CT0A 3U6IA 2XRUA 4H3PA 4G5PA 5JGDA 3NNWA 4FL3A 4YZBA 4FVRA 3F3ZA 3MB6A 2BRMA 1GZ8A 3QZFA 3GQIA 4M0ZA 1R3CA 4QD6A 4AGCA 4BIDA 1IAHA 2VWZA 3ET7A 4Z9LA 4WOVA 4XBRA 3KFAA 2YDJA 3CBLA 5EFQA 4MXAA 4EYMA 4DGGA 2I0EA 4K2RA 4G3CA 4W9WA 1R0PA 4PTGA 2V7OA 5LCKA 2OJIA 2QLUA 3RWQA 4IFCA 1T45A 4IAIA 4Y8DA 3ZM4A 1H08A 4O7SA 2GNLA 3NNUA 4NH1A 5HG8A 1LPUA 2C6LA 3DZQA 5CSWA 4FSZA 3EB0A 4F1OA 3GCPA 3ALNA 3WZJA 4YURA 1KOAA 2Y9QA 3R00A 5M51A 4OTIA 3MPTA 2JDOA 4AT5A 4ACMA 2JKOA 4LL5A 5HVYA 1TQMA 2A27A 2ZDTA 2CNVA 5HG5A 1OPLA 4YHJA 1R0EA 4FT5A 4PPBA 1U46A 4BTJA 2I0VA 3II5A 5EKOA 2GHGA 3A8WA 3AOXA 3DTWA 5I3RA 4G6NA 3JXWA 4KBKA 3CP9A 2WHBA 4LFIA 4EZ5A 3BI6A 3UOKA 2G15A 3TV7A 4HGSA 3MFUA 2IPXA 1KE5A 3LXPA 5C8KA 3NAYA 1YI6A 3U54A 2W06A 2IZTA 3R7IA 2W1EA 4OTFA 4PTCA 4U81A 3DNDA 5HIEA 3RPVA 2WTKC 3BZ3A 4BYIA 3E62A 4D28A 4L67A 1OVEA 5IA3A 3NUNA 2QR8A 4GJ3A 4ZP5A 3FMKA 3F6XA 1OIQA 4MXOA 4IMYA 3GU4A 2ITOA 4YZMA 5HESA 4FNXA 3FY2A 4FKTA 4R7IA 4M97A 5ACBC 4FV9A 1URWA 2JITA 3QTQA 4QT1A 3H0ZA 2PU8A 3IG7A 4N70A 5GHVA 1OITA 2HAKA 5KMIA 4PX6A 3VHEA 4YJUA 4AOIA 4KBAA 3PG3A 2OXXA 2VO7A 3R73A 4F7LA 2RG6A 4I41A 3VS0A 4XV3A 1SMHA 4F6WA 2R3OA 4IX6A 5DT0A 4C37A 3C5IA 3RK7A 4BDKA 5FBOA 4RIYA 1WVXA 3PUPA 3BHUA 4FTRA 1NW1A 1SYKA 2ESMA 3E3PA 3BU6A 3FC1X 1BMKA 4JNWA 5AR5A 4CXAA 5GIOE 2UZLA 4WBOA 5K5NA 3Q52A 4L52A 2VO6A 3R7GA 3E8NA 5AP0A 4DH3A 4TNBA 4I20A 4OTHA 4AZFA 5FM3A 3R01A 5C1QB 3C51A 4WA9A 5KZIA 5IA0A 4J97A 2OZOA 3DBFA 4WRSA 3I5ZA 3LFCA 4M69A 3UNZA 4AP7A 5A4CA 3T9TA 4YC3A 3NYNA 4CTBA 4YUQA 4ITJA 2QOCA 3DFAA 2O8YA 4IWOA 2PZ5A 3C1XA 3PZHA 3QGWA 2W1FA 3MH0A 1PXLA 4CCUA 3MFRA 4C8BA 3OZ6A 5HD4A 4X7QA 2BALA 4RPVA 4XUFA 4NM0A 4W4YA 4E4LA 1YDSE 2X9EA 3PE1A 3QXOA 4HVDA 2WTDA 5HNGA 3V3VA 4ALVA 4YP8A 3E87A 3RAKA 2C5VA 4MD8E 4AT4A 2C3IB 4HW7A 4EUUA 4GW8A 4M3QA 4AAAA 1GOLA 2IZRA 4I4FA 3OXZA 4ZZOA 5M53A 1RQQA 3ZZWA 5EHLA 4DBNA 2J7TA 4BCHA 3DOGA 2P0CA 2XCKA 5EM7A 4FK6A 5DI1A 5CTPA 2P2IA 2R0UA 2B53A 4B8LA 4O91A 5FDPA 4ANLA 5HCXA 3NUYA 2CKOA 3HV7A 2X7GA 3HDMA 3ORPA 3DB6A 4XP0A 3EZRA 1SNUA 3G2FA 4B6LA 5CNNA 2Y4PA 1H1WA 3BLQA 4RVLA 2XK8A 3LFFA 2ETMA 5ANDA 3GEQA 4ZTLA 3U9CA 4EORA 3CR0A 4CEGA 4HNFA 4P5QA 3NS9A 3QQJA 2B54A 4H39A 4BYJA 4B99A 3RBWA 1BI8A 3LXLA 4FV2A 4DGNA 4K8AA 2ZV2A 3C7QA 5CYIA 4FKSA 4DT8A 3EL7A 2Z60A 1BYGA 3OWLA 4C3RA 1PKDA 3TKUA 2C5XA 4BDBA 5CU2A 2OZAB 5KZ0A 4KIKA 4YC8A 2J90A 4WHZA 3ZRKA 3BV2A 4D1XA 3SA0A 1IAJA 2YDIA 4IFGA 4JDJA 4GKHA 2QC6A 4UXLA 4AA5A 3FMJA 2X7OA 3F5XA 2X2KA 4EOJA 4O6LA 4O7WA 1BKXA 2VN9A 1U54B 4J7BA 2YN8A 3RK5A 4DEEA 5IPJA 2I7QA 1OIUA 3P9JA 3PLSA 4UMTA 2CCIA 3D2IA 4R3RA 4DG0E 1OL6A 4EZ3A 2YIWA 3POOA 4XG2A 3P08A 4FKIA 2G2FA 1O9UA 4YBJA 5DA3A 2W0JA 2YM7A 5IF1A 5CY3A 3TACA 4B9DA 1JWHA 2YIRA 4D55A 4E20A 4CKJA 3ZBFA 4O7LA 1GIHA 4HJOA 2YZLA 3O50A 2C69A 3OBJA 4U80A 3U87A 4X2KA 4DFYA 4A9RA 3W2SA 4XBUA 3RCDA 2PMIA 3TZ9A 4MBLA 4BCPA 2XB7A 2H96A 2C68A 4IBMA 2WTWA 1F0QA 4RBLA 3QTSA 2B9IA 1P4FA 2GNJA 3GBZA 4ERWA 4IE9A 1J3HA 3IK3A 4G3EA 5BUIA 3NMUF 2W4OA 4TWCA 5FTGA 5CX9A 4AZWA 3E8EA 3Q60A 3H9OA 4I5MA 4DE4A 3AT2A 4LOOA 1JSVA 4GCJA 4EK8A 5IDNA 1FMOE 3PIXA 3WARA 4BGGA 2OJFE 3FI8A 3LMGA 2C0IA 3FSKA 4B4LA 3G6HA 3R9NA 4ZS0A 3GVUA 2CSNA 1XQZA 2JAVA 3JYAA 4DC2A 3TWJA 2QOLA 3Q32A 4XG6A 2CKPA 3FQSA 5A6OA 3B2TA 3ZTXA 3AC5A 3DZOA 5F95A 2REIA 4ANSA 2HZ0A 2UVZA 3ALOA 3QWKA 5AUUA 3FQHA 3CPBA 4XV9A 5KMLA 1UVRA 4BRXA 4LG4A 5JRSA 4IAFA 4L42A 2X2MA 4MTAA 1PXKA 1W7HA 2OF4A 2ZM1A 3AC2A 3BHYA 2V55A 3D5WA 3DBDA 3EJ1A 3FKLA 3G9LX 3HV6A 5H8BA 4A9YA 4U79A 2WIPA 1Z9XA 4YLJA 4HVIA 5I5ZA 3FLZA 2VAGA 2GQGA 3JUHA 3G33A 3V5JA 2QODA 1YWNA 4EQMA 4YPDA 4CLIA 1Q3DA 4EBWA 2V7AA 1OBGA 2ZB0A 4IAZA 1O6KA 5I9WA 1X8BA 3VUGA 4KS8A 2VTTA 2XZSA 2J4ZA 3HDNA 4LQMA 1BLXA 4D5KA 1Q3WA 4GU6A 5AP6A 3VHKA 2RF9A 2HENA 1UU9A 4BCGA 5FEQA 5IMXA 5HTIA 3FDNA 4KKHA 3HAVA 4CFNA 4Y83A 4CFWA 4YJSA 3DKCA 3ORKA 3QGYA 1R39A 4GS6A 4C33A 4OLIA 3R8VA 3UODA 4UBAA 3EFJA 5AUYA 2PVFA 5CAOA 2WTKB 1NVRA 2YCFA 4LRJA 1UV5A 5A9UA 4L43A 4CNHA 3KREA 4AA0A 4LYNA 3C13A 4R5YA 5AP2A 2OXYA 1NT2A 3TJCA 3A7IA 4DH8A 4HPUE 2UZEA 3QRTA 4PL3A 4JQ7A 4YHFA 2HWPA 3MI9A 2YISA 1ZY4A 2XKFA 4U9AA 1Q24A 4FR4A 4DH1A 5LCJA 2UVYA 4EOSA 3VVHA 4F0GA 2W99B 1DI9A 1Q8TA 4U40A 3SV0A 2C6EA 2W1HA 3N9XA 4GT3A 5HBHA 4E6DA 4FT7A 3AC1A 3PP0A 3QCQA 5HBEA 3ORIA 5EW8A 3PRFA 3E63A 2X4FA 4MCVA 1QPCA 3FZPA 1XH8A 4YZDA 4TNDA 2OXDA 3EFKA 4UYAA 4BL1A 1PXPA 1YOLA 1Q5KA 3CGFA 4FT0A 4KSPA 3VF9A 2WD1A 2PVMA 2PHKA 3Q4ZA 3MVLA 5HE0A 3ZONA 3EN4A 4DG3E 3VF8A 4ZMEA 3WZKA 5L6PA 5IG1A 4O96A 3THBA 3EKNA 2YAAA 3SGCA 2ONLA 3EN5A 3TNWA 4ARKA 3NRMA 2CLXA 3OY3A 2R5TA 4BDDA 2BFYA 3SX9A 4UWBA 5EM5A 1HOWA 3DU8A 4IX4A 2UZVA 4TRLA 2BVAA 3L1SA 4HGLA 1Q8UA 5C01A 2GS7A 4JIKA 3O17A 4G9CA 4C57A 3FKOA 2VX3A 4OT5A 2PZRA 4HZRA 4KS7A 4V0GA 4IWQA 4YJRA 2W9ZB 5ITAA 3CGOA 4BI0A 5AR4A 3WI6A 3ANRA 3KL8A 1AQ1A 5CF8A 4XP2A 4FV0A 3M2WA 5AP4A 2ITUA 3QQUA 3FLWA 4JAIA 5HORA 2R0IA 4JVGA 4F9WA 3QTWA 4RIXA 4H58A 4K0YA 4DT9A 2YIXA 3Q2JA 2BILB 3I5NA 3AMAA 1YXUA 5DIAA 4WUNA 4J53A 4MVFA 2OLCA 2ITXA 4RX5A 1UNLA 1SVEA 4F0FA 2YM6A 2VRXA 2Y6MA 1P4OA 4RQVA 4YTHA 5D1JA 5H9BA 2VGOA 3DCVA 4FX3A 1JBPE 3LQ5A 4JDHA 4M13A 3QYZA 2C5YA 1URCA 2FA2A 4PY1A 3SXFA 1WBOA 1PXOA 1R78A 4MNFA 4XG8A 1QPJA 1KOBA 3EQFA 3CEKA 3PE2A 4K77A 4UY9A 3MPMA 3E7OA 4KKGA 3SD0A 4BZNA 3OVVA 2OF2A 2I1MA 3TNQB 3FMLA 1WBNA 3VUDA 4AW0A 4HGTA 4HYIA 4DCAA 3CQEA 1WZYA 3QKMA 5CSVA 2QOOA 4YR8A 3A4OX 4L46A 3UQCA 2UZUE 3UIUA 4YSJA 2ITWA 2IG7A 3P7CA 3IW6A 3R63A 5DRBA 3U6JA 1ZWSA 3AQVA 4WO5A 4FBXA 1H0WA 5AUWA 1CDKA 3FWQA 4JG6A 3UYSA 4AW1A 3D5XA 1PYEA 5EK7A 4F4PA 1HCLA 5EW3A 4EK4A 1A06A 1XH9A 4J8MA 4FYNA 4BICA 3VS7A 1REKA 3QTXA 3FXWA 3P1AA 4IACA 3W2OA 2F57A 2Y4IB 5L2QA 3O2MA 5DWRA 2QG7A 3K54A 2JDSA 4E26A 3MH3A 3GCUA 5CQWA 4NZWB 3RZBA 1L8TA 2VD5A 2GS6A 3AD5A 3NLBA 5L8LA 1B6CB 2E9PA 2FSMX 3R21A 4LUDA 2BIKB 3I79A 5IQIA 2YIQA 4FTAA 1PHKA 1XWSA 4GIHA 4YNOA 5E8YA 2B52A 5HE1A 4JR7A 4WUAA 3ULIA 5EQPA 2BKZA 3OS3A 4O0UA 4ANQA 2FYSA 3HA6A 1H1QA 1OIRA 4DGLC 2CMWA 5AA8A 5J7BA 4D2TA 4PL4A 1UU3A 4LI5A 2OH4A 2F49A 3OWJA 4BF2A 3R2YA 1WAKA 5BUJA 2B9JA 4ZLZA 1QMZA 1OM1A 2DWBA 2GFCA 4FEWA 4DTKA 2BPMA 2GS2A 4BCQA 3KULB 4G16A 3OMVA 5IEYA 3KRXA 3QRJA 1JKTA 4K33A 5J5TA 3O8PA 2WNTA 4RC2A 4ASEA 3DKOA 4IJ9A 1YHSA 4IVBA 3FL5A 4MWIA 3Q4TA 5KMJA 3DJ5A 4D2PA 4EH8A 4BKYA 2J0JA 2P55A 2W4JA 4DEAA 3ZS5A 4E3CA 4U45A 4R77A 4HYSA 5ETCA 4MXYA 3BQRA 5KE0A 3C0GA 4IWDA 4O22A 5DT4A 4C2WA 3MIYA 5E9EA 3OCTA 2XIRA 3DXQA 5GZ8A 4XCUA 3D7TA 2QHNA 3ZEWA 4F7NA 4C2VA 5KMOA 2UW3A 4IB5A 3CTJA 3EYGA 4FV5A 3HV5A 3K3IA 4S31A 3LFQA 5GZ9A 2XNNA 2R3KA 3CLYA 4ANNA 3MJ2A 1ERKA 4HCTA 5JZNA 1K9AA 4EJNA 3FXZA 2QLQA 2PUPA 4AS0A 2GSFA 4AGUA 5BVOA 3G9NA 3W32A 3RAHA 1G5SA 2WXVA 4X3FA 2HK5A 3KCKA 3OF0A 2EVAA 1APME 3AC4A 1YOJA 2GQSA 1ND4A 5DR9A 2YDKA 5CEIA 4CMUA 4CYIA 1Q99A 1XH6A 5AMNA 3TG1A 5CEQA 5IUGA 4N6ZA 4R8QA 4C4GA 3UNKA 4FIFA 2GNHA 4MNEB 3KRJA 4BC6A 4OBPA 3BGPA 3FL4A 4IW0A 1SM2A 2F7ZE 3HUCA 3PWYA 4UB7A 3F61A 4XNEA 2X8EA 4L7SA 5TR6A 4DAWA 3NIEA 5KKRB 3S00A 5I0BA 2WTCA 4FV7A 4FT3A 2QOIA 5CVGA 5D9HA 1JSTA 1UWHA 4P4CA 5K0XA 3SG8A 3QHWA 2F4JA 3ZXZA 3IPHA 2XBJA 4O86A 4U7ZA 4D0XA 2BAKA 3HYHA 4FTCA 4U6RA 5J87A 5CSPA 4YO6A 2GCDA 5DMZA 3GU8A 4NFNA 3V51A 3ZO4A 4C4FA 4Y46A 2WOTA 4G1WA 3UBDA 4QPAA 4O6EA 4TY1A 4J1RA 4AZTA 4L6QA 5LMKA 3QLFA 3U4UA 5G1XA 5E8WA 2WAJA 4MAOA 3A60A 5CVHA 5AR8A 4AN2A 3VS5A 1VR2A 3BV3A 3FHIA 4F1TA 3CCNA 2QO9A 4UWCA 4CD0A 5EW9A 1GIIA 5CXHA 2ZJWA 3BU5A 1FQ1B 2F9GA 2J5FA 4JG7A 4P7EA 3PVUA 1PMEA 4KKEA 3PA5A 4APPA 3OOMA 3QALE 5M4FA 2WMWA 3RINA 2R7IA 3V04A 2WMXA 3C9WA 3EH9A 4O81A 3RCJA 4GMYA 5KNJA 4YJVA 2XIZA 3DGKA 1LP4A 4CCBA 2CNUA 4MEDA 1WCCA 4KA3A 4RC4A 2GMXA 3QYWA 4WG4A 3VJNA 3DTCA 3OOGA 1CKIA 2BDFA 1ZZLA 2BFXA 2PWLA 3DT1A 4KAOA 4BBMA 4L3LA 5E1SA 1W8CA 3KN6A 3NVMB 3R7OA 2XKCA 3MV5A 4CT1A 3EQHA 5JQ8A 3UZTA 4S2ZA 4I92A 3EIDA 3RHXA 4W8DA 4EEVA 2BRHA 4NT4A 3RJCA 3MBLA 4F09A 3CQWA 3SC1A 3TUBA 2WPAA 4LOQA 4A4LA 4R3CA 3UDBA 2HW6A 3KVWA 2VWBA 4CV9A 3D83A 4CMOA 3R71A 3RPSA 3KN5A 4TTHB 5HEZA 2RIOA 1QPDA 4RSSA 4ZTMA 1P14A 5C4LA 3V01A 5AV0A 1UU8A 1V1KA 3ULZA 4F9YA 2XS0A 1OB3A 5AFVA 2QG5A 4APCA 2W9FB 2RG5A 4XRLA 2LAVA 4IJPA 1LEZA 3BLRA 2VWIA 4O7NA 5DR2A 5M06A 5HVKA 4A9TA 1PW2A 4S34A 5EYKA 4DCEA 4F0IA 3WOWA 2XIXA 3LVPA 3MFSA 2VNWA 3VBQA 3ZLWA 2X39A 4ZTSA 4EOLA 4JXFA 5AP1A 4N0SA 3UO4A 1QPEA 2YCRA 4QQTA 1E1XA 4QMMA 4PMPA 4BGQA 3QC9A 3FQEA 1YI3A 3WE8A 3OEFX 5EI6A 3CC6A 1B39A 4ZLYA 2OBJA 1GNGA 2AYPA 3ENMA 3L8SA 2QKWB 3P23A 2HYYA 1Y8GA 2A4LA 2WMSA 5EOBA 4DH5A 4AW5A 1F3MC 1V0PA 3BEGA 3GCVA 4AF3A 4FE2A 3PDTA 3NUAA 2VTNA 3HRBA 5HGIA 3EFLA 4O7YA 2HCKA 3R22A 4IB3A 5GJDA 4EUTA 4RIYB 3ODZX 2Q83A 3BEAA 3RHKA 3I0OA 1ZY5A 3PJ2A 5AIRA 4PP9A 2DQ7X 5AM6A 4EHVA 3VNTA 4EH9A 5BMSA 3FEGA 1RDQE 4TYIA 3PG1A 2UW8A 4YJPA 4BCOA 4DFLA 1DAWA 3KY2A 3HMMA 5AUTA 1OZ1A 3PXRA 4Z7GA 1O6YA 3PTGA 4KB8A 4G34A 2C0OA 5T68A 2GTMA 1B38A 2GNFA 2ONLC 3I60A 4M69B 2QNJA 3OTUA 5ACKA 1YXXA 4WBBB 3B8QA 3EFWA 2QONA 4I6FA 3FLQA 2GHLA 3I7BA 5E8TA 4E5WA 1FGKA 3KK9A 3MVJA 4GJ2A 3LW0A 3FZTA 5BMMA 3R9RA 2X8IA 2FVDA 2PE0A 1FMKA 1OL5A 3NAXA 3PPJA 3L9PA 4MBJA 4ZOGA 5FP5A 1KE6A 2QOQA 4A07A 1FBNA 2ERKA 3AXWA 4FG8A 4YZ9A 3UG1A 4AWIA 4KBCA 4CZUA 4FTUA 4IDTA 5AV1A 5DEYA 4MWHA 4JT3A 2R2PA 4YTIA 4R1YA 4FI1A 3EQPA 5A4EA 1ATPE 4CLJA 4FTJA 4XG4A 3SXSA 3UOLA 3R9DA 3FXXA 4ZLOA 3NW7A 1JPAA 1PKGA 3AT3A 3IW4A 2Z7LA 4F6UA 3MWUA 2JKQA 4OTGA 4C4JA 3ZSGA 2YHVA 4CRSA 5L6WL 2XCHA 1GAGA 3C4FA 2Q0NA 5FEEA 4F08A 2IZSA 4MHAA 4I22A 1H25A 5FDXA 5CAVA 5IQAA 4KD1A 5F20A 2NNWB 5H8EA 3QCSA 3TNHA 5AJQA 4AT3A 4F6SA 3VO3A 5CS6A 5CT7A 2JBOA 3QTRA 2UW6A 4NKAA 1JKSA 1IA8A 4D9UA 2YCQA 5F1ZA 1UNGA 2ZMDA 4QMYA 3H9RA 4WSYA 4XG7A 3W18A 4JS8A 2RSVA 2YJSA 3QKLA 3QQLA 2GFSA 2OWBA 3BGZA 4M12A 5T6KA 2WQNA 5DG5A 3GUBA 1AD5A 3UO6A 3ZLYA 5L4QA 3F2AA 3NW5A 4GFGA 4J95A 3OT3A 4N57A 4FEUA 1Q62A 1W98A 4KIKB 4XS2A 4L45A 4QP2A 4J96A 4LGHA 3MYGA 2CPKE 4U5JA 5EHOA 3RK9A 3FI2A 3IDCA 4BB4A 1JLUE 3BQCA 1OKVA 3OCBA 5E8VA 4FKOA 2RFDA 4JR3A 4H1JA 3SW7A 4HVGA 3QU0A 3ITZA 4JAJA 2NO3A 3KF7A 2PE2A 4G31A 5FG8A 3A2CA 3UPXA 3MDYA 2WMAA 4CSVA 1OPJA 5DFPA 5KHXA 4J52A 1MUOA 3DKFA 3R9OA 3MGYA 1JAMA 3D0EA 3U55A 4FICA 4RJ5A 3QAME 4QMXA 5IU2A 1OMWA 3MSSA 3DJ7A 3ZO1A 5AUZA 3VJOA 2O65A 3BRBA 3F3UA 2KTYA 2YZAA 4RJ6A 4WNKA 3PVGA 4E7WA 3IKAA 4IQ6A 3QTIA 5IQEA 1FGIA 2XP2A 5AIKA 1XBCA 3FBVA 3V5QA 4LV8A 4O7ZA 2J50A 1Q8WA 2UW0A 4NIFA 1ZAOA 3K3JA 2IO6A 3A7HA 4O1PA 2JGZA 2WQMA 4R1VA 5HKMA 1H24A 2PVHA 3FSFA 4H3QA 2OW3A 3JVSA 2UW5A 4FNWA 4C35A 3R7VA 5M4CA 3M11A 4HYUA 1QCFA 3REPA 3FAAA 2F7XE 1MQ4A 3QA8A 4JQEA 4BBEA 4GK3A 5G6VA 3IW7A 4U3YA 4DFXE 1KUTA 1CKPA 4A4XA 4KWPA 5TKDA 4P2KA 4JL9A 1NVSA 4UZHA 3UVRA 1E9HA 2B7AA 3NGAA 3QCYA 2CJMA 3U4WA 3GOKA 4QNYA 3NR9A 4BN1A 5GJGA 4CRLA 5CU0A 4Q9ZA 3BYMA 4HOKA 2C1AA 3TUCA 4AZSA 5DVRA 5BYLA 2X6EA 5HLNA 4DEGA 1UA2A 3QUPA 4D58A 2PTKA 3KCFA 3K5VA 3R04A 2BAQA 4RJ7A 4CFVA 3RM7A 4E6QA 5FD2A 4U43A 2WGJA 4PF4A 3C4ZA 4EL9A 3CKXA 4M0YA 5CU3A 2G1TA 3PRIA 4QTDA 3V5LA 5DNRA 2Z7SA 4AW2A 4DG2E 5CXZA 3GU7A 3JPVA 2A2AA 4JG8A 1BI7A 3FZ1A 3PSBA 3TTIA 4W4XA 4NJDA 4D0WA 4I5PA 2OH0E 4TN6A 2VTSA 3D94A 2HY0A 4CV8A 4ZZMA 1CKJA 4L00A 4L9IA 1YI4A 3HLLA 3ZU7A 3EWHA 4QMWA 1XH7A 1YXVA 4Y5QA 4D1SA 1OBDA 5IKWA 4EC9A 3Q5IA 3COKA 4AN9A 4YZCA 2A1AB 3DPKA 2BDJA 5HG9A 2BUJA 3T8OA 4F1MA 3N4UA 1W83A 4IB0A 1FVVA 2R7BA 2Y4IC 4NM5A 4AQCA 2QCSA 4FTMA 4FV3A 5CWZA 3TNPC 5EM8A 4AU8A 1U5RA 4AA4A 4IAKA 2VWXA 2J0LA 4IZ7A 4ZTQA 3LQ8A 2PVNA 4UMQA 4R3PA 3AD4A 5ETFA 4YJOA 5JK3A 2BIYA 3E5AA 5H3QA 4OTDA 5CAPA 2A19B 2VUWA 3LCSA 4ZJVA 3KMMA 4QMVA 5LMKC 4PMMA 4EK5A 4ERKA 2Y8OA 5CENA 3TUDA 3HUBA 3TXOA 5E8XA 1DI8A 2QOFA 3TDVA 4KIOA 4JLCA 4NCTC 2PSQA 4USDA 5L2WA 3COHA 2JKMA 3LZBA 4RFYA 4XMOA 3BPRA 5EYMA 5JFSA 3W1FA 1KWPA 3TJDA 2R64A 4CGAA 1ZOEA 2BZKB 2C4GA 3D9VA 3PXYA 4GT5A 4G17A 4DGMA 2R3PA 4O0SA 5EKNA 1OKZA 3PA3A 4U8ZA 1PXJA 3AD6A 3IDPA 5E7RA 4YO4A 4O7VA 5HBJA 1Q8YA 4ID7A 4Y95A 4UX9A 3IECA 2UW7A 3DAJA 4EKKA 4FKPA 4RVTA 4FTNA 5EI8A 2UZDA 2VTHA 5D7AA 1YW2A 4YLLA 5AR2A 3ZBXA 3UTOA 1ZYDA 3SQQA 2C30A 3LFAA 5EDPA 3AC8A 4FG7A 1FPUA 3Q2MA 2PULA 4NW5A 4WRGA 3B8RA 4V0GB 2Z8CA 2I6LA 2RL5A 4WKQA 4QTEA 4GIIA 4AACA 2W17A 4OT6A 5HCZA 3W2QA 4DEDA 3OG7A 2IN6A 1WBWA 3CE3A 5HU9A 3LKMA 4R7BA 3HVCA 3MA6A 4EONA 4QMNA 3FYJX 2V22A 1S9IA 5IQBA 4NKSA 2IWIA 5FRIA 3W55A 4RIXB 5AAFA 4ACCA 2OIDA 4QYEA 4PV0A 4G9RA 3W16A 3E88A 3FZRA 3Q4UA 4H36A 4FZAB 1PF8A 4FZ6A 3P78A 4QP4A 5JEBA 5JGAA 2ZM3A 1OL1A 3MH2A 5CI6A 3W33A 3GC0A 3MVHA 2RFNA 3NUXA 2OGVA 5DBXA 5DPVA 2I0HA 2WB8A 3UQFA 3PXKA 2E9OA 4FSUA 4XLIA 3TKHA 5LVPA 1EH4A 3HP5A 3R8PA 3QQFA 5TE0A 5IDPA 3QRIA 4FSWA 5BVEA 4DFUA 4E93A 4I6HA 4MKCA 4YJQA 4DEBA 2Z02A 3LFSA 5LXMA 1IEPA 3EQRA 2AUHA 3V5PA 3VBYA 3FMEA 1UU7A 4RT7A 3OUNB 4O7RA 1IG1A 2XJ0A 3HMIA 5CANA 5KKRC 4TWNA 2JAMA 2VTMA 2IVUA 5IMEA 3LMIA 5CSXA 2X6DA 4GL9A 4EHZA 4EQUA 4QPSA 2ITVA 4RX8A 5HG7A 4USFA 3OC1A 4U97A 1U54A 4D2SA 4AOJA 4X6RA 5K4JA 3H30A 5F9EA 5C8MA 3ANQA 3QQGA 4RX7A 4QO9A 5EDQA 5IH5A 2W4KA 2YFXA 2UZOA 4ZEGA 4CFMA 3ENHA 3TM0A 2PL0A 2P33A 1A9UA 3OBGA 2EXCX 4FTOA 2VTOA 3DK3A 4CQGA 5DOSA 5CALA 5J1VA 2JDTA 4GG7A 4BIEA 2P2HA 3A4PA 3C5UA 3ERKA 3P79A 3QTUA 4R7HA 4BCFA 2X81A 4QMPA 5M56A 3CS9A 4Y72A 3O7LD 3GU5A 3O8TA 4A4OA 5IUHA 1A48A 1VZOA 2XNPA 4FKQA 4Q5HA 1UWJA 3GGFA 3SAYA 4G3FA 5E8SA 4ZY4A 4JJRA 1P2AA 1RW8A 4FOBA 4LUEA 2WOUA 2Z7QA 2YA9A 5AUVA 4PMTA 4EH4A 4GV1A 3ZUVA 4D5HA 3PXQA 3FE3A 4BWPA 4YJNA 2IVTA 2J9MA 5LOHA 4XJ0A 3S95A 3ORMA 5AP7A 4D4RA 2XMYA 4C62A 4D2WA 5JGBA 2XNEA 2QHMA 5LVLA 1Y91A 2PE1A 2BROA 3FPMA 3FLNC 3PVBA 2XKEA 4NM3A 1TKIA 3FMDA 3NYXA 4JDIA 3TL8A 3ZZEA 3S4QA 1YXSA 3AMBA 4FA2A 1YDRE 3EQCA 3OUKA 5DE2A 3LM0A 3BBTB 4DITA 5AUXA 4QMLA 2VTRA 3IQ7A 5DH3A 1SZMA 3A62A 2Y6OA 4FTLA 5TF9A 3CSVA 3IS5A 4FC0A 3UJGA 2WU6A 4CTCA 3FMMA 3KXZA 3VRYA 4EC8A 3HP2A 2R3LA 4FZDB 5L2SA 2XVDA 3LCDA 3HMNA 2RGPA 3QQHA 3R28A 3WILA 4A7CA 4D1ZA 3SLSA 1ZOGA 2ITNA 3A7GA 3QC4A 4XRJA 3MTLA 5B0XA 4RGJA 1SNXA 2VO3A 5EI2A 4EHEA 3GOPA 3D7TB 2PYWA 4PNKA 3QX4A 1JOWB 4RX9A 3M1SA 4WSQA 4BDHA 5M57A 3Q9XA 2IW6A 3UPZA 3EKKA 3ZFXA 4KABA 3SXRA 2WMVA 1GJOA 4K18A 3CY2A 4HZSA 2IVSA 5AAEA 3UMWA 2C3KA 2WMUA 3PVWA 5D12A 2XNOA 5BVKA 2VWWA 3U9NA 5CNOA 2JC6A 3QQKA 5DEWA 4AG8A 5C26A 3QD0A 3ODYX 3UZPA 3DB8A 2JFMA 4K1BA 4RIWA 4X3FB 4QTCA 3UVPA 3POZA 1YVJA 4RVMA 4E8AA 3FI3A 3LQ3A 2QVSE 4RZVA 4UV0A 4YMJA 4RWIA 2W5HA 5CF5A 5ANJA 2IVVA 3ROYA 4O1OA 2X8DA 4FMQA 3IOKA 4YPSA 2G2IA 4DYMA 5FWKK 4X2JA 4A9SA 3AGMA 4RA4A 1ZYJA 3KRWA 4MF1A 4FKJA 1M2QA 1SVHA 4OR5A 4KRCA 3GXLA 4Y85A 5I9VA 3ACKA 3BHHA 4XG9A 3V8SA 4RIOA 4Y5HA 4BHNA 4RWKA 4RWLA 1E1VA 4E1ZA 3EHAA 4EBVA 3PA4A 4FSNA 3R7EA 5AV4A 3RGFA 1MP8A 3ORZA 4FKWA 2YJRA 4IM3A 2W1GA 2EU9A 4FNYA 4I6QA 2CCHA 4QMQA 5BNJA 1G8SA 4FODA 2OU7A 3DS6A 4ZSEA 1FVTA 2QU6A 4F63A 2BAJA 3F3TA 4IADA 3NWWA 3VS1A 1I09A 3ZEPA 3DQXA 4O0RA 5TO8A 4EH2A 3DY7A 1H4LA 3VS2A 1O6LA 4JBVA 4F9AA 5DN3A 4I23A 5M07A 5HQ0A 3GC9A 3I1AA 4YU2A 4MF0A 4KUJA 4ZJIA 3CPCA 1CSNA 5CZIA 2G2HA 4BTFA 3C0IA 4ANMA 2VU3A 3F66A 3Q4CA 4KNBA 4AFJA 4J99A 2JDRA 3NYOA 5L8KA 1H28A 4QP6A 4R6VA 3DBQA 2PK9A 4PDOA 4K6ZA 5AM7A 2JIVA 5GZAA 2W5AA 1JSUA 4EKLA 4OTQA 3C4CA 3NNXA 4IM2A 3UOJA 3DKGA 2O0UA 3FZOA 3HAMA 1I44A 5CZHA 1U59A 4QTAA 3SOCA 4BKZA 4D4SA 2WZJA 4ZTRA 5IQGA 3UOHA 4IH8A 4AOTA 1OUKA 3VAPA 2CN8A 4DN5A 4EZ7A 5IA1A 4CFXA 4L7FA 3QLGA 5BX0A 4OBOA 5D10A 3IO7A 4BY9E 4FL2A 2FH9A 4CVAA 4OUCA 5FM2A 2F2UA 4TW9A 2JKKA 2VTPA 4JI9A 3PYYA 3IGOA 4LM5A 3F82A 3V5TA 4GG5A 4MXXA 1CMKE 2YIYA 5EOLA 5L2IA 3O8UA 3ZXTA 2RKUA 3V6RA 1BL7A 1OKYA 3ZC5A 3HX4A 3O0GA 5CAQA 2O5KA 3P86A 4M68A 4PDPA 2ZAZA 1WBPA 4H3BA 3ZRMA 2EB3A 2GNGA 4L3JA 3QL8A 4NM7A 3C4EA 1H1SA 1G8AA 3CIKA 3RPOA 1PXNA 2OJGA 4XHKB 2ZVAA 3RKBA 3OROA 5B2MA 3DA6A 4C36A 2XNBA 3OP5A 4J8NA 3KB7A 3A99A 1W82A 2Y0AA 3MH1A 1J7IA 3UIXA 4HCUA 3SRVA 1XBAA 2R3MA 5EM6A 3E8CA 2ETRA 3HRCA 4TZRA 2FSLX 2QOKA 3WZEA 3ZLXA 2WMTA 2VX0A 5EDRA 5T3QA 3EZVA 1M17A 4G6LA 5FLFA 3TZ7A 5C4KA 4XV1A 5A6NA 2YLFA 2PVYA 2XYNA 2J0IA 2NRUA 3NEWA 4OAVB 4KSQA 4L3PA 4GKIA 2Z7RA 4NEUA 3CD8A 4AE6A 1OPKA 4QPMA 3SW4A 3TZ8A 2PVKA 3ZUUA 4BKJA 1V0BA 2BDWA 2J2IB 4LRMA 5FGKA 3Q5ZA 2DS1A 3WF9A 3LLAA 3MVMA 3D15A 3PXFA 4AGDA 3DXNA 4EWQA 4QMTA 3A7FA 3G51A 3LCTA 5GJFA 5FP6A 3COIA 4JDKA 3QFVA 4ENYA 4HCVA 2CLQA 4QMSA 4I0SA 4IB1A 2R3GA 4X2NA 3W2RA 4CKIA 2O64A 4EYJA 3UO5A 2B4SB 4M84A 4MD7E 4GH2A 4U0IA 3QD3A 3ZCLA 1PJKA 3DDPA 2X0GA 3LFBA 2XK6A 5AEPA 5KHWA 5HICA 3QBNA 4AZVA 3MIAA 3LHJA 4GK2A 4CFUA 3OD6X 5KBQA 3WIGA 4KIPA 4PPAA 4X2GA 3FHRA 3SKCA 4I3ZA 1ZMWA 2GHMA 3PPZA 5H8GA 2XKDA 2WELA 1XJDA 3VBWA 4PDYA 3L8XA 4ALUA 3KMUA 3C4WA 2A0CX 4XOYA 3RPYA 4GEOA 3KXMA 4C4HA 2O3PA 1M14A 3F3WA 3TIZA 3KRLA 5BYYA 5C9CA 1M2PA 5HVJA 5CEOA 5I9YA 2YWVA 5LVNA 5A4TA 3FJQE 4FKGA 5EG3A 4FKUA 2C5OA 3SDJA 4EHGA 4E5AX 5K3YA 3P7BA 1MRUA 4LL0A 4YTCA 4IEBA 2PMOX 2GTNA 2X1NA 4DTBA 1H07A 4BI1A 3HECA 4I1ZA 2QURA 3R6XA 2W96B 2Z2WA 4RJ3A 5CF6A 3Q9ZA 2UZNA 3HEGA 3BCEA 3F69A 1NXKA 3LXNA 4EOQA 1BX6A 4CYJA 3ATTA 2AC5A 3E7VA 4BR3A 2OKRA 5ANEA 4E6AA 3FC2A 2VTAA 3DBCA 2UZWE 3BYSA 2R3JA 4QNAA 2BTRA 3F3VA 1OGUA 2HW7A 2UV2A 4FVPA 4FZFB 1YOMA 2E9VA 2XM8A 3NX8A 5HO7A 3CXWA 3P5KA 1YWVA 5HCYA 5LVMA 2E9UA 3CY3A 4H1MA 4N4SA 4USEA 4BGHA 4JX3A 3KRRA 1VJYA 3K5UA 3HZTA 4XLVA 4XH6A 4U3ZA 4JBQA 4DLJA 4B0GA 3LCOA 3Q3BA 3PJ1A 3AGLA 4O82A 4O2ZA 5DGZA 3A7JA 4FGRA 1YXTA 2ZMCA 3HV3A 2YM4A 4ZAUA 3BELA 3FI4A 5AP5A 5JFWA 1DM2A 1YRPA 2UZBA 1IRKA 4DH7A 3OT8A 4CQEA 3BHVA 2XYUA 3ZDUA 3HA8A 4E6CA 3Q04A 5M44A 1R1WA 3PXZA 2C6OA 2H8HA 3MN3A 4GSBA 4O21A 4C0TA 5M4IA 2RFSA 1NY3A 4PMSA 2WKMA 5AWMA 5IA4A 5EQYA 4I5CA 4U42A 4I6BA 5HTBA 4Q2AA 1Q97A 3RI1A 2PMLX 3NZ0A 5TOZA 1TQIA 2HZ4A 2UZTA 4FG9A 2EB2A 5E90A 2QOBA 2ACXA 3WF7A 5E92A 3MA3A 4ORKA 1K3AA 3LM5A 5IZFA 4CZTA 4D4VA 4FTTA 4V04A 4LGDA 1GIJA 4GVAA 3BE9A 2R3HA 4NIFB 4O83A 4MYGA 3L9LA 1PY5A 3EQDA 2WTJA 4GT4A 4I94A 5A46A 1ZZ2A 1JQHA 3LXKA 3R7UA 4XYFA 4IAYA 3TT0A 3DV3A 4TYJA 1NVQA 2QO2A 5ETIA 4IC8A 4FEXA 2VO0A 3QTZA 4O0TA 1G3NA 3VQHA 2Q0BA 4FIJA 4ANBA 5AV3A 4HGEA 1J1BA 3AC3A 3PWDA 4RJ4A 1ZMUA 1Q61A 3P4KA 3PZEA 3RP9A 5CAUA 5A54A 4EJ7A 3BYUA 4EK6A 3KXNA 4EH7A 4RLLA 4ACDA 3OFMA 1OECA 2OJJA 4NTTA 2C6MA 2OK1A 4M66A 5E91A 3EN7A 1MQBA 3LJ1A 3GI3A 3PFQA 3DJ6A 5HE2A 3RVGA 3WBLA 4GFOA 4DGOA 4CG9A 4GK4A 4FNZA 3UC4A 2QKRA 3GQLA 3VW6A 5AV2A 3VBTA 1VYWA 2ITPA 4G3GA 3E3BX 5HX6A 4C38A 2BZHB 2ETKA 3EQBA 3TI1A 1LR4A 2C47A 3VS3A 4BDGA 5AADA 5I4NA 5EH0A 3LPBA 2YM8A 2GDOA 3R1YA 1PMUA 4FSRA 4G6OA 1F5QA 4QTBA 4RJ8A 5E8UA 2YABA 5KMNA 2J5EA 5JN2A 4FIGA 4C02A 2YERA 5CEMA 2PVRA 5AX9A 4PPCA 1BUHA 4NL0A 1J91A 2XUUA 3QKKA 4O84A 1P5EA 5IEVA 3GC7A 2C3LA 4FV8A 5LARA 4QOXA 1Q8ZA 3R7YA 4DFNA 4R5SA 2YITA 3PIYA 4TYHA 2W05A 2IZUA 3FV8A 5KMKA 1M7NA 4ACHA 2R3NA 2VGPA 4M14A 4BDIA 2OO8X 4M67A 4IVCA 4ASXA 3OXTA 3R30A 4AX8A 3Q6WA 3WIKA 3RMFA 3C0HA 4UALA 3QUDA 4IZ5A 3LAUA 5FXQA 5LQFA 4DBXA 3BE2A 2CNQA 3LMHA 5K4IA 4BCJA 2FGIA 1Y8YA 1IR3A 2GQRA 1OL2A 1L3RE 2CGVA 3TDWA 2ERZE 4RFMA 5GIPE 4LMNA 1J1CA 3D7ZA 4O7TA 3AT4A 2YEXA 2WTVA 4RQKA 3ZUTA 4MX9A 4PUZA 5JFXA 4FUXA 4GUBA 3UP2A 2WU7A 4UXQA 4FKRA 3OHTA 4I24A 2BZIB 4L8MA 4PWNA 5FBNC 4FGBA 3ZDIA 4C3PA 2UUEA 1STCE 5BPYA 3FKNA 4TPTA 4UZDA 3VWAA 4YBKA 3L9MA 4F9CA 2ITYA 4QP9A 2H6DA 3W8LA 2J6MA 1ZYSA 1H00A 4JRNA 3RNYA 4U44A 4BWXA 4ZIMA 1WMKA 2WFYA 5ANGA 2RFEA 1WBTA 3A61A 4HNIA 5JSMA 4R78A 4HYHA 1Q41A 4X6QC 4G5JA 2H34A 3QRKA 3MFTA 4AN3A 2C3JA 3VBVA 4TT7A 3R2BA 3DAKA 2WMQA 4FV6A 4W4WA 4TL0A 4ITIA 4JX7A 4KIQA 5GNKA 1J7LA 3VS4A 3OW3A 5CU6A 2FB8A 2QU5A 3ZSIA 5IA5A 4S32A 3NSZA 4JBPA 4YTFA 3HNGA 1YKRA 1M2RA 3BIZA 4BWKA 2XNMA 2ITZA 3UYTA 4UMUA 4O0WA 4C7TA 4FT9A 3GFEA 2XK7A 4I93A 4RA5A 4BTKA 4GFMA 3WZDA 2XF0A 2G01A 2DYLA 2ZV8A 4IM0A 1H0VA 3WF8A 4PL5A 1TVOA 3MY5A 2HELA 4HVHA 3OTVA 4O38A 4BBFA 4X3FC 4C61A 5D7VA 5J9LA 2FSTX 3F5UA 2PZYA 5LMAA 4E4XA 3QD2B 1FINA 2WO6A 3TZMA 2FO0A 5AP3A 4FL1A 1VEBA 4QYGA 3CJFA 1H26A 4II5A 3E92A 2V62A 4ZY6A 4ZMFA 1M7QA 4BDEA 4ZS4A 3O7LB 3T9IA 4IVAA 5AAGA 4ASDA 2WEVA 5E4HA 4FV1A 4Z55A 5JMSA 4V01A 1REJA 2ZV9A 3NUSA 3SHEA 4CZYB 4WG5A 2R3FA 2VWUA 3KC3A 4TWOA 5L6OA 4X21A 2W1ZA 1PMNA 2XJ1A 1CM8A 4OW8A 4WD5A 3ZFMA 1WFCA 3H4JA 4O0VA 4DF3A 3CKWA 3DK6A 3BYVA 3QUEA 4PNIA 4WIHA 2OFUA 1DAYA 4IZAA 4F99A 4JRVA 4BVUA 2AC3A 4FIHA 5EYCA 4ASZA 2GNIA 2KULA 1Q4LA 4GRBA 3ZM9A 5M4UA 4TKSA 1KSWA 2YM5A 4TXCA 4DHFA 4A9UA 3SOAA 3SVVA 2ZOQA 3UC3A 2XIKA 4F65A 2H9VA 3TIYA 5HX8A 3ORLA 3PIZA 4BTMA 1H1PA 1JKKA 1ZXEA 3WF6A 5FEDA 1IA9A 3MY1A 3TV4A 3KXHA 2UW9A 3FLSA 3ZH8A 4X3JA 3VW8A 4FKVA 4AZEA 1KV2A 2XNGA 5J1WA 5CASA 3Q9YA 3QXPA 1MRVA 2V0DA 1WBSA 2UW4A 4PTEA 1LEWA 1ZARA 4U41A 4TYEA 5HIDA 4XX9A 3DAEA 2F2CB 4AXAA 4UEUA 3D2KA 4A06A 2OJ9A 5LWMA 2VNYA 4EOKA 3V8TA 4I0TA 2WTIA 3WZUA 4DEIA 3R0TA 2CDZA 3EYHA 4ZSJA 4DTAA 4FTKA 4BDAA 4BI2A 2QQ7A 4S33A 4FIEA 4FEQA 1PRYA 3DFCB 3MTFA 2VWVA 4RFZA 3I6WA 4RG0A 4S30A 4WNPA 2XA4A 3GP0A 2YM3A 3ZO3A 5D11A 4FSYA 5KMMA 3E8DA 3EMGA 3ZYAA 3LCKA 5H2UA 2OIQA 2O63A 3CTQA 3R1NA 5KUPA 1GZKA 3PJCA 4UMRA 2OICA 2B0QA 4EOOA 3FPQA 3BX5A 3DLZA 4CT2A 4Z16A 4ZY5A 5HLWA 2ITQA 3R8UA 4TWPA 2CGUA 2WQOA 4LMUA 3BBWA 2VTIA 3SG9A 3KF4A 4CKRA 4F7JA 2WMRA 2IW8A 3LJ0A 3U6HA 3U51A 3DNEA 1W0XC 4DFBA 3DK7A 4C4IA 4TYGA 3S3IA 5M09A 4EQCA 2J0KA 3GCQA 3QF9A 4QRCA 2BKKA 3KA0A 3NYVA 4FTIA 4EOIA 2CHLA 4RLKA 3QRUA 3QD4A 4OTPA 4ZZNA 2WEIA 2PMNX 3CTHA 4N6YA 5F4NA 1PXMA 2OZAA 3BU3A 4ACGA 4WG3A 2JIUA 5JFVA 2HIWA 3GCSA 2X9FA 3AMYA 3VIDA 3UP7A 1M52A 2VTLA 2UVXA 1AGWA 2BR1A 4C34A 4IVDA 4MXZA 4IIRA 3UE4A 4EOMA 2V5QA 4UN0C 3UIMA 3VUKA 5KX8A 4RIWB 2XBAA 5E1EA 2ZYBA 4IAAA 4MH7A 4F70A 4EOPA 4JIAA 4RWJA 3HL7A 4DINA 3KU2A 3LFEA 3PY3A 5JRQA 4FYOA 3T3UA 3QHRA 2I40A 5IQDA 2BHHA 2BHEA 4XV2A 3MESA 5EQEA 3VQUA 3T3VA 2GU8A 4ITHA 4B8MA 2EUFB 2VZ6A 1XH5A 4C3FA 3EQGA 5HU3A 1ZRZA 4NTSA 5J5SA 5KO1A 4IX3A 3CD3A 3FZSA 4BZDA 5M55A 3BKBA 4F9BA 2BMCA 2BTSA 3GB2A 5IQFA 3BLHA 3S2PA 3H9FA 3KEXA 5A14A 2OSCA 2W5BA 5ANOA 4BDJA 3R8LA 1W84A 5ANKA 3NIZA 3VUTA 2X4ZA 2B1PA 3A8XA 5J9YA 5EYDA 4EWHA 3NVKI 1WBVA 4XOZA 2BRNA 3CJGA 5HHWA 4W8EA 4L53A 4O0XA 3S1HA 3W2PA 4QQ5A 5J95A 5BQ0A 4BCNA 1OUYA 1WVYA 3EOCA 4FSMA 2HXLA 3I7CA 3RALA 3F7WA 3ORNA 4FZ7A 3H0YA 4RC3A 2PPQA 4GU9A 4FV4A 3AG9A 3B2WA 1KE7A 4UWYA 1U4DA 3IGGA 4MQ1A 4O2PA 4YSMA 3ROCA 5I9XA 5K9IA 5M08A 3VRZA 3RAWA 4D2RA 2P3GX 3NDMA 5K5XA 3UNJA 3ATSA 3EN6A 2OI4X 4ZSAA 3QZIA 4G3DA 3I4BA 2FUMA 4RVKA 3E93A 2VTJA 3KXXA 4V05A 5FXSA 4Z3VA 4FEVA 2JIIA 5AX3A 3FLYA 5BVWA 2PUNA 3MY0A 4AFEA 5CF4A 3FYKX 3MS9A 4JBOA 4EH3A 2SRCA 2W1CA 2LGCA 5CVFA 4G2FA 3DLSA 4EK3A 4KRDA 4ZTNA 4C4EA 1MRYA 5CEKA 3V6SA 4CG8A 5C8NA 4YNEA 3WF5A 2CKQA 2ZV7A 4QP7A 4EH6A 4O27B 4IXPA 3RWPA 4D2VA 4W4VA 2O2UA 4EI4A 1S9JA 3ZFYA 4PP7A 1BL6A 1YWRA 4D9TA 5KCVA 3MJ1A 4GYIA 2XK4A 3D4QA 3LJ2A 1UNHA 3VN9A 3GC8A 2BRBA 4J71A 1UKHA 4P5ZA 5CI7A 4C59A
chains in the Genus database with same CATH superfamily
4YGAA 3D5UA 5JH6A 1H27A 2ITTA 3EQIA 2JD5A 3BWJA 4HPTE 5CQUA 3V5WA 5J79A 5HI2A 1RJBA 1DS5A 4QP3A 4L01A 5FUTA 2PUIA 4JOAA 1H8FA 3O71A 2XARA 4DFZE 1K2PA 3G0EA 2YCSA 1Y6AA 2BRGA 3K2LA 3ZHPC 4OAUC 1H1RA 3SRVB 5L8JA 2JEDA 4RMZA 4YLKA 1OL7A 1YHVA 3R02A 3BHTA 4LRKA 2CGXA 1U5QA 4IX5A 5IH6A 3O51A 5C27A 5I9ZA 2HY81 2R9SA 2XIYA 3KK8A 5JKGA 3I81A 5B2LA 2CGWA 1JNKA 1QL6A 2PUUA 4H05A 3I0QA 4DLIA 3ZLSA 4YZNA 1H01A 4X2FA 5L2TA 5LMBA 1RE8A 3IW5A 1TQPA 1Z5MA 3Q6UA 5A4LA 1IASA 4GUEA 1NA7A 2B55A 2BCJA 4NFMA 3R83A 4YJTA 3GENA 4WNMA 3VUMA 5HE3A 5IH4A 2OG8A 4ALWA 3ORXA 3Q96A 1XBBA 5CLPA 2HWOA 2JBPA 3RTPA 1XKKA 3C50A 4FIIA 3JVRA 3P7AA 3NCZA 2J0MB 2XM9A 3UZRA 3PY0A 5L3AA 3HMPA 4CFFA 2E2BA 5BUEA 3IW8A 3VUHA 5FXRA 4DDIA 3LOKA 3Q9WA 4E4NA 3PJ3A 4QYYA 3M42A 3FMNA 1JVPP 5IUIA 3ZC6A 4IWPA 4BDFA 3H3CA 4NJ3A 5JT2A 3ZOSA 3PY1A 4IHPA 3G90X 3N4TA 3VBXA 2C1BA 4L68A 5I9UA 4M15A 3U8WA 1OIYA 3HRFA 3F2RA 4GVJA 4HVSA 4FVQA 4LOPA 1FVRA 3QZGA 3OCGA 2PZPA 2WMBA 4IANA 3VULA 1LUFA 5IISA 1Z57A 3F88A 3RM6A 1UKIA 1ZLTA 3E64A 5C03A 1T46A 5IEXA 4Y73A 3F9NA 2QD9A 4MQ2A 4FSQA 2C0TA 3DQWA 1XHAA 4ZSLA 4FKLA 3GU6A 4J98A 5TT7A 3TNIA 4EH5A 3R8ZA 3UQGA 2F7EE 3W8QA 4ZSGA 4NW6A 2XEYA 3LIJA 5A4QA 3S0OA 2R3IA 1Y57A 4C58A 3PP1A 2W1DA 3FUPA 4FOCA 4I0RA 3UG2A 3D14A 5ICPA 3G6GA 2PY3A 3RNIA 2HXQA 3OCSA 2C6KA 1ZMVA 2JFLA 2VTQA 2VWYA 3KQ7A 2HZNA 3HMOA 3LFNA 4JQ8A 4ZK5A 4I4EA 2VV9A 5CEPA 3MPAA 3DDQA 2NPQA 2ZM4A 4XEYA 2EWAA 3DBEA 1KE8A 3MB7A 3FY0A 4BZOA 3OEZA 1J7UA 3OXIA 5LWNA 2XJ2A 2W7XA 3NCGA 4WNOA 2NRYA 3OWKA 5E8ZA 2PVLA 3N51A 3VS6A 2J51A 3VONA 3IONA 4YHTA 3TTJA 3LLTA 5BVFA 5DYJA 1KE9A 3H10A 1YQJA 5CU4A 3TN8A 4FTQA 2BZJA 1FOTA 2HOGA 1ZYCA 5HIBA 1GZNA 4PQNA 4BHZA 5HOAA 2EXMA 4I5HA 2B9FA 5HNBA 3TV6A 3ETAA 3OY1A 4MD9E 5JQ5A 4RZWA 4FUYA 5BVDA 3EN9A 2QO7A 4BCMA 3AKJA 1CTPE 1ST4A 4O4EA 3G5DA 4FF8A 2OIBA 3PJ8A 3F5GA 4QP8A 1OKWA 5IA2A 3ACJA 4LGGA 2DUVA 2OFVA 5J8IA 4AGWA 4QQCA 2P4IA 5IQHA 3V8WA 5B2KA 3HV4A 3KMWA 1PXIA 3L9NA 5HLPA 1YHWA 3BGQA 3OW4A 3D5VA 2JLDA 4NWMA 3GT8A 1WVWA 5JZJA 2QI8A 3MW1A 4PRJA 2C6DA 5HZNA 2Y7JA 4RRVA 3VUIA 4OGRA 4GYGA 5DLSA 2R3QA 4DEHA 5I3OA 2ZB1A 5J7HA 3C4XA 4NUSA 4QMUA 2GPHA 2R3RA 3ZMMA 2WQEA 3W0PA 3WYYA 2YACA 4UMPA 2XEZA 4NU1A 4O0YA 5DT3A 3L8PA 1KV1A 3HKOA 4X0MA 3TCPA 3TEIA 3P0MA 4NCTA 2CKEA 4K11A 2E9NA 2HZIA 3WE4A 2JDVA 4B7TA 3JS2A 3UMXA 4ANOA 2C6IA 3KULA 4QMZA 3WYXA 3JY9A 4DHZA 2C6TA 4L44A 5A3XA 5FTOA 1JKLA 1OI9A 2X0QA 2XH5A 4MK0A 3R8MA 3PSDA 4WT6A 2IW9A 5J9ZA 4BIBA 4AXFA 5HO8A 1V0OA 2ZDUA 1XMMA 1GZOA 1PYXA 4AUAA 5KBRA 3ELJA 3F7ZA 5HNIX 3FMHA 3LFDA 3UIBA 3QZHA 2CN5A 3NNVA 3PSCA 2NP8A 3I6UA 4IC7A 2EXEA 4OTRA 2G9XA 5IQCA 4UYNA 5D41A 4Z7HA 3JY0A 1ZOHA 2PZIA 3CQUA 5DR6A 4AXDA 4K9YA 4ENXA 4QP1A 4MBIA 2QR7A 5AA9A 3DXPA 3GNIB 2B9HA 3HGKA 3COMA 3ORTA 3KGAA 2XRWA 4Q9SA 4QMOA 5HD7A 3OWPA 4QDVA 4YC6A 4QQJA 4QYFA 4AE9A 1HCKA 3R1SA 5BYZA 1Y6BA 5DHJA 1YDTE 3NUPA 3VC4A 2X7FA 4M8TA 5ANIA 2PVJA 3BYOA 1SVGA 3W10A 4CMTA 2XK3A 4F64A 5BVNA 5K0KA 3NUUA 5B7VA 3O96A 2QOHA 2YWPA 3G0FA 3KKVA 3L8VA 4FK3A 4IZYA 4Q5EA 5DRDA 3W2CA 4NK9A 4OTWA 1XR1A 4LV5A 1XO2B 4FSTA 4M7IA 4P90A 3ZO2A 5HTCA 4QYHA 4E4MA 4DA5A 3R1QA 3PLAE 3O23A 3RAIA 3IOPA 4MNEA 5EHYA 5GINE 2R4BA 5ETAA 2YLEA 3BWFA 3UDSA 1GY3A 3RZFA 5FQDC 4BFMA 3NW6A 4BCKA 3N4VA 1PMVA 1XH4A 3EL8A 4MXCA 5F94A 4NSTA 3UGCA 3ZRLA 2C5NA 5AR3A 1VYZA 5AR7A 4ZJJA 3LE6A 4KINA 3JR1A 4E5BA 2WQBA 2WIHA 5LVOA 2FSOX 2W1IA 4BDCA 4TYHB 4ZXTA 4F7SA 5LJJA 3QA0A 3QX2A 3Q53A 3QWJA 2IJMA 4XG3A 5CSHA 4D4YA 3F5PA 5FTQA 2YAKA 5HO6A 3TKIA 4ONAA 4OBQA 3KXGA 3KVXA 3RPRA 4QDEA 3ZSHA 3IDBA 2VX1A 3UVQA 4NYEA 3ID6C 3NPCA 4E73A 4BCIA 4LDTA 1ZYLA 3GFWA 3PPKA 2XK9A 3F2NA 3R9HA 3G15A 4XP3A 4PDSA 4IDVA 2I0YA 2X2LA 4ZTHA 3QCXA 4I21A 4W9XA 5CT0A 3U6IA 2XRUA 4H3PA 4G5PA 5JGDA 3NNWA 4FL3A 4YZBA 4FVRA 3F3ZA 3MB6A 2BRMA 1GZ8A 3QZFA 3GQIA 4M0ZA 1R3CA 4QD6A 4AGCA 4BIDA 1IAHA 2VWZA 3ET7A 4Z9LA 4WOVA 4XBRA 3KFAA 2YDJA 3CBLA 5EFQA 4MXAA 4EYMA 4DGGA 1G8KA 2I0EA 4K2RA 4G3CA 4W9WA 1R0PA 4PTGA 2V7OA 5LCKA 2OJIA 2QLUA 3RWQA 4IFCA 1T45A 4IAIA 4Y8DA 3ZM4A 1H08A 4O7SA 2GNLA 3NNUA 4NH1A 5HG8A 1LPUA 2C6LA 3DZQA 5CSWA 4FSZA 3EB0A 4F1OA 3GCPA 3ALNA 3WZJA 4YURA 1KOAA 2Y9QA 3R00A 5M51A 4O4DA 3MPTA 2JDOA 4OTIA 4AT5A 4ACMA 2JKOA 4LL5A 5HVYA 1TQMA 2A27A 2ZDTA 2CNVA 5HG5A 1OPLA 4YHJA 1R0EA 4FT5A 2A98A 4PPBA 1U46A 4BTJA 2I0VA 3II5A 5EKOA 2GHGA 3A8WA 3AOXA 3DTWA 5I3RA 4G6NA 3JXWA 4KBKA 3CP9A 2WHBA 4LFIA 4EZ5A 3BI6A 3UOKA 2G15A 3TV7A 4HGSA 3MFUA 2IPXA 1KE5A 3LXPA 5C8KA 3NAYA 1YI6A 3U54A 2W06A 2IZTA 3R7IA 2W1EA 4OTFA 4PTCA 4U81A 3DNDA 5HIEA 3RPVA 2WTKC 3BZ3A 4BYIA 3E62A 4D28A 4L67A 1OVEA 5IA3A 4DHJA 3NUNA 2QR8A 4GJ3A 4ZP5A 3FMKA 3F6XA 1OIQA 4MXOA 4IMYA 3GU4A 2ITOA 4YZMA 5HESA 4FNXA 3FY2A 4FKTA 4R7IA 4M97A 5ACBC 4FV9A 1URWA 2JITA 3QTQA 4QT1A 3H0ZA 4BJJA 2PU8A 3IG7A 4N70A 5GHVA 1OITA 2HAKA 5KMIA 4PX6A 3VHEA 4YJUA 4AOIA 4KBAA 3PG3A 2OXXA 2VO7A 3R73A 4F7LA 2RG6A 4I41A 3VS0A 4XV3A 1SMHA 4F6WA 2R3OA 4IX6A 4AAYA 5DT0A 4C37A 3C5IA 3RK7A 4BDKA 5FBOA 4RIYA 1WVXA 3PUPA 3BHUA 4FTRA 1NW1A 1SYKA 2ESMA 3E3PA 3BU6A 3FC1X 1BMKA 4JNWA 5AR5A 4CXAA 2ZFYA 2UZLA 4WBOA 5K5NA 5GIOE 3Q52A 4L52A 2VO6A 3R7GA 3E8NA 5AP0A 4DH3A 4TNBA 4I20A 4OTHA 3W0SA 4AZFA 5FM3A 3R01A 5C1QB 3C51A 4WA9A 5KZIA 5IA0A 4J97A 2OZOA 3DBFA 4WRSA 3I5ZA 3LFCA 1G8JA 4M69A 3UNZA 4AP7A 5A4CA 3T9TA 4YC3A 3NYNA 4CTBA 4YUQA 4ITJA 2QOCA 3DFAA 2O8YA 4IWOA 2PZ5A 3C1XA 3PZHA 3QGWA 2W1FA 3MH0A 1PXLA 4CCUA 3MFRA 4C8BA 3OZ6A 5HD4A 4X7QA 2BALA 4RPVA 4XUFA 4NM0A 4W4YA 4E4LA 1YDSE 2X9EA 3PE1A 3QXOA 4HVDA 2WTDA 5HNGA 3V3VA 4ALVA 4YP8A 3E87A 3RAKA 2C5VA 4MD8E 4AT4A 2C3IB 4HW7A 4EUUA 4GW8A 4M3QA 4AAAA 1GOLA 2IZRA 4I4FA 3OXZA 4ZZOA 5M53A 1RQQA 3ZZWA 5EHLA 4DBNA 2J7TA 4BCHA 3DOGA 2P0CA 2XCKA 5EM7A 4FK6A 5DI1A 5CTPA 2P2IA 2R0UA 2B53A 4B8LA 4O91A 5FDPA 4ANLA 5HCXA 3NUYA 2CKOA 3HV7A 2X7GA 3HDMA 3ORPA 3DB6A 4O4FA 4XP0A 3EZRA 1SNUA 3G2FA 4B6LA 5CNNA 2Y4PA 1H1WA 3BLQA 4RVLA 2XK8A 3LFFA 2ETMA 5ANDA 3GEQA 4ZTLA 3U9CA 4EORA 3CR0A 4CEGA 4HNFA 4P5QA 3NS9A 3QQJA 2B54A 4H39A 4BYJA 4B99A 3RBWA 1BI8A 3LXLA 4FV2A 4DGNA 4K8AA 2ZV2A 3C7QA 5CYIA 4FKSA 4DT8A 3EL7A 2Z60A 1BYGA 3OWLA 4C3RA 1PKDA 3TKUA 2C5XA 4BDBA 5CU2A 2OZAB 5KZ0A 4KIKA 4YC8A 2J90A 4WHZA 3ZRKA 3BV2A 4D1XA 3SA0A 1IAJA 2YDIA 4IFGA 4JDJA 4GKHA 2QC6A 4UXLA 4AA5A 3FMJA 2X7OA 3F5XA 2X2KA 4EOJA 4O6LA 4O7WA 1BKXA 2VN9A 1U54B 4J7BA 2YN8A 3RK5A 4DEEA 5IPJA 2I7QA 1OIUA 3P9JA 3PLSA 4UMTA 2CCIA 3D2IA 4R3RA 4DG0E 1OL6A 4EZ3A 2YIWA 3POOA 4XG2A 3P08A 4FKIA 2G2FA 1O9UA 4YBJA 5DA3A 2W0JA 2YM7A 5IF1A 5CY3A 3TACA 4B9DA 1JWHA 2YIRA 4D55A 4E20A 4CKJA 3ZBFA 4O7LA 1GIHA 4HJOA 2YZLA 3O50A 2C69A 3OBJA 4U80A 3U87A 4X2KA 4DFYA 4A9RA 3W2SA 4XBUA 3RCDA 2PMIA 3TZ9A 4MBLA 4BCPA 2XB7A 2H96A 2C68A 4IBMA 2WTWA 1F0QA 4RBLA 3QTSA 2B9IA 1P4FA 2GNJA 3GBZA 4ERWA 4IE9A 1J3HA 3IK3A 4G3EA 5BUIA 3NMUF 2W4OA 4TWCA 5FTGA 5CX9A 4AZWA 3E8EA 3Q60A 3H9OA 4I5MA 4DE4A 3AT2A 4LOOA 1JSVA 4GCJA 4EK8A 5IDNA 1FMOE 3PIXA 3WARA 4BGGA 2OJFE 3FI8A 3LMGA 4DF3A 2C0IA 3FSKA 4B4LA 3G6HA 3R9NA 4ZS0A 3GVUA 2CSNA 1XQZA 2JAVA 3JYAA 4DC2A 3TWJA 2QOLA 3Q32A 4XG6A 2CKPA 3FQSA 5A6OA 3B2TA 3ZTXA 3AC5A 3DZOA 5F95A 2REIA 4ANSA 2HZ0A 2UVZA 3ALOA 3QWKA 5AUUA 3FQHA 3CPBA 4XV9A 5KMLA 1UVRA 4BRXA 4LG4A 5JRSA 4IAFA 4L42A 2X2MA 4MTAA 1PXKA 1W7HA 2OF4A 2ZM1A 3AC2A 3BHYA 2V55A 3D5WA 3DBDA 3EJ1A 3FKLA 3G9LX 3HV6A 5H8BA 4A9YA 4U79A 2WIPA 1Z9XA 4YLJA 4HVIA 5I5ZA 3FLZA 2VAGA 2GQGA 3JUHA 3G33A 3V5JA 2QODA 1YWNA 4EQMA 4YPDA 4CLIA 1Q3DA 4EBWA 2V7AA 1OBGA 2ZB0A 4IAZA 1O6KA 5I9WA 1X8BA 3VUGA 4KS8A 2VTTA 2XZSA 2J4ZA 3HDNA 4LQMA 1BLXA 4D5KA 3PFYA 1Q3WA 4GU6A 5AP6A 3VHKA 2RF9A 2HENA 1UU9A 4BCGA 5FEQA 5IMXA 5HTIA 3FDNA 4KKHA 3HAVA 4CFNA 4Y83A 4CFWA 4YJSA 3DKCA 3ORKA 3QGYA 1R39A 4GS6A 4C33A 4OLIA 3R8VA 3UODA 4UBAA 3EFJA 5AUYA 2PVFA 5CAOA 2WTKB 1NVRA 2YCFA 4LRJA 1UV5A 5A9UA 4L43A 4CNHA 3KREA 4AA0A 4LYNA 3C13A 4R5YA 5AP2A 2OXYA 1NT2A 3TJCA 3A7IA 4DH8A 4HPUE 2UZEA 3QRTA 4PL3A 4JQ7A 4YHFA 2HWPA 3MI9A 2YISA 1ZY4A 2XKFA 4U9AA 1Q24A 4FR4A 4DH1A 5LCJA 2UVYA 4EOSA 3VVHA 4F0GA 2W99B 1DI9A 1Q8TA 4U40A 3SV0A 2C6EA 2W1HA 3N9XA 4GT3A 5HBHA 4E6DA 4FT7A 3AC1A 3PP0A 3QCQA 5HBEA 3ORIA 5EW8A 3PRFA 3E63A 2X4FA 4MCVA 1QPCA 3FZPA 1XH8A 4YZDA 4TNDA 2OXDA 3EFKA 4UYAA 4BL1A 1PXPA 1YOLA 1Q5KA 3CGFA 4FT0A 4KSPA 3VF9A 2WD1A 2PVMA 2PHKA 3Q4ZA 3MVLA 5HE0A 3ZONA 3EN4A 4DG3E 3VF8A 4ZMEA 3WZKA 5L6PA 5IG1A 4O96A 3THBA 3EKNA 2YAAA 3SGCA 2ONLA 3EN5A 3TNWA 4ARKA 3NRMA 2CLXA 3OY3A 2R5TA 4BDDA 2BFYA 3SX9A 4UWBA 5EM5A 1HOWA 3DU8A 4IX4A 2UZVA 4TRLA 2BVAA 3L1SA 4HGLA 1Q8UA 5C01A 2GS7A 4JIKA 3O17A 4G9CA 4C57A 3FKOA 2VX3A 4OT5A 2PZRA 4HZRA 4KS7A 4V0GA 4IWQA 4YJRA 2W9ZB 5ITAA 3CGOA 4BI0A 5AR4A 3WI6A 3ANRA 3KL8A 1AQ1A 5CF8A 4XP2A 4FV0A 3M2WA 5AP4A 2ITUA 3QQUA 3FLWA 4JAIA 5HORA 2R0IA 4JVGA 4F9WA 3QTWA 4RIXA 4H58A 4K0YA 4DT9A 2YIXA 3Q2JA 2BILB 2XANA 3I5NA 3AMAA 1YXUA 5DIAA 4WUNA 4J53A 4MVFA 2OLCA 2ITXA 4RX5A 1UNLA 1SVEA 4F0FA 2YM6A 2VRXA 2Y6MA 1P4OA 4RQVA 4YTHA 5D1JA 5H9BA 2VGOA 3DCVA 4FX3A 1JBPE 3LQ5A 4JDHA 4M13A 3QYZA 2C5YA 1URCA 2FA2A 4PY1A 3SXFA 1WBOA 1PXOA 1R78A 4MNFA 4XG8A 1QPJA 1KOBA 3EQFA 3CEKA 3PE2A 4K77A 4UY9A 3MPMA 3E7OA 4KKGA 3SD0A 4BZNA 3OVVA 2OF2A 2I1MA 3TNQB 3FMLA 1WBNA 3VUDA 4AW0A 4HGTA 4HYIA 4DCAA 3CQEA 1WZYA 3QKMA 5CSVA 2QOOA 4YR8A 3A4OX 4L46A 3UQCA 2UZUE 3UIUA 4YSJA 2ITWA 2IG7A 3P7CA 3IW6A 3R63A 5DRBA 3U6JA 1ZWSA 3AQVA 4WO5A 4FBXA 1H0WA 5AUWA 1CDKA 3FWQA 4JG6A 3UYSA 4AW1A 3D5XA 1PYEA 5EK7A 4F4PA 1HCLA 5EW3A 4EK4A 1A06A 1XH9A 4J8MA 4FYNA 4BICA 3VS7A 1REKA 3QTXA 3FXWA 3P1AA 4IACA 3W2OA 2F57A 2Y4IB 5L2QA 3O2MA 5DWRA 2QG7A 3K54A 2JDSA 4E26A 3MH3A 3GCUA 5CQWA 4NZWB 3RZBA 1L8TA 2VD5A 2GS6A 3AD5A 3NLBA 5L8LA 1B6CB 2E9PA 2FSMX 3R21A 4LUDA 2BIKB 3I79A 5IQIA 2YIQA 4FTAA 1PHKA 1XWSA 4GIHA 4YNOA 4FRFA 5E8YA 2B52A 5HE1A 4JR7A 4WUAA 3ULIA 5EQPA 2BKZA 3OS3A 4O0UA 4ANQA 2FYSA 3HA6A 1H1QA 1OIRA 4DGLC 2CMWA 5AA8A 5J7BA 4D2TA 4PL4A 1UU3A 4LI5A 2OH4A 2F49A 3OWJA 4BF2A 3R2YA 1WAKA 5BUJA 2B9JA 4ZLZA 1QMZA 1OM1A 2DWBA 2GFCA 4FEWA 4DTKA 2BPMA 2GS2A 4BCQA 3KULB 4G16A 3OMVA 5IEYA 3KRXA 3QRJA 1JKTA 4K33A 5J5TA 3O8PA 2WNTA 4RC2A 4ASEA 3DKOA 4IJ9A 1YHSA 4IVBA 3FL5A 4MWIA 3Q4TA 5KMJA 3DJ5A 4D2PA 4EH8A 4BKYA 2J0JA 2P55A 2W4JA 4DEAA 3ZS5A 4E3CA 4U45A 4R77A 4HYSA 5ETCA 4MXYA 3BQRA 5KE0A 3C0GA 4IWDA 4O22A 5DT4A 4C2WA 3MIYA 5E9EA 3OCTA 2XIRA 3DXQA 5GZ8A 4XCUA 3D7TA 2QHNA 3ZEWA 4F7NA 4C2VA 5KMOA 2UW3A 4IB5A 3CTJA 3EYGA 4FV5A 3HV5A 3K3IA 4S31A 3LFQA 5GZ9A 2XNNA 2R3KA 3CLYA 4ANNA 3MJ2A 1ERKA 4HCTA 5JZNA 1K9AA 4EJNA 3FXZA 2QLQA 2PUPA 4AS0A 2GSFA 4AGUA 5BVOA 3G9NA 3W32A 3RAHA 1G5SA 2WXVA 4X3FA 2HK5A 3KCKA 3OF0A 2EVAA 2AQXA 1APME 3AC4A 1YOJA 2GQSA 1ND4A 5DR9A 2YDKA 5CEIA 4CMUA 4CYIA 1Q99A 1XH6A 5AMNA 2IF8A 5CEQA 3TG1A 5IUGA 4I6LA 4N6ZA 4R8QA 4C4GA 3UNKA 4FIFA 2GNHA 4MNEB 3KRJA 4BC6A 4OBPA 3BGPA 3FL4A 4IW0A 1SM2A 2F7ZE 3HUCA 3PWYA 4UB7A 3F61A 4XNEA 2X8EA 4L7SA 5TR6A 4DAWA 3NIEA 5KKRB 3S00A 5I0BA 2WTCA 4FV7A 4FT3A 2QOIA 5CVGA 5D9HA 1JSTA 1UWHA 4P4CA 5K0XA 3SG8A 3QHWA 2F4JA 3ZXZA 3IPHA 2XBJA 4O86A 4U7ZA 4D0XA 2BAKA 3HYHA 4FTCA 4U6RA 5J87A 5CSPA 4YO6A 2GCDA 5DMZA 3GU8A 4NFNA 3V51A 3ZO4A 4C4FA 4Y46A 2WOTA 4G1WA 3UBDA 4QPAA 4O6EA 4TY1A 4J1RA 4AZTA 4L6QA 5LMKA 3QLFA 3U4UA 5G1XA 5E8WA 2WAJA 4MAOA 3A60A 5CVHA 5AR8A 4AN2A 3VS5A 1VR2A 3BV3A 3FHIA 4F1TA 3CCNA 2QO9A 4UWCA 4CD0A 5EW9A 1GIIA 5CXHA 2ZJWA 3BU5A 1FQ1B 2F9GA 2J5FA 4JG7A 4P7EA 3PVUA 1PMEA 4KKEA 3PA5A 4APPA 3OOMA 3QALE 5M4FA 2WMWA 3RINA 2R7IA 3V04A 2WMXA 3C9WA 3EH9A 4O81A 3RCJA 4GMYA 5KNJA 4YJVA 2XIZA 3DGKA 1LP4A 4CCBA 2CNUA 4MEDA 1WCCA 4KA3A 4RC4A 2GMXA 3QYWA 4WG4A 3VJNA 3DTCA 3OOGA 1CKIA 2BDFA 1ZZLA 2BFXA 2PWLA 3DT1A 4KAOA 4BBMA 4L3LA 5E1SA 1W8CA 3KN6A 3NVMB 3R7OA 2XKCA 3MV5A 4CT1A 3EQHA 5JQ8A 3UZTA 4S2ZA 4I92A 3EIDA 3RHXA 4W8DA 4EEVA 2BRHA 4NT4A 3RJCA 3MBLA 4F09A 3CQWA 3SC1A 4DHIB 3TUBA 2WPAA 4LOQA 4A4LA 4R3CA 3UDBA 2HW6A 3KVWA 2VWBA 4CV9A 3D83A 4CMOA 3R71A 3RPSA 3KN5A 4TTHB 5HEZA 3KIOC 2RIOA 1QPDA 4RSSA 4ZTMA 1P14A 5C4LA 3V01A 5AV0A 3W0NA 1UU8A 1V1KA 3ULZA 4F9YA 2XS0A 1OB3A 5AFVA 2QG5A 4APCA 2W9FB 2RG5A 4XRLA 2LAVA 4IJPA 1LEZA 3BLRA 2VWIA 4O7NA 5DR2A 5M06A 5HVKA 4A9TA 1PW2A 4S34A 5EYKA 4DCEA 4F0IA 3WOWA 2XIXA 3LVPA 3MFSA 2VNWA 3VBQA 3ZLWA 2X39A 4ZTSA 4EOLA 4JXFA 5AP1A 4N0SA 3UO4A 1QPEA 2YCRA 4QQTA 1E1XA 4QMMA 4PMPA 4BGQA 3QC9A 3FQEA 1YI3A 3WE8A 4BJJB 3OEFX 5EI6A 3CC6A 1B39A 4ZLYA 2OBJA 1GNGA 2AYPA 3ENMA 3L8SA 2QKWB 3P23A 2HYYA 1Y8GA 2A4LA 2WMSA 5EOBA 4DH5A 4AW5A 1F3MC 1V0PA 3BEGA 3GCVA 4AF3A 4FE2A 3PDTA 3NUAA 2VTNA 3HRBA 5HGIA 3EFLA 4O7YA 2HCKA 3R22A 4IB3A 5GJDA 4EUTA 4RIYB 3ODZX 2Q83A 3BEAA 3RHKA 3I0OA 1ZY5A 3PJ2A 5AIRA 4PP9A 2DQ7X 5AM6A 4EHVA 3VNTA 4EH9A 5BMSA 3FEGA 4F78A 1RDQE 4TYIA 3PG1A 2UW8A 4YJPA 4BCOA 4DFLA 1DAWA 3KY2A 3HMMA 5AUTA 1OZ1A 3PXRA 4Z7GA 1O6YA 3PTGA 4KB8A 4G34A 2C0OA 5T68A 2GTMA 1B38A 2GNFA 2ONLC 3I60A 4M69B 2QNJA 3OTUA 5ACKA 3P5JC 1YXXA 4WBBB 3B8QA 3EFWA 2QONA 4I6FA 3FLQA 2GHLA 3I7BA 5E8TA 4E5WA 1FGKA 3KK9A 3MVJA 4GJ2A 3LW0A 3FZTA 5BMMA 3R9RA 2X8IA 2FVDA 2PE0A 1FMKA 1OL5A 3NAXA 3PPJA 3L9PA 4MBJA 4ZOGA 5FP5A 1KE6A 2QOQA 4A07A 1FBNA 2ERKA 3AXWA 4FG8A 4YZ9A 3UG1A 4AWIA 4KBCA 4CZUA 4FTUA 4IDTA 5AV1A 5DEYA 4MWHA 4JT3A 2R2PA 4YTIA 4R1YA 4FI1A 3EQPA 5A4EA 1ATPE 4CLJA 4FTJA 4XG4A 3SXSA 3UOLA 3R9DA 3FXXA 4ZLOA 3NW7A 1JPAA 1PKGA 3AT3A 3IW4A 2Z7LA 4F6UA 3MWUA 2JKQA 4OTGA 4C4JA 3ZSGA 2YHVA 4CRSA 5L6WL 2XCHA 1GAGA 3C4FA 2Q0NA 5FEEA 4F08A 2IZSA 4MHAA 4I22A 1H25A 5FDXA 5CAVA 5IQAA 4KD1A 5F20A 1OGYA 2NNWB 5H8EA 3QCSA 3TNHA 5AJQA 4AT3A 4F6SA 3VO3A 5CS6A 5CT7A 2JBOA 3QTRA 2UW6A 4NKAA 1JKSA 1IA8A 4D9UA 2YCQA 5F1ZA 2XALA 1UNGA 2ZMDA 4QMYA 3H9RA 4WSYA 4XG7A 3W18A 4JS8A 2RSVA 2YJSA 3QKLA 3QQLA 3BL7A 2GFSA 2OWBA 3BGZA 4M12A 5T6KA 2WQNA 5DG5A 3GUBA