5FTOA

Crystal structure of the alk kinase domain in complex with entrectinib
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
309
structure length
298
Chain Sequence
b'GPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of Entrectinib: A New 3-Aminoindazole as a Potent Anaplastic Lymphoma Kinase (Alk), C-Ros Oncogene 1 Kinase (Ros1), and Pan-Tropomyosin Receptor Kinases (Pan-Trks) Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 298
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ftoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ftoA01
1H1PA 2UUEA 4B0GA 2YN8A 5IPJA 4TTHB 1YOLA 1JOWB 3F7WA 4RFYA 3BYSA 2W1DA 1Y91A 2ITNA 2QC6A 5A46A 5HBEA 3NVKI 1OKYA 5F20A 3SKCA 3ZYAA 3W2RA 2WTDA 1XWSA 2UW3A 3OC1A 3I7BA 5KMKA 3DCVA 3RBWA 1ZYDA 3JVRA 4M68A 2ZJWA 2JDRA 1FMOE 5EQPA 4W4XA 5LXMA 3ERKA 3HGKA 4QP1A 4UZHA 1R78A 3AT2A 4XG7A 3ANRA 4WOVA 3MI9A 4O0XA 1OIRA 4IM3A 4LV8A 5C27A 1YWNA 3MFTA 3JY9A 3L8XA 2XK6A 5FTOA 4Y46A 3P78A 1IAHA 3FLSA 3KC3A 3KCFA 4H1JA 3KQ7A 4WO5A 2C6DA 4J52A 4X2JA 4DH8A 3QA0A 3ZRLA 3D0EA 3GC9A 3FL4A 3SGCA 2W1HA 3QZHA 5IA0A 3L8PA 3D14A 3QRIA 4GU9A 1OITA 2WMTA 1FVVA 4XHKB 1H1RA 3D15A 2R0IA 4G2FA 4I20A 2IO6A 1XBBA 3A60A 4JX7A 5EDQA 5CAQA 3TUCA 3R8MA 5J7BA 2R3GA 3FMLA 5B7VA 1G3NA 2W5BA 4GFGA 4IZ5A 4J53A 4XYFA 1Z9XA 2CPKE 4HGTA 4BRXA 2WGJA 2WIPA 2BTRA 3VUMA 1ATPE 4AT5A 3R63A 4BCJA 2CNVA 3DQXA 3LJ1A 2XNGA 3NS9A 3ROCA 5I9YA 3KA0A 1OIQA 4ZS0A 2F57A 4EBWA 1ZOEA 2GSFA 4WNOA 5IUHA 5KHXA 4RX5A 3SRVA 1BI8A 1I09A 2BAJA 1R1WA 1F5QA 4BYJA 4D9UA 2PZRA 4FKPA 3GU8A 5M08A 3GP0A 4I0RA 2QVSE 4DC2A 4EH9A 4TNDA 3MVJA 1OKZA 3QQUA 5FG8A 3SV0A 3KXMA 3OUKA 1H1WA 3RTPA 3LZBA 4F63A 4FZ6A 4XLIA 1G5SA 3QKLA 4ZTHA 1Q3WA 5FBNC 3HRFA 4XP0A 4M8TA 1W84A 3H9RA 4FV2A 4IANA 4D5KA 4NJ3A 3GOKA 2R5TA 3ITZA 3AGLA 4XRLA 5IKWA 3MESA 3MFSA 4R6VA 2R3FA 3UNKA 4BDJA 4JDIA 4UALA 2DS1A 4ZXTA 1NT2A 3RJCA 3KXGA 3OMVA 4DCAA 4BCQA 2NNWB 1OKWA 4K8AA 5DGZA 3H0ZA 3MFRA 1A9UA 2WMRA 3D2KA 4FNYA 3ET7A 4ZLZA 3F9NA 3GFEA 4E73A 4UB7A 3CC6A 3QD2B 4M84A 2XB7A 3SC1A 2ITQA 1TVOA 3I81A 2WAJA 3VBWA 4FEUA 4D0XA 4NEUA 4AAAA 4AW0A 4BDKA 4RA4A 1ZYLA 4DFZE 4EOJA 5IU2A 4ZY5A 4AP7A 2REIA 4XOZA 3POZA 4BN1A 4AS0A 2ZV8A 5LMKC 2UZWE 3U6JA 1Z57A 3TV7A 1J1BA 3PIZA 3I7CA 3ZSIA 5CAOA 4KBCA 3ACJA 3ZCLA 2G01A 3JY0A 4F9YA 1XR1A 5AR8A 4C2WA 4GU6A 3VUDA 4G5PA 4I6FA 4A9TA 3MB6A 4AA5A 2E9VA 4Z7HA 3ZFYA 2J9MA 4FKGA 4ZZMA 2XNNA 4UV0A 2PE1A 4AZFA 3HAMA 3W1FA 2A27A 3DZQA 5CQUA 4EH4A 3FKNA 5HEZA 3UODA 5GZAA 4TKSA 5AUYA 5ANIA 3UVQA 4E6QA 3QRTA 2QKRA 2H96A 1F3MC 2C3JA 3GT8A 3NUSA 4NWMA 4OTIA 1YDRE 2WEIA 4LRKA 2XUUA 2RG6A 3OWPA 3MA3A 4MD8E 2VUWA 5CSVA 4QPMA 5KZ0A 4NL0A 3PFQA 4L01A 3PYYA 4FKRA 1QCFA 5CEQA 1IASA 4PNKA 4QTAA 2RIOA 3PY3A 3TIYA 3BYOA 3SX9A 4EOSA 5HLWA 1JQHA 5FLFA 4ZJJA 4AWIA 5E8SA 3D5XA 3D9VA 5HKMA 3NAXA 3ZC5A 4D4RA 1URWA 4AW1A 3QKMA 4QPAA 4C3PA 4HNFA 2QR7A 3AMBA 4P5ZA 4ASXA 3BEAA 4XEYA 2QLUA 4FV5A 4Y5QA 4FV4A 4ASZA 4ORKA 4LOQA 2IVUA 2YAAA 4MXZA 5AV1A 1PF8A 3RWPA 2R3JA 1Q99A 3WZDA 5AA9A 1VR2A 4CMUA 3NZ0A 5C8NA 4FV8A 3FZPA 2W4OA 4JRNA 1ZYSA 1XQZA 2GNLA 3E8EA 3Q2MA 4FG9A 3LQ8A 2BUJA 3UTOA 4AZTA 4ZZOA 3PWDA 4O0UA 4QMVA 4WSQA 3MVMA 3P1AA 5C01A 4Q2AA 4FNWA 3MFUA 2V55A 4BCNA 4F7LA 4ANMA 3DBDA 3EQPA 3VHKA 3C4XA 2UZEA 3FY0A 5CXHA 2Y6OA 3EYGA 4YC8A 2DWBA 5I4NA 4OTGA 4QMUA 5EOBA 3UYTA 4KKHA 2JIUA 5D9HA 5KE0A 3I60A 3LXNA 3W32A 4O1PA 4KIQA 1SYKA 1H8FA 5M06A 5KKRC 5EM7A 3QTXA 3RINA 2HZNA 5CI6A 2B9HA 4O38A 3PUPA 5H2UA 1WBPA 4J8NA 4E7WA 4LL0A 2CJMA 3QWKA 2YIXA 5F94A 5IDPA 2C6OA 4BDHA 3PY0A 2V5QA 4PMSA 5HORA 5J9LA 4QQJA 4L3PA 2WXVA 4HCUA 2YWPA 4FOCA 4YLJA 5J7HA 1SVGA 2QOBA 1CDKA 2BRBA 3EYHA 2BMCA 2UW0A 4ZK5A 2C6IA 2PL0A 3C4FA 3ZC6A 1PXKA 5BVKA 1G8AA 4L44A 2I7QA 4ZIMA 3PA4A 1U54B 3FMKA 3ZOSA 3B8RA 4NSTA 2E9PA 3KRWA 3UZTA 5IZFA 1YXSA 3O0GA 4IAFA 1Y8GA 2VTIA 3IW6A 4A07A 5BVNA 4OBPA 1Q5KA 5AAFA 2VX1A 1NA7A 4CKIA 4CZUA 4D4VA 3NNWA 5AMNA 2PVRA 3TV6A 3DS6A 2F4JA 4W4YA 2P2HA 2X8EA 4K9YA 4EHZA 4I6BA 5CSXA 1P2AA 3FQSA 1PXMA 1ZXEA 2C6TA 4DH3A 4FKLA 3FC1X 5AAEA 4I21A 2X7FA 3UG1A 2H9VA 4KS7A 4C61A 3F6XA 3NUNA 4X6RA 4ERWA 2B1PA 4U43A 4IDTA 4JNWA 4G3DA 4MAOA 4Y8DA 4W9XA 3GFWA 4F65A 2DYLA 3E93A 5LOHA 4DTAA 5LMKA 4YGAA 1SNXA 3CIKA 5G6VA 3D7TB 1ZWSA 3W18A 4BDBA 5LVOA 3NCZA 3T3UA 2RFDA 2VO3A 2B54A 3NUPA 4GG7A 5HD7A 3SOAA 4IC8A 1Q41A 1S9IA 3IO7A 2GNFA 4L42A 4IWOA 5L2SA 2C6LA 5H8BA 3NLBA 4U8ZA 3QRKA 5CXZA 3Q5ZA 3D7TA 4KIKA 5ANOA 1BMKA 4NTSA 4IFGA 3OXTA 3ZTXA 1JKTA 3PDTA 3EN6A 4ZP5A 1R39A 3WZUA 1OUYA 4OUCA 3T3VA 3PE1A 4Y85A 3P4KA 3QUDA 4EZ3A 5HVKA 3SA0A 3CR0A 1O9UA 3LCTA 5J1VA 3GU7A 5EHYA 2OH0E 1FOTA 4FT3A 5BMSA 3DAKA 2IVSA 2C3LA 2VZ6A 2OXYA 3GQLA 4WRGA 3R1YA 2B9JA 3II5A 5ETIA 5HVJA 4DEHA 4G3FA 4NT4A 4M0YA 1J7LA 3BYVA 4EOQA 3HRCA 4AW2A 3C0GA 3IOPA 3A7GA 4HVHA 3QQKA 2CDZA 1PYEA 4O7SA 3QF9A 4DTKA 1OPLA 3CQEA 4C34A 4FIEA 2VTQA 3WE8A 4IH8A 4FZAB 4YZMA 2VWVA 3WYXA 1OI9A 4BZDA 3AC5A 2ZOQA 4L3LA 4RX8A 4DYMA 4CKJA 4ANNA 3EQRA 5IF1A 4LQMA 5FDPA 3RK7A 4DFUA 5CY3A 4BDCA 1OKVA 5JRSA 4RQVA 4WUAA 1FQ1B 5AV3A 3HYHA 5CSPA 4I0TA 4BCOA 3O8TA 2X4FA 2HW6A 2XK7A 2XM8A 5BVEA 2WB8A 2ACXA 4X6QC 4D1XA 3HKOA 4IXPA 4NCTC 4ZSEA 1ZY4A 3R22A 1H0VA 2Y0AA 3VF8A 3ZEWA 4EHVA 2I1MA 3G15A 3F3UA 3SXFA 3R71A 3QXPA 3VS1A 4GS6A 5E91A 3PJ1A 4F1MA 4HCTA 2EU9A 4DA5A 3TNWA 1Q62A 3R9DA 4R7IA 2B7AA 2CGXA 4RRVA 2BDWA 2UVXA 3QFVA 3BBTB 3GC8A 3NNVA 5KMIA 3OEFX 1IA8A 1IG1A 1M2QA 3Q60A 4X2FA 5J9YA 4B8LA 5JQ5A 1YDSE 2W1ZA 2WQEA 4PPBA 4EOOA 1KUTA 5GINE 4L46A 4QP7A 1XHAA 1OL1A 2F7EE 3UNJA 4P2KA 3E88A 5C8MA 5JRQA 2FO0A 4D4YA 5L6WL 3N4UA 2PZPA 3THBA 3S4QA 3EQCA 3TJCA 5A6OA 3IPHA 3UO6A 2PVYA 4ALUA 5KCVA 2OG8A 4AG8A 1DI8A 2PY3A 4LUEA 4E4LA 4A9RA 4G17A 2CN8A 5KO1A 5A4CA 3DAJA 4FTNA 4L53A 4EC9A 5I9WA 4KA3A 3BU3A 1UKHA 1WZYA 4QTDA 4QQCA 5FBOA 5M4IA 4C4FA 3KMUA 5D10A 2XBAA 4V04A 2CNQA 4MWHA 4I3ZA 3Q9WA 3FV8A 4QMQA 3JVSA 4P4CA 2JDVA 4GMYA 3M42A 4C37A 3O2MA 3PSBA 4O0VA 5HESA 3R7EA 3RGFA 3UPXA 3GC7A 4O84A 4ZS4A 4FIHA 2OJGA 2VAGA 5DEWA 4F99A 1W83A 2VGPA 4IAKA 4M67A 3ZONA 5CQWA 5HBHA 3IW5A 5T6KA 1Q8TA 4FKSA 3RCJA 2CLXA 3Q52A 4IWPA 4JVGA 5E8ZA 4CCUA 2PUPA 1EH4A 2ITUA 3ELJA 4KB8A 2Z8CA 3VRZA 3FMJA 4C59A 4U6RA 2PZIA 4K0YA 3MH3A 4U9AA 4EOMA 3NYNA 4BZNA 5TOZA 5IQIA 1NY3A 4ZTQA 3V6SA 3GCUA 3EZVA 2B0QA 4FKWA 2YM4A 2DUVA 2OZAB 3IONA 3ZMMA 4D1SA 4J97A 4BDGA 4IVAA 2O63A 2UVZA 2QHMA 2WZJA 3PP1A 3EB0A 2NRUA 3D5VA 4G9RA 5E7RA 3ZLWA 3BIZA 4G34A 3V5WA 4ANLA 2GHMA 4KRCA 3TNPC 4TWPA 3BHUA 3LXPA 5FQDC 3ZDIA 4AA4A 4O7RA 1CMKE 5C4LA 4QOXA 5EI2A 3EOCA 2VWXA 2BIKB 2QCSA 5D1JA 3QGWA 5GIOE 4G31A 4GJ3A 4BGHA 4EH7A 4KAOA 4EH2A 1GIJA 4HNIA 3QTUA 5AUTA 5A4QA 4AZEA 1DAYA 4L52A 4CKRA 2QNJA 4FIJA 4FG7A 3JXWA 4NU1A 2ETKA 3I0QA 5HNBA 5K5NA 4O21A 1AQ1A 2QD9A 2W0JA 3AOXA 4YPDA 3WF8A 2PWLA 2YABA 1GZNA 2C5VA 2OH4A 2VD5A 2RG5A 3NW6A 4K2RA 3TNHA 5HGIA 5J8IA 4EWQA 1YRPA 2GQSA 5AIKA 4DEAA 4OTDA 5B0XA 3GENA 2YA9A 2JKOA 3I4BA 1JKKA 4NK9A 4RVKA 4FIFA 5JGBA 3ZDUA 2X2KA 5EFQA 4AN2A 1F0QA 1WAKA 2UZDA 4IZ7A 4L68A 2WIHA 3PXYA 5HLPA 3ZH8A 4QYHA 4C4HA 4CXAA 3LQ5A 2J5FA 4WBBB 3BGZA 4YJNA 5HBJA 3VIDA 3ZO3A 5BQ0A 4IVCA 4R7HA 4QMTA 2C3KA 3WZKA 4ZSAA 4L00A 3SAYA 3UGCA 4CFFA 4RJ3A 4CFWA 5FWKK 5L8LA 2A0CX 3KCKA 3FZSA 4QMPA 4ITIA 4HYSA 4NCTA 4KINA 3S3IA 3VBTA 3AMAA 5J95A 3ORKA 2PZ5A 5LVNA 1CSNA 2XM9A 4NM7A 4FNZA 3RHKA 4YSJA 5K5XA 3U8WA 4YPSA 4BKZA 4ZJVA 2ONLA 4NFNA 2VNYA 4U79A 4YJTA 2YERA 4GL9A 4FGRA 1FBNA 2F49A 3M1SA 3MJ1A 4QTCA 5TF9A 2IW8A 5HU3A 4D2RA 4Z16A 4WD5A 4F1TA 1LPUA 1ZRZA 2ZM4A 4FKQA 3QXOA 4H58A 4Q9ZA 1M14A 5EKNA 3OWKA 3PSDA 3WZJA 3MA6A 4QD6A 2HZ0A 3QQFA 4EQCA 4DITA 2OIDA 2R3IA 1B38A 2VO0A 3QCQA 5GNKA 1L3RE 3PXFA 3LCKA 4MBJA 5DEYA 1P4OA 2QOLA 4QMWA 2GHGA 4I5CA 4RFZA 2LGCA 4H36A 4JOAA 4QQTA 4LV5A 2GNGA 3NUAA 1IRKA 4FTKA 5ANGA 2IWIA 3UC4A 3UOJA 1UKIA 1ZYJA 3FY2A 4XX9A 3BQRA 4EK8A 4PP7A 3U6HA 3Q5IA 2PK9A 5KNJA 1H00A 2E9NA 2J6MA 3FXWA 4FKUA 4FYOA 1J1CA 4PV0A 4BYIA 4QP3A 1DAWA 2QOKA 4ZSJA 3OW4A 5H9BA 4CV9A 3CE3A 2VO6A 5HE0A 2Y8OA 3IGGA 3U4WA 3CGOA 3WF5A 5CSHA 4B7TA 2C5XA 5E8VA 4MYGA 4P7EA 1MRUA 3VF9A 4FUYA 1WFCA 4L43A 5HCZA 4K1BA 2R3NA 4QPSA 4TXCA 4FTIA 4E26A 3SW7A 3PWYA 3ZLXA 3ZSGA 3WE4A 4YLLA 4OTFA 1Q97A 3QKKA 3F69A 1WBNA 3WILA 3MSSA 4FV1A 4RWKA 5CTPA 3VRYA 4FEWA 2PMNX 4ACCA 2OFUA 1UWJA 4HYUA 4MTAA 2CGWA 4RJ6A 3V5JA 3RPYA 4FEXA 4W9WA 3UNZA 3OD6X 3KMWA 4IM2A 2JD5A 2XVDA 2WTJA 1PMEA 5DBXA 1PXIA 2C5NA 3VUTA 1PKDA 3KY2A 1PMNA 1URCA 4HW7A 3O51A 4OBOA 2IPXA 3IGOA 1P5EA 1UU8A 2YFXA 4L45A 2PZYA 2B9FA 5M51A 4DE4A 4EK4A 4JAJA 4FG8A 1KSWA 2FB8A 2QO2A 1QMZA 1YW2A 2RFEA 2W7XA 3C0HA 3QZGA 4AE9A 1GAGA 5BVOA 3HUCA 3RK5A 1JWHA 1YXXA 4EH3A 5IDNA 2WELA 4TWOA 4R8QA 4FV7A 4E6CA 5L8KA 2PVNA 5BYLA 5CI7A 5JKGA 3EL8A 1PW2A 2CGVA 1QPJA 2VTJA 4YJPA 4LRMA 2J50A 2ITVA 4RC3A 4C8BA 3W33A 3LMGA 4OW8A 4FT7A 3OW3A 4UN0C 1FVRA 3UP7A 3BRBA 3ORLA 3R01A 1BKXA 3CPBA 3ORNA 2WMQA 4JJRA 2PU8A 1OIYA 4GVJA 3F2RA 3P0MA 3RZBA 1Q24A 2HK5A 2WTVA 5AM6A 2GQGA 2JLDA 3V8WA 2IG7A 3EFWA 3QC4A 1AGWA 1YXTA 4G3EA 3V5PA 5JFXA 5J5SA 3NNXA 5CU3A 2XCKA 3L9NA 5HIBA 2HY0A 3MBLA 2B52A 4N70A 3RVGA 4E6AA 2PYWA 5JQ8A 2P33A 5CYIA 4I6HA 4YJUA 5AADA 2OFVA 5AEPA 2H34A 4HCVA 3V3VA 1AD5A 3KEXA 1CKJA 3KFAA 3KN6A 2CKEA 3A2CA 3SXRA 1RJBA 1S9JA 2JEDA 2WMBA 3QUEA 3RKBA 2XKDA 3LW0A 3ENMA 1PJKA 2H8HA 4FMQA 4RIXA 5AWMA 3IDBA 1OVEA 4UMUA 5ANEA 3VN9A 4IB0A 3CKWA 4XP2A 2XH5A 2BZIB 4FSNA 5B2KA 2I6LA 2GHLA 4FTJA 1I44A 1UU3A 4IX4A 4UYAA 3CEKA 3QL8A 2WTWA 5IEXA 1A06A 3HVCA 4ENXA 5I9UA 2JDOA 3GCSA 3ZXZA 3L8VA 1KV2A 2UZUE 1PRYA 3TM0A 5GIPE 4FV6A 4DFLA 4D2SA 4AGCA 5I9VA 3A7IA 1Y57A 5KUPA 2QOFA 3RPVA 3SHEA 1OZ1A 4JIAA 1WBVA 5FM3A 3NW5A 4YBJA 4RVTA 2EXMA 2HWOA 3LFEA 4WBOA 5EM8A 2OJ9A 4ZTMA 4CG8A 3ZM4A 3CQWA 3O7LB 4YURA 2ITWA 3GU5A 5HU9A 4O82A 3MH2A 5CLPA 2WOTA 2W05A 3KF4A 4TWCA 4D5HA 4O7NA 2FVDA 3OVVA 5EDPA 4FKTA 5HO6A 3WF9A 1O6KA 2ZM1A 3A7FA 3KRXA 3QGYA 3KU2A 4M0ZA 3E3PA 4QMYA 2AUHA 5G1XA 4D2VA 5I9ZA 4NW6A 4WNMA 3BE2A 3QTQA 4IZAA 3HP5A 1OL7A 4DH7A 1MP8A 4J8MA 2GQRA 4EH8A 4MBLA 3R9RA 3EH9A 2JIVA 1Y6BA 4DINA 4PP9A 4A9YA 4O7WA 2G1TA 3PJ3A 4O91A 2XYUA 3EFKA 3QZFA 5C26A 1OBGA 1UA2A 1WBTA 3GVUA 4DG2E 5I0BA 2WMAA 5IQHA 4F08A 2XK9A 3LM5A 4C4JA 4R3PA 4QMZA 2OJFE 4X21A 3WF7A 4R3RA 4ASEA 3DK3A 5EYDA 5KX8A 2FH9A 5AUVA 4FEQA 3PXQA 4JL9A 4BL1A 2YEXA 3Q53A 4F70A 3DBCA 2O0UA 5CF4A 5KBRA 1LUFA 4IHPA 2ITXA 3R7YA 4M97A 2RFSA 1R0EA 2BDJA 4O2ZA 4BTFA 4D2PA 4DFNA 5KMNA 4Y73A 2JFLA 2ITTA 2PMIA 1H1SA 2YACA 3K3IA 3FDNA 4I23A 3AT4A 4NUSA 2OW3A 3WZEA 4MQ2A 3ZS5A 3OY3A 3E63A 5LMAA 3PY1A 2PE2A 3Q6WA 3A7JA 4QYEA 3VO3A 4BKYA 4X0MA 2QOIA 4O22A 2CMWA 2J4ZA 2OICA 3LXKA 3CTJA 4EK5A 1KE9A 4OTQA 4A9SA 3SQQA 3P08A 4HZRA 1OECA 4JBQA 2BKZA 2BROA 2XNOA 3G90X 4LOPA 4QNAA 5AP4A 4R1VA 2P4IA 3K2LA 4EKKA 4GUBA 4DEEA 3O7LD 3QRJA 4GK2A 5A9UA 3UQCA 5HZNA 4GKIA 4FKOA 2YISA 3PRIA 1H27A 2BTSA 1GNGA 2GMXA 2WPAA 4TL0A 3FL5A 1PKGA 2C6MA 2ITYA 1JNKA 4TPTA 4APCA 3DBFA 3FQEA 4M69B 4NW5A 4JQ8A 1YVJA 3VS4A 4FGBA 5AJQA 1QPDA 4JDHA 4DT9A 1YQJA 2Y4IB 3PIYA 1XBAA 3HRBA 4TN6A 3D94A 3TEIA 2HY81 4BKJA 2YIQA 2IN6A 4NM3A 2BIYA 3F5XA 4BTKA 4FTTA 5EOLA 2JC6A 2ZYBA 5E90A 4FVQA 4BHZA 3KMMA 3LOKA 4BBFA 3FSFA 4HVSA 3QCSA 3KVWA 5HIEA 1JSUA 4RIWB 4HPTE 4GYGA 2W1GA 2VWUA 2R3PA 3AC1A 4C4GA 1PY5A 1QL6A 3HNGA 2XK4A 3P7CA 3C5IA 3DAEA 3R7OA 4G6NA 5J1WA 4RX7A 3DU8A 4U41A 3WI6A 5BMMA 3QALE 4ZAUA 4RIOA 4XG9A 5M07A 5B2MA 4YZ9A 2WTKB 3LFBA 2QONA 2QHNA 4JT3A 1H08A 4BDAA 4LG4A 3COHA 1OMWA 4RIWA 4UMQA 5AR2A 4APPA 4K6ZA 2CCHA 1ZMWA 1WCCA 3KXXA 4GIIA 5HNGA 4FK3A 4XG3A 4CVAA 2AC5A 2W9FB 3FUPA 4O86A 4PL5A 5E1EA 5M57A 3FJQE 4QMMA 3BQCA 5IA2A 4FSZA 4KSQA 5EH0A 2YM3A 5IQFA 3VS0A 4BICA 3ZFMA 3SG9A 5DH3A 4E3CA 3F5PA 2HXLA 1YKRA 3I6WA 4XMOA 2PVFA 4FTUA 3SW4A 4Z7GA 3PPKA 3A99A 1LR4A 4FUXA 5LWMA 1A48A 4AZSA 3RK9A 2ZV7A 1Q8YA 1SNUA 4DLIA 4MX9A 5KBQA 4FSMA 4I93A 1OL2A 4PWNA 4DGNA 4RZVA 4OTHA 4PPCA 2EVAA 2UVYA 2W5HA 3CGFA 3QLFA 1PMUA 2EUFB 3PRFA 2GFSA 2IW6A 4WNPA 2QO9A 3AMYA 2PUNA 1SVHA 4OGRA 3N51A 4U42A 5DI1A 5K0XA 3FEGA 2WTIA 2QG7A 4HJOA 4FODA 3FLNC 4IFCA 3F7ZA 4CTCA 2OF4A 3HLLA 1XH6A 3EN4A 2UV2A 4FI1A 4Q5HA 4DF3A 4ZSLA 2YJRA 3SVVA 3ZSHA 4YJRA 3R7UA 3IK3A 3QD4A 4RJ7A 2C0IA 2VTOA 3DK7A 3V6RA 4EC8A 4ZSGA 4CYJA 4LMUA 3VUHA 1KE5A 2J5EA 5HD4A 4MXAA 2HOGA 3LFSA 4EH5A 4I5MA 3MS9A 3P7BA 3BEGA 2Z7QA 5E8TA 4RX9A 5FUTA 4UXLA 1GY3A 3DOGA 3UBDA 1Q61A 4ANOA 4CFNA 3SOCA 3QUPA 5M4CA 4PUZA 5ETFA 4J96A 4LGGA 5EHLA 4AU8A 4XV2A 4CFXA 3QZIA 4UWBA 5HQ0A 3CJFA 4M66A 3GB2A 4FV0A 3EFLA 1M52A 4EK3A 2UW5A 1Q8ZA 1WVYA 1XH5A 3D83A 1OUKA 4DFYA 5IUIA 1REKA 2GNIA 4IEBA 3U87A 2BAQA 1JAMA 5I9XA 3HX4A 1BX6A 3CP9A 4KNBA 4I41A 4GUEA 4LRJA 3H10A 4YZCA 3MY1A 3HV6A 3ORIA 3PXKA 2W9ZB 3SLSA 4F6SA 4FR4A 4W8DA 4E5AX 3W10A 5E92A 3OXIA 2C47A 2G2IA 5CU4A 3TT0A 5CNOA 4W4WA 5DT3A 2CHLA 3HV7A 3B8QA 3DFAA 3ATTA 5CEKA 4XOYA 1UNGA 3VULA 2C5YA 3CTQA 4IAYA 3F66A 2PVMA 3HV4A 4RG0A 3AD6A 4ITHA 4H3PA 4NTTA 1W82A 3ZBFA 3SG8A 5CU6A 5IEVA 4BZOA 3TTIA 1U54A 2BAKA 3VWAA 4MK0A 5DR6A 3RHXA 3BHTA 2FUMA 3NSZA 2R7IA 5JH6A 3D2IA 4XCUA 5ITAA 4UY9A 2W1IA 3PVGA 3QX4A 4EEVA 3TJDA 3MIYA 3E64A 5L8JA 4FT0A 1MQ4A 3NUXA 2PULA 3GUBA 4D2WA 3FLQA 5CS6A 2BCJA 5JN2A 2BPMA 2WMWA 4YTHA 5CF8A 4AW5A 2PVLA 5HICA 3V04A 3V8TA 5CEMA 1BL7A 3Q96A 4UMRA 3V5TA 5KZIA 2UZTA 3HECA 5TKDA 1M2RA 2ERKA 4XUFA 3QTWA 2XBJA 2HELA 2A4LA 2VRXA 3BI6A 3KB7A 4OBQA 3HAVA 4IM0A 3BELA 3LCSA 1MRVA 3LFCA 1PXNA 4V05A 2OJIA 4MXOA 3OCGA 4QMSA 3O17A 4HPUE 3EFJA 5I3OA 4BI1A 2YZAA 4O1OA 4I22A 3BWJA 3FI3A 3EWHA 3VBVA 4BTJA 4IACA 4IZYA 2RL5A 3P79A 2OK1A 5EYMA 2QLQA 4O6EA 5AFVA 4MWIA 2ETMA 4HYIA 1ZARA 2V7OA 5DPVA 2XEYA 3UOLA 3TDWA 4FKVA 4FTRA 3DLSA 4FV9A 3QTIA 4C7TA 1L8TA 3PPJA 2R7BA 5EDRA 4A4OA 4JBVA 4HYHA 4EH6A 3CXWA 3MVHA 3S1HA 2PPQA 4QYGA 1YWVA 4H1MA 3TG1A 3F3TA 4G16A 2Z7SA 3K5VA 4EYMA 4O0TA 2CLQA 5HTCA 1ZYCA 4WG4A 2BRNA 3FHRA 4XG8A 5FM2A 4AF3A 5D11A 4AUAA 4A9UA 4LI5A 2QOCA 3OT8A 1FINA 4J7BA 3UO5A 3DA6A 1B39A 2YDKA 1X8BA 4CZTA 4OTPA 3R9NA 3BX5A 3ZEPA 3C5UA 5CAVA 3QQJA 3FZRA 2HZIA 4I24A 4OR5A 3MPAA 2JFMA 4K77A 1WVWA 4QTEA 3QX2A 4C57A 2GS6A 4XV3A 3VS3A 3JS2A 3HUBA 5E8UA 3EKNA 2J0IA 2I0VA 5EW9A 4BCHA 5BUIA 5CANA 3LKMA 2HENA 5EW3A 2OWBA 4GK3A 4JR3A 2UW7A 4OT6A 3RWQA 5BNJA 5CAUA 2ONLC 4EOLA 3TZ7A 3NYOA 5HHWA 2Z02A 3AC3A 5IUGA 4HVDA 3UC3A 4WUNA 4AQCA 4Y5HA 1V0PA 4GW8A 4BCKA 2YIYA 3R1QA 4S2ZA 5FP6A 3TI1A 3GQIA 4NH1A 2PTKA 3POOA 4UYNA 2HZ4A 3GCQA 5FXRA 3FZOA 3EMGA 3BHYA 4RPVA 3R9OA 2WMUA 2SRCA 4IE9A 3PJ2A 3F5GA 3TUDA 4GH2A 3FPMA 4GV1A 3G9NA 1OL6A 3T9IA 4DAWA 5LJJA 2R3OA 3DKCA 3R1NA 3R00A 1ZLTA 4HOKA 3PJ8A 3F3WA 2VTLA 4ANSA 4OTWA 4FBXA 1J91A 2YITA 3TKIA 1IR3A 4CEGA 3MY5A 2WMXA 3FI2A 3F61A 3GBZA 4F6WA 4EZ7A 3A62A 1Q4LA 4FOBA 3DQWA 3UP2A 4C36A 3NUUA 2XIRA 3QTRA 4YC3A 4I0SA 4YHJA 4ZMEA 2IVTA 1FPUA 3LLAA 3U6IA 1UV5A 3TDVA 3D5WA 4XG6A 2PE0A 5AP7A 1ZOHA 4YJOA 4IWQA 2OF2A 3R02A 4ANQA 5FTGA 3BKBA 5M09A 3ORMA 4ALVA 5IQEA 1YHSA 4H3BA 4AE6A 4FSWA 3ANQA 3GCPA 3F5UA 4O0SA 4EORA 5FEDA 3RZFA 5CAPA 2VX3A 2ZV2A 3EQHA 5BYZA 3A61A 3LQ3A 3H4JA 2JGZA 3QAME 3ODZX 4QTBA 3UIXA 4MHAA 2UW6A 4AGWA 4AT3A 1M7QA 3E8NA 4FICA 4GRBA 3V5LA 2W4JA 2GS7A 2ZM3A 3FAAA 2OO8X 3O50A 1SMHA 4G3CA 1QPEA 4Q9SA 5HI2A 5TE0A 3R6XA 3F82A 4ANBA 3BZ3A 1RW8A 1YXUA 2VGOA 5AP2A 2ZAZA 5T68A 3DBQA 5EI8A 3O71A 2VTTA 4WA9A 3RPRA 4IJ9A 2VWZA 4ZZNA 4O81A 2J7TA 3NEWA 2G2HA 3ZLYA 3BV2A 4E6DA 2C6EA 2X2MA 3PP0A 1YI3A 5JZJA 3NYVA 3CBLA 1LP4A 2W4KA 2VV9A 4HGEA 4BDFA 3FMDA 1UVRA 2OZAA 3CD8A 3I1AA 4YHTA 2W96B 5FGKA 5LCKA 3NNUA 4EJNA 3COKA 5ETAA 3N4TA 3AQVA 3W2PA 4RSSA 5T3QA 2ZVAA 2IJMA 3LAUA 3Q9ZA 2R64A 4GT4A 4I5PA 1WBOA 3ZRKA 4F1OA 4BB4A 4UWCA 3UMWA 3V5QA 2CKPA 3LFAA 4DHFA 2YDIA 3GNIB 4RVMA 4V0GB 2V62A 4ZY6A 4NKAA 3ATSA 4FX3A 3KULB 4YNOA 2VWWA 3OFMA 4FTCA 4PQNA 4JDJA 3UYSA 4TRLA 4I1ZA 3VUGA 3R28A 3TN8A 3FKLA 3R8PA 3W55A 4EKLA 4F9AA 4J98A 4QNYA 4C02A 4M12A 2OZOA 5D41A 3RAIA 5IQDA 4S32A 3K5UA 2XKEA 3KULA 3VBYA 3W8LA 2UZLA 3TNQB 2G15A 3DBEA 3GCVA 3MH0A 1YOJA 4YC6A 4F0GA 2XMYA 4C4EA 3HMIA 5AP0A 2O65A 4J71A 3C4CA 4UEUA 4FTAA 3CPCA 3PA5A 3VBXA 4BVUA 3DXQA 5LQFA 2XK8A 4DGMA 3Q9YA 4TYGA 2WU7A 3WYYA 2YM7A 4WT6A 4Y83A 5EYKA 1JBPE 3LIJA 3NRMA 2AYPA 3ZUTA 4ZTSA 5HG5A 3ZRMA 3KN5A 1FGKA 3JYAA 5DLSA 2ZMDA 5DRDA 1JVPP 5HX6A 4BWXA 3S00A 3FMMA 3T9TA 5IH6A 3RPOA 3DDQA 3HEGA 3KKVA 3TZ9A 2YIWA 4XBUA 3AXWA 1FGIA 2OXXA 4JBOA 1Q3DA 4XLVA 5F4NA 3R9HA 3U9NA 4LM5A 4F64A 4PDYA 4MCVA 2OXDA 2X2LA 1KWPA 4GVAA 3IQ7A 4F09A 3PXZA 5GZ8A 3R7GA 4S34A 4OAUC 1GZOA 3MTFA 4YBKA 4IB3A 3O8PA 4U81A 4OTRA 3TTJA 3K54A 3BCEA 1YWRA 3MGYA 4CQEA 2VTRA 5IG1A 4F9WA 4EYJA 4LL5A 4JQ7A 2BVAA 2I40A 3H9FA 4YTCA 4MNFA 4PF4A 3B2WA 1BUHA 3R2BA 4EUTA 4ZOGA 3CSVA 5BVWA 2QI8A 3Q4TA 2A1AB 1PMVA 4BGQA 2XKCA 3AD5A 3LFFA 1Y6AA 4BCMA 4KABA 3D4QA 4P5QA 4CFMA 5H8EA 2Y9QA 1SM2A 5LCJA 4XV1A 2XNBA 1PYXA 5ANJA 4OLIA 2PMLX 4FKIA 2I0HA 4CT1A 5JZNA 4MKCA 4PTEA 3JR1A 1PXJA 5H3QA 3W16A 2X81A 4XH6A 3BLRA 5L2WA 4NIFB 4EWHA 3FZ1A 4AOTA 1M2PA 2QODA 2X9EA 2C3IB 2ESMA 5F1ZA 5A3XA 4E4MA 4E93A 5M44A 2WKMA 3DGKA 1TQIA 4IBMA 4KIOA 2ITPA 4BTMA 4O0YA 2FSOX 3NIEA 4E1ZA 2C0TA 3UJGA 1BI7A 3KXZA 1XH4A 3M2WA 3HDMA 3VNTA 2GS2A 2ZDUA 4FK6A 5CU0A 1IEPA 2YLEA 3IECA 4I94A 3E5AA 4LMNA 5HCXA 2FA2A 3BHHA 4JRVA 2RSVA 2QOOA 5GJGA 2VO7A 2VWIA 5HVYA 3HMNA 4MXYA 2R2PA 3MJ2A 3VQUA 5AV4A 3HA6A 4X2GA 4AT4A 3NMUF 2B53A 2YM8A 4I4EA 2ITZA 4YLKA 3ORTA 4WKQA 2NRYA 3CLYA 4PTCA 4RJ8A 4TT7A 1CKPA 4ZLYA 3F2AA 3NCGA 4FL1A 4RWIA 3SXSA 3TCPA 4F9BA 1IA9A 2V7AA 3WBLA 4MD7E 1RQQA 3ZUVA 4IW0A 1M7NA 3VBQA 4CFVA 5L2TA 4IX6A 3DXNA 3GC0A 3R2YA 2XNMA 1KOBA 3LMIA 4EOIA 1H01A 2F7ZE 4CD0A 4FT9A 4L9IA 3VJNA 1H0WA 3ZXTA 2Y4IC 3KVXA 3RI1A 3FBVA 3FZTA 4DT8A 2IZRA 4CTBA 4MH7A 4BFMA 2BZKB 2F7XE 5LWNA 4ZTRA 3PSCA 5KMOA 3FI8A 2JKQA 4FSYA 5ANKA 4FC0A 5HLNA 2X9FA 3IW8A 2R3KA 1XBCA 4L7FA 1LEZA 1YHVA 4F7NA 3Q4UA 4NKSA 4CG9A 3FMHA 4XNEA 1W8CA 2UZVA 2BFXA 3LMHA 4F9CA 4F0IA 2G2FA 4HGLA 4YNEA 5GZ9A 4N0SA 5JK3A 4CLIA 5LVPA 4ALWA 2R0UA 1K3AA 4KD1A 3OCTA 2CSNA 4ACDA 5HO7A 3R0TA 2JBPA 5DMZA 2YLFA 2PUUA 4N6ZA 2WTKC 5H8GA 4TYHB 3ODYX 5CALA 2ZMCA 3ORXA 3NDMA 2UW8A 3R8UA 2BALA 3KGAA 4WSYA 5A4LA 4ZJIA 4RA5A 3QWJA 4TWNA 5CEOA 2JKKA 3MTLA 4C2VA 3GU4A 4I92A 4KBAA 4XG4A 5IA5A 1W98A 5ETCA 3UIBA 4DG0E 3CD3A 5A6NA 4TYHA 2WD1A 3CS9A 2F9GA 5CX9A 4RZWA 1YXVA 1OBDA 2ERZE 3EKKA 3EQGA 3QCYA 1T46A 3VS2A 2CN5A 1Q8WA 2VTMA 2X8DA 3OROA 4GFOA 2PVJA 3CJGA 2YCRA 3P9JA 4R5SA 5FEQA 5M4FA 5IQBA 2J90A 3DLZA 2C0OA 4NZWB 3COIA 4AFJA 2YHVA 3H30A 4RLLA 4QYYA 4IDVA 4PL4A 4DFXE 3DFCB 2B55A 1GIIA 2FYSA 2WQNA 2UW4A 2W1FA 3TKHA 1VJYA 5BPYA 3UVRA 4E5BA 4M14A 4KSPA 4MD9E 4DTBA 3OBJA 1YDTE 4IJPA 1XH7A 1OL5A 3R83A 4EL9A 3LM0A 3AT3A 4FVPA 1K9AA 3HP2A 1E9HA 4UBAA 4L6QA 3UZRA 3RPSA 5FEEA 4FIIA 5C9CA 1JKLA 1ERKA 4CMOA 5E9EA 5EKOA 2PHKA 4O6LA 4YTIA 4WIHA 1VZOA 3MV5A 2BHHA 4I4FA 2CGUA 2YZLA 3FYKX 5CASA 3W2OA 2XA4A 3C50A 2BZJA 3BWFA 2X6EA 3EIDA 3RNYA 4S30A 2GU8A 5CSWA 4ACHA 1P4FA 4DEIA 3G6HA 3MVLA 4MVFA 4R3CA 4FYNA 3L9MA 3SRVB 2XRWA 3PG3A 4CMTA 3QCXA 4IVBA 3FWQA 5AA8A 5JT2A 3DB6A 3TV4A 3C4WA 4N6YA 1DS5A 1U59A 4IADA 4O27B 4U3YA 5D12A 2OSCA 4O7VA 4BDEA 2ZV9A 4J99A 1UWHA 3LXLA 4JG6A 3AC8A 4M15A 3DZOA 5FDXA 3W2QA 3E7OA 2XK3A 5AAGA 4IX3A 4GJ2A 1U4DA 4BF2A 2QURA 2YJSA 4QQ5A 3OY1A 4U7ZA 5CVGA 4BBEA 3VS6A 3C51A 3LPBA 4RGJA 3ID6C 3QD3A 5HG7A 2YDJA 2XIKA 4GT3A 5IQGA 4O7LA 5IEYA 3IW7A 4UZDA 4EJ7A 3I0OA 4S33A 3ROYA 4Z3VA 1SZMA 2KULA 4U3ZA 5D7VA 3MH1A 2OIQA 5AX9A 4QRCA 4RMZA 4USEA 3OG7A 4BCIA 4RFMA 4G6OA 3ZFXA 2QU6A 3BV3A 3OCBA 4XG2A 2BDFA 4M69A 4AZVA 2O5KA 4C0TA 3OCSA 4O7ZA 5IA1A 4ITJA 2J2IB 1MRYA 4DEDA 3QQHA 4ASDA 1HCLA 1PXPA 1H25A 2KTYA 2BZHB 4BDIA 5K0KA 3PLSA 5F95A 4EOKA 3Q3BA 5AP6A 4G5JA 4PX6A 1J7IA 2C68A 3U51A 2GNJA 1JSTA 4JS8A 5J5TA 3OBGA 2IVVA 3SD0A 3C1XA 4QMXA 2PVHA 4TY1A 4QYFA 5JSMA 3A4PA 3FC2A 1XJDA 5M53A 2QR8A 1KE7A 4PL3A 2Z7RA 4BCPA 1ZMVA 4LUDA 4CRSA 5C4KA 2I0YA 3QTSA 5LVLA 2R4BA 1E1XA 1XH9A 3PA3A 5DWRA 2QOQA 2Z2WA 3WARA 3RCDA 4NYEA 2EB3A 3VW6A 1XKKA 3PZEA 5CF5A 4JG8A 2GPHA 3EZRA 4R77A 2X7GA 1WMKA 5LMBA 2WMVA 3G2FA 3OTVA 3DKOA 3AC2A 4USDA 3ACKA 4YZDA 4JR7A 3IKAA 5HOAA 3GEQA 2E9OA 2OU7A 3N9XA 4CSVA 2FSTX 1VYWA 2BRHA 2Q0BA 4AX8A 5AR7A 3BYUA 4K33A 2O2UA 5EQEA 5AUZA 3U55A 3NIZA 3RAHA 4M3QA 2UW9A 5FD2A 2PSQA 1E1VA 3KRRA 3FMEA 4CT2A 3QHWA 4EQUA 5A54A 4IIRA 3UE4A 5E8WA 3G5DA 5ACKA 3FLZA 3GU6A 4O2PA 3NYXA 4E4NA 3ALNA 5FRIA 3QBNA 5DIAA 4FV3A 2C5OA 1Z5MA 3CTHA 3HV3A 1DM2A 5JGAA 3OF0A 1BL6A 3PVUA 4X3FC 4W8EA 2BFYA 4DEGA 5CF6A 5DVRA 3FSKA 5AR5A 5GHVA 3Q4ZA 2JDTA 4GIHA 3RM6A 3U9CA 1XH8A 2ZB1A 4BI2A 3E62A 3LE6A 3R04A 2X1NA 2EXEA 3RAKA 1OGUA 4CCBA 1KE8A 5HCYA 3I6UA 3JPVA 3MWUA 2J0JA 2J0MB 4RWLA 5E1SA 4A4LA 3A4OX 4WRSA 3NPCA 5AV0A 3VW8A 4B8MA 1QPCA 5L6PA 1V1KA 2XJ0A 5IH4A 3V51A 3TZMA 3OOMA 3DY7A 4MQ1A 4U44A 4PDOA 3E7VA 1MUOA 2R3HA 3ETAA 3NAYA 3QU0A 4XJ0A 3IDCA 1W7HA 4S31A 4A7CA 4BC6A 3DTWA 3LCDA 3GGFA 1KV1A 4E8AA 2X7OA 4UMTA 3BU6A 3R8ZA 5A14A 1KOAA 4AA0A 4OAVB 1J7UA 2WEVA 3QQGA 5C1QB 3PG1A 2VX0A 4IB1A 4DLJA 3EQBA 5HE3A 1TKIA 1H26A 5HG9A 3A8WA 5CU2A 3PIXA 5C03A 4KIPA 3DB8A 4C35A 2Y6MA 4GCJA 4KRDA 4RC4A 1OM1A 4UXQA 3OXZA 5DOSA 3LFQA 2VWYA 5EW8A 4EK6A 4KKEA 4KS8A 4BIEA 5IA3A 4U0IA 3BE9A 3PVBA 3OWLA 4BR3A 1H07A 3CCNA 3ZUUA 4PMMA 3ZHPC 3FXZA 3RAWA 3OUNB 3IOKA 1JLUE 2JIIA 5IMXA 4C3FA 2VN9A 1NVQA 2HWPA 4B99A 3PXRA 5ICPA 4RJ5A 3BGPA 3C4ZA 5TR6A 3KXNA 4XBRA 5CEPA 4BY9E 2C4GA 3RNIA 2R3RA 3R7IA 4D4SA 3PPZA 4CFUA 5JMSA 1ZZ2A 1K2PA 3CQUA 3QQLA 3EN7A 4IWDA 2WNTA 2XKFA 3TZ8A 3H9OA 4IC7A 4U5JA 4CV8A 4C58A 3ZM9A 4TZRA 3MW1A 3IG7A 5J79A 4K11A 4YSMA 4DBXA 4YU2A 3G51A 3WOWA 4HVIA 2OKRA 3NUYA 2WTCA 3IS5A 4O0WA 4C38A 4GYIA 5HIDA 2QQ7A 2UZOA 4N57A 3TACA 1PXOA 3VHEA 1LEWA 4PNIA 3DTCA 5AUXA 3VS7A 4ZLOA 3WF6A 5IH5A 2ZDTA 4NM0A 4GG5A 3R73A 2WOUA 2VTAA 4RC2A 4YJSA 4QP2A 2XNEA 3NWWA 3WIGA 3EQDA 3V8SA 3MB7A 4AOIA 4G6LA 3TKUA 1T45A 2B4SB 4EHEA 3G0EA 4BWKA 1BLXA 3P86A 1FMKA 2YCFA 1O6LA 1HCKA 1YI4A 2OBJA 3BYMA 3ZO4A 3C13A 5K4JA 3Q9XA 5DR2A 1YOMA 1OB3A 3F3ZA 4H05A 4RQKA 5BUEA 1GZKA 4JXFA 2H6DA 5DN3A 1XO2B 4RLKA 5M4UA 1FVTA 5AIRA 4ZEGA 5JFVA 4TW9A 2BILB 3TIZA 1CKIA 3ORZA 4QMNA 3U54A 4Z9LA 1H24A 2YM5A 3E87A 4QP6A 4GFMA 5ACBC 3EN9A 2BKKA 3K3JA 1JPAA 5K9IA 2XIXA 4BBMA 2P3GX 4KIKB 2CNUA 2QOHA 4JG7A 2X6DA 3QYWA 4FTLA 5M56A 4MF0A 3R21A 1ZOGA 3BLQA 4P90A 5CVFA 2F2UA 3U4UA 3UMXA 4JQEA 4R5YA 2CKQA 5DYJA 4II5A 5DFPA 5EQYA 3H0YA 4J95A 4X3FB 5E4HA 3PVWA 4CZYB 5AX3A 4XV9A 3R7VA 5CWZA 2JITA 5TO8A 4DG3E 4YZBA 4ZY4A 4E5WA 1KE6A 4WNKA 4BGGA 4ERKA 3L9LA 1H1QA 4D55A 3R1SA 3L8SA 3NR9A 2I0EA 3OEZA 3QYZA 4X3FA 2IZTA 3COMA 5HG8A 3DJ7A 4YO6A 4C4IA 4R1YA 3DNEA 1ZAOA 5C8KA 3VAPA 5DNRA 4WG5A 3UG2A 4JIKA 3GXLA 2WO6A 2IW9A 4BCGA 3TL8A 3C4EA 4D58A 2XIZA 3Q4CA 4PMPA 4RBLA 4O7TA 3QTZA 3TNIA 4OT5A 4MNEB 2ETRA 2GNHA 2R3MA 3M11A 5EM5A 1M17A 3P5KA 5K3YA 4E4XA 3CY3A 5HE2A 3D7ZA 3O23A 5HTBA 4AGUA 5A4TA 4FZDB 2UZBA 3CY2A 4D2TA 1U5RA 2R3QA 3VS5A 4H3QA 5IISA 4TNBA 3RP9A 4AOJA 2W17A 5FP5A 3DDPA 1OIUA 3ULZA 3A7HA 2LAVA 4MNEA 3E8CA 3D5UA 4MXCA 2OI4X 2PUIA 3EQFA 5CZIA 5AM7A 3N4VA 5CT7A 3PE2A 2WU6A 4YTFA 2EB2A 2JBOA 3LJ2A 3HMPA 2DQ7X 2YCSA 3OHTA 5DR9A 3LFDA 3VUIA 4BHNA 3DK6A 5B2LA 4X7QA 5L6OA 3KRJA 5BVFA 1ND4A 1NVRA 3OWJA 3NX8A 5KMJA 3DNDA 4FTQA 4V01A 3MN3A 4D1ZA 1PXLA 4L8MA 5KKRB 3ZO1A 5BYYA 4TYJA 4ENYA 4KKGA 4ZTNA 4FT5A 2OIBA 2BRGA 2A2AA 4UX9A 3FKOA 3ENHA 5L3AA 4ZMFA 4BWPA 4EUUA 5BX0A 4EZ5A 2C1AA 2WQOA 2GTNA 2EWAA 3DPKA 3E8DA 3BGQA 3VJOA 4R78A 2C69A 5CEIA 1REJA 5AUWA 3KF7A 4F7JA 3WIKA 3FPQA 2X39A 3FLYA 5J87A 4AFEA 1GIHA 5IMEA 4YHFA 3QC9A 4AN9A 4YZNA 3MDYA 1HOWA 4X2NA 5L2QA 3UOHA 2XJ1A 2RF9A 3FE3A 4QO9A 3G33A 5FXQA 2HCKA 4RJ4A 4EOPA 5DT0A 1WBSA 2X0GA 4FTMA 3EN5A 2WQMA 4M7IA 3FI4A 3ZU7A 4BDDA 3Q04A 1ZY5A 1RE8A 4FTOA 4O83A 4GK4A 3TUBA 4D28A 5AP1A 2YIRA 3C9WA 2ZB0A 2GDOA 2JDSA 5HO8A 4F4PA 3KXHA 1UNLA 4CNHA 2EXCX 4PDPA 4DGLC 4KUJA 4G3GA 3KK8A 4PRJA 4O7YA 3IDPA 2IZSA 2W1EA 1WVXA 3ORPA 5CT0A 5LARA 3F2NA 3EL7A 3UQGA 4LGDA 4EI4A 2WHBA 2B9IA 4FSTA 3LCOA 1U46A 3G9LX 5GJDA 2G9XA 1YHWA 4FZ7A 3KREA 4KWPA 1W0XC 3I5ZA 3FHIA 3E3BX 3KL8A 5AP3A 4DCEA 4F6UA 4RIYB 2W99B 4F7SA 5DE2A 4DEBA 4FSQA 3LFNA 4IAIA 5EM6A 3R8VA 4AZWA 5JEBA 4TYIA 3MY0A 4C62A 3OTUA 1JKSA 4YJQA 2QU5A 3FLWA 4HVGA 4E20A 1WBWA 2V22A 3W2SA 2W06A 5AUUA 4DGGA 1OPKA 5CVHA 4EBVA 3KRLA 4RIYA 2VWBA 4DGOA 4C3RA 5KMMA 4DN5A 4FVRA 4B9DA 2C1BA 2XYNA 2YCQA 3DT1A 4PMTA 4XP3A 3S95A 1MQBA 3RMFA 3MPMA 4QMLA 3DJ6A 2HYYA 4FNXA 4G9CA 5E8XA 4MBIA 2UZNA 4V0GA 2VTSA 4MEDA 2C30A 4XS2A 3UIUA 1NXKA 4FE2A 4RWJA 3O8UA 3Q32A 4QT1A 3GOPA 3ZLSA 4FSRA 4D9TA 5BUJA 3EHAA 5I3RA 4FL3A 2W1CA 4YJVA 4BIDA 3QHRA 3DKFA 3H3CA 5DRBA 4IAZA 4JBPA 1V0OA 4ACMA 4EHGA 2Y7JA 4FZFB 2Z60A 2J0KA 4I6QA 5DT4A 3ULIA 4JDKA 3JUHA 4DFBA 4HZSA 1APME 2W5AA 3TWJA 3OS3A 5JGDA 1OPJA 2XP2A 4B6LA 5EI6A 4Z55A 3OT3A 3ZZWA 1Q8UA 5I5ZA 4IQ6A 1STCE 3UZPA 1U5QA 2CKOA 4D0WA 2CCIA 4YUQA 5HTIA 3HL7A 2QG5A 2YM6A 4W4VA 1H28A 1J3HA 2FGIA 5CNNA 3BBWA 2HIWA 4X2KA 2O3PA 3ZZEA 3VQHA 2OJJA 5D7AA 5EHOA 4U40A 3L9PA 4NM5A 5LVMA 3O96A 4A06A 5DA3A 3UDBA 1GJOA 4CGAA 5AR4A 4FA2A 2O8YA 4J1RA 3AD4A 2Q0NA 1NW1A 3FQHA 4C33A 2V0DA 1Y8YA 3E92A 3F88A 4GT5A 2VU3A 2JAVA 3B2TA 3VVHA 4NFMA 3LLTA 2WFYA 3BLHA 4QP9A 3SDJA 2QO7A 4XRJA 2RGPA 5HX8A 3PLAE 2GFCA 2HAKA 4FL2A 2JAMA 1R0PA 4FKJA 3EJ1A 4Q5EA 5EK7A 4YO4A 4AXAA 2O64A 3A8XA 3AC4A 3QRUA 4IAAA 4Y72A 3S0OA 2X4ZA 2R3LA 4UMPA 5AV2A 4YR8A 3UVPA 3S2PA 2WQBA 2XEZA 1YI6A 5GJFA 5KHWA 3QA8A 3EQIA 5AR3A 5J9ZA 2FSMX 3T8OA 4L3JA 3PTGA 3R8LA 4PTGA 3G6GA 4JI9A 4GEOA 1ZZLA 3FYJX 3TXOA 5F9EA 1VYZA 5TT7A 4LOOA 4U97A 2NO3A 4B4LA 2XF0A 2OLCA 3HMOA 3BU5A 3GI3A 3C7QA 4AGDA 1GZ8A 4DH5A 4GKHA 1GOLA 2VTPA 3KK9A 2XS0A 3NGAA 2XIYA 2HW7A 5ANDA 4IB5A 4EONA 3HDNA 2PMOX 3ALOA 1CM8A 3UO4A 2Y4PA 1JSVA 4YMJA 5FTQA 3OP5A 3Q6UA 4RVLA 3PZHA 4JLCA 3VUKA 5A4EA 3UQFA 4IMYA 2A19B 2VTNA 2BRMA 3UPZA 4NIFA 4FSUA 4LFIA 4WG3A 2J51A 4BCFA 5E8YA 3DV3A 3MYGA 3Q2JA 5L4QA 2RKUA 3DJ5A 4AN3A 3DKGA 2XJ2A 5DHJA 3CKXA 4DBNA 3V01A 2ITOA 3I5NA 2X8IA 1TQMA 4ONAA 4RT7A 2VTHA 1B6CB 4H39A 3W8QA 4USFA 5HNIX 4K18A 3AG9A 4N4SA 4LYNA 4QP4A 2XZSA 3ZO2A 5K4IA 3P23A 2HXQA 3I79A 3QD0A 3BHVA 3NW7A 3HMMA 4DH1A 1SVEA 4MXXA 5EYCA 4A4XA 3QLGA 3UOKA 1UNHA 1P14A 3LJ0A 4O96A 4X3JA 5IQAA 2OGVA 3OOGA 2F2CB 3FXXA 3W2CA 2Z7LA 4ID7A 2RFNA 5KMLA 4PDSA 2NP8A 4I5HA 4ARKA 4HGSA 1UU7A 4QP8A 1CTPE 1DI9A 3P7AA 1NVSA 2P0CA 4L67A 2C6KA 4WHZA 5M55A 4BI0A 4CRLA 3MPTA 2BR1A 3C0IA 1V0BA 3HZTA 2E2BA 2E9UA 3HV5A 5FXSA 3NVMB 3G0FA 4TYEA 3LVPA 4IX5A 3RALA 3MIAA 1VEBA 5BVDA 2GTMA 3AGMA 2YAKA 4G1WA 4QMOA 5IA4A 4PPAA 1PHKA 2Q83A 2P2IA 3UIMA 3ZBXA 4F0FA 4ACGA 5DG5A 5CENA 4KBKA 5CZHA 4R7BA 4PY1A 5EG3A 2PVKA 4CQGA 3REPA 2QKWB 2XNPA 2XRUA 4FIGA 4JAIA 3IW4A 2J0LA 4UWYA 3RM7A 5HE1A 2WMSA 2XCHA 1TQPA 2P55A 3L1SA 4YP8A 1BYGA 2GCDA 4CLJA 4FF8A 4M13A 4RIXB 3LHJA 3FMNA 1IAJA 2YWVA 2AC3A 4U80A 4IVDA 5AP5A 5JFWA 2IZUA 3BPRA 5L2IA 3F3VA 2JKMA 1UU9A 4FEVA 3OZ6A 1ZMUA 5JFSA 2BHEA 4BIBA 4CYIA 1G8SA 4GSBA 4L7SA 4EQMA 2NPQA 4NJDA 4Y95A 5IQCA 1R3CA 3VC4A 4LGHA 1H4LA 2VNWA 4AACA 1RDQE 2FSLX 4ZTLA 3R30A 4JX3A 3HA8A 1O6YA 4MF1A 3PJCA 4O0RA 4U45A 2R9SA 3DXPA
chains in the Genus database with same CATH superfamily
1H1PA 2UUEA 4B0GA 2YN8A 5IPJA 4TTHB 1YOLA 1JOWB 3F7WA 4RFYA 3BYSA 2W1DA 1Y91A 2ITNA 2QC6A 5A46A 5HBEA 3NVKI 1OKYA 5F20A 3SKCA 3ZYAA 3W2RA 2WTDA 1XWSA 2UW3A 3OC1A 3I7BA 5KMKA 3DCVA 3RBWA 1ZYDA 3JVRA 4M68A 2ZJWA 2JDRA 1FMOE 5EQPA 4W4XA 5LXMA 3ERKA 3HGKA 4QP1A 4UZHA 1R78A 3AT2A 4XG7A 3ANRA 4WOVA 3MI9A 4O0XA 1OIRA 4IM3A 4LV8A 5C27A 1YWNA 3MFTA 3JY9A 3L8XA 2XK6A 5FTOA 4Y46A 3P78A 1IAHA 3FLSA 3KC3A 3KCFA 4H1JA 3KQ7A 4WO5A 2C6DA 4J52A 4X2JA 4DH8A 3QA0A 3ZRLA 3D0EA 3GC9A 3FL4A 3SGCA 2W1HA 3QZHA 5IA0A 3L8PA 3D14A 3QRIA 4GU9A 1OITA 2WMTA 1FVVA 4O4DA 4XHKB 1H1RA 3D15A 2R0IA 4G2FA 4I20A 2IO6A 1XBBA 3A60A 4JX7A 5EDQA 5CAQA 3TUCA 3R8MA 5J7BA 2R3GA 3FMLA 5B7VA 1G3NA 2W5BA 4GFGA 4IZ5A 4J53A 4XYFA 1Z9XA 2CPKE 4HGTA 4BRXA 2WGJA 2WIPA 2BTRA 3VUMA 1ATPE 4AT5A 3R63A 4BCJA 2CNVA 3DQXA 3LJ1A 2XNGA 3NS9A 3ROCA 5I9YA 3KA0A 1OIQA 4ZS0A 2F57A 4EBWA 1ZOEA 2GSFA 4WNOA 5IUHA 5KHXA 4RX5A 3SRVA 1BI8A 1I09A 2BAJA 1R1WA 1F5QA 4BYJA 4D9UA 2PZRA 4FKPA 3GU8A 5M08A 3GP0A 4I0RA 2QVSE 4DC2A 4EH9A 4TNDA 3MVJA 1OKZA 3QQUA 5FG8A 3SV0A 3KXMA 3OUKA 1H1WA 3RTPA 3LZBA 4F63A 2IF8A 4FZ6A 4XLIA 1G5SA 3QKLA 4ZTHA 1Q3WA 5FBNC 3HRFA 4AXFA 4XP0A 4M8TA 1W84A 3H9RA 4FV2A 4IANA 4D5KA 3BLAA 4NJ3A 3GOKA 2R5TA 3ITZA 3AGLA 4XRLA 5IKWA 3MESA 3MFSA 4R6VA 2R3FA 3UNKA 4BDJA 4JDIA 4UALA 2DS1A 4ZXTA 1NT2A 3RJCA 3KXGA 3OMVA 4DCAA 4BCQA 2NNWB 1OKWA 4K8AA 5DGZA 3H0ZA 3MFRA 1A9UA 2WMRA 3D2KA 4FNYA 3ET7A 4ZLZA 3F9NA 3GFEA 4E73A 4UB7A 3CC6A 3QD2B 4M84A 2XB7A 3SC1A 2ITQA 1TVOA 3I81A 2WAJA 3VBWA 4FEUA 4D0XA 4NEUA 4AAAA 4AW0A 4BDKA 4RA4A 1ZYLA 4DFZE 4EOJA 5IU2A 4ZY5A 4AP7A 2REIA 4XOZA 3POZA 4BN1A 4AS0A 2ZV8A 5LMKC 2UZWE 3U6JA 1Z57A 3TV7A 1J1BA 3PIZA 3I7CA 3ZSIA 5CAOA 4KBCA 3ACJA 3ZCLA 2G01A 3JY0A 4F9YA 1XR1A 5AR8A 4C2WA 4GU6A 3VUDA 4G5PA 4I6FA 4A9TA 3MB6A 4AA5A 2E9VA 4Z7HA 3ZFYA 2J9MA 4FKGA 4ZZMA 2XNNA 4UV0A 2PE1A 4AZFA 3HAMA 3W1FA 2A27A 3DZQA 5CQUA 4EH4A 3FKNA 5HEZA 3UODA 5GZAA 4TKSA 4O4CA 5AUYA 3W0PA 5ANIA 3UVQA 4E6QA 3QRTA 2QKRA 2H96A 1F3MC 2C3JA 3GT8A 3NUSA 4NWMA 4OTIA 1YDRE 2WEIA 4LRKA 2XUUA 2RG6A 3W0MA 3OWPA 3MA3A 4MD8E 2VUWA 5CSVA 4QPMA 5KZ0A 4NL0A 3PFQA 4L01A 3PYYA 4FKRA 1QCFA 5CEQA 1IASA 4PNKA 4QTAA 2RIOA 3PY3A 3TIYA 3BYOA 3SX9A 4EOSA 5HLWA 1JQHA 5FLFA 4ZJJA 4AWIA 5E8SA 3D5XA 3D9VA 5HKMA 3NAXA 3ZC5A 4D4RA 1URWA 4AW1A 3QKMA 4QPAA 4C3PA 4HNFA 2QR7A 3AMBA 4P5ZA 4ASXA 3BEAA 4XEYA 2QLUA 4FV5A 4Y5QA 4FV4A 4ASZA 4ORKA 4LOQA 2IVUA 2YAAA 4MXZA 5AV1A 1PF8A 3RWPA 2R3JA 1Q99A 3WZDA 5AA9A 1VR2A 4CMUA 3NZ0A 5C8NA 4FV8A 3FZPA 2W4OA 4JRNA 1ZYSA 1XQZA 2GNLA 3E8EA 3Q2MA 4FG9A 3LQ8A 2BUJA 3UTOA 4AZTA 4ZZOA 3PWDA 4O0UA 4QMVA 4WSQA 3MVMA 3P1AA 5C01A 4Q2AA 4FNWA 3MFUA 2V55A 4BCNA 4F7LA 4ANMA 3DBDA 3EQPA 3VHKA 3C4XA 2UZEA 3FY0A 5CXHA 2Y6OA 3EYGA 4YC8A 2DWBA 5I4NA 4OTGA 4QMUA 5EOBA 3UYTA 4KKHA 2JIUA 5D9HA 5KE0A 3I60A 3LXNA 3W32A 4O1PA 4KIQA 1SYKA 1H8FA 5M06A 5KKRC 5EM7A 3QTXA 3RINA 2HZNA 5CI6A 2B9HA 4O38A 3PUPA 5H2UA 1WBPA 4J8NA 4E7WA 4LL0A 2CJMA 3QWKA 2YIXA 5F94A 5IDPA 2C6OA 4BDHA 3PY0A 2V5QA 4PMSA 5HORA 5J9LA 4QQJA 4L3PA 2WXVA 4HCUA 2YWPA 4FOCA 4YLJA 5J7HA 1SVGA 2QOBA 1CDKA 2BRBA 3EYHA 2BMCA 2UW0A 4ZK5A 2C6IA 2PL0A 3C4FA 3ZC6A 1PXKA 5BVKA 1G8AA 4L44A 2I7QA 4ZIMA 3PA4A 1U54B 3FMKA 3ZOSA 3B8RA 4NSTA 2E9PA 3KRWA 3UZTA 5IZFA 1YXSA 3O0GA 4IAFA 1Y8GA 2VTIA 3IW6A 4A07A 5BVNA 4OBPA 1Q5KA 5AAFA 2VX1A 1NA7A 4CKIA 4CZUA 4D4VA 3NNWA 5AMNA 2PVRA 3TV6A 3DS6A 2F4JA 4W4YA 2P2HA 2X8EA 4K9YA 4EHZA 4I6BA 5CSXA 1P2AA 3FQSA 1PXMA 1ZXEA 2A98A 2C6TA 4DH3A 4FKLA 3FC1X 5AAEA 4I21A 2X7FA 3UG1A 2H9VA 4KS7A 4C61A 3F6XA 3NUNA 4X6RA 4ERWA 2B1PA 4U43A 4IDTA 4JNWA 4G3DA 4MAOA 4Y8DA 4W9XA 3GFWA 4F65A 2DYLA 3E93A 5LOHA 3VONA 4DTAA 5LMKA 4YGAA 1SNXA 3CIKA 5G6VA 3D7TB 1ZWSA 3W18A 4BDBA 5LVOA 3NCZA 3T3UA 2RFDA 2VO3A 2B54A 3NUPA 4GG7A 5HD7A 3SOAA 4IC8A 1Q41A 1S9IA 3IO7A 2GNFA 4L42A 4IWOA 5L2SA 3PFYA 2C6LA 5H8BA 3NLBA 4DHIB 4U8ZA 3QRKA 5CXZA 3Q5ZA 3D7TA 4KIKA 5ANOA 3AKLA 1BMKA 4NTSA 4IFGA 3OXTA 3ZTXA 1JKTA 3PDTA 3EN6A 4ZP5A 1R39A 3WZUA 1OUYA 4OUCA 3T3VA 3PE1A 4Y85A 3P4KA 2XALA 3QUDA 4EZ3A 5HVKA 3SA0A 3CR0A 1O9UA 3LCTA 5J1VA 3GU7A 5EHYA 2OH0E 1FOTA 4FT3A 5BMSA 3DAKA 2IVSA 2C3LA 2VZ6A 2OXYA 3GQLA 4WRGA 3R1YA 2B9JA 3II5A 5ETIA 5HVJA 4DEHA 4G3FA 4NT4A 4M0YA 1J7LA 3BYVA 4EOQA 3HRCA 4AW2A 3ML1A 3C0GA 3IOPA 3A7GA 4HVHA 3QQKA 2CDZA 1PYEA 4O7SA 3QF9A 4DTKA 1OPLA 3CQEA 4C34A 4FIEA 2VTQA 3WE8A 4IH8A 4FZAB 4YZMA 2VWVA 3WYXA 1OI9A 4BZDA 3AC5A 2ZOQA 4L3LA 4RX8A 4DYMA 4CKJA 2AEGA 4ANNA 3EQRA 5IF1A 4LQMA 5FDPA 3RK7A 4DFUA 5CY3A 4BDCA 1OKVA 5JRSA 4RQVA 4WUAA 1FQ1B 5AV3A 3HYHA 5CSPA 4I0TA 4BCOA 3O8TA 2X4FA 2HW6A 2XK7A 2XM8A 5BVEA 2WB8A 2ACXA 4X6QC 4D1XA 3HKOA 4IXPA 4NCTC 4ZSEA 1ZY4A 3R22A 1H0VA 2Y0AA 3VF8A 3ZEWA 4EHVA 2I1MA 3G15A 3F3UA 3SXFA 3R71A 3QXPA 3VS1A 4GS6A 5E91A 3PJ1A 4F1MA 4HCTA 2EU9A 4DA5A 3TNWA 1Q62A 3R9DA 4R7IA 2B7AA 2CGXA 4RRVA 2BDWA 2UVXA 3QFVA 3BBTB 3GC8A 3NNVA 5KMIA 3OEFX 1IA8A 1IG1A 1M2QA 3Q60A 4X2FA 5J9YA 4B8LA 5JQ5A 1YDSE 2W1ZA 2WQEA 4PPBA 4EOOA 1KUTA 5GINE 4L46A 4QP7A 1XHAA 1OL1A 2F7EE 3UNJA 4P2KA 3E88A 5C8MA 5JRQA 2FO0A 4D4YA 5L6WL 3N4UA 2PZPA 3THBA 3S4QA 3EQCA 3TJCA 5A6OA 3IPHA 3UO6A 2PVYA 4ALUA 5KCVA 2OG8A 4AG8A 1DI8A 2PY3A 4LUEA 4E4LA 4A9RA 4G17A 2CN8A 5KO1A 5A4CA 3DAJA 4FTNA 4FRFA 4L53A 4EC9A 5I9WA 4KA3A 3BU3A 1UKHA 1WZYA 4QTDA 4QQCA 5FBOA 5M4IA 4C4FA 3KMUA 5D10A 2XBAA 4V04A 2CNQA 4MWHA 4I3ZA 3Q9WA 3FV8A 4QMQA 3JVSA 4P4CA 2JDVA 4GMYA 3M42A 4C37A 3O2MA 3PSBA 4O0VA 5HESA 3R7EA 3RGFA 3UPXA 3GC7A 4O84A 4ZS4A 4FIHA 2OJGA 2VAGA 5DEWA 2X0QA 1W83A 4F99A 2VGPA 4IAKA 4M67A 3ZONA 5CQWA 5HBHA 3IW5A 5T6KA 1Q8TA 4FKSA 3RCJA 2CLXA 2XARA 3Q52A 4IWPA 4JVGA 5E8ZA 4CCUA 2PUPA 1EH4A 2ITUA 3ELJA 4KB8A 2Z8CA 3VRZA 3FMJA 4C59A 4U6RA 2PZIA 4K0YA 3MH3A 4U9AA 4EOMA 3NYNA 4BZNA 5TOZA 5IQIA 1NY3A 4ZTQA 3V6SA 3GCUA 3EZVA 2B0QA 4FKWA 2YM4A 2DUVA 2OZAB 3IONA 3ZMMA 4D1SA 4J97A 4BDGA 4IVAA 2O63A 2UVZA 2QHMA 2WZJA 3PP1A 3EB0A 2NRUA 3D5VA 4G9RA 4AXDA 5E7RA 3ZLWA 3BIZA 4G34A 3V5WA 4ANLA 2GHMA 4KRCA 3TNPC 4TWPA 3BHUA 3LXPA 5FQDC 3ZDIA 4AA4A 4O7RA 1CMKE 5C4LA 4QOXA 5EI2A 3EOCA 2VWXA 2BIKB 2QCSA 5D1JA 3QGWA 5GIOE 4G31A 4GJ3A 4BGHA 4EH7A 4KAOA 4EH2A 1GIJA 4HNIA 3QTUA 5AUTA 5A4QA 1OGYA 4AZEA 1DAYA 4L52A 4CKRA 2QNJA 4FIJA 4FG7A 3JXWA 4NU1A 2ETKA 3I0QA 5HNBA 5K5NA 4O21A 1AQ1A 2QD9A 2W0JA 3AOXA 4YPDA 3WF8A 2PWLA 2YABA 1GZNA 2C5VA 2OH4A 2VD5A 2RG5A 3NW6A 4K2RA 3TNHA 5HGIA 5J8IA 4EWQA 1YRPA 2GQSA 5AIKA 4DEAA 4OTDA 5B0XA 3GENA 2YA9A 2JKOA 3I4BA 1JKKA 4NK9A 4RVKA 4FIFA 5JGBA 3ZDUA 2X2KA 5EFQA 4AN2A 1F0QA 1WAKA 2UZDA 4IZ7A 4L68A 2WIHA 3PXYA 5HLPA 3ZH8A 4QYHA 4C4HA 4CXAA 3LQ5A 2J5FA 4WBBB 3BGZA 4YJNA 5HBJA 3VIDA 3ZO3A 5BQ0A 4IVCA 4R7HA 4QMTA 2C3KA 3WZKA 4ZSAA 4L00A 3SAYA 3UGCA 4CFFA 4RJ3A 4CFWA 5FWKK 5L8LA 2A0CX 3KCKA 3FZSA 4QMPA 4ITIA 4HYSA 4NCTA 4KINA 3S3IA 3VBTA 3AMAA 5J95A 3ORKA 2PZ5A 5LVNA 1CSNA 2XM9A 4NM7A 4FNZA 3RHKA 4YSJA 5K5XA 3U8WA 4YPSA 4BKZA 4ZJVA 2ONLA 4NFNA 2VNYA 4U79A 4YJTA 2YERA 4GL9A 4FGRA 1FBNA 2F49A 3M1SA 3MJ1A 4QTCA 5TF9A 2IW8A 5HU3A 4D2RA 4Z16A 4WD5A 4F1TA 1LPUA 1ZRZA 2ZM4A 4FKQA 3QXOA 4H58A 4Q9ZA 1M14A 5EKNA 3OWKA 3PSDA 3WZJA 3MA6A 4QD6A 2HZ0A 3QQFA 4EQCA 4DITA 2OIDA 2R3IA 1B38A 2VO0A 3QCQA 5GNKA 1L3RE 3PXFA 3LCKA 4MBJA 5DEYA 1P4OA 2QOLA 4QMWA 2GHGA 4I5CA 4RFZA 2LGCA 4H36A 4JOAA 4QQTA 4LV5A 2GNGA 3NUAA 1IRKA 4FTKA 5ANGA 2IWIA 3UC4A 3UOJA 1UKIA 1ZYJA 3FY2A 4XX9A 3BQRA 4EK8A 4PP7A 3U6HA 3Q5IA 2PK9A 5KNJA 1H00A 2E9NA 2J6MA 3FXWA 4FKUA 4FYOA 1J1CA 4PV0A 4BYIA 4QP3A 1DAWA 2QOKA 4ZSJA 3OW4A 5H9BA 4CV9A 3CE3A 2VO6A 5HE0A 2Y8OA 3IGGA 3U4WA 3CGOA 3WF5A 5CSHA 4B7TA 2C5XA 5E8VA 4MYGA 4P7EA 1MRUA 3VF9A 4FUYA 1WFCA 4L43A 5HCZA 4K1BA 2R3NA 4QPSA 4TXCA 4FTIA 4E26A 3SW7A 3PWYA 3ZLXA 3ZSGA 3WE4A 4YLLA 4OTFA 1Q97A 3QKKA 3F69A 1WBNA 3WILA 3MSSA 4FV1A 4RWKA 5CTPA 3VRYA 4FEWA 2PMNX 3UDTA 4ACCA 2OFUA 1UWJA 4HYUA 4MTAA 2CGWA 4RJ6A 3V5JA 3RPYA 4FEXA 4W9WA 3UNZA 3OD6X 3KMWA 4IM2A 2JD5A 2XVDA 2WTJA 1PMEA 5DBXA 1PXIA 2C5NA 3VUTA 1PKDA 3KY2A 1PMNA 1URCA 4HW7A 3O51A 4OBOA 2IPXA 3IGOA 1P5EA 1UU8A 2YFXA 4L45A 3W0NA 2PZYA 2B9FA 5M51A 4DE4A 4EK4A 4JAJA 4FG8A 1KSWA 2FB8A 2QO2A 1QMZA 1YW2A 2RFEA 2W7XA 3C0HA 3QZGA 4AE9A 1GAGA 5BVOA 3HUCA 3RK5A 1JWHA 1YXXA 4EH3A 5IDNA 2WELA 4TWOA 4R8QA 4FV7A 4E6CA 5L8KA 2PVNA 5BYLA 5CI7A 5JKGA 3EL8A 1PW2A 2CGVA 1QPJA 2VTJA 4YJPA 4LRMA 2J50A 2ITVA 4RC3A 4C8BA 3W33A 3LMGA 4OW8A 4FT7A 3OW3A 4UN0C 1FVRA 3UP7A 3BRBA 3ORLA 3R01A 1BKXA 3CPBA 3ORNA 2WMQA 4JJRA 2PU8A 1OIYA 4GVJA 3F2RA 3P0MA 3RZBA 1Q24A 2HK5A 2WTVA 5AM6A 2GQGA 4DDGA 2JLDA 3V8WA 2IG7A 3EFWA 3QC4A 1AGWA 1YXTA 4G3EA 3V5PA 5JFXA 5J5SA 3NNXA 5CU3A 2XCKA 3L9NA 5HIBA 2HY0A 3MBLA 2B52A 4N70A 3RVGA 4E6AA 2PYWA 5JQ8A 2P33A 5CYIA 4I6HA 4YJUA 5AADA 2OFVA 5AEPA 2H34A 4HCVA 3V3VA 1AD5A 3KEXA 1CKJA 1TZDA 3KFAA 2CKEA 3KN6A 3A2CA 3SXRA 1RJBA 1S9JA 2JEDA 2WMBA 3QUEA 3RKBA 2XKDA 3LW0A 3ENMA 1PJKA 2H8HA 4FMQA 4RIXA 5AWMA 3IDBA 1OVEA 4UMUA 5ANEA 3VN9A 4IB0A 3CKWA 4XP2A 2XH5A 2BZIB 4FSNA 5B2KA 2I6LA 2GHLA 4FTJA 1I44A 1UU3A 4IX4A 4UYAA 3CEKA 3QL8A 2WTWA 5IEXA 1A06A 3HVCA 4ENXA 5I9UA 2JDOA 3GCSA 3ZXZA 3L8VA 1KV2A 2UZUE 1PRYA 3TM0A 3W0RA 5GIPE 4FV6A 4DFLA 4D2SA 4AGCA 5I9VA 3A7IA 1Y57A 5KUPA 2QOFA 3RPVA 3SHEA 1OZ1A 4JIAA 1WBVA 5FM3A 3NW5A 4YBJA 4RVTA 2EXMA 2HWOA 3LFEA 4WBOA 5EM8A 2OJ9A 4ZTMA 4CG8A 3ZM4A 3CQWA 3O7LB 4YURA 2ITWA 3GU5A 5HU9A 4O82A 3MH2A 5CLPA 2WOTA 2W05A 3KF4A 4TWCA 4D5HA 4O7NA 2FVDA 3OVVA 5EDPA 4FKTA 5HO6A 3WF9A 1O6KA 2ZM1A 3A7FA 3KRXA 3QGYA 3KU2A 4M0ZA 3E3PA 4QMYA 2AUHA 5G1XA 4D2VA 5I9ZA 4NW6A 3BL9A 4WNMA 3BE2A 3QTQA 4IZAA 3HP5A 1OL7A 4DH7A 1MP8A 4J8MA 2GQRA 4EH8A 4MBLA 3R9RA 3EH9A 2JIVA 1Y6BA 4DINA 4PP9A 4A9YA 4O7WA 2G1TA 3PJ3A 4O91A 2XYUA 3EFKA 3QZFA 5C26A 1OBGA 1UA2A 1WBTA 3GVUA 4DG2E 5I0BA 2WMAA 5IQHA 4F08A 2XK9A 3LM5A 4C4JA 4R3PA 4QMZA 2OJFE 4X21A 3WF7A 4R3RA 4ASEA 3DK3A 5EYDA 5KX8A 2FH9A 5AUVA 4FEQA 3PXQA 4JL9A 4BL1A 2YEXA 3Q53A 4F70A 3DBCA 2O0UA 5CF4A 5KBRA 1LUFA 4IHPA 2ITXA 3R7YA 4M97A 2RFSA 1R0EA 2BDJA 4O2ZA 4BTFA 4D2PA 4DFNA 5KMNA 4Y73A 2JFLA 2ITTA 2PMIA 1H1SA 2YACA 3K3IA 3FDNA 4I23A 3AT4A 4NUSA 2OW3A 3WZEA 4MQ2A 3ZS5A 3OY3A 3E63A 5LMAA 3PY1A 2PE2A 3Q6WA 3A7JA 4QYEA 3VO3A 4BKYA 4X0MA 2QOIA 4O22A 2CMWA 2J4ZA 2OICA 3LXKA 3CTJA 4EK5A 1KE9A 4OTQA 4A9SA 3SQQA 3P08A 4HZRA 1OECA 4JBQA 2BKZA 2BROA 2XNOA 3G90X 4LOPA 4QNAA 5AP4A 4R1VA 2P4IA 3K2LA 4EKKA 4GUBA 4DEEA 3O7LD 3QRJA 4GK2A 5A9UA 3UQCA 5HZNA 4GKIA 4FKOA 2YISA 3PRIA 1H27A 2BTSA 1GNGA 2GMXA 2WPAA 4TL0A 3FL5A 1PKGA 2C6MA 2ITYA 1JNKA 4TPTA 4APCA 3DBFA 3FQEA 4M69B 4NW5A 4JQ8A 1YVJA 3VS4A 4FGBA 5AJQA 1QPDA 4JDHA 2IEWA 4DT9A 1YQJA 2Y4IB 3PIYA 1XBAA 3HRBA 4TN6A 3D94A 3TEIA 2HY81 4BKJA 2YIQA 2IN6A 4NM3A 2BIYA 3F5XA 4BTKA 4FTTA 5EOLA 2JC6A 2ZYBA 5E90A 4FVQA 4BHZA 1VLRA 3KMMA 3LOKA 4BBFA 3FSFA 4HVSA 3QCSA 3KVWA 5HIEA 1JSUA 4RIWB 4HPTE 4GYGA 2W1GA 2VWUA 2R3PA 3AC1A 4C4GA 1PY5A 1QL6A 3HNGA 2XK4A 3P7CA 3C5IA 3DAEA 3R7OA 4G6NA 5J1WA 4RX7A 3DU8A 4U41A 3WI6A 5BMMA 3QALE 4ZAUA 4RIOA 4XG9A 5M07A 5B2MA 4YZ9A 2WTKB 3LFBA 2QONA 2QHNA 4JT3A 1H08A 4BDAA 4LG4A 3COHA 1OMWA 4RIWA 4UMQA 5AR2A 4APPA 4K6ZA 2CCHA 1ZMWA 1WCCA 3KXXA 4GIIA 2X0PA 5HNGA 4FK3A 4XG3A 4CVAA 2AC5A 2W9FB 3FUPA 4O86A 4PL5A 5E1EA 5M57A 3FJQE 4QMMA 3BQCA 5IA2A 4FSZA 4KSQA 5EH0A 2YM3A 5IQFA 3VS0A 4AXEA 4BICA 3ZFMA 3SG9A 5DH3A 4E3CA 1G8JA 3F5PA 2HXLA 1YKRA 3I6WA 4XMOA 2PVFA 4FTUA 3SW4A 4Z7GA 3PPKA 3A99A 1LR4A 4FUXA 5LWMA 1A48A 4AZSA 3RK9A 2ZV7A 1Q8YA 1SNUA 4DLIA 4MX9A 5KBQA 4FSMA 4I93A 1OL2A 4PWNA 4DGNA 4RZVA 4OTHA 4PPCA 2EVAA 2UVYA 2W5HA 3CGFA 3QLFA 1PMUA 3W0OA 2EUFB 3PRFA 2GFSA 2IW6A 4WNPA 2QO9A 3AMYA 2PUNA 1SVHA 4OGRA 3N51A 4U42A 1W2DA 5DI1A 5K0XA 3FEGA 2WTIA 2QG7A 4HJOA 4FODA 3FLNC 4IFCA 3F7ZA 4CTCA 2OF4A 3HLLA 1XH6A 3EN4A 2UV2A 4FI1A 4Q5HA 4DF3A 4ZSLA 2YJRA 3SVVA 3ZSHA 4YJRA 3R7UA 3IK3A 3QD4A 4RJ7A 2C0IA 2VTOA 3DK7A 3V6RA 4EC8A 4ZSGA 4CYJA 4LMUA 3VUHA 1KE5A 2J5EA 5HD4A 4MXAA 2HOGA 3LFSA 4EH5A 4I5MA 3MS9A 3P7BA 3BEGA 2Z7QA 5E8TA 4RX9A 5FUTA 4UXLA 1GY3A 3DOGA 3UBDA 1Q61A 4ANOA 4CFNA 3SOCA 3QUPA 5M4CA 4PUZA 5ETFA 4J96A 4LGGA 5EHLA 4AU8A 4XV2A 4CFXA 3QZIA 4UWBA 5HQ0A 3CJFA 4M66A 3GB2A 4FV0A 3EFLA 1M52A 4EK3A 2UW5A 1Q8ZA 1WVYA 1XH5A 3D83A 1OUKA 4DFYA 5IUIA 1REKA 2GNIA 4IEBA 3U87A 2BAQA 1JAMA 5I9XA 3HX4A 1BX6A 3CP9A 4KNBA 4I41A 4GUEA 4LRJA 3H10A 4YZCA 3MY1A 3HV6A 3ORIA 3PXKA 2W9ZB 3SLSA 4F6SA 4FR4A 4W8DA 4E5AX 3W10A 5E92A 3OXIA 2C47A 2G2IA 5CU4A 3TT0A 5CNOA 4W4WA 5DT3A 2CHLA 3HV7A 3B8QA 3DFAA 3ATTA 5CEKA 4XOYA 1UNGA 3VULA 2C5YA 3CTQA 4IAYA 3F66A 2PVMA 3HV4A 4RG0A 3AD6A 4ITHA 4H3PA 4NTTA 1W82A 3ZBFA 3SG8A 5CU6A 5IEVA 4BZOA 3TTIA 1U54A 2BAKA 3VWAA 4MK0A 5DR6A 3RHXA 3BHTA 2FUMA 3NSZA 2R7IA 5JH6A 3D2IA 4XCUA 5ITAA 4UY9A 2W1IA 3PVGA 3QX4A 4EEVA 3TJDA 3MIYA 3E64A 5L8JA 4FT0A 1MQ4A 3NUXA 2PULA 3GUBA 4D2WA 3FLQA 5CS6A 2BCJA 5JN2A 2BPMA 2WMWA 4YTHA 5CF8A 4AW5A 2PVLA 5HICA 3V04A 3V8TA 5CEMA 1BL7A 3Q96A 4UMRA 3V5TA 5KZIA 2UZTA 3HECA 5TKDA 1M2RA 2ERKA 4XUFA 3QTWA 2XBJA 2HELA 2A4LA 2VRXA 3BI6A 3KB7A 4OBQA 3HAVA 4IM0A 3BELA 3LCSA 1MRVA 3LFCA 1PXNA 4V05A 2OJIA 4MXOA 3OCGA 4QMSA 3O17A 4HPUE 3EFJA 5I3OA 4BI1A 2YZAA 4O1OA 4I22A 3BWJA 3FI3A 3EWHA 3VBVA 4BTJA 4IACA 4IZYA 2RL5A 3P79A 2OK1A 5EYMA 2QLQA 4O6EA 5AFVA 4MWIA 2ETMA 4HYIA 1ZARA 2V7OA 5DPVA 2XEYA 3UOLA 3TDWA 4FKVA 4FTRA 3DLSA 4FV9A 3QTIA 4C7TA 1L8TA 3PPJA 2R7BA 5EDRA 4A4OA 4JBVA 4HYHA 4EH6A 3CXWA 3MVHA 3S1HA 2PPQA 4QYGA 1YWVA 4H1MA 3TG1A 3F3TA 4G16A 2Z7SA 3K5VA 4EYMA 4O0TA 1TFFA 2CLQA 5HTCA 1ZYCA 4WG4A 2BRNA 3FHRA 4XG8A 5FM2A 4AF3A 5D11A 4AUAA 4A9UA 3KIOC 4LI5A 2QOCA 3OT8A 1FINA 4J7BA 3UO5A 3DA6A 1B39A 4BJJB 2YDKA 1X8BA 4CZTA 4OTPA 3R9NA 3BX5A 3ZEPA 3C5UA 5CAVA 3QQJA 3FZRA 2HZIA 4I24A 4OR5A 3MPAA 2JFMA 4K77A 1WVWA 4QTEA 3QX2A 4C57A 2GS6A 4XV3A 3VS3A 3JS2A 3HUBA 5E8UA 3EKNA 2J0IA 2I0VA 5EW9A 4BCHA 5BUIA 5CANA 3LKMA 2HENA 5EW3A 2OWBA 4GK3A 4JR3A 2UW7A