3POZA

Egfr kinase domain complexed with tak-285
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
293
Chain Sequence
b'QALLRILKETEFKKIKVLGSGAFGTVYKGLWIPVKIPVAIKELANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDVVDADEYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Structural Analysis of the Mechanism of Inhibition and Allosteric Activation of the Kinase Domain of HER2 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 293
sequence length 317
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pozA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pozA01
3BQCA 4D1SA 4FKUA 3VUMA 4MNFA 4L01A 3CXWA 4QYHA 3PXKA 1H24A 4YC3A 5HG7A 3VVHA 2QKWB 4U44A 3WILA 1WZYA 3GU8A 2ZV8A 3JVSA 1FGIA 1WVXA 4IADA 1BI8A 4PDPA 4ANSA 4L46A 2W99B 2J0MB 4ENYA 4G6LA 2G2HA 1U54B 2QVSE 3TG1A 3LFCA 5GNKA 5CAPA 2PWLA 3O2MA 1UNHA 4AP7A 4RFZA 4WUAA 3AMAA 1REKA 4XP3A 3VULA 4E93A 5IQHA 4FKPA 2A4LA 1MQ4A 3VJNA 2OSCA 3A60A 4F7LA 3TDWA 4G6NA 2XF0A 2XIKA 3NYVA 3QFVA 3D2KA 1UA2A 4GIIA 4A9SA 3PG3A 5EM6A 3I1AA 1OZ1A 4W4VA 5EKNA 5T3QA 2WMXA 3GFWA 1URWA 4R5YA 3F69A 5T6KA 4DH1A 1YXTA 4BKZA 2J2IB 3FWQA 5HHWA 2QOCA 4L53A 4DEAA 5DLSA 3PXYA 4L3LA 3P0MA 1T45A 5F9EA 4IFCA 5LMKC 1O6LA 3DOGA 1YWNA 2PVHA 3DKCA 5FP5A 3WF9A 4W8DA 3HAVA 3P7AA 4O7VA 2R3HA 4EHVA 2R3QA 2WU7A 4AZVA 4J95A 2OJIA 4X21A 3AQVA 1PXMA 2F7XE 4OTWA 1U5RA 5AADA 1I44A 2XKEA 4FEQA 4PX6A 1T46A 2V5QA 3LCSA 4FIGA 3TJCA 3GEQA 4QPSA 4QYEA 3ROCA 1YXXA 3TT0A 3QRIA 4MX9A 5FGKA 3D7TA 2CN5A 2Z7LA 3I5NA 4E26A 3GU5A 4FSUA 4PY1A 2W1EA 1OL7A 2YCRA 2VTRA 4IVBA 4PDSA 2YCFA 3LQ8A 4BCNA 2V55A 3IW8A 4RIYB 1APME 3AMYA 1BI7A 1PXNA 2W5AA 3BWJA 4WG3A 4GT5A 3F2RA 4HZSA 3QAME 1XH5A 3CKWA 1Z5MA 3ACJA 3KC3A 3KXMA 3PG1A 3QD2B 2IZTA 3ODZX 3BX5A 3FZTA 2W1FA 2X6EA 4JLCA 3DTCA 4WBOA 3RBWA 3WZKA 4ANQA 4ANMA 2WQMA 4HGSA 3UIUA 4WKQA 4ZSJA 1F0QA 3AD6A 4UY9A 5CF5A 4C33A 2XK8A 3ORKA 3JXWA 4U97A 3KVWA 1FMKA 4FVRA 2DWBA 3KF4A 4FTCA 4EQUA 3SGCA 1ZY5A 4UMQA 4RQKA 4P7EA 4L6QA 2GQRA 2CLQA 4EJ7A 1LUFA 3NYNA 3ZRLA 3ZSIA 4U8ZA 3ORTA 4QQJA 5CENA 3JVRA 1DI8A 2BAQA 5KZ0A 3MFRA 3FC2A 2EB2A 2OJ9A 4RQVA 3RINA 3NUSA 5IA4A 4RPVA 4MVFA 5LCJA 5HCYA 2VX1A 3GGFA 3DK3A 1ZARA 3QC4A 4FOBA 1PKGA 3R1YA 2R64A 4PNIA 4YJPA 3ZONA 1LR4A 4FL1A 4FKWA 3NYXA 1VJYA 4G3EA 4Y72A 1OIRA 2WQBA 2YCQA 4MXOA 2WMRA 1CMKE 4YTCA 4UN0C 3DJ6A 3QTIA 4HPUE 4HOKA 2VAGA 4Y85A 3QHRA 4AFEA 4AAAA 3P78A 2XMYA 1Y8YA 4FUXA 4EH8A 4O0TA 1TQPA 3M11A 4HZRA 1U59A 4RIXA 2P2IA 2C5OA 3FHIA 5E1SA 4QMSA 4BDGA 5CSXA 2ZMCA 4FTNA 2B4SB 1Q62A 4NTSA 4IACA 3W2SA 2YA9A 2FSTX 4IEBA 5JFVA 3Q4ZA 1JNKA 3ETAA 3MJ1A 4GYIA 5EFQA 4YTIA 2BHHA 4MXYA 2ZDUA 4FL2A 1ZMWA 4J71A 3RCJA 2BTSA 3AC5A 1YRPA 2YWPA 3TV4A 3VS2A 3RNYA 1IA8A 3AMBA 3I7BA 4G9CA 2PE0A 2PMIA 2ITQA 4JOAA 3UYSA 2VTIA 2I1MA 3NIEA 2JAMA 4GYGA 4HCUA 4TYHB 2I7QA 3G15A 1HCLA 4I21A 3LIJA 4X0MA 4J7BA 2PU8A 3HAMA 3EIDA 4BR3A 3WI6A 5KE0A 2QOLA 4L3PA 5K4IA 3GCPA 4WUNA 3IGGA 3CTJA 4IM0A 4TWOA 3BE2A 3CC6A 5EM8A 3DLSA 4UWYA 3UIMA 3IKAA 2BDJA 2W4OA 5LMKA 1NY3A 3IS5A 2YACA 3QQUA 3CD3A 4IX4A 4LGHA 3VWAA 4BGGA 1W8CA 4AZSA 4TZRA 3C4XA 2CNVA 5HGIA 2QHMA 5F20A 4EOQA 3W1FA 4OUCA 2WEVA 4X7QA 3EFJA 3ULIA 4FSQA 4DH3A 4BB4A 1Q8YA 4BN1A 4KIOA 1FVRA 4B8MA 4AE6A 2C6EA 3VRYA 4I5MA 2JDTA 3B8QA 1XBBA 2HY0A 2ITOA 3O23A 3Q04A 4IW0A 3KXHA 1YWVA 4RIOA 1S9JA 3BPRA 3Q4UA 3FPQA 5EQYA 4WG5A 2ETRA 4FKSA 4OBPA 2XIXA 4E3CA 3RTPA 3BHHA 4H05A 4GJ3A 3M42A 2YERA 5AV1A 5K0KA 4AT5A 4NL0A 1FVTA 5BQ0A 1YHVA 3COKA 2EB3A 4KIKA 3PE2A 4KIKB 2XEZA 3QQJA 3ORNA 2AC3A 4CGAA 1STCE 4TRLA 3AD4A 5JMSA 3QGWA 4EKLA 4FTLA 4P90A 3UPXA 4S31A 3PJ2A 2JIVA 2PUNA 2VTJA 3I0QA 2RFNA 3MIAA 2B55A 4YSJA 2XCHA 4R7BA 3U6IA 2OO8X 4WBBB 4GFGA 5B2KA 3UZRA 4LFIA 4XV9A 3WIGA 3ELJA 4YZCA 2C30A 3OWKA 5CXHA 4M14A 3OCTA 3OT8A 4XV2A 4YJOA 3RGFA 3ID6C 4QPMA 3BYSA 1YDTE 4QMOA 3GNIB 1R0EA 3HGKA 3RHKA 5IA1A 1ZLTA 4BBMA 4KWPA 2RFSA 2XK4A 3L1SA 2UW9A 4BICA 3Q5ZA 3DXNA 4U9AA 3II5A 3KK8A 4CKIA 1KUTA 4FSNA 4CMOA 4I0SA 5IQIA 4F9CA 5F1ZA 4JI9A 4BDFA 3BCEA 3Q6UA 2X7GA 1H26A 4NM5A 4BVUA 5IEXA 4QP6A 4M66A 4I6QA 4RX5A 4AZTA 1MRUA 4WRSA 5AV3A 3REPA 2B7AA 3PVGA 4FK6A 5CX9A 2R9SA 2VTLA 4QP4A 5FBNC 1IEPA 2Q0BA 2ITXA 4JDHA 5CF8A 2OIBA 4TWNA 4EHEA 4OGRA 5B7VA 4MNEB 3UGCA 4EQMA 4RLLA 2PK9A 3KMWA 3R21A 5AM7A 4DEEA 3F66A 3ITZA 3R6XA 1YKRA 3IW4A 3DB6A 3MPMA 5IH6A 4J52A 1LP4A 3G33A 3R8LA 2X8IA 2YDJA 4GU9A 1NVRA 1AQ1A 5EYDA 3GI3A 4AZEA 1H1RA 3LM0A 3LFFA 3WZJA 4DEIA 4G16A 4I5CA 4EH5A 4W4WA 4F0GA 2ETKA 3FV8A 3PRIA 4DG2E 4CLJA 4O7TA 3OF0A 2XKFA 3TM0A 4BHNA 4M15A 3FZPA 3SRVB 4C4FA 1OITA 4FG9A 1MRYA 2XJ1A 2CSNA 5J7BA 4JL9A 3SOAA 5TT7A 5TE0A 2GHMA 4RZVA 4FT0A 4OTIA 4YPDA 3N9XA 1ZOGA 3UO4A 4BCPA 4TL0A 4EQCA 3WOWA 5DMZA 3HNGA 4FV2A 2Y8OA 2XNBA 5J1WA 5EW3A 3O50A 2BFXA 3RPYA 4ZJIA 2J90A 2A2AA 2J0IA 2XNGA 5EW8A 3VJOA 3TUDA 3QKKA 2R3OA 2OW3A 3PTGA 4BDDA 3DB8A 3F3ZA 3DKGA 1S9IA 3MH3A 5CEKA 5IF1A 4ASDA 4IX5A 3RK7A 4ZZNA 4CEGA 2PVJA 3EQFA 2Q83A 4EBVA 2BR1A 3KRJA 4TYIA 1QPCA 4IWOA 2A27A 4E5BA 1XH4A 3VW6A 1KOBA 2OIQA 3U87A 4C3FA 2XK6A 3OUNB 3JS2A 2XIZA 4GT4A 2W9ZB 4OTFA 3RAKA 4DCAA 1UU9A 2X9EA 3FE3A 5ANEA 1E9HA 4TWCA 5K5NA 3Q9XA 4FTUA 1SVGA 3A99A 3L9NA 3HECA 5CF6A 3LXLA 2JFMA 2GS2A 3CPCA 4X3FB 5DA3A 4JDKA 4C57A 4KUJA 4F7SA 1ZOEA 5GJFA 3KXGA 5C4LA 1PF8A 4ZZOA 4FODA 2AC5A 2PVKA 3TNQB 3F3WA 3QCQA 4JQ7A 4CMTA 4DC2A 2C6MA 4D28A 4WT6A 4C2WA 4D55A 2B53A 4X2JA 5KBQA 3UPZA 4FR4A 4I23A 3AC3A 3HLLA 3FHRA 3RZFA 3BU5A 3VAPA 5BVDA 1BMKA 3IGOA 3MS9A 4FTJA 4DGNA 2PVMA 4CFVA 3PJ3A 3W16A 2C47A 5EM7A 4PPCA 3BEGA 2G2FA 3EN7A 5E9EA 3QD3A 4O27B 1Q8TA 2C68A 3JY0A 5EI8A 5E7RA 2I0YA 3KMUA 5CTPA 1GAGA 3ORIA 2WTCA 5AV2A 4XYFA 4DFYA 2V62A 4NH1A 2QOHA 3COMA 3NW7A 3PWYA 4ZTHA 4BIEA 4BBFA 2X2MA 2BDFA 3RAWA 1IAJA 2P33A 3TKUA 2Y6OA 4YNOA 5CEOA 3FMDA 4JR3A 2W1IA 2ZM4A 4GCJA 3K3JA 2FYSA 4D4SA 2GCDA 2FVDA 4JAIA 3RZBA 1NVQA 4U3ZA 4J96A 3EZRA 5E8TA 3OXZA 4JAJA 1GZNA 4JS8A 2WFYA 3DTWA 3GC9A 3U9NA 3ZXTA 4O0WA 1R0PA 3W18A 3MGYA 2H34A 4X6QC 1NA7A 5DI1A 3SW4A 3ZM4A 2OF2A 4QTBA 4IXPA 5KMKA 3NAXA 4C3PA 2F57A 4TY1A 2YM5A 3VBQA 4D2PA 3RP9A 4DCEA 4DFBA 5JGBA 5GZ9A 5BVWA 4F08A 2XM9A 4FZ7A 4V01A 4NT4A 3WE4A 3SVVA 2CKPA 2NNWB 2RGPA 1SM2A 3E63A 1HCKA 4D5KA 2PE1A 2HW6A 4XLVA 3FMJA 3LMGA 4N0SA 4ACGA 4FICA 3H30A 4WOVA 4AXAA 4DYMA 3CBLA 3FYKX 4QYYA 1ZY4A 3MSSA 3U6HA 2WXVA 3JUHA 2JEDA 3PE1A 2VRXA 1KV2A 4QYFA 3SQQA 4IWPA 1L3RE 3C5UA 1XH8A 2WMUA 1Q4LA 3L9LA 5IA0A 2F9GA 3P23A 4LOOA 1IR3A 2JGZA 2FGIA 2UW4A 2CN8A 2YIXA 3QD4A 3ZFXA 2XK7A 4L45A 3H10A 5CEMA 4KKEA 4AT3A 5AM6A 4F64A 4FYOA 2IVUA 2VGPA 3JY9A 4HGLA 3Q6WA 1CSNA 3RPOA 3LFDA 1Y57A 1H27A 4G6OA 4L00A 4EEVA 2GNJA 4MBLA 4BCJA 4U0IA 4KSPA 3FMNA 5EK7A 4J99A 3QZGA 2OKRA 3U54A 1ZYDA 5AUTA 5AP6A 2G2IA 4Z9LA 5FWKK 3WZEA 5L2WA 1BX6A 2ITNA 3HRCA 4FSMA 2X7OA 2CGUA 3FLSA 4ACDA 2WTJA 3FYJX 3KCKA 3KXXA 1VR2A 4RIWB 3VF9A 2NRUA 4DEHA 4QP1A 5M09A 2VV9A 4KBCA 2HELA 4IC7A 4M3QA 4ENXA 4F1OA 5GZAA 1QPEA 3VS4A 4CV8A 2HWPA 3QWKA 2R0IA 2X8EA 4IAFA 2C5YA 4GK3A 3RVGA 4GFOA 1QPJA 5KMOA 2WTDA 4U41A 4PDYA 3ZLYA 2VWUA 3Q9ZA 1SZMA 2V7AA 2RF9A 4F09A 5BVFA 5CAOA 4MYGA 5BPYA 2ITZA 4U6RA 4JRNA 2Z7QA 2ETMA 3GC0A 1YDSE 4X2NA 3T8OA 2JDSA 3NNWA 3POOA 4UBAA 1J7UA 5HQ0A 5AFVA 1P14A 5FBOA 1KE5A 3CY2A 4C34A 4CCUA 2BALA 4C4EA 3PPKA 3OY1A 3TTJA 2OBJA 3QXPA 5HICA 1W98A 2WMVA 1NW1A 2G01A 4HVDA 3KREA 4DLJA 1Y91A 3LHJA 5JFWA 4B6LA 2YDKA 4ZS4A 4O0UA 3DFCB 3EQHA 4G5JA 4UXQA 4C37A 2BRBA 2XNMA 3NNXA 3FI4A 4EH3A 4S34A 5HVKA 2O3PA 3C4FA 4AW5A 2I0HA 3O0GA 3FL4A 1SYKA 2QKRA 2G1TA 3MVJA 4ITJA 4DLIA 3QC9A 3NX8A 4LV8A 2PVFA 1WAKA 4AGCA 4NCTC 5HVJA 5L3AA 3BRBA 4FKOA 1Q41A 4EWQA 4ZLYA 4B4LA 4Q5EA 4UMRA 5JSMA 4ZY5A 1M2PA 3QTWA 4FV0A 4N57A 3CLYA 4DT8A 3RI1A 5CZHA 4BRXA 3C0GA 3OROA 5C03A 2Y0AA 2V7OA 3GU6A 3Q3BA 5HLWA 2JLDA 2IZRA 4I5HA 2UZNA 3I5ZA 2JDRA 3O8UA 4FG7A 3LXPA 2QURA 4S33A 5A6OA 2IW8A 2XIRA 3PA5A 3QALE 1IASA 4LMUA 4M0ZA 2XNPA 4FTAA 4IC8A 3L9MA 2BKZA 4YZDA 5ANDA 5AUVA 4FV1A 5DWRA 2P0CA 1O9UA 4KBKA 3ZC6A 4EOKA 4ZMFA 1Q3WA 4IZ7A 4H39A 1XH6A 4U80A 2YITA 3FJQE 3MVMA 4MD9E 3PJCA 4NEUA 3QQGA 5HIEA 4GEOA 3RAIA 5J5SA 4ZSLA 4CD0A 3GB2A 5EW9A 3OCGA 4QYGA 4U42A 3VBWA 5CEIA 3VBTA 2HZ4A 2O2UA 2F2UA 4GG7A 2PUIA 3G0FA 3BWFA 3VW8A 1K3AA 2WB8A 4XJ0A 4ZJVA 1W84A 2ZB1A 4G5PA 4MH7A 2UUEA 4PMSA 3KGAA 2W4JA 5HIDA 3EOCA 4PP7A 2C0OA 3BI6A 5ETCA 5FEDA 3NEWA 3HV7A 4X2KA 4M8TA 3TZMA 4F4PA 4KKGA 1PMUA 1H08A 3EKNA 5L8KA 5JN2A 4ANOA 2FSMX 3ZLSA 5AP7A 1XR1A 1R3CA 4N4SA 3N51A 4NM3A 5HESA 2OXXA 3LW0A 3NDMA 4DH5A 5ICPA 4FMQA 4OTGA 2FH9A 5FXRA 4C4GA 2YAAA 3QX4A 3TNHA 1OPKA 4KS8A 4U3YA 4XG4A 5CU3A 4C7TA 4F9BA 3K54A 4FNXA 4NKAA 3UE4A 1UWJA 1H25A 4XOYA 4E5WA 2WIPA 2UZEA 4AA4A 5KHWA 4BDJA 2G9XA 3ODYX 3QL8A 2F7ZE 3R7UA 4OTHA 4O81A 4BWPA 3E88A 4G34A 2EVAA 4EOSA 3DA6A 3FMLA 1M52A 1WBSA 2BKKA 4F65A 4F9WA 4YZNA 4PF4A 5CU6A 5GHVA 3QZHA 5H8BA 4Y5HA 3COHA 3QA0A 4MXZA 1M2QA 4A9YA 4FSZA 2R5TA 4I1ZA 3TEIA 3PJ8A 4RC2A 5E8ZA 4XCUA 5C01A 4FNWA 1YQJA 2CKOA 5E92A 3FSKA 3KRXA 5HG8A 3OEFX 2RL5A 2GHLA 3FMHA 3DZOA 2IWIA 2W4KA 4GK2A 4NW5A 2J0KA 4BTJA 4YO4A 5JGDA 4G3DA 3CR0A 3LCKA 4E4XA 2WNTA 4EK5A 1J91A 1JSVA 4ERWA 3TZ7A 4O7WA 4RG0A 2I0VA 4HVSA 4NCTA 4G3FA 2X4ZA 1NXKA 3PFQA 3F2AA 3SXRA 4ZAUA 4PP9A 5IEVA 3IK3A 2VWYA 4FT9A 5FDXA 3OWPA 3TIZA 3P7BA 4V0GB 3QUEA 3DBFA 2VZ6A 4IJPA 4V0GA 4BDAA 3V5TA 4O86A 4MEDA 4MD7E 4HW7A 4FTTA 1JKLA 2UVYA 4C61A 3FKNA 3NZ0A 3UOKA 3LOKA 5IH5A 2QODA 2XYNA 2J0LA 3LAUA 3WF6A 2XVDA 5AA9A 5EDPA 1FQ1B 4DN5A 4NKSA 3LMIA 1XO2B 5EI2A 1FBNA 4QMWA 5ANOA 3KMMA 4WSYA 5E1EA 2W96B 4O0VA 4QMMA 3A61A 3VS7A 3E87A 2F7EE 2ZYBA 1Q61A 4NU1A 2C6IA 4EH4A 3UG1A 1YI3A 2J51A 3R04A 3IDPA 3QYZA 4CT1A 5HBJA 2AYPA 4KSQA 2GDOA 3D5XA 2HZNA 4JVGA 2QO2A 4JJRA 4X6RA 1PXLA 4XRLA 4PMPA 1ZYSA 2CHLA 5HVYA 3PDTA 2VO7A 4NIFA 3UQFA 1EH4A 4R6VA 5FXSA 3V5QA 1V0BA 4YMJA 3HVCA 4GK4A 2VTNA 4H3QA 5CVGA 3ORPA 4PWNA 2XJ0A 5JFXA 4BCHA 3O17A 1Q5KA 3P08A 4EI4A 3NW5A 4KIPA 4F0FA 3QZFA 3HMNA 2BCJA 2FO0A 4DAWA 4W4YA 2HXLA 2YJSA 4H3BA 3PYYA 3D94A 2OZAB 2W9FB 2OZAA 2WELA 4APPA 4O7NA 3QCYA 1B6CB 1ZWSA 4O0SA 3UVPA 4KINA 5J7HA 5AUUA 5HTCA 1SMHA 2J0JA 5G6VA 2OICA 4EH6A 2W5BA 3R7IA 5H9BA 4BDBA 4FEXA 2OFUA 3TACA 3AC2A 4PTCA 1YVJA 1PW2A 2F49A 3CQUA 5H2UA 2OJJA 2XCKA 4MK0A 4F6SA 5AX9A 4NM0A 4F7NA 3R00A 1WBWA 3OBJA 5HO8A 3E8EA 4M0YA 5B2MA 1ZYJA 5LXMA 3MY1A 4ZXTA 3LE6A 4PPAA 5KZIA 3VS1A 3Q9WA 2W1HA 3I6UA 4KBAA 4HVHA 4K2RA 3DBDA 4QP7A 2GU8A 2JITA 4AW0A 4C38A 5H8EA 3L8XA 4IX3A 2R3FA 3FLNC 4CFUA 3UVQA 3D7TB 2REIA 4IWQA 4CQGA 4UX9A 2WTWA 2RG5A 4G1WA 2CGVA 1J7LA 1CM8A 1XKKA 3GCUA 4EYMA 4MTAA 3FQSA 4AZWA 5IISA 5ETIA 2CNUA 1W0XC 4XBUA 4U81A 5CSPA 2WTKB 3UTOA 3A7JA 5AR8A 5AWMA 3UMWA 1ZZLA 1IG1A 3QQKA 2DYLA 4FTQA 3DZQA 4FZ6A 4L7FA 5J5TA 1PMNA 4XG2A 2X2LA 3L8PA 3VIDA 4EK8A 4R1VA 2GPHA 1A06A 5EHLA 3CTQA 3DDQA 3CS9A 3FDNA 5HOAA 4K18A 3PA4A 4JNWA 5CSVA 4IH8A 5HCXA 4K0YA 4AOIA 2XEYA 2DS1A 5E8SA 3BBTB 2Y9QA 4KIQA 2UZTA 3HMMA 3OUKA 4TWPA 5EDQA 4UMPA 3TI1A 2OH0E 5I9WA 3B2TA 4FTMA 4IWDA 4OAUC 2VX3A 4ACMA 2C4GA 4G17A 1Q24A 1GNGA 3SDJA 4YC6A 1GIJA 4GRBA 3MVLA 4F1TA 4I22A 3OOGA 4ALWA 4C2VA 5ETAA 3IG7A 4HJOA 3DAJA 3TV7A 4JG6A 1DAWA 1YHWA 5TF9A 4JRVA 3E8NA 3GU7A 4Q2AA 3FEGA 5ACKA 1Z9XA 4GFMA 3NNVA 4ZIMA 3DPKA 4XG9A 2OIDA 3ZEPA 4FGBA 2ZM3A 4XBRA 4ACCA 4IZ5A 2XKDA 3CJFA 3IW7A 4XV1A 3HL7A 1YHSA 2UZWE 5LVNA 3CJGA 3AD5A 1JSTA 5HE0A 1OKVA 3ZM9A 2OFVA 1K9AA 2VX0A 4XP2A 4EYJA 4O82A 1H8FA 4FIFA 4G3CA 3F6XA 4JBVA 4A4LA 5KMJA 5IQGA 4BY9E 4OAVB 3CQEA 4JR7A 3S2PA 3NW6A 4QMUA 3A8WA 4RIXB 3V5PA 3G5DA 3CSVA 2Z02A 3H0ZA 4MQ2A 3CP9A 4FF8A 3AT2A 4QRCA 1F3MC 5CSHA 2JKQA 4FKLA 4M7IA 5BMMA 2QG7A 4D2SA 3UO6A 3VUHA 2DQ7X 3C1XA 3TKIA 3V6RA 4Y95A 4TYGA 3V5WA 4BL1A 1PMVA 2H6DA 4PNKA 4YU2A 2ESMA 4ORKA 5A6NA 5A54A 4M67A 4R78A 4CLIA 2QU5A 4PPBA 4IQ6A 4GVAA 3NRMA 4RVTA 3R28A 3FKLA 3FKOA 4QD6A 3BYVA 3DQWA 2PVNA 3F3VA 3FZSA 2PZYA 2R7IA 3DNEA 3VHEA 2R3JA 3G6HA 4UEUA 5BYZA 5F95A 4JBOA 4XG8A 3W2RA 3LCTA 3E7VA 5AUYA 3BLRA 4I3ZA 2BDWA 2VTPA 4CFNA 4EUTA 2YFXA 3SG8A 3R1SA 4JG8A 4V05A 3FMEA 4W4XA 3V01A 3ROYA 2KULA 4DEBA 4I4FA 5IDNA 2GS6A 3QQFA 1B38A 1GY3A 1KSWA 1VZOA 3W2PA 3IQ7A 2VWWA 4ASXA 4EOOA 5K0XA 5HD7A 3SKCA 4DH8A 3SC1A 1XHAA 4TT7A 5DFPA 3A4PA 5DR2A 4ZTLA 1JWHA 3Q60A 3W8QA 2VWBA 5CANA 4H36A 5IU2A 2P4IA 1BL6A 3FUPA 4NWMA 1M7NA 4EOIA 3FPMA 1JLUE 2C1BA 4MWIA 3NNUA 3CKXA 2HW7A 1A9UA 3KULA 3TUCA 2I0EA 5FXQA 5HO6A 1I09A 2QOOA 2W0JA 5D9HA 5FTQA 1J7IA 2C69A 2HXQA 5GZ8A 4FIHA 3UOHA 1IA9A 2E9VA 3A7GA 3MTFA 4AGUA 5A9UA 2B9HA 5BVEA 4FKQA 1ZMUA 4XNEA 1M7QA 1AD5A 4BZOA 2WQNA 3BBWA 1G3NA 3QD0A 4FSRA 5BVKA 1PXIA 1SNXA 2X39A 2YLEA 4O7ZA 3LJ2A 5C27A 1QCFA 4V04A 2BZHB 1P2AA 3PPJA 5L6WL 2WMSA 3E93A 3A4OX 3C9WA 3PLAE 4A06A 1MQBA 2IG7A 3LMHA 3QKMA 2VTHA 3PP1A 4MQ1A 2B1PA 3DS6A 3ACKA 2C5XA 3ATSA 3H9OA 1JPAA 3E62A 5D12A 2HZIA 4OTDA 4B7TA 1JOWB 2OI4X 2XYUA 3ZZEA 3FZ1A 3K2LA 2QOKA 3OW3A 4Y83A 5HO7A 2C6TA 5LVMA 3VRZA 3EN6A 4U43A 4M84A 5DBXA 4W9XA 3V5JA 5HLNA 5CVHA 3FXXA 2CJMA 3QCSA 3ZO2A 2OJGA 2OF4A 2WQOA 4PV0A 2E9UA 3FY0A 4CFXA 3F9NA 4M69A 2BFYA 3FXZA 3R9HA 3C0HA 2IJMA 3GFEA 4L44A 2W1CA 2YABA 2YZLA 4IAIA 4J53A 5AJQA 2HWOA 1X8BA 4DEGA 2W17A 2HENA 5HE2A 2IVTA 2WMQA 4QMZA 4BZNA 3FLQA 2PUPA 4K11A 2CCHA 4GIHA 5C9CA 1H1QA 1OUKA 4H1MA 4TW9A 4R7IA 3DGKA 2XKCA 2BIKB 2I40A 3W55A 4D2WA 2VWIA 2ZV2A 5HTBA 3DXQA 4EOPA 2BHEA 1SVEA 4WIHA 4I6BA 1R39A 4F1MA 2R3KA 5KMLA 5ANIA 4A4XA 4L43A 5HKMA 3MJ2A 4NFMA 5CU2A 4O1OA 5L6PA 1LPUA 2X2KA 3G90X 2YN8A 4O84A 1P4FA 2WTIA 3D2IA 1WBVA 1PY5A 2XRWA 4L67A 2WO6A 2ZJWA 1LEWA 2EXCX 1ZRZA 4FNZA 3TNWA 2UW5A 4FEVA 4K77A 2WMWA 1O6YA 2PVLA 5ANJA 4LG4A 1OKWA 3UIXA 5M56A 5M4CA 4YBKA 5DPVA 3Q9YA 4NK9A 4RC4A 5DHJA 2GMXA 4IHPA 4L7SA 2YLFA 3ZBXA 3GCVA 3ZRKA 3SXSA 5DR6A 1XBCA 3OTVA 4FNYA 3E3BX 4QOXA 3DNDA 4LOQA 4FGRA 3LFEA 4TPTA 2BIYA 5AR4A 2R3LA 1ZOHA 3UNJA 2PVRA 4AE9A 5LVPA 2A0CX 4FYNA 4F6WA 3EWHA 4FV4A 4HVGA 3QBNA 5C8MA 5I0BA 2GNIA 3ORMA 3ZMMA 1CDKA 3OEZA 2UW7A 4CT2A 4UWBA 3AXWA 1XQZA 1H00A 5AP5A 3JR1A 1M14A 4K8AA 3O71A 4WNPA 3D4QA 3LVPA 5DVRA 3P4KA 4A07A 2CGXA 4RGJA 3QUPA 2FSLX 1PMEA 2WIHA 4YTHA 1BLXA 2C3JA 4RVLA 3ORLA 4BI0A 3TCPA 3W33A 3R8VA 3OOMA 3ANQA 5I4NA 2W1DA 4YGAA 2J6MA 3H9RA 2JDVA 1HOWA 2Y6MA 5HX6A 3RAHA 5A3XA 4PTGA 1FVVA 2IZSA 5B0XA 4C02A 2BTRA 3U9CA 4FV3A 2GNFA 4YLJA 4NJDA 4RMZA 2VTQA 4JDIA 1DI9A 2I6LA 4IAKA 1PRYA 4KNBA 4QO9A 5HX8A 2JKKA 5BNJA 4ZEGA 5IQBA 2VWVA 3LXKA 4Y73A 2Z8CA 4UALA 3F82A 4QNYA 2J9MA 4UYNA 3HV3A 5DG5A 2BRMA 2PZPA 3DCVA 4I6FA 4YJNA 5EYKA 2W1GA 4FC0A 4H1JA 4CV9A 1XBAA 2OH4A 4FV6A 1Q99A 2B52A 3KF7A 4N6ZA 4QTAA 4XOZA 4YJTA 4RFYA 5CT0A 3D0EA 2RFDA 4O6LA 4BWKA 4EJNA 3DBEA 5B2LA 3WZDA 3FI2A 5M55A 5AAEA 3R9DA 4FVPA 4D9TA 2XBAA 3VF8A 3K5VA 4XG7A 5LMAA 3MFUA 2BPMA 5IUHA 3FQEA 2VNWA 4BCOA 5JRQA 3TUBA 4UMTA 4FUYA 3AC1A 4OR5A 4RX9A 5CT7A 4DINA 3F61A 3L8VA 4MF1A 5EQPA 4HVIA 5HZNA 5KKRC 3DK6A 1M17A 3DAKA 3NLBA 3VBVA 3R71A 4O0YA 3HKOA 4IX6A 4YC8A 4FG8A 1JSUA 4IDTA 4O96A 4AFJA 1ZYLA 3AOXA 4K33A 4F7JA 2CKQA 4XRJA 4TNDA 4J8MA 2YIQA 3GT8A 4I0RA 4EKKA 3DK7A 1UU8A 4HCVA 2UW3A 2E9OA 2FB8A 5E8WA 5TOZA 2RG6A 4I20A 2JBOA 5DEWA 3NVKI 5HLPA 2YJRA 2QOFA 3TNIA 3AGMA 3VS5A 4BGHA 3RMFA 1UNLA 3NUYA 3UODA 2JKMA 3BU6A 5HU9A 4AOTA 2ZVAA 2ERZE 2ITPA 1ATPE 3EQRA 3G2FA 5HE1A 4FTKA 3MPTA 1VEBA 3ZDIA 1LEZA 2C3KA 4ITHA 4RVKA 4A9UA 4PMMA 3KXZA 3W8LA 2BAKA 2E9PA 4Q5HA 3UZPA 4ZSEA 4RRVA 5HCZA 2QI8A 3I7CA 4AN9A 4MBJA 4N70A 3OP5A 2EXEA 3N4VA 4YHTA 4RT7A 4XG3A 4YJSA 4XG6A 1PYXA 2G15A 3RWPA 5L2SA 5AP1A 4ALVA 4WSQA 2WZJA 3ZUUA 3VO3A 4R1YA 4BKYA 4R3RA 4ZTSA 3HP5A 2UW0A 4WRGA 1H28A 5CI6A 5DIAA 1PKDA 1YXVA 4QP9A 4D4VA 3R0TA 5AMNA 4GJ2A 3ET7A 2B9FA 3QTXA 3EN4A 5DR9A 3R7YA 2XNNA 1FOTA 2NO3A 5ACBC 4DFNA 3LZBA 2P2HA 5KUPA 1YDRE 2XRUA 5I9ZA 4CG9A 1V1KA 4AZFA 4ID7A 2C5NA 1WBNA 4X2FA 1YW2A 1ND4A 5DNRA 4AT4A 3UC3A 4E5AX 3KXNA 4UB7A 5HEZA 2X0GA 3OD6X 1OIQA 3LFSA 2QOQA 4YHJA 2PZIA 4OTPA 2XNOA 3EQDA 3WARA 3A8XA 3KFAA 3KK9A 5DT3A 3PA3A 2IVSA 4DFXE 5C4KA 1GIHA 3QLFA 4ARKA 4CZYB 2F4JA 3OBGA 2H8HA 3EQBA 2Y4IC 4IZAA 4K1BA 2XZSA 3Q4CA 3BYMA 4P4CA 1QL6A 2VU3A 4E6CA 4FSWA 3VS3A 5KO1A 4AX8A 2UZUE 2UVXA 3QTQA 5F94A 4FV7A 5DE2A 4GU6A 3I6WA 5H8GA 2HZ0A 3D5UA 5HG9A 1UKIA 2O64A 5GINE 2W06A 1TKIA 3WYXA 2R7BA 4BWXA 5LWMA 5J1VA 3QTUA 3Q5IA 3KA0A 4QMXA 1CKPA 1UU3A 1OM1A 3PSDA 5ITAA 3S0OA 2IW9A 2KTYA 4I0TA 2BUJA 1FPUA 4RX8A 3WF5A 3S95A 2C6LA 3CPBA 3QTRA 4U40A 1DAYA 2R0UA 1ZMVA 3MTLA 4HGEA 3BEAA 3QUDA 3NS9A 3GQIA 5HI2A 4YJQA 3PXRA 4QQCA 1W7HA 2WOUA 3C50A 2C1AA 4W9WA 5CLPA 5BVNA 3QKLA 3C7QA 4G2FA 4IDVA 1CKIA 4UV0A 5CQUA 4E7WA 3N4UA 4L8MA 3E7OA 1OL2A 4ASEA 2XM8A 3D5WA 5KMNA 2C6DA 3PVUA 3F5UA 3QGYA 4R3CA 4JBQA 4O2PA 2VNYA 3OVVA 3BGQA 5EOBA 4HNIA 4DGGA 4EK3A 1H1SA 4PL5A 2XK3A 5IZFA 1G5SA 2JDOA 5IMEA 5CAQA 3HUCA 4DG3E 4H3PA 4S32A 1Y8GA 3LXNA 4H58A 3ZUVA 3NCZA 4ZSGA 2RSVA 4EZ5A 3DY7A 3PY3A 4LV5A 4CZUA 3FC1X 4MWHA 4FA2A 5CVFA 4FT3A 3R01A 4IAZA 3T3UA 4GT3A 2H9VA 3DBCA 1ZXEA 2UZBA 3HX4A 1P4OA 2W05A 3H0YA 4CKJA 1KV1A 4DFZE 1E1XA 2PE2A 4KS7A 5AIKA 3WF7A 3DQXA 4J98A 3MY5A 3CY3A 5I3RA 1O6KA 2PMOX 1DM2A 1KE6A 1H1WA 3F5GA 4JX3A 4J8NA 4LL5A 3PZEA 3EN9A 3GQLA 3VUKA 4MF0A 4Q9ZA 4OT6A 2R3IA 3FQHA 1UWHA 3QZIA 3ALOA 2UV2A 3TV6A 4D5HA 4EL9A 3NUNA 4BCIA 4DITA 5HD4A 2IPXA 3MI9A 4NZWB 1OPLA 3E92A 1Y6AA 5IG1A 2UVZA 3ZCLA 3EHAA 1FINA 3ZBFA 3BKBA 3E64A 4A7CA 4B9DA 2JD5A 4CSVA 2OJFE 5GJGA 3MBLA 3NR9A 5GIOE 5FQDC 3W2CA 2X8DA 3R8ZA 3OCBA 1U5QA 3NUAA 4L3JA 2PVYA 2NP8A 1PJKA 2IN6A 3A2CA 4RZWA 2XK9A 3TKHA 3BU3A 4LRMA 3ZRMA 3IPHA 4AG8A 4FZFB 2A1AB 2OGVA 3MPAA 5DYJA 2PHKA 1YI4A 1OECA 2BRNA 5T68A 4WNMA 3QLGA 2B9JA 2UZDA 4EZ3A 4R5SA 2PMNX 4G3GA 1RQQA 3IDBA 3O8TA 3DDPA 4O7LA 4FKJA 5AX3A 2HCKA 3FAAA 4USEA 4BDHA 3Q53A 4EK6A 2JAVA 3U4UA 3AGLA 3QF9A 1UU7A 5J9ZA 4RA4A 4XLIA 5CNNA 3I0OA 3ERKA 3NCGA 3ZDUA 4ZY4A 4YZ9A 3BHYA 3KCFA 1R78A 1GZOA 4WNOA 2VTTA 2C5VA 4FT5A 4IB1A 4PUZA 1PXJA 2O65A 4IAAA 4IM2A 2B9IA 4YJRA 3UG2A 4BCMA 4DG0E 1BYGA 2J50A 4DT9A 4QMTA 4BDCA 4QTEA 3B8RA 1Y6BA 3BV3A 4OTRA 1PXKA 4BCKA 3U55A 3Q52A 4MD8E 4WD5A 3OXIA 4FIEA 3WF8A 5L2IA 3FMKA 3IECA 4YSMA 2QLQA 2OXDA 3R22A 3RK5A 2R3MA 3VC4A 4R77A 3DKOA 4R7HA 4LL0A 4U5JA 2GQSA 2GSFA 2JBPA 4OTQA 3RHXA 5EHOA 4QPAA 4EOMA 3MFTA 4FKTA 4FTIA 5EM5A 4ANLA 5F4NA 1REJA 2X1NA 5C1QB 4EOJA 3QYWA 4II5A 3FZRA 4OLIA 1JKSA 2W7XA 3D9VA 2WGJA 1M2RA 5HNGA 3Q4TA 2WD1A 4IVCA 4UYAA 3UP2A 4O21A 2F2CB 5JQ5A 4RWJA 5DT4A 4NIFB 3TXOA 2QD9A 2VN9A 1YWRA 4ZLZA 4K9YA 3UNZA 3GCSA 3F7ZA 4R3PA 4P5ZA 5ANKA 4DE4A 4M97A 4WNKA 3ZYAA 3R9OA 3U51A 1OL1A 3W32A 2GS7A 3BLHA 4LRKA 3HA6A 4USDA 3O8PA 2NPQA 5IQAA 4I41A 2LGCA 1OUYA 3TZ9A 4AA5A 3QRJA 5IMXA 1MP8A 2LAVA 3AT4A 3KVXA 4CFMA 4O7YA 4CTBA 1ZYCA 5BX0A 5IDPA 5K4JA 3DFAA 4HYIA 3UJGA 4E6DA 3MVHA 4ZLOA 4Y46A 2J5EA 2ZAZA 2PL0A 3CGOA 5JRSA 3FZOA 2QO7A 4FTRA 4MXAA 3QQLA 4JT3A 3T9TA 3ZO3A 2O63A 4NW6A 1OIYA 4GV1A 4RWLA 5DRDA 4BIDA 1UVRA 3S4QA 4RSSA 3VHKA 5E8VA 4C3RA 4BHZA 5D10A 5A4TA 1OBGA 1U54A 2JKOA 3LCOA 5FDPA 2J4ZA 4GSBA 3OG7A 4IJ9A 4KABA 2CMWA 3M2WA 3QQHA 3U8WA 4TKSA 2WQEA 3OMVA 3LCDA 4EHZA 1GOLA 5J87A 4KRDA 5M4FA 4ONAA 4XEYA 3R8UA 4IVAA 5AA8A 5E90A 1G8SA 2R3NA 3CGFA 3RK9A 3THBA 1YXSA 2ONLC 3UYTA 4FT7A 1H4LA 5E4HA 3P9JA 4D4RA 2XIYA 3PSBA 3TIYA 2VTMA 1OKYA 4RWKA 3IOKA 1KE8A 4BTFA 2O5KA 4RJ6A 1ZZ2A 4ZTRA 3L9PA 2EWAA 4CRSA 1RE8A 5CY3A 4PMTA 3GXLA 5E8YA 4GVJA 3D14A 3OY3A 2UW6A 3RNIA 4EBWA 2A19B 3NGAA 4CG8A 4GUBA 4JQEA 4QTDA 3ZU7A 5J9YA 3GOPA 4LGDA 1MRVA 1KOAA 2WMBA 4EOLA 3NUUA 5FM2A 4XHKB 3R73A 1CKJA 4O91A 4E6AA 2OG8A 4NTTA 1NT2A 4BGQA 4FTOA 4AQCA 4G9RA 4FEUA 4G31A 4BIBA 3ZXZA 4Z55A 4OBQA 3MDYA 2C0IA 4O7SA 3QA8A 4I4EA 1WBTA 5A4QA 5LVOA 5EQEA 2DUVA 4RIYA 4XV3A 3C4CA 2R3GA 5AP0A 3PWDA 1GIIA 4ZK5A 5FTGA 3FXWA 2ZM1A 3I60A 3FI8A 5EG3A 3NSZA 1CTPE 2P3GX 5KHXA 3R83A 3TDVA 5AEPA 4LI5A 3QHWA 4LQMA 1ERKA 5K3YA 4BBEA 4L9IA 3OW4A 2VTAA 2C6KA 3OTUA 3R30A 5CNOA 4CFFA 4JIAA 4QMYA 2HY81 3LLTA 3F88A 2YM6A 4IFGA 5CZIA 3BZ3A 3R63A 3V6SA 4EH9A 4BFMA 3OWJA 5M53A 3HRBA 2ZOQA 3BHUA 2VUWA 4JQ8A 4Y5QA 3E8DA 5K5XA 1YXUA 2VTSA 1KE7A 4NUSA 4QMVA 4EUUA 3HYHA 3G9LX 3OWLA 4MXXA 3AC4A 3RKBA 4DBNA 5EI6A 4XH6A 4X3JA 5FEQA 4OT5A 3P79A 4AGDA 3VQUA 3D15A 4R8QA 5DRBA 4J1RA 5JFSA 5L8JA 1ZAOA 1GJOA 2PSQA 1H07A 1XH9A 2QHNA 3RWQA 4DA5A 4U79A 3G6GA 4QMNA 3B2WA 4RFMA 5FLFA 3BYOA 2CNQA 1RW8A 4XS2A 2CGWA 3GUBA 3KQ7A 1VYZA 5AR2A 3WZUA 4E6QA 2PPQA 3F5PA 4D2RA 3ZH8A 3S00A 4DTKA 2GNLA 5AP4A 5CS6A 2PMLX 3MWUA 5LARA 4DH7A 1K2PA 4S2ZA 5CYIA 4JBPA 4AW2A 4FE2A 4KD1A 1WCCA 5AP2A 5AR5A 4D58A 1OBDA 1SNUA 2HAKA 4TYEA 3C13A 3LQ5A 3MIYA 3Q96A 2Z60A 4L52A 1PXPA 3ZLWA 3FLWA 4P2KA 4LUDA 4TYHA 3HUBA 4PQNA 4YPSA 2ONLA 3SAYA 3ZLXA 3K5UA 4FL3A 4USFA 3ZO4A 3MB7A 3DU8A 3KU2A 2YDIA 4M13A 5BYLA 1GZ8A 3KL8A 3LQ3A 2NRYA 5IUIA 3BQRA 4DF3A 3P1AA 4OW8A 3H4JA 3C51A 3GC8A 5J95A 2IW6A 3VUDA 2V22A 2YAKA 2QLUA 3ENHA 4C58A 3Q32A 1H0WA 4DTBA 3KULB 4GUEA 3R2YA 4TYJA 3I4BA 4ZJJA 5KMIA 1R1WA 2FSOX 3QTSA 2PTKA 3M1SA 4BDEA 4IIRA 3I81A 5CU4A 1RJBA 3MV5A 2WMTA 4I93A 5JK3A 2AUHA 4QQ5A 3LFNA 5TKDA 3RPRA 3KRWA 3LJ0A 4ANBA 1BL7A 3OCSA 4C4HA 4UZHA 5EH0A 2QOBA 5JKGA 1OB3A 3VN9A 3FLYA 3ZHPC 5KNJA 4BKJA 2CDZA 4FZAB 3EQPA 4QMPA 3ZOSA 5BVOA 2CKEA 3TJDA 4TN6A 4WHZA 2BZKB 2ITTA 4IE9A 3R7GA 5HE3A 5DEYA 4BC6A 4YTFA 2WHBA 4QNAA 2IVVA 5HBHA 2JIUA 4IB5A 3EN5A 2C3IB 3FMMA 4AOJA 1G8AA 1FMOE 4BI2A 4X3FC 5C8NA 3BV2A 5HU3A 5IUGA 1YOMA 1TQMA 3SLSA 5EOLA 5CAUA 3EH9A 3ZC5A 3BELA 3U6JA 1OMWA 3PXFA 3QCXA 4HNFA 2PYWA 4UMUA 3PSCA 3TL8A 4BF2A 3ZZWA 4Z3VA 4ANNA 4ZSAA 4BDIA 3VUTA 4CMUA 4M69B 4I6HA 4ALUA 3IDCA 1W83A 2GQGA 3V8TA 3FI3A 4YZMA 5L6OA 4AGWA 5D7AA 4QP3A 1QPDA 3Q2MA 3PJ1A 4Y8DA 4ZTNA 4GKHA 4AN3A 2OXYA 5CQWA 1OI9A 3W2OA 4RA5A 5AR7A 2Z7RA 4HYSA 3UZTA 4YLKA 3PIXA 5A4CA 1OPJA 3UP7A 2B0QA 3HV4A 5ETFA 5BMSA 1H0VA 2BROA 4RVMA 5EYMA 4I24A 4AWIA 1V0PA 3EL7A 3MFSA 2CCIA 3O96A 3PVWA 5FP6A 3LFQA 5DH3A 2BAJA 2VGOA 5L8LA 3HEGA 4E8AA 4EH2A 5A4EA 2FUMA 3GU4A 3V8WA 3O7LB 2YISA 3UDBA 5IQCA 2QONA 2YIRA 5HIBA 2OLCA 4FX3A 3SW7A 4MCVA 2WTVA 4I5PA 4MNEA 1OL6A 4FKVA 2P55A 4KB8A 4O0RA 4C4JA 3R8MA 3EJ1A 4IMYA 4AA0A 4RJ3A 5CALA 2YHVA 2UW8A 4GG5A 3RCDA 4PDOA 4ZP5A 2CPKE 2GTMA 4RJ7A 3SV0A 5A14A 2XJ2A 4QP8A 5L2QA 5FRIA 2JC6A 3UQCA 1IRKA 3SRVA 5FM3A 4LGGA 1UNGA 4AS0A 1JVPP 4A4OA 1Q8ZA 2WU6A 3A7HA 3LFAA 3LJ1A 3WIKA 4E4NA 2ERKA 3NIZA 2QCSA 4D0WA 4RJ4A 4Z7GA 3NUXA 3NAYA 4KA3A 4AF3A 4KRCA 4YURA 3F5XA 3EFKA 4NSTA 3U4WA 3V5LA 4BCFA 5HNBA 3SHEA 2GFSA 4MHAA 3CCNA 2VO6A 5K9IA 4TNBA 4P5QA 3Q2JA 5IA3A 4LOPA 4YHFA 3OXTA 5AUZA 3R7EA 3R9NA 2ZDTA 4FI1A 2QC6A 3ZS5A 2ITWA 4ZZMA 5AV4A 5I9XA 4EC9A 4EHGA 1Q8UA 3KKVA 2ZMDA 4OBOA 4ERKA 4L68A 5JZNA 4U7ZA 2BMCA 4BI1A 1UV5A 2VO3A 3VBXA 5IH4A 1OVEA 4IVDA 3PP0A 4AW1A 2V0DA 5HORA 3S1HA 4IB3A 3SG9A 2WEIA 3BHVA 1U4DA 3W2QA 2QU6A 3FBVA 3EZVA 4X3FA 3V8SA 4B0GA 3EMGA 4ZS0A 4GW8A 4YR8A 5BUIA 3UO5A 3KN5A 5IKWA 5AP3A 3CQWA 1U46A 5CI7A 2SRCA 4RWIA 4AU8A 3VS0A 4CRLA 3HRFA 4YLLA 5J79A 4TXCA 2E2BA 3AC8A 3C0IA 1H01A 3DJ5A 5LQFA 3O7LD 3VUIA 2GTNA 2WPAA 3MW1A 3DLZA 5EHYA 3QXOA 3V04A 2EXMA 3PLSA 3RJCA 4D0XA 4FKRA 4UZDA 3SOCA 3OHTA 3VNTA 5JT2A 2BZJA 1V0OA 2BRGA 3ALNA 2QR8A 3I79A 2WKMA 2ITVA 5M51A 3AT3A 3HMOA 3UIBA 4A9RA 4IANA 3CTHA 4F70A 1XH7A 4TTHB 3RPSA 3HA8A 5KX8A 4S30A 4JG7A 5CWZA 3SD0A 5AAGA 1JAMA 2RKUA 3F3UA 1VYWA 1WVWA 4HYHA 5E8UA 5I9UA 3SX9A 3R8PA 3EYGA 4AN2A 3WE8A 3LFBA 5LMBA 3LM5A 5M44A 4BDKA 4C4IA 1J3HA 1WMKA 3EQGA 3FSFA 2W5HA 4CNHA 5D11A 3PY0A 4LRJA 3RM6A 4QQTA 4CTCA 4RJ8A 2UZLA 2Z2WA 4D4YA 2R3RA 4KKHA 5LOHA 3BGPA 3KB7A 4PL4A 1A48A 1L8TA 4XP0A 4D2VA 1WVYA 1J1CA 4C59A 4MKCA 2GFCA 3VQHA 3GP0A 5FD2A 3G51A 2XB7A 3RALA 3UNKA 2QR7A 3RPVA 3F3TA 3DXPA 3TTIA 2JFLA 2WOTA 3NUPA 4C36A 4CKRA 5LJJA 3EYHA 4FIIA 3UOLA 5A4LA 4CCBA 4YO6A 4AUAA 5M08A 3NMUF 4IZYA 5CF4A 2J5FA 4B99A 3VBYA 4E73A 1F5QA 1J1BA 2BZIB 3HZTA 2RFEA 2X7FA 4FBXA 3HMIA 3IOPA 4RX7A 5DT0A 5AUXA 1TVOA 3DBQA 3LKMA 2IO6A 5CSWA 1URCA 5C8KA 5CAVA 2W1ZA 1OGUA 4O1PA 3R2BA 5TO8A 4L42A 3ULZA 2R3PA 2VWZA 5M4IA 5CEPA 3C4WA 2BRHA 3E8CA 3A7FA 4O22A 4IAYA 2O0UA 2PY3A 3FLZA 1B39A 3C4ZA 1OKZA 2QNJA 1Q97A 4DGLC 1YOLA 4QMQA 3DT1A 3MA6A 3P7CA 5J8IA 4JIKA 2UZOA 2YIYA 2QO9A 4RLKA 5LCKA 4RIWA 3COIA 3UMXA 4F99A 4Z7HA 3HDMA 2YM8A 5JZJA 2VO0A 5CEQA 2Y7JA 2VTOA 3BE9A 5AR3A 2GHGA 3ZTXA 4DGOA 4JX7A 2C6OA 4D1XA 4QP2A 4QT1A 3FL5A 4K6ZA 2WAJA 4ZMEA 4A9TA 4MAOA 4YP8A 3KY2A 2J7TA 5M4UA 2QG5A 5FG8A 1MUOA 5E91A 5DN3A 3H3CA 5IA5A 3PIYA 3W10A 4EK4A 3G0EA 3EL8A 2BVAA 1GZKA 3VS6A 5D41A 3R02A 2HIWA 3MA3A 4FSTA 4I92A 2XS0A 3KN6A 4FIJA 5FTOA 3UC4A 4FVQA 3EKKA 1JKTA 4O38A 4HPTE 3DJ7A 3LPBA 4CXAA 2ZB0A 4GL9A 1YI6A 1QMZA 4O2ZA 1NVSA 3GVUA 2C0TA 4LMNA 5JQ8A 3ZFYA 2XA4A 3BHTA 3FY2A 2OU7A 3CE3A 3HMPA 4BTKA 4E4MA 1W82A 4AACA 4WA9A 4GKIA 3E5AA 4O83A 5AIRA 5KKRB 4GMYA 2XP2A 1SVHA 3C4EA 2E9NA 3KRRA 4ITIA 4Q9SA 3DV3A 4RC3A 3ZSGA 5IQDA 3NVMB 4FOCA 3CIKA 1WFCA 5D1JA 5H3QA 5CU0A 3IW6A 5CXZA 5G1XA 4DEDA 2QQ7A 3P86A 3IW5A 5I9VA 4CYJA 4FV8A 5L4QA 5J9LA 4BCQA 2EU9A 2YM3A 3BLQA 4LYNA 5M07A 2YEXA 3PRFA 4HYUA 2ITYA 4MBIA 2WMAA 5HBEA 4B8LA 4LM5A 5EKOA 1UKHA 3WYYA 1AGWA 2GNGA 2X6DA 5M06A 2GNHA 3VUGA 5KCVA 3TWJA 4IB0A 4D2TA 3QRTA 4GS6A 4YJVA 3R7VA 4CYIA 5I5ZA 4CQEA 5I9YA 4U45A 2YWVA 4EORA 3H9FA 4I94A 3MESA 3TNPC 3GC7A 4YZBA 4ZY6A 4BYIA 4CFWA 3CEKA 4UWCA 4DFUA 4YBJA 4ZOGA 4JXFA 3MH1A 3TN8A 3BGZA 3UQGA 5LWNA 4WO5A 4J97A 3DAEA 3PXZA 4F0IA 5JH6A 4EZ7A 3GOKA 3ANRA 4IM3A 3R7OA 5DGZA 1E1VA 3TZ8A 2CLXA 4BYJA 4W8EA 3PUPA 3RM7A 3R9RA 4E4LA 3QRKA 5C26A 3HDNA 3MN3A 4C35A 4C62A 3C5IA 5A46A 3PPZA 4XUFA 2H96A 4DFLA 3V3VA 2EUFB 2HK5A 4WG4A 4NFNA 2R2PA 1YOJA 2YM4A 4FSYA 4UXLA 4X2GA 3UOJA 2Q0NA 1PXOA 3QWJA 4PRJA 1JQHA 4PL3A 3F7WA 3PY1A 1P5EA 3HV5A 5GJDA 4RJ5A 2QOIA 3ZEWA 2HYYA 2X4FA 5ANGA 5I3OA 1DS5A 3MY0A 2UZVA 4NJ3A 3IO7A 4FKIA 3MYGA 4O7RA 3HV6A 1PHKA 3IONA 2X9FA 2VD5A 4YJUA 1RDQE 4D1ZA 2HOGA 4HGTA 5AUWA 3EQIA 2XNEA 1BUHA 2Y4IB 4YNEA 3AG9A 5HTIA 1Q3DA 3R1QA 4GH2A 3EFLA 4MXCA 1FGKA 3BIZA 2YIWA 3QX2A 2X81A 3QTZA 3R1NA 3CD8A 2FA2A 4M68A 3S3IA 1WBOA 3UVRA 3ZSHA 4F63A 5IPJA 2XBJA 1OL5A 3EQCA 5AAFA 3T3VA 5AV0A 3K3IA 3NPCA 4C8BA 3OS3A 3A7IA 4E20A 3O51A 1OIUA 2BILB 1H1PA 3OZ6A 4CVAA 5TR6A 3SA0A 5HNIX 3WBLA 3MH0A 2R4BA 5FUTA 4XMOA 2JIIA 4DBXA 2PZRA 5IA2A 1WBPA 4HCTA 3ZO1A 3V51A 1Q8WA 5EYCA 5BUEA 4EH7A 1KWPA 5GIPE 2Y4PA 3GCQA 3OT3A 5IQFA 4FV5A 2PZ5A 3EB0A 3BYUA 4F9YA 1JKKA 3GENA 2IZUA 3PXQA 5CASA 3ATTA 4NM7A 2ACXA 4JDJA 4O0XA 3POZA 3OC1A 2WTKC 5HG5A 2YZAA 3JPVA 2Z7SA 2OWBA 4LUEA 5FEEA 3ORZA 2C3LA 3UBDA 4M12A 2PULA 1BKXA 4BCGA 2YCSA 5KBRA 2OZOA 4ZTMA 1KE9A 4FKGA 4YUQA 3QU0A 2B54A 2XH5A 4O6EA 3ORXA 4FV9A 4APCA 3HP2A 3P5KA 4FZDB 4EONA 3ENMA 5JGAA 2OK1A 2ITUA 3D5VA 3NYOA 2RIOA 4IBMA 1IAHA 4QMLA 3PVBA 2ZV9A 3KRLA 3QRUA 3PZHA 5DOSA 4E1ZA 4D9UA 4RBLA 3ZUTA 4DGMA 4FEWA 4DTAA 5LVLA 4FK3A 4BZDA 3SXFA 1Z57A 4ZTQA 5BUJA 3OFMA 4Z16A 5L2TA 3KEXA 5IEYA 3MH2A 3PIZA 3LLAA 3N4TA 3L8SA 4EC8A 5E8XA 1JBPE 3GBZA 3MB6A 4PTEA 1TQIA 3G9NA 4N6YA 3JYAA 3F2NA 1XJDA 3DKFA 4EWHA 4F6UA 4NYEA 2YM7A 3E3PA 4KAOA 4XX9A 2VWXA 4C0TA 4F9AA 3ZFMA 2XUUA 2O8YA 2PUUA 5JEBA 4CZTA 3D7ZA 5D7VA 2ZV7A 4BTMA 4DHFA 5M57A 3T9IA 5KMMA 3NWWA 1XWSA 5EDRA 1PYEA 4ACHA 4ASZA 5BYYA 3D83A 5IQEA 4QTCA 3EFWA 3A62A
chains in the Genus database with same CATH superfamily
3BQCA 4D1SA 4FKUA 3VUMA 4MNFA 4L01A 3CXWA 4QYHA 3PXKA 1H24A 4YC3A 5HG7A 3VVHA 2QKWB 4U44A 3WILA 1WZYA 3GU8A 2ZV8A 3JVSA 1FGIA 1WVXA 4IADA 1BI8A 4PDPA 4ANSA 4L46A 2W99B 2J0MB 4ENYA 4G6LA 2G2HA 1U54B 2QVSE 3TG1A 3LFCA 5GNKA 5CAPA 2PWLA 3O2MA 1UNHA 4AP7A 4AAYA 4RFZA 4WUAA 3AMAA 1REKA 4XP3A 3VULA 4E93A 5IQHA 4FKPA 2A4LA 1MQ4A 3VJNA 2OSCA 3A60A 4F7LA 3TDWA 4G6NA 2XF0A 2XIKA 3NYVA 3QFVA 3D2KA 1UA2A 4GIIA 4A9SA 3PG3A 5EM6A 3I1AA 1OZ1A 4W4VA 5EKNA 5T3QA 2WMXA 3GFWA 1URWA 4R5YA 3F69A 5T6KA 4DH1A 1YXTA 4BKZA 2J2IB 3FWQA 5HHWA 2QOCA 4L53A 4DEAA 5DLSA 3PXYA 4L3LA 3P0MA 1T45A 5F9EA 4IFCA 5LMKC 1O6LA 3DOGA 1YWNA 2PVHA 3DKCA 5FP5A 3WF9A 4W8DA 3HAVA 3P7AA 3ML1A 4O7VA 2R3HA 4EHVA 2R3QA 2WU7A 4AZVA 4J95A 2OJIA 4X21A 3AQVA 1PXMA 2F7XE 2XAOA 4OTWA 1U5RA 5AADA 1I44A 2XKEA 4FEQA 4PX6A 1T46A 2V5QA 3LCSA 4FIGA 3TJCA 3GEQA 4QPSA 3UDTA 4QYEA 3ROCA 1YXXA 3TT0A 3QRIA 4MX9A 5FGKA 3D7TA 2CN5A 2Z7LA 3I5NA 4E26A 3GU5A 4FSUA 4PY1A 2W1EA 1OL7A 2YCRA 2VTRA 4IVBA 4PDSA 2YCFA 3LQ8A 4BCNA 2V55A 3IW8A 4RIYB 1APME 3AMYA 1BI7A 1PXNA 2W5AA 3BWJA 4WG3A 4GT5A 3F2RA 4HZSA 3QAME 1XH5A 3CKWA 1Z5MA 3ACJA 3KC3A 3KXMA 3PG1A 3QD2B 2IZTA 3ODZX 3BX5A 3FZTA 2W1FA 2X6EA 4JLCA 3DTCA 4WBOA 3RBWA 3WZKA 4ANQA 4ANMA 2WQMA 4HGSA 3UIUA 4WKQA 4ZSJA 1F0QA 3AD6A 4UY9A 5CF5A 4C33A 2XK8A 3ORKA 3JXWA 4U97A 3KVWA 1FMKA 4FVRA 2DWBA 3KF4A 4FTCA 4EQUA 3SGCA 1ZY5A 4UMQA 4RQKA 4P7EA 4L6QA 2GQRA 2CLQA 4EJ7A 1LUFA 3NYNA 3ZRLA 3ZSIA 4U8ZA 3ORTA 4QQJA 5CENA 3JVRA 1DI8A 2BAQA 5KZ0A 3MFRA 3FC2A 2EB2A 2OJ9A 4RQVA 3RINA 3NUSA 5IA4A 4RPVA 4MVFA 5LCJA 5HCYA 2VX1A 3GGFA 3DK3A 1ZARA 3QC4A 4FOBA 1PKGA 3R1YA 2R64A 4PNIA 4YJPA 4AQKA 3ZONA 1LR4A 4FL1A 4FKWA 4LDTA 3NYXA 1VJYA 4G3EA 4Y72A 1OIRA 2WQBA 2YCQA 4MXOA 2WMRA 1CMKE 4YTCA 4UN0C 3DJ6A 3QTIA 4HPUE 4HOKA 2VAGA 4Y85A 3QHRA 4AFEA 4AAAA 3P78A 2XMYA 1Y8YA 4FUXA 4EH8A 4O0TA 1TQPA 3M11A 4HZRA 1U59A 4RIXA 2P2IA 2C5OA 3FHIA 5E1SA 4QMSA 4BDGA 5CSXA 2ZMCA 4FTNA 2B4SB 1Q62A 4NTSA 4IACA 3W2SA 2YA9A 2FSTX 4IEBA 5JFVA 3Q4ZA 4MUQA 1JNKA 3ETAA 3MJ1A 4GYIA 2IEWA 5EFQA 2BHHA 4YTIA 4MXYA 2ZDUA 4FL2A 1ZMWA 4J71A 3RCJA 2BTSA 3AC5A 1YRPA 2YWPA 3TV4A 3VS2A 3RNYA 1IA8A 3AMBA 3I7BA 4G9CA 2PE0A 2PMIA 2ITQA 4JOAA 3UYSA 2VTIA 2I1MA 3NIEA 2JAMA 4GYGA 4HCUA 4TYHB 2I7QA 3G15A 1HCLA 4I21A 3LIJA 4X0MA 4J7BA 2PU8A 3HAMA 3EIDA 4BR3A 3WI6A 1XMMA 5KE0A 2QOLA 4L3PA 5K4IA 3GCPA 4WUNA 3IGGA 3CTJA 4IM0A 4TWOA 3BE2A 3CC6A 5EM8A 3DLSA 4UWYA 3UIMA 3IKAA 2BDJA 2W4OA 5LMKA 1NY3A 3IS5A 2YACA 3QQUA 3CD3A 4IX4A 4LGHA 3VWAA 4BGGA 1W8CA 4AZSA 4TZRA 3C4XA 2CNVA 5HGIA 2QHMA 5F20A 4EOQA 3W1FA 4OUCA 2WEVA 4X7QA 3EFJA 3ULIA 4FSQA 4DH3A 3W0RA 4BB4A 1Q8YA 4BN1A 4KIOA 1FVRA 4B8MA 4AE6A 2C6EA 3VRYA 4I5MA 2JDTA 3B8QA 1XBBA 2HY0A 2ITOA 3O23A 3Q04A 4IW0A 3KXHA 1YWVA 4RIOA 1S9JA 3BPRA 3Q4UA 3FPQA 5EQYA 4WG5A 2ETRA 4FKSA 4OBPA 2XIXA 4E3CA 3RTPA 3BHHA 4H05A 4GJ3A 3M42A 2YERA 5AV1A 5K0KA 4AT5A 4NL0A 1FVTA 5BQ0A 1YHVA 3COKA 2EB3A 4KIKA 3PE2A 4KIKB 2XEZA 3QQJA 3ORNA 2AC3A 4CGAA 1STCE 4TRLA 3AD4A 5JMSA 3QGWA 4EKLA 4FTLA 4P90A 3UPXA 4S31A 3PJ2A 2JIVA 2PUNA 2VTJA 3I0QA 2RFNA 3MIAA 2B55A 4YSJA 2XCHA 3TMOA 4R7BA 3U6IA 2OO8X 4WBBB 4GFGA 5B2KA 3UZRA 4LFIA 4XV9A 3WIGA 3ELJA 4YZCA 2C30A 3OWKA 5CXHA 4M14A 3OCTA 3OT8A 4XV2A 4YJOA 3RGFA 3ID6C 4QPMA 3BYSA 1YDTE 4QMOA 3GNIB 1R0EA 3HGKA 3RHKA 5IA1A 1ZLTA 4BBMA 4KWPA 2RFSA 2XK4A 3L1SA 2UW9A 4BICA 3Q5ZA 3DXNA 4U9AA 3II5A 3KK8A 4CKIA 1KUTA 4FSNA 4CMOA 4I0SA 3BLAA 5IQIA 4F9CA 5F1ZA 4JI9A 4BDFA 3BCEA 3Q6UA 2X7GA 1H26A 4NM5A 4BVUA 5IEXA 4QP6A 4M66A 4I6QA 4RX5A 4AZTA 1MRUA 4WRSA 5AV3A 3REPA 2B7AA 3PVGA 4FK6A 5CX9A 2R9SA 2VTLA 4QP4A 5FBNC 4JMQA 3W0NA 1IEPA 2Q0BA 2ITXA 4JDHA 5CF8A 2OIBA 4TWNA 4EHEA 4OGRA 5B7VA 4MNEB 3UGCA 4EQMA 4RLLA 2PK9A 3KMWA 3R21A 5AM7A 4DEEA 3F66A 3ITZA 3R6XA 1YKRA 3IW4A 3DB6A 3MPMA 5IH6A 4J52A 1LP4A 3G33A 3R8LA 2X8IA 2YDJA 4GU9A 1NVRA 1AQ1A 5EYDA 3GI3A 4AZEA 1H1RA 3LM0A 3LFFA 3WZJA 4DEIA 4G16A 4I5CA 4EH5A 4W4WA 4F0GA 2ETKA 3FV8A 3PRIA 4DG2E 4CLJA 4O7TA 3OF0A 2XKFA 3TM0A 4BHNA 4M15A 3FZPA 3SRVB 4C4FA 1OITA 4FG9A 1MRYA 2XJ1A 2CSNA 5J7BA 4JL9A 5BV3A 3SOAA 5TT7A 5TE0A 2GHMA 4RZVA 4FT0A 4OTIA 4YPDA 3N9XA 1ZOGA 3UO4A 4BCPA 4TL0A 4EQCA 3WOWA 5DMZA 3HNGA 4FV2A 2Y8OA 2XNBA 5J1WA 5EW3A 3O50A 2BFXA 3RPYA 4ZJIA 1W2CA 2A2AA 2J0IA 2J90A 2XNGA 5EW8A 3VJOA 3TUDA 3QKKA 2R3OA 2OW3A 3PTGA 4BDDA 3DB8A 3F3ZA 3DKGA 1S9IA 3MH3A 5CEKA 5IF1A 4ASDA 4IX5A 3RK7A 4ZZNA 4CEGA 2PVJA 3EQFA 2Q83A 4EBVA 2BR1A 3KRJA 4TYIA 1QPCA 4IWOA 2A27A 4E5BA 1XH4A 3VW6A 1KOBA 2OIQA 3U87A 4C3FA 2XK6A 3OUNB 3JS2A 2XIZA 4GT4A 2W9ZB 4OTFA 3RAKA 4DCAA 1UU9A 2X9EA 3FE3A 5ANEA 1E9HA 4TWCA 5K5NA 3Q9XA 4FTUA 1SVGA 3A99A 3L9NA 3HECA 5CF6A 3LXLA 2JFMA 2GS2A 3CPCA 4X3FB 5DA3A 4JDKA 4C57A 4KUJA 4F7SA 1ZOEA 5GJFA 3KXGA 5C4LA 1PF8A 4ZZOA 4FODA 2AC5A 2PVKA 3TNQB 3F3WA 3QCQA 4JQ7A 4CMTA 4DC2A 2C6MA 4D28A 4WT6A 4C2WA 4D55A 2B53A 4X2JA 5KBQA 3UPZA 4FR4A 4I23A 3AC3A 3HLLA 3FHRA 3RZFA 3BU5A 3VAPA 5BVDA 1BMKA 3IGOA 3MS9A 4FTJA 4DGNA 2PVMA 4CFVA 3PJ3A 3W16A 2C47A 5EM7A 4PPCA 3BEGA 2G2FA 3EN7A 5E9EA 3QD3A 4O27B 1Q8TA 2C68A 3JY0A 5EI8A 5E7RA 2I0YA 3KMUA 5CTPA 1GAGA 3ORIA 2WTCA 5AV2A 3W0MA 4XYFA 4DFYA 2V62A 4NH1A 2QOHA 3COMA 3NW7A 3PWYA 4ZTHA 4BIEA 4BBFA 2X2MA 2BDFA 3RAWA 1IAJA 2P33A 3TKUA 2Y6OA 4YNOA 5CEOA 3FMDA 4JR3A 2W1IA 2ZM4A 4GCJA 3K3JA 2FYSA 4D4SA 2GCDA 2FVDA 4JAIA 3RZBA 1NVQA 4U3ZA 4J96A 3EZRA 5E8TA 3OXZA 4JAJA 1GZNA 4JS8A 2WFYA 3DTWA 4DDIA 3GC9A 3U9NA 3ZXTA 4O0WA 1R0PA 3W18A 3MGYA 2H34A 4X6QC 1NA7A 5DI1A 3SW4A 3ZM4A 2OF2A 4QTBA 4IXPA 5KMKA 4O4FA 3NAXA 4C3PA 2F57A 4TY1A 2YM5A 3VBQA 4D2PA 3RP9A 4DCEA 3BL9A 5JGBA 4DFBA 5GZ9A 5BVWA 4F08A 2XM9A 4FZ7A 4V01A 4NT4A 3WE4A 3SVVA 2CKPA 2NNWB 2RGPA 1SM2A 3E63A 1HCKA 4D5KA 2PE1A 2HW6A 4XLVA 3FMJA 3LMGA 4N0SA 4ACGA 4FICA 3H30A 4WOVA 4AXAA 4DYMA 3CBLA 3FYKX 4QYYA 3W0QA 1ZY4A 3MSSA 3U6HA 2WXVA 3JUHA 2JEDA 3PE1A 2VRXA 1KV2A 4QYFA 3SQQA 4IWPA 1L3RE 3C5UA 1XH8A 2WMUA 1Q4LA 3L9LA 5IA0A 2F9GA 3P23A 4LOOA 1IR3A 2JGZA 2FGIA 2UW4A 2CN8A 2YIXA 3QD4A 3ZFXA 2XK7A 4L45A 3H10A 5CEMA 4KKEA 4AT3A 5AM6A 4F64A 4FYOA 2IVUA 2VGPA 3JY9A 4HGLA 3Q6WA 1CSNA 4O4EA 3RPOA 3LFDA 1Y57A 1H27A 4G6OA 4L00A 4EEVA 2GNJA 4MBLA 4BCJA 4U0IA 4KSPA 3FMNA 5EK7A 4J99A 3QZGA 2OKRA 3U54A 1ZYDA 5AUTA 5AP6A 2G2IA 4Z9LA 5FWKK 3WZEA 5L2WA 1BX6A 2ITNA 3HRCA 4FSMA 2X7OA 2CGUA 3FLSA 4ACDA 2WTJA 3FYJX 3KCKA 3KXXA 1VR2A 4RIWB 3VF9A 2NRUA 4DEHA 4QP1A 5M09A 2VV9A 4KBCA 2HELA 4IC7A 4M3QA 4ENXA 4F1OA 5GZAA 4DHJA 1QPEA 3VS4A 4CV8A 2HWPA 3QWKA 2R0IA 2X8EA 4IAFA 2C5YA 4GK3A 3RVGA 4GFOA 1QPJA 5KMOA 2WTDA 4U41A 4PDYA 3ZLYA 2VWUA 3Q9ZA 1SZMA 2V7AA 2RF9A 4F09A 5BVFA 5CAOA 4MYGA 5BPYA 2ITZA 4U6RA 4JRNA 2Z7QA 2ETMA 3GC0A 1YDSE 4X2NA 3T8OA 2JDSA 3NNWA 3POOA 4UBAA 1J7UA 5HQ0A 5AFVA 1P14A 5FBOA 1KE5A 3CY2A 4C34A 4CCUA 2BALA 4C4EA 3PPKA 3OY1A 3TTJA 2OBJA 3QXPA 5HICA 1W98A 2WMVA 1TFFA 1NW1A 2G01A 4HVDA 3KREA 4DLJA 1Y91A 3LHJA 5JFWA 4B6LA 2YDKA 4ZS4A 4O0UA 3DFCB 3EQHA 4G5JA 4UXQA 4C37A 2BRBA 2XNMA 3NNXA 3FI4A 4EH3A 4S34A 5HVKA 2O3PA 3C4FA 4AW5A 2I0HA 3O0GA 3FL4A 1SYKA 2QKRA 2G1TA 3MVJA 4ITJA 4DLIA 3QC9A 3NX8A 4LV8A 2PVFA 1WAKA 4AGCA 4NCTC 5HVJA 5L3AA 3BRBA 4FKOA 1Q41A 4EWQA 4ZLYA 4B4LA 4Q5EA 4UMRA 5JSMA 4ZY5A 1M2PA 3QTWA 4FV0A 4O4BB 3CLYA 4N57A 3RI1A 4DT8A 5CZHA 4BRXA 3C0GA 3OROA 5C03A 2Y0AA 2V7OA 3GU6A 3Q3BA 5HLWA 2JLDA 2IZRA 4I5HA 2UZNA 3I5ZA 2JDRA 3O8UA 4FG7A 3LXPA 2QURA 4S33A 5A6OA 2IW8A 2XIRA 3PA5A 3QALE 1IASA 4LMUA 4M0ZA 2XNPA 4FTAA 4IC8A 3L9MA 2BKZA 4YZDA 5ANDA 5AUVA 4FV1A 5DWRA 2P0CA 1O9UA 4KBKA 3ZC6A 4EOKA 4ZMFA 1Q3WA 4IZ7A 4H39A 1XH6A 4U80A 2YITA 3FJQE 3MVMA 4MD9E 3PJCA 4NEUA 3QQGA 5HIEA 4GEOA 3RAIA 5J5SA 4ZSLA 4CD0A 3GB2A 5EW9A 3OCGA 4QYGA 4U42A 3VBWA 1G8JA 5CEIA 3VBTA 2HZ4A 2O2UA 2F2UA 4GG7A 2PUIA 3G0FA 3BWFA 3VW8A 1K3AA 2WB8A 4XJ0A 4ZJVA 1W84A 2ZB1A 4G5PA 4MH7A 2UUEA 4PMSA 3KGAA 1ST0A 2W4JA 5HIDA 3EOCA 4PP7A 2C0OA 3BI6A 5ETCA 5FEDA 3NEWA 3HV7A 4X2KA 4M8TA 3TZMA 4F4PA 4KKGA 1PMUA 1H08A 3EKNA 5L8KA 5JN2A 4ANOA 2FSMX 3ZLSA 4AXEA 5AP7A 1XR1A 1R3CA 4N4SA 3N51A 4NM3A 5HESA 2OXXA 3LW0A 3NDMA 4DH5A 5ICPA 4FMQA 4OTGA 2FH9A 5FXRA 4C4GA 2YAAA 3QX4A 3TNHA 1OPKA 4KS8A 4U3YA 4XG4A 5CU3A 4C7TA 4F9BA 3K54A 4FNXA 4NKAA 3UE4A 1UWJA 1H25A 4XOYA 4E5WA 2WIPA 2UZEA 4AA4A 5KHWA 4BDJA 2G9XA 3ODYX 3QL8A 2F7ZE 3R7UA 4OTHA 4O81A 4BWPA 3E88A 4G34A 2EVAA 4EOSA 3DA6A 3FMLA 1M52A 1WBSA 2BKKA 4F65A 4F9WA 4YZNA 4PF4A 5CU6A 3W0PA 5GHVA 3QZHA 5H8BA 4Y5HA 3COHA 3QA0A 4MXZA 1M2QA 4A9YA 4FSZA 2R5TA 4I1ZA 3TEIA 3PJ8A 4RC2A 5E8ZA 4XCUA 5C01A 4FNWA 1YQJA 2CKOA 5E92A 3FSKA 3KRXA 5HG8A 3OEFX 2RL5A 2GHLA 3FMHA 3DZOA 2IWIA 2W4KA 4GK2A 4NW5A 2J0KA 4BTJA 4YO4A 5JGDA 4G3DA 3CR0A 3LCKA 4E4XA 2WNTA 4EK5A 1J91A 1JSVA 4ERWA 3TZ7A 4O7WA 4AXDA 4RG0A 2I0VA 4HVSA 4NCTA 4G3FA 2X4ZA 1NXKA 3PFQA 3F2AA 3SXRA 4ZAUA 4PP9A 5IEVA 3IK3A 2VWYA 4FT9A 5FDXA 3OWPA 3TIZA 3P7BA 4V0GB 3QUEA 3DBFA 2VZ6A 4IJPA 4V0GA 4BDAA 3V5TA 4O86A 4MEDA 4MD7E 4HW7A 4FTTA 1JKLA 2UVYA 4C61A 3FKNA 3NZ0A 3UOKA 3LOKA 5IH5A 2QODA 2XYNA 2J0LA 3LAUA 3WF6A 2XVDA 5AA9A 5EDPA 1FQ1B 4DN5A 4NKSA 3LMIA 1XO2B 5EI2A 1FBNA 4QMWA 5ANOA 3KMMA 4WSYA 5E1EA 2W96B 4O0VA 4QMMA 3A61A 3VS7A 3E87A 2F7EE 2ZYBA 1Q61A 4NU1A 2C6IA 4EH4A 3UG1A 1YI3A 2J51A 3R04A 3IDPA 3QYZA 4CT1A 5HBJA 2AYPA 4KSQA 2GDOA 1XMLA 3D5XA 2HZNA 4JVGA 2QO2A 4JJRA 4X6RA 1PXLA 4XRLA 4PMPA 1ZYSA 2CHLA 5HVYA 3PDTA 2VO7A 4NIFA 3UQFA 1EH4A 4R6VA 5FXSA 3V5QA 1V0BA 4YMJA 3HVCA 4GK4A 2VTNA 4H3QA 5CVGA 3ORPA 4PWNA 2XJ0A 5JFXA 4BCHA 3O17A 1Q5KA 3P08A 4EI4A 3NW5A 4KIPA 4F0FA 3QZFA 3HMNA 2BCJA 2FO0A 4DAWA 4W4YA 2HXLA 2YJSA 4H3BA 3PYYA 3D94A 2OZAB 2W9FB 2OZAA 2WELA 4APPA 4O7NA 3QCYA 1B6CB 1ZWSA 4O0SA 3UVPA 4KINA 5J7HA 5AUUA 5HTCA 1SMHA 2J0JA 5G6VA 2OICA 4EH6A 2W5BA 3R7IA 5H9BA 4BDBA 4FEXA 2IF8A 2OFUA 3TACA 3AC2A 4PTCA 1YVJA 1PW2A 2F49A 3CQUA 5H2UA 2OJJA 2XCKA 4MK0A 4F6SA 5AX9A 4NM0A 4F7NA 3R00A 1WBWA 3OBJA 5HO8A 3E8EA 4M0YA 5B2MA 1ZYJA 5LXMA 3MY1A 4ZXTA 3LE6A 4PPAA 5KZIA 3VS1A 3Q9WA 2W1HA 3I6UA 4KBAA 4HVHA 4K2RA 3DBDA 4QP7A 2GU8A 2JITA 4AW0A 4C38A 5H8EA 3L8XA 4IX3A 2R3FA 3FLNC 4CFUA 3UVQA 3D7TB 2REIA 4IWQA 2XAMA 4CQGA 4UX9A 2WTWA 2RG5A 4G1WA 2CGVA 1J7LA 1CM8A 1XKKA 3GCUA 4EYMA 4MTAA 3FQSA 4AZWA 5IISA 5ETIA 2CNUA 1W0XC 4XBUA 4U81A 5CSPA 2WTKB 3UTOA 3A7JA 5AR8A 5AWMA 2XANA 3UMWA 1ZZLA 1IG1A 3QQKA 2DYLA 4FTQA 3DZQA 4FZ6A 4L7FA 5J5TA 1PMNA 4XG2A 2X2LA 3L8PA 3VIDA 4EK8A 4R1VA 2GPHA 1A06A 5EHLA 3CTQA 3DDQA 3CS9A 3FDNA 5HOAA 4K18A 3PA4A 4JNWA 5CSVA 2X0QA 4IH8A 5HCXA 4K0YA 4AOIA 2XEYA 2DS1A 5E8SA 3BBTB 2Y9QA 4KIQA 2UZTA 3HMMA 3OUKA 4TWPA 5EDQA 4UMPA 3TI1A 2OH0E 5I9WA 3B2TA 4FTMA 4IWDA 4OAUC 2VX3A 4ACMA 2C4GA 4G17A 1Q24A 1GNGA 3SDJA 4YC6A 1GIJA 4GRBA 3MVLA 4F1TA 4I22A 3OOGA 4ALWA 4C2VA 5ETAA 3IG7A 4HJOA 3DAJA 3TV7A 4JG6A 1DAWA 1YHWA 5TF9A 4JRVA 3E8NA 3GU7A 4Q2AA 3FEGA 5ACKA 1Z9XA 4GFMA 3NNVA 4ZIMA 3DPKA 4XG9A 2OIDA 3ZEPA 4FGBA 2ZM3A 4XBRA 4ACCA 4IZ5A 2XKDA 3CJFA 3IW7A 4XV1A 3HL7A 1YHSA 2UZWE 5LVNA 3CJGA 3AD5A 1JSTA 5HE0A 1OKVA 3ZM9A 2OFVA 1K9AA 2VX0A 4XP2A 4EYJA 4O82A 1H8FA 4FIFA 4G3CA 3F6XA 4JBVA 4A4LA 5KMJA 5IQGA 4BY9E 4OAVB 3CQEA 4JR7A 3S2PA 3NW6A 4QMUA 3A8WA 4RIXB 3V5PA 3G5DA 3CSVA 2Z02A 3H0ZA 4MQ2A 3CP9A 4FF8A 3AT2A 4QRCA 1F3MC 5CSHA 2JKQA 4FKLA 4M7IA 5BMMA 2QG7A 4D2SA 3UO6A 3VUHA 2DQ7X 3C1XA 3TKIA 3V6RA 4Y95A 4TYGA 3V5WA 4BL1A 1PMVA 2H6DA 4PNKA 4YU2A 2ESMA 4ORKA 5A6NA 5A54A 4M67A 4R78A 4CLIA 2QU5A 4PPBA 4IQ6A 4GVAA 3NRMA 4RVTA 3R28A 3FKLA 3FKOA 4QD6A 3BYVA 3DQWA 2PVNA 3F3VA 4QDEA 3FZSA 2PZYA 2R7IA 3DNEA 3VHEA 2R3JA 3G6HA 4UEUA 5BYZA 5F95A 4JBOA 4XG8A 3W2RA 3LCTA 3E7VA 5AUYA 3BLRA 4I3ZA 2BDWA 2VTPA 4CFNA 4EUTA 2YFXA 3SG8A 3R1SA 4JG8A 4V05A 3FMEA 4W4XA 3V01A 3ROYA 2KULA 2X0OA 4DEBA 4I4FA 5IDNA 2GS6A 3QQFA 1B38A 1GY3A 1KSWA 1VZOA 3W2PA 3IQ7A 2VWWA 4ASXA 4EOOA 5K0XA 5HD7A 3SKCA 4DH8A 3SC1A 1XHAA 4TT7A 5DFPA 4I6LA 3A4PA 5DR2A 4ZTLA 1JWHA 3Q60A 3W8QA 2VWBA 5CANA 4H36A 5IU2A 2P4IA 1BL6A 3FUPA 4NWMA 1M7NA 4EOIA 3FPMA 1JLUE 1W2FA 2C1BA 4MWIA 3NNUA 3CKXA 2HW7A 1A9UA 3KULA 3TUCA 2I0EA 5FXQA 5HO6A 1I09A 2QOOA 2W0JA 5D9HA 5FTQA 1J7IA 2C69A 2HXQA 5GZ8A 4FIHA 3UOHA 1IA9A 2E9VA 3A7GA 3MTFA 4AGUA 5A9UA 2B9HA 5BVEA 4FKQA 1ZMUA 4XNEA 1M7QA 1AD5A 4BZOA 2WQNA 3BBWA 1G3NA 3QD0A 4FSRA 5BVKA 1PXIA 1SNXA 2X39A 2YLEA 4O7ZA 3LJ2A 5C27A 1QCFA 4V04A 2BZHB 4DDGA 1P2AA 3PPJA 5L6WL 2WMSA 3E93A 3A4OX 3C9WA 3PLAE 4A06A 1MQBA 2IG7A 3LMHA 3QKMA 2VTHA 3PP1A 4MQ1A 2B1PA 3DS6A 3ACKA 2C5XA 3ATSA 3H9OA 1JPAA 3E62A 5D12A 2HZIA 4OTDA 4B7TA 1JOWB 2OI4X 2XYUA 3ZZEA 3FZ1A 3K2LA 2QOKA 3OW3A 4Y83A 5HO7A 2C6TA 5LVMA 3VRZA 3EN6A 4U43A 4M84A 5DBXA 4W9XA 3V5JA 5HLNA 5CVHA 3FXXA 2CJMA 3QCSA 3ZO2A 2OJGA 2OF4A 2WQOA 4PV0A 2E9UA 3FY0A 4CFXA 3F9NA 4M69A 2BFYA 3FXZA 3R9HA 3C0HA 2IJMA 3GFEA 4QDVA 4L44A 2W1CA 2YABA 2YZLA 4IAIA 4J53A 5AJQA 2HWOA 1X8BA 4DEGA 2W17A 2HENA 5HE2A 2IVTA 2WMQA 4QMZA 4BZNA 3FLQA 2PUPA 4K11A 2CCHA 4GIHA 5C9CA 1H1QA 1OUKA 4H1MA 4TW9A 4R7IA 3DGKA 2XKCA 2BIKB 2I40A 3W55A 4D2WA 2VWIA 2ZV2A 5HTBA 3DXQA 4EOPA 2BHEA 1SVEA 4WIHA 4I6BA 1R39A 4F1MA 2R3KA 5KMLA 5ANIA 4A4XA 4L43A 5HKMA 3MJ2A 4NFMA 5CU2A 4O1OA 5L6PA 1LPUA 2X2KA 3G90X 2YN8A 4O84A 1P4FA 2WTIA 3D2IA 1WBVA 1PY5A 2XRWA 4L67A 2WO6A 2ZJWA 1LEWA 2EXCX 1ZRZA 4FNZA 3TNWA 2UW5A 4FEVA 4K77A 2WMWA 1O6YA 2PVLA 5ANJA 4LG4A 1OKWA 3UIXA 5M56A 4BJJA 5M4CA 4YBKA 5DPVA 3Q9YA 4NK9A 4RC4A 5DHJA 2GMXA 4IHPA 4L7SA 2YLFA 3ZBXA 3GCVA 3ZRKA 3SXSA 5DR6A 1XBCA 3OTVA 4FNYA 3E3BX 4QOXA 3DNDA 4LOQA 4FGRA 3LFEA 4TPTA 2BIYA 5AR4A 2R3LA 1ZOHA 3UNJA 2PVRA 4AE9A 5LVPA 2A0CX 4FYNA 4F6WA 3EWHA 4FV4A 4HVGA 3QBNA 5C8MA 5I0BA 2GNIA 3ORMA 3ZMMA 1CDKA 3OEZA 2UW7A 4CT2A 4UWBA 3AXWA 1XQZA 1H00A 5AP5A 3JR1A 1M14A 4K8AA 3O71A 4WNPA 3D4QA 3LVPA 5DVRA 3P4KA 4A07A 2CGXA 4RGJA 3QUPA 2FSLX 1PMEA 2WIHA 4YTHA 1BLXA 2C3JA 4RVLA 3ORLA 4BI0A 3TCPA 3W33A 3R8VA 3OOMA 3ANQA 5I4NA 2W1DA 4YGAA 2J6MA 3H9RA 2JDVA 1HOWA 2Y6MA 5HX6A