3POZA

Egfr kinase domain complexed with tak-285
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
293
Chain Sequence
QALLRILKETEFKKIKVLGSGAFGTVYKGLWIPVKIPVAIKELANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDVVDADEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Structural Analysis of the Mechanism of Inhibition and Allosteric Activation of the Kinase Domain of HER2 Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 293
sequence length 317
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pozA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pozA01
5H8BA 4X3FC 3CP9A 3ULIA 4EOQA 4QMNA 4QP4A 3GC8A 3GNIB 5CTPA 5CEPA 3OWLA 5HVKA 5KBRA 4OAUC 1PMUA 4BCQA 4I22A 4EBWA 3HMIA 3UNJA 1M2PA 4EOPA 4ZZOA 3SOAA 4YHJA 4ZY4A 3OMVA 1XH6A 2XNBA 3RCDA 5L2WA 2WTKB 1B38A 1AGWA 4GFGA 1SNUA 4ANOA 3LJ0A 4UB7A 5AUXA 3F5UA 4E7WA 4D2WA 1P14A 3L9LA 3LFFA 2V0DA 3O7LD 3DKOA 4QMLA 5CAOA 3UOHA 4BHZA 4U7ZA 4R1YA 5HIEA 4OTWA 2ZB1A 3LQ3A 4HPUE 4NUSA 2PZPA 3PZHA 4XLVA 3VBWA 4AZTA 5BYYA 3CCNA 4BIEA 2CCIA 2Z7QA 5C9CA 2VUWA 2FUMA 5HLWA 2I6LA 3ZSHA 2PWLA 5CEOA 2OZOA 4LMNA 3W2OA 2CLQA 2HZ4A 3G9LX 4BKYA 5L3AA 5CSPA 2PVLA 2UZBA 2YDIA 4RFZA 2C6OA 5AM7A 4D2SA 5DI1A 2R9SA 4O1OA 1XHAA 3E62A 3FYJX 5D10A 3FHRA 3SG9A 3DJ6A 4RX7A 3CD3A 4PTCA 3NYVA 3G6GA 4FTTA 1UNLA 2W4KA 1ZYLA 2B53A 3NDMA 4OLIA 5DE2A 1YWNA 2VX0A 3JPVA 4KNBA 5FBNC 5AV3A 3DLSA 3TT0A 4EHEA 4XG8A 1Y8GA 4B9DA 4C3RA 5KUPA 2H96A 3MTFA 3DV3A 5FUTA 1XR1A 1UWHA 4UEUA 3R02A 1JQHA 4WKQA 3U8WA 3WIKA 3FMHA 4E6AA 1OKVA 3ET7A 4X3FB 3HVCA 5CS6A 2QOBA 4MVFA 1O9UA 2P2IA 4PDSA 1PXLA 3IPHA 5KMOA 5BVOA 2I7QA 3BPRA 4BFMA 4G34A 5LVPA 1CMKE 3M1SA 4FG7A 2C5XA 5KZ0A 3CQWA 2WZJA 3CQUA 2O3PA 5BVWA 3TNIA 5GZAA 3HLLA 4R5YA 3ELJA 5L8KA 3W2SA 3FHIA 4Y5HA 5LMKA 3W16A 1R0PA 5HZNA 3TTIA 4AZWA 4CLIA 4EOSA 3EQCA 2OU7A 4O7NA 5AIRA 5LWMA 4ITIA 4J99A 4FTMA 4EK5A 4DITA 2XBJA 3WI6A 5EYCA 1BL7A 3UIXA 4EUTA 2XA4A 3UQCA 1WBPA 1CTPE 5HCXA 4FGRA 4EHVA 3ENMA 1CSNA 3L8VA 3R7GA 3VF8A 3E8CA 2OH0E 3O51A 5CF5A 3FKOA 4AW5A 3TL8A 3BU6A 4E5BA 1YWRA 2GHMA 1H25A 2QOFA 2R7BA 3MGYA 2QO9A 4WA9A 2HELA 2PE2A 3WZDA 2CNQA 4KIOA 5EKOA 5FTQA 2XBAA 3RCJA 1Q97A 2WMWA 4TWNA 5CEIA 3A8XA 3EQPA 3LE6A 4BDFA 2BZJA 3RNYA 4R6VA 3WF7A 3U9CA 2ZM1A 1W98A 2C6MA 3D4QA 4YJTA 4G31A 3ODYX 4CKIA 1ZZ2A 3MY5A 1H01A 4LM5A 3HV4A 3PJCA 4C62A 4YJOA 4FT3A 4TNDA 3BYOA 4LI5A 1QPEA 2LGCA 5C8MA 2PULA 2ITYA 5C01A 3JUHA 4P2KA 3SRVB 3RBWA 1FINA 3FMJA 4F0FA 2YZAA 2QI8A 2C3IB 3ETAA 4AN3A 4RMZA 1REJA 4FVQA 4NZWB 5JZNA 2IJMA 4FK6A 4EYJA 1U5QA 5BNJA 3ACJA 4XBUA 4BI1A 3OD6X 3QAME 4FKWA 1P4FA 5L4QA 2QNJA 4DH8A 4AW1A 4P5QA 5LCKA 5E4HA 2WNTA 4BDGA 3R8UA 3QTIA 3GI3A 3B8RA 2FSTX 3GBZA 4CGAA 3NGAA 4UWBA 3R7VA 4E4MA 3IDBA 4EYMA 5K0XA 5LVMA 4DEBA 3H3CA 4EORA 1FVRA 1LEWA 4FV6A 1JNKA 2RG5A 2GQSA 4RGJA 4JG8A 2BUJA 4O0VA 3LHJA 3HMOA 4DEHA 4ZZMA 4OTHA 3ROCA 2UZUE 3BI6A 3DNDA 2J51A 3A7GA 3N9XA 3ZLYA 2BIYA 4BDAA 2DWBA 4EH8A 3JXWA 4YURA 5A6OA 1PXNA 2GNLA 2ITNA 4RWKA 4F70A 1OBGA 4R3PA 4W4WA 3R9DA 2OSCA 3QWJA 4FTNA 4JR7A 4AF3A 5IPJA 2BZHB 2QVSE 2CMWA 3THBA 3QTWA 4EJNA 4FTUA 3E88A 2GU8A 4X2FA 4D1SA 4IEBA 3VUTA 5A6NA 3IDCA 1W0XC 2UW4A 1WFCA 2NRUA 5CASA 2AYPA 3UJGA 4BKZA 4JL9A 3W55A 4WHZA 4MBIA 3O8UA 4F9WA 2WTJA 4FKSA 5BQ0A 5JT2A 2I0EA 3GCUA 4ZSJA 3PWDA 4DGMA 5KE0A 2WXVA 3AC5A 4XG2A 3BLRA 3KEXA 5F4NA 4FZ6A 5HKMA 3TUCA 3BEGA 4F1TA 4M7IA 4J8NA 3SV0A 2W5AA 3N4TA 2J7TA 3NLBA 4QMQA 5M08A 4M69B 4F1MA 4RVLA 3Q9WA 5AV4A 2XKEA 5D1JA 5GHVA 3EZRA 3DKGA 2RGPA 5DGZA 4C02A 4EH6A 3Q9XA 3ORMA 3GCQA 3F3UA 2C30A 2C3JA 4IAAA 3ZFXA 4HCVA 5E7RA 4GMYA 2QOKA 2RFNA 3UVQA 4LFIA 4CFMA 4FZAB 1ATPE 2A2AA 2WIHA 2W99B 4DGOA 3UO5A 3VW8A 3L9NA 3MH2A 3CXWA 5AP5A 5BYZA 3V5WA 3ZRLA 2PUNA 3OUNB 3ORNA 4XG4A 2UVYA 5AAFA 5A46A 4M97A 4DFBA 1B6CB 3FI2A 3OXTA 3D2IA 2J0JA 3E3PA 4EHGA 4C35A 1JKKA 2VWVA 5G1XA 5C26A 2WMSA 4ZLZA 2OBJA 3FLWA 3AT2A 4TW9A 3FXZA 1I44A 4QPMA 5KMIA 3COIA 5CAPA 4MEDA 4IFGA 5AUVA 1RJBA 4JS8A 4NIFA 3TJCA 2ZV7A 4DFZE 2OF2A 1YKRA 2OLCA 3VO3A 4BIBA 4EOMA 2W1GA 3D7TB 4LGGA 5M57A 5EI6A 5F9EA 2JEDA 4R7HA 2YZLA 2UVZA 2W1IA 3SXFA 4C4EA 3UOKA 2Q83A 3QX2A 3R2YA 2PZYA 3GQIA 3FMNA 4I3ZA 1OM1A 5EDRA 4BF2A 2VTQA 4MD7E 4DTBA 3FQSA 2F57A 3ZXZA 1NXKA 4BGGA 4H36A 3H9OA 4FTOA 5ANIA 3JVSA 1QL6A 4WSQA 3OG7A 1W82A 3RKBA 4EJ7A 2VTIA 2PVNA 4KIKA 5M4FA 1JBPE 3FY0A 4YBJA 4BN1A 5C8KA 1LUFA 1JAMA 4RIXB 4WG3A 3OVVA 2F2UA 3ZOSA 4RJ5A 2B52A 3GGFA 4FEWA 2RFEA 1JKSA 3I0QA 3QQHA 5HIDA 4NTSA 2VWXA 4EBVA 3QCXA 4F09A 2C6EA 4NW6A 2W1CA 3FI8A 3FL5A 1SNXA 2X0GA 4AGDA 1MUOA 2XK7A 2B1PA 5HI2A 1B39A 4ZTLA 4QTDA 3F88A 4V01A 4KAOA 3BE2A 3AMAA 4BCMA 3DOGA 4H39A 3O17A 3BQCA 3VS2A 4DFYA 4N70A 3TDWA 4Y73A 4BR3A 4JBPA 3Q96A 3IOKA 4X21A 4E93A 5J5SA 4AAAA 5IQGA 2JITA 3BE9A 4ZY5A 4BVUA 2HOGA 4Y95A 3R71A 4MNFA 5DG5A 4DGNA 2F9GA 4WD5A 4TYIA 1TQMA 4DG2E 2WB8A 3V8WA 3ZO1A 2BRBA 2WMXA 4MYGA 2JDTA 3NW5A 4GRBA 1WCCA 1BMKA 4S32A 3AMYA 3ORPA 4BWKA 3FYKX 4IX4A 4O6LA 4H1JA 3E93A 2UW6A 4WG4A 3EQIA 3TKIA 4QMSA 3LMIA 3BQRA 1XQZA 4F1OA 4ERKA 2R4BA 4NH1A 1IA8A 3OT8A 2BCJA 5HCYA 4G3GA 4D5HA 2BHEA 4ONAA 5IQCA 4KKHA 2QKRA 3DBFA 2JDSA 3MESA 1U5RA 3PVWA 4TTHB 2XKCA 2PE0A 3NR9A 4BWXA 2WQBA 3KB7A 2YM6A 4LV5A 1GNGA 3FQHA 4CTBA 5I9VA 5D7VA 1KUTA 4ORKA 5A4LA 5EDPA 4PUZA 1PHKA 5I9ZA 3A2CA 3LLAA 4GV1A 3SDJA 1DI9A 1BI7A 3C9WA 4C4IA 4DCEA 3MPTA 2CGWA 4UALA 4J52A 4A9SA 1NW1A 5E8TA 4DEIA 2J0IA 4ZSGA 3ITZA 1H1SA 5HU9A 3GVUA 4RZVA 4E6QA 3TG1A 1OL7A 4I6FA 2FO0A 5EM7A 3O71A 3NNUA 1NT2A 2IZTA 5FLFA 4EKKA 3NS9A 1R78A 4HGSA 3OXIA 4IZYA 3A4PA 3F2AA 4G2FA 4YMJA 1R39A 3K5VA 4FR4A 4K1BA 2WMQA 4W8EA 4A06A 2Z8CA 3LXLA 3VVHA 5CT0A 3P5KA 2GDOA 3ZUUA 2QD9A 5AR4A 3ZS5A 3BHYA 3LFCA 4U41A 5AR3A 3W2QA 4UN0C 5IA4A 5HO7A 4AW2A 5CNOA 3P78A 3D9VA 2I0YA 3IONA 3JYAA 1PXPA 4WRGA 4FVRA 3VJOA 2BPMA 4A9YA 4FTQA 4QTEA 3VULA 2FSOX 3V6RA 4I4EA 4UZHA 4ENYA 1H0VA 3C0GA 3DBEA 1WBTA 2RL5A 2VNWA 2WKMA 3FI3A 4MD8E 4MX9A 4RQKA 5GJGA 4CV8A 2J2IB 4RX9A 4BBMA 4TWOA 3D5VA 2PHKA 4ZXTA 4K11A 2XK4A 3KMMA 5CU6A 2C1BA 3P4KA 4HZRA 2QHMA 3KF7A 4EZ7A 3OTVA 2YIWA 4GU9A 2BMCA 3PXRA 3PE2A 4QMVA 4QD6A 5IA2A 4EK3A 4W4VA 3OZ6A 4QMZA 2CKEA 4YO6A 2WELA 1W83A 3ZLSA 4QP6A 4QQ5A 5IA5A 2P55A 3FV8A 3C5IA 3MFTA 4IW0A 1OKZA 2ZAZA 1M52A 4O2ZA 3FBVA 4Q2AA 4QMTA 3VBVA 3PTGA 2YCRA 3F3WA 4OTIA 3VS0A 4O0SA 2I1MA 3DFAA 5EDQA 3SC1A 1DAYA 4WSYA 3OBJA 2GS2A 3R7YA 2NPQA 3QKMA 1PXJA 4GG7A 4L3PA 4O6EA 1ZOEA 2R3PA 1SZMA 2CN8A 4FKTA 4HYIA 2OXYA 5L6OA 2ETMA 3KY2A 3HV5A 3OUKA 5AP2A 2XYNA 4HGLA 4ZEGA 5JZJA 4AT3A 3TUBA 3QZFA 4MKCA 2XUUA 3LJ1A 4FODA 4DFUA 2QKWB 2KTYA 2BRGA 3DCVA 1YRPA 3NUSA 3MTLA 1A06A 5IKWA 3WZEA 3PA4A 4G16A 3KRLA 4JQEA 5CEQA 3UG2A 4GCJA 3DK3A 4Z55A 3C13A 4UMPA 1JOWB 4D2RA 3VIDA 2E9PA 2QCSA 1V0OA 3OFMA 2PVYA 3OCBA 4I6HA 1BX6A 2EXEA 2C4GA 2XF0A 3PLSA 4C4GA 3EFLA 1STCE 4QP8A 4QYHA 1T46A 3NNWA 1WBVA 2Z2WA 2HYYA 4H05A 4EK4A 3UNKA 4X3FA 3R21A 4MK0A 4TZRA 4U81A 4AWIA 1JSVA 3RPOA 3QZHA 5IUHA 3Q4ZA 3ZM4A 3IW5A 5ACBC 3T8OA 2UZTA 4E5WA 4UMUA 4FX3A 2UW3A 2WQMA 3D5WA 5BX0A 1OITA 4NTTA 5BPYA 1WBWA 5LVOA 1OIUA 4IWQA 4ALWA 2R64A 3EIDA 3I6UA 4XYFA 3WILA 4EQMA 1M2QA 3LFEA 2YABA 3MIYA 3FEGA 3LFSA 2XM8A 1M2RA 4YHFA 4D4SA 3G15A 3MH3A 4XJ0A 3F66A 4G17A 4W8DA 1E1XA 2UW8A 5E8UA 1OZ1A 4NM0A 4PV0A 3RAWA 5EKNA 4USDA 4XP2A 2C5VA 3A7HA 2G2FA 2QOHA 3BZ3A 2OICA 3FMMA 3QBNA 4ZIMA 3VS1A 3GC0A 1G3NA 3HNGA 1ZYJA 1Z5MA 3AC4A 3NCGA 4N57A 3P9JA 4C4JA 1RE8A 4YGAA 2WHBA 2WIPA 3EN9A 3W32A 3SX9A 5EW3A 4GJ3A 3RGFA 4Z9LA 2YIYA 2QU6A 4YU2A 5JRQA 1J1CA 3EWHA 2C6DA 2PSQA 1XH9A 3BHHA 1WVYA 2YAAA 4F4PA 2F7XE 5BVKA 3Q3BA 1HCKA 1QPDA 1T45A 3FMDA 4FNXA 4IVCA 5CSXA 2PUPA 5I9WA 2GNGA 2XIYA 4FKIA 5HG9A 2YM5A 4C38A 5IU2A 3W2PA 4I0TA 4QTCA 4KSQA 4RVTA 3NUYA 2I0VA 3VBTA 4C7TA 3CLYA 4H3PA 1G8SA 5GZ9A 2O2UA 5HLNA 3D14A 4WNMA 4BCOA 2VWUA 4K0YA 5JQ5A 1ZMVA 2JKOA 4I5HA 3UP7A 4GUBA 4JG6A 2YA9A 3IQ7A 4KKEA 3SRVA 4CVAA 3O8TA 4M14A 4MQ1A 1UKIA 5EHOA 1V1KA 3IKAA 5HESA 2OIQA 4QQCA 4X7QA 3EYHA 2QOQA 4GYGA 5T68A 4TYJA 5AP4A 4CQEA 2WTDA 3R28A 3PA5A 5TOZA 4ZLYA 1Q8WA 2QODA 4K18A 1U46A 1ZWSA 5DN3A 1OGUA 2X2KA 4FYNA 2CGXA 2WTCA 3H0YA 3EQBA 4AXAA 3OBGA 4QMUA 3COMA 2PVKA 3MJ2A 4C8BA 3BEAA 4PQNA 3C0IA 3SLSA 5J1WA 2W06A 4IVBA 1GY3A 4W4YA 4HNIA 4FG8A 3W18A 4D0WA 5A4QA 5HTBA 2F2CB 2JC6A 4PMTA 4ALVA 3KMUA 5A14A 5L2IA 2PMLX 3QRTA 4FI1A 4NEUA 4RA4A 4B8MA 5LQFA 2X2LA 3BWJA 5CU4A 3R2BA 1F0QA 4ZZNA 4GVJA 4L3JA 4D4YA 1FGIA 2JGZA 3RPVA 3F5XA 3W8QA 3FZTA 3DKCA 4A7CA 4EC8A 3S1HA 2O65A 3QALE 4MXXA 2QO2A 3UOJA 4TWCA 2XS0A 3NVKI 1NY3A 2UW0A 3LCOA 5L2TA 2C5OA 3VUGA 5TO8A 3LFDA 4F0IA 4O84A 3LIJA 4P90A 3EB0A 4DTAA 1UU7A 2UW7A 4QNYA 1Q3DA 1Y6AA 2GTNA 2WQEA 1QMZA 4BCNA 3CGOA 4IWOA 3EJ1A 2QOOA 2W7XA 4R7BA 1XWSA 2VTMA 1ZOHA 5DPVA 2ZMCA 1QCFA 3POOA 4L6QA 5IDPA 4RG0A 3E8EA 4UWYA 3DKFA 2PU8A 1OUYA 4QPSA 3DK6A 5AX9A 3BV3A 3A7IA 4CYJA 2BROA 5CSHA 1KE9A 2V22A 1Q5KA 3ZBXA 1OIQA 2JIVA 3VUIA 4CCBA 3KK9A 2OI4X 4FTLA 3GT8A 4PL3A 2QLUA 5J8IA 1KSWA 5KZIA 5CF6A 5J9YA 4LQMA 2KULA 2O5KA 3OCTA 4WO5A 4RVMA 4GH2A 5AV1A 3G5DA 4C61A 4CZTA 2BALA 5K5NA 1FMKA 4Z16A 1VEBA 1P2AA 3DZOA 4F0GA 4JRNA 4ZTHA 1H1WA 4AU8A 5KX8A 5E8ZA 3PPKA 2H8HA 4HCTA 5BVDA 1KE6A 4KINA 3QXPA 1JWHA 3P23A 4H58A 5KNJA 2EB2A 4GG5A 4JIAA 3BHVA 4BL1A 4E8AA 2R3KA 5IDNA 2OIBA 4U5JA 5FTGA 4BHNA 4DEDA 4IFCA 1YDTE 3ALNA 1VJYA 3IOPA 4A9RA 4GT5A 2CCHA 4HNFA 4QO9A 4U3YA 3RK7A 3UE4A 5JSMA 1IG1A 4F6UA 1SM2A 5EM5A 1KE7A 3FUPA 4K2RA 4JBOA 2YDJA 2Z7RA 2ZM3A 3F7WA 5AADA 2JKMA 4KIQA 2RF9A 1A48A 4HYUA 5TKDA 3D7TA 2WOUA 4QQTA 3E64A 3BGPA 1OPJA 2XVDA 1W84A 4N6YA 2QG7A 4ANQA 4F9BA 4RWJA 2G01A 3QQUA 5HICA 3HZTA 5HHWA 4XG7A 4U9AA 4R8QA 5E90A 4GFOA 4V05A 2JIUA 5AFVA 2VWBA 1PMEA 2GS7A 4I5MA 5M4UA 3AOXA 2IW8A 4FK3A 2GCDA 4IC7A 1QPCA 5HVJA 3N4UA 3KXXA 3MVJA 4RJ3A 4ZSLA 3PP0A 3RPSA 2IWIA 4YNOA 2XNNA 4FNZA 4J96A 3G0EA 4L42A 4CKJA 1Q8UA 2V62A 5K0KA 4XUFA 3R8VA 1ZXEA 2CDZA 3KQ7A 5DWRA 4F6SA 4KS8A 2FB8A 1GOLA 3FXWA 3QQJA 3EL7A 3BBWA 4O7VA 3VBYA 1PYEA 5DYJA 5HNIX 4PDPA 2BZIB 2W9FB 4RC2A 3WARA 1URCA 4DG3E 3UYSA 4M84A 4LG4A 2BKZA 3IGGA 3TEIA 5LOHA 4YTFA 3E3BX 4E20A 4PPBA 5JK3A 3UGCA 4RRVA 2VTAA 3I6WA 3POZA 4O0YA 4XHKB 4U44A 5HD4A 4C58A 5HBHA 5AA8A 1WBNA 3P79A 4EONA 1G8AA 4RIYB 4JT3A 3RJCA 3LCKA 1GZKA 4WBOA 3KRXA 3VS3A 3O8PA 4RLKA 1KE5A 3QWKA 4I6BA 3LOKA 4QP7A 3EQRA 4YR8A 1J1BA 2OFVA 2XMYA 4JBVA 1YOJA 3OHTA 4M15A 2HZNA 5G6VA 4FZ7A 2ZB0A 1WBSA 3HEGA 3ZRKA 2QHNA 4EUUA 2J0LA 4IVAA 4RC3A 5LWNA 3DZQA 1PW2A 2YN8A 1UNHA 1JSUA 1ZMUA 5CU2A 4DLJA 2XNGA 2C3KA 4J7BA 4BCGA 3CGFA 2R3QA 4QTBA 3COHA 2PVMA 3MI9A 4AA0A 1M14A 2XH5A 4U45A 4FKUA 2HAKA 4NW5A 2QQ7A 2WMBA 2ETRA 4U0IA 3NEWA 5HBJA 4D1ZA 2ZV2A 3HECA 4CKRA 5AMNA 4YSJA 2C6TA 3I79A 3UMWA 2R3HA 2Y4PA 4OBPA 5FTOA 3EFJA 3FMKA 3VJNA 5E92A 3E7OA 4O21A 2OK1A 1LP4A 3A61A 3DFCB 1W7HA 3AT3A 4YLJA 2Y0AA 5CQUA 3SOCA 2ZJWA 2Y6OA 4RC4A 5EI2A 1GIJA 1DS5A 1J7UA 1XH7A 1UU9A 5FM2A 4B8LA 2O0UA 2DUVA 2QO7A 3BHTA 3LLTA 3Q5IA 3Q60A 4ACHA 3MFSA 5CI7A 4BDKA 3OWJA 2UZOA 3LPBA 3S4QA 2WU6A 5BMMA 3BYUA 3HAMA 3DPKA 5J9ZA 1U59A 3JVRA 3LXPA 2F7EE 3TZ9A 4E5AX 1H4LA 4PF4A 3N4VA 1ZMWA 4I5CA 1Q24A 4AZVA 3PPZA 2UUEA 4D4VA 3RP9A 2R7IA 1YI4A 4YBKA 1ZYDA 3FZRA 4GEOA 4DF3A 5IQEA 5FBOA 3FAAA 4DTKA 2VN9A 4OAVB 5EHYA 4D4RA 5I4NA 3R1QA 5FP5A 3ZM9A 2E9VA 2YIRA 3L9MA 4WUAA 1YXVA 5ANGA 4AGUA 5ETFA 3U54A 2DYLA 3IO7A 3DB8A 2XP2A 1I09A 2VZ6A 1H07A 3Q4UA 5CU3A 5EG3A 5FXQA 5GJDA 3FC2A 4Q5EA 2P2HA 3Q04A 1OVEA 2IZUA 4FT9A 4UY9A 1NVSA 3PJ2A 3CY3A 3AMBA 4HGTA 3NAXA 3C4ZA 4QMXA 4XMOA 4G5PA 3ZBFA 4FL3A 4HJOA 4O0XA 3FPMA 5AP0A 3TIZA 5K4IA 1ZOGA 2EXMA 3L9PA 3O50A 4U80A 4USFA 2EUFB 4GVAA 2YCSA 3NYXA 3LFNA 4OUCA 3SKCA 3ZO4A 3HA6A 5AV2A 3M42A 4Y72A 3C4XA 5HNBA 3COKA 5K5XA 5LXMA 3WZKA 4IAYA 1X8BA 3E63A 4FV4A 4IACA 5HE1A 1M7QA 3ZO2A 2GMXA 5C27A 3EN4A 4OT6A 3U51A 3D83A 4O96A 3P7CA 4BYIA 4WG5A 4YTIA 2ITVA 1GZOA 3R1YA 4O22A 5D9HA 4KWPA 5T3QA 4PMSA 5EI8A 4EEVA 2J90A 5L6WL 3K3IA 5DH3A 4EC9A 1ZYSA 4YNEA 1YW2A 2FSLX 4CFWA 3R73A 2R3RA 4UXLA 5CQWA 1WVXA 3QQGA 2PK9A 2VO6A 2YCQA 4L43A 3HV6A 4OTRA 4QYGA 5M55A 3QC9A 2GNJA 4O7RA 5AR8A 4BDHA 1OPKA 2W4JA 3QD0A 4GS6A 5EM6A 4CD0A 3S3IA 4E1ZA 3IDPA 3ZSGA 4FTAA 3LCSA 3UMXA 2XK6A 3HYHA 3KKVA 3VBQA 3HRFA 3QU0A 3LXKA 4O38A 4OBOA 3TZMA 3DB6A 4AA5A 4H3QA 4G6LA 1YDSE 2PE1A 2XK8A 3L8SA 4IM3A 2ACXA 3Q5ZA 4OTPA 3H0ZA 4NKAA 5CVHA 4BI0A 5HTIA 1KWPA 4BZDA 3QUEA 1L3RE 3TNWA 5CSWA 3E5AA 5CEKA 4AN9A 3U4UA 3FL4A 5AUZA 3BRBA 2XIKA 3LW0A 5CXZA 4NL0A 4ZY6A 4OT5A 3K54A 5L6PA 3F2NA 1H08A 5HO8A 3FLSA 2PVJA 4HOKA 2JD5A 4X6QC 3VWAA 4AGWA 3KVXA 5DR2A 4HVIA 2XCKA 3MFRA 5FRIA 1Q99A 4FOBA 4D55A 4AG8A 3P1AA 3R22A 4U43A 4X2JA 4QP1A 4RBLA 5E1SA 5ACKA 2CNVA 2CJMA 4O2PA 1M17A 5JKGA 4RT7A 2BRNA 2YACA 3IGOA 3RK5A 3VAPA 1DM2A 1JPAA 4Q9ZA 5IA0A 2OFUA 5GIOE 4FEQA 4QMWA 3A99A 2VTOA 3S95A 2XYUA 1FVTA 4V04A 5EH0A 2VWWA 2BAKA 4XNEA 4OBQA 3ULZA 1OBDA 5C8NA 4ACGA 5KMJA 3PDTA 3EN6A 4OR5A 2GFSA 2WMVA 3LVPA 2WMUA 2YLFA 4FZFB 5HU3A 3UVPA 1H1RA 1YHVA 2YM3A 3DTCA 3WBLA 3I81A 3DAEA 1F5QA 3GC7A 4XP0A 3HA8A 1ZYCA 3WOWA 1R0EA 3CQEA 3T9TA 5IQBA 2ITTA 2HIWA 3FXXA 2XIRA 3V6SA 3C4WA 3W1FA 2J9MA 2B54A 3UDBA 4V0GB 5DA3A 2WD1A 1Y6BA 3AD5A 4FKLA 2VTLA 5AP3A 3G2FA 3ORZA 2YHVA 4U6RA 1OL2A 4O0WA 4MF1A 4C0TA 4IC8A 3QA8A 2OIDA 2GFCA 3FZSA 4JXFA 4YJRA 2VX1A 3EQGA 5A54A 3PY1A 4MCVA 4HVHA 4IDTA 3OP5A 5DR9A 4BDBA 4IZ5A 2XZSA 5JMSA 3VQUA 5HTCA 4OGRA 4I92A 4FZDB 5CX9A 2RKUA 2WMTA 4XV9A 2JKKA 4QP3A 4BDEA 4O27B 2C6KA 5FEEA 3RM7A 1TVOA 2WTWA 3R9RA 2HZIA 1OECA 3FMLA 3CBLA 4PMMA 4I1ZA 3C50A 4I5PA 5CT7A 3KU2A 3FE3A 4KS7A 2XK3A 2Q0BA 4IB1A 5FDPA 5D12A 5CZIA 5TF9A 2PL0A 4QNAA 5DVRA 2R3NA 3RTPA 3TV7A 2XRUA 4UV0A 2X8DA 5EOBA 4JDHA 3PG3A 3GFEA 4FV8A 4GYIA 3MW1A 4MXYA 5CYIA 3TZ7A 4EOLA 5EQEA 1XJDA 3E7VA 4JX3A 5DMZA 5J5TA 3HDMA 4IJ9A 2FGIA 3Q6WA 2IW6A 5CXHA 3R6XA 3TNPC 2JIIA 5IUGA 3B8QA 4IZAA 1WMKA 3ZMMA 3ZRMA 3R7OA 1IAHA 2X6DA 4FUYA 2QLQA 2OJ9A 3NIZA 4FT5A 4XS2A 5AP7A 2C6IA 4ACDA 4BBFA 5J9LA 5IQDA 1GJOA 3EL8A 4A4LA 4YZBA 2VTNA 4R7IA 1H28A 4ASZA 1Q4LA 4HCUA 5AUTA 5FGKA 4AX8A 1MP8A 4N6ZA 4BCJA 4BDCA 2X39A 4RWLA 4IIRA 5KBQA 4JAIA 3PXFA 2IVUA 3MIAA 4PP9A 4EOOA 4YLKA 2A4LA 3PWYA 4QT1A 2R3IA 3TDVA 3HX4A 3TNQB 2A0CX 4PTGA 4MXOA 4F9CA 5CANA 1R1WA 2OJFE 4RIOA 3FWQA 4GW8A 3HMMA 4BDJA 4EI4A 4JDJA 2ITXA 2Z7LA 4JAJA 4WNPA 5K3YA 4E26A 5I9YA 4LRMA 1J3HA 3FC1X 4TPTA 4YJSA 1P4OA 3S00A 4E4XA 3QD2B 2JAVA 3G51A 3PIXA 4G1WA 3ORXA 3HMPA 3SQQA 4I21A 3UTOA 5J7BA 3PIYA 4CMTA 4BBEA 1MQBA 4FGBA 3I7CA 4GK3A 4CZYB 4UZDA 4A9TA 3KREA 2OZAB 3Q4CA 4P5ZA 3AC8A 2ONLC 4ARKA 4QPAA 5FWKK 4ANLA 3F6XA 4BCHA 3NAYA 2UW5A 3FLQA 3MVHA 4DC2A 3H30A 3HP2A 1JSTA 4K77A 3QUPA 3UO4A 3NNVA 2OG8A 4L53A 1IASA 5IMEA 4BY9E 2FA2A 1E9HA 3C51A 1SYKA 3P08A 3GC9A 5HBEA 3F5PA 1W8CA 3ORLA 3RZBA 5LARA 3V5PA 4XOYA 4FKQA 4BDIA 4EWQA 5L2QA 2WO6A 3GU6A 3KK8A 3LM5A 4E6DA 3KRJA 4ZTMA 2ITPA 1FQ1B 3ORKA 4NCTC 2XEYA 4GT3A 4APCA 5EW9A 4U40A 3IW6A 3V3VA 4AW0A 4EL9A 3FQEA 2EXCX 2J5FA 3MYGA 2O8YA 1M7NA 4XG3A 4FE2A 1NVQA 2QG5A 2X7FA 4FTIA 4PNKA 2RFDA 3HV3A 5IMXA 3R7UA 2BFYA 3KULB 4GIIA 2CN5A 3R7IA 3TI1A 2W1EA 2GPHA 2Y7JA 1KV1A 3DBCA 4FMQA 5EHLA 1XBAA 3TUDA 3EZVA 1Y8YA 4C59A 5BVNA 5CZHA 3PSDA 3MBLA 5DT0A 4PRJA 3SW7A 4EOJA 4G3DA 2R0IA 4DFXE 4D0XA 2YM8A 2XJ2A 4FOCA 3V04A 3WE8A 2JBPA 4HYHA 4ZMEA 5LVNA 3O23A 5BYLA 4BZOA 3Q2MA 1PXMA 2XIXA 3MWUA 5JFSA 2CKOA 3KFAA 1YHSA 4XV2A 1H24A 3V5JA 4ACMA 4C4HA 3PXYA 3V51A 3ZO3A 4RFYA 2W1DA 3VNTA 4N0SA 4NKSA 4XRJA 1OPLA 3OT3A 3S0OA 4C37A 3QC4A 5KHXA 2Z60A 3EHAA 2ERZE 3CKWA 4L00A 2WGJA 3PRFA 4XG9A 4YZNA 3QRJA 4ZJJA 3RPYA 3UPZA 4RIYA 4DH1A 3F3TA 2E9OA 2UZLA 1GIHA 5I9UA 5I9XA 4F7JA 1L8TA 2YJRA 4HYSA 5CF4A 2I0HA 2XKDA 3REPA 4LUEA 2FH9A 2H34A 2W1FA 4ITJA 3TV6A 1HOWA 3DDPA 2GQRA 4CNHA 2A27A 5F1ZA 2C47A 3CTHA 5DBXA 4RIWB 2JKQA 5FQDC 3CS9A 3RHKA 4AS0A 4EWHA 2C0OA 4RX8A 4FT0A 3TIYA 4G5JA 5ANDA 1F3MC 2VAGA 4WNKA 2W0JA 2V55A 1KOAA 4RFMA 4TY1A 5HLPA 3MV5A 3N51A 4FKGA 5TR6A 4EH9A 3BIZA 3SVVA 5CF8A 1PMNA 1OKYA 2B9IA 2X7GA 3KXZA 3UIUA 3QTSA 4K6ZA 4PDOA 3D7ZA 4X3JA 4CT2A 5CLPA 1XKKA 2PTKA 3NSZA 4TYEA 4B99A 5EOLA 2E9UA 4LL0A 5ICPA 4MH7A 5D11A 4AOJA 2WQNA 4I23A 2C5NA 2CKQA 1IR3A 3BHUA 4UBAA 1H00A 4N4SA 3AGMA 3ZTXA 2UZVA 3QCYA 3GOKA 4YZDA 3RWPA 3ID6C 2CHLA 2XJ0A 3FY2A 4TRLA 2IW9A 1A9UA 1YXXA 2J50A 4IAIA 5DHJA 1CM8A 2HENA 2VTHA 5C4LA 3F3VA 4ZTQA 1GZ8A 2A19B 2YITA 4FKJA 3PJ1A 5EYMA 4TL0A 1SVHA 2OXDA 1U54B 2C0IA 4B0GA 2VO7A 3K3JA 3G0FA 2VTSA 3VUMA 3QRKA 4HZSA 5AM6A 4ANSA 1OL1A 4K33A 5AR2A 2BTSA 1Z9XA 2VTTA 3CTJA 4DT8A 1PXKA 4QOXA 1BKXA 4S2ZA 1KV2A 2QR8A 3MSSA 2F4JA 4YSMA 4C57A 4CRLA 4F65A 3ZC5A 4FICA 4JNWA 3MPMA 3UZPA 2UZDA 3KCFA 3DTWA 4EZ5A 3BKBA 3UVRA 3NUUA 4W4XA 3HV7A 4W9WA 3A8WA 1PYXA 4KD1A 2IG7A 3GU8A 2QR7A 3CD8A 4YTCA 4NYEA 3BBTB 4CEGA 2ZV8A 4X0MA 4IM0A 4BB4A 1MRYA 2C0TA 2BHHA 4G3EA 2W1ZA 3GP0A 3OC1A 4L67A 5H9BA 5CAVA 3A7FA 3DY7A 1G5SA 2GNFA 4FT7A 4FL1A 5I3OA 3IW8A 2QURA 2UV2A 2HW6A 2R3OA 1PF8A 1FMOE 2SRCA 4FV3A 4L45A 4AUAA 4O82A 4WUNA 3NYNA 3QTXA 3JR1A 4KIKB 3GENA 1VYWA 2GHLA 5F20A 3VRYA 2C3LA 5JN2A 4GUEA 5IEXA 4F63A 4AFJA 4I0SA 4KBAA 4UYAA 1YOLA 3UIBA 3AC2A 1OIYA 4RJ4A 4R78A 2PVFA 5C4KA 3MDYA 5FEQA 5EW8A 2W4OA 4I4FA 2H6DA 2HW7A 3EQFA 4M13A 4FSZA 4YJNA 4DFLA 3RPRA 1YI6A 3ZU7A 4IDVA 1UU3A 2O63A 3QTRA 3QLGA 4O7WA 5CSVA 5JFXA 3AD4A 2GTMA 2C1AA 3L1SA 4I6QA 3VQHA 3TTJA 4BIDA 3ODZX 4FSMA 3CSVA 4HVGA 3LAUA 3RZFA 3W2CA 4O81A 4YC8A 3E8NA 3BELA 4NM7A 3W10A 5KMLA 4ZLOA 4C3PA 3QLFA 1SMHA 3OOMA 4RLLA 2PMIA 2UZWE 4ZMFA 1V0BA 2WOTA 4KBKA 4BWPA 4CSVA 1J7LA 2HCKA 1PY5A 2VTJA 3NX8A 3F61A 5AAGA 3ZLWA 4ZJIA 3LFAA 2JBOA 2W5BA 5CWZA 3BX5A 4O7ZA 2JDRA 3LCTA 3LMGA 1ZZLA 3MY1A 2FSMX 2YIXA 3WF5A 5CAUA 5I3RA 5BVFA 4IX6A 4U8ZA 4GJ2A 2BAJA 2G9XA 4XEYA 4IAKA 5JGDA 4M69A 3RWQA 2YEXA 4ZJVA 5I5ZA 1OB3A 3PLAE 3B2WA 4Q9SA 4CV9A 2PPQA 1SVGA 3MPAA 5B7VA 3ANRA 4LRJA 5D7AA 2J0KA 3PJ3A 5IISA 3DU8A 4JOAA 1IAJA 3GUBA 4WNOA 2RSVA 5EQYA 4JQ7A 5H2UA 2PVHA 2V5QA 3BGZA 4LUDA 1CKPA 2P4IA 2HXQA 3IK3A 4TYHB 3P7BA 3CJGA 4MWIA 4AE6A 3EN7A 1XH5A 2BVAA 4GL9A 3U6HA 5IQHA 4U79A 2BZKB 3O0GA 3IW4A 5GJFA 3VUDA 4PDYA 3CJFA 1OIRA 1R3CA 4XH6A 4Y83A 3QGWA 5FDXA 5CENA 3WYXA 1OL6A 4FIEA 2FVDA 4FV0A 5HGIA 3HP5A 2BAQA 1Q8ZA 3ROYA 3V5TA 2X2MA 4F7SA 5HIBA 1AD5A 2BR1A 4JVGA 3R00A 2OW3A 1KOBA 1YQJA 2W17A 2XB7A 3H9FA 4QYFA 3PSCA 3QYZA 1GIIA 4YJVA 1DAWA 4AQCA 4C2VA 4BI2A 3MVMA 3VS4A 1CKJA 4DFNA 3Q2JA 4XBRA 2UZNA 3KVWA 4IXPA 1JVPP 1PXIA 3UQFA 2X8EA 4PWNA 5M53A 5CNNA 5CVFA 1PKDA 3AQVA 2PY3A 4FC0A 2REIA 3OTUA 1YVJA 3CPBA 2BDWA 5KMKA 3U6IA 4MD9E 2ZYBA 4JI9A 4PNIA 3QFVA 3I7BA 4IBMA 3D94A 5HX8A 1QPJA 3ZCLA 3W2RA 4F9YA 4ZS0A 2F49A 4V0GA 1FGKA 4RIXA 5HQ0A 3NRMA 3G6HA 3UZRA 3BYMA 1Q8TA 2GNHA 3ENHA 3QYWA 4LOQA 4LV8A 2W1HA 4FIFA 2WU7A 4KBCA 4NWMA 3S2PA 3H10A 4ZTRA 4BCPA 1APME 4FTJA 2BIKB 4FSRA 2R5TA 2VO0A 3QRUA 4IX5A 4S34A 5E1EA 4M8TA 4P7EA 3ZONA 3LXNA 2R3JA 2XNPA 2YWPA 4YZCA 2YJSA 5E8YA 2XNMA 3OF0A 2WPAA 3RAKA 5FD2A 1NVRA 4MHAA 2X6EA 2Y8OA 4L01A 4PMPA 3FDNA 2V7AA 4KKGA 5AIKA 4IANA 4NFMA 1FOTA 3QL8A 4C33A 4LGHA 4GKHA 2OH4A 5HORA 5BUEA 3TXOA 1NA7A 1WZYA 4CFFA 3QTZA 3BLQA 3R0TA 2Y6MA 3VW6A 3PSBA 4YJPA 5H3QA 4KIPA 4O1PA 4F7NA 3DA6A 3AGLA 1LR4A 2VX3A 4G9RA 4BC6A 5K4JA 1JKTA 4JR3A 5AP6A 4CMUA 4GFMA 1K9AA 2G2IA 2OJIA 3NVMB 1O6LA 3WF6A 2X4ZA 3KMWA 4PPAA 5CI6A 1K3AA 5AX3A 4BGQA 5M4IA 3PY3A 3NUAA 5AP1A 4IB0A 2YERA 2ZM4A 3V01A 3WF8A 4ZS4A 5M07A 4F64A 4CQGA 4G3CA 3ZC6A 4CG8A 4PTEA 4IWPA 3D2KA 4DCAA 5JGBA 2XKFA 4FEXA 4JLCA 1PXOA 4CMOA 3IG7A 2CNUA 2JDOA 3CEKA 2IZRA 1H27A 3DJ5A 1YWVA 4L44A 1VZOA 3V5QA 3P7AA 2IO6A 2W5HA 4C2WA 5C1QB 3ATTA 2NRYA 2YCFA 4D2TA 2NO3A 4NM5A 1O6YA 4IADA 4IHPA 4FF8A 4J97A 2QOLA 2Y9QA 3Q53A 4AZFA 2HWPA 5E8SA 3SXSA 4RQVA 5ITAA 3PG1A 2IVSA 2VTPA 5AUWA 4TT7A 5DLSA 3QQFA 4CCUA 3UZTA 3PJ8A 5DT4A 2BILB 3MB6A 3MS9A 5AA9A 1Q41A 4MBLA 3LFQA 3R9NA 3GCVA 2HXLA 4AT4A 5ETAA 4LYNA 1S9IA 4IAFA 1HCLA 4AT5A 4CYIA 5CEMA 4AN2A 2VWYA 4F7LA 4I24A 1RQQA 2RIOA 3QD4A 3R9HA 2PVRA 3FKLA 4EK6A 1E1VA 3HL7A 2X1NA 4XV1A 4NJDA 3D5XA 3KC3A 5EM8A 5J7HA 4O0UA 4F99A 3F3ZA 5J87A 4OTQA 1U4DA 3U4WA 4CFNA 3NPCA 2J5EA 3PE1A 4C34A 4OW8A 5IEVA 1IA9A 2EVAA 2HZ0A 4PX6A 5H8EA 3WYYA 3ORTA 4UMQA 3R8PA 4UX9A 3PXKA 2OZAA 3LQ5A 3OEZA 4GK4A 5BUJA 4FSWA 4IJPA 3GU5A 3V5LA 3UP2A 4EQUA 3GQLA 3HRBA 4K9YA 3Q9ZA 4MXAA 3ZUTA 4IAZA 5IF1A 3SA0A 4OTDA 5HCZA 3QD3A 4E6CA 5HG7A 3EQHA 3T3UA 3RINA 3F69A 3AG9A 3MA6A 4AGCA 3Q32A 1MQ4A 2Y4IC 3FSKA 2WMAA 3V8TA 4FSYA 4XX9A 4TXCA 4EZ3A 5ETIA 3UPXA 3DQXA 3T9IA 4RA5A 3H9RA 2BKKA 3ZDIA 3OOGA 3QA0A 3KULA 1DI8A 2AUHA 3GFWA 4QMMA 5HE0A 4D28A 3CTQA 4O7TA 3ZYAA 3NUPA 1ZAOA 5LCJA 2P0CA 5E8XA 4DH5A 4PPCA 4QQJA 3PVUA 3DLZA 3OW4A 3U87A 4A9UA 2NNWB 4H3BA 4FTKA 2FYSA 5J95A 4RSSA 3GCSA 1J7IA 4U97A 5LVLA 2YDKA 4IQ6A 3ZHPC 3EH9A 4S33A 2B9JA 1BLXA 2ZDUA 4KRDA 2IPXA 4ZP5A 2W96B 3U6JA 3OWKA 2OGVA 3TN8A 3VF9A 4RZWA 2DS1A 3AC3A 3LM0A 3KXGA 4MWHA 4FV7A 4DN5A 3CKXA 3OY3A 4KABA 1Y57A 4BCIA 5FEDA 3ZFMA 5AR5A 4GIHA 5CY3A 2GSFA 2Z02A 3FZOA 4DA5A 5I0BA 3K5UA 3TV4A 2EB3A 5IZFA 4X2KA 3FZ1A 3R63A 4TKSA 1LPUA 4A07A 3OCGA 2ONLA 3NIEA 3NW6A 4KUJA 4EH5A 3KXMA 4UMTA 1ZARA 5E8WA 4OTFA 4NFNA 3F7ZA 1UWJA 4RIWA 4NM3A 4R77A 3EN5A 3ACKA 3OCSA 3VHKA 4BTJA 1TKIA 4FKVA 2B9HA 3MY0A 4F9AA 2WAJA 5EYKA 5ANOA 2Q0NA 2AC5A 2GS6A 2V7OA 3LFBA 1TQIA 1K2PA 3DQWA 1XBBA 1YOMA 2OKRA 2Y4IB 5IA3A 3EKNA 3MVLA 3VN9A 2IVVA 4FNYA 4NCTA 3VHEA 3C5UA 4D2VA 3F82A 3AXWA 4MBJA 3R8MA 4G6NA 5JFVA 4AE9A 5EYDA 3BV2A 3PVGA 5A9UA 4LMUA 5A3XA 4XRLA 4EH2A 3ALOA 3HKOA 3ZFYA 4ALUA 4ANNA 5M09A 3UBDA 4J71A 2F7ZE 3W8LA 2PZRA 4O7YA 2YM4A 3GOPA 5FXSA 3QQKA 5EQPA 3BCEA 4DH3A 4RJ6A 2B7AA 4ASEA 3RM6A 4CT1A 3PUPA 5M4CA 1ZY4A 2W05A 3CE3A 4FKPA 2J0MB 3R9OA 4ANMA 1BUHA 3R7EA 3MA3A 3SD0A 4R3RA 1JKLA 1U54A 3CR0A 2QONA 1XH4A 3OWPA 4M66A 4MNEB 2PUUA 4Z3VA 3KGAA 5JFWA 4RVKA 4J8MA 4WRSA 2OO8X 2VV9A 5IA1A 3R1NA 4DGLC 2CKPA 4YP8A 3HUCA 5F95A 4FEVA 2PZIA 2ITWA 1Y91A 5LMBA 2C6LA 4CRSA 4YHTA 3HMNA 4J95A 3TWJA 3FKNA 3UYTA 4ZOGA 2LAVA 2XRWA 4QMOA 2G1TA 5AJQA 2XK9A 3FMEA 4FTCA 5AAEA 4AFEA 4YPSA 2XCHA 2J4ZA 2ITZA 4QRCA 1V0PA 4QMPA 4I94A 2X9FA 3IECA 4XCUA 1PMVA 3VUKA 3AC1A 4XOZA 3GU4A 3EOCA 2X9EA 2BRHA 2G15A 1UNGA 5LMKC 3U55A 3ZSIA 3C1XA 4D9UA 3C4CA 3RHXA 5IEYA 3FLZA 1IRKA 4IVDA 3UO6A 1PKGA 4AACA 2R3FA 2B4SB 3JY0A 1YXTA 3RK9A 5M06A 1UU8A 4A4OA 3NUNA 4I20A 1O6KA 5BUIA 4AZEA 3DJ7A 2VGOA 5HG8A 4UMRA 1PRYA 3IS5A 3HGKA 5DT3A 3WZUA 2E9NA 3Q4TA 5HEZA 2VD5A 4JRVA 5AEPA 5LMAA 2GHGA 3VC4A 3MB7A 2XIZA 3EFWA 5B0XA 3R1SA 5C03A 3WE4A 4BTKA 2NP8A 4PP7A 3P0MA 2CSNA 4KSPA 5KCVA 5JEBA 4RX5A 3OROA 3OS3A 2XM9A 2JDVA 3QCSA 4BTMA 1YI3A 3NCZA 3ATSA 4Y8DA 4L3LA 3TZ8A 4FSQA 5CAQA 3GEQA 3Q9YA 3QZGA 4Y85A 4UXQA 4WT6A 4XLIA 3CY2A 3NNXA 2AC3A 1YHWA 3VS7A 5J1VA 3R30A 3SXRA 4FIGA 4CFXA 3OW3A 3WIGA 4YZMA 5M51A 1RW8A 4AZSA 3C7QA 3P86A 3NYOA 5LJJA 1XH8A 4YPDA 3A4OX 5M44A 3Q52A 5L8JA 4M67A 5DEYA 1ZY5A 3RNIA 5ANKA 3ZXTA 2R0UA 4ID7A 2C69A 3M2WA 4FG9A 4WIHA 3ZUVA 3DK7A 3SW4A 1H0WA 3C0HA 1WAKA 2OJJA 4IX3A 4Y46A 2OJGA 1VYZA 2ZV9A 4UYNA 4NU1A 4TYHA 3ZEWA 3FSFA 3ERKA 4DYMA 3O96A 3TKUA 4QMYA 4FEUA 5FXRA 3I5ZA 3OXZA 3I0OA 4AOIA 4CLJA 3HAVA 4FNWA 1OMWA 3KCKA 4FSUA 3PXZA 3F2RA 3A7JA 3LCDA 3Q6UA 4MXCA 2HK5A 4NSTA 3JS2A 3QZIA 4U42A 4KA3A 4QTAA 5GINE 1IEPA 4P4CA 3DAKA 1H1PA 3ZZWA 2BDJA 1YXSA 3TKHA 2CLXA 3QTQA 5HVYA 2ERKA 3TJDA 5IG1A 3BLHA 4MQ2A 4QP2A 5GNKA 2PZ5A 4EH7A 5A4TA 2CPKE 4ERWA 3L8XA 5H8GA 2YIQA 3C4FA 3WZJA 3QRIA 2YWVA 3FI4A 1FVVA 4ZK5A 3UG1A 4BICA 4FV2A 4JIKA 4YJQA 3QHWA 4R1VA 3F9NA 3BYSA 3NUXA 4AP7A 3W33A 3FLNC 4HVSA 4MXZA 2X7OA 3KF4A 5ETCA 4LGDA 3R83A 4XV3A 3VRZA 4BTFA 5JH6A 1URWA 4ZSAA 1ZLTA 4I41A 2VNYA 2WTVA 4U3ZA 2HY81 4ENXA 3DDQA 4QP9A 4O83A 5DIAA 4YJUA 4S30A 3NW7A 3O2MA 1PJKA 2XNOA 3PY0A 3DXNA 4FBXA 4FV9A 4LOPA 4ITHA 5DR6A 4BCKA 1OL5A 2CGVA 3F5GA 3KXHA 4JX7A 3SHEA 2H9VA 5DFPA 1FPUA 3DXPA 3VBXA 2C68A 4EKLA 4DBXA 4GT4A 4GSBA 1GZNA 2PMOX 4TN6A 4DHFA 5HE2A 2J6MA 1AQ1A 3U9NA 5B2LA 4IB3A 3QX4A 1YDRE 2DQ7X 4TNBA 5E9EA 1XO2B 3E87A 5AUYA 1ND4A 3HDNA 3R8LA 5DOSA 3VS5A 4DEEA 1CKIA 4USEA 4MF0A 3G90X 5AV0A 2R2PA 4EHZA 2RG6A 5HO6A 3SAYA 4HW7A 3M11A 3AT4A 2XJ1A 4CFVA 4M3QA 4FUXA 2HWOA 2QU5A 3V8SA 2WTIA 1J91A 4O0TA 2OF4A 2X81A 4YLLA 1YXUA 3SG8A 3AD6A 3VS6A 2BTRA 3UNZA 3BYVA 3PP1A 3UODA 3UQGA 4LL5A 3DNEA 3T3VA 3DAJA 3QTUA 4FVPA 2XEZA 1BI8A 4ANBA 2QOIA 3KL8A 2OWBA 5HE3A 4YZ9A 1Q61A 3EMGA 4H1MA 4I93A 3QHRA 2GNIA 2R3LA 4CZUA 5BMSA 4APPA 4BYJA 3A60A 2YAKA 4RPVA 4B6LA 4CFUA 4I0RA 5DEWA 3CC6A 1Q8YA 3II5A 2B55A 3WF9A 1H26A 3D5UA 4QYEA 2P33A 4MAOA 4D1XA 3GB2A 2C5YA 4J53A 2CGUA 3I4BA 4Q5HA 1MRVA 3L8PA 3DS6A 4YUQA 3PA3A 4WOVA 2X8IA 2ESMA 5FG8A 3HUBA 4ZTSA 3FLYA 3EFKA 2W9ZB 3ZH8A 2YM7A 3UC4A 3IW7A 4X2NA 3R01A 2YFXA 2Z7SA 4FKRA 3PZEA 3QF9A 1WVWA 3CIKA 2P3GX 3O7LB 4L9IA 4Y5QA 5HG5A 3R8ZA 4DINA 5M56A 4O7SA 3UIMA 5AR7A 3EQDA 4KB8A 1ERKA 3VUHA 2IN6A 4BGHA 3I1AA 3QUDA 4L46A 1S9JA 3KA0A 4LOOA 4M68A 5HX6A 5KKRC 2ITQA 5IQFA 4G9CA 4UWCA 3D0EA 3I60A 5DRBA 3QQLA 5FM3A 4IM2A 3RALA 4F08A 2R3GA 4DAWA 5B2MA 5CVGA 5IUIA 2WQOA 2IZSA 4FL2A 4IWDA 4OTGA 5D41A 4E73A 2VRXA 3TACA 2BDFA 2WEIA 2G2HA 3UC3A 4IZ7A 4Z7HA 5CU0A 4IMYA 3OY1A 5L8LA 3MH1A 4ASXA 4C3FA 4A4XA 3RI1A 3DGKA 4DE4A 1UV5A 3ZLXA 2IVTA 5K9IA 4NIFB 4TYGA 4WBBB 2UW9A 3K2LA 4ZTNA 4D9TA 3NMUF 2RFSA 1Q3WA 3OEFX 4KRCA 3BWFA 3G33A 4M0ZA 4XP3A 4EOIA 5GZ8A 2WFYA 5DRDA 5ANEA 2BRMA 2VU3A 4NJ3A 3PXQA 3FPQA 2JFMA 4HGEA 4JDIA 4D58A 1UVRA 1JLUE 4BDDA 4DGGA 3KRWA 5E8VA 3PPJA 2R3MA 1UKHA 4L68A 3BU5A 3QKLA 4RJ8A 3KXNA 5T6KA 1ZRZA 3RVGA 4X6RA 1OUKA 1XBCA 5HD7A 1RDQE 2PMNX 3B2TA 3DBDA 4YTHA 1WBOA 1LEZA 2OXXA 3FZPA 3PIZA 4PY1A 5E91A 4GKIA 3RAIA 1FBNA 3MH0A 4ZAUA 1SVEA 1VR2A 2VTRA 4FYOA 4JDKA 5TT7A 3TCPA 4ACCA 3BU3A 4JG7A 3PVBA 4FSTA 4DBNA 4Z7GA 4EK8A 4BZNA 3NZ0A 1OKWA 3QKKA 4DLIA 5FP6A 5EFQA 4CG9A 3QXOA 3H4JA 2UVXA 5IH5A 2JLDA 3KRRA 3QCQA 4D5KA 2EU9A 3EYGA 2XNEA 5IH4A 4RJ7A 4FV5A 3I5NA 2VGPA 3PFQA 1BL6A 1P5EA 4X2GA 4C36A 5KO1A 5KKRB 4NK9A 4E4LA 5IQIA 2O64A 1EH4A 5HOAA 4DT9A 4BKJA 4FKOA 4YO4A 4FIIA 2WEVA 4FSNA 4NT4A 4EQCA 4FIHA 3ANQA 3CPCA 2PYWA 5A4EA 5L2SA 3HRCA 2E2BA 4R5SA 3TNHA 5KMMA 5GIPE 4L8MA 5KMNA 3LMHA 4JJRA 4FIJA 5IQAA 5B2KA 3LZBA 4BRXA 1REKA 3PRIA 4F6WA 3MFUA 2HY0A 1H1QA 1OI9A 1KE8A 3RAHA 3A62A 4G3FA 4S31A 4CXAA 5A4CA 5AUUA 3KN5A 5JGAA 1H8FA 2X4FA 3GU7A 4IH8A 4EH3A 4L7SA 3R04A 2ITOA 2ETKA 2B0QA 4PL5A 3LKMA 4O0RA 4B7TA 3NWWA 4EH4A 4FV1A 4YC3A 4IB5A 3SGCA 4W9XA 5EK7A 2ZDTA 1CDKA 4L52A 4TWPA 2QC6A 4BCFA 4DG0E 1BYGA 2WTKC 4MTAA 4O86A 4LRKA 3GXLA 3FJQE 1Q62A 5KHWA 2ZVAA 3ZZEA 3EKKA 5HNGA 3DT1A 3KN6A 3BGQA 5JQ8A 2ITUA 4II5A 4QYYA 4O7LA 2B9FA 2UZEA 3UOLA 4XG6A 5TE0A 4AA4A 2JAMA 3G9NA 4DEGA 4AOTA 4GK2A 4JBQA 5ANJA 4HVDA 2EWAA 2VWIA 4PL4A 3LJ2A 5AWMA 2JFLA 1MRUA 4E4NA 5F94A 2A1AB 4J1RA 3ZEPA 4FA2A 4R3CA 2ZMDA 5CALA 4C4FA 4FTRA 4O91A 2GQGA 4YC6A 2WMRA 3PYYA 5IH6A 3D15A 5BVEA 4B4LA 5J79A 1TQPA 2VWZA 2QOCA 3MN3A 3ORIA 5DNRA 4DEAA 4DH7A 4EOKA 4CTCA 4MNEA 4IE9A 2YLEA 4M12A 2YISA 3ZDUA 4E3CA 1UA2A 3RMFA 4HPTE 1Z57A 3DXQA 2ZOQA 4ZSEA 3LQ8A 3DBQA 3E8DA 3MJ1A 4M0YA 5JRSA 4J98A 2PUIA 4L7FA 4K8AA 3GCPA 3TM0A 3JY9A 3QGYA 2VO3A 4GU6A 4RWIA 4ASDA 3C4EA 3E92A 4JQ8A 4G6OA 2BFXA 4D2PA 1GAGA 2I40A
chains in the Genus database with same CATH superfamily
5H8BA 4X3FC 3CP9A 3ULIA 4EOQA 4QMNA 4QP4A 3GC8A 3GNIB 5CTPA 5CEPA 3OWLA 5HVKA 5KBRA 4OAUC 1PMUA 4BCQA 4I22A 4EBWA 3HMIA 3UNJA 1M2PA 4EOPA 4ZZOA 3SOAA 4YHJA 4ZY4A 3OMVA 1XH6A 2XNBA 3RCDA 5L2WA 2WTKB 1B38A 1AGWA 4GFGA 1SNUA 4ANOA 3LJ0A 4UB7A 5AUXA 3F5UA 4E7WA 4D2WA 1P14A 3L9LA 3LFFA 2V0DA 3O7LD 3DKOA 4QMLA 5CAOA 3UOHA 4BHZA 4U7ZA 4R1YA 5HIEA 4OTWA 2ZB1A 3LQ3A 4HPUE 4NUSA 2PZPA 3PZHA 4XLVA 3VBWA 4AZTA 5BYYA 3CCNA 4BIEA 2CCIA 2Z7QA 5C9CA 2VUWA 2FUMA 5HLWA 2I6LA 3ZSHA 2PWLA 5CEOA 2OZOA 4LMNA 3W2OA 2CLQA 2HZ4A 3G9LX 4BKYA 5L3AA 5CSPA 2PVLA 2UZBA 2YDIA 4RFZA 2C6OA 5AM7A 4D2SA 5DI1A 2R9SA 4O1OA 1XHAA 3E62A 3FYJX 5D10A 3FHRA 3SG9A 3DJ6A 4RX7A 3CD3A 4PTCA 3NYVA 3G6GA 4FTTA 1UNLA 2W4KA 4AAYA 1ZYLA 2B53A 3NDMA 4OLIA 5DE2A 1YWNA 2VX0A 3JPVA 4KNBA 5FBNC 5AV3A 3DLSA 3TT0A 4EHEA 4XG8A 1Y8GA 4B9DA 4C3RA 5KUPA 2H96A 3MTFA 3DV3A 5FUTA 1XR1A 1UWHA 4UEUA 3R02A 1JQHA 4WKQA 3U8WA 3WIKA 3FMHA 4E6AA 1OKVA 3ET7A 4X3FB 3HVCA 5CS6A 2QOBA 4MVFA 1O9UA 2P2IA 4PDSA 1PXLA 3IPHA 5KMOA 5BVOA 2I7QA 3BPRA 4BFMA 4G34A 5LVPA 1CMKE 3M1SA 4FG7A 2C5XA 5KZ0A 3CQWA 2WZJA 3CQUA 2O3PA 5BVWA 3TNIA 5GZAA 3HLLA 4R5YA 3ELJA 5L8KA 3W2SA 3FHIA 4Y5HA 5LMKA 3W16A 1R0PA 5HZNA 3TTIA 4AZWA 4CLIA 4EOSA 3EQCA 2OU7A 4O7NA 5AIRA 3AKKA 5LWMA 4ITIA 4J99A 4FTMA 4EK5A 4DITA 2XBJA 3WI6A 5EYCA 1BL7A 3UIXA 4EUTA 2XA4A 3UQCA 1WBPA 1CTPE 5HCXA 4FGRA 4EHVA 3ENMA 1CSNA 3L8VA 3R7GA 3VF8A 3E8CA 2OH0E 3O51A 5CF5A 3FKOA 4AW5A 3TL8A 3BU6A 4E5BA 1YWRA 2GHMA 1H25A 2QOFA 2R7BA 3MGYA 2QO9A 4WA9A 2HELA 2PE2A 3WZDA 2CNQA 4KIOA 5EKOA 5FTQA 2XBAA 3RCJA 1Q97A 2WMWA 4TWNA 5CEIA 3A8XA 3EQPA 3LE6A 4BDFA 2BZJA 3RNYA 4R6VA 3WF7A 3U9CA 2ZM1A 1W98A 2C6MA 3D4QA 4YJTA 4G31A 3ODYX 4CKIA 1ZZ2A 3MY5A 1H01A 4LM5A 3HV4A 3PJCA 4C62A 4YJOA 4FT3A 4TNDA 3BYOA 4LI5A 1QPEA 2LGCA 5C8MA 2PULA 2ITYA 5C01A 3JUHA 4P2KA 3SRVB 3RBWA 1FINA 3FMJA 4F0FA 2YZAA 2QI8A 2C3IB 3ETAA 4AN3A 4RMZA 4QEBA 1REJA 4FVQA 4NZWB 5JZNA 2IJMA 4FK6A 4EYJA 1U5QA 5BNJA 3ACJA 4XBUA 4BI1A 3OD6X 3QAME 4FKWA 1P4FA 5L4QA 2QNJA 4DH8A 4AW1A 4P5QA 5LCKA 5E4HA 2WNTA 4BDGA 3R8UA 3QTIA 3GI3A 3B8RA 2FSTX 3GBZA 4CGAA 3NGAA 4UWBA 3R7VA 4E4MA 3IDBA 4EYMA 5K0XA 5LVMA 4DEBA 3H3CA 4EORA 1FVRA 1LEWA 4FV6A 1JNKA 2RG5A 2GQSA 4RGJA 4JG8A 2BUJA 4O0VA 3LHJA 3HMOA 4DEHA 4ZZMA 4OTHA 3ROCA 2UZUE 3BI6A 3DNDA 2J51A 3A7GA 3N9XA 3ZLYA 2BIYA 4BDAA 2DWBA 4EH8A 3JXWA 4YURA 5A6OA 1PXNA 2GNLA 2ITNA 4RWKA 4F70A 1OBGA 4R3PA 4W4WA 3R9DA 2OSCA 3QWJA 4FTNA 4JR7A 4AF3A 5IPJA 2BZHB 2QVSE 2CMWA 3THBA 3QTWA 4EJNA 4FTUA 3E88A 2GU8A 4X2FA 4D1SA 4IEBA 3VUTA 5A6NA 3IDCA 1W0XC 2UW4A 1WFCA 2NRUA 5CASA 2AYPA 3UJGA 4BKZA 4JL9A 3W55A 4WHZA 4MBIA 3O8UA 4F9WA 2WTJA 4FKSA 5BQ0A 5JT2A 2I0EA 3GCUA 4ZSJA 3PWDA 4DGMA 5KE0A 2WXVA 3AC5A 4XG2A 3BLRA 3KEXA 5F4NA 4FZ6A 5HKMA 3TUCA 3BEGA 4F1TA 4M7IA 4J8NA 3SV0A 2W5AA 3N4TA 2J7TA 3NLBA 4QMQA 5M08A 4M69B 4F1MA 4RVLA 3Q9WA 5AV4A 2XKEA 5D1JA 5GHVA 3EZRA 3DKGA 2RGPA 5DGZA 4C02A 4EH6A 3Q9XA 3ORMA 3GCQA 3F3UA 2C30A 2C3JA 4IAAA 3ZFXA 4HCVA 5E7RA 4GMYA 2QOKA 2RFNA 3UVQA 4LFIA 4CFMA 4FZAB 1ATPE 2A2AA 2WIHA 2W99B 4DGOA 3UO5A 3VW8A 3L9NA 3MH2A 3CXWA 5AP5A 5BYZA 3V5WA 3ZRLA 2PUNA 3OUNB 3ORNA 4XG4A 2UVYA 5AAFA 5A46A 4M97A 4DFBA 1B6CB 3FI2A 3OXTA 3D2IA 2J0JA 3E3PA 4EHGA 4C35A 1JKKA 2VWVA 5G1XA 5C26A 2WMSA 4ZLZA 2OBJA 3FLWA 3AT2A 4TW9A 3FXZA 1I44A 4QPMA 5KMIA 3COIA 5CAPA 4MEDA 4IFGA 5AUVA 1RJBA 4JS8A 4NIFA 3TJCA 2ZV7A 4DFZE 2OF2A 1YKRA 2OLCA 3VO3A 4BIBA 4EOMA 2W1GA 3D7TB 4LGGA 5M57A 5EI6A 5F9EA 2JEDA 4R7HA 2YZLA 2UVZA 2W1IA 3SXFA 4C4EA 3UOKA 2Q83A 3QX2A 3R2YA 2PZYA 3GQIA 3FMNA 4I3ZA 1OM1A 5EDRA 4BF2A 2VTQA 4MD7E 4I6LA 3FQSA 2F57A 4DTBA 3ZXZA 1NXKA 4BGGA 4H36A 3H9OA 4FTOA 5ANIA 3JVSA 1QL6A 4WSQA 3OG7A 1W82A 3RKBA 4EJ7A 2VTIA 2PVNA 4KIKA 5M4FA 1JBPE 3FY0A 4YBJA 4BN1A 5C8KA 1LUFA 1JAMA 4RIXB 4WG3A 3OVVA 2F2UA 3ZOSA 4RJ5A 3W0OA 2B52A 3GGFA 4FEWA 2RFEA 1JKSA 3I0QA 3QQHA 5HIDA 4NTSA 2VWXA 4EBVA 3QCXA 4F09A 2C6EA 4NW6A 2W1CA 3FI8A 3FL5A 1SNXA 4O4EA 2X0GA 4AGDA 1MUOA 2XK7A 2B1PA 5HI2A 3BLAA 1B39A 4ZTLA 4QTDA 3F88A 4V01A 4KAOA 3BE2A 3AMAA 4BCMA 3DOGA 4H39A 3O17A 3BQCA 3VS2A 4DFYA 4N70A 3TDWA 4Y73A 4BR3A 4JBPA 3Q96A 3IOKA 4X21A 4E93A 5J5SA 4AAAA 5IQGA 2JITA 3W0PA 3BE9A 4ZY5A 4BVUA 2HOGA 4Y95A 3R71A 4MNFA 5DG5A 4DGNA 2F9GA 4WD5A 4TYIA 1TQMA 4DG2E 2WB8A 3V8WA 3ZO1A 2BRBA 2WMXA 4MYGA 2JDTA 3NW5A 4GRBA 1WCCA 1BMKA 4S32A 3AMYA 3ORPA 4BWKA 3FYKX 4IX4A 4O6LA 4H1JA 3E93A 2UW6A 4WG4A 3EQIA 3TKIA 4QMSA 3LMIA 3BQRA 1XQZA 4F1OA 4ERKA 2R4BA 4NH1A 1IA8A 3OT8A 2BCJA 5HCYA 4G3GA 4D5HA 2BHEA 4ONAA 5IQCA 4KKHA 2QKRA 3DBFA 2JDSA 3MESA 1U5RA 3PVWA 4TTHB 2XKCA 2PE0A 3NR9A 4BWXA 2WQBA 3KB7A 2YM6A 4LV5A 1GNGA 3FQHA 4CTBA 5I9VA 5D7VA 1KUTA 4ORKA 5A4LA 5EDPA 4PUZA 1PHKA 5I9ZA 3A2CA 3LLAA 4GV1A 3SDJA 1DI9A 1BI7A 3C9WA 4C4IA 4DCEA 3MPTA 2CGWA 4UALA 4J52A 4A9SA 1NW1A 5E8TA 4DEIA 2J0IA 4ZSGA 3ITZA 3AKLA 1H1SA 5HU9A 3GVUA 4RZVA 4E6QA 3TG1A 1OL7A 4I6FA 2FO0A 5EM7A 3O71A 3NNUA 1NT2A 2IZTA 5FLFA 4EKKA 3NS9A 1R78A 4HGSA 3OXIA 4IZYA 3A4PA 3F2AA 4G2FA 4YMJA 1R39A 3K5VA 4FR4A 4K1BA 2WMQA 4W8EA 4A06A 2Z8CA 3LXLA 3VVHA 5CT0A 3P5KA 2GDOA 3ZUUA 3KIOC 2QD9A 5AR4A 3ZS5A 3BHYA 3LFCA 4U41A 5AR3A 3W2QA 4UN0C 5IA4A 5HO7A 4AW2A 5CNOA 3P78A 3D9VA 2I0YA 3IONA 3JYAA 1PXPA 4WRGA 4FVRA 3VJOA 2BPMA 4A9YA 4FTQA 4QTEA 3VULA 2FSOX 3V6RA 4I4EA 4UZHA 4ENYA 1H0VA 3C0GA 3DBEA 1WBTA 2RL5A 2VNWA 2WKMA 3FI3A 4MD8E 4MX9A 4RQKA 1W2DA 5GJGA 4CV8A 2J2IB 4AXDA 4RX9A 4BBMA 4TWOA 3D5VA 2PHKA 4ZXTA 4K11A 2XK4A 3KMMA 5CU6A 2C1BA 3P4KA 4HZRA 2QHMA 3KF7A 4EZ7A 3OTVA 2YIWA 4GU9A 2BMCA 3PXRA 3PE2A 4QMVA 4QD6A 5IA2A 4EK3A 4W4VA 3OZ6A 4QMZA 2CKEA 4YO6A 2WELA 1W83A 3ZLSA 4QP6A 4QQ5A 5IA5A 2P55A 3FV8A 3C5IA 3MFTA 4IW0A 1OKZA 2ZAZA 1M52A 4O2ZA 4LV7A 3FBVA 4Q2AA 4QMTA 3VBVA 3PTGA 2YCRA 3F3WA 4OTIA 3VS0A 4O0SA 2I1MA 3DFAA 5EDQA 3SC1A 1DAYA 4WSYA 3OBJA 2GS2A 3R7YA 2NPQA 3QKMA 1PXJA 4GG7A 4L3PA 4O6EA 1ZOEA 2R3PA 1SZMA 2CN8A 4FKTA 4HYIA 2OXYA 5L6OA 2ETMA 3KY2A 3HV5A 3OUKA 5AP2A 2XYNA 4HGLA 4ZEGA 5JZJA 4AT3A 3TUBA 3QZFA 4MKCA 2XUUA 3LJ1A 4FODA 3BL7A 4AQKA 4DFUA 2QKWB 2KTYA 2BRGA 3DCVA 1YRPA 3NUSA 3MTLA 1A06A 5IKWA 3WZEA 3PA4A 4G16A 3KRLA 4JQEA 5CEQA 3UG2A 4GCJA 3DK3A 4Z55A 3P5JC 3C13A 4UMPA 1JOWB 4D2RA 3VIDA 2E9PA 2QCSA 1V0OA 3OFMA 3O5AA 2PVYA 3OCBA 4I6HA 1BX6A 3NFGB 2EXEA 2C4GA 2XF0A 3PLSA 4C4GA 3EFLA 1STCE 4QP8A 4QYHA 1T46A 3NNWA 1WBVA 2Z2WA 2HYYA 4H05A 4EK4A 3UNKA 4X3FA 3R21A 4MK0A 4TZRA 4U81A 4AWIA 1JSVA 3RPOA 3QZHA 5IUHA 3Q4ZA 3ZM4A 3IW5A 5ACBC 3T8OA 2UZTA 4E5WA 4UMUA 4FX3A 2UW3A 2WQMA 3D5WA 5BX0A 1OITA 4NTTA 5BPYA 1WBWA 5LVOA 1OIUA 4IWQA 4ALWA 2R64A 3EIDA 3I6UA 4XYFA 3WILA 4EQMA 1M2QA 3LFEA 2YABA 3MIYA 3FEGA 3LFSA 2XM8A 1M2RA 4YHFA 4D4SA 3G15A 3MH3A 4XJ0A 3F66A 4G17A 4W8DA 1E1XA 2UW8A 5E8UA 1OZ1A 4NM0A 4PV0A 3RAWA 5EKNA 4USDA 4XP2A 2C5VA 1TFFA 3A7HA 2G2FA 2QOHA 3BZ3A 2OICA 3FMMA 3QBNA 4ZIMA 3VS1A 3GC0A 1G3NA 3HNGA 1ZYJA 1Z5MA 3AC4A 3NCGA 4N57A 3P9JA 4C4JA 1RE8A 4YGAA 2WHBA 2WIPA 3EN9A 3W32A 3SX9A 5EW3A 4GJ3A 3RGFA 4Z9LA 2YIYA 2QU6A 4YU2A 5JRQA 1J1CA 3EWHA 2C6DA 2PSQA 1XH9A 3BHHA 1WVYA 2YAAA 4F4PA 2F7XE 5BVKA 3Q3BA 4LDTA 1HCKA 2IEWA 1QPDA 1T45A 3FMDA 4FNXA 4IVCA 5CSXA 2PUPA 5I9WA 2GNGA 2XIYA 4FKIA 5HG9A 2YM5A 4C38A 5IU2A 3W2PA 4I0TA 4QTCA 4KSQA 4RVTA 3NUYA 2I0VA 3VBTA 4C7TA 3CLYA 4H3PA 1G8SA 5GZ9A 2O2UA 5HLNA 3D14A 4WNMA 4BCOA 3NFFB 2VWUA 4K0YA 5JQ5A 1ZMVA 2JKOA 4I5HA 3UP7A 4GUBA 4JG6A 2YA9A 3IQ7A 4KKEA 3SRVA 4O4DA 4CVAA 3O8TA 4M14A 4MQ1A 1UKIA 5EHOA 1V1KA 3IKAA 5HESA 2OIQA 4QQCA 4X7QA 3EYHA 2QOQA 4GYGA 5T68A 4TYJA 5AP4A 4CQEA 2WTDA 3R28A 3PA5A 5TOZA 4ZLYA 1Q8WA 2QODA 4K18A 1U46A 1ZWSA 5DN3A 1OGUA 2X2KA 4FYNA 2CGXA 2WTCA 3H0YA 3EQBA 4AXAA 3OBGA 4QMUA 3COMA 2PVKA 3MJ2A 4C8BA 3BEAA 4PQNA 3C0IA 3SLSA 5J1WA 2W06A 4IVBA 1GY3A 4W4YA 4HNIA 4FG8A 3W18A 4D0WA 5A4QA 5HTBA 2F2CB 2JC6A 4PMTA 3PUFC 4ALVA 3KMUA 5A14A 5L2IA 2PMLX 3QRTA 4FI1A 4NEUA 4RA4A 4B8MA 5LQFA 2X2LA 3BWJA 5CU4A 3R2BA 1F0QA 4ZZNA 4GVJA 4L3JA 4D4YA 1FGIA 2JGZA 3RPVA 3F5XA 3W8QA 3FZTA 3DKCA 4A7CA 4EC8A 3S1HA 2O65A 3QALE 4MXXA 2QO2A 3UOJA 4TWCA 2XS0A 3BL9A 3NVKI 1NY3A 2UW0A 3LCOA 5L2TA 2C5OA 3VUGA 5TO8A 3LFDA 4F0IA 4O84A 3LIJA 4P90A 3EB0A 4DTAA 1UU7A 2UW7A 4QNYA 1Q3DA 1Y6AA 2GTNA 2WQEA 1QMZA 4BCNA 3CGOA 4IWOA 3EJ1A 2QOOA 2W7XA 4R7BA 1XWSA 2VTMA 1ZOHA 5DPVA 2ZMCA 1QCFA 3POOA 4L6QA 5IDPA 4RG0A 3E8EA 4UWYA 3DKFA 2PU8A 1OUYA 4QPSA 3DK6A 5AX9A 3BV3A 3A7IA 4CYJA 2BROA 5CSHA 1KE9A 2V22A 1Q5KA 3ZBXA 1OIQA 2JIVA 3VUIA 4CCBA 3KK9A 2OI4X 4FTLA 3GT8A 4PL3A 2QLUA 5J8IA 1KSWA 5KZIA 5CF6A 5J9YA 4LQMA 2KULA 2O5KA 3OCTA 4WO5A 4MUQA 4RVMA 4GH2A 5AV1A 3G5DA 4C61A 4CZTA 2BALA 5K5NA 1FMKA 4Z16A 1VEBA 1P2AA 3DZOA 4F0GA 4JRNA 4ZTHA 1H1WA 4AU8A 5KX8A 5E8ZA 3PPKA 2H8HA 4HCTA 5BVDA 1KE6A 4KINA 3QXPA 1JWHA 3P23A 4H58A 5KNJA 2EB2A 4GG5A 4JIAA 3BHVA 4BL1A 4E8AA 2R3KA 5IDNA 2OIBA 4U5JA 5FTGA 4BHNA 4DEDA 4IFCA 1YDTE 3ALNA 1VJYA 3IOPA 4A9RA 4GT5A 2CCHA 4HNFA 4QO9A 4U3YA 3W0QA 3RK7A 3UE4A 5JSMA 1IG1A 4F6UA 1SM2A 5EM5A 1KE7A 3FUPA 4K2RA 4JBOA 2YDJA 2Z7RA 2ZM3A 3F7WA 5AADA 2JKMA 4KIQA 2RF9A 1A48A 4HYUA 5TKDA 3D7TA 2WOUA 4QQTA 3E64A 3BGPA 1OPJA 2XVDA 1W84A 4N6YA 2QG7A 4ANQA 4F9BA 4RWJA 2G01A 3QQUA 5HICA 3HZTA 5HHWA 4XG7A 4U9AA 4R8QA 5E90A 4GFOA 4V05A 2JIUA 5AFVA 1W2FA 1PMEA 2GS7A 2VWBA 4I5MA 5M4UA 3AOXA 2IW8A 4FK3A 2GCDA 4IC7A 1QPCA 5HVJA 3N4UA 3KXXA 3MVJA 4RJ3A 4ZSLA 3PP0A 3RPSA 2IWIA 4YNOA 2XNNA 4FNZA 4J96A 3G0EA 4L42A 4CKJA 1Q8UA 2V62A 5K0KA 4XUFA 3R8VA 1ZXEA 2CDZA 3KQ7A 5DWRA 4F6SA 4KS8A 2XARA 2FB8A 1GOLA 3FXWA 3QQJA 3EL7A 3BBWA 4O7VA 3VBYA 1PYEA 5DYJA 5HNIX 4PDPA 2BZIB 2W9FB 4RC2A 3WARA 1URCA 4DG3E 3UYSA 4M84A 4LG4A 2BKZA 3IGGA 3TEIA 5LOHA 4YTFA 1G8JA 3E3BX 4E20A 4PPBA 5JK3A 3UGCA 4RRVA 2VTAA 3I6WA 3POZA 4O0YA 4XHKB 4U44A 5HD4A 4C58A 5HBHA 4AXEA 5AA8A 1WBNA 3P79A 4EONA 1G8AA 4RIYB 4JT3A 3RJCA 3LCKA 1GZKA 4WBOA 3KRXA 3VS3A 3O8PA 4RLKA 1KE5A 3QWKA 4I6BA 3LOKA 4QP7A 3EQRA 4YR8A 1J1BA 2OFVA 2XMYA 4JBVA 1YOJA 3OHTA 4M15A 2HZNA 5G6VA 4FZ7A 2ZB0A 1WBSA 3HEGA 3ZRKA 2QHNA 4EUUA 2J0LA 4IVAA 4RC3A 5LWNA 3DZQA 1PW2A 2YN8A 1UNHA 1JSUA 1ZMUA 5CU2A 4DLJA 2XNGA 2C3KA 4J7BA 4BCGA 3CGFA 2R3QA 4QTBA 3COHA 2ZFYA 2PVMA 3MI9A 4AA0A 1M14A 2XH5A 4U45A 4FKUA 2HAKA 4NW5A 2QQ7A 2WMBA 2ETRA 4U0IA 3NEWA 5HBJA 4D1ZA 2ZV2A 3HECA 4CKRA 5AMNA 4YSJA 2C6TA 3I79A 3UMWA 2R3HA 2Y4PA 4OBPA 5FTOA 3EFJA 3FMKA 3VJNA 5E92A 3E7OA 4O21A 2OK1A 1LP4A 3A61A 3DFCB 1W7HA 3AT3A 4YLJA 2Y0AA 5CQUA 3SOCA 2ZJWA 2Y6OA 4RC4A 5EI2A 1GIJA 1DS5A 1J7UA 1XH7A 1UU9A 5FM2A 4B8LA 2O0UA 2DUVA 2QO7A 3BHTA 3LLTA 3Q5IA 3Q60A 4ACHA 3MFSA 5CI7A 4BDKA 3OWJA 2UZOA 3LPBA 3S4QA 2WU6A 5BMMA 3BYUA 3HAMA 3DPKA 5J9ZA 1U59A 3JVRA 3LXPA 2F7EE 3TZ9A 4E5AX 1H4LA 4PF4A 3N4VA 1ZMWA 4I5CA 1Q24A 4AZVA 3PPZA 2UUEA 4D4VA 3RP9A 2R7IA 1YI4A 4YBKA 1ZYDA 3FZRA 4GEOA 4DF3A 5IQEA 5FBOA 3FAAA 4DTKA 2VN9A 4OAVB 5EHYA 4D4RA 5I4NA 3R1QA 5FP5A 3ZM9A 2E9VA 2YIRA 3L9MA 4WUAA 1YXVA 5ANGA 4AGUA 5ETFA 1ST0A 3U54A 2DYLA 3IO7A 3DB8A 2XP2A 1I09A 2VZ6A 1H07A 3Q4UA 5CU3A 5EG3A 5FXQA 5GJDA 3FC2A 4Q5EA 2P2HA 3Q04A 1OVEA 2IZUA 4FT9A 4UY9A 1NVSA 3PJ2A 3CY3A 3AMBA 4HGTA 3NAXA 3C4ZA 4QMXA 4XMOA 4G5PA 3ZBFA 4FL3A 4HJOA 4O0XA 3FPMA 5AP0A 3TIZA 5K4IA 1ZOGA 2EXMA 3L9PA 3O50A 4U80A 4USFA 2EUFB 4GVAA 2YCSA 3NYXA 3LFNA 4OUCA 3SKCA 3ZO4A 3HA6A 5AV2A 3M42A 4Y72A 3C4XA 5HNBA 3COKA 5K5XA 5LXMA 3WZKA 4IAYA 4DDIA 1X8BA 3E63A 4FV4A 4IACA 5HE1A 1M7QA 3ZO2A 2GMXA 5C27A 3EN4A 4OT6A 3U51A 3D83A 4O96A 3P7CA 4BYIA 3UDTA 4WG5A 4YTIA 2ITVA 1GZOA 3R1YA 4O22A 5D9HA 4KWPA 5T3QA 4PMSA 5EI8A 4EEVA 2J90A 5L6WL 3K3IA 5DH3A 4EC9A 1ZYSA 4YNEA 1YW2A 2FSLX 3ML1A 4CFWA 1ST4A 3R73A 2R3RA 4UXLA 5CQWA 1WVXA 3QQGA 2PK9A 2VO6A 2YCQA 4L43A 3HV6A 4OTRA 4QYGA 5M55A 3QC9A 2GNJA 4O7RA 5AR8A 4BDHA 1OPKA 2W4JA 3QD0A 4GS6A 5EM6A 4CD0A 3S3IA 4E1ZA 3IDPA 3ZSGA 4FTAA 3LCSA 3UMXA 2XK6A 3HYHA 3KKVA 3VBQA 3HRFA 3QU0A 3LXKA 4O38A 4OBOA 3TZMA 3DB6A 4O4FA 4AA5A 4H3QA 4G6LA 1YDSE 2PE1A 2XK8A 3L8SA 4IM3A 2ACXA 3Q5ZA 4OTPA 3H0ZA 4NKAA 5CVHA 4BI0A 5HTIA 1KWPA 4BZDA 3QUEA 1L3RE 3TNWA 5CSWA 3E5AA 5CEKA 4AN9A 3U4UA 3FL4A 5AUZA 3BRBA 2XIKA 3LW0A 5CXZA 4NL0A 4ZY6A 4OT5A 3K54A 5L6PA 3F2NA 1H08A 5HO8A 3FLSA 2PVJA 4HOKA 2JD5A 4X6QC 3VWAA 4AGWA 3KVXA 5DR2A 4HVIA 2XCKA 3MFRA 5FRIA 1Q99A 4FOBA 4D55A 4AG8A 3P1AA 3R22A 4U43A 4X2JA 4QP1A 4RBLA 5E1SA 5ACKA 2CNVA 3UDSA 2CJMA 4O2PA 1M17A 5JKGA 4RT7A 2BRNA 2YACA 3IGOA 3RK5A 3VAPA 1DM2A 1JPAA 4Q9ZA 5IA0A 2OFUA 5GIOE 4FEQA 4QMWA 3A99A 2VTOA 3S95A 4QDVA 2XYUA 1FVTA 4V04A 5EH0A 2VWWA 2BAKA 4XNEA 4OBQA 3ULZA 1OBDA 5C8NA 4ACGA 5KMJA 3PDTA 3EN6A 4OR5A 2GFSA 1VLRA 2WMVA 3LVPA 2WMUA 2YLFA 4FZFB 5HU3A 3UVPA 1H1RA 1YHVA 2YM3A 3DTCA 3WBLA 3I81A 3DAEA 1F5QA 3GC7A 4XP0A 3HA8A 3W0MA 1ZYCA 3WOWA 1R0EA 3CQEA 3T9TA 5IQBA 2ITTA 2HIWA 3FXXA 2XIRA 3V6SA 3C4WA 4BJJB 3W1FA 2J9MA 2B54A 3UDBA 4V0GB 5DA3A 2WD1A 1Y6BA 3AD5A 4FKLA 2VTLA 5AP3A 3G2FA 3ORZA 2XANA 2YHVA 4U6RA 1OL2A 4O0WA 4MF1A 4C0TA 4IC8A 3QA8A 2OIDA 2GFCA 3FZSA 4JXFA 4YJRA 2VX1A 3EQGA 5A54A 3PY1A 4MCVA 4HVHA 4IDTA 3OP5A 5DR9A 4BDBA 4IZ5A 2XZSA 5JMSA 3VQUA 5HTCA 4OGRA 4I92A 4FZDB 5CX9A 2RKUA 2WMTA 4XV9A 2JKKA 4QP3A 4BDEA 4O27B 2C6KA 2X0OA 5FEEA 3RM7A 1TVOA 2WTWA 3R9RA 2HZIA 1OECA 3FMLA 3CBLA 4PMMA 4I1ZA 3C50A 4I5PA 5CT7A 3KU2A 3FE3A 4KS7A 2XK3A 2Q0BA 4IB1A 5FDPA 5D12A 5CZIA 5TF9A 2PL0A 4QNAA 5DVRA 2R3NA 3RTPA 3TV7A 2XRUA 4UV0A 2X8DA 5EOBA 4JDHA 3PG3A 3GFEA 4FV8A 4GYIA 3MW1A 4MXYA 5CYIA 3TZ7A 4EOLA 5EQEA 1XJDA 3E7VA 4JX3A 5DMZA 5J5TA 3HDMA 4IJ9A 2FGIA 3Q6WA 2IW6A 5CXHA 3R6XA 3TNPC 2JIIA 5IUGA 3B8QA 4IZAA 1WMKA 3ZMMA 3ZRMA 3R7OA 1IAHA 2X6DA 4FUYA 2QLQA 2OJ9A 3NIZA 4FT5A 4XS2A 5AP7A 2C6IA 4ACDA 4BBFA 5J9LA 5IQDA 1GJOA 3EL8A 4A4LA 4YZBA 2VTNA 4R7IA 1H28A 4ASZA 1Q4LA 4HCUA 5AUTA 5FGKA 4AX8A 1MP8A 4N6ZA 4BCJA 4BDCA 2X39A 4RWLA 4IIRA 5KBQA 4JAIA 3PXFA 2IVUA 3MIAA 4PP9A 4EOOA 4YLKA 2A4LA 3PWYA 4QT1A 2R3IA 3TDVA 4AXFA 3HX4A 3TNQB 2A0CX