3POZA

Egfr kinase domain complexed with tak-285
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
293
Chain Sequence
QALLRILKETEFKKIKVLGSGAFGTVYKGLWIPVKIPVAIKELANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDVVDADEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Structural Analysis of the Mechanism of Inhibition and Allosteric Activation of the Kinase Domain of HER2 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 293
sequence length 317
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pozA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pozA01
3AT3A 3QD3A 4USDA 4D9UA 4DEDA 4JBQA 3RNIA 4JX7A 4YHFA 3IPHA 3Q6WA 3UZTA 4DTAA 4LUEA 3UQCA 4BHNA 1OL6A 3ZBFA 4ACCA 2B9JA 3DXPA 2O2UA 2XF0A 3SXRA 4JR3A 2GMXA 4A9YA 3BHUA 4U97A 2C6OA 5AUZA 4E3CA 3JYAA 1PJKA 1XH5A 3PRIA 3QYWA 3O71A 4GG5A 4GT3A 4A4OA 4NT4A 4WD5A 4W4VA 1YRPA 2XYUA 4ZY4A 5HORA 3FSKA 4NKAA 2RKUA 4A07A 5G1XA 3HUBA 1KE9A 4RBLA 5M09A 3OROA 4U42A 3GC0A 2XIKA 5HBJA 4ZMFA 4FSWA 2VO3A 1FOTA 3OZ6A 3QALE 1IG1A 3NYVA 5HNBA 5I3OA 1WAKA 4FKRA 3W2QA 5CF5A 2W5HA 4PY1A 2NRUA 3WZJA 3CKXA 4CKIA 4HNFA 4W4XA 1SYKA 2YABA 4ZEGA 1TKIA 3NUSA 5AP0A 3VW6A 2CKPA 3DAEA 5IEYA 4QPAA 1Q8YA 2Z60A 3UQGA 4BCHA 4FG9A 3L8SA 3PLAE 4PUZA 5J1WA 1PMUA 3MBLA 3KCKA 5CU3A 5I0BA 4DEHA 4V04A 1Z5MA 4JBOA 3ZLSA 1H01A 5AP2A 3IDPA 5AV3A 2OIBA 4DITA 3UOJA 4FYOA 3FKLA 3C0IA 5HE2A 1FMKA 3DAKA 1MRVA 4N70A 1OL1A 2YIXA 4XG6A 5AR7A 4BGQA 5D12A 5JGBA 3L1SA 4C3PA 4EONA 4U79A 5DR9A 3IS5A 3R30A 3O8TA 3AC2A 3V6RA 3R00A 4F7LA 3R9RA 4QOXA 3FPQA 2Y4IB 3BLHA 3DAJA 5H8EA 5C26A 5IH6A 2C6TA 1KWPA 4RA4A 4APPA 4PL3A 2BRGA 3C4CA 5GJFA 4YLLA 4I22A 4DLIA 1L8TA 2PE2A 2Z7SA 5KKRC 4QMXA 3PA5A 4BCNA 3NAXA 3QKLA 3NUXA 3I60A 4JQ7A 1UWJA 3O8UA 4XOYA 2OO8X 3CCNA 3JVRA 2OFUA 1BYGA 3SXFA 3C9WA 2QOFA 2WMBA 4LOOA 2HXLA 3PY3A 3HEGA 1J3HA 5HLPA 3LHJA 4BI2A 3CBLA 5AAGA 3TUCA 1LR4A 1WVYA 3F3UA 4ZTLA 3QXOA 1JSTA 2HYYA 5CNOA 2XP2A 4L3JA 5CSVA 4E4LA 3NCZA 5LVPA 4DH5A 4JG6A 1PKDA 2PYWA 3KXHA 4RIWA 3MH1A 1ZYJA 1YI4A 4RJ3A 4QMUA 5H3QA 1TVOA 2XMYA 4TNDA 5EKOA 3RZFA 3G5DA 5DHJA 3VUTA 2YAKA 2OZAA 4FKIA 2C3IB 4FKGA 4FG8A 4UZHA 3VULA 2GNFA 2Y8OA 1JKKA 4DFYA 3U54A 3KULA 3A7HA 4MAOA 2O63A 3PUPA 2Z7QA 3JUHA 4O7RA 3GGFA 3REPA 3HUCA 4AFJA 1PXPA 3IONA 5EFQA 2VTAA 4X6RA 3LQ8A 4DT9A 2P55A 5HIEA 4EH2A 4EI4A 4CFXA 3R9HA 4IJPA 4G6OA 1GNGA 4K2RA 5FEQA 4F7JA 4U40A 3K2LA 4WSQA 4W8DA 3G51A 1V0BA 4RLLA 5BVWA 3ZHPC 2F7EE 5CNNA 2BHEA 3PXQA 4F0FA 4Z3VA 1M2QA 5CANA 3WZDA 3IW4A 4NSTA 1LP4A 3D7ZA 3QKKA 3PIYA 3F2RA 1FPUA 3FZSA 3SQQA 3VO3A 4BWXA 4ZZOA 3KF7A 2V7AA 2CJMA 3CJGA 3OBGA 2WEVA 3TM0A 1YDTE 2J0KA 2OICA 4KSPA 3DCVA 3DLZA 4FIHA 5HIBA 2P3GX 4HYHA 5M55A 2OK1A 4X2NA 4PL5A 4ZXTA 5CASA 4ALUA 4R7IA 3EL8A 3QTSA 3ET7A 1BLXA 3OT3A 5FTGA 2XYNA 4K18A 2R7IA 4ANOA 4AU8A 2WIPA 3EN4A 4FR4A 5KMKA 3BYMA 3CLYA 4M66A 4NFNA 4WA9A 2GNHA 5BVKA 5AAFA 2UW6A 5J95A 4BCQA 2FA2A 4UX9A 1DI8A 3UMXA 4IDTA 2B9HA 4RWLA 4YSMA 2BILB 5EKNA 2IN6A 3VBTA 1PRYA 2ZVAA 4YR8A 4JVGA 4RIYB 4RJ6A 3UNJA 2BTSA 5FBNC 4F1MA 4WG5A 5C9CA 4V0GA 4OR5A 4UWBA 5FEEA 4CTCA 5IA3A 5HI2A 4UV0A 5K5XA 4P90A 4YPDA 4CFMA 5AP6A 3CTJA 3MVJA 3AC8A 4Z7GA 4KIQA 4M14A 3OY3A 2ZJWA 5A6OA 3QTWA 2XNGA 3F3WA 4G6LA 1PY5A 4O7YA 4RPVA 5A4LA 4W4YA 4U9AA 5AV0A 3DK7A 3H9FA 1KV1A 3D2IA 3LFQA 5FUTA 2XVDA 2ESMA 3E7VA 3UVRA 2XNBA 3V5JA 4BBEA 1APME 4BR3A 2W9ZB 4EOIA 1WZYA 4EK5A 3KXNA 4AZFA 3MYGA 4C3RA 5JZJA 1NW1A 4L45A 5DEWA 4C3FA 3AMAA 3KCFA 4XS2A 3TNIA 3IO7A 2BVAA 1PXJA 4U41A 4FSRA 3FHIA 2W1FA 2XM8A 4ZY6A 2QURA 3BEAA 4M8TA 4F1OA 2YHVA 3BX5A 2YWVA 2OFVA 4GW8A 2WGJA 4O0WA 5AUXA 5FBOA 1G3NA 3LLTA 3D5WA 3CGFA 4JDJA 5DIAA 4CCUA 5ANOA 3RCJA 4DGMA 4EH6A 1ZMUA 2WU6A 2X2MA 4NIFB 5K4IA 3DNDA 4C02A 1RJBA 3ZFXA 4EK8A 2XIRA 5CU0A 4Q5HA 2OSCA 3MVLA 4GYGA 4GVAA 4WG3A 3GU8A 3FY2A 4D5HA 3LCDA 3NEWA 4GJ2A 5J9YA 4IAYA 4QMOA 5DG5A 3BELA 1V0OA 2FGIA 4ZJJA 4F9YA 3GU7A 4ACDA 2WMXA 4XV2A 2VWIA 3C50A 5D11A 4ZK5A 1FVVA 2LGCA 1QPCA 4A4XA 3C5IA 4MBLA 4YC8A 4R5YA 4NYEA 3R6XA 1K2PA 2R3KA 3UIXA 3NSZA 2ERKA 3ZC5A 4YMJA 4O22A 3E62A 3E8CA 5I9YA 3HAMA 4L52A 4KRCA 4C61A 2WQMA 2AYPA 4GIHA 5HOAA 4RC2A 2UV2A 4D28A 3LMIA 1YOMA 4YTIA 1TQPA 5LCKA 2ZM4A 2P4IA 3H3CA 3OF0A 3GQIA 5CEKA 3L8VA 4OBQA 3SDJA 5DNRA 5DR2A 4ZJVA 5EM7A 5EYDA 3TNPC 2JAMA 2I0HA 3COIA 3GFEA 2GTNA 4BTKA 3E92A 4FTRA 3EH9A 4XP0A 3VRYA 4NL0A 5H2UA 4M13A 1BL7A 4ITIA 4O2PA 1URCA 3BCEA 3TDWA 4FVRA 2W1DA 3B8QA 3FAAA 2UZTA 3NX8A 3O7LD 3F2AA 4FKQA 4NW6A 4RIXB 5KMNA 5LVMA 3MGYA 3RP9A 3NGAA 2X7GA 4EUTA 3HMOA 4GVJA 4O96A 5KMIA 4IX6A 3PPZA 4O0SA 2C4GA 1GZ8A 5EOLA 3VS5A 4LV5A 4ASZA 4I0TA 2NRYA 4O81A 4WT6A 3P5KA 4YTCA 4G1WA 2R64A 2WMVA 4U44A 1OBDA 2ITNA 3E88A 3CPCA 2WELA 4HOKA 2PVKA 5IU2A 4EJ7A 4EWQA 2VGOA 3HV6A 1Y8GA 3PZEA 5DLSA 3CP9A 5AIRA 1FVRA 4FV9A 3RPSA 2NNWB 3PWDA 4PL4A 3QUPA 4M84A 4BWKA 3ZYAA 4UMQA 3W2CA 3NYOA 1DI9A 3FYJX 2WU7A 3COKA 5I9XA 5L3AA 3I1AA 3UE4A 2FB8A 4ZZMA 3RPRA 2ZV8A 4EK6A 5IUHA 1HCKA 5HESA 5HKMA 3RALA 4ZAUA 4U6RA 5FDXA 4MKCA 4YSJA 5FRIA 3I81A 1XO2B 2QO7A 4QTDA 3NNWA 5EDRA 4LQMA 3TZMA 2P0CA 4I5CA 5C03A 5EH0A 4CRLA 3R8UA 4G17A 2WOUA 4QMWA 5J79A 3W2RA 1FGIA 3UC4A 5J9ZA 4C2VA 2UW9A 2XIZA 1OUYA 3T9TA 4ACHA 4FGRA 5IQEA 4EZ5A 5EM5A 5KE0A 4EOQA 3SX9A 4KBKA 4FA2A 1H26A 4FTCA 2OF4A 1XH6A 3Q5IA 2HWPA 2PMIA 1OKWA 1YXXA 3AD5A 3FWQA 5T68A 3LAUA 1OL5A 2Y9QA 3E64A 3RPVA 3COMA 3GUBA 4ZTMA 5EQEA 4R8QA 4DFNA 3AC5A 4TTHB 3ZO1A 3NR9A 5HEZA 4XG3A 4NH1A 3FL5A 4P2KA 1JKSA 1CMKE 1UKIA 2C0OA 4KINA 3ZSIA 4USFA 2DYLA 4QP3A 5CENA 3SW7A 4QD6A 4YZ9A 3QXPA 2F2UA 4M0YA 4XNEA 2X81A 4S31A 5IUGA 2Z8CA 3QHWA 2I40A 3EQFA 2ITUA 5AP5A 2ITYA 3WYXA 3FMMA 4JBVA 4IJ9A 3EQHA 5I9VA 1Y6BA 3Q4UA 1OKVA 2H8HA 3LJ2A 4L00A 5E8XA 5BMSA 3PXFA 5DYJA 2IVTA 2XK3A 3OXZA 4RVTA 3EKNA 4PDYA 4F7SA 2BKKA 1LEZA 3AOXA 4UBAA 4V01A 3F3TA 5DN3A 2YWPA 4K1BA 4HGLA 4C62A 4FTKA 5ANIA 3HRCA 3U4UA 4MYGA 4GIIA 3FE3A 4IAKA 3OOGA 2QKRA 3QKMA 3UJGA 4MHAA 4EEVA 3W33A 2ITPA 5A46A 4FNYA 5BQ0A 2EB3A 3ULIA 3R28A 4Z7HA 3BYUA 2I0VA 3LW0A 1VEBA 1NVSA 2C6DA 3I0OA 3UG1A 5EHLA 4O84A 5HE1A 5M53A 4Y72A 4R7HA 3KU2A 3RKBA 3CD8A 4BFMA 4C4GA 5BYYA 1GIJA 4I5MA 3R9NA 4GMYA 4BTMA 1Q5KA 2XEZA 2ZMDA 2R4BA 3EMGA 4EQUA 3Q53A 4F9CA 3PYYA 4S34A 3QRUA 5A54A 1NVQA 2GS2A 5AP1A 2QCSA 5EI8A 5HZNA 1G5SA 2QOCA 3MH0A 3ORKA 3IG7A 5K0XA 1S9IA 2PVNA 3QUDA 4AOTA 4ZLYA 4I4FA 4XRLA 3OXIA 3P0MA 3ZEPA 4IAFA 3RAKA 4RJ8A 4LG4A 2VTJA 4BDAA 3LM5A 2R3NA 3ODZX 4OTRA 4ITJA 3TTJA 4G9CA 3NPCA 4O1OA 4DFLA 4JL9A 3Q3BA 3C4EA 5HG5A 5C1QB 3UNKA 4MWHA 5CTPA 4NU1A 5CX9A 5CEMA 3MJ2A 1Y57A 3FL4A 4FZ6A 1YKRA 4H39A 4XBRA 3UC3A 4D4VA 3BWFA 2V62A 4CEGA 2B7AA 4E5AX 5M07A 2GQGA 4RQVA 3QD2B 4IW0A 2E9UA 4XBUA 1WBOA 2EUFB 4QTCA 4F6WA 2ITWA 3KK8A 1WBSA 2JDTA 3PP0A 5AV4A 2PVRA 3FLYA 2ITQA 3NAYA 4H1MA 4FKLA 4KNBA 5EHYA 3UYSA 5FGKA 3VUIA 4O1PA 3WE4A 4BDBA 2CGWA 4I6BA 2BUJA 3ZU7A 4BN1A 2ZAZA 4GL9A 5AR4A 3A2CA 3ORTA 3ZFMA 3PVUA 4GS6A 4LYNA 5EM8A 4RIOA 3BU5A 5CZHA 1XH7A 2GNIA 2PY3A 3A62A 3HKOA 4I6FA 5LARA 2PZIA 4QYYA 2EXCX 4RC4A 3SLSA 1M17A 2J51A 1KE7A 3GU6A 5IA4A 2GQRA 4IB5A 2RGPA 2PPQA 3ODYX 3TKHA 4IB3A 5HHWA 2W1IA 1ZZLA 4EQMA 4N6ZA 4K9YA 4TXCA 4R1YA 5DMZA 4UMUA 4CZTA 1W0XC 1OKYA 1T46A 4L3PA 2J5FA 1YWNA 4MNFA 4XX9A 3S3IA 1HCLA 4CG8A 2OBJA 4YUQA 1H00A 5FQDC 1U5QA 2G9XA 2P2IA 3CTHA 2VWUA 2X0GA 2YN8A 4R3RA 4DEBA 1E1XA 4I41A 2FSTX 4QYFA 4YZDA 2QQ7A 3VUMA 4DBXA 3GCSA 3DBCA 5J9LA 4IWDA 3ROYA 5GHVA 1FVTA 5JT2A 1T45A 3AC3A 4EUUA 1ZYDA 4FEUA 1OIRA 5AUWA 1ZY5A 4FKTA 2GTMA 2OXXA 4D2WA 3DPKA 3FZRA 1UU8A 4ONAA 3R8LA 4HVDA 3FZTA 3QD4A 3NW5A 3JS2A 3LFBA 3DJ7A 3V01A 1HOWA 2PVJA 2W4KA 2C5OA 4IX3A 2E9OA 2Z7LA 3QC4A 2BZKB 5ANGA 2C6KA 2OW3A 3R1QA 4AAAA 4FC0A 4O0UA 2GU8A 4FEWA 2WMQA 3RM6A 3F5GA 4NWMA 2VTQA 1FQ1B 4U43A 4USEA 3UO4A 4BICA 4IFCA 4ZMEA 1ZYLA 3A7FA 4BDCA 2R3PA 3W18A 3LCTA 3PP1A 1CSNA 4WSYA 2YAAA 1KV2A 3FZPA 3QCYA 2E9VA 2GFCA 2ITOA 2VTTA 4FSUA 1H27A 2GQSA 2BAQA 2V7OA 4AGCA 3R04A 4M97A 3IOPA 5CXHA 5L2SA 3E63A 4FIIA 5IEXA 1YHSA 4O0XA 3H9OA 5D1JA 2QHNA 3FSFA 3OUNB 1JNKA 4IB1A 3KRJA 1U46A 1Z57A 3ENMA 4BDFA 3RHXA 4EWHA 1NXKA 3OCBA 4JI9A 4S2ZA 2ETRA 3NUAA 4EK3A 5TR6A 4ORKA 2WD1A 3U9NA 2GSFA 5IUIA 3UGCA 3W1FA 5HG7A 4U0IA 1CKJA 3L8XA 3QQJA 3Q5ZA 3QLFA 1ZMVA 4AZSA 4AA4A 4DTBA 4I21A 3L9PA 1K3AA 4HZRA 1SNUA 4UZDA 3O50A 3MFRA 5M06A 1OPJA 2HOGA 4L7SA 4E6QA 1U4DA 4AXAA 4CFNA 4RRVA 4D58A 3MS9A 4IWOA 3BU3A 2X7FA 4HGSA 3RPOA 1JPAA 3PPJA 4UMPA 5HE0A 3P4KA 3NCGA 2UW7A 2W05A 4L67A 4D4YA 5EI2A 3PXRA 4OTWA 3DOGA 3F5UA 4F09A 4UYNA 4YPSA 3FXZA 1H25A 4TPTA 4HCTA 3F9NA 5L8KA 3QRIA 4HVHA 5DR6A 2YCQA 4D5KA 3QGYA 4PRJA 2X9FA 4C4HA 3LFCA 3I6WA 4DEAA 2ZB1A 2VV9A 3QTQA 5ANDA 3DBQA 4I92A 1H1SA 4KAOA 4R1VA 4C37A 5E4HA 3S00A 2XNEA 2J90A 3I7CA 3JPVA 3ZMMA 3NUPA 3TG1A 3OFMA 4YBKA 4J99A 4L6QA 4ZTNA 3QAME 2RL5A 2JGZA 4I0SA 5AR5A 3UO5A 4G3GA 3OC1A 4YHJA 3BGPA 3VJOA 3TL8A 5D41A 4FV4A 5A6NA 4PV0A 1OIQA 1IA8A 2A1AB 2CGXA 4A9TA 2R5TA 4FYNA 4NEUA 3R7EA 2UW0A 4DGLC 4C4IA 3D2KA 4J52A 3T8OA 1JOWB 5A4TA 4Y83A 3EYHA 4YJPA 1MRUA 3PSCA 1MQ4A 3U9CA 4FL1A 2C30A 4RX9A 4EC8A 4X3FC 3A4OX 3ZM9A 2ZM1A 1KSWA 4EHZA 5D10A 4RWKA 3W2SA 4DEIA 5M4UA 2BR1A 1TQIA 4QYGA 2JIIA 3QBNA 4RX5A 4AF3A 3F7ZA 4X7QA 5KZ0A 4JX3A 2J50A 1SM2A 1DM2A 4BCPA 3I4BA 4OGRA 3NW7A 2JD5A 4L68A 1B39A 1M7NA 4NM5A 1PXKA 3NZ0A 3A60A 1PXMA 3OHTA 4L46A 3R7OA 3B8RA 5JK3A 2W0JA 4CT2A 4FNZA 4PTGA 3PY0A 4U45A 3MSSA 4YJNA 3PJ8A 1A9UA 1P4FA 5GIPE 3ZBXA 3T3UA 5D7AA 3ZONA 5JEBA 3E8DA 2X4ZA 4U7ZA 2WTDA 2QOKA 4O27B 3WE8A 2VAGA 1PXNA 4O2ZA 3SRVB 4FSMA 5CU6A 2J0IA 4AT5A 4E5WA 5CZIA 3DBFA 1ZXEA 5DE2A 3BE9A 3HMMA 3Q9ZA 2G2IA 4MXYA 4QQ5A 4G3CA 2ZMCA 4QP7A 4OTGA 2UZOA 3QZHA 4WBOA 3O0GA 2NPQA 5T3QA 2WTWA 2IPXA 2IVUA 4NTTA 3CSVA 4F08A 2C68A 5EM6A 3QZGA 3DJ6A 5K3YA 4S33A 3PSBA 5IQAA 3ALOA 4K6ZA 1OL2A 4EH8A 3OTUA 4DG3E 2Y6OA 1A06A 2VNYA 2R3JA 4PWNA 4EHVA 3VS2A 5I9WA 1YOJA 4ZS0A 5JSMA 2AC5A 3R2BA 3LMHA 4RLKA 3W2PA 2H6DA 2XBJA 2B54A 4JS8A 2FSLX 2JC6A 3MTLA 4IIRA 3MI9A 3BHYA 4A7CA 5I9ZA 3ERKA 3VUGA 3AXWA 5DVRA 5FP6A 4I5PA 3FLZA 4RIWB 3TI1A 3W32A 4C58A 1YXUA 4DINA 3CD3A 3DBEA 5AR2A 4MNEB 3R7YA 4G16A 3N4UA 3QC9A 4AS0A 3ENHA 3NRMA 4IACA 4QMPA 1Q24A 4Q2AA 2PWLA 2JITA 2XEYA 4D4SA 1UNGA 2OZAB 2ZOQA 3QX4A 4EKLA 5K9IA 5KHWA 3SKCA 3U8WA 4NKSA 3OWJA 2CN5A 2X6EA 4B8LA 4PP7A 3LCKA 2OIQA 1WBWA 1F5QA 5L6WL 4FTMA 3KULB 3GENA 4I24A 3KMMA 2YISA 4WNOA 4CLIA 5ITAA 3LLAA 5AM6A 5FWKK 2FSMX 2WTKC 4GKHA 2YDIA 2WMUA 5LCJA 3ORZA 2VWXA 5AFVA 1Q8UA 4EK4A 3R1YA 1UWHA 4J96A 5HD7A 5M51A 3U55A 5KNJA 4AUAA 3LFFA 3QYZA 4TYJA 5IA2A 5CXZA 3RTPA 5FDPA 1Y91A 4WHZA 5LJJA 3IQ7A 3HV3A 3F69A 1B6CB 3QCXA 5FTOA 3HV5A 2B52A 2HY81 4MBJA 3FI4A 4IEBA 3CPBA 3CXWA 2VWBA 4NUSA 3QQHA 5ETFA 1FMOE 5IQHA 2X9EA 4QMQA 2PL0A 4X21A 4WOVA 1PXOA 2FVDA 3GCQA 3ZSGA 4BZOA 1P5EA 4FT0A 3F7WA 2PE0A 5IDPA 4TYHA 3SA0A 4TKSA 5IKWA 3UVPA 5BVNA 4X3FA 4AW1A 5AUYA 3OEFX 4JXFA 3IW7A 4RMZA 3G2FA 2WHBA 3F66A 4QT1A 3TV4A 5AUVA 1OITA 4W8EA 2O8YA 5C8KA 4RX7A 3VAPA 2QU6A 4EOOA 3D4QA 4N57A 3F88A 2QLUA 4I6QA 4U5JA 5C8MA 4QMSA 3FC2A 5CYIA 1OIYA 3HYHA 4C35A 3E3BX 3HRFA 5LQFA 3TIYA 4QNYA 3UP2A 2DUVA 2OI4X 4IDVA 1XWSA 4Q5EA 5DH3A 1H1QA 4M68A 5ANKA 3UQFA 3I5ZA 3E7OA 5HO7A 2VTHA 2EU9A 3PLSA 4JRNA 3MB6A 5I4NA 2G2HA 3FHRA 4FVQA 2OLCA 2BRMA 4P7EA 4FEVA 3UOKA 3Q6UA 4GEOA 3IDCA 4QMTA 1W98A 3PVWA 3BHHA 4EH7A 5GIOE 2Q83A 3VF8A 4D2SA 4DFXE 3AG9A 2X1NA 4FX3A 4TRLA 4BDEA 3GCPA 2QD9A 3DZQA 4FUXA 4EOPA 4DA5A 3BYOA 4O7NA 2V55A 5BMMA 2RG6A 2CKQA 3DDQA 4XV1A 3GT8A 3A8XA 4ASXA 1Z9XA 3R8VA 4D2VA 1OUKA 2RFDA 2BRNA 3D7TB 4BCMA 3WF6A 4R5SA 3VVHA 3BLQA 3BIZA 4FT7A 4MXXA 4TT7A 4YTFA 5KKRB 4YNEA 2GPHA 3DBDA 1NT2A 3NUUA 1QPJA 4W9WA 4F6SA 3U6HA 1S9JA 3QA8A 4EZ3A 3QWKA 1ZWSA 3OOMA 4YC3A 5IQBA 2CMWA 1Q3DA 3OT8A 5CAOA 3E87A 5HLWA 2P2HA 4OBOA 3TNHA 5M56A 4G2FA 3MA6A 4JDIA 3RZBA 4QMVA 1MUOA 2CNQA 4IE9A 4RZWA 4I94A 2UW3A 4F9AA 5JFSA 1OPLA 4GT5A 2WTKB 4LRJA 3FI3A 3G90X 1SVGA 2QI8A 2C0IA 3ORMA 2XKEA 4HPUE 2VWVA 3LCOA 3QQFA 2H34A 4CFFA 3EKKA 3KC3A 5AWMA 4II5A 1M7QA 4MH7A 1BMKA 4NJDA 1JBPE 4RIYA 3V5WA 4RC3A 4ZSGA 3QTRA 5G6VA 4Y5HA 4F64A 2YZAA 4L53A 1I44A 3T3VA 2HW6A 4XH6A 4H3PA 2J5EA 3QLGA 1PMNA 2SRCA 4CMUA 3DK3A 4E8AA 4FODA 3EZVA 2PZ5A 4YC6A 4AGWA 4F6UA 4QQTA 3HAVA 4RFMA 5DGZA 2VX1A 4KS7A 3CQWA 3GU4A 1H28A 5FXRA 1Q97A 4G6NA 5LMBA 1H07A 1OBGA 2ITZA 4KKEA 5JGDA 1J91A 1VJYA 3DTCA 5HBEA 3TV7A 4W9XA 1ZY4A 3OD6X 2LAVA 4EHEA 4L8MA 5ACBC 3W2OA 2JDOA 1XBAA 5B7VA 5JMSA 2OJGA 3OWPA 4IVBA 3UZPA 3ELJA 2XUUA 4XG9A 3GB2A 4BKJA 2CNVA 3E8NA 3MY0A 3PVBA 4APCA 1XH4A 5M08A 4AN9A 2PE1A 3PRFA 1H08A 2C6LA 4YJTA 3I6UA 2WKMA 2XK7A 2Y0AA 5B0XA 3QX2A 5M57A 3QTZA 2QODA 3AMYA 3EQGA 1YXVA 2A27A 3NWWA 3RGFA 3NW6A 3K54A 2PVHA 4GUBA 3TKIA 1VR2A 3Q4CA 3G0EA 4Y73A 2XZSA 5EK7A 4BDHA 2ACXA 4NW5A 5L2IA 4FIFA 1UU7A 4GUEA 4NIFA 1R39A 4D2TA 4GK2A 5BUJA 2YLEA 3C7QA 5J5SA 4R77A 4W4WA 4WNPA 4O0YA 1ZOGA 5DWRA 1J7LA 4JAIA 3QFVA 4DH1A 2R9SA 4X2GA 4MD9E 4YJVA 3F82A 1H1RA 5HTBA 1H0VA 3VN9A 2F7ZE 4IM0A 4QRCA 2BIYA 4EKKA 4CVAA 3UMWA 2Q0NA 4XJ0A 5KZIA 2W5AA 3BGQA 4D0XA 3D5VA 3MWUA 3BQCA 3MIAA 3ZZEA 1JWHA 2WMAA 4FV3A 2YACA 4E20A 1BI8A 4FTLA 5F4NA 2XA4A 2IZUA 1YOLA 2BTRA 2YJRA 3HLLA 5IG1A 5KBRA 2QHMA 2J7TA 3KVWA 3A61A 3OEZA 3PDTA 1Y8YA 3OP5A 5J8IA 2C6IA 3LFNA 5CVHA 4CSVA 2UZNA 4XG8A 5AP7A 3UDBA 4JT3A 3PY1A 4RWJA 4OBPA 3ZFYA 4KBCA 5IA0A 3JY9A 5HCYA 2PUUA 3O2MA 1JKTA 4UMRA 3SVVA 1GIIA 2ZM3A 4FV7A 3EHAA 4YZMA 3A7JA 5FM2A 4FKOA 3PJ3A 1OMWA 3EN5A 5K0KA 5L2TA 3FPMA 4KA3A 4L44A 3BLRA 2JFLA 4JG7A 5HG9A 2XRUA 1WFCA 2CLQA 2FH9A 2JIVA 3MPMA 4KB8A 2VO0A 2PUPA 4AT3A 1PHKA 2W99B 4YBJA 3R8ZA 5HCZA 1GAGA 4YJQA 3BBTB 4CTBA 4EH9A 5IQDA 3FMDA 3MN3A 5M4CA 4RQKA 4DFZE 5AEPA 4BKYA 2ETMA 2YJSA 5B2MA 4H05A 1H4LA 5HU9A 1RE8A 3R9OA 4DT8A 2JKOA 3PFQA 2JLDA 1W8CA 3NNVA 3ULZA 3FQEA 4AT4A 4C33A 3POZA 4LL5A 4OTIA 3KKVA 3VS7A 2GNGA 3G15A 4WNKA 4IC7A 2EXEA 2X39A 1P2AA 3EL7A 3FQSA 4WKQA 3FYKX 2VTSA 2B9IA 1CKIA 1QPEA 2X4FA 2PU8A 1L3RE 3CC6A 2QKWB 3LMGA 2OZOA 3O51A 3R7GA 4I93A 4JDKA 2IZRA 2C47A 3VUDA 2R7BA 4C59A 2B53A 3UOHA 2XS0A 4X0MA 1FBNA 4E6DA 3E3PA 1KE6A 2CKOA 2FSOX 4DYMA 4LGHA 2G15A 4ZSLA 2BAJA 4D1XA 3VNTA 2X8IA 4OTHA 1YXSA 3WILA 2QOHA 1IASA 4BY9E 2G01A 3ZH8A 1U5RA 2HCKA 4NK9A 2I0YA 4BTJA 4D2RA 5HLNA 2A0CX 4Q9ZA 4CYIA 4K8AA 4XG2A 2YIWA 3MDYA 5C27A 4C34A 2IG7A 3R63A 2C69A 2CCHA 3QRTA 5EOBA 5TF9A 3ZRKA 3KRRA 2JAVA 2H96A 2BZJA 2OF2A 3DKCA 5HG8A 5TO8A 4IZYA 4QQJA 3WF9A 1V1KA 4O38A 3EFKA 2BZIB 4GSBA 3FMJA 5HNIX 4LGDA 4QP4A 4HVSA 3WARA 3O7LB 5CT7A 1V0PA 3MA3A 5E7RA 2I6LA 4DCEA 5HTIA 4I20A 2WFYA 2FYSA 3HX4A 1JVPP 5CQUA 3QZIA 4CZUA 2BALA 3IECA 2YFXA 4CV9A 1UNLA 5BUEA 3QRKA 4BZNA 4R3CA 2C5YA 3RBWA 5K4JA 4EOSA 5L4QA 4S32A 4IWQA 3FKNA 4NCTA 3FV8A 2OXYA 3V8WA 3LFDA 2Y7JA 4MQ1A 5HD4A 3JVSA 3UYTA 2GNJA 5M4IA 4X6QC 2UW8A 2IW8A 4BB4A 3BQRA 3G33A 4TY1A 2HXQA 4B6LA 5M4FA 3ZUTA 4HZSA 4TW9A 3QGWA 2PZYA 3HMNA 3Q9YA 3P23A 4E4MA 2XNMA 5C4KA 4ASDA 2IZSA 4LI5A 5E91A 3WOWA 5M44A 4CKJA 3ZEWA 4C0TA 5BUIA 2VUWA 3DQXA 2F2CB 2W1GA 4OUCA 4ZSJA 3OVVA 3FMNA 2C3KA 3EFLA 4O21A 2QOOA 4YLJA 2HW7A 3VBVA 2BAKA 2W9FB 2BZHB 3D5XA 3Q4ZA 5CT0A 5GJGA 5EYMA 2VWYA 2XK6A 5IH4A 1IRKA 3KMUA 1DS5A 1VYWA 2IW6A 4IC8A 4DGOA 2R3OA 3DXNA 4ZTRA 4EHGA 4BBFA 5A4CA 2CDZA 3PTGA 5JFXA 4LMNA 4FE2A 3VQUA 3FMKA 2GS6A 2V5QA 3HGKA 4G31A 3C0HA 3PE2A 4HGTA 2UZWE 5F20A 2QU5A 4EH3A 2VWZA 5JFVA 3FMHA 4JR7A 2WZJA 2J9MA 2YERA 4DEGA 3TV6A 1I09A 2ZDUA 1ZZ2A 1A48A 5DFPA 2IW9A 3MTFA 3EZRA 3PA3A 2ITVA 1YI3A 4U80A 4ACGA 5AM7A 4E5BA 3UTOA 4WUNA 3CQUA 4DH3A 4YJOA 2JKKA 4H3QA 4CNHA 4CZYB 1JQHA 3FZOA 4KIKB 5IZFA 3MFTA 4YO4A 4O6LA 4YJUA 3ZO4A 5KO1A 5AR3A 3I0QA 1XH8A 4ARKA 3NS9A 4MEDA 3CEKA 3COHA 3WIKA 2PHKA 3FC1X 2R3LA 4AGDA 2BROA 4JRVA 4TL0A 2WAJA 3R2YA 2YEXA 4UWYA 4OTQA 5CI7A 3KMWA 3KXZA 4HCVA 5LOHA 2JDSA 3EQDA 4O7SA 3RI1A 2X8EA 4Y8DA 3EQPA 3N4TA 3BGZA 2YDKA 4RJ5A 3WYYA 1U54B 4ZLZA 5DT3A 2QG5A 2WMSA 4XLIA 4QMMA 4LGGA 2VO7A 5HX6A 2YM4A 3HVCA 4G3FA 3WBLA 3RWPA 3UVQA 4CQEA 3K5UA 4UN0C 4BVUA 3FXWA 2B1PA 3H9RA 5E9EA 3JY0A 5DT0A 3WF7A 5JQ5A 5CWZA 4OW8A 4MBIA 5AJQA 4FV0A 4EYJA 3VUHA 1SVHA 2OGVA 3PPKA 4HGEA 5EW9A 4FT3A 2KULA 3G9NA 1FINA 2J0JA 3TACA 2OJFE 4DH7A 4F65A 1YW2A 3EQCA 3EQRA 3GC9A 3ANQA 3U51A 4DH8A 1W83A 4ZTHA 2YM5A 3F5PA 3U87A 3BZ3A 3SOAA 2Z7RA 4AW5A 5LVOA 3TZ8A 5DOSA 1KUTA 2QOBA 4AN3A 2JFMA 3D14A 4DE4A 4WIHA 4OT5A 5F95A 4A9SA 2HAKA 4ALWA 4RZVA 4G34A 3ORNA 5DEYA 3UIUA 4F9BA 1YQJA 3N9XA 5B2LA 3U6JA 1DAYA 4PP9A 4AACA 1RQQA 2HY0A 5BPYA 3EQIA 2PMLX 2WEIA 2XK8A 5L2WA 3TTIA 2FUMA 1GZKA 2YM6A 3IK3A 4JDHA 4EOLA 4JIAA 2CKEA 3ZTXA 2HK5A 3AGLA 3P7AA 3R22A 1IR3A 4J98A 5HIDA 4BDKA 4F1TA 3GU5A 3RAIA 4UXLA 4PTEA 3R7IA 3RWQA 3Q2MA 2WMRA 3BBWA 3Q9XA 3R21A 4F99A 4GJ3A 2QOLA 5ICPA 5DPVA 5JRSA 3B2TA 5BYLA 3G6GA 3LCSA 5IQFA 2DS1A 5E8UA 3IKAA 4M69B 3TZ9A 3LOKA 3OUKA 2F9GA 3HMIA 2IO6A 3OCTA 4FTUA 4J7BA 5A4EA 3V8SA 1YHVA 4HYSA 1MRYA 1WBTA 3CKWA 3W16A 5J5TA 4A9RA 4GH2A 1RDQE 2XCHA 1Q3WA 3IGOA 2RG5A 3JR1A 3DKGA 4FTTA 5ANJA 2BFXA 2YIQA 3OTVA 2XKCA 3M42A 4LM5A 3Q9WA 5E8WA 4IX4A 4AN2A 4D55A 4ANMA 5J1VA 4MXZA 4Z55A 2Z02A 2B55A 3DB8A 3TJCA 3O8PA 3HRBA 3QTUA 2PVYA 3DB6A 4ZSAA 3KXGA 4IAZA 3EJ1A 5FXSA 4BCKA 2C3LA 2WO6A 1OI9A 4AA0A 2C0TA 3AMBA 4LRKA 3QUEA 2C1BA 4XV9A 4O7WA 3P78A 4JAJA 4XP3A 3RMFA 4IM2A 5C4LA 4AZEA 1GIHA 2VGPA 4RWIA 3R71A 5JQ8A 4L01A 3DLSA 3V04A 4ERWA 3EQBA 3DKFA 4QO9A 4BBMA 3BI6A 3OW3A 5TE0A 3O23A 3ZO3A 5IEVA 4IZ7A 3MH2A 3UPZA 4BDIA 1OL7A 4M15A 3RK5A 2CHLA 3PWYA 4NM0A 2J0LA 4P4CA 4ZP5A 5AV1A 2Y4IC 3WF8A 4NM7A 2OU7A 4IFGA 1E9HA 3D5UA 1G8AA 5AIKA 5FM3A 5CF4A 2WTJA 4FV2A 3BKBA 4FKJA 3DU8A 4AE9A 2GHMA 3RVGA 4EOJA 3CR0A 3L9NA 4FT5A 4GFMA 4E93A 4F9WA 3PXKA 2PTKA 1UNHA 3FZ1A 3PJ2A 4C57A 2AC3A 2CCIA 4C4EA 4K33A 3TXOA 3LIJA 4JBPA 4JQEA 4XMOA 4CMOA 5FEDA 3UIMA 3W8LA 3FLWA 3WZUA 2W1EA 4KKHA 4QPSA 4ANSA 4IBMA 5HCXA 3CE3A 5BVFA 5IF1A 1XKKA 3C4WA 4EBVA 3ZDUA 3HP2A 3ORPA 3OCGA 4XG7A 3F6XA 3C4ZA 2VNWA 3CGOA 4D1ZA 4QMLA 3NMUF 2O65A 4DLJA 1K9AA 1NY3A 2C5NA 5EHOA 1XR1A 3TWJA 2WMWA 3GCUA 1ZOHA 3C4FA 4YLKA 3RAHA 1W84A 4CFWA 5K5NA 4FT9A 1CM8A 4KBAA 4H58A 4O0RA 3JXWA 4O83A 1R78A 4CT1A 2P33A 4PMTA 4BYJA 5KBQA 3FLSA 5HBHA 3SOCA 5HVYA 2R3QA 3SGCA 3TKUA 1Q41A 4YNOA 5GINE 5LMKA 5A14A 5HNGA 2Y6MA 4Y95A 4A06A 2QVSE 2VTLA 3H0YA 2W1ZA 5CEIA 4MTAA 3DT1A 3FKOA 2PK9A 3OWKA 2E9NA 5CAQA 3DFCB 3KB7A 3QQKA 4KS8A 3Q2JA 1ZOEA 3CS9A 2Z2WA 4FSNA 4ERKA 5FLFA 1PYEA 4ANLA 3FJQE 3ATTA 3C5UA 4IHPA 2VTIA 1J1CA 4J71A 5D7VA 5AA8A 2V0DA 2VX0A 5TOZA 4FNXA 4AA5A 4DBNA 1XJDA 2HIWA 3DJ5A 4S30A 3TNQB 3HV7A 5CS6A 4CXAA 1J7UA 4YO6A 5I9UA 4YTHA 2XNOA 3DTWA 3OBJA 5TKDA 4FK6A 4G9RA 3P1AA 4YJSA 3LQ3A 4UMTA 1Q8TA 3IGGA 3SAYA 3LM0A 1JLUE 3BYVA 2OIDA 3FLNC 3GC8A 1P14A 3DDPA 4IAIA 3DY7A 5JH6A 3EFWA 1YVJA 2HZ4A 1O6YA 2R2PA 4K0YA 5E1EA 4Q9SA 1KE5A 4RGJA 1PKGA 1VZOA 4FNWA 3D94A 3Q32A 4TWCA 5A3XA 1SZMA 1J7IA 3SG8A 4C38A 2VWWA 3AC4A 4RFZA 4E73A 3MY1A 2ZV9A 4FL3A 1M14A 4MF0A 2J6MA 4Y5QA 3SRVA 2C1AA 5GZAA 4FSZA 2WXVA 3ETAA 5JZNA 4MQ2A 2NO3A 4ZY5A 1PXLA 2F4JA 3L9MA 1OVEA 3SD0A 3HDMA 2J4ZA 4E1ZA 1R0PA 4Y46A 3II5A 3LFSA 2OXDA 4OTPA 3DKOA 2GCDA 2HENA 2GHGA 2R3IA 3ITZA 3KQ7A 3POOA 2CNUA 3UNZA 1AD5A 5KMMA 2QR8A 4FTAA 4UALA 4ASEA 4Z9LA 4O0VA 4ZTQA 4UWCA 5FTQA 1XBCA 4D1SA 3K3JA 4ITHA 4FBXA 3BEGA 1UU3A 2XIYA 4IVAA 3VS4A 3A7IA 3O96A 1QL6A 3TIZA 4R7BA 5BYZA 3D83A 1OZ1A 1RW8A 3VS1A 1CDKA 5IA1A 2VX3A 2R0UA 3A7GA 2G1TA 3V5LA 3AT2A 4NTSA 4FTNA 4TYHB 5AMNA 4X3FB 3R9DA 4XHKB 1KE8A 3EFJA 1YWRA 4O0TA 3ALNA 3ZOSA 3NUNA 2GNLA 3F3VA 4I4EA 4AFEA 1QMZA 5LMAA 4EL9A 4JG8A 4LOQA 4XV3A 2VTNA 3CTQA 3HMPA 4KABA 1GOLA 4KIOA 1E1VA 4GFOA 4BIDA 2YM7A 1WVWA 3V3VA 4ANQA 4YGAA 4GK4A 2HZIA 2QOQA 3F5XA 4MNEA 4OT6A 1OIUA 5EW3A 3S95A 1BX6A 4IB0A 4YJRA 2OJJA 3CIKA 5CLPA 4FV1A 3DA6A 2YZLA 4XG4A 4O86A 2J2IB 4RG0A 4FOCA 4IVCA 4U8ZA 3FLQA 3WIGA 4PF4A 3FBVA 3Q60A 2BIKB 2OJ9A 2XRWA 1URWA 2WQOA 4KIPA 4QP8A 5HVJA 3TZ7A 5JFWA 3ZLYA 5I5ZA 3PG1A 3UP7A 1SMHA 4EH4A 5AV2A 3TDVA 5EDQA 4YU2A 2UW5A 3R0TA 2QLQA 4YZCA 3LXPA 1QPDA 3RK7A 3LJ0A 4ACMA 4CFUA 3KF4A 5A9UA 4FTIA 4GCJA 2ONLA 2WPAA 3SG9A 4TYGA 4CYJA 3E8EA 2I0EA 4BTFA 5JN2A 4L9IA 2UZBA 2A2AA 5GZ8A 4V0GB 4AOJA 1U59A 1QCFA 4ZIMA 2EXMA 3BU6A 4WG4A 4FGBA 2B4SB 2NP8A 1KOBA 4HCUA 4ZOGA 2W1HA 3QL8A 2RFSA 3G9LX 3LE6A 4HW7A 3RAWA 3MFUA 1SVEA 5E8VA 5DT4A 4TNBA 5H9BA 1BKXA 2PVMA 2KTYA 3FXXA 4CD0A 4I3ZA 4CMTA 2XNPA 4LFIA 4ZZNA 3KEXA 5ACKA 4ID7A 2XJ0A 4UYAA 3C13A 3IW8A 3SC1A 4FZFB 3EYGA 4I1ZA 3V6SA 4KWPA 1VYZA 1Y6AA 4BIEA 3AD6A 4QP6A 3ID6C 3V5TA 1ZRZA 3R83A 4XOZA 1OECA 1REJA 3H30A 3DV3A 3KN5A 3ZSHA 5CVFA 2OWBA 3V5QA 4BGHA 3QZFA 5KHXA 4XCUA 4PX6A 3W8QA 4AG8A 5FD2A 5IQIA 5AP3A 4WRSA 3VWAA 3HNGA 3IDBA 3ZS5A 4IM3A 5A4QA 2PSQA 2GDOA 4I23A 4TWOA 5CVGA 2XCKA 2JDVA 2X8DA 3ZCLA 5IA5A 3RJCA 1OB3A 1GY3A 5DRBA 3KXMA 3H4JA 3TNWA 3NUYA 4E6AA 3IW6A 4PQNA 4XYFA 1GJOA 3I5NA 3V51A 4ANNA 4G5PA 4F4PA 3F2NA 3NIZA 5HU3A 2X2KA 1YWVA 4NM3A 4PMMA 3NLBA 3UG2A 1W82A 4D9TA 4HJOA 2XKDA 4IX5A 5EYKA 2QC6A 2V22A 3EN7A 3IW5A 4RVKA 3NYXA 5L8JA 3UZRA 4LRMA 3QD0A 4GG7A 4X3JA 5CEQA 1UU9A 4ENXA 5KCVA 4H36A 3MVMA 3HA6A 4QTEA 1B38A 2ZDTA 1FGKA 1WBNA 4U3ZA 3VBXA 3VS6A 3FQHA 1ZYSA 1ZAOA 2CN8A 1O6KA 4V05A 5AP4A 2WMTA 4QTBA 4ENYA 4WO5A 4UEUA 4FKSA 4XRJA 1YXTA 3VUKA 3GOPA 1YI6A 4BRXA 2O0UA 3CJFA 4KKGA 4IAAA 5CEOA 4FKWA 2JDRA 5IDNA 3KGAA 2R3HA 1SNXA 3D7TA 4F7NA 2QNJA 4M67A 1Q62A 2WB8A 4PPAA 2VZ6A 1AGWA 1H0WA 3PIXA 2WIHA 4AP7A 4C2WA 5KMLA 1BL6A 3FUPA 3QWJA 4C4JA 3AD4A 4M0ZA 3CY3A 5AX9A 4NJ3A 1IAJA 3Q4TA 2YLFA 5HTCA 5DI1A 3ZUUA 4DF3A 3EOCA 5HE3A 5EQYA 5L6OA 4R78A 1X8BA 4MWIA 3P79A 4RSSA 4YP8A 4AZVA 2I1MA 4X2KA 3BV3A 3GEQA 4RVLA 3UODA 4GKIA 3ORXA 1IA9A 1GZOA 2XIXA 5EQPA 4FIGA 4BWPA 3RPYA 4K77A 4GV1A 1PW2A 3OCSA 5TT7A 3AC1A 4GU6A 1BUHA 2EVAA 3DZOA 2W4JA 4FI1A 5BNJA 2ITXA 4J95A 2CGVA 4FUYA 3VHKA 2VRXA 4FSQA 4I0RA 4NCTC 5IMXA 2XBAA 3IOKA 2YCRA 5IISA 3R02A 5ETAA 4FKPA 4AX8A 3ZLWA 4AWIA 1ND4A 5CSHA 2YCFA 2VTMA 4DN5A 1XH9A 4IQ6A 2BRBA 2C5VA 2OJIA 4EZ7A 1IEPA 5KMOA 2Q0BA 3W55A 4NFMA 4N4SA 5HX8A 3CY2A 4TWNA 2EWAA 3DNEA 4GYIA 3VJNA 2QG7A 3QU0A 4I6HA 2UVXA 5L8LA 4AGUA 3TEIA 4EBWA 5DA3A 4G3EA 2E9PA 2VTOA 4QPMA 4BHZA 1EH4A 4DAWA 4ALVA 3CQEA 4JOAA 1DAWA 2ITTA 4JQ8A 5EDPA 3S4QA 3OS3A 2VU3A 3C51A 5J7HA 5IQCA 1MP8A 4GK3A 4QYHA 3LFAA 2HZNA 1XHAA 2VN9A 4ANBA 2BRHA 3WZKA 5GZ9A 3FI2A 3S0OA 5E8TA 3BE2A 2UZDA 3NYNA 3R7VA 3ATSA 3DFAA 3WF5A 3ZUVA 1XQZA 3RINA 4RVMA 3P7CA 1F0QA 3BV2A 4BDDA 2XKFA 4ZS4A 5E8SA 3LKMA 4D4RA 1WMKA 5E8ZA 3A8WA 2XJ1A 4EQCA 4HVIA 4CG9A 4EOKA 4PMSA 4UXQA 4YZBA 3ORLA 4MK0A 2RFNA 5JKGA 2W1CA 3C1XA 5IQGA 2GHLA 2BDFA 1BI7A 5B2KA 4IZAA 4F63A 1YHWA 2RF9A 3NIEA 4GU9A 4X2FA 3TUBA 1MQBA 4BCGA 4I5HA 4QP2A 4RIXA 5I3RA 4FVPA 1OGUA 3D0EA 5LVLA 3ANRA 1R3CA 3GOKA 2JBOA 3BWJA 4BDGA 3TT0A 4DHFA 3M1SA 2I7QA 5CU4A 3KFAA 4FZDB 4BC6A 2YDJA 4KUJA 4G5JA 3A99A 3KRLA 1UA2A 5E92A 5ANEA 5CY3A 3TCPA 4F0GA 1Q99A 4P5QA 2RFEA 3VC4A 2W96B 1G8SA 5LWMA 2H9VA 4MXCA 4OAUC 4E4NA 3MY5A 3R01A 1ATPE 2A19B 2BCJA 2Y4PA 5BVOA 2X2LA 2G2FA 4C4FA 2XM9A 4FV5A 3GXLA 3QTXA 4BI1A 3ZZWA 1PMVA 3F61A 3HDNA 2R3RA 2IWIA 3QTIA 3FY0A 3R1SA 3F3ZA 3VW8A 4E26A 3KN6A 5AUUA 5KUPA 5IH5A 5EW8A 2QO2A 4A4LA 3D9VA 4J1RA 4O6EA 4L7FA 5AX3A 2W06A 2BHHA 4AOIA 2R3FA 3AGMA 2YM3A 2JBPA 4J8NA 2R3MA 4K11A 4E7WA 2WTCA 3HV4A 2FO0A 3HL7A 3MJ1A 4DFUA 4DG2E 3LXKA 4IVDA 2O64A 1ERKA 4MVFA 2BMCA 2GFSA 2XK4A 4CRSA 2W4OA 3R73A 4DCAA 5CSPA 2IZTA 4O7ZA 4RX8A 5JRQA 1OKZA 5E90A 2A4LA 1REKA 2BFYA 2DWBA 2WNTA 3Q96A 2UZUE 3QCSA 3R7UA 4B99A 1UVRA 2QOIA 2QO9A 3ZM4A 2XH5A 1YDSE 5E1SA 5IMEA 3I7BA 4FSTA 4M12A 2BKZA 4QTAA 3R1NA 4IWPA 5FG8A 5HICA 4FTQA 3UBDA 2UVZA 3E5AA 3GP0A 3H10A 4O7VA 5H8GA 4R3PA 4MD8E 5F9EA 2JKQA 4IH8A 1ZLTA 3ZRLA 3ZXTA 4DC2A 1UKHA 4L42A 4JIKA 1WBPA 4TN6A 4EOMA 4BIBA 3OXTA 4WNMA 5FP5A 4EORA 4O7LA 4LL0A 4QMZA 4YHTA 3VQHA 3FI8A 3GC7A 4KD1A 3QCQA 4AW2A 3KA0A 1WVXA 4IZ5A 1PMEA 3ORIA 1H24A 3O17A 4QQCA 3ZLXA 4DTKA 3I79A 1Q8WA 4A9UA 3BHTA 2VTRA 5J87A 3KRWA 3UIBA 2PVLA 4CCBA 4LMUA 2C6MA 2C5XA 1UV5A 5EI6A 4PNKA 2HWOA 4F70A 4WRGA 4NZWB 5FXQA 3L8PA 5EG3A 4OTDA 2YIYA 4E6CA 4TYIA 4FZAB 5KX8A 4LV8A 4MX9A 5HGIA 3OMVA 4PMPA 2WOTA 4PTCA 2PZPA 4AZWA 3LVPA 3S1HA 2UZLA 4IXPA 3MB7A 1KOAA 4H3BA 3GQLA 4PPCA 1PYXA 5BX0A 5CAVA 3DQWA 5GJDA 3FMEA 2CGUA 3FDNA 1ZMWA 4OAVB 4YURA 4FF8A 3PJ1A 4N0SA 4PPBA 3RM7A 2O5KA 2UZVA 2UUEA 1CTPE 3TUDA 1Q8ZA 1O9UA 2HELA 3QQLA 3QF9A 4IMYA 2QONA 2UW4A 4CGAA 1O6LA 5DBXA 3QHRA 3GI3A 4L3LA 4RJ7A 5L2QA 1H8FA 3ZRMA 4HVGA 2B0QA 2PZRA 3OY1A 3B2WA 2WQBA 3KVXA 3QQUA 3TN8A 5AADA 4WBBB 5KMJA 3S2PA 2J0MB 4F0IA 2ZV2A 5CALA 2IVVA 3LXLA 5CSWA 4FIEA 4AZTA 3P7BA 2C3JA 2HZ0A 5D9HA 5AAEA 3G0FA 4EJNA 3MVHA 3GNIB 4FG7A 5ETCA 3MPAA 4Z16A 3DXQA 3VF9A 1J1BA 3UO6A 4BF2A 2F57A 2E2BA 3ZXZA 5J7BA 4O7TA 2PVFA 4GT4A 3UPXA 4BI0A 4DGGA 4BCFA 2OH4A 4DFBA 3LQ5A 3OG7A 3W10A 1OPKA 3VRZA 4HPTE 3L9LA 1W7HA 3H0ZA 5HO8A 4B8MA 4J8MA 3U6IA 4J97A 3EB0A 4L43A 1OM1A 4FOBA 3VIDA 5CF8A 4PDPA 4B9DA 3QA0A 3WI6A 3ZC6A 2PUNA 3MW1A 4CFVA 3QRJA 5T6KA 5C8NA 2XK9A 2BDWA 4DEEA 4ZSEA 2VO6A 3MIYA 3KY2A 3AT4A 3N51A 4MXAA 4E4XA 2XB7A 3GBZA 1JSVA 4WUAA 2ZYBA 2JEDA 3BPRA 3OWLA 4XEYA 3P9JA 5LWNA 2EB2A 5AA9A 2CPKE 3D15A 4PDOA 4OTFA 4TYEA 4J53A 2RIOA 3SV0A 4FIJA 3E93A 4H1JA 2UVYA 2REIA 3BHVA 3MV5A 4BYIA 2DQ7X 5LMKC 4KIKA 2PUIA 5AR8A 3AQVA 1JSUA 5GNKA 2PMNX 1WBVA 3NDMA 2W5BA 3ROCA 5IPJA 3WZEA 3BYSA 5HQ0A 2CSNA 2IVSA 4MD7E 3NVKI 1TQMA 2F7XE 3GFWA 4M7IA 4QMYA 3MH3A 5CQWA 3SHEA 3Q52A 3DK6A 3MESA 4FEXA 3HP5A 4FEQA 5ETIA 3NNUA 4CQGA 4M3QA 2IJMA 3KXXA 3HA8A 5AUTA 3FEGA 3N4VA 4HYUA 3A4PA 3DGKA 3Q04A 4BL1A 4GFGA 2BPMA 4O82A 1CKPA 2WTIA 4DG0E 1U54A 3KK9A 3SXSA 2PULA 1LUFA 4RJ4A 5E8YA 4FZ7A 4MCVA 4FMQA 2VD5A 1ZYCA 4LOPA 3PA4A 5L6PA 3OW4A 3RK9A 1H1PA 4EYMA 4FSYA 4XLVA 4ZJIA 5HVKA 2ERZE 4BGGA 4D0WA 2WQNA 3PG3A 1R0EA 4GRBA 3V5PA 4CLJA 1NVRA 4X2JA 4FKUA 1Q4LA 1P4OA 3HECA 2JIUA 3PSDA 5H8BA 5CI6A 3VBQA 3G6HA 2ZB0A 4OLIA 1R1WA 4BCIA 4C36A 3EWHA 3VBWA 4FK3A 1JAMA 2PMOX 4G3DA 4IANA 1M52A 5F94A 3PXYA 3PVGA 2W17A 5BVEA 2QR7A 4TWPA 4BCOA 4D2PA 4RA5A 5CSXA 3ACKA 2RSVA 3LFEA 2ETKA 1JKLA 2XNNA 4P5ZA 4C8BA 1ZARA 4O91A 4R6VA 1H1WA 4XP2A 1IAHA 3GVUA 3BRBA 3M2WA 4PNIA 4KRDA 2CLXA 4FV8A 2R3GA 3VHEA 4FTOA 3SW4A 4MXOA 4IADA 2VTPA 2YIRA 4RFYA 4CV8A 5C01A 1NA7A 3P86A 4LUDA 3TJDA 4QMNA 3P08A 3PXZA 3K3IA 4HYIA 1WCCA 4B0GA 4AQCA 2R0IA 5CF6A 4ZTSA 5JGAA 4TZRA 3RHKA 3EIDA 2OKRA 4EH5A 2F49A 3GCVA 3KRXA 3QQGA 2XJ2A 2YITA 4MF1A 1LEWA 4N6YA 3PJCA 2W7XA 4FKVA 4PDSA 3VS0A 4B4LA 1STCE 5CAPA 3KREA 3EN9A 4JJRA 1LPUA 1M2RA 4AW0A 4XUFA 2WTVA 3R8PA 2OH0E 1PF8A 4FL2A 2OG8A 4JLCA 3NNXA 4M69A 3PIZA 4QNAA 4B7TA 3HZTA 4BDJA 4ZLOA 4BKZA 5LVNA 3MFSA 1AQ1A 3ACJA 3C4XA 4HNIA 3RNYA 4C7TA 5BVDA 4U81A 1GZNA 1XBBA 3PZHA 4FV6A 3ZO2A 3NVMB 3FMLA 1M2PA 3VS3A 3LJ1A 3U4WA 2UZEA 5HO6A 1F3MC 2YCSA 4JNWA 4RT7A 4EC9A 5CAUA 3MPTA 5DRDA 3RCDA 3LZBA 1YDRE 2WQEA 3C0GA 3LPBA 3PE1A 3UOLA 1Q61A 2C6EA 4YZNA 2B9FA 3M11A 2BDJA 5CEPA 3LXNA 3V8TA 5LXMA 2O3PA 4U3YA 4FICA 4FTJA 2X7OA 5EYCA 4CKRA 4KSQA 4BCJA 5CU2A 4QP1A 4UB7A 3ZDIA 4AE6A 2YA9A 5F1ZA 2YM8A 3KL8A 2GS7A 4QP9A 4UY9A 2JKMA 4Y85A 3T9IA 4BZDA 1PXIA 2ONLC 3EN6A 3VBYA 4QYEA 3THBA 4DGNA 2AUHA 2ZV7A 3DS6A 2X6DA 3K5VA 3R8MA
chains in the Genus database with same CATH superfamily
3AT3A 3QD3A 4USDA 4D9UA 4DEDA 4JBQA 3RNIA 4JX7A 4YHFA 3IPHA 3Q6WA 3UZTA 4DTAA 4LUEA 3UQCA 4BHNA 1OL6A 3ZBFA 4ACCA 2B9JA 3DXPA 2O2UA 2XF0A 3SXRA 4JR3A 2GMXA 4A9YA 3BHUA 4U97A 2C6OA 5AUZA 4E3CA 3JYAA 1PJKA 1XH5A 3PRIA 3QYWA 3O71A 4GG5A 4GT3A 4A4OA 4NT4A 4WD5A 4W4VA 1YRPA 2XYUA 4ZY4A 5HORA 3FSKA 4NKAA 2RKUA 4A07A 5G1XA 3HUBA 1KE9A 4RBLA 5M09A 3OROA 4U42A 3GC0A 2XIKA 5HBJA 4ZMFA 4FSWA 2VO3A 4AXEA 1FOTA 3OZ6A 3QALE 1IG1A 3NYVA 5HNBA 5I3OA 1WAKA 4FKRA 3W2QA 5CF5A 2W5HA 4PY1A 2NRUA 3WZJA 3CKXA 4CKIA 4HNFA 4W4XA 1SYKA 2YABA 4ZEGA 1TKIA 3NUSA 5AP0A 3VW6A 2CKPA 3DAEA 5IEYA 4QPAA 1Q8YA 2Z60A 3UQGA 4BCHA 4FG9A 3L8SA 3PLAE 4PUZA 5J1WA 1PMUA 3MBLA 3KCKA 5CU3A 5I0BA 4DEHA 4V04A 1Z5MA 4JBOA 3ZLSA 1H01A 5AP2A 3IDPA 5AV3A 2OIBA 4DITA 3UOJA 4FYOA 3FKLA 3C0IA 5HE2A 1FMKA 3DAKA 1MRVA 4N70A 1OL1A 2YIXA 4XG6A 5AR7A 4BGQA 5D12A 5JGBA 3L1SA 4C3PA 4EONA 4U79A 5DR9A 3IS5A 3R30A 3O8TA 3AC2A 3V6RA 3R00A 4F7LA 3R9RA 4QOXA 3FPQA 2Y4IB 3BLHA 3DAJA 5H8EA 5C26A 5IH6A 2C6TA 1KWPA 4RA4A 4APPA 4PL3A 2BRGA 3C4CA 5GJFA 4YLLA 4I22A 4DLIA 1L8TA 2PE2A 2Z7SA 5KKRC 4QMXA 3PA5A 4BCNA 3NAXA 3QKLA 3NUXA 3I60A 4JQ7A 1UWJA 3O8UA 4XOYA 2OO8X 3CCNA 3JVRA 2OFUA 1BYGA 3SXFA 3C9WA 2QOFA 2WMBA 4LOOA 2HXLA 3PY3A 3HEGA 1J3HA 5HLPA 3LHJA 4BI2A 3CBLA 5AAGA 3TUCA 1LR4A 1WVYA 3F3UA 4ZTLA 3QXOA 1JSTA 2HYYA 5CNOA 2XP2A 4L3JA 5CSVA 4E4LA 3NCZA 5LVPA 4AQKA 4DH5A 4JG6A 1PKDA 2PYWA 3KXHA 4RIWA 3MH1A 1ZYJA 1YI4A 4RJ3A 4QMUA 5H3QA 1TVOA 2XMYA 4TNDA 5EKOA 3RZFA 3G5DA 5DHJA 3VUTA 2YAKA 2OZAA 4FKIA 2C3IB 4FKGA 4FG8A 4UZHA 3VULA 2GNFA 2Y8OA 1JKKA 4DFYA 3U54A 3KULA 3A7HA 4MAOA 2O63A 3PUPA 2Z7QA 3JUHA 4O7RA 3GGFA 3REPA 3HUCA 4AFJA 1PXPA 3IONA 5EFQA 2VTAA 4X6RA 3LQ8A 4DT9A 2P55A 5HIEA 4EH2A 4EI4A 4CFXA 3R9HA 4IJPA 4G6OA 1GNGA 4K2RA 5FEQA 4F7JA 4U40A 3K2LA 4WSQA 4W8DA 3G51A 1V0BA 4RLLA 5BVWA 3ZHPC 2F7EE 5CNNA 2BHEA 3PXQA 4F0FA 4Z3VA 1M2QA 5CANA 3WZDA 3IW4A 4NSTA 1LP4A 3D7ZA 3QKKA 3PIYA 3F2RA 1FPUA 3FZSA 3SQQA 3VO3A 4BWXA 4ZZOA 3KF7A 2V7AA 2CJMA 3CJGA 3OBGA 2WEVA 3TM0A 1YDTE 2J0KA 2OICA 4KSPA 3DCVA 3DLZA 4FIHA 5HIBA 2P3GX 4HYHA 5M55A 2OK1A 4X2NA 4PL5A 4ZXTA 5CASA 4ALUA 4R7IA 3EL8A 3QTSA 3ET7A 1BLXA 3OT3A 5FTGA 2XYNA 4K18A 2R7IA 4ANOA 4AU8A 2WIPA 3EN4A 4FR4A 5KMKA 3BYMA 3CLYA 4M66A 4NFNA 4WA9A 2GNHA 5BVKA 5AAFA 2UW6A 5J95A 4BCQA 2FA2A 4UX9A 1DI8A 3UMXA 4IDTA 2B9HA 4RWLA 4YSMA 2BILB 5EKNA 2IN6A 3VBTA 1PRYA 4O4CA 2ZVAA 4YR8A 4JVGA 4RIYB 4RJ6A 3UNJA 2BTSA 5FBNC 4F1MA 4WG5A 5C9CA 4V0GA 4OR5A 4UWBA 5FEEA 4CTCA 5IA3A 5HI2A 4UV0A 5K5XA 4P90A 4YPDA 4CFMA 5AP6A 3CTJA 3MVJA 3AC8A 4Z7GA 4KIQA 4M14A 3OY3A 2ZJWA 5A6OA 3QTWA 2XNGA 3F3WA 4G6LA 1PY5A 4O7YA 4RPVA 5A4LA 4W4YA 4U9AA 5AV0A 3DK7A 3H9FA 1KV1A 3D2IA 3LFQA 5FUTA 2XVDA 2ESMA 3E7VA 3UVRA 2XNBA 3V5JA 4BBEA 1APME 4BR3A 4DHJA 2W9ZB 4EOIA 1WZYA 4EK5A 3KXNA 4AZFA 3MYGA 4C3RA 5JZJA 1NW1A 4L45A 5DEWA 4C3FA 3AMAA 3KCFA 4XS2A 3TNIA 3IO7A 2BVAA 1PXJA 4U41A 4FSRA 3FHIA 2W1FA 2XM8A 4ZY6A 2QURA 4AXDA 3BEAA 4M8TA 4F1OA 2YHVA 3BX5A 2YWVA 2OFVA 4GW8A 2WGJA 4O0WA 5AUXA 5FBOA 1G3NA 3LLTA 3D5WA 3CGFA 4JDJA 5DIAA 4CCUA 5ANOA 3RCJA 4DGMA 4EH6A 1ZMUA 2WU6A 2X2MA 4NIFB 5K4IA 3AKJA 3DNDA 4C02A 1RJBA 3ZFXA 4EK8A 2XIRA 5CU0A 4Q5HA 2OSCA 3MVLA 4GYGA 4GVAA 4WG3A 3GU8A 3FY2A 4D5HA 3LCDA 3NEWA 4GJ2A 5J9YA 4IAYA 4QMOA 5DG5A 3BELA 1V0OA 2FGIA 4ZJJA 4F9YA 3GU7A 4ACDA 2WMXA 4XV2A 2VWIA 3C50A 5D11A 4ZK5A 1FVVA 2LGCA 1QPCA 4A4XA 3C5IA 4MBLA 4YC8A 4R5YA 4NYEA 3R6XA 1K2PA 2R3KA 3UIXA 3NSZA 1W2DA 2ERKA 3ZC5A 4YMJA 4O22A 3E62A 3E8CA 5I9YA 3HAMA 4L52A 4KRCA 4C61A 2WQMA 2AYPA 4GIHA 5HOAA 4RC2A 2UV2A 4D28A 3LMIA 1YOMA 4YTIA 1TQPA 5LCKA 2ZM4A 2P4IA 3H3CA 3OF0A 3GQIA 5CEKA 3L8VA 4OBQA 3SDJA 5DNRA 5DR2A 4ZJVA 5EM7A 5EYDA 3TNPC 2JAMA 2I0HA 3COIA 3GFEA 2GTNA 4BTKA 3E92A 4FTRA 3EH9A 4XP0A 3VRYA 4NL0A 5H2UA 4M13A 1BL7A 4ITIA 4O2PA 1URCA 3BCEA 3TDWA 4FVRA 2W1DA 3B8QA 3FAAA 2UZTA 3NX8A 3O7LD 3F2AA 4FKQA 4NW6A 4RIXB 5KMNA 5LVMA 3MGYA 3RP9A 3NGAA 2X7GA 4EUTA 3HMOA 4GVJA 4O96A 5KMIA 4IX6A 3PPZA 4O0SA 2C4GA 1GZ8A 5EOLA 3VS5A 4LV5A 4ASZA 4I0TA 2NRYA 4DDIA 4O81A 4WT6A 3P5KA 4YTCA 4G1WA 2R64A 2WMVA 4U44A 1OBDA 2ITNA 3E88A 3CPCA 2WELA 4HOKA 2PVKA 5IU2A 4EJ7A 4EWQA 2VGOA 3HV6A 1Y8GA 3PZEA 5DLSA 3CP9A 5AIRA 1FVRA 4FV9A 3RPSA 2NNWB 3PWDA 4PL4A 3QUPA 4M84A 4BWKA 3ZYAA 4UMQA 3W2CA 3NYOA 1DI9A 3FYJX 2WU7A 3COKA 5I9XA 5L3AA 3I1AA 3UE4A 2FB8A 4ZZMA 3RPRA 2ZV8A 4EK6A 5IUHA 1HCKA 5HESA 5HKMA 3RALA 4ZAUA 3NFFB 4U6RA 5FDXA 4MKCA 4YSJA 5FRIA 3I81A 1XO2B 2QO7A 4QTDA 3NNWA 5EDRA 4LQMA 3TZMA 2P0CA 4I5CA 5C03A 5EH0A 4CRLA 3R8UA 4G17A 2WOUA 4QMWA 5J79A 3W2RA 1FGIA 3UC4A 5J9ZA 4C2VA 2UW9A 2XIZA 1OUYA 3T9TA 4ACHA 4FGRA 5IQEA 4EZ5A 5EM5A 5KE0A 4EOQA 3SX9A 4KBKA 4FA2A 1H26A 4FTCA 2OF4A 1XH6A 3Q5IA 2HWPA 2PMIA 1OKWA 1YXXA 3AD5A 3FWQA 5T68A 3LAUA 1OL5A 3O5AA 2Y9QA 3E64A 3RPVA 3COMA 3GUBA 4ZTMA 5EQEA 4R8QA 4DFNA 3AC5A 4TTHB 3ZO1A 3NR9A 5HEZA 4XG3A 4NH1A 3FL5A 4P2KA 1JKSA 1CMKE 1UKIA 2C0OA 4KINA 3ZSIA 4USFA 2DYLA 4QP3A 5CENA 3SW7A 4QD6A 4YZ9A 3QXPA 2F2UA 4M0YA 4XNEA 2X81A 4S31A 5IUGA 2Z8CA 3QHWA 2I40A 3EQFA 2ITUA 5AP5A 2ITYA 3WYXA 3FMMA 4JBVA 4IJ9A 3EQHA 5I9VA 1Y6BA 3Q4UA 1OKVA 2H8HA 3LJ2A 4L00A 5E8XA 5BMSA 3PXFA 5DYJA 2IVTA 2XK3A 3OXZA 4RVTA 3EKNA 4PDYA 4F7SA 2BKKA 1LEZA 3AOXA 4UBAA 4V01A 3F3TA 5DN3A 2YWPA 4K1BA 4HGLA 4C62A 4FTKA 5ANIA 3HRCA 3U4UA 4MYGA 4GIIA 3FE3A 4IAKA 3OOGA 2QKRA 3QKMA 3UJGA 4MHAA 4EEVA 3W33A 2ITPA 5A46A 4FNYA 5BQ0A 2EB3A 3ULIA 3R28A 4Z7HA 3BYUA 4BJJB 2I0VA 3LW0A 1VEBA 1NVSA 2C6DA 3I0OA 3UG1A 4JMQA 5EHLA 4O84A 5HE1A 5M53A 4Y72A 4R7HA 3KU2A 3RKBA 3CD8A 4BFMA 4C4GA 5BYYA 1GIJA 4I5MA 3R9NA 4GMYA 4BTMA 1Q5KA 1G8KA 2XEZA 2ZMDA 2R4BA 3EMGA 4EQUA 3Q53A 4F9CA 3PYYA 4S34A 3QRUA 5A54A 1NVQA 2GS2A 5AP1A 2QCSA 5EI8A 5HZNA 1G5SA 2QOCA 3MH0A 3ORKA 3IG7A 5K0XA 1S9IA 2PVNA 3QUDA 4AOTA 4ZLYA 4I4FA 4XRLA 3OXIA 3P0MA 3ZEPA 4IAFA 2IEWA 3RAKA 2IF8A 4LG4A 4RJ8A 2VTJA 4BDAA 3LM5A 2R3NA 3ODZX 4OTRA 4ITJA 3TTJA 4G9CA 3NPCA 4O1OA 4DFLA 4JL9A 3Q3BA 3C4EA 5HG5A 5C1QB 3UNKA 4MWHA 5CTPA 4NU1A 5CX9A 5CEMA 3MJ2A 1Y57A 3FL4A 4FZ6A 1YKRA 4H39A 4XBRA 3UC3A 4D4VA 3BWFA 2V62A 4CEGA 2B7AA 4E5AX 5M07A 2GQGA 4RQVA 3QD2B 4IW0A 2E9UA 4XBUA 1WBOA 2EUFB 4QTCA 4F6WA 2ITWA 3KK8A 1WBSA 2JDTA 3PP0A 5AV4A 2PVRA 3FLYA 2ITQA 3NAYA 4H1MA 4FKLA 4KNBA 5EHYA 3UYSA 5FGKA 3VUIA 4O1PA 1G8JA 3WE4A 4BDBA 2CGWA 4I6BA 2BUJA 3ZU7A 4BN1A 2ZAZA 4GL9A 5AR4A 3A2CA 3ORTA 3ZFMA 3PVUA 4GS6A 4LYNA 5EM8A 4RIOA 3BU5A 5CZHA 1XH7A 2GNIA 2PY3A 3A62A 3HKOA 4I6FA 5LARA 1ST0A 2PZIA 4QYYA 2EXCX 4RC4A 3SLSA 1M17A 2J51A 1KE7A 3GU6A 5IA4A 2GQRA 4IB5A 2RGPA 2PPQA 3ODYX 3TKHA 4IB3A 5HHWA 2W1IA 1ZZLA 4EQMA 4N6ZA 4K9YA 4TXCA 4R1YA 5DMZA 4UMUA 4CZTA 1W0XC 1OKYA 1T46A 4L3PA 2J5FA 1YWNA 4MNFA 4XX9A 3S3IA 2ZFYA 1HCLA 4CG8A 2OBJA 4YUQA 1H00A 5FQDC 1U5QA 2G9XA 2P2IA 3CTHA 2VWUA 2X0GA 2YN8A 4R3RA 4DEBA 1E1XA 4I41A 2FSTX 4QYFA 4YZDA 2QQ7A 3VUMA 4DBXA 3GCSA 3DBCA 5J9LA 1OGYA 4IWDA 3ROYA 3TYKA 5GHVA 1FVTA 5JT2A 1T45A 3AC3A 4EUUA 1ZYDA 4FEUA 1OIRA 5AUWA 1ZY5A 4FKTA 2GTMA 2OXXA 4D2WA 3DPKA 3FZRA 1UU8A 4ONAA 3R8LA 4HVDA 3FZTA 4FJVA 3QD4A 3NW5A 3JS2A 3LFBA 3DJ7A 3V01A 1HOWA 2PVJA 2W4KA 2C5OA 4IX3A 2E9OA 2Z7LA 3QC4A 2BZKB 5ANGA 2C6KA 2OW3A 3R1QA 4AAAA 3VONA 3AKLA 4FC0A 4O0UA 2GU8A 4FEWA 2WMQA 3RM6A 3F5GA 4NWMA 2VTQA 1FQ1B 4U43A 4USEA 3UO4A 4BICA 4IFCA 4ZMEA 1ZYLA 3A7FA 4BDCA 2R3PA 3W18A 3LCTA 3PP1A 1CSNA 4WSYA 2YAAA 1KV2A 3FZPA 3QCYA 2E9VA 2GFCA 2ITOA 2VTTA 4FSUA 1H27A 2GQSA 2BAQA 2V7OA 4AGCA 3R04A 4M97A 3IOPA 5CXHA 5L2SA 3E63A 4FIIA 5IEXA 1YHSA 4O0XA 3H9OA 5D1JA 2QHNA 3FSFA 3OUNB 1JNKA 4IB1A 3KRJA 1U46A 1Z57A 3ENMA 4BDFA 3RHXA 4EWHA 1NXKA 3OCBA 4JI9A 4S2ZA 2ETRA 3NUAA 4EK3A 5TR6A 4ORKA 2WD1A 3U9NA 2GSFA 5IUIA 3UGCA 3W1FA 5HG7A 4U0IA 1CKJA 3L8XA 3QQJA 3Q5ZA 3QLFA 1ZMVA 4AZSA 4AA4A 4DTBA 4I21A 3L9PA 2X0PA 1K3AA 4HZRA 1SNUA 4DHIB 4UZDA 3O50A 3MFRA 5M06A 1OPJA 2HOGA 4L7SA 4E6QA 1U4DA 4AXAA 4CFNA 4RRVA 4D58A 3MS9A 4IWOA 3BU3A 2X7FA 4HGSA 3RPOA 1JPAA 3PPJA 4UMPA 5HE0A 3P4KA 3NCGA 2UW7A 2W05A 4L67A 4D4YA 5EI2A 3PXRA 4OTWA 3DOGA 3F5UA 4F09A 4UYNA 4YPSA 3FXZA 1H25A 4TPTA 4HCTA 3F9NA 5L8KA 3QRIA 4HVHA 5DR6A 2YCQA 4D5KA 3QGYA 4PRJA 2X9FA 4C4HA 3LFCA 3I6WA 4DEAA 2ZB1A 2VV9A 3QTQA 5ANDA 3DBQA 4I92A 1H1SA 4KAOA 4R1VA 4C37A 5E4HA 3S00A 2XNEA 2J90A 3I7CA 3JPVA 3ZMMA 3NUPA 3TG1A 3OFMA 4YBKA 4J99A 4L6QA 4ZTNA 3QAME 2RL5A 2JGZA 4I0SA 5AR5A 3UO5A 1W2CA 4G3GA 3OC1A 4YHJA 3BGPA 3VJOA 3TL8A 5D41A 4FV4A 5A6NA 4PV0A 1OIQA 1IA8A 2A1AB 2CGXA 4A9TA 2R5TA 4FYNA 4NEUA 3R7EA 2UW0A 4DGLC 4C4IA 3D2KA 4J52A 3T8OA 1JOWB 5A4TA 4Y83A 3EYHA 4YJPA 1MRUA 3PSCA 1MQ4A 3U9CA 4FL1A 2C30A 4RX9A 4EC8A 4X3FC 3A4OX 3ZM9A 2ZM1A 1KSWA 4EHZA 5D10A 4RWKA 3W2SA 4DEIA 5M4UA 2BR1A 1TQIA 4QYGA 2JIIA 3QBNA 4RX5A 4AF3A 3F7ZA 4X7QA 5KZ0A 4JX3A 2J50A 1SM2A 1DM2A 4BCPA 3I4BA 4OGRA 3NW7A 2JD5A 4L68A 1B39A 1M7NA 4NM5A 1PXKA 3NZ0A 3A60A 1PXMA 3OHTA 4L46A 3R7OA 3B8RA 5JK3A 2W0JA 2AQXA 4CT2A 4FNZA 4PTGA 3PY0A 4U45A 3MSSA 4YJNA 3PJ8A 1A9UA 1P4FA 5GIPE 3ZBXA 3T3UA 5D7AA 3ZONA 5JEBA 3E8DA 2X4ZA 4U7ZA 2WTDA 2QOKA 4O27B 3WE8A 4MUQA 2VAGA 1PXNA 4O2ZA 3SRVB 4FSMA 5CU6A 2J0IA 4AT5A 4E5WA 5CZIA 3DBFA 1ZXEA 5DE2A 3BE9A 3HMMA 3Q9ZA 2G2IA 4MXYA 4QQ5A 4G3CA 2ZMCA 4QP7A 4OTGA 2UZOA 3QZHA 4WBOA 3O0GA 2NPQA 5T3QA 2WTWA 2IPXA 2IVUA 4NTTA 3CSVA 4F08A 2C68A 5EM6A 3QZGA 3DJ6A 5K3YA 4S33A 3PSBA 4O4DA 5IQAA 3ALOA 4K6ZA 1OL2A 4EH8A 3OTUA 4DG3E 2Y6OA 1A06A 2VNYA 2R3JA 4PWNA 4EHVA 3VS2A 5I9WA 1YOJA 4ZS0A 5JSMA 2AC5A 3R2BA 3LMHA 4RLKA 3W2PA 2H6DA 2XBJA 2B54A 4JS8A 2FSLX 2JC6A 3MTLA 4IIRA 3MI9A 3BHYA 4A7CA 5I9ZA 3ERKA 3VUGA 3AXWA 5DVRA 5FP6A 4I5PA 3FLZA 4RIWB 3TI1A 3W32A 4C58A 1YXUA 4DINA 3CD3A 3DBEA 5AR2A 4MNEB 3R7YA 4G16A 3N4UA 3QC9A 4AS0A 3ENHA 3NRMA 4IACA 4QMPA 1Q24A 4Q2AA 2PWLA 2JITA 2XEYA 4D4SA 1UNGA 2OZAB 2ZOQA 3QX4A 4EKLA 5K9IA 5KHWA 3SKCA 3U8WA 4NKSA 3OWJA 2CN5A 2X6EA 4B8LA 4PP7A 3LCKA 2OIQA 1WBWA 1F5QA 5L6WL 4FTMA 3KULB 3GENA 4I24A 3KMMA 2YISA 4WNOA 4CLIA 5ITAA 3LLAA 5AM6A 5FWKK 2FSMX 2WTKC 4GKHA 2YDIA 2WMUA 5LCJA 3ORZA 2VWXA 5AFVA 1Q8UA 4LDTA 4EK4A 3R1YA 1UWHA 4J96A 3W0SA 5HD7A 5M51A 3U55A 5KNJA 4AUAA 3LFFA 3QYZA 4TYJA 5IA2A 5CXZA 3RTPA 5FDPA 1Y91A 4WHZA 5LJJA 3IQ7A 3HV3A 3F69A 1B6CB 3QCXA 5FTOA 3HV5A 2B52A 2HY81 4MBJA 3FI4A 4IEBA 3CPBA 3CXWA 2VWBA 4NUSA 3QQHA 5ETFA 1FMOE 5IQHA 2X9EA 4QMQA 2PL0A 4X21A 4WOVA 1PXOA 2FVDA 3GCQA 3ZSGA 4BZOA 1P5EA 4FT0A 3F7WA 2PE0A 5IDPA 4TYHA 3SA0A 4TKSA 5IKWA 3UVPA 5BVNA 4X3FA 4AW1A 5AUYA 3OEFX 4JXFA 3IW7A 4RMZA 3G2FA 2WHBA 3F66A 4QT1A 3TV4A 5AUVA 1OITA 4W8EA 2O8YA 5C8KA 4RX7A 3VAPA 2QU6A 4EOOA 3D4QA 4N57A 3F88A 2QLUA 4I6QA 4U5JA 5C8MA 4QMSA 3FC2A 5CYIA 1OIYA 3HYHA 4C35A 3E3BX 3HRFA 5LQFA 3TIYA 4QNYA 3UP2A 2DUVA 2OI4X 4IDVA 1XWSA 4Q5EA 5DH3A 1H1QA 4M68A 5ANKA 3UQFA 3I5ZA 3E7OA 5HO7A 2VTHA 2EU9A 3PLSA 4JRNA 3MB6A 5I4NA 2G2HA 3FHRA 4FVQA 2OLCA 2BRMA 4P7EA 2X0OA 4FEVA 3UOKA 3Q6UA 4GEOA 3IDCA 4QMTA 1W98A 3PVWA 3BHHA 4EH7A 5GIOE 2Q83A 3VF8A 4D2SA 4DFXE 3AG9A 2X1NA 4FX3A 4TRLA 4BDEA 3GCPA 2QD9A 3DZQA 4FUXA 4EOPA 4DA5A 3BYOA 4O7NA 2V55A 5BMMA 2RG6A 2CKQA 3DDQA 4XV1A 3GT8A 3A8XA 4ASXA 1Z9XA 3R8VA 4D2VA 1OUKA 2RFDA 2BRNA 3D7TB 4BCMA 3WF6A 4R5SA 3VVHA 3BLQA 3BIZA 4FT7A 4MXXA 4TT7A 4YTFA 5KKRB 4YNEA 2GPHA 3DBDA 1NT2A 3NUUA 1QPJA 4W9WA 4F6SA 3U6HA 1S9JA 3QA8A 4EZ3A 3QWKA 1ZWSA 3OOMA 4YC3A 5IQBA 2CMWA 1Q3DA 3OT8A 5CAOA 3E87A 5HLWA 2P2HA 4OBOA 3TNHA 5M56A 4G2FA 3MA6A 4JDIA 3RZBA 4QMVA 1MUOA 2CNQA 4IE9A 4RZWA 4I94A 2UW3A 4F9AA 5JFSA 1OPLA 4GT5A 2WTKB 4LRJA 3FI3A 3G90X 1SVGA 1TFFA 2QI8A 2C0IA 3ORMA 2XKEA 4HPUE 2VWVA 3LCOA 3QQFA 2H34A 4CFFA 3EKKA 3KC3A 5AWMA 4II5A 1M7QA 4MH7A 1BMKA 4NJDA 1JBPE 4RIYA 3V5WA 4RC3A 4ZSGA 3QTRA 5G6VA 4Y5HA 4F64A 2YZAA 4L53A 1I44A 3T3VA 2HW6A 4XH6A 4H3PA 2J5EA 3QLGA 1PMNA 2SRCA 4CMUA 3DK3A 4E8AA 4FODA 3EZVA 2PZ5A 4YC6A 4AGWA 4F6UA 4QQTA 3HAVA 4RFMA 5DGZA 2VX1A 4KS7A 3CQWA 3AKKA 3GU4A 1H28A 5FXRA 1VLRA 1Q97A 4G6NA 5LMBA 1H07A 1OBGA 2ITZA 4KKEA 5JGDA 1J91A 1VJYA 3DTCA 5HBEA 3TV7A 4W9XA 1ZY4A 3OD6X 2LAVA 4EHEA 4L8MA 5ACBC 3W2OA 2JDOA 1XBAA 5B7VA 5JMSA 2OJGA 3OWPA 4IVBA 3UZPA 3ELJA 2XUUA 4XG9A 3GB2A 4BKJA 2CNVA 3E8NA 3MY0A 3PVBA 4APCA 1XH4A 5M08A 4AN9A 2PE1A 3PRFA 1H08A 2C6LA 4YJTA 3I6UA 2WKMA 2XK7A 2Y0AA 5B0XA 3QX2A 5M57A 3QTZA 2QODA 3AMYA 3EQGA 1YXVA 2A27A 3NWWA 3RGFA 3NW6A 3K54A 2PVHA 4GUBA 3TKIA 1VR2A 3Q4CA 3G0EA 4Y73A 2XZSA 5EK7A 4BDHA 2ACXA 4NW5A 5L2IA 4FIFA 1UU7A 4GUEA 4NIFA 1R39A 4D2TA 4GK2A 5BUJA 2YLEA 3C7QA 2A98A 5J5SA 4R77A 4W4WA 4WNPA 4O0YA 1ZOGA 5DWRA 1J7LA 4QDEA 4JAIA 3QFVA 4DH1A 2R9SA 4X2GA 4MD9E 4YJVA 3F82A 1H1RA 5HTBA 1H0VA 3VN9A 2F7ZE 4IM0A 4QRCA 2BIYA 4EKKA 4CVAA 3UMWA 2Q0NA 4XJ0A 5KZIA 2W5AA 3BGQA 4D0XA 3D5VA 3MWUA 3BQCA 3MIAA 3ZZEA 1JWHA 2WMAA 4FV3A 2YACA 4E20A 1BI8A 4FTLA 5F4NA 2XA4A 2IZUA 1YOLA 2BTRA 2YJRA 3HLLA 5IG1A 5KBRA 2QHMA 2J7TA 3KVWA 3A61A 3OEZA 3PDTA 1Y8YA 3OP5A 5J8IA 2C6IA 3LFNA 5CVHA 4CSVA 2UZNA 4XG8A 5AP7A 3UDBA 4JT3A 3PY1A 4RWJA 4OBPA 3ZFYA 4KBCA 5IA0A 3JY9A 5HCYA 2PUUA 3O2MA 1JKTA 4UMRA 3SVVA 1GIIA 2ZM3A 4FV7A 3EHAA 4YZMA 3A7JA 3P5JC 5FM2A 4FKOA 3PJ3A 1OMWA 3EN5A 5K0KA 5L2TA 3FPMA 4KA3A 4L44A 3BLRA 2JFLA 4JG7A 5HG9A 2XRUA 1WFCA 2CLQA 2FH9A 2JIVA 3MPMA 4KB8A 2VO0A 2PUPA 4AT3A 1PHKA 2W99B 4YBJA 3R8ZA 5HCZA 1GAGA 4YJQA 3BBTB 4CTBA 4EH9A 5IQDA 3FMDA 3MN3A 5M4CA 4RQKA 4DFZE 5AEPA 4BKYA 2ETMA 2YJSA 5B2MA 4H05A 1H4LA 5HU9A 1RE8A 3R9OA 4DT8A 2JKOA 3PFQA 2JLDA 2AEGA 1W8CA 3NNVA 3ULZA 3FQEA 4AT4A 4C33A 3POZA 4LL5A 4OTIA 3KKVA 3VS7A 2GNGA 3G15A 4WNKA 4IC7A 2EXEA 2X39A 1P2AA 3EL7A 3FQSA 4WKQA 3FYKX 2VTSA 2B9IA 1CKIA 1QPEA 2X4FA 2PU8A 1L3RE 3CC6A 2QKWB 3LMGA 2OZOA 3O51A 3R7GA 4I93A 4JDKA 2IZRA 2C47A 3VUDA 2R7BA 4C59A 2B53A 3UOHA 2XS0A 3PFYA 4X0MA 1FBNA 4E6DA 3E3PA 1KE6A 2CKOA 2FSOX 4DYMA 4LGHA 2G15A 4ZSLA 2BAJA 4D1XA 3VNTA 2X8IA 4OTHA 4FRFA 1YXSA 3WILA 2QOHA 1IASA 4BY9E 2G01A 3ZH8A 1U5RA 2HCKA 4NK9A 2I0YA