5FTOA

Crystal structure of the alk kinase domain in complex with entrectinib
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
309
structure length
298
Chain Sequence
GPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of Entrectinib: A New 3-Aminoindazole as a Potent Anaplastic Lymphoma Kinase (Alk), C-Ros Oncogene 1 Kinase (Ros1), and Pan-Tropomyosin Receptor Kinases (Pan-Trks) Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 298
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ftoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ftoA01
4IFGA 5AR3A 3R7GA 3PA5A 5E8UA 1YDSE 5DVRA 3RI1A 5M56A 3QZIA 4HVHA 5D10A 3I6UA 4PQNA 5BMMA 1FOTA 2UW4A 2J7TA 4OTWA 3TZMA 4A07A 4QT1A 3R1YA 3RAWA 4RG0A 3LLTA 1XKKA 1GY3A 3WIGA 5HG8A 3PFQA 3JVRA 4F6UA 4NH1A 3PPZA 4PDPA 3OEFX 2X7OA 5L6OA 4W8EA 3MY1A 2WTKB 3PYYA 5L2SA 4YNEA 3DK3A 3ZFMA 4BTFA 2JLDA 4O7TA 5HNIX 3QA0A 2PVHA 1B6CB 1ZYJA 3BE2A 1RDQE 3ORMA 5AX3A 3ENHA 3PRIA 4RJ7A 3E8CA 4ZJIA 3NUPA 4PMPA 4I6HA 1F0QA 1HCKA 1I09A 3ORNA 2UZUE 2O5KA 3HRCA 1NVSA 3TWJA 4B0GA 5IQDA 4BRXA 1VYZA 1Y6AA 4CT2A 3QKMA 5EM7A 5K4IA 2R7BA 4O84A 3RNYA 4U80A 4OT5A 4O7ZA 1BX6A 4R78A 3OVVA 4YU2A 4XUFA 3S00A 4BY9E 3KXMA 3TTIA 4IX4A 2OJIA 4E5BA 4U8ZA 4U44A 4GVJA 4C38A 2CMWA 3NAYA 4RA4A 3IW5A 5IA5A 3W33A 4LUDA 4QNYA 5FM2A 2YIXA 2G2HA 4YZCA 5GINE 3ZU7A 4ANBA 5C9CA 4OTQA 3NYVA 2IZRA 4WBBB 3QZGA 4QQ5A 4BTMA 3LXPA 5DOSA 3QTIA 5CQWA 3VF8A 4O1PA 4A9TA 1H1RA 3ENMA 4HCUA 4QRCA 3DKGA 4RIWA 5BUIA 2WMWA 1T46A 3EQBA 3W8QA 2BVAA 3VBVA 1PW2A 2GU8A 4FSWA 3Q9YA 3WILA 4HYUA 4BWPA 5DH3A 3IGOA 4EUTA 2WMSA 2QHNA 1OBGA 4QMUA 2W5BA 1UNHA 4FTMA 3P1AA 3GOKA 3FLQA 4AS0A 3R22A 4V0GA 5CXHA 5FGKA 4NM0A 3EMGA 3HGKA 4V05A 4BIEA 4ZJVA 2R3OA 1BUHA 4N70A 4JR3A 3COKA 3C4EA 3R9HA 3F5XA 4MEDA 4CFFA 4S31A 4NYEA 4RIXB 4BDFA 4ONAA 4QTEA 4LGHA 1HCLA 3GGFA 2BDWA 4NEUA 2YACA 4O0YA 3ZO2A 5HD4A 3EL7A 4I0SA 3DPKA 5CNNA 2JFMA 3FEGA 3C4FA 5I5ZA 2JC6A 5M44A 4L00A 3V5WA 4A9YA 4AXAA 3BV3A 4AW5A 3Q5IA 1DI9A 5FBOA 3SAYA 3T3VA 3UIMA 2VTJA 3WZKA 2C5NA 2C1AA 2X7GA 3SKCA 4GSBA 4L9IA 1YWRA 4IX3A 4AG8A 5JKGA 2YEXA 1Q3WA 3F61A 3MH0A 4L45A 3JYAA 4UZDA 5E92A 4LV8A 3OY1A 4X0MA 4FKIA 4F9CA 5ACKA 4XLVA 5TO8A 4F7SA 2JD5A 2WEVA 2VTTA 3KRXA 5J95A 2PVYA 2ZV2A 1OKWA 2UZWE 1Q8YA 4FV7A 3DLZA 4FEQA 4IX5A 4IZAA 4CFVA 5G6VA 4ERWA 5KMKA 2PTKA 4FTNA 3WF6A 4U6RA 3DU8A 4QMOA 4B4LA 3JPVA 2PZ5A 5CF8A 3EN5A 3RNIA 1OL7A 4E6CA 4ZZOA 3G0FA 4NL0A 4AGUA 2XNGA 4IDVA 5L2QA 3M42A 4XG7A 1UVRA 2WAJA 3B8RA 3F2NA 3QZHA 4ANMA 2GHMA 3BLRA 4I4FA 3E8EA 2W1IA 5AEPA 3ANRA 4BWKA 1CSNA 1H01A 2BAJA 5A4TA 2WXVA 5KBQA 4D2PA 3DKOA 1OI9A 4EOSA 3EOCA 3HLLA 1BI7A 4YLJA 1FVVA 5A4QA 3A99A 4YPSA 4TL0A 4AZTA 4MD7E 1IAJA 4FTLA 5D9HA 3VBWA 3QQFA 2OK1A 5BPYA 2IVSA 4RSSA 3Q4UA 5HEZA 3S0OA 3OWPA 1YI6A 4G1WA 1W7HA 3QQGA 2Z7SA 3KREA 3WARA 2XVDA 2FUMA 3A61A 3Q96A 5J5TA 1J91A 3A8XA 5EDQA 3NUSA 1YOJA 2SRCA 4EH3A 4JG7A 4E5WA 3NEWA 2B4SB 4LRJA 3NUYA 4EK8A 4KRCA 1U4DA 4XBRA 4EBVA 3IOKA 4DE4A 1SVEA 3RHXA 5I3RA 4LM5A 4CMUA 2W1HA 2R0IA 2FGIA 2B55A 4ZMEA 2C5XA 4FTOA 2F9GA 4M0ZA 4AN3A 2FH9A 2CKOA 2WMQA 4UEUA 2YCQA 4UYAA 3GQLA 1OMWA 4OTIA 3TNQB 2ITVA 3HUBA 4WNOA 5HBHA 4MAOA 5IA3A 4FIFA 4DT9A 1Y8YA 4QP2A 2LAVA 1JSVA 3A4PA 3MB7A 5FG8A 3V6RA 3KRLA 3DY7A 4QMZA 1WVWA 1XWSA 4IWPA 4E8AA 1TQMA 2VU3A 3NUUA 1EH4A 4IVAA 3PXRA 4FGBA 4EOIA 1M7NA 2ITQA 3C9WA 3ODYX 1OKVA 3E64A 3F3TA 4JRNA 4X7QA 2VWYA 4EOLA 4RWIA 2XUUA 4I5MA 1FPUA 2IZUA 3CTHA 4G3EA 5IG1A 2PZPA 1H1PA 3LXKA 3HX4A 3ZRLA 5HU3A 2UVYA 3Q5ZA 3I60A 5AP2A 1OVEA 3EFLA 3QRTA 4Y5HA 4AACA 3LCSA 5EM5A 4O91A 5TR6A 4YJTA 3F3UA 3PWYA 2CN5A 2GQRA 1QPDA 2RF9A 3BE9A 4CXAA 3QRUA 4O7LA 2A19B 1STCE 2XJ1A 4ZTNA 2I1MA 3OS3A 5H2UA 3WF7A 4J52A 2Y7JA 3CKXA 4RGJA 3UGCA 3V51A 1JKSA 1FVRA 2X8EA 4GW8A 3VBXA 3BKBA 4ZY4A 3T8OA 1OM1A 2B53A 3W2OA 4M68A 3TUBA 3OZ6A 3KXZA 4E4MA 3OXIA 2VX0A 3DGKA 3HVCA 5D7VA 2I0VA 5K0KA 4RIXA 4FV3A 2B52A 4QYFA 4YJUA 1H4LA 1XQZA 2VTLA 5FEEA 3GOPA 4A7CA 2VX3A 4C4JA 4DC2A 4CEGA 3PA3A 3DQWA 4EZ7A 2JKMA 4LGGA 5HNBA 3FI2A 4BGGA 5AP7A 4IVCA 3R6XA 5K3YA 3BI6A 2C0OA 2HZIA 1TKIA 2OJFE 4HZRA 4OTRA 2X8IA 5ICPA 2VGPA 4G6LA 2BRHA 3RK9A 4L8MA 4FF8A 4YSMA 3GCQA 4CFNA 4IZ5A 1PY5A 2ZJWA 4C2VA 3E87A 4FYNA 4L44A 3R2BA 1U59A 3PSDA 3FQEA 2VX1A 3KK9A 2ITPA 4OTFA 5FBNC 5TE0A 3UBDA 2O8YA 4PP9A 4UX9A 3KVWA 3QD2B 4QPSA 4EOMA 1SM2A 1ZMWA 4FK6A 4WBOA 2WMRA 2OZAA 4R8QA 3ALOA 4YUQA 3UPZA 3NWWA 4F09A 1A48A 5DI1A 4YJOA 1UWHA 3QTUA 4FZDB 4UMUA 4FVRA 3MVHA 5IDPA 5KX8A 3FY0A 3T9IA 2VWZA 2O2UA 4FKOA 5I4NA 3R7IA 3CTQA 3OW3A 2W96B 3RPYA 3QF9A 4MNFA 1KE7A 3HA8A 4U5JA 2ZOQA 4TNBA 4DGLC 4ZSGA 1IR3A 3FY2A 4I41A 4MQ2A 4RJ6A 3M1SA 1AD5A 3COIA 3E5AA 3TKHA 2HOGA 5CU0A 1PMNA 4TWOA 5DEYA 1OIRA 2X6EA 1WCCA 4BCKA 1QPJA 2VNYA 3G6GA 2DWBA 2UW9A 3TI1A 3OTUA 2XIZA 4JR7A 3OROA 5AP0A 5AP1A 4AOIA 1KV2A 4CFUA 5BVDA 3UVQA 4CCBA 4JBPA 5HGIA 2YCSA 4FKGA 4FTKA 2RG6A 4L3LA 1ZZLA 3K2LA 2YDKA 2XNNA 1R78A 4HGSA 5IDNA 2VWXA 4FGRA 5EQYA 5ANJA 3IW7A 2EWAA 2QCSA 4FT5A 5AP5A 5HICA 3F9NA 5AX9A 4RMZA 4C62A 5DNRA 2G2IA 5AAEA 5J7BA 5E8SA 5CI6A 1WBPA 1KE6A 2PVKA 4EJNA 3PVWA 1DAYA 4AZSA 3WBLA 5IQGA 3QUDA 1W0XC 3OCSA 2C6KA 4XV2A 4DEHA 2VTPA 4BYIA 4D4SA 1BL7A 3L9LA 3FHRA 2WPAA 3DDQA 2QOKA 5CAOA 3QC4A 1W8CA 3TDWA 4FNXA 2PVNA 2ZV7A 2IVUA 3D7TA 2JDTA 4LG4A 4YNOA 4I0RA 5HZNA 2J5EA 4WG3A 2XIKA 2BDJA 4Y85A 5JFXA 4WSYA 5TF9A 4D2VA 5GZAA 4U41A 4QD6A 4J8NA 1Q8TA 5IA1A 2BRBA 2E9PA 2YITA 4J71A 2RIOA 2J5FA 4U45A 4ERKA 1Q8UA 2JAMA 2P4IA 4M0YA 1B38A 3P86A 1SYKA 4DFUA 2BCJA 1FINA 1ZOEA 1Q5KA 3E62A 5FXSA 3BCEA 1RW8A 4JDJA 3ORLA 2X9EA 4DAWA 1R1WA 5DWRA 3VUGA 3ZLXA 2A2AA 3TNPC 3BRBA 4J1RA 2I7QA 4KNBA 3OBJA 3F2RA 5L2IA 3C13A 3KMMA 4HNIA 3UIBA 2FSOX 2DQ7X 3HDNA 4QOXA 5ETAA 3R7OA 5IH4A 4RJ8A 3AOXA 2ESMA 3N4TA 5A6NA 3M2WA 2R3NA 4ZSJA 4QMLA 5M09A 3QALE 5IUIA 3UNJA 2OBJA 3V3VA 4EC9A 2W06A 2CKPA 4AOJA 3ITZA 2R7IA 5AR8A 4KABA 5CAQA 3LQ5A 2ZM1A 3GCSA 3VS7A 4IM0A 2WMUA 4JXFA 3FE3A 4KIOA 3PSBA 2OIQA 4LMNA 2R3PA 3P0MA 4PDOA 2OFUA 5ANGA 1ERKA 4EBWA 2NP8A 5KE0A 3VWAA 4DF3A 4WG5A 2A4LA 2C3JA 4G9RA 4IWDA 4O81A 3K3IA 2YZLA 3U54A 4M13A 5AM6A 2A0CX 3VUMA 4JI9A 2JGZA 3VRYA 3TNWA 3A60A 1G5SA 3MFUA 4ZSEA 3HMPA 4C7TA 4OGRA 1URCA 5K5NA 3UVRA 4JDHA 1RQQA 3CR0A 2WMVA 1YWVA 3P7AA 4LL5A 5CT7A 5GHVA 5KBRA 3I6WA 4PX6A 3VW8A 3A7GA 4EHVA 3ZXZA 2OFVA 3RM6A 3FZPA 3I81A 3FZSA 5B2KA 3LM5A 3Q53A 1JSTA 4AU8A 4D2RA 4JRVA 3U6HA 3KXGA 5C4KA 4P4CA 2WU7A 4LYNA 3LPBA 3SC1A 4XMOA 2UZEA 4ARKA 4R3CA 2UW6A 3DAKA 3PE1A 5ITAA 4BL1A 4DEAA 2WMAA 3MYGA 3CEKA 4FV1A 1KWPA 4I6QA 1HOWA 4ANLA 2UZLA 5DEWA 1F3MC 4Q5EA 3ETAA 2CCIA 3FUPA 2XNEA 4IJPA 5EW9A 2YHVA 4GIHA 4F99A 2JKKA 3SX9A 4O0TA 4O7SA 3KVXA 1WAKA 3CIKA 3F5GA 3RPSA 4DFXE 2OF2A 4EEVA 3DBFA 2VRXA 5ANEA 1NXKA 1NW1A 5A46A 4CSVA 1IASA 3CQWA 3MJ2A 4P90A 5LVNA 4ACMA 4E4LA 1J7IA 1FMOE 4ZZNA 4IWQA 4Y46A 5EHYA 3AC3A 2BDFA 5I9UA 3CTJA 1OIQA 3ZEWA 2BILB 1OIUA 4RIYB 3RAHA 4WNKA 4ANNA 2R5TA 4MTAA 1OIYA 4FV9A 4IVBA 1PF8A 5EI6A 1BKXA 4NTTA 4ZTRA 2J90A 3IW6A 4AZWA 4M97A 2G15A 2W1CA 3CXWA 4FSQA 4KKGA 5C8MA 2ETKA 2WGJA 1Z5MA 4KBKA 4C34A 4IAKA 1KE9A 3N51A 4NK9A 3HRBA 3CC6A 1H27A 1CMKE 3ZEPA 3DS6A 4WKQA 4EUUA 1P5EA 4L52A 3SRVB 2BR1A 3AMYA 2J0LA 2FA2A 1J3HA 1WBTA 5IKWA 2VTNA 2Z60A 4ACCA 2PVFA 5EYDA 5KMJA 1Q61A 2DS1A 3CQEA 3DJ6A 2Z8CA 5HIDA 1UWJA 1S9IA 2R64A 3EQRA 4FBXA 3UZPA 2WTJA 2DYLA 2XNOA 3DBDA 3K54A 4HPTE 2E2BA 1OL6A 3GI3A 5GZ9A 3ZSGA 1SNXA 3I5ZA 4XLIA 5T6KA 5CEOA 2BFXA 3BELA 3GNIB 5FTGA 3FLSA 4UMTA 4XP0A 4APPA 4YZDA 3MTFA 3CY3A 4FKJA 3GU6A 3DK7A 4FL2A 4N4SA 2OGVA 4MXYA 4DT8A 3SXSA 5D12A 3QA8A 3DK6A 1ZXEA 2OG8A 4L7FA 3DB6A 3OWLA 2VO0A 3MA3A 4MF0A 3TG1A 4C58A 4QYHA 4FT3A 3ZC5A 3W2PA 5A54A 4CGAA 4YTHA 3NX8A 5BVFA 5FQDC 4AP7A 3EH9A 4Y72A 4USEA 4BGQA 5FWKK 3N9XA 1KE5A 4PTCA 4FV4A 5IPJA 4CVAA 1H00A 4YC8A 5HLNA 5HQ0A 2PU8A 3TTJA 3UG2A 3EFWA 3R7EA 4RWJA 3QRIA 1MRVA 2BUJA 3COMA 3OC1A 3EZRA 4I94A 4DLJA 3CD3A 2V0DA 4C37A 5CAVA 4AZFA 4FZFB 5BYLA 4CTBA 4EORA 4KINA 3RHKA 5AUXA 4MWHA 4O6EA 3VS4A 5B7VA 2VTMA 3LFSA 3BPRA 4IZYA 4BCMA 3R9DA 3FZ1A 3U51A 3OCBA 5AP3A 5T68A 4L43A 2GFSA 3ORIA 5IISA 2XK3A 5I0BA 2AC3A 2ZB0A 2FVDA 2H9VA 3MH3A 3ZTXA 3VUDA 1UA2A 1GZKA 4R7HA 3FHIA 5AUYA 3BWFA 4E73A 1R39A 2C47A 4CTCA 2O3PA 4BTJA 1JNKA 3RZFA 1OL5A 5E1EA 3DAJA 3GQIA 5HO8A 4D1ZA 2YIRA 2HELA 4NCTC 2BZKB 2W1ZA 2XK8A 3HYHA 3LW0A 5IMEA 3DLSA 4QYEA 2Z7LA 4I6FA 5CU3A 3ORTA 1U5RA 3KMWA 4O83A 4DEDA 4XRLA 3NR9A 4RC4A 4O0XA 4M69A 4AZVA 4HGEA 4FSMA 5DN3A 3L9MA 4DINA 3C5IA 1MRYA 5CYIA 2ITYA 2R3QA 1E1VA 4FKWA 4D28A 3R01A 4ZY5A 2VTQA 3G9LX 5CS6A 1MQBA 1GIJA 4O7VA 4C36A 2EXMA 3EYHA 4FKVA 5M06A 5IA0A 5BUJA 3KL8A 4FI1A 4XV3A 1SMHA 2XBAA 4IACA 2VWVA 2BMCA 4BCHA 4GK4A 4WD5A 1ZZ2A 3QTXA 5HBJA 4PRJA 1JKKA 4XOYA 3VQHA 1AGWA 2VGOA 4X2NA 3OF0A 4G34A 4O96A 3BZ3A 4CV8A 2B9IA 3OT3A 1BYGA 3TJDA 3ZOSA 3NMUF 4KSPA 1NT2A 2V7AA 2R3FA 2J51A 3P7BA 3MIYA 4AW0A 4KWPA 2CGWA 3O50A 4LGDA 5EYCA 3ROYA 4MF1A 2G1TA 2X1NA 3HECA 3MH1A 4U7ZA 2O64A 3W8LA 4AT3A 3U9NA 4BWXA 2WIHA 4C0TA 3C51A 2GHLA 3H9RA 1JQHA 3NYXA 5ETCA 4IXPA 1OL1A 3WE8A 4BDBA 2YM6A 4BGHA 3RBWA 3I7CA 4GYGA 4P5ZA 4DGMA 4EOOA 5LJJA 2XNMA 4CQEA 4E6AA 4QP3A 4AGWA 1WMKA 3PIZA 5EH0A 4GFMA 5DE2A 1PKGA 4IBMA 5EK7A 5J79A 2VO7A 3EQCA 2RGPA 1E1XA 4G6NA 3E3PA 2C6EA 3H0YA 4I4EA 4S34A 5E1SA 5AV3A 3VJOA 4A9UA 4D5KA 1GOLA 3D5VA 4PNIA 3VBQA 3QLFA 5EW3A 3PZHA 4TKSA 4O82A 5AUWA 3OUKA 1XH9A 4U81A 1KOAA 4RJ3A 4WT6A 3QGYA 3VC4A 2X7FA 4BHZA 5DMZA 2GFCA 5JSMA 2Q0BA 3GFEA 4NM7A 4AX8A 3FQSA 3D14A 2QO9A 3I4BA 5M55A 3MBLA 4EHGA 5AADA 1DI8A 3QTWA 1ZMUA 3FDNA 4JG8A 4MH7A 2YCRA 1CDKA 1L3RE 4UBAA 5J1WA 4E6DA 1P4OA 4FEXA 3ANQA 4D0XA 4B6LA 2C0IA 3W2RA 3I0QA 3LFAA 3QTQA 4F08A 5CQUA 5F20A 5IEVA 3QXPA 4MXOA 1Q41A 3H9FA 1CTPE 3A8WA 5LQFA 4TWPA 2E9VA 4N57A 4L46A 4BDJA 4E4NA 4QMNA 4PY1A 1YDRE 4WA9A 3CKWA 4ITJA 3OCTA 5CSVA 2QOLA 3O17A 1YOMA 4FSYA 5AV0A 4H3QA 3AT3A 5CVGA 3TEIA 4DH5A 4WRSA 5HD7A 3OMVA 3II5A 3ZFYA 2VTHA 3LIJA 2QC6A 2XM8A 4QNAA 4Y5QA 5D1JA 3G2FA 4W9XA 3SW7A 5JK3A 4JQ7A 4X3JA 5FD2A 3E8NA 5AAFA 2QHMA 2WQMA 5FXQA 2GPHA 1OPLA 4IE9A 4TYHA 2ETRA 1XH4A 3RZBA 4K33A 3G0EA 4MVFA 1XJDA 2OXYA 2X4FA 3ULIA 4GFOA 3UOLA 3TZ7A 5H8EA 4FE2A 1OUKA 4GT5A 3CP9A 4OLIA 3ZUTA 4I5CA 3BEGA 1W83A 4KKHA 3QUEA 3TKIA 5L8JA 5C1QB 4GMYA 4B9DA 1DS5A 3S95A 5GIPE 3GC0A 4D9TA 3KK8A 5GIOE 3QQUA 4YJNA 2X2KA 2QKWB 3ORZA 4IVDA 4DA5A 4PTEA 4GKHA 1UKHA 2PK9A 3IDCA 3KN6A 4M66A 4LI5A 3V5LA 3ZFXA 3VHKA 4EH4A 4XG3A 1GNGA 3QL8A 2IVTA 2F7EE 2ZV8A 3IQ7A 2O65A 5GJGA 4CQGA 5IQIA 4O1OA 3LFFA 3RGFA 1GIIA 3SXRA 3L1SA 3BU5A 2J2IB 3FL5A 3TUCA 1IG1A 4DGOA 4G3CA 4HCVA 4O0VA 3VBYA 4QTBA 3O0GA 4X2KA 3BGZA 4FG9A 1PJKA 3JY0A 4L42A 2XK9A 4GS6A 2F2UA 3PY0A 3R8MA 3BGPA 4EI4A 2UZTA 4F63A 2QR8A 3O96A 3ID6C 2WKMA 4ACDA 4GL9A 4DN5A 5HO6A 3OCGA 4KBAA 4UWYA 5IU2A 5L3AA 2BKKA 3QAME 5C26A 4W4VA 4XEYA 4FTAA 2Y8OA 2PZIA 5IUGA 3MFTA 5CZHA 4A4XA 4PDYA 2F4JA 3TZ8A 4WUAA 4FZAB 4EKLA 1JPAA 2J4ZA 4LRMA 1T45A 4RX9A 3FBVA 2BALA 4BN1A 5HO7A 2FSTX 2PVRA 4U97A 3AC5A 3QTZA 4OTDA 4O7YA 2W1FA 1UU8A 2XJ2A 4CYIA 2C6TA 3CPCA 2BKZA 4DEEA 3KF4A 4K1BA 4FZ6A 4PWNA 4F7NA 3R8VA 3LCDA 5CX9A 3ZUVA 2UZDA 4FV8A 2GTMA 4OTGA 2LGCA 4G16A 1O6LA 2ZDUA 3Q52A 5CENA 5JFVA 3MVJA 3QD3A 5M53A 4LUEA 3OP5A 4BHNA 3GBZA 3AC4A 4I6BA 4IB3A 5DR9A 3GVUA 1WVYA 5EG3A 1S9JA 4WNPA 2QURA 3TZ9A 3ZHPC 5LMBA 4TXCA 4FTUA 4DCAA 3EQHA 4GJ2A 2R2PA 1TQIA 2XP2A 4ZK5A 4Y73A 5E8VA 3ET7A 4NCTA 5FP5A 2ZM4A 3ZZEA 2YIQA 4FTJA 5AUTA 1Z57A 2X0GA 3H4JA 5JRQA 2YN8A 3FLNC 3FZTA 4F0GA 4JLCA 3PPJA 3DZQA 1ZWSA 4DITA 3EN7A 1X8BA 1CKIA 2HW6A 2JDOA 3EFKA 4FT9A 2BTRA 2HWOA 5HOAA 1M7QA 3TUDA 1J7LA 2OXDA 2R9SA 3FI8A 2C5OA 3H9OA 4UYNA 3DXQA 4ASEA 3D94A 4QMPA 3UC3A 2OJJA 4PDSA 3SG9A 3KKVA 3BYOA 4IB0A 4O0WA 2ZVAA 4GH2A 4EZ5A 4F65A 5CVFA 3R30A 4DH7A 3GCVA 4TYJA 3QC9A 2OZOA 3R8LA 4EKKA 3QHWA 4NIFB 2OI4X 2W7XA 2WNTA 3GXLA 4PPBA 4O7RA 5CWZA 1P2AA 4H3PA 3V5JA 3BEAA 4XRJA 3I5NA 4HVSA 4NKSA 5CZIA 5F1ZA 1FGKA 3TKUA 2G9XA 2EVAA 2OU7A 2HWPA 2WB8A 3C0HA 3NW5A 4M14A 1H08A 3E8DA 3WI6A 5I9ZA 5IEXA 5JN2A 2XRWA 1UU3A 1FBNA 1H1WA 5M4UA 4FKRA 4I20A 3BGQA 3LJ1A 3PXQA 4RQKA 1Q24A 3ORKA 4RVKA 1PHKA 3OHTA 2VWIA 2W4JA 5IA2A 3MPTA 5FEQA 3LCTA 3NZ0A 2UW3A 2VWBA 3DXNA 2XEZA 2VTSA 3ORXA 4CNHA 4N0SA 4MWIA 3VVHA 3VQUA 3GC9A 3NAXA 4TW9A 5GJFA 4BVUA 5L6PA 3K5UA 3KULB 1U46A 3UIXA 1PXNA 5DFPA 3AQVA 4MHAA 3NLBA 4APCA 4CV9A 2WZJA 4XV1A 3OFMA 4FV6A 3EQGA 1U54B 2H6DA 3VUIA 3SGCA 3MESA 3SOCA 5EQEA 1PMEA 5EDRA 4L67A 4H3BA 4EYJA 4DEBA 3PXKA 5AWMA 3R02A 5HVJA 3LHJA 3RP9A 2ITUA 4ZTSA 3V04A 2VWWA 4YLLA 1Y91A 3AD5A 4O0UA 4QP4A 4D2TA 3FMEA 3FLZA 4IDTA 2RFDA 2GSFA 3ZRMA 3TV7A 4XYFA 2R3HA 4NWMA 2WEIA 3ZM4A 5CANA 3ZLYA 2CLQA 3ZLSA 5KUPA 4E3CA 3R1NA 4HOKA 3W32A 4Y8DA 2W17A 2YDIA 4GT3A 5HCYA 3PXZA 4I5PA 3W18A 1OECA 5CEIA 1PKDA 4NJDA 5JQ5A 2XIYA 4MD8E 4HGLA 2YM7A 3O8UA 1OZ1A 4X21A 4IX6A 3FYKX 2QOCA 5CEMA 3HL7A 3GCPA 5KHWA 4FOCA 1LEWA 3IECA 3MA6A 3WF9A 4X2JA 4FKQA 4FTTA 2VTOA 4FKPA 3G5DA 3MWUA 3TXOA 3WYXA 2BAKA 1RE8A 4FYOA 1PRYA 4YZMA 2CKQA 5A3XA 5C8NA 4BCFA 4KIKB 4A4OA 1JSUA 1YXXA 4KIPA 5G1XA 5BVEA 4ZZMA 4HCTA 4GRBA 4IADA 4RJ5A 2QLQA 4WIHA 4AWIA 3H0ZA 3NYNA 4YZ9A 1P4FA 4BFMA 2XIXA 4II5A 3QWKA 4ID7A 2QONA 4IANA 3DFCB 3VNTA 1REKA 4S32A 4D0WA 5CF5A 5HESA 5M07A 5DT0A 3L8VA 4Z55A 4CLJA 1OKYA 3FZOA 2ITZA 2PMIA 3QU0A 2JBOA 4JBQA 1YWNA 4EH7A 1YXVA 4U43A 3G9NA 2YCFA 4EC8A 4JBVA 3QKLA 4ZS0A 4AT4A 1NVRA 2GCDA 4CKJA 4B8MA 2C68A 4ZY6A 2IW8A 4TY1A 2IW6A 1KV1A 4WSQA 4EH8A 4BCPA 4ZTLA 4ZLOA 2RFEA 4FV2A 4H1MA 1IEPA 4W4YA 2CSNA 4S33A 4ANOA 2F2CB 4F6SA 3G51A 5A4LA 1JAMA 2JBPA 3ELJA 3GU5A 3GU8A 4FKSA 3MW1A 3REPA 2XH5A 5KMNA 3PY1A 5IQHA 3AD4A 1Y8GA 2PPQA 2XM9A 5HTCA 4DFLA 4K8AA 2QU6A 4WHZA 2VTIA 3BYMA 3FJQE 3PP0A 3EKNA 3NNXA 4XCUA 5KZIA 4YTFA 2C3KA 2JKQA 1UU9A 3QCQA 3C4CA 4I23A 4X2FA 3KQ7A 2GS6A 3OG7A 4EK3A 3NNWA 5LMKC 3C4ZA 4G17A 4QMWA 3FI3A 5LOHA 1Q99A 3JY9A 2P3GX 4AW2A 2YWVA 2R3JA 1GZOA 4YBJA 3MY0A 1Q4LA 5CSXA 1YI3A 3A2CA 3U55A 4O0SA 3Q9ZA 3Q2MA 4U0IA 2W4OA 2XCHA 3KN5A 4IAIA 4GU9A 2XK7A 4IW0A 4CMTA 4IAFA 1M2PA 4FX3A 1WBSA 4FIIA 4JJRA 4XH6A 5EI8A 4DG3E 4USDA 3D4QA 2IVVA 1MP8A 3F66A 5DT3A 4I93A 5HBEA 5LMAA 3VRZA 3WOWA 3HUCA 5HLPA 5IQCA 2DUVA 5AM7A 4YZBA 4HW7A 4BB4A 5BVKA 3MIAA 2VN9A 1VYWA 2OJ9A 3GC8A 3H30A 3W2CA 4J98A 4C4GA 2Q83A 4OW8A 2HY81 5T3QA 4IFCA 3GB2A 4RC3A 3F3WA 4WUNA 5AAGA 2X2LA 4H39A 3FPQA 2W05A 4HVGA 5DIAA 2R4BA 1LR4A 2W5HA 1ZY4A 2F49A 4UXQA 5CLPA 3KULA 4I24A 4R1VA 1XH6A 1VEBA 5HIEA 2RFSA 3KCKA 1YXUA 1NA7A 1UNGA 2ITWA 2C6DA 1U54A 2UW5A 2XJ0A 4TNDA 2Y9QA 3DV3A 4I21A 1G8SA 3V01A 3QX4A 3HEGA 4IC8A 4TWCA 2VZ6A 5AR4A 2CNQA 3I0OA 3L9PA 3SV0A 3D7ZA 3OWJA 3PJCA 4GK3A 2GNJA 5E8YA 1WFCA 4JX7A 3ZONA 1WVXA 5B2LA 1E9HA 3P79A 1H8FA 2YJSA 5IEYA 3LXLA 2E9UA 3LFEA 1QPEA 3SXFA 3ZZWA 5I9VA 4IB1A 2JIUA 4RWKA 5KMMA 5M4IA 4BR3A 2VO6A 1YHSA 4F0IA 2W5AA 2WOUA 2FSMX 2YIYA 5EYKA 4PPCA 4EHZA 1H1QA 3AXWA 5GZ8A 4QO9A 4JDIA 3LCKA 4J99A 2FYSA 3FKLA 3NW6A 3CSVA 1V0PA 4ZTHA 3PY3A 3NSZA 3WF8A 3HP5A 5AUUA 2W0JA 3UJGA 4W4XA 4Z3VA 2OSCA 2QOBA 4FVQA 4UMPA 5AIKA 5AR7A 4NT4A 3PA4A 4R6VA 2BZIB 5C03A 3QTRA 3AT2A 2Y4PA 3UTOA 5A6OA 3PWDA 4LOOA 5EHOA 2IW9A 4FV0A 4WG4A 5J9LA 4JT3A 4JIKA 3NCGA 2WHBA 1DAWA 3NW7A 5I9XA 2R3GA 2X2MA 3N4VA 5J5SA 4W4WA 4KRDA 4P5QA 4QP7A 3U4UA 4XG6A 1MQ4A 2JKOA 1XHAA 5I3OA 3QKKA 4XP3A 4F1OA 4C4FA 2GMXA 5GJDA 1ZMVA 3FXWA 3QCSA 4M7IA 4F9WA 2O0UA 4L6QA 3PVGA 3FZRA 3BIZA 1UV5A 3FL4A 2ETMA 1MRUA 3KB7A 2OXXA 4FG8A 4FV5A 4J7BA 2XS0A 3SD0A 2FO0A 4NUSA 2A27A 2P33A 4M15A 1OGUA 3O71A 4XOZA 3O2MA 3UE4A 4XJ0A 5IH6A 3LMHA 5FTQA 3JVSA 3VS0A 4Z7GA 4FNWA 4QMVA 1ZOHA 3BU3A 4H1JA 3BHHA 5TT7A 3IOPA 2QOHA 1V1KA 4JVGA 4O38A 3ZO4A 3P08A 4OTHA 4C8BA 2IJMA 3OT8A 4F9BA 5LWNA 5ANIA 3EKKA 2UZNA 2YAAA 3M11A 3HZTA 5EDPA 4D2WA 5JGBA 4HJOA 2HW7A 4O2PA 2V62A 2WQEA 2YDJA 4UZHA 2C6LA 4ZOGA 4IQ6A 3G15A 3UP7A 1ZYDA 3KRRA 4EL9A 3BHUA 4GG5A 5LVMA 2GNFA 3VS1A 3HMNA 4AGDA 2C6IA 2YM5A 3NDMA 3PLAE 1APME 3COHA 4JIAA 4KIQA 3D5WA 3DQXA 4MBJA 3CE3A 2XNPA 2HAKA 5A4EA 3KFAA 3ZLWA 3NUAA 5AA8A 2YISA 5HIBA 4ACHA 4BDIA 4BKZA 4YURA 4HPUE 4NTSA 4GT4A 4DCEA 2QG7A 3OTVA 4CFWA 1M52A 1F5QA 4TN6A 3HMOA 4BF2A 3E7OA 3A62A 2Y6OA 4OBQA 4P2KA 4F9AA 5K9IA 2W1GA 3V8TA 3FMKA 4L53A 4RX8A 2BZJA 3AMAA 4UXLA 2XKEA 2RSVA 5M51A 1ZYCA 2NPQA 4UWCA 2V22A 2CDZA 3S4QA 3FWQA 4R3PA 4AE6A 2BRNA 2BHEA 3QXOA 4RC2A 4RZWA 3R0TA 3L8SA 4EJ7A 4KD1A 3A7IA 3AG9A 1ZYLA 3FAAA 4MD9E 3EL8A 4FSZA 3ZSHA 4RZVA 2I0HA 4E5AX 3JR1A 3UIUA 2WO6A 2C69A 2WFYA 4DLIA 2BPMA 4YJRA 3UPXA 4GG7A 3R63A 4C2WA 2Y6MA 5FDPA 5F94A 4YJSA 2QLUA 3MSSA 3FC2A 4K2RA 4IEBA 2JIVA 4R5SA 5AJQA 1KE8A 4RVLA 5DRDA 2OO8X 4RFZA 5DR2A 4F4PA 2YZAA 5AMNA 5HE3A 3T3UA 3H3CA 3DT1A 5AR5A 3UG1A 4C59A 4QQJA 1Q3DA 1R0EA 3AC8A 4M8TA 3F7WA 3R00A 1YVJA 4NZWB 5ETIA 4Z7HA 1UNLA 4YJVA 1M2RA 2JDSA 3FC1X 5CU4A 4FTCA 2ZMCA 4A9SA 3PIXA 2OICA 2PZYA 3HP2A 4DH8A 2PZRA 3IW8A 1H26A 4XNEA 2XYUA 3BWJA 5KZ0A 5GNKA 3SHEA 2PMLX 3I79A 4C4IA 5BX0A 3RTPA 5FEDA 4B8LA 5BVWA 2OH0E 5CEQA 4FIJA 4K6ZA 4IAYA 3C4XA 5AP4A 2IO6A 5BYYA 4RFYA 2J0MB 1KUTA 4FEUA 3O8TA 5LMKA 3BBTB 2I0YA 3DDPA 3R21A 3HDMA 4K11A 3NVMB 3W10A 1IA9A 4O7NA 5JRSA 4CT1A 4E6QA 1PXPA 4JDKA 2HZ0A 3FMDA 3ZO3A 4G6OA 2ITNA 2XZSA 3ZMMA 5JGAA 4FSTA 3L9NA 4RIWB 4IC7A 4ZSLA 3PJ8A 4FODA 5FTOA 1YI4A 5IMXA 4QYGA 3OBGA 5E8WA 2W9FB 2UW0A 3DBCA 4GK2A 3PJ2A 3UVPA 4EK6A 3FMMA 4AN9A 4FSUA 3EQIA 4HGTA 4CCUA 4PP7A 2YERA 3DKFA 3R8PA 2X6DA 5H3QA 1XR1A 3GENA 3AMBA 2UZBA 4AN2A 4O0RA 3EZVA 3FSFA 3ZO1A 5HE0A 2B9JA 4RWLA 3WZUA 4TYEA 2BZHB 1ND4A 2I0EA 4V01A 2BTSA 3RKBA 1Y6BA 3RPRA 4ANSA 5C27A 4YR8A 1A9UA 5AUVA 4FTIA 4BTKA 2PHKA 5L8LA 3R9RA 4DYMA 5DA3A 2E9NA 1QL6A 4PUZA 5J87A 4FKLA 3WIKA 2X4ZA 4P7EA 1SZMA 5L4QA 3UNKA 3P9JA 3V5PA 3F2AA 3DNDA 4E1ZA 4IHPA 4C02A 4G31A 2P55A 1LEZA 2R3LA 2UVZA 3D15A 3LAUA 5LVLA 4EWHA 2VWUA 4C57A 4QQCA 5HU9A 4RT7A 2HXLA 2V55A 1OKZA 4J95A 4AA0A 3PE2A 4EOPA 5IQEA 3QQKA 3RCDA 5HI2A 1YXTA 4A4LA 4X6QC 4RIYA 3C0GA 4EYMA 3POOA 2PE2A 4QP1A 4DFBA 2UZOA 3BQRA 3ZBFA 3MGYA 1H0WA 4CZTA 3HNGA 5CNOA 4ZMFA 3R2YA 4GKIA 3EJ1A 5BVOA 4XG4A 2HYYA 2YJRA 2B9FA 2ZMDA 3QCYA 3VS3A 3SOAA 3WZDA 4BDEA 5CAPA 2WIPA 4PMTA 4KKEA 4KSQA 3SRVA 5KNJA 4PL5A 3TNIA 3FKNA 4G9CA 4IMYA 4YBKA 4EONA 4BI2A 1FQ1B 5HG5A 4ZTQA 1B39A 4ANQA 2C5VA 3CS9A 2PWLA 4RVTA 5EI2A 5KO1A 5D41A 2W1DA 4RX7A 4YGAA 4CRLA 4C3PA 5M57A 5CTPA 4EZ3A 4S2ZA 3DNEA 3VUKA 3SA0A 3LM0A 4WNMA 3PG3A 4N6ZA 3RWQA 3B8QA 3EN6A 1BI8A 4BBMA 3FLWA 1R3CA 2YM4A 2BHHA 5AV2A 2R3KA 4A06A 3RVGA 5CF4A 3PVUA 2XK4A 3WYYA 2CJMA 4FOBA 2JITA 4KUJA 4O2ZA 3RWPA 4ZJJA 3R04A 2Z2WA 3U6IA 5BNJA 4I1ZA 4Y83A 3UYTA 1XBBA 4TYGA 2IN6A 1CKPA 4NFMA 3LQ8A 4BZOA 4CYJA 4ZSAA 5HHWA 4YHFA 3ATTA 2HK5A 4F1TA 3D0EA 4XS2A 3FXXA 5DG5A 2C4GA 4YHTA 4QMTA 3R1QA 3W16A 1XH7A 3IGGA 3PG1A 4ZTMA 5J1VA 2XRUA 5BVNA 4FEVA 4E7WA 1ZRZA 3OOGA 3PUPA 4XG9A 4O86A 3BLQA 2UZVA 5ACBC 3QYZA 4FZ7A 2W4KA 4MBLA 1PXKA 2R0UA 2R3MA 2UW7A 3Q32A 4FKUA 2IG7A 1PXLA 4ZS4A 2PY3A 2QNJA 4RBLA 4BDAA 1PXMA 5FM3A 5HTBA 4QP8A 3PXFA 2QO2A 4EK4A 1H0VA 3ODZX 3SG8A 4ALWA 3UQGA 3DTWA 4Q9SA 3E88A 3RINA 4TYIA 2J0JA 2QVSE 3R9OA 4X2GA 3CY2A 3D2KA 4PPAA 2WMTA 3QZFA 2OW3A 4BC6A 5JEBA 4MX9A 1H28A 5H8BA 3MH2A 3F5UA 1PXJA 5K5XA 2VD5A 4U40A 3LQ3A 4Z9LA 4JQ8A 5KCVA 4BIBA 2XK6A 4WRGA 5B0XA 3G90X 3FV8A 3U6JA 4CG8A 4AZEA 2KULA 1O6YA 2YAKA 3EQFA 4KAOA 3ULZA 2CN8A 4CKRA 2QR7A 2BFYA 2PUUA 4AOTA 1W82A 3OXTA 5EM6A 3LFNA 3THBA 5J9YA 3B2WA 4GFGA 3OEZA 5CF6A 1SNUA 1P14A 3TT0A 4JBOA 3ZBXA 3RAIA 3R71A 3FMLA 5JT2A 4DH1A 4XP2A 2IPXA 3VUTA 3V5QA 3R7YA 3KCFA 4UMQA 1XBCA 4FUYA 4CKIA 1O9UA 3PTGA 2YFXA 5DR6A 3T9TA 4XBUA 3UZTA 3TIYA 3E7VA 3E92A 2PYWA 3TL8A 2XB7A 3ERKA 3LFDA 4U42A 2WQOA 2QD9A 4OTPA 4BIDA 3HAMA 3V8SA 4QTDA 2FB8A 4NFNA 4UALA 3IW4A 1OB3A 4R1YA 5CU6A 3NVKI 3PZEA 1L8TA 1NY3A 2WMBA 4I22A 4RLKA 3KGAA 3DZOA 4E26A 4FL3A 2UVXA 4I92A 4GCJA 4G3DA 3NNVA 2B0QA 5HVKA 3AD6A 4DFNA 5M4FA 2WQBA 2GNLA 1PMVA 4D2SA 1YRPA 2NO3A 4FMQA 4KS7A 3PDTA 4BDDA 3QFVA 2IZTA 1K3AA 2H8HA 4S30A 4BCQA 2XA4A 4ASZA 5IZFA 3TV6A 2XCKA 3F69A 4FNZA 3ATSA 3QD0A 1FGIA 2OZAB 4BYJA 3MFSA 2OH4A 3WZJA 4CFMA 5CSPA 2QQ7A 1BMKA 1ZARA 5L6WL 5B2MA 2VAGA 1IAHA 3CJFA 4PV0A 4XV9A 1UKIA 4FICA 4PL3A 4DHFA 1URWA 3O8PA 4MXCA 3UNZA 1M2QA 1GZ8A 1GZNA 2CHLA 5J8IA 4JX3A 1LUFA 3DOGA 3TIZA 3ZC6A 4FT7A 1KOBA 3P5KA 2OIBA 4D58A 2ITXA 3CQUA 2ZAZA 3BHYA 5HE2A 4DEIA 2RKUA 4QP9A 3FYJX 4AW1A 4CZYB 4YTIA 2C0TA 1VJYA 3V8WA 3HV5A 2HXQA 3MY5A 1LP4A 5FUTA 4CRSA 2I40A 2J6MA 4AAAA 2HCKA 4AUAA 3UOJA 5HTIA 3BYSA 3O7LD 4EH9A 2IZSA 4G3FA 2AUHA 4OAVB 3JS2A 3ZSIA 2PVMA 3C1XA 3E63A 1RJBA 3LVPA 4FK3A 1Q62A 2XKCA 4IIRA 3FKOA 3IONA 3C4WA 5JH6A 2XBJA 3EIDA 5AUZA 1VR2A 4A9RA 4H58A 4YMJA 3ZYAA 3UQFA 2EB3A 2YWPA 4R3RA 3HMMA 4G5JA 4JS8A 2HZNA 4C3FA 1WBNA 1JKTA 5CY3A 4RRVA 5EYMA 4ALUA 4FEWA 3MDYA 3CPBA 2Z7QA 2B7AA 4BZNA 1K2PA 4X6RA 2CCHA 2CGVA 4BKYA 4C35A 2Z02A 4EK5A 2GNHA 4UWBA 3QUPA 5JGDA 3GC7A 3DB8A 3WZEA 3OUNB 3U9CA 3NRMA 1XH8A 3NNUA 4RVMA 2YLFA 2UV2A 3KMUA 1Z9XA 3NUNA 3IDBA 3PSCA 2C3LA 3D7TB 2C6OA 1OITA 4NW6A 5LCKA 5LVOA 3UZRA 4V04A 4MCVA 4PMMA 3KRWA 5F95A 3TJCA 4U9AA 4FC0A 5A9UA 4PNKA 3UC4A 5BMSA 2P2HA 4TZRA 3UO6A 3Q4TA 4AFJA 5DT4A 4WO5A 3FMHA 2RFNA 3A7HA 3IO7A 4CZUA 4ZXTA 5E4HA 2ONLC 4R7IA 3RJCA 1YDTE 2WTDA 4FTRA 3UP2A 2HIWA 3Q9WA 2UUEA 2QODA 2B9HA 3FPMA 3AGLA 5CXZA 1QPCA 1ZAOA 2QOFA 2XEYA 3OY3A 4YJQA 1G8AA 5DHJA 4DTAA 4LOQA 4UN0C 3HV3A 4C33A 2Y4IC 4B7TA 1WBVA 3LCOA 2GS2A 3QQJA 3QX2A 4L3PA 3LMIA 3R7VA 3Q60A 4C3RA 2QG5A 3Q3BA 2QOOA 4KS8A 1JBPE 4HYIA 4I3ZA 4O6LA 4ASDA 2OJGA 4FSNA 5M4CA 4D55A 5I9YA 2GS7A 2WTVA 5EOBA 2EXCX 4MYGA 3SW4A 3KXHA 2B1PA 4QYYA 3S3IA 4DFZE 1M14A 2XIRA 5CSHA 3U8WA 3PLSA 2QO7A 3BLHA 4Q9ZA 5AP6A 4O21A 1YQJA 2QU5A 4D5HA 2WU6A 2OLCA 3LXNA 2VO3A 3ZCLA 3U4WA 1SVHA 5E9EA 4IM3A 2I6LA 5HVYA 4K9YA 5FP6A 2CPKE 4GEOA 4CLIA 4PF4A 1YXSA 2WQNA 4ACGA 3D2IA 3QQHA 5E8TA 3QCXA 2BIYA 3GEQA 3G33A 3MVMA 4FKTA 4QPAA 4EHEA 4YP8A 3U87A 3V5TA 2C3IB 4TT7A 3P4KA 1WBOA 3DA6A 3QGWA 1I44A 1OUYA 2WMXA 4LRKA 4LMUA 3TV4A 4LL0A 3L8XA 2JFLA 3N4UA 4BI1A 3D5XA 3W1FA 4RA5A 5EM8A 4ZLYA 4NKAA 2C6MA 2GNIA 4U3ZA 3TN8A 4IH8A 5HNGA 5L2WA 4FIGA 3KRJA 2YLEA 1FMKA 3IKAA 2PULA 3UMWA 5IQAA 2JIIA 4TRLA 5DLSA 4AE9A 3GU7A 2Z7RA 5IUHA 4R5YA 5L8KA 3VN9A 4F70A 4RX5A 2ITTA 4U3YA 4RJ4A 3DXPA 1VZOA 4KB8A 4QP6A 5IH5A 3KXXA 5CVHA 3TNHA 3AC1A 5K0XA 4ORKA 4BCGA 4QPMA 3DBQA 5CASA 4XX9A 3VF9A 4NU1A 1NVQA 2XKFA 2PVLA 3IS5A 4GJ3A 2CNVA 3WE4A 2Y4IB 5EKNA 4R77A 5LWMA 4I5HA 3UODA 2YABA 3DJ5A 2QOIA 3F7ZA 4IAZA 1JWHA 2YM3A 1J1CA 2PE0A 3QTSA 4BCOA 5AA9A 1BL6A 3FMJA 1XH5A 3F88A 1JVPP 4JAIA 4JNWA 4M84A 5AIRA 2GQGA 2HY0A 3W2SA 2X9FA 3BV2A 4AT5A 4F64A 2EU9A 4HNFA 1ZOGA 2XKDA 4JL9A 4BCNA 3AC2A 1O6KA 1BLXA 5HKMA 4RFMA 3VO3A 3CGOA 5C8KA 5IF1A 4ASXA 4RLLA 4O27B 3JUHA 4GV1A 4N6YA 4EOQA 2ACXA 3PPKA 3CCNA 2PMOX 2VTAA 4RPVA 3VS2A 1DM2A 5JMSA 4U79A 3C7QA 3DBEA 4AFEA 2GTNA 4FSRA 2ZDTA 2EXEA 3O51A 5DYJA 4EOJA 1V0BA 2BAQA 4HVIA 3NPCA 3ZH8A 4BI0A 4JG6A 1YW2A 1ZY5A 4L7SA 5KMOA 3OD6X 4NW5A 4G5PA 2J50A 4GUEA 4IZ7A 4JAJA 5A14A 2BIKB 2PVJA 3ZM9A 5H8GA 3A7FA 4O22A 4EH6A 5C4LA 2W9ZB 4BKJA 3KF7A 4X3FC 4EQUA 2H34A 2G01A 4NIFA 1YKRA 2UW8A 3L8PA 5BUEA 5DBXA 3MB6A 3HAVA 3Q04A 1GJOA 5CAUA 3OXZA 4NM3A 1H25A 3KEXA 1IA8A 4EQCA 4RQVA 5AV4A 3ZDIA 4UB7A 4DFYA 4AA4A 3QHRA 4PMSA 4MXXA 4ITIA 4USFA 4C4EA 3I7BA 1R0PA 3EQPA 5JZNA 3TM0A 4GYIA 1G3NA 5J7HA 5EHLA 2J0KA 3KY2A 3QBNA 4GUBA 3NIZA 1AQ1A 4NSTA 3DCVA 4XG8A 4YZNA 5TKDA 2PMNX 3MJ1A 3H10A 5ANOA 4DGNA 5JFWA 2VNWA 3UYSA 1GIHA 4DTBA 3K3JA 5CEPA 5LXMA 3LFBA 3POZA 4EWQA 5HX6A 3A4OX 2PE1A 5KKRC 4UV0A 3LFQA 3IK3A 4IB5A 4LOPA 3GFWA 3QD4A 5IQBA 2PSQA 3ALNA 2GDOA 3DKCA 3SLSA 3K5VA 3V6SA 5EFQA 3R28A 4MXZA 3TDVA 4MXAA 3AGMA 2WELA 4QMXA 1OL2A 5CSWA 2P0CA 3F3VA 1K9AA 4M67A 1CM8A 1ZLTA 3GCUA 5BYZA 4FIEA 2E9OA 2NRYA 4F0FA 3VHEA 4DBXA 3NS9A 2GNGA 3UOKA 3UDBA 1SVGA 2F7XE 4F7LA 2OF4A 3O23A 3RK5A 1H1SA 1JOWB 3GP0A 3LMGA 3MTLA 4B99A 3EN9A 5F4NA 4X3FB 4LFIA 2G2FA 5FDXA 3OW4A 4AA5A 2CGXA 3NGAA 3ZUUA 3RPOA 4MK0A 3QQLA 2GQSA 4HVDA 5D7AA 3UO4A 4ITHA 4PTGA 1GAGA 4I0TA 4FIHA 4J97A 4DBNA 5CEKA 2H96A 3S1HA 3R83A 4YHJA 3VIDA 4HYHA 5KMLA 4W9WA 4YC3A 3SVVA 3FMNA 4ALVA 3F3ZA 4W8DA 1PYEA 3PVBA 4J96A 4KIKA 3PIYA 4DEGA 4EQMA 4J8MA 4UMRA 5I9WA 4OUCA 3E3BX 5BQ0A 2V7OA 3NCZA 4M69B 3MV5A 3Q4CA 3GT8A 1XBAA 4ZP5A 5FRIA 1UU7A 2ERKA 3EYGA 4QTAA 4FG7A 4F9YA 1W98A 4MNEB 4OR5A 5KKRB 4BZDA 2PL0A 4RIOA 5FXRA 2IWIA 2XYNA 5ANKA 4E4XA 4DH3A 3BU6A 2ONLA 1J1BA 4YJPA 3PXYA 3R7UA 4BDKA 2VV9A 3ROCA 3Q2JA 3RAKA 3D5UA 1H24A 4DG2E 4MQ1A 4FNYA 5L2TA 3DFAA 4J53A 1TVOA 5HE1A 3VULA 3GU4A 4ZAUA 3HRFA 3VS6A 4OT6A 3Q9XA 3ORPA 4FT0A 1ZYSA 5K4JA 4K18A 4DGGA 5HCXA 3DAEA 4EOKA 4FR4A 3VAPA 2BRGA 4QQTA 5AFVA 2F7ZE 4EH5A 5HORA 4L3JA 4F6WA 1IRKA 3EQDA 4YC6A 4JQEA 2C30A 2AYPA 3FLYA 3I1AA 3NUXA 2YA9A 2ZYBA 4QMMA 3HKOA 5E91A 3BYVA 3IPHA 2A1AB 4E93A 5FLFA 3LZBA 4L01A 4QMSA 5JQ8A 4FL1A 3ZRKA 4E20A 3R8UA 4M12A 3C50A 4OBPA 5IA4A 2OIDA 4FTQA 4BICA 4BDHA 3RALA 4G3GA 2WTWA 2XMYA 1QMZA 3CJGA 3GUBA 3LJ2A 3CLYA 2ZV9A 4K0YA 1WBWA 2YM8A 2J9MA 2NRUA 2HENA 5KMIA 3BQCA 2VTRA 5JFSA 2JAVA 3LE6A 3ZS5A 3G6HA 3QLGA 1J7UA 1YOLA 5KHXA 3NIEA 5E7RA 3HV6A 3ACKA 3MPMA 4IWOA 3BHTA 2JDRA 3CD8A 5AR2A 2QOQA 3C0IA 2QI8A 2V5QA 4ZIMA 4ENYA 4Z16A 4YO6A 3VJNA 2EUFB 3SDJA 2GHGA 5HG7A 4FVPA 4F7JA 4C61A 4D4RA 5ANDA 3EFJA 4IJ9A 4HZSA 4D4YA 3EB0A 4BBFA 3OWKA 2HZ4A 3WF5A 4DG0E 3FQHA 2BRMA 5F9EA 3LKMA 3JXWA 4TWNA 2CNUA 3PJ1A 3BHVA 3UO5A 4BCJA 1YHVA 3DJ7A 1JKLA 1OBDA 4AF3A 2O63A 5ETFA 4ZLZA 3BBWA 3B2TA 3CBLA 1MUOA 4C4HA 4IM2A 2W1EA 2X81A 4YPDA 2R3IA 3KXNA 4D4VA 4NM5A 2W99B 4XG2A 3MFRA 2P2IA 5LVPA 4TPTA 1QCFA 3Q4ZA 3ACJA 5CU2A 3W2QA 4FUXA 4D1XA 4CD0A 4QMQA 3R8ZA 3LLAA 3LJ0A 3RCJA 4PL4A 2ZB1A 3OOMA 3SQQA 1PXOA 2R3RA 5EKOA 5AV1A 4EH2A 3VUHA 4YLKA 4G2FA 5LCJA 3PP1A 4TYHB 3MN3A 1XO2B 3HV7A 3EWHA 4CG9A 3BYUA 3HMIA 3QYWA 4QTCA 3KU2A 2CLXA 5C01A 2B54A 3VBTA 4XHKB 4X3FA 2EB2A 2REIA 2X8DA 3HA6A 3UMXA 2WOTA 4Q2AA 5CI7A 3F82A 2ZM3A 5HLWA 1W84A 5E90A 4OAUC 1JLUE 4V0GB 2XNBA 3BX5A 3QRKA 3FXZA 4M3QA 3RK7A 5J9ZA 3EHAA 4NJ3A 5EW8A 3ZDUA 4O7WA 5LARA 1M17A 2XF0A 3RM7A 2CKEA 5CT0A 2FSLX 2OKRA 3RPVA 4GVAA 5JZJA 3FI4A 5HCZA 4BCIA 4OBOA 1KSWA 3EN4A 4Q5HA 3FSKA 3TACA 4TTHB 4ZEGA 4ENXA 4DTKA 1PYXA 1TQPA 1LPUA 2KTYA 4YSJA 3D9VA 3S2PA 3UOHA 2VUWA 2WD1A 2QKRA 4JOAA 4KA3A 3ZXTA 2X39A 3VW6A 4GU6A 4MNEA 3IG7A 4AGCA 2WTIA 1A06A 3TCPA 1WZYA 2PUPA 4CMOA 3R9NA 1ATPE 4IAAA 2WTCA 4FA2A 4KBCA 3AT4A 2JDVA 2ITOA 4HYSA 2WTKC 3E93A 1REJA 3A7JA 3IDPA 3Q6WA 4UY9A 4D9UA 4H05A 5IQFA 1FVTA 4LQMA 5E8XA 4BDCA 4L68A 2BROA 5H9BA 5A4CA 3D83A 3MI9A 3Q6UA 2RG5A 3F5PA 5DRBA 3VS5A 4CFXA 1Y57A 5M08A 1Q8ZA 2PUNA 5HG9A 3MVLA 3NYOA 2F57A 2C5YA 2Y0AA 2PUIA 3PJ3A 2AC5A 4D1SA 3R73A 1Q8WA 1H07A 3MS9A 3P23A 4BDGA 5CALA 1U5QA 3F6XA 5EQPA 2RL5A 3QRJA 5D11A 2OWBA 4K77A 4WOVA 2J0IA 2JEDA 5DPVA 2CGUA 1OPKA 2ERZE 3KC3A 1PXIA 2Q0NA 4H36A 4GIIA 4YO4A 1Q97A 1CKJA 1V0OA 3LOKA 3R1SA 3PRFA 4F1MA 3CGFA 1PMUA 3P78A 2NNWB 3KA0A 4MKCA 3LFCA 3RMFA 1YHWA 3HV4A 3MPAA 4LV5A 5DGZA 5E8ZA 4YTCA 3W55A 2YIWA 2C1BA 4QMYA 3QWJA 3C5UA 3UQCA 5TOZA 4BBEA 5EOLA 3DTCA 3O7LB 4MBIA 3P7CA 4AQCA 5HX8A 4Y95A 4R7BA 1OPJA
chains in the Genus database with same CATH superfamily
4IFGA 5AR3A 3R7GA 3PA5A 5E8UA 1YDSE 5DVRA 3RI1A 5M56A 3QZIA 4HVHA 5D10A 3I6UA 4PQNA 5BMMA 1FOTA 2UW4A 2J7TA 4OTWA 3TZMA 4A07A 4QT1A 3R1YA 3RAWA 4RG0A 3LLTA 1XKKA 1GY3A 3WIGA 4QDVA 5HG8A 3PFQA 3JVRA 3BL7A 4F6UA 4NH1A 3PFYA 3PPZA 4PDPA 3OEFX 2X7OA 5L6OA 4W8EA 3MY1A 2WTKB 3PYYA 5L2SA 4YNEA 3DK3A 3ZFMA 4BTFA 2JLDA 4O7TA 5HNIX 3QA0A 2PVHA 1B6CB 1ZYJA 3BE2A 1RDQE 3ORMA 5AX3A 3ENHA 3PRIA 4RJ7A 3E8CA 4ZJIA 3NUPA 4PMPA 4I6HA 1F0QA 1HCKA 1I09A 3ORNA 2UZUE 2O5KA 3HRCA 1NVSA 3TWJA 4B0GA 5IQDA 4BRXA 1VYZA 1Y6AA 4CT2A 3QKMA 5EM7A 5K4IA 2R7BA 4O84A 3RNYA 4U80A 4OT5A 4O7ZA 1BX6A 4R78A 3OVVA 4YU2A 4XUFA 3S00A 4BY9E 3KXMA 3TTIA 4IX4A 2OJIA 4E5BA 4U8ZA 4U44A 4GVJA 4C38A 2CMWA 3NAYA 4RA4A 3IW5A 5IA5A 3W33A 1XMLA 4LUDA 4QNYA 5FM2A 2YIXA 2G2HA 4YZCA 5GINE 3ZU7A 4ANBA 5C9CA 4OTQA 3NYVA 2IZRA 4WBBB 3QZGA 4QQ5A 4BTMA 3LXPA 5DOSA 3QTIA 5CQWA 3VF8A 4O1PA 4A9TA 1H1RA 3ENMA 4HCUA 4QRCA 3DKGA 4RIWA 5BUIA 2WMWA 1T46A 3EQBA 3W8QA 2BVAA 3VBVA 1PW2A 2GU8A 4FSWA 3Q9YA 3WILA 4HYUA 4BWPA 5DH3A 3IGOA 4EUTA 2WMSA 2QHNA 1OBGA 4QMUA 2W5BA 1UNHA 4FTMA 3P1AA 3GOKA 3FLQA 4AS0A 3R22A 4V0GA 5CXHA 5FGKA 4NM0A 3EMGA 3HGKA 4V05A 4BIEA 4ZJVA 2R3OA 1BUHA 4N70A 4JR3A 3COKA 3C4EA 3R9HA 3F5XA 4MEDA 4CFFA 4S31A 4NYEA 4RIXB 4BDFA 4ONAA 4QTEA 4LGHA 1HCLA 3GGFA 2BDWA 4NEUA 2YACA 4O0YA 3ZO2A 5HD4A 3EL7A 4I0SA 3DPKA 5CNNA 2JFMA 3FEGA 3C4FA 5I5ZA 2JC6A 2IF8A 4L00A 3V5WA 4A9YA 4AXAA 3BV3A 5M44A 4AW5A 3Q5IA 1DI9A 5FBOA 3SAYA 3T3VA 3UIMA 2VTJA 3WZKA 2C5NA 2C1AA 2X7GA 3SKCA 4GSBA 4L9IA 1YWRA 4IX3A 4AG8A 5JKGA 2YEXA 1Q3WA 3F61A 3MH0A 4L45A 1VLRA 3JYAA 4UZDA 5E92A 4LV8A 3OY1A 4X0MA 4FKIA 4F9CA 5ACKA 4XLVA 5TO8A 4F7SA 2JD5A 2WEVA 2XAMA 2VTTA 3KRXA 5J95A 2PVYA 2ZV2A 1OKWA 2UZWE 1Q8YA 4FV7A 3DLZA 4FEQA 4IX5A 4IZAA 4CFVA 5G6VA 4ERWA 5KMKA 2PTKA 4FTNA 4LDTA 3WF6A 4U6RA 3DU8A 4QMOA 4B4LA 3JPVA 2PZ5A 5CF8A 3EN5A 3RNIA 1OL7A 4E6CA 4ZZOA 3G0FA 4NL0A 4AGUA 2XNGA 4IDVA 5L2QA 3M42A 4XG7A 1UVRA 2WAJA 3B8RA 3F2NA 3QZHA 4ANMA 2GHMA 3BLRA 4I4FA 3E8EA 2W1IA 5AEPA 3ANRA 4BWKA 1CSNA 1H01A 2BAJA 5A4TA 2WXVA 5KBQA 4D2PA 3DKOA 1OI9A 4EOSA 3EOCA 3HLLA 1BI7A 4YLJA 1FVVA 5A4QA 3A99A 4YPSA 4TL0A 4AZTA 4MD7E 1IAJA 4FTLA 5D9HA 3VBWA 3QQFA 2OK1A 5BPYA 2IVSA 4RSSA 3Q4UA 5HEZA 3S0OA 3OWPA 1YI6A 4G1WA 1W7HA 3QQGA 2Z7SA 3KREA 3WARA 2XVDA 2FUMA 3A61A 3Q96A 5J5TA 1J91A 3A8XA 5EDQA 3NUSA 1YOJA 2SRCA 4EH3A 4JG7A 4E5WA 3NEWA 2B4SB 4LRJA 3NUYA 4EK8A 4KRCA 1U4DA 4XBRA 4EBVA 3IOKA 4DE4A 1SVEA 3RHXA 5I3RA 4LM5A 4CMUA 2W1HA 2R0IA 2FGIA 2B55A 4ZMEA 2A98A 2C5XA 2F9GA 4FTOA 4M0ZA 2FH9A 4AN3A 2CKOA 2WMQA 4UEUA 2YCQA 4UYAA 3GQLA 1OMWA 4OTIA 3TNQB 2ITVA 3HUBA 4WNOA 5HBHA 4MAOA 5IA3A 4FIFA 3TYKA 4DT9A 1Y8YA 4QP2A 2LAVA 1JSVA 3A4PA 3MB7A 5FG8A 3V6RA 3KRLA 3DY7A 4QMZA 1WVWA 1XWSA 4IWPA 4E8AA 1TQMA 2VU3A 3NUUA 1EH4A 4IVAA 3PXRA 4FGBA 4EOIA 1M7NA 2ITQA 3C9WA 3ODYX 1OKVA 3E64A 4MUQA 3F3TA 4JRNA 4X7QA 2VWYA 4EOLA 4AXFA 4RWIA 2XUUA 4I5MA 1FPUA 2IZUA 3CTHA 4G3EA 5IG1A 2PZPA 1H1PA 3LXKA 3HX4A 3ZRLA 5HU3A 2UVYA 3Q5ZA 3I60A 5AP2A 1OVEA 3EFLA 3QRTA 4Y5HA 4AACA 3LCSA 5EM5A 4O91A 5TR6A 4YJTA 3F3UA 3PWYA 2CN5A 2GQRA 1QPDA 2RF9A 3BE9A 4CXAA 3QRUA 4O7LA 2A19B 1STCE 2XJ1A 4ZTNA 2I1MA 3OS3A 5H2UA 3WF7A 4J52A 2Y7JA 1TFFA 3CKXA 4RGJA 3UGCA 2AQXA 3V51A 1JKSA 1FVRA 2X8EA 4GW8A 3VBXA 3BKBA 4ZY4A 3T8OA 1OM1A 2B53A 3W2OA 4M68A 3TUBA 3OZ6A 3KXZA 4E4MA 3OXIA 2VX0A 3DGKA 3HVCA 5D7VA 2I0VA 5K0KA 4RIXA 4FV3A 2B52A 4QYFA 4YJUA 1H4LA 1XQZA 2VTLA 5FEEA 3GOPA 4A7CA 2VX3A 4C4JA 4DC2A 4CEGA 3PA3A 3DQWA 4EZ7A 2JKMA 4LGGA 5HNBA 3FI2A 4BGGA 5AP7A 4IVCA 3R6XA 5K3YA 3BI6A 2C0OA 2HZIA 1TKIA 2OJFE 4HZRA 4OTRA 2X8IA 5ICPA 2VGPA 4G6LA 2BRHA 3RK9A 4L8MA 4FF8A 4YSMA 3GCQA 4CFNA 4IZ5A 1PY5A 2ZJWA 4C2VA 3E87A 4FYNA 4L44A 3R2BA 1U59A 3PSDA 4BJJB 3FQEA 2VX1A 3KK9A 2ITPA 4OTFA 5FBNC 5TE0A 3UBDA 2O8YA 4PP9A 4UX9A 3KVWA 3QD2B 4QPSA 4EOMA 1SM2A 1ZMWA 4FK6A 4WBOA 2WMRA 2OZAA 4R8QA 3ALOA 4YUQA 3UPZA 3NWWA 4F09A 1A48A 5DI1A 4YJOA 1UWHA 3QTUA 4FZDB 4UMUA 4FVRA 3MVHA 5IDPA 5KX8A 3FY0A 3T9IA 2VWZA 2O2UA 4FKOA 5I4NA 3R7IA 3CTQA 3OW3A 2W96B 3RPYA 3QF9A 4MNFA 1KE7A 3HA8A 4U5JA 2ZOQA 4TNBA 4DGLC 4ZSGA 1IR3A 3FY2A 4I41A 4MQ2A 4RJ6A 3M1SA 1AD5A 3COIA 3E5AA 3TKHA 2HOGA 5CU0A 1PMNA 4TWOA 5DEYA 1OIRA 2X6EA 1WCCA 4BCKA 1QPJA 2VNYA 3G6GA 2DWBA 2UW9A 3TI1A 3OTUA 2XIZA 4JR7A 3OROA 5AP0A 5AP1A 4AOIA 1KV2A 4CFUA 5BVDA 3UVQA 4CCBA 4JBPA 5HGIA 2YCSA 4FKGA 3UDSA 4FTKA 2RG6A 4L3LA 1ZZLA 3K2LA 2YDKA 2XNNA 1R78A 4HGSA 5IDNA 2VWXA 4FGRA 5EQYA 4F78A 5ANJA 3IW7A 2EWAA 2QCSA 4FT5A 5AP5A 5HICA 3F9NA 5AX9A 4RMZA 4C62A 5DNRA 2G2IA 5AAEA 5J7BA 5E8SA 5CI6A 1WBPA 1KE6A 2PVKA 4EJNA 3PVWA 1DAYA 4AZSA 3WBLA 5IQGA 3QUDA 1W0XC 3OCSA 2C6KA 4O4BB 4XV2A 4DEHA 2VTPA 4BYIA 4D4SA 1BL7A 3L9LA 3FHRA 2WPAA 3DDQA 2QOKA 5CAOA 3QC4A 1W8CA 3TDWA 4FNXA 2PVNA 2ZV7A 2IVUA 3D7TA 2JDTA 4LG4A 4YNOA 4I0RA 5HZNA 2J5EA 4WG3A 2XIKA 2BDJA 4Y85A 5JFXA 4WSYA 5TF9A 4D2VA 5GZAA 4U41A 4QD6A 4J8NA 1Q8TA 5IA1A 2BRBA 2E9PA 2YITA 4J71A 2RIOA 2J5FA 4U45A 4ERKA 1Q8UA 2JAMA 2P4IA 4M0YA 1B38A 3P86A 1SYKA 4DFUA 2BCJA 1FINA 1ZOEA 1Q5KA 3E62A 5FXSA 3BCEA 1RW8A 4JDJA 3ORLA 2X9EA 4DAWA 1R1WA 5DWRA 3VUGA 3ZLXA 2A2AA 3TNPC 3BRBA 4J1RA 2I7QA 4KNBA 3OBJA 3F2RA 4O4EA 5L2IA 3C13A 3KMMA 4HNIA 3UIBA 2FSOX 2DQ7X 3HDNA 4QOXA 5ETAA 3R7OA 5IH4A 4RJ8A 3AOXA 2ESMA 3N4TA 5A6NA 3M2WA 2R3NA 4ZSJA 4QMLA 3W0SA 5M09A 3QALE 5IUIA 3UNJA 2OBJA 3V3VA 4EC9A 2W06A 1XMMA 4AOJA 2CKPA 3ITZA 2R7IA 5AR8A 4KABA 5CAQA 3LQ5A 2ZM1A 3GCSA 3VS7A 4IM0A 2WMUA 4JXFA 3FE3A 4KIOA 3PSBA 2OIQA 4LMNA 2R3PA 3P0MA 4PDOA 2OFUA 5ANGA 1ERKA 4EBWA 2X0PA 2NP8A 5KE0A 3VWAA 4DF3A 4WG5A 2A4LA 2C3JA 4G9RA 4IWDA 4O81A 3K3IA 2YZLA 3U54A 4M13A 5AM6A 2A0CX 3VUMA 4JI9A 2JGZA 3VRYA 3TNWA 3A60A 1G5SA 3MFUA 4ZSEA 3HMPA 4C7TA 4OGRA 1URCA 5K5NA 3UVRA 4JDHA 1RQQA 3CR0A 2WMVA 1YWVA 3P7AA 4LL5A 5CT7A 5GHVA 5KBRA 3I6WA 4PX6A 3VW8A 3A7GA 4EHVA 3ZXZA 2OFVA 3RM6A 3FZPA 3I81A 3FZSA 5B2KA 3LM5A 3Q53A 1JSTA 4AU8A 4D2RA 4JRVA 3U6HA 3KXGA 5C4KA 4P4CA 3AKLA 2WU7A 4LYNA 3LPBA 3SC1A 4XMOA 2UZEA 4ARKA 4R3CA 2UW6A 3DAKA 3PE1A 4BJJA 5ITAA 4BL1A 4DEAA 2WMAA 3MYGA 3CEKA 4FV1A 1KWPA 4I6QA 1HOWA 4ANLA 2UZLA 5DEWA 1F3MC 4Q5EA 3ETAA 2CCIA 3FUPA 2XNEA 4IJPA 5EW9A 2YHVA 4GIHA 3UDTA 4F99A 2JKKA 3SX9A 4O0TA 2XANA 4O7SA 3KVXA 1WAKA 3CIKA 3F5GA 3RPSA 4DFXE 2OF2A 4EEVA 3DBFA 2VRXA 5ANEA 1NXKA 1NW1A 5A46A 4CSVA 1IASA 3CQWA 3MJ2A 4P90A 5LVNA 4ACMA 4E4LA 1J7IA 1FMOE 4ZZNA 4IWQA 4Y46A 5EHYA 3AC3A 2BDFA 5I9UA 1OIQA 3CTJA 3ZEWA 2BILB 1OIUA 4RIYB 3RAHA 4WNKA 4ANNA 2R5TA 4MTAA 1OIYA 4FV9A 4IVBA 1PF8A 5EI6A 1BKXA 4NTTA 4ZTRA 2J90A 3IW6A 4AZWA 4M97A 2G15A 2W1CA 3CXWA 4FSQA 4KKGA 5C8MA 2ETKA 2WGJA 1Z5MA 4KBKA 4C34A 4IAKA 1KE9A 3N51A 4NK9A 3HRBA 3CC6A 1H27A 1CMKE 3ZEPA 3DS6A 4WKQA 4EUUA 1P5EA 4L52A 3SRVB 2BR1A 3AMYA 2J0LA 2FA2A 1J3HA 1WBTA 5IKWA 2VTNA 2Z60A 4ACCA 2PVFA 5EYDA 5KMJA 1Q61A 2DS1A 3CQEA 3DJ6A 2Z8CA 5HIDA 1UWJA 1S9IA 2R64A 3EQRA 4FBXA 3UZPA 2WTJA 2DYLA 2XNOA 3DBDA 3K54A 4HPTE 2E2BA 1OL6A 3GI3A 5GZ9A 3ZSGA 1SNXA 3I5ZA 4XLIA 5T6KA 5CEOA 2BFXA 3BELA 3GNIB 5FTGA 3FLSA 4UMTA 4XP0A 4APPA 4YZDA 3MTFA 3CY3A 4FKJA 3GU6A 3DK7A 4FL2A 4N4SA 2OGVA 4MXYA 4DT8A 3SXSA 5D12A 3QA8A 3DK6A 1ZXEA 2OG8A 4L7FA 3DB6A 3OWLA 2VO0A 3MA3A 4MF0A 3TG1A 4C58A 4QYHA 4FT3A 3ZC5A 3W2PA 2IEWA 5A54A 4CGAA 4YTHA 3NX8A 5BVFA 5FQDC 4AP7A 3EH9A 4Y72A 4USEA 4BGQA 5FWKK 3N9XA 1KE5A 4PTCA 4FV4A 5IPJA 4CVAA 1H00A 4YC8A 5HLNA 5HQ0A 2PU8A 3TTJA 3UG2A 3EFWA 3R7EA 4RWJA 3QRIA 1MRVA 2BUJA 3COMA 3OC1A 3EZRA 4I94A 4DLJA 3CD3A 2V0DA 4C37A 5CAVA 4AZFA 4FZFB 5BYLA 4CTBA 4EORA 4KINA 3RHKA 5AUXA 4MWHA 4O6EA 3VS4A 5B7VA 2VTMA 3LFSA 3BPRA 4IZYA 4BCMA 3R9DA 3FZ1A 3U51A 3OCBA 5AP3A 5T68A 4L43A 2GFSA 3ORIA 5IISA 2XK3A 5I0BA 2AC3A 2ZB0A 2FVDA 2H9VA 3MH3A 3ZTXA 3NVKI 3VUDA 4DDGA 1UA2A 1GZKA 4R7HA 3FHIA 5AUYA 3BWFA 4E73A 1R39A 2C47A 4CTCA 2O3PA 4BTJA 1JNKA 3RZFA 1OL5A 5E1EA 3DAJA 3GQIA 5HO8A 4D1ZA 2YIRA 2HELA 4NCTC 2BZKB 2W1ZA 2XK8A 3HYHA 3LW0A 5IMEA 3DLSA 4QYEA 2Z7LA 4I6FA 5CU3A 3ORTA 1U5RA 3KMWA 4O83A 4DEDA 4XRLA 3NR9A 4RC4A 4O0XA 4M69A 4AZVA 4HGEA 4FSMA 5DN3A 3L9MA 4DINA 3C5IA 1MRYA 5CYIA 2ITYA 2R3QA 1E1VA 4FKWA 4D28A 3R01A 4ZY5A 2VTQA 3G9LX 5CS6A 1MQBA 1GIJA 4O7VA 4C36A 2EXMA 3EYHA 4FKVA 5M06A 5IA0A 5BUJA 3KL8A 4FI1A 4XV3A 1SMHA 2XBAA 4IACA 2VWVA 2BMCA 4BCHA 4GK4A 4WD5A 1ZZ2A 3QTXA 5HBJA 4PRJA 1JKKA 4XOYA 3VQHA 1AGWA 2VGOA 4X2NA 3OF0A 4G34A 4O96A 3BZ3A 4CV8A 2B9IA 3OT3A 1BYGA 3TJDA 3ZOSA 3NMUF 4KSPA 1NT2A 2V7AA 2R3FA 2J51A 3P7BA 3MIYA 4AW0A 4KWPA 2CGWA 3O50A 4LGDA 5EYCA 3ROYA 4MF1A 2G1TA 2X1NA 3HECA 3MH1A 4U7ZA 2O64A 3W8LA 4AT3A 3U9NA 4BWXA 2WIHA 4C0TA 3C51A 2GHLA 3H9RA 1JQHA 3NYXA 5ETCA 4IXPA 1OL1A 3WE8A 4BDBA 2YM6A 4BGHA 5BV3A 3RBWA 3I7CA 4GYGA 4P5ZA 4DGMA 4EOOA 5LJJA 2XNMA 4CQEA 4E6AA 4QP3A 4AGWA 1WMKA 3PIZA 5EH0A 4GFMA 5DE2A 1PKGA 4IBMA 5EK7A 5J79A 2VO7A 3EQCA 2RGPA 1E1XA 4G6NA 3E3PA 2C6EA 3H0YA 4I4EA 4S34A 5E1SA 5AV3A 3VJOA 4A9UA 4D5KA 1GOLA 3D5VA 4PNIA 3VBQA 3QLFA 5EW3A 3PZHA 4TKSA 4O82A 5AUWA 3OUKA 1XH9A 4U81A 1KOAA 4RJ3A 4WT6A 3QGYA 3VC4A 2X7FA 4BHZA 5DMZA 2GFCA 5JSMA 2Q0BA 3GFEA 4NM7A 4AX8A 3FQSA 3D14A 2QO9A 3I4BA 5M55A 3MBLA 4EHGA 5AADA 1DI8A 3QTWA 1ZMUA 3FDNA 4JG8A 4MH7A 2YCRA 1CDKA 1L3RE 4UBAA 5J1WA 4E6DA 1P4OA 4FEXA 3ANQA 4D0XA 4B6LA 2C0IA 3W2RA 3I0QA 3LFAA 3QTQA 4F08A 5CQUA 5F20A 5IEVA 3QXPA 4MXOA 1Q41A 3H9FA 1CTPE 3A8WA 5LQFA 4TWPA 2E9VA 4N57A 4L46A 4BDJA 4E4NA 4QMNA 4PY1A 1YDRE 4WA9A 3CKWA 4ITJA 3OCTA 5CSVA 2QOLA 3O17A 1YOMA 4FSYA 5AV0A 4H3QA 3AT3A 5CVGA 3TEIA 4DH5A 4WRSA 5HD7A 3OMVA 3II5A 3ZFYA 2VTHA 3LIJA 2QC6A 2XM8A 4QNAA 4Y5QA 5D1JA 3G2FA 4W9XA 3SW7A 3W0RA 5JK3A 4JQ7A 4X3JA 5FD2A 3E8NA 5AAFA 2QHMA 2WQMA 3AKJA 5FXQA 2GPHA 1OPLA 4IE9A 4TYHA 2ETRA 1XH4A 3RZBA 4K33A 3G0EA 4MVFA 1XJDA 2OXYA 2X4FA 3ULIA 4GFOA 3UOLA 3TZ7A 5H8EA 4FE2A 1OUKA 4DDIA 4GT5A 3CP9A 4OLIA 3ZUTA 4I5CA 3BEGA 1W83A 4KKHA 3QUEA 3TKIA 5L8JA 5C1QB 4GMYA 4B9DA 1DS5A 3S95A 5GIPE 3GC0A 4D9TA 3KK8A 5GIOE 3QQUA 4YJNA 2X2KA 2QKWB 3ORZA 4IVDA 4DA5A 4PTEA 4GKHA 1UKHA 2PK9A 3IDCA 3KN6A 4M66A 4LI5A 3V5LA 3ZFXA 3VHKA 4EH4A 4XG3A 1GNGA 3QL8A 2IVTA 2F7EE 2ZV8A 3IQ7A 2O65A 5GJGA 4CQGA 5IQIA 4O1OA 3LFFA 3RGFA 1GIIA 3SXRA 3L1SA 3BU5A 2J2IB 3FL5A 3TUCA 1IG1A 4DGOA 4G3CA 4HCVA 4O0VA 3VBYA 1W2CA 4QTBA 3O0GA 4X2KA 3BGZA 4FG9A 1PJKA 3JY0A 4L42A 2XK9A 4GS6A 2F2UA 3PY0A 3R8MA 3BGPA 4EI4A 2UZTA 4F63A 2QR8A 3O96A 3ID6C 2WKMA 4ACDA 4GL9A 4DN5A 5HO6A 3OCGA 4KBAA 4UWYA 5IU2A 5L3AA 2BKKA 3QAME 5C26A 4W4VA 4XEYA 4FTAA 2Y8OA 2PZIA 5IUGA 3MFTA 5CZHA 4A4XA 4PDYA 2F4JA 3TZ8A 4WUAA 4FZAB 4EKLA 1JPAA 2J4ZA 4LRMA 1T45A 4RX9A 3FBVA 2BALA 4BN1A 5HO7A 2FSTX 2PVRA 4U97A 3AC5A 3QTZA 4OTDA 4O7YA 2W1FA 1UU8A 2XJ2A 4CYIA 2C6TA 3CPCA 2BKZA 4DEEA 3KF4A 4K1BA 4FZ6A 4PWNA 4F7NA 3R8VA 3LCDA 5CX9A 3ZUVA 2UZDA 4FV8A 2GTMA 4OTGA 2LGCA 4G16A 1O6LA 2XALA 2ZDUA 3Q52A 5CENA 5JFVA 3MVJA 3QD3A 5M53A 4LUEA 3OP5A 4BHNA 3GBZA 3AC4A 4I6BA 4IB3A 5DR9A 3GVUA 1WVYA 5EG3A 1S9JA 4WNPA 2QURA 3TZ9A 3ZHPC 5LMBA 4TXCA 4FTUA 4DCAA 3EQHA 4GJ2A 2R2PA 1TQIA 2XP2A 4ZK5A 4Y73A 5E8VA 3ET7A 4NCTA 5FP5A 2ZM4A 3ZZEA 2YIQA 4FTJA 5AUTA 1Z57A 2X0GA 3H4JA 5JRQA 2YN8A 3FLNC 3FZTA 4F0GA 4JLCA 3PPJA 3DZQA 1ZWSA 4DITA 3EN7A 1X8BA 1CKIA 2HW6A 2JDOA 3EFKA 4FT9A 2BTRA 2HWOA 5HOAA 1M7QA 3TUDA 1J7LA 2OXDA 2R9SA 3FI8A 2C5OA 3H9OA 4UYNA 3DXQA 4ASEA 3D94A 4QMPA 3UC3A 2OJJA 4PDSA 3SG9A 3KKVA 3BYOA 4IB0A 4O0WA 2ZVAA 4GH2A 4EZ5A 4F65A 5CVFA 3R30A 4DH7A 3GCVA 4TYJA 3QC9A 1W2DA 2OZOA 3R8LA 4EKKA 3QHWA 4NIFB 2OI4X 2W7XA 2WNTA 3GXLA 4PPBA 4O7RA 5CWZA 1P2AA 4H3PA 3V5JA 3BEAA 4XRJA 3I5NA 4HVSA 4NKSA 5CZIA 5F1ZA 1FGKA 3TKUA 2G9XA 2EVAA 2OU7A 2HWPA 2WB8A 3C0HA 3NW5A 4M14A 1H08A 3E8DA 3WI6A 5I9ZA 5IEXA 5JN2A 2XRWA 1UU3A 1FBNA 1H1WA 5M4UA 4FKRA 4I20A 3BGQA 3LJ1A 3PXQA 4RQKA 1Q24A 3ORKA 4RVKA 1PHKA 3OHTA 2VWIA 2W4JA 5IA2A 3MPTA 5FEQA 3LCTA 3NZ0A 2UW3A 2VWBA 3DXNA 2XEZA 2VTSA 3ORXA 4CNHA 4N0SA 4MWIA 3VVHA 3VQUA 3GC9A 3NAXA 4TW9A 5GJFA 4BVUA 5L6PA 3K5UA 3KULB 1U46A 3UIXA 1PXNA 5DFPA 3AQVA 4MHAA 3NLBA 4APCA 4CV9A 2WZJA 4XV1A 3UDZA 3OFMA 4FV6A 3EQGA 1U54B 2H6DA 3VUIA 3SGCA 3MESA 3SOCA 5EQEA 1PMEA 5EDRA 4L67A 4H3BA 4EYJA 4DEBA 3PXKA 5AWMA 3VONA 3R02A 5HVJA 3LHJA 3RP9A 2ITUA 4ZTSA 3V04A 2VWWA 4YLLA 1Y91A 2XARA 3AD5A 4O0UA 4QP4A 4D2TA 3FMEA 3FLZA 4IDTA 2RFDA 2GSFA 3ZRMA 3TV7A 4XYFA 2R3HA 4NWMA 2WEIA 3ZM4A 5CANA 4O4FA 3ZLYA 2CLQA 3ZLSA 5KUPA 4E3CA 3R1NA 4HOKA 3W32A 4Y8DA 2W17A 2YDIA 4GT3A 5HCYA 3PXZA 4I5PA 3W18A 1OECA 5CEIA 1PKDA 4NJDA 5JQ5A 2XIYA 4MD8E 4HGLA 2YM7A 3O8UA 1OZ1A 4X21A 4LV7A 4IX6A 3FYKX 2QOCA 5CEMA 3HL7A 3GCPA 5KHWA 4FOCA 1LEWA 3IECA 3MA6A 3WF9A 4X2JA 4FKQA 4FTTA 2VTOA 4FKPA 3G5DA 3MWUA 3TXOA 3WYXA 2BAKA 1RE8A 4FYOA 1PRYA 4YZMA 2CKQA 5A3XA 5C8NA 4BCFA 4KIKB 4A4OA 1JSUA 1YXXA 4KIPA 5G1XA 5BVEA 4ZZMA 4HCTA 4GRBA 4IADA 4RJ5A 2QLQA 4WIHA 4AWIA 3H0ZA 3NYNA 4YZ9A 1P4FA 4BFMA 2XIXA 4II5A 3QWKA 4ID7A 2QONA 4IANA 3DFCB 3VNTA 1REKA 4S32A 4D0WA 5CF5A 5HESA 5M07A 5DT0A 3L8VA 4Z55A 4CLJA 1OKYA 3FZOA 2ITZA 2PMIA 3QU0A 2JBOA 4JBQA 1YWNA 4EH7A 1YXVA 4U43A 3G9NA 2YCFA 4EC8A 4JBVA 3QKLA 4ZS0A 4AT4A 1NVRA 2GCDA 4CKJA 4B8MA 2C68A 4ZY6A 2IW8A 4TY1A 2IW6A 1KV1A 4WSQA 4EH8A 4BCPA 3NFGB 4ZTLA 4ZLOA 2RFEA 4FV2A 4H1MA 1IEPA 4W4YA 2CSNA 4S33A 4ANOA 2F2CB 4F6SA 3G51A 5A4LA 1JAMA 2JBPA 3ELJA 3GU5A 3GU8A 4FKSA 3MW1A 3REPA 2XH5A 5KMNA 3PY1A 5IQHA 3AD4A 1Y8GA 2PPQA 2XM9A 5HTCA 4DFLA 4K8AA 2QU6A 4WHZA 2VTIA 3BYMA 3FJQE 3PP0A 3EKNA 3NNXA 4XCUA 5KZIA 4YTFA 2C3KA 2JKQA 1UU9A 3QCQA 3C4CA 4I23A 4X2FA 3KQ7A 2GS6A 3OG7A 4EK3A 3NNWA 5LMKC 3C4ZA 4G17A 4QMWA 3FI3A 5LOHA 1Q99A 3JY9A 2P3GX 4AW2A 2YWVA 2R3JA 1GZOA 4YBJA 3MY0A 1Q4LA 5CSXA 1YI3A 3A2CA 3U55A 4O0SA 3Q9ZA 3Q2MA 4U0IA 2W4OA 2XCHA 3KN5A 4IAIA 4GU9A 2XK7A 4IW0A 4CMTA 4IAFA 1M2PA 4FX3A 1WBSA 4FIIA 4JJRA 4XH6A 5EI8A 4DG3E 4USDA 3D4QA 2IVVA 1MP8A 3F66A 5DT3A 4I93A 5HBEA 5LMAA 3VRZA 3WOWA 3HUCA 5HLPA