3UG2A

Crystal structure of the mutated egfr kinase domain (g719s/t790m) in complex with gefitinib
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
299
Chain Sequence
b'EAPNQALLRILKETEFKKIKVLSSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLEDMDDVVDADEYLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Structural basis for the altered drug sensitivities of non-small cell lung cancer-associated mutants of human epidermal growth factor receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 299
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ug2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ug2A01
5C4KA 3R8LA 3ZM4A 5GJGA 2H6DA 4UN0C 3COKA 5I4NA 3G90X 4FKLA 1F0QA 4JDIA 4C38A 4X3FB 4H58A 2W06A 4RWJA 5E92A 2HWPA 4FT3A 1OPLA 3QZFA 4J53A 2GHMA 3H9OA 4J96A 3A61A 2FYSA 4I94A 4U80A 4BFMA 3P4KA 3A62A 1WCCA 4S2ZA 4R1VA 3D9VA 1FMKA 2CKQA 3HAVA 4LG4A 2WZJA 5ACKA 5JKGA 4FZ7A 3UGCA 3BLHA 3QLFA 2NNWB 2UVZA 3E62A 2V5QA 1KE6A 4IBMA 3O7LB 4BYIA 4D0WA 1RW8A 4FVRA 1PF8A 4D5KA 4DT8A 3FPQA 3AG9A 2WMAA 5HE1A 1JLUE 4FV1A 5CXZA 4ZSGA 2OKRA 3PLAE 3ZLXA 4KSQA 5IH6A 4C33A 3PXYA 5CX9A 4CTBA 4KD1A 4BDEA 2XNMA 2UZUE 2WTWA 5AJQA 4IH8A 4YU2A 4M15A 1UKIA 3ZLSA 3NRMA 3QCYA 4H05A 5CI6A 3QKKA 4A4LA 3RCJA 4UYAA 4KIOA 1PKDA 2QC6A 4KIQA 1PMVA 3GU5A 3OC1A 2GNHA 4NU1A 1FINA 2HOGA 1JSUA 3G6HA 5T68A 3ZEWA 2BHHA 3FDNA 3GC0A 2R3IA 4JLCA 1I09A 5ANGA 4DEIA 3ULIA 3HLLA 3MH3A 4MXXA 5CEKA 3L1SA 3KRLA 3P23A 4JL9A 4O22A 5AM6A 2CNUA 3S00A 5JH6A 4BKYA 3D5UA 2PWLA 4FV8A 2FSOX 4OBQA 1Z5MA 2BUJA 3PXRA 1RE8A 4D2WA 2A4LA 4MQ1A 4YZ9A 4C7TA 5EKNA 2QLQA 3GC8A 4JG6A 4RJ7A 4QRCA 3COIA 3O50A 4PDOA 1Y8YA 3V5TA 4JNWA 3P79A 5CTPA 4UWYA 1U5QA 2WEIA 5CS6A 3UO6A 2WHBA 5DRBA 3H3CA 2X6DA 2WMSA 3TNHA 3EZVA 3KMUA 3W55A 2YWPA 5ETAA 3U8WA 2HZ0A 4O0YA 2XK4A 3Q96A 5BVKA 3U9NA 4QTEA 5K0KA 3PXQA 4I92A 3E3PA 4FKOA 2E9OA 2HZNA 4QNYA 4XLVA 4ZS0A 3H0ZA 3I7CA 4N6ZA 4G3EA 3TM0A 4O0WA 4TW9A 2R3FA 4UY9A 2OU7A 3IOPA 2CLQA 3VS7A 3VS2A 4FNXA 4BTFA 4NJ3A 2OXXA 5LWMA 4ANBA 2OFVA 4IB1A 3FQEA 2JIVA 4GCJA 3OCGA 4MVFA 3D5WA 4LOPA 1LUFA 4TN6A 4YTCA 3NNXA 4XBUA 3WYYA 2XCKA 4NW5A 1H0VA 3NIEA 3EQHA 2Y0AA 1GIHA 4M67A 3NX8A 2WMTA 3QD0A 4PL4A 1Q62A 2PVMA 3MVLA 2Y7JA 2J0MB 3PSBA 4FNWA 3GU4A 5F94A 3VBYA 3DBFA 4IZ5A 4DFZE 4TNDA 3VBWA 5FDPA 2XNGA 2W4KA 2YIQA 3QC4A 3QTIA 3FYKX 5IPJA 5AUXA 5JFSA 4ZTHA 4EWHA 4QT1A 3ZSGA 4BCOA 4ZP5A 2FGIA 3QRJA 4O38A 4L43A 3RZBA 3CY2A 3SOCA 3ERKA 3JYAA 3GUBA 1ZRZA 4ANOA 4BWKA 2KULA 4Y5HA 5DHJA 3OP5A 4F7NA 4YHFA 1STCE 5DLSA 4DG3E 2EWAA 3I60A 3OTUA 3PYYA 5AA9A 2QG5A 3SXRA 2BTSA 1WAKA 3PY1A 4ONAA 5CAUA 1U4DA 5CVGA 2R5TA 3M11A 1F5QA 3DK3A 4RVKA 4CV8A 5HX6A 5ANIA 3TNQB 3MH1A 3UNKA 2RFNA 4D4VA 4MXOA 4UXLA 2G01A 4BWXA 4UV0A 4BBFA 1J1BA 1Y6BA 2F49A 5GJDA 3UIBA 5KHWA 5CAVA 2O65A 3KULA 1KE7A 1ZYSA 2Y6MA 4LMUA 4AGUA 2CPKE 4F1MA 4BIEA 1RQQA 4MD7E 4TWCA 4AZWA 3PVUA 4DAWA 4Z3VA 3C4ZA 4DCAA 1BL7A 3TIYA 3VULA 1XH8A 3FQSA 2X2LA 5CZIA 4QQTA 3IDPA 4EZ3A 3SVVA 5TT7A 2VTHA 1LP4A 4S34A 5BQ0A 3PWDA 2BKKA 3K3JA 4IQ6A 5IDPA 3QZIA 3BI6A 2XJ0A 4LGDA 3RPYA 2R4BA 4XG3A 5CEQA 5HLPA 4AW0A 4U45A 4GG5A 4USEA 5A4TA 3MTFA 3UZTA 4KB8A 1UKHA 3TEIA 2ERZE 4ZTRA 2IVVA 4WNKA 1OPKA 2C6IA 3A8WA 2XJ1A 2ZB1A 4TYHB 4AOTA 3F6XA 2VO3A 3F7ZA 3QQJA 3ZH8A 2WKMA 3RZFA 1Q4LA 2OH0E 4IX6A 3Q2MA 2ITWA 4NKSA 4IVBA 5A4LA 2Y8OA 3O17A 4M14A 4U3ZA 2PVJA 3O51A 5HO6A 4YMJA 3LFCA 3M1SA 3BWFA 4QPMA 2C3LA 3MW1A 4FV3A 1U59A 3CXWA 4FTLA 3NUXA 4FV0A 4PNIA 4C58A 1W7HA 3LIJA 3CBLA 3DLSA 1FGIA 2W5HA 4KIKA 5FP6A 4F9BA 4B8MA 4KBAA 3AD4A 4RIYB 2B7AA 5FXRA 4ZS4A 4QMXA 5HTCA 4FX3A 5L2IA 3C4EA 3I4BA 3KXMA 4LFIA 5GNKA 5L2WA 4FT7A 4ACMA 3KREA 1DAWA 2HWOA 2R3MA 3RAHA 2C5YA 3CKXA 4GEOA 5JEBA 5E7RA 3R8MA 3AD5A 4Q9ZA 4RX5A 4JXFA 4L68A 5J1WA 1OKYA 3MFSA 3QRUA 2OZAA 4A4OA 5E8VA 1YOJA 3HVCA 4O7ZA 1PXJA 3QX2A 3TT0A 3N4VA 5BUIA 4W4XA 3EFWA 2J5FA 4RFZA 3QQLA 2P55A 5EQPA 2YM3A 1T45A 3HUCA 2R7IA 4MWHA 3U6IA 4EK5A 5CSHA 3NYXA 3S4QA 4U5JA 2PVRA 4RIWB 4QMVA 3FZPA 3D2KA 3A7HA 4IAKA 3R7UA 2JIIA 1WBNA 4WBOA 3BEAA 4FEXA 3EOCA 3R00A 4XCUA 1ZY4A 5HKMA 3E64A 4LQMA 3LMGA 4D2TA 2XNOA 4G6NA 2XK9A 3JXWA 4L3LA 1UWJA 4F0IA 3RCDA 4G1WA 4LRMA 1QCFA 3HMNA 3PSDA 5CANA 2ZOQA 2ACXA 2YIWA 4DF3A 2Z7QA 3FZSA 1U46A 5EOBA 1YHSA 4U9AA 4FKRA 5CSWA 2ZVAA 3MPMA 4JBPA 4CZYB 4EK6A 2LAVA 2QOIA 2A19B 4ZTLA 4E73A 4EZ5A 3ID6C 4X2JA 4YNOA 3BGZA 5TE0A 4QP1A 3CD3A 4FTIA 4QP3A 4O7VA 4JG7A 4AX8A 5H3QA 5DG5A 4K18A 2J50A 3QKMA 4H1JA 1V0BA 3GT8A 4QMUA 3SAYA 5M57A 2B55A 2JDVA 4G9CA 4TWPA 3BGQA 3U87A 4BIDA 5KNJA 5GZAA 3SW4A 4YJUA 1BI7A 1Y8GA 2ZYBA 3K5UA 5EW3A 3GENA 4YTIA 3Q9WA 5D11A 3CPBA 4FIJA 4GU6A 5EQYA 2RFEA 3D7ZA 3DDQA 4AF3A 2J0IA 2W1ZA 4V01A 4ALUA 2CGXA 2WQOA 3R63A 4FSYA 2JDOA 3Q9XA 4FTNA 5HI2A 3VNTA 2ETMA 5H8BA 2V55A 5M56A 4O0TA 1X8BA 4CTCA 2QURA 3DPKA 3GVUA 2CN5A 4G3CA 4MTAA 3SKCA 2B52A 3D7TA 5IZFA 2JITA 5E8ZA 3HV6A 3SXSA 4ENYA 4EOQA 3GFEA 3LCSA 4DC2A 2Z60A 5IQHA 5B7VA 4HYIA 5GIOE 3QTWA 1SVGA 3HV5A 3QHRA 4GUEA 3D4QA 4F9AA 5J5TA 1PKGA 2JKMA 3R1YA 3COMA 1Q8TA 5AR3A 3DDPA 4FKJA 4Z9LA 1KOBA 3FKNA 5HVJA 1V0PA 2VWVA 2WMRA 3DKOA 3E93A 3EL7A 4ZOGA 1QPEA 2GPHA 3DBCA 4GFGA 4TT7A 4BTKA 4GK3A 4K6ZA 1ZY5A 4JQEA 3FAAA 1XQZA 4J98A 4EJNA 1PYEA 3TKUA 5HD4A 4JIKA 3DNDA 2PVKA 3F5UA 1B39A 4O7RA 4AT5A 4D28A 1RJBA 3LXLA 5EYDA 2XBAA 4ACDA 4XLIA 1WMKA 1H1RA 4MNEB 2C6LA 2ITOA 5IQIA 3OW3A 4R7IA 1V0OA 4ZY6A 3LCKA 4O0RA 3S1HA 1M7NA 1G5SA 1YOMA 2VTSA 3MV5A 4JR3A 4TWOA 5DT0A 4QMYA 2BIKB 3A4PA 5KZ0A 4LL5A 3THBA 4BWPA 1FPUA 3C4CA 1Q3WA 3F3UA 3BGPA 4OT5A 3UMWA 3TXOA 5IF1A 4D1XA 1REKA 2WMUA 1M14A 3LM5A 3B8RA 3CC6A 4PTEA 4AAAA 4C61A 2R7BA 4IMYA 2BZKB 3C51A 3GXLA 2YIRA 2SRCA 4QYGA 3H30A 1JSTA 2BZIB 4F08A 2R3RA 3A8XA 4QNAA 4O83A 3PXZA 2W99B 3VAPA 2PHKA 3WBLA 3ZCLA 4DG0E 3LMHA 4JDJA 2UZDA 5FD2A 2VAGA 4D58A 4FV6A 4GS6A 5M51A 3EZRA 4EH7A 3VS6A 5BYLA 1CMKE 4IZAA 5EW9A 3QRTA 2Y4IB 3TZMA 4HZSA 4DH3A 1ZLTA 4HVHA 1GOLA 2CGWA 2UZVA 1QPJA 5CT0A 2F9GA 4CNHA 2VWXA 3F3VA 4AW1A 2IZSA 3FE3A 3KXZA 3QTXA 2B9IA 4II5A 1FGKA 4R5SA 3F3ZA 2P33A 3FKLA 4Z16A 1ZOGA 4QMSA 3R83A 5JK3A 3OOGA 4C2VA 4YPSA 1ATPE 3DV3A 2RIOA 3O8PA 3PZHA 4UZDA 3KU2A 5EHOA 5FBNC 4DLJA 3K2LA 3PUPA 5IDNA 1SYKA 2A1AB 3QBNA 4HYHA 5JSMA 4TWNA 3V8WA 4JBQA 2OZOA 2JKKA 4DTAA 3NYVA 5LVMA 3N4TA 4YLLA 2YCFA 2WMXA 5AEPA 3HRFA 5E9EA 5HBEA 5J8IA 4BGHA 2XK7A 4U40A 2YM5A 2V62A 4QTDA 2HZ4A 4Q9SA 4UMQA 1IR3A 4I5HA 4EBWA 2GDOA 1APME 4O6LA 5HBHA 3ZO1A 5JFVA 4R3PA 4ACGA 2YN8A 3ANQA 5CLPA 4CLJA 3U6JA 3PZEA 4E6DA 3HNGA 3RNYA 4ZTMA 3F7WA 3EKKA 4UEUA 4M97A 4YLKA 4CFVA 5EM5A 4QMPA 4GUBA 1KE9A 1UU3A 3A7FA 4USDA 5IMXA 4QTBA 5F95A 4IDTA 3TDVA 4D2VA 3VUDA 4HNFA 3L8VA 1DI8A 1IASA 5LVNA 2I0YA 3BU6A 4NZWB 4GIIA 4ZXTA 4UWCA 3PWYA 3JY0A 3QTQA 5AP5A 4AN3A 3UOJA 5IUHA 3DBEA 2C4GA 3PVGA 4M69A 4OBPA 3ULZA 4AQCA 2WD1A 3KY2A 3T9IA 1PXKA 3ORKA 3QKLA 5AV0A 4ZLYA 4PV0A 1B6CB 2BFYA 5FLFA 4JAJA 1YDSE 4W8DA 3Q2JA 1M2PA 3VUMA 3UYTA 5AX9A 1UA2A 5CALA 3FY0A 5DR9A 3L9PA 4WNMA 2W17A 4FKSA 1FMOE 2X6EA 3G9LX 4D9UA 4H36A 4EKLA 4J99A 4QMOA 2GSFA 3DAEA 2I1MA 4UBAA 5LMKA 5EHLA 5BYZA 3ZBFA 3MY0A 2WTIA 3QHWA 1J1CA 1MUOA 3HUBA 3QTRA 2PE0A 4KKGA 3PSCA 4OLIA 4QMMA 3CJGA 5CU4A 3RM7A 3R9HA 3VUKA 5DT4A 5CAOA 5IEVA 3CPCA 1LR4A 2GTNA 3IW8A 3GU8A 3IW5A 4GVAA 4FNZA 4NM3A 4YC8A 3U4UA 4PNKA 4ORKA 3AOXA 3QXPA 2X8IA 3AC1A 4FTRA 4BC6A 3MIAA 5AUTA 4FV4A 4XX9A 3AC5A 4RIXA 5DT3A 4L45A 5LMKC 2QOHA 3PY3A 3ZUVA 3QRIA 5CU2A 4CEGA 2WTCA 3BE2A 3I0OA 4RJ3A 5AIKA 4M3QA 4EH8A 3EH9A 3ZRLA 1A06A 4BB4A 1H07A 2HZIA 4PMPA 3F9NA 1YI6A 3CGFA 4ZK5A 2ITYA 5DYJA 2UW6A 5FEDA 5IQFA 5EM8A 3V5QA 5DN3A 3HAMA 2G9XA 3U51A 5AP6A 4C4EA 3PDTA 1T46A 4OTPA 4M0YA 5HCYA 3ZS5A 4RX9A 3FHIA 2X9EA 4JX3A 4YJVA 5E8TA 3SX9A 1KV1A 4FYNA 3R1NA 2CJMA 4I5CA 4O0UA 5DPVA 1U54A 4BICA 4F7JA 3OS3A 2GTMA 5ANKA 4ALVA 4RG0A 4DH1A 4FSMA 3S3IA 1XH4A 2X39A 3VUIA 2W1HA 4V0GA 4QPSA 2REIA 3OW4A 1PHKA 3GGFA 5JRSA 4QMQA 4IXPA 4KSPA 2WTVA 4A06A 3MB6A 4BY9E 4O1OA 3ZZWA 3BYSA 4RJ4A 4CKRA 5D1JA 1IAJA 5HVYA 1Z57A 4FVPA 2F7ZE 2W9ZB 3DB8A 3U54A 4XG2A 3WE4A 3BEGA 2QKWB 3VQHA 2BPMA 3MA3A 1PXPA 4IB0A 4BHNA 3AC3A 4O6EA 4BTJA 4G16A 4DT9A 5L6WL 4DH8A 3BV3A 2OIBA 3HZTA 5I9UA 4HVDA 4E8AA 4JIAA 4U41A 4BZOA 3BLQA 1OL1A 3CQUA 3A60A 4QQJA 3C1XA 1TVOA 2GNLA 2JEDA 4QTAA 3F2AA 3HMIA 3LAUA 4A07A 5HBJA 5IUGA 5KUPA 3R7GA 4O7NA 4ZJJA 5E8UA 2W05A 2XK3A 3AMYA 3K5VA 4F64A 1BUHA 3EFLA 3MPAA 3QCQA 5GJFA 3KRJA 4C37A 3HGKA 3VHKA 2UZNA 3ITZA 5CYIA 2JD5A 4PDYA 4EH6A 2OBJA 4R7BA 2ESMA 3OEFX 4QTCA 5L6PA 5LJJA 3FJQE 2RFSA 4FOBA 1PXOA 4I6HA 4TTHB 1DM2A 5HOAA 2E2BA 3QQHA 3OXTA 1K9AA 3ALNA 1J91A 3IECA 3MH0A 3LXPA 2QOFA 4F6SA 1H8FA 4NK9A 4DITA 4C36A 3FY2A 3E88A 2WTKC 4C0TA 3FSKA 1O6YA 3W2PA 1ZYLA 2UUEA 3TI1A 4NTTA 3SDJA 4IAAA 3R04A 3T9TA 4WO5A 1IRKA 1GIJA 5D9HA 5HESA 2PPQA 1NVRA 4O7WA 1Y6AA 3GCQA 3AGMA 5DMZA 2ZV9A 2YDKA 4IM2A 3OHTA 4MNFA 3HRCA 4XHKB 2OK1A 5HCZA 1PXIA 4EL9A 4DH5A 2XK8A 3I7BA 2EXEA 4HOKA 4RQKA 4CFMA 3O8UA 3FI4A 5AP1A 4J95A 3RK5A 1E1XA 3FZOA 3DXPA 2VTJA 1ZMVA 3OWJA 3OF0A 4P90A 1R1WA 3NSZA 5FUTA 2RL5A 4BYJA 2XIZA 4GJ3A 4MBLA 2WMBA 1S9JA 4KRCA 3QXOA 4RMZA 3OWPA 5CQUA 4AW2A 5CF8A 5L6OA 2C5XA 2VNWA 1SZMA 1MQBA 1OKWA 3W2OA 3GU7A 5C03A 2X1NA 5IQEA 4ZJVA 2WQBA 2HXQA 4CG8A 2QKRA 3U4WA 4UMPA 2WTJA 4B7TA 2VX1A 3C0GA 2R9SA 3FQHA 2JBPA 4IVAA 4DEAA 3C4XA 3D0EA 1YXVA 3ORMA 4L6QA 3KXGA 2XIXA 4BCQA 2O64A 3EJ1A 5HU9A 2OI4X 2C3JA 2YITA 1TQPA 3FL5A 2ERKA 5E90A 4CMUA 3QC9A 5L8KA 4PDSA 3UZRA 3QL8A 4HGTA 4ZLOA 4PL5A 4HCTA 3DQXA 1MRUA 2UW9A 3QD3A 3DT1A 4ZEGA 3W16A 3W2RA 4K0YA 3RBWA 3V8SA 4IAFA 2C30A 1OIQA 4GYGA 4CVAA 2J5EA 3I0QA 2QOOA 3NW7A 3CCNA 4MXYA 3BCEA 4QD6A 4OUCA 4CT2A 4OTRA 3OWKA 2CGUA 4IWPA 2HW6A 5A46A 5KO1A 4EI4A 1JKLA 3PLSA 4LM5A 3NZ0A 3VS5A 3PTGA 4AA5A 5J9LA 5BMSA 5ICPA 1ZMUA 5AUZA 2OJFE 3O71A 5BYYA 2PVYA 2EXCX 4FT0A 3L8SA 4RZVA 4IAIA 1WBTA 3HV4A 4GT5A 2IW6A 4XNEA 1KSWA 3VBTA 4BDIA 1OB3A 3ACJA 4FSWA 2C6TA 3NCGA 1UNGA 4FUXA 4ZTNA 3MPTA 4JS8A 4UB7A 1XR1A 1WBOA 4IVCA 3ZXZA 5IA0A 3OT8A 3Q53A 2RKUA 5LOHA 2IG7A 2ITPA 2HYYA 3F5XA 4HCVA 3FMJA 2UVXA 3RHKA 3V5LA 4O21A 4AZFA 5LXMA 4HVIA 2F2UA 1OGUA 2BDWA 3COHA 2EXMA 3NEWA 1YXXA 2IPXA 5AAGA 3KKVA 4FK6A 3DXNA 3U6HA 2XM8A 4ID7A 2UZTA 3SD0A 3NUAA 2VTPA 1CDKA 3E7OA 4W9XA 3NVKI 4EQMA 5I5ZA 2YHVA 3LJ1A 1GZ8A 2PMOX 2ZV8A 4M68A 4I3ZA 2H8HA 1OUYA 3QYWA 4MKCA 4U8ZA 4YBJA 3VS1A 5CU0A 3WYXA 5BVEA 5AV4A 3S0OA 4IEBA 3OXZA 3W32A 4JG8A 2FUMA 3F2NA 4RBLA 5ETIA 2CKPA 2ITQA 2NO3A 3BHTA 1M7QA 5ANEA 2BAKA 2JKQA 3V3VA 4USFA 4FZ6A 4DTKA 2WMQA 4M7IA 4BGGA 3LHJA 3QGWA 4ERKA 4IZ7A 3HMMA 2RSVA 5IEYA 3DKFA 3MVHA 4MXZA 3O23A 3RINA 3OBJA 4MK0A 5AR8A 2EVAA 5AP4A 4B4LA 2OJ9A 4UXQA 4YO6A 5DR6A 1BL6A 2G2HA 4RLLA 4IM0A 3UODA 1JWHA 5C4LA 5JFXA 5FQDC 3DXQA 1MRYA 5CVFA 4J7BA 4TZRA 3PXKA 3RALA 2UW0A 4TYHA 4EOLA 3ZMMA 4QO9A 1PW2A 3V04A 5KKRB 3POZA 4I6FA 4PQNA 4QP4A 3QCXA 4C4IA 3WE8A 2AYPA 5H8GA 2PUNA 4R77A 3LFFA 1WBPA 2OICA 3H0YA 4FUYA 4JAIA 3QGYA 2CMWA 4QYYA 4C35A 3U9CA 2CN8A 3IDCA 3DBQA 4CMOA 4F7LA 1M2RA 5LCKA 2PE2A 2VTIA 2UZWE 3UPXA 4NT4A 2RG6A 4U3YA 3RPRA 3TWJA 2VO6A 3TUCA 5AFVA 3KK8A 4FKUA 3F61A 1NVQA 2ZM4A 3EB0A 4IWQA 4U79A 3WF9A 4C3RA 5KMIA 2QQ7A 4I1ZA 4OBOA 4TYIA 2YDJA 4CQEA 2JGZA 2W1EA 3E3BX 4ZSLA 1OIRA 5K4IA 2YZAA 4HPUE 4XRLA 4FR4A 4O7TA 3HV3A 4KKEA 2RFDA 4YTHA 5E8YA 4QP6A 4BKZA 5FEQA 4AOJA 4KKHA 4QYEA 3CJFA 2Q0NA 2C47A 4FGBA 1E9HA 3MVMA 1UU7A 1NA7A 3O0GA 3A7IA 4FSQA 4RWIA 3PJ1A 4FG8A 3RPSA 5M4UA 4U0IA 3CGOA 3MY5A 4CD0A 4CLIA 2C5OA 2JAMA 4F65A 5EI8A 4K2RA 1IA9A 1YI4A 2OIDA 2VWUA 4C59A 2C6OA 3WZJA 3GI3A 1CM8A 5JGDA 4F9WA 3HMOA 2PVHA 4OTFA 2XA4A 1VJYA 1OL6A 3GQLA 3UC3A 3FZRA 3QYZA 3LFDA 1XJDA 5K5XA 2EB2A 4EK3A 4RX8A 1OZ1A 2XIKA 4ENXA 4OTIA 4B8LA 4EOOA 2EU9A 4GIHA 3QQKA 3L8XA 2H34A 4E5AX 3ELJA 2I40A 2CKOA 3TUBA 4EUTA 1ZXEA 2XEYA 3AC2A 2VTLA 4FEUA 2PVNA 3DJ5A 2W1GA 3FLNC 4N6YA 3R9NA 4CT1A 4M66A 3ZO4A 5AP7A 4GKIA 2YM6A 3UQCA 2HW7A 3G6GA 2NP8A 3QZGA 5BVNA 1BLXA 3FSFA 4XG4A 3KF4A 3IO7A 3LVPA 5IA5A 3G5DA 1BKXA 3R7OA 4BCGA 2O63A 4MH7A 4C4FA 3OG7A 1K3AA 3FMDA 3II5A 4NUSA 5FRIA 5CEIA 5FTGA 3QD2B 3P86A 4DGNA 4M8TA 3GP0A 5BMMA 3T3VA 3SC1A 2BAQA 3LFAA 5KMLA 5M53A 4ASEA 3PP1A 3C9WA 3Q6WA 4BI2A 4EOMA 4ZZOA 2P4IA 3ZDUA 4F9YA 5AAEA 4GKHA 5I9YA 4WG4A 3VBQA 2XS0A 4PWNA 1BYGA 3FKOA 3D94A 4I23A 5DGZA 4AWIA 5EOLA 2WELA 1ZOHA 2C0TA 5LARA 3WF8A 4K33A 4F1OA 2Z7RA 2J7TA 1O6KA 3F5GA 3P5KA 4DBXA 3WZEA 2C68A 1JBPE 2BIYA 3ODZX 3ZYAA 3R28A 4LGGA 4FIFA 1YRPA 2HY81 3ENHA 3KC3A 3PFQA 3Q32A 5ETFA 2Z7SA 2YJSA 2FO0A 2GS7A 2R3LA 3HEGA 4CFWA 1NVSA 4FTTA 4I20A 4E1ZA 1G3NA 2BR1A 1CKPA 5I9WA 4ACHA 3P7BA 2UZOA 5TOZA 3P7CA 4J1RA 2FSTX 1UNLA 4FGRA 4DLIA 2ITVA 4JDKA 3FPMA 4TY1A 5FTQA 2BRHA 4WRSA 3RHXA 5IISA 1J7UA 3CSVA 5M06A 4A9SA 2GNGA 2VWZA 3FWQA 3BYMA 3KQ7A 4S33A 2QR8A 1URWA 3KCFA 5H2UA 3SLSA 2B9HA 4TXCA 3ALOA 4JQ7A 4BDGA 1WBVA 5KMJA 1R0PA 5KMKA 4AFEA 3VC4A 4ACCA 3HL7A 3LXKA 3QAME 4ITHA 4IX5A 1Q3DA 4BBMA 3PG3A 4J71A 4NWMA 5IA4A 4CFFA 4DCEA 3DGKA 1WVYA 4MNEA 2P3GX 5AMNA 4DBNA 1OL7A 2UZLA 4X2NA 5B2MA 4YURA 4FT5A 5CI7A 2XK6A 3W2QA 2PSQA 5AAFA 1HOWA 1ZYCA 3I5ZA 1YHWA 4G31A 5DNRA 1OIYA 5ANJA 3BX5A 4EORA 3WARA 4OTWA 4R3CA 3KB7A 3L9LA 3OCSA 3CE3A 4QYFA 4R8QA 3VO3A 4KAOA 2VO0A 3FLSA 3QUPA 4XG9A 5C8KA 5IA1A 2QO7A 2QLUA 2AC5A 4Q2AA 3VS4A 3DY7A 4CKIA 1XH5A 3WILA 4W4YA 2Z8CA 1U5RA 3TV7A 5T3QA 4CRSA 4O7SA 3MTLA 2A27A 3AT2A 3R6XA 4AN9A 4QP9A 4IAZA 4I0SA 1GZOA 2R3KA 3IQ7A 1Q8WA 4JJRA 1ZZ2A 2HENA 5FGKA 4FE2A 3BV2A 4O1PA 4R7HA 4QMZA 2CGVA 2WQNA 3AC4A 3ZRMA 4U7ZA 2PU8A 3ZFXA 3EQPA 4RC4A 4J8MA 3UYSA 4FV5A 3IPHA 1DS5A 4Z55A 4K11A 3DAKA 5DIAA 3LFEA 4RC3A 5G6VA 4DFUA 3I5NA 4IACA 3CQWA 2QVSE 3GC7A 1WVXA 2ITZA 3DAJA 3ZC5A 4HYUA 4DEGA 3A7GA 1S9IA 2UW3A 4JOAA 3UOHA 4H1MA 5HTIA 2J0KA 4GVJA 5I9ZA 5M4IA 2XNBA 5JGBA 1PXMA 5DEYA 5IG1A 2VWYA 3F3WA 1O9UA 2OIQA 2QONA 3NLBA 3PPKA 4YBKA 4ZLZA 5BX0A 2V22A 3DZQA 5IA2A 2B0QA 2QD9A 3LE6A 3NIZA 1TQIA 2X8EA 3KXXA 3Q9YA 4D4YA 5D12A 2X7OA 1Z9XA 1GNGA 5E91A 4XMOA 4FKWA 5HNGA 2QHMA 4KIKB 3UG2A 4B6LA 4GW8A 2VD5A 3EFKA 3OCBA 4XEYA 5IA3A 1YDRE 3BRBA 3E8NA 2PULA 2YAKA 5E8WA 5IQAA 4KBKA 3VUHA 2UW4A 4G34A 3HP2A 3UVPA 3NAXA 2I0HA 4C4JA 2Y4PA 3OT3A 4FTCA 4APPA 1Y57A 2ZV7A 3O8TA 3C50A 5DFPA 4FSNA 4I4EA 4PP7A 3LCDA 3NUPA 5EHYA 4XOYA 3GB2A 2GHLA 2OZAB 2XIRA 3SHEA 4XOZA 4YJTA 4FSRA 2BDJA 3AGLA 4TNBA 3TTIA 3W18A 3SRVA 2IZTA 3VIDA 5K9IA 2XF0A 3ODYX 1OIUA 4N4SA 5B2KA 2QOBA 1J3HA 4NM5A 3I6WA 2C0IA 1KUTA 1GZKA 1H25A 2IZRA 1I44A 1GJOA 2NRYA 3R8ZA 3JVSA 3PIZA 1FOTA 3SGCA 3P7AA 2BZHB 3R8PA 1IG1A 3UDBA 1ZOEA 1NT2A 5LMBA 4LGHA 4O0SA 4U44A 5CENA 3E8CA 3Q52A 3TKHA 2B4SB 3QQFA 3C5UA 4YPDA 5C27A 3KRWA 3DTCA 4BDCA 4FKGA 4PRJA 3FLWA 1SNUA 2VWBA 2PE1A 2HY0A 3VVHA 4UWBA 4E5WA 2UW8A 4MAOA 3ZRKA 2QI8A 4CGAA 3BU5A 3OWLA 2YM4A 4OW8A 2UZEA 5E8SA 4DINA 5JT2A 4QP2A 3FI8A 4UYNA 3LZBA 4Y73A 4PTCA 3ZSHA 3TCPA 3B2WA 4C02A 4OT6A 3DK7A 2CCIA 3GU6A 3DQWA 3KK9A 3OFMA 2XRUA 4I0RA 5HICA 4DN5A 4FNYA 2XNPA 3ZSIA 4YZBA 4QMLA 3FMEA 2JLDA 2EUFB 4X6RA 5IH4A 5DR2A 3F88A 2W1IA 1FBNA 4J52A 4BDAA 4QYHA 3F66A 2IW9A 4M13A 2CCHA 4QQ5A 3BYUA 4GL9A 4L42A 2GQRA 4XV2A 1CKJA 1GY3A 2PZIA 4CSVA 2XH5A 4MXAA 5F20A 4C34A 5D7VA 5A4CA 3LLTA 3FMMA 1JAMA 3BQRA 3D7TB 3KVWA 4MF1A 3DLZA 4FK3A 2JIUA 5ANDA 4TYEA 2R3PA 3CEKA 2OF2A 4AE9A 4KBCA 4WUNA 2DWBA 4YZDA 3MFRA 4XUFA 4M84A 2PZPA 4N70A 4RX7A 4M12A 4H3QA 3W2SA 4BN1A 1L3RE 3GCSA 3PP0A 3VUGA 4BDJA 4Y83A 3CKWA 5AX3A 2BDFA 4R78A 3BELA 3KMMA 3QA8A 1A9UA 3P9JA 4UALA 2X7FA 5ACBC 2R64A 3QD4A 2WOTA 4GJ2A 4XP3A 3DNEA 3UG1A 2J2IB 3EQBA 4EOJA 2W4JA 2ZM3A 3R2BA 3NUSA 5AP3A 2PUIA 3ZZEA 2YLEA 3EYGA 4PF4A 5CQWA 4YLJA 4D9TA 5M09A 2BRNA 4KINA 2XYNA 3FUPA 3R1SA 3FMHA 2BRBA 2YFXA 2BCJA 4A4XA 1WZYA 3CS9A 4NIFA 5AR5A 3TZ9A 4BI0A 4ZZNA 4GV1A 3UO5A 2YZLA 4WHZA 1Q99A 5IQDA 4DGOA 5M44A 3E87A 5DH3A 5HG7A 4BDHA 4F09A 3HKOA 4EC9A 1OL2A 2W9FB 3ZHPC 2C69A 2VUWA 1YOLA 4RIOA 4BZDA 3ROCA 2VTAA 3RNIA 4U81A 3GOPA 5LVOA 5AIRA 3UOLA 5BPYA 4ALWA 4ZTSA 1H28A 3PRFA 4C3PA 3TJCA 2XZSA 3LJ2A 4H3BA 1BI8A 3IW7A 2W96B 5C01A 3ORTA 4NJDA 4ERWA 3FHRA 2F2CB 2QR7A 3FL4A 5H8EA 1G8SA 4PMTA 3QQGA 4NKAA 5IQBA 5AADA 3DS6A 3SG9A 1JKSA 3Q6UA 3JUHA 1FVRA 3MJ2A 4KABA 5CEMA 3ORIA 3EL8A 4XYFA 4P7EA 1IA8A 3QX4A 5D41A 4L8MA 4K1BA 1VR2A 4DA5A 4E5BA 2UV2A 3ENMA 4IB3A 3N9XA 3KN6A 3PPJA 4QP7A 3POOA 4MCVA 5CT7A 4UMRA 4FKTA 3UNZA 1XWSA 2WQEA 2OW3A 4G3DA 3VF9A 2JKOA 2QO2A 3ZEPA 2VWIA 3EYHA 4ASZA 2ITNA 4DG2E 2QU6A 2R3HA 3IS5A 2YEXA 3JVRA 5AWMA 4D4SA 5E8XA 3L8PA 3K3IA 4FSUA 1FVVA 3GOKA 4R5YA 4ZY5A 3TNWA 2ONLA 3VW8A 3D5VA 5CEPA 5M08A 3LPBA 4BCMA 3LFNA 5EKOA 2UVYA 3HA8A 4NM0A 5HORA 5HX8A 1W84A 4X21A 3VW6A 2BAJA 5LVPA 3EN4A 4IAYA 4MWIA 3NW6A 4KS7A 4O86A 4CMTA 4TYJA 1JQHA 3BE9A 3R7VA 3OEZA 3FI3A 3W1FA 4BVUA 2ONLC 4C62A 4FICA 3FV8A 4RLKA 3BIZA 2XUUA 3HA6A 4OAUC 2VGOA 2WXVA 5TR6A 3HDNA 3Q60A 2ITUA 1J7IA 4LOOA 3TN8A 2ITTA 4X3FA 5EK7A 5KBRA 4RJ6A 3ORNA 4HVGA 2VTTA 2ZDUA 3E8EA 1ZWSA 1W98A 2BRGA 4FBXA 2QCSA 4FODA 3PJCA 2YIXA 4CZTA 3V8TA 5JGAA 3P0MA 3ZFMA 1Q5KA 2PZRA 2R2PA 4D2RA 4X3FC 1YWRA 4F0FA 2W1DA 3MDYA 4AT3A 4BDKA 4W9WA 4EYJA 4HCUA 2PYWA 4DE4A 3LW0A 5J95A 3TDWA 2H96A 3HDMA 4BRXA 5CZHA 5LWNA 3VBVA 1R3CA 3Q3BA 4DFYA 2XRWA 4ASXA 4BCIA 4AFJA 4E6QA 4LV5A 4R1YA 2J51A 3B8QA 1FQ1B 1XBCA 4PL3A 3OY1A 4AP7A 3VQUA 4E7WA 3D14A 1MQ4A 2J6MA 3G0FA 3KVXA 4YC3A 5HCXA 4UZHA 3ET7A 4U42A 2IWIA 4W8EA 4PMSA 3EMGA 2OXYA 4QMNA 4X2KA 4HYSA 4Y72A 4AZEA 3KMWA 5CF6A 3LQ3A 4ZTQA 1SM2A 3DU8A 3E92A 4ASDA 5I9XA 2O5KA 3PIXA 4YP8A 3VJNA 4D1SA 4G5JA 2XIYA 4Z7HA 4O81A 1QPCA 3AQVA 4KRDA 4BKJA 4E3CA 1NY3A 3T3UA 2JDRA 4BCNA 2J4ZA 1XO2B 2VNYA 4FIGA 5AA8A 2XKCA 5AUVA 1ZARA 5B2LA 5HGIA 3NGAA 3DCVA 5IMEA 1PXLA 2BZJA 4LI5A 4YGAA 3T8OA 1JKTA 2FVDA 4EH9A 1P4FA 4G6OA 4E4XA 2QO9A 3R1QA 1F3MC 5E1EA 5L4QA 2Q83A 4D5HA 4RFMA 4XV3A 4O84A 2R3QA 1URCA 3H9RA 4H3PA 2AC3A 1JOWB 4D0XA 3BLRA 3QFVA 3TIZA 2W4OA 3CD8A 4FYOA 4RQVA 3W10A 1U54B 3ZOSA 1Q24A 5EI6A 2H9VA 4RGJA 5HVKA 3TACA 4AGCA 3UPZA 3BZ3A 3GNIB 4GFOA 4NL0A 4HGSA 4IWDA 5J5SA 5CAQA 1AQ1A 3ZO2A 4Y46A 1P5EA 4EWQA 4L3JA 2FH9A 4NEUA 2EB3A 4FIHA 1GZNA 1MRVA 1W8CA 3NNWA 2C3IB 5DA3A 5LVLA 5TKDA 3TV4A 2I7QA 1JSVA 4S32A 3RAWA 4FIEA 1P14A 3PE1A 3RAKA 3TKIA 4FMQA 4E20A 2WU7A 4MD8E 1QPDA 1XH6A 4FIIA 4RVLA 2CLXA 2F4JA 4L53A 2F57A 3F5PA 2B1PA 2PVLA 3TNPC 3R2YA 4YSJA 3EQDA 3BBWA 3NPCA 4O0VA 4RVMA 4CXAA 3UNJA 3I81A 2XCHA 3DA6A 4FL3A 3GBZA 2XYUA 4C3FA 5IQCA 4DEHA 4HZRA 2VGPA 3C0IA 2WIPA 2ZJWA 2PUUA 3NUUA 3FI2A 1QL6A 2WU6A 3WF6A 3E8DA 3EFJA 3KA0A 3QTZA 3V01A 4JRNA 3Q5ZA 1UVRA 2IZUA 1YWVA 3PA5A 2R3JA 4ZZMA 5L3AA 4X2GA 2NRUA 4YJRA 4P4CA 4OR5A 4AG8A 3UE4A 4IW0A 4ZJIA 4DFNA 5GZ8A 3FC1X 4I22A 4XS2A 3E63A 2WTKB 3UOKA 4B99A 2B54A 2YACA 4EC8A 2HELA 2WFYA 2GHGA 4XP0A 3R21A 3OBGA 3H9FA 3TZ8A 3RM6A 4C8BA 4N0SA 2G2FA 3V6SA 4BGQA 2BTRA 3MS9A 4ZSAA 1J7LA 2P2IA 1ZAOA 3GC9A 3R71A 4I93A 5EH0A 3R7YA 3V6RA 5J9ZA 1L8TA 4NH1A 4AXAA 1R39A 2B53A 2P2HA 1R78A 4K9YA 4XH6A 5BVOA 4HW7A 4O7LA 2IN6A 2LGCA 3ZM9A 3MBLA 4FTJA 4XJ0A 3C5IA 3BBTB 3VS3A 3HMPA 2JAVA 2Z7LA 1GAGA 5GHVA 4RPVA 5IEXA 3F69A 4L46A 4EHGA 3ROYA 3NYOA 3NCZA 3NS9A 1OUKA 4A9UA 1KE8A 4C57A 4KS8A 5BUEA 5IU2A 4FEVA 3HP5A 4YZNA 4F6WA 2JBOA 4PMMA 3R9RA 3CTQA 4O96A 5K4JA 3QWJA 2BKZA 1LPUA 5TO8A 1H26A 4FI1A 5HE0A 3UBDA 1G8AA 1EH4A 1ERKA 4AGWA 1OVEA 3BU3A 3M42A 3EQCA 5LMAA 2W5BA 4O27B 1TQMA 3QCSA 2XEZA 3DBDA 2VTNA 2C6KA 3EN5A 3ETAA 1OBDA 2CNQA 3ORZA 4KUJA 2VN9A 5L8JA 4TPTA 5HHWA 3O7LD 4AZTA 2R3OA 5GINE 4WKQA 4WSYA 5A14A 5HQ0A 4YZCA 3QTUA 3R22A 3EKNA 4ANLA 3MA6A 1BMKA 2QNJA 2HK5A 5C1QB 3AMBA 4KIPA 4EQCA 4CFXA 4RJ5A 4RIYA 5DBXA 4IFGA 3ORPA 3VWAA 2RGPA 4NYEA 3Q4UA 4FTUA 5HLNA 5K0XA 5EM6A 4O7YA 2C0OA 3LMIA 5HIDA 3A99A 4IJ9A 2W1CA 3MFTA 4I41A 3KRRA 4IVDA 1OBGA 3MN3A 1CTPE 2Q0BA 3RPVA 3MY1A 5AV1A 2WAJA 5M4CA 5L2TA 1P4OA 4FG9A 4LV8A 3Q5IA 3E5AA 3JPVA 3IGOA 3ZU7A 4U6RA 3SOAA 4ANSA 4CFNA 2YABA 4O91A 2PVFA 2QOKA 3DOGA 3ZC6A 5CF4A 4YJNA 5HE3A 4RIWA 4YO4A 3D5XA 1YXSA 3R7IA 1RDQE 3QUEA 4AN2A 2WO6A 3RGFA 4MHAA 2BVAA 3UP7A 4WD5A 3VS0A 4IFCA 1OM1A 2GQGA 5AP2A 3ORXA 4AGDA 2BRMA 2VRXA 3MI9A 3PY0A 5I3OA 3TG1A 1H1WA 2WMVA 4BZNA 3ZONA 3FXWA 3A2CA 4TYGA 3UP2A 1IEPA 3EWHA 3LQ8A 5FXQA 2PMNX 2VTOA 3MJ1A 4JDHA 4YZMA 3G15A 4BCKA 3PA3A 4JBOA 2DYLA 2E9UA 4GG7A 4LUDA 5KMOA 3QZHA 4PPBA 5JFWA 4ZMFA 4CZUA 1YI3A 2VWWA 4IIRA 5AUYA 4BF2A 4DYMA 2ZDTA 3MSSA 4GMYA 4IX3A 3OY3A 4F6UA 2IVTA 1UV5A 4I21A 2YCSA 2JC6A 3BYOA 4S31A 4BI1A 4UMUA 5CSXA 4N57A 3RAIA 3W8LA 1UU8A 4F4PA 5EQEA 3IDBA 1TKIA 3OUNB 2C6EA 3MFUA 5C26A 4FKIA 4FOCA 2C1AA 4RRVA 2CNVA 4FKPA 2XNNA 2O2UA 2X2MA 3AT4A 3PIYA 5CVHA 3UTOA 4AE6A 5I0BA 3HX4A 1Q8UA 3I1AA 3QF9A 4CG9A 2OGVA 3BQCA 4FKQA 1OL5A 4QMWA 2J9MA 3EN9A 2HXLA 2VTQA 2C5NA 3G2FA 5T6KA 5ANOA 4CFUA 4G17A 5J9YA 2B9FA 2GS2A 5JN2A 4CYIA 4LUEA 4QOXA 3M2WA 4O0XA 1YWNA 2J0JA 3DJ7A 2XJ2A 5HG8A 4E93A 4JQ8A 4E4MA 3JY9A 1AGWA 3FZTA 3BYVA 4FTOA 3R30A 4FZAB 4KWPA 3EQFA 5IKWA 2QOQA 4L3PA 2IO6A 3DFAA 4YTFA 3ZO3A 2ZB0A 2DQ7X 4Y95A 3DZOA 1SVHA 3E7VA 2QU5A 3LFBA 4YR8A 5IQGA 2B9JA 5FDXA 3FLQA 4GYIA 2W1FA 4C4HA 3OXIA 4EH3A 4IE9A 5EYCA 1H1PA 4OAVB 2WMWA 4DH7A 4ZAUA 4JVGA 3ATSA 1HCKA 3LFSA 5KZIA 3G0EA 3R02A 1SNXA 4ANQA 4IJPA 2V7AA 5HE2A 1H08A 3IGGA 4DEEA 5HIBA 2VX0A 3WIGA 1OKZA 3PPZA 4IHPA 5EW8A 5J7HA 2UZBA 3WI6A 4IWOA 4MX9A 5GZ9A 2X81A 1NW1A 3EQRA 2XP2A 1PRYA 4ZMEA 5A6OA 3DK6A 2VO7A 3KL8A 2I0EA 3SW7A 4HGEA 2QHNA 3JS2A 3GCUA 5G1XA 4CYJA 4L9IA 4AS0A 1H27A 5A54A 5ITAA 1YHVA 5FP5A 2DS1A 2IVUA 2O3PA 5FWKK 3K54A 5JZNA 3UC4A 4OGRA 2OJJA 4LRJA 3VJOA 4E6AA 3N51A 5KCVA 5L2SA 4QMTA 4PPCA 2ITXA 5KMNA 2YA9A 1YKRA 3NNUA 3HECA 4I4FA 4TKSA 4FT9A 3RPOA 4EQUA 3F2RA 3WF5A 4EZ7A 3BHUA 4ZIMA 4P2KA 3R8VA 3MH2A 1Q8YA 2XM9A 5EM7A 4D55A 3NNVA 4O82A 4AW5A 4GK2A 3ATTA 3V5JA 1W83A 4LRKA 3PRIA 4MD9E 5HZNA 5D7AA 1ZYDA 4X6QC 2BMCA 4DGLC 4LYNA 3WF7A 3ANRA 4HNIA 1KV2A 4BCHA 2VTRA 2E9PA 2YJRA 1YXUA 4QQCA 1YDTE 5AM7A 2G15A 5HEZA 4WG3A 5C9CA 5JMSA 3KULB 4FV9A 3EIDA 4WRGA 2A0CX 4D1ZA 4EHVA 5CAPA 3ACKA 4FEWA 4DTBA 3HYHA 3RI1A 4IZYA 4LMNA 3VUTA 3R9OA 2O0UA 2YCQA 3D15A 5FM2A 4IX4A 4NM7A 5HO8A 2IVSA 4L00A 2Y4IC 4WNPA 3GQIA 1CKIA 4EEVA 4I6QA 2WGJA 5D10A 2OJGA 1MP8A 3A7JA 2ZV2A 3QUDA 4BL1A 1M52A 3IOKA 3FXZA 3UIMA 3R73A 5F9EA 4EH5A 3O2MA 3KF7A 3L9MA 2PL0A 4Q5EA 2HAKA 5HTBA 5H9BA 4JI9A 4L44A 3KRXA 4HVSA 4NSTA 4FL1A 3OOMA 2QOCA 4MF0A 2FB8A 3NAYA 4QP8A 4WBBB 5L8LA 3A4OX 4GH2A 3LKMA 3O96A 2OXDA 4EH2A 4G5PA 2W0JA 4AOIA 3KCKA 4G9RA 1OITA 1OKVA 4OTDA 4AA0A 1YW2A 1Q41A 4U43A 2GNJA 5I3RA 4XBRA 4BCPA 3OVVA 4MEDA 4M0ZA 4WNOA 1SMHA 4Y8DA 1JKKA 4LOQA 4IC7A 4PUZA 3EQIA 3CR0A 2E9VA 3C4WA 2C5VA 1PMUA 3PXFA 1OMWA 2VU3A 2FA2A 4GK4A 3V5WA 3S95A 4DEBA 4FTMA 4YC6A 3IONA 3W8QA 2QG7A 1H4LA 4RSSA 2IW8A 4IADA 1WBSA 2QODA 5EFQA 5AR2A 1ZZLA 2PK9A 4MQ2A 3TTJA 4S30A 4YHTA 4F9CA 4A7CA 3U55A 1VZOA 2JFLA 3CTHA 2Z02A 5HO7A 3RTPA 2O8YA 1PYXA 4F7SA 5HNBA 4FA2A 4PX6A 2XNEA 3EQGA 4F63A 5FG8A 4DHFA 2YDIA 3TL8A 4I0TA 3RWQA 1QMZA 5E1SA 4FZDB 3GEQA 4W4VA 5BVFA 3UVRA 5F4NA 3TNIA 3RVGA 4J8NA 3FZ1A 1WFCA 4D2PA 2OO8X 3DJ6A 3QRKA 1WVWA 2CKEA 4CCUA 2BALA 4HJOA 3PVBA 4UMTA 3BHVA 4DEDA 4EH4A 4CKJA 5FXSA 3UVQA 4FC0A 5CXHA 2UW5A 5CSVA 4YSMA 5BVWA 3EN6A 5J79A 4XG8A 3AD6A 4L01A 3N4UA 2Y6OA 3LLAA 3PE2A 1Q8ZA 3NUNA 4R6VA 3RJCA 4ZSJA 3NR9A 2F7XE 4WT6A 1DAYA 5J1VA 3CLYA 4JRVA 3G51A 5HU3A 4A9YA 3ZUUA 5JQ8A 5E4HA 3NYNA 5A4EA 4F1TA 2CSNA 3OZ6A 3C4FA 4EJ7A 4XV1A 5CASA 5L2QA 4G3GA 3R7EA 1H1SA 2R0UA 3DFCB 4I5MA 4I6BA 4X0MA 5A3XA 4D4RA 2RF9A 3KEXA 5BNJA 4BCJA 2R3GA 1CSNA 4OTQA 5K3YA 5CEOA 4D2SA 2X4FA 3VHEA 3HRBA 5EDPA 3P78A 2OG8A 3SV0A 3IKAA 1OPJA 2WQMA 3BHHA 3NW5A 4WOVA 4YHJA 1K2PA 3WZDA 1P2AA 4DGMA 3MWUA 4X7QA 3IW4A 5AUUA 3AMAA 5EYKA 4FSZA 4CCBA 2BHEA 5I9VA 2AUHA 2C6DA 5M07A 4FG7A 4MXCA 1IAHA 3NDMA 3RP9A 4RWLA 4DFLA 4GSBA 4EHEA 2PZ5A 2GNIA 2QOLA 3PA4A 3GCVA 5GIPE 4RJ8A 2YCRA 2G1TA 2YERA 3F3TA 4QPAA 4ZSEA 3VBXA 3VRZA 4A9TA 2X8DA 4CV9A 3AXWA 1NXKA 4NCTA 2WNTA 4BDFA 5J7BA 3G9NA 4V04A 3D2IA 3I6UA 3VRYA 4H39A 3UO4A 4ITJA 4E4LA 1VEBA 5LQFA 4WG5A 1Q61A 1WBWA 3KXHA 2FSLX 2X9FA 3Q4CA 4EBVA 1Y91A 1M17A 3LFQA 2UW7A 4NCTC 3I79A 2R3NA 5AV2A 4F0GA 4ARKA 4YJSA 3B2TA 4FTAA 2NPQA 5KX8A 3SA0A 1XHAA 2KTYA 3KXNA 4BTMA 4EOIA 3KFAA 1W0XC 5KHXA 2C6MA 4GT3A 3NUYA 3PJ8A 1DI9A 5DE2A 1XKKA 4XG6A 4GFMA 5CSPA 4R3RA 4W4WA 4LL0A 5A4QA 3EHAA 4ANMA 2WPAA 4L52A 2X4ZA 1ND4A 4P5QA 1UNHA 5TF9A 4J97A 5HG5A 1H01A 1VYWA 4XV9A 1KWPA 3WZKA 3LQ5A 5C8MA 3HV7A 2BROA 3REPA 1UU9A 4CQGA 4XG7A 4E26A 5BUJA 3Q04A 2YM7A 2XKFA 3DTWA 4PTGA 3JR1A 1XBBA 2FSMX 3DKCA 3LCOA 4EOPA 3QALE 2ZMDA 2JDTA 3RMFA 3H10A 4DFXE 2GFCA 1XH9A 2JDSA 1V1KA 3Q9ZA 4IANA 5CU6A 4ZY4A 2VX3A 3UIUA 5M55A 1BX6A 2PZYA 3DKGA 2J0LA 5JZJA 4FZFB 2C3KA 2BFXA 4RA4A 4FL2A 4AA4A 2GCDA 2GFSA 3KGAA 1O6LA 3C7QA 3ZFYA 4JBVA 3AC8A 5FTOA 5JRQA 4AT4A 3FMLA 4BDDA 1PY5A 3FLYA 4FV2A 3CQEA 3TZ7A 1YVJA 3FXXA 4L7FA 5JQ5A 3NVMB 3AT3A 3SRVB 3KN5A 1LEZA 1B38A 3CY3A 4HPTE 5DOSA 2OJIA 5LCJA 5EDQA 3MESA 5A6NA 2GU8A 3QQUA 3QU0A 4YJOA 2Y9QA 1A48A 1R0EA 4G2FA 4K8AA 3EN7A 4FF8A 2OSCA 3RKBA 2J90A 4BBEA 3ORLA 3F82A 4FEQA 3TUDA 3WOWA 4OTHA 5HLWA 4IDVA 3BKBA 2RG5A 4NFMA 3IG7A 1AD5A 3IW6A 4NTSA 5EI2A 2XMYA 4F99A 1YQJA 4MYGA 3QWKA 1VYZA 4UX9A 1XBAA 2W5AA 3QTSA 4YNEA 3BPRA 4EKKA 1H1QA 3UJGA 3OTVA 3GFWA 4AZVA 4L67A 5EG3A 4EOSA 3DB6A 3OMVA 2WB8A 5KE0A 3QLGA 3R01A 4EYMA 2OLCA 3WZUA 2CDZA 3WIKA 4G3FA 4V05A 1PXNA 5K5NA 4Q5HA 3Q4TA 5CNOA 5EDRA 3PJ3A 3CTJA 4I24A 4JR7A 2ZMCA 2GQSA 1KE5A 1E1VA 4HGLA 4C2WA 4U97A 1H24A 1REJA 2F7EE 3MVJA 3VF8A 4YJQA 2OF4A 3PG1A 1OECA 4APCA 4DGGA 2GMXA 4AZSA 2XKDA 5DEWA 5IUIA 2ZAZA 5AUWA 2YWVA 1JPAA 3ZLWA 4O2ZA 1JNKA 4NW6A 2YLFA 1KOAA 3UZPA 4O2PA 1PJKA 3TJDA 4BHZA 2PY3A 4PP9A 5HNIX 5CY3A 5DRDA 3L9NA 5HG9A 2BILB 3W2CA 3UQGA 4KNBA 5AV3A 5J87A 3PVWA 2OWBA 4MBIA 2PMLX 4BDBA 2XKEA 2X2KA 3PJ2A 3OUKA 1XH7A 3FEGA 4YUQA 4Z7GA 4Y5QA 2W7XA 3ZXTA 5ETCA 4AUAA 4L7SA 3G33A 2X7GA 5KBQA 1PMNA 3GCPA 1YXTA 3FLZA 2ETKA 3MIYA 2CHLA 3OROA 3QA0A 4TRLA 3NMUF 3LM0A 2I0VA 2XB7A 4I5PA 5A9UA 1GIIA 1OI9A 4EOKA 4DFBA 4M69B 1UWHA 4WUAA 2YIYA 2PUPA 4BIBA 4X2FA 2Z2WA 4RA5A 5AP0A 1FVTA 4NFNA 3OD6X 4E4NA 3BHYA 3ZUTA 1HCLA 4FTKA 2GNFA 1ZYJA 2VV9A 2E9NA 4KA3A 1ZMWA 4GRBA 5M4FA 4JT3A 4ANNA 2HIWA 3CP9A 2OH4A 3ZTXA 3R8UA 4FTQA 2V0DA 2YAAA 3LCTA 4NIFB 3VN9A 3LJ0A 3MGYA 3W33A 3RWPA 4AU8A 5FEEA 3MYGA 2WTDA 3FYJX 2YM8A 4FSTA 4WSQA 3OCTA 2ETRA 3FC2A 2GS6A 3D83A 4CRLA 1SVEA 4RVTA 4A9RA 2VTMA 3C13A 2XBJA 4RIXB 1M2QA 5CU3A 5F1ZA 3P1AA 4ITIA 4RT7A 4EHZA 3FMKA 3UIXA 2C1BA 4F70A 4EK4A 4XRJA 4FKVA 2P0CA 4PY1A 3MB7A 1Q97A 4WIHA 5FM3A 2I6LA 2ZM1A 3FMNA 4PPAA 4IC8A 5FBOA 2WOUA 5DWRA 4WA9A 3FBVA 2HCKA 5HD7A 3ZBXA 5C8NA 3R9DA 2IJMA 4B0GA 4JX7A 5KMMA 1W82A 3BWJA 4C4GA 3V5PA 4IB5A 4Y85A 1PMEA 4MBJA 5AR7A 4RWKA 4EONA 4TL0A 2YISA 2WIHA 4AACA 2V7OA 1H0WA 5CF5A 3C0HA 4FV7A 4BCFA 2PMIA 3Q4ZA 2DUVA 4G6LA 4X3JA 5DI1A 3V51A 2XVDA 4EUUA 3CIKA 5AR4A 4YJPA 1LEWA 4FVQA 5IH5A 2VZ6A 4BR3A 5HIEA 2WEVA 5CNNA 4XP2A 4B9DA 2R0IA 5BVDA 2JFMA 1JVPP 3IK3A 2OFUA 3LOKA 3R0TA 4V0GB 3RK9A 4IM3A 2G2IA 4RC2A 5CWZA 4OTGA 4PDPA 3P08A 4GT4A 3S2PA 3UQFA 5KKRC 4RFYA 2X0GA 3ZDIA 4GU9A 3LXNA 5EYMA 4E6CA 4EK8A 3NWWA 3SG8A 4P5ZA 3RK7A 3SQQA 2A2AA 4RZWA 2PTKA 3UMXA 4K77A 1H00A 3ZLYA 3SXFA 5B0XA 5DVRA 3H4JA 3TV6A
chains in the Genus database with same CATH superfamily
5C4KA 3R8LA 3ZM4A 5GJGA 2H6DA 4UN0C 3COKA 5I4NA 3G90X 4FKLA 1F0QA 4JDIA 4C38A 4X3FB 4H58A 2W06A 4RWJA 5E92A 2HWPA 4FT3A 1OPLA 3QZFA 4J53A 2GHMA 3H9OA 4J96A 3A61A 2FYSA 4I94A 4U80A 4BFMA 3P4KA 3A62A 1WCCA 4S2ZA 4R1VA 3D9VA 1FMKA 2CKQA 3HAVA 4LG4A 2WZJA 5ACKA 5JKGA 4FZ7A 3UGCA 3BLHA 3QLFA 2NNWB 2UVZA 3E62A 2V5QA 1KE6A 4IBMA 3O7LB 4BYIA 4D0WA 1RW8A 4FVRA 1PF8A 4D5KA 4DT8A 3FPQA 3AG9A 2WMAA 5HE1A 1JLUE 4FV1A 5CXZA 4ZSGA 2OKRA 3PLAE 3ZLXA 4KSQA 5IH6A 4C33A 3PXYA 5CX9A 4CTBA 4KD1A 4BDEA 2XNMA 2UZUE 2WTWA 5AJQA 4IH8A 4YU2A 4M15A 1UKIA 3ZLSA 3NRMA 3QCYA 4H05A 5CI6A 3QKKA 4A4LA 3RCJA 4UYAA 4KIOA 3PFYA 1PKDA 2QC6A 4KIQA 1PMVA 3GU5A 3OC1A 2GNHA 4NU1A 1FINA 2HOGA 1JSUA 3G6HA 5T68A 3ZEWA 2BHHA 3FDNA 3GC0A 2R3IA 4JLCA 1I09A 5ANGA 4DEIA 3ULIA 3HLLA 3MH3A 4MXXA 5CEKA 3L1SA 3KRLA 3P23A 4JL9A 4O22A 5AM6A 2CNUA 3S00A 5JH6A 4BKYA 3D5UA 2PWLA 4FV8A 2FSOX 4OBQA 1Z5MA 2BUJA 3PXRA 1RE8A 4D2WA 2A4LA 4MQ1A 4YZ9A 4C7TA 5EKNA 2QLQA 3GC8A 4JG6A 4RJ7A 4QRCA 3COIA 3O50A 4PDOA 1Y8YA 3V5TA 4JNWA 3P79A 5CTPA 4UWYA 1U5QA 2WEIA 5CS6A 3UO6A 2WHBA 5DRBA 3H3CA 2X6DA 2WMSA 3TNHA 3EZVA 3KMUA 3W55A 2YWPA 5ETAA 3U8WA 2HZ0A 4O0YA 2XK4A 3Q96A 5BVKA 3U9NA 4QTEA 5K0KA 3PXQA 4I92A 3E3PA 4FKOA 2E9OA 2HZNA 4QNYA 4XLVA 4ZS0A 4AXDA 3H0ZA 3I7CA 4N6ZA 4G3EA 3TM0A 4O0WA 4TW9A 2R3FA 4UY9A 2OU7A 3IOPA 2CLQA 3VS7A 3VS2A 4FNXA 4BTFA 4NJ3A 2OXXA 5LWMA 4ANBA 2OFVA 4IB1A 3FQEA 4DDIA 2JIVA 4GCJA 3OCGA 4MVFA 3D5WA 4LOPA 1LUFA 4TN6A 4YTCA 3NNXA 4XBUA 3WYYA 2XCKA 4NW5A 1H0VA 3NIEA 3EQHA 2Y0AA 1GIHA 4M67A 3NX8A 5BV3A 2WMTA 3QD0A 4PL4A 1Q62A 2PVMA 3MVLA 2Y7JA 2J0MB 3PSBA 4FNWA 3GU4A 5F94A 3VBYA 3DBFA 4IZ5A 4DFZE 4TNDA 3VBWA 5FDPA 2XNGA 2W4KA 2YIQA 3QC4A 3QTIA 3FYKX 5IPJA 5AUXA 5JFSA 4ZTHA 4EWHA 4QT1A 3ZSGA 4BCOA 4ZP5A 2FGIA 3QRJA 4O38A 4L43A 3RZBA 3CY2A 3SOCA 3ERKA 3JYAA 3GUBA 1ZRZA 4ANOA 4BWKA 2KULA 4Y5HA 5DHJA 3OP5A 4F7NA 4YHFA 1STCE 5DLSA 4DG3E 2EWAA 3I60A 3OTUA 3PYYA 5AA9A 2QG5A 3SXRA 2BTSA 1WAKA 3PY1A 4ONAA 5CAUA 1U4DA 5CVGA 2R5TA 3M11A 1F5QA 3DK3A 4RVKA 4CV8A 5HX6A 5ANIA 3TNQB 3MH1A 3UNKA 2RFNA 4D4VA 4MXOA 4UXLA 2G01A 4BWXA 4UV0A 4BBFA 1J1BA 1Y6BA 2F49A 5GJDA 3UIBA 5KHWA 5CAVA 3AKJA 2O65A 3KULA 1KE7A 1ZYSA 2Y6MA 4LMUA 4AGUA 2CPKE 4F1MA 4BIEA 1RQQA 4MD7E 4TWCA 4AZWA 3PVUA 4DAWA 4Z3VA 3C4ZA 4O4EA 1BL7A 3TIYA 3VULA 1XH8A 4DCAA 3FQSA 2X2LA 5CZIA 4QQTA 3IDPA 4EZ3A 3SVVA 5TT7A 2VTHA 1LP4A 4S34A 5BQ0A 3PWDA 2BKKA 3K3JA 4IQ6A 5IDPA 3QZIA 3BI6A 2XJ0A 4LGDA 3RPYA 2R4BA 4XG3A 5CEQA 5HLPA 4AW0A 4U45A 4GG5A 3W0MA 4USEA 5A4TA 3MTFA 3UZTA 4KB8A 1UKHA 3TEIA 2ERZE 4ZTRA 2IVVA 4WNKA 1OPKA 2C6IA 3A8WA 2XJ1A 2ZB1A 4TYHB 4AOTA 3F6XA 2VO3A 3F7ZA 3QQJA 3ZH8A 2WKMA 3RZFA 1Q4LA 2OH0E 4IX6A 3Q2MA 2ITWA 4NKSA 4IVBA 5A4LA 2Y8OA 3O17A 4M14A 4U3ZA 2PVJA 3O51A 5HO6A 4YMJA 3LFCA 3M1SA 3BWFA 4QPMA 2C3LA 3MW1A 4FV3A 1U59A 3CXWA 4FTLA 3NUXA 4FV0A 4PNIA 4C58A 1W7HA 3LIJA 3CBLA 3DLSA 1FGIA 2W5HA 4KIKA 5FP6A 4F9BA 4B8MA 4KBAA 3AD4A 4RIYB 2B7AA 5FXRA 4ZS4A 4QMXA 5HTCA 4FX3A 5L2IA 3C4EA 3I4BA 3KXMA 4LFIA 5GNKA 5L2WA 4FT7A 4ACMA 3KREA 1DAWA 2HWOA 2R3MA 3RAHA 2C5YA 3CKXA 4GEOA 5JEBA 5E7RA 3R8MA 3AD5A 4Q9ZA 4RX5A 4JXFA 4L68A 5J1WA 1OKYA 3MFSA 3QRUA 2OZAA 4A4OA 5E8VA 1YOJA 3HVCA 2ZFYA 4O7ZA 1PXJA 3QX2A 3TT0A 3N4VA 5BUIA 4W4XA 3EFWA 2J5FA 4RFZA 3QQLA 2P55A 5EQPA 2YM3A 1T45A 3HUCA 2R7IA 4MWHA 3U6IA 4EK5A 5CSHA 3NYXA 3S4QA 4U5JA 2PVRA 4RIWB 4QMVA 3FZPA 3D2KA 3A7HA 4IAKA 3R7UA 2JIIA 1WBNA 4WBOA 3BEAA 4FEXA 3W0QA 3EOCA 3R00A 4XCUA 1ZY4A 5HKMA 3E64A 4LQMA 3LMGA 4D2TA 2XNOA 4G6NA 2XK9A 3JXWA 4L3LA 1UWJA 4F0IA 3W0RA 3RCDA 4G1WA 4LRMA 1QCFA 3HMNA 3PSDA 5CANA 2ZOQA 2ACXA 2YIWA 4DF3A 2Z7QA 3FZSA 1U46A 5EOBA 1YHSA 4U9AA 4FKRA 5CSWA 2ZVAA 3MPMA 4JBPA 4CZYB 4EK6A 2LAVA 2QOIA 2A19B 4ZTLA 4E73A 4EZ5A 3ID6C 4X2JA 4YNOA 3BGZA 5TE0A 4QP1A 3CD3A 4FTIA 4QP3A 4O7VA 4JG7A 4AX8A 5H3QA 5DG5A 4K18A 2J50A 3QKMA 4H1JA 1V0BA 3GT8A 4QMUA 3SAYA 4FRFA 5M57A 2B55A 2JDVA 4G9CA 4TWPA 3BGQA 3U87A 4BIDA 5KNJA 5GZAA 3SW4A 4YJUA 1BI7A 1Y8GA 2ZYBA 3K5UA 5EW3A 3GENA 4YTIA 3Q9WA 3NFFB 5D11A 3CPBA 4FIJA 4GU6A 5EQYA 2RFEA 3D7ZA 3DDQA 4AF3A 2J0IA 2W1ZA 4V01A 4ALUA 3PUFC 2CGXA 2WQOA 3R63A 4FSYA 2JDOA 3Q9XA 4FTNA 5HI2A 3VNTA 2ETMA 5H8BA 2V55A 5M56A 4O0TA 1X8BA 4CTCA 2QURA 3DPKA 3GVUA 2CN5A 4G3CA 4MTAA 3SKCA 2B52A 3D7TA 5IZFA 2JITA 5E8ZA 3HV6A 3SXSA 4ENYA 4EOQA 3GFEA 3LCSA 4DC2A 2Z60A 5IQHA 5B7VA 4HYIA 5GIOE 3QTWA 1SVGA 3HV5A 3QHRA 4GUEA 3D4QA 4F9AA 5J5TA 1PKGA 2JKMA 3R1YA 3COMA 1Q8TA 5AR3A 3DDPA 4FKJA 4Z9LA 1KOBA 3FKNA 5HVJA 1V0PA 2VWVA 2WMRA 3DKOA 3E93A 3EL7A 4ZOGA 1QPEA 2GPHA 3DBCA 4GFGA 4TT7A 4BTKA 4GK3A 4K6ZA 1ZY5A 4JQEA 3FAAA 1XQZA 4J98A 4EJNA 1PYEA 3TKUA 5HD4A 4JIKA 3DNDA 2PVKA 3F5UA 1B39A 4O7RA 4AT5A 4D28A 1RJBA 3LXLA 5EYDA 2XBAA 4ACDA 4XLIA 1WMKA 1H1RA 4MNEB 2C6LA 2ITOA 5IQIA 3OW3A 4R7IA 1V0OA 4ZY6A 3LCKA 4O0RA 3S1HA 1M7NA 1G5SA 1YOMA 2VTSA 3MV5A 4JR3A 4TWOA 5DT0A 4QMYA 2BIKB 3A4PA 5KZ0A 4LL5A 3THBA 4BWPA 1FPUA 3C4CA 1Q3WA 3F3UA 3BGPA 4OT5A 3UMWA 3TXOA 5IF1A 4D1XA 1REKA 2WMUA 1M14A 3LM5A 4DHJA 3B8RA 3CC6A 4PTEA 4AAAA 4C61A 2R7BA 4IMYA 2BZKB 3C51A 3GXLA 2YIRA 2SRCA 4QYGA 3H30A 1JSTA 2BZIB 4F08A 2R3RA 3A8XA 4QNAA 4O83A 3PXZA 2W99B 3VAPA 2PHKA 3WBLA 3ZCLA 4DG0E 3LMHA 4JDJA 2UZDA 5FD2A 2VAGA 4D58A 4FV6A 4GS6A 5M51A 3EZRA 4EH7A 3VS6A 5BYLA 1CMKE 4IZAA 5EW9A 3QRTA 2Y4IB 3TZMA 4HZSA 4DH3A 1ZLTA 4HVHA 1GOLA 2CGWA 2UZVA 1QPJA 5CT0A 2F9GA 4CNHA 2VWXA 3F3VA 4AW1A 2IZSA 3FE3A 3KXZA 3QTXA 2B9IA 4II5A 1FGKA 4R5SA 3F3ZA 2P33A 3FKLA 4Z16A 1ZOGA 4QMSA 3R83A 5JK3A 3OOGA 4C2VA 4YPSA 1ATPE 3DV3A 2RIOA 3O8PA 3PZHA 4UZDA 3KU2A 5EHOA 5FBNC 4DLJA 3TMOA 2AQXA 3K2LA 3PUPA 5IDNA 1SYKA 2A1AB 3QBNA 4HYHA 5JSMA 4TWNA 3V8WA 4JBQA 2OZOA 2JKKA 4DTAA 3NYVA 5LVMA 3N4TA 4YLLA 2YCFA 2WMXA 5AEPA 3HRFA 5E9EA 5HBEA 5J8IA 4BGHA 2XK7A 4U40A 2YM5A 2V62A 4QTDA 2HZ4A 4Q9SA 4UMQA 1IR3A 4I5HA 4EBWA 2GDOA 1APME 4O6LA 5HBHA 3ZO1A 5JFVA 4R3PA 4ACGA 2YN8A 3ANQA 5CLPA 4CLJA 3U6JA 3PZEA 4E6DA 3HNGA 3RNYA 4ZTMA 3F7WA 3EKKA 4UEUA 4M97A 4YLKA 4CFVA 5EM5A 4QMPA 4GUBA 1KE9A 1UU3A 3A7FA 4USDA 5IMXA 4QTBA 5F95A 4IDTA 3TDVA 4D2VA 3VUDA 4HNFA 3L8VA 1DI8A 1IASA 5LVNA 2I0YA 3BU6A 4NZWB 4GIIA 4ZXTA 4UWCA 3PWYA 3JY0A 3QTQA 5AP5A 4AN3A 3UOJA 5IUHA 3DBEA 2C4GA 3PVGA 4M69A 4OBPA 3ULZA 4AQCA 2WD1A 3KY2A 3T9IA 1PXKA 3ORKA 3QKLA 5AV0A 4ZLYA 4PV0A 1B6CB 2BFYA 5FLFA 4JAJA 1YDSE 4W8DA 3Q2JA 1M2PA 3VUMA 3UYTA 5AX9A 1UA2A 5CALA 3FY0A 5DR9A 3L9PA 4WNMA 2W17A 4FKSA 1FMOE 2X6EA 3G9LX 4D9UA 4H36A 4EKLA 4J99A 4QMOA 2GSFA 3DAEA 2I1MA 4UBAA 5LMKA 5EHLA 5BYZA 3ZBFA 3MY0A 2WTIA 3QHWA 1J1CA 1MUOA 3HUBA 3QTRA 2PE0A 4KKGA 3PSCA 4OLIA 4QMMA 3CJGA 5CU4A 3RM7A 3R9HA 3VUKA 5DT4A 5CAOA 5IEVA 3CPCA 1LR4A 2GTNA 3IW8A 3GU8A 3IW5A 4GVAA 4FNZA 4NM3A 4YC8A 3U4UA 4PNKA 4ORKA 3AOXA 3QXPA 2X8IA 3AC1A 4FTRA 4BC6A 3MIAA 5AUTA 4FV4A 4XX9A 3AC5A 4RIXA 5DT3A 4L45A 5LMKC 2QOHA 3PY3A 3ZUVA 3QRIA 5CU2A 4CEGA 2WTCA 3BE2A 3I0OA 4RJ3A 5AIKA 4M3QA 4EH8A 3EH9A 3ZRLA 1A06A 4BB4A 1H07A 2HZIA 4PMPA 3F9NA 1YI6A 3CGFA 4ZK5A 2ITYA 5DYJA 2UW6A 3NFGB 5FEDA 5IQFA 5EM8A 3V5QA 5DN3A 3HAMA 2G9XA 3U51A 5AP6A 4C4EA 3PDTA 1T46A 4OTPA 4M0YA 5HCYA 3ZS5A 4RX9A 3FHIA 2X9EA 4JX3A 4YJVA 5E8TA 3SX9A 1KV1A 4FYNA 3R1NA 2CJMA 4I5CA 4O0UA 5DPVA 1U54A 4BICA 4F7JA 3KIOC 3OS3A 2GTMA 5ANKA 4ALVA 4RG0A 4DH1A 4FSMA 3S3IA 1XH4A 2X39A 3VUIA 2W1HA 4V0GA 4QPSA 2REIA 3OW4A 1PHKA 3GGFA 5JRSA 4QMQA 4IXPA 4KSPA 2WTVA 4A06A 3MB6A 4BY9E 4O1OA 3ZZWA 3BYSA 4RJ4A 4CKRA 5D1JA 1IAJA 5HVYA 1Z57A 4FVPA 2F7ZE 2W9ZB 3DB8A 3U54A 4XG2A 3WE4A 3BEGA 2QKWB 3VQHA 2BPMA 3MA3A 1PXPA 4IB0A 4BHNA 3AC3A 4O6EA 4BTJA 4G16A 4DT9A 5L6WL 4DH8A 3BV3A 2OIBA 3HZTA 4AXCA 5I9UA 4HVDA 4E8AA 4JIAA 4U41A 4BZOA 3BLQA 1OL1A 3CQUA 3A60A 4QQJA 3C1XA 1TVOA 2GNLA 2JEDA 4QTAA 3F2AA 3HMIA 3LAUA 4A07A 5HBJA 5IUGA 5KUPA 3R7GA 4O7NA 4ZJJA 5E8UA 2W05A 2XK3A 3AMYA 3K5VA 4F64A 1BUHA 3EFLA 3MPAA 3QCQA 5GJFA 3KRJA 4C37A 3HGKA 3VHKA 2UZNA 3ITZA 5CYIA 2JD5A 4PDYA 4EH6A 2OBJA 4R7BA 2ESMA 3OEFX 4QTCA 5L6PA 5LJJA 3FJQE 2RFSA 4FOBA 1PXOA 4I6HA 4TTHB 1DM2A 5HOAA 2E2BA 3QQHA 3ML1A 3OXTA 1K9AA 3ALNA 1J91A 3IECA 3MH0A 3LXPA 2QOFA 4F6SA 1H8FA 4NK9A 4DITA 4C36A 3FY2A 3E88A 2WTKC 4C0TA 3FSKA 1O6YA 3W2PA 1ZYLA 2UUEA 3TI1A 2A98A 4NTTA 3SDJA 4IAAA 3R04A 3T9TA 4WO5A 1IRKA 1GIJA 5D9HA 5HESA 1ST4A 2PPQA 1NVRA 4O7WA 1Y6AA 3GCQA 3AGMA 5DMZA 2ZV9A 2YDKA 4IM2A 3OHTA 4MNFA 3HRCA 4XHKB 2OK1A 5HCZA 1PXIA 4EL9A 4DH5A 2XK8A 3I7BA 2EXEA 4HOKA 4RQKA 4CFMA 3O8UA 3FI4A 5AP1A 4J95A 3RK5A 1E1XA 3FZOA 3DXPA 2VTJA 1ZMVA 3OWJA 3OF0A 4P90A 1R1WA 3NSZA 5FUTA 2RL5A 4BYJA 2XIZA 4GJ3A 4MBLA 2WMBA 1S9JA 4KRCA 3QXOA 4RMZA 3OWPA 5CQUA 4AW2A 3P5JC 5CF8A 5L6OA 2C5XA 2VNWA 1SZMA 1MQBA 1OKWA 3W2OA 3GU7A 5C03A 2X1NA 5IQEA 4ZJVA 2WQBA 2HXQA 4CG8A 2QKRA 3U4WA 4UMPA 2WTJA 4B7TA 2VX1A 3C0GA 2R9SA 3FQHA 2JBPA 4IVAA 4DEAA 3C4XA 3D0EA 1YXVA 3ORMA 4L6QA 3KXGA 2XIXA 4BCQA 2O64A 3EJ1A 5HU9A 2OI4X 2C3JA 2YITA 1TQPA 3FL5A 2ERKA 5E90A 4CMUA 3QC9A 5L8KA 4PDSA 3UZRA 3QL8A 4HGTA 4ZLOA 4PL5A 4HCTA 3DQXA 1MRUA 2UW9A 3QD3A 3DT1A 4ZEGA 3W16A 3W2RA 4K0YA 3RBWA 3V8SA 4IAFA 2C30A 1OIQA 4GYGA 4CVAA 2J5EA 3I0QA 2QOOA 3NW7A 3CCNA 4MXYA 3BCEA 4QD6A 4OUCA 4CT2A 4OTRA 3OWKA 2CGUA 4IWPA 2HW6A 5A46A 5KO1A 4EI4A 1JKLA 3PLSA 4LM5A 3NZ0A 3VS5A 3PTGA 4AA5A 5J9LA 5BMSA 5ICPA 1ZMUA 5AUZA 2OJFE 3O71A 5BYYA 2PVYA 2EXCX 4FT0A 3L8SA 4RZVA 4IAIA 1WBTA 3HV4A 4GT5A 2IW6A 4XNEA 1KSWA 3VBTA 4BDIA 1OB3A 3ACJA 4FSWA 2C6TA 3NCGA 1UNGA 4FUXA 4ZTNA 3MPTA 4JS8A 4UB7A 1XR1A 1WBOA 4IVCA 3ZXZA 5IA0A 3OT8A 3Q53A 2RKUA 5LOHA 2IG7A 2ITPA 2HYYA 3F5XA 4HCVA 3FMJA 2UVXA 3RHKA 3V5LA 4O21A 4AZFA 5LXMA 4HVIA 2F2UA 1OGUA 2BDWA 3COHA 2EXMA 3NEWA 1YXXA 2IPXA 5AAGA 3KKVA 4FK6A 3DXNA 3U6HA 2XM8A 4ID7A 2UZTA 3SD0A 3NUAA 2VTPA 1CDKA 3E7OA 4W9XA 3NVKI 4EQMA 5I5ZA 2YHVA 3LJ1A 1GZ8A 2PMOX 2ZV8A 4M68A 4I3ZA 2H8HA 1OUYA 3QYWA 4MKCA 4U8ZA 4YBJA 3VS1A 5CU0A 3WYXA 5BVEA 5AV4A 3S0OA 4IEBA 3OXZA 3W32A 4JG8A 2FUMA 3F2NA 4RBLA 5ETIA 2CKPA 2ITQA 2NO3A 3BHTA 1M7QA 5ANEA 2BAKA 2JKQA 3V3VA 4USFA 4FZ6A 4DTKA 2WMQA 4M7IA 4BGGA 3LHJA 3QGWA 4ERKA 4IZ7A 3HMMA 2RSVA 5IEYA 3DKFA 3MVHA 4MXZA 3O23A 3RINA 3OBJA 4MK0A 5AR8A 2EVAA 5AP4A 4B4LA 2OJ9A 4UXQA 4YO6A 5DR6A 1BL6A 2G2HA 4RLLA 2XANA 4IM0A 3UODA 1JWHA 5C4LA 5JFXA 5FQDC 3DXQA 1MRYA 5CVFA 3W0PA 4J7BA 4TZRA 3PXKA 3RALA 2UW0A 4TYHA 4EOLA 3ZMMA 4QO9A 1PW2A 3V04A 5KKRB 3POZA 4I6FA 4PQNA 4QP4A 3QCXA 4C4IA 3WE8A 3W0NA 2AYPA 5H8GA 2PUNA 4R77A 3LFFA 1WBPA 2OICA 3H0YA 4FUYA 4JAIA 3QGYA 2CMWA 4QYYA 4C35A 3U9CA 2CN8A 4DHIB 3IDCA 3DBQA 4CMOA 4F7LA 1M2RA 5LCKA 2PE2A 2VTIA 2UZWE 3UPXA 3O5AA 4NT4A 2RG6A 4U3YA 3RPRA 3TWJA 2VO6A 3TUCA 5AFVA 3KK8A 4FKUA 3F61A 1NVQA 2ZM4A 3EB0A 4IWQA 4U79A 3WF9A 4C3RA 5KMIA 2QQ7A 4I1ZA 4OBOA 4TYIA 2YDJA 4CQEA 2JGZA 2W1EA 3E3BX 4ZSLA 1G8JA 1OIRA 5K4IA 2YZAA 4HPUE 4XRLA 4FR4A 4O7TA 3HV3A 4KKEA 2RFDA 4YTHA 5E8YA 4QP6A 4BKZA 5FEQA 4AOJA 4KKHA 4QYEA 3CJFA 2Q0NA 2C47A 4FGBA 1E9HA 3MVMA 1UU7A 1NA7A 3O0GA 3A7IA 4FSQA 4RWIA 3PJ1A 4FG8A 3RPSA 5M4UA 4F78A 4U0IA 3CGOA 3MY5A 4CD0A 4CLIA 2C5OA 2JAMA 4F65A 5EI8A 4K2RA 1IA9A 1YI4A 2OIDA 2VWUA 4C59A 2C6OA 3WZJA 3GI3A 1CM8A 5JGDA 4F9WA 3HMOA 2PVHA 4OTFA 2XA4A 1VJYA 1OL6A 3GQLA 3UC3A 3FZRA 3QYZA 3LFDA 1XJDA 5K5XA 2EB2A 4EK3A 4RX8A 1OZ1A 2XIKA 4ENXA 4OTIA 4B8LA 4EOOA 2EU9A 4GIHA 3QQKA 3L8XA 2H34A 4E5AX 3ELJA 2I40A 2CKOA 3TUBA 4EUTA 1ZXEA 2XEYA 3AC2A 2VTLA 4FEUA 2PVNA 3DJ5A 2W1GA 3FLNC 4N6YA 3R9NA 4CT1A 4M66A 3ZO4A 5AP7A 4GKIA 2YM6A 3UQCA 2HW7A 3G6GA 2NP8A 3QZGA 5BVNA 1BLXA 3FSFA 4XG4A 3KF4A 3IO7A 3LVPA 5IA5A 3G5DA 1BKXA 3R7OA 4BCGA 2O63A 4MH7A 4C4FA 3OG7A 1K3AA 3FMDA 3II5A 4NUSA 5FRIA 5CEIA 5FTGA 3QD2B 3P86A 4DGNA 4M8TA 3GP0A 5BMMA 3T3VA 3SC1A 2BAQA 3LFAA 5KMLA 5M53A 3W0OA 4ASEA 3PP1A 3C9WA 3Q6WA 4BI2A 4EOMA 4ZZOA 2P4IA 3ZDUA 4F9YA 5AAEA 4GKHA 5I9YA 4WG4A 3VBQA 2XS0A 4PWNA 1BYGA 3FKOA 3D94A 4I23A 5DGZA 4AWIA 5EOLA 2WELA 1ZOHA 2C0TA 5LARA 3WF8A 4K33A 4F1OA 2Z7RA 2J7TA 1O6KA 3F5GA 3P5KA 4DBXA 3WZEA 2C68A 1JBPE 2BIYA 3ODZX 3ZYAA 3R28A 4LGGA 4FIFA 1YRPA 2HY81 3ENHA 3KC3A 3PFQA 3Q32A 5ETFA 4DDGA 2Z7SA 2YJSA 2FO0A 2GS7A 2R3LA 3HEGA 4CFWA 1NVSA 4FTTA 4I20A 4E1ZA 2XAMA 1G3NA 2BR1A 1CKPA 5I9WA 4ACHA 3P7BA 2X0OA 2UZOA 5TOZA 3P7CA 4J1RA 2FSTX 1UNLA 4FGRA 4DLIA 2ITVA 4JDKA 3FPMA 4TY1A 5FTQA 2BRHA 4WRSA 3RHXA 5IISA 1J7UA 3CSVA 5M06A 4A9SA 2GNGA 2VWZA 3FWQA 3BYMA 3KQ7A 4O4CA 4S33A 2QR8A 1URWA 3KCFA 5H2UA 3SLSA 2B9HA 4TXCA 3ALOA 4JQ7A 4BDGA 1WBVA 5KMJA 1R0PA 5KMKA 4AFEA 3VC4A 4ACCA 3HL7A 3LXKA 3QAME 4ITHA 4IX5A 1Q3DA 4BBMA 3PG3A 4J71A 4NWMA 5IA4A 4CFFA 4DCEA 3DGKA 1WVYA 4MNEA 2P3GX 5AMNA 4DBNA 1OL7A 2UZLA 4X2NA 5B2MA 4YURA 4FT5A 5CI7A 2XK6A 3W2QA 2PSQA 5AAFA 1HOWA 1ZYCA 3I5ZA 1YHWA 4G31A 5DNRA 1OIYA 5ANJA 3BX5A 4EORA 3WARA 4OTWA 4R3CA 3KB7A 3L9LA 3OCSA 3CE3A 4QYFA 4R8QA 3VO3A 4KAOA 2VO0A 3FLSA 3QUPA 4XG9A 5C8KA 5IA1A 2QO7A 2QLUA 2AC5A 4Q2AA 3VS4A 3DY7A 4CKIA 1XH5A 3WILA 4W4YA 2Z8CA 1U5RA 3TV7A 5T3QA 4CRSA 4O7SA 3MTLA 2A27A 3AT2A 3R6XA 4AN9A 4QP9A 4IAZA 4I0SA 1GZOA 2R3KA 3IQ7A 1Q8WA 4JJRA 1ZZ2A 2HENA 5FGKA 4FE2A 3BV2A 4O1PA 4R7HA 4QMZA 2CGVA 2WQNA 3AC4A 3ZRMA 4U7ZA 2PU8A 3ZFXA 3EQPA 2XAOA 4RC4A 4J8MA 3UYSA 4FV5A 3IPHA 1DS5A 4Z55A 4K11A 3DAKA 5DIAA 3LFEA 4RC3A 5G6VA 4DFUA 3I5NA 4IACA 3CQWA 2QVSE 3GC7A 1WVXA 2ITZA 3DAJA 3ZC5A 4HYUA 4DEGA 3A7GA 1S9IA 2UW3A 4JOAA 3UOHA 4H1MA 5HTIA 2J0KA 4GVJA 5I9ZA 5M4IA 2XNBA 5JGBA 1PXMA 5DEYA 5IG1A 2VWYA 3F3WA 1O9UA 2OIQA 2QONA 3NLBA 3PPKA 3TYKA 4YBKA 4ZLZA 5BX0A 2V22A 3DZQA 5IA2A 2B0QA 2QD9A 3LE6A 3NIZA 1TQIA 2X8EA 3KXXA 3Q9YA 4D4YA 5D12A 2X7OA 1Z9XA 1GNGA 5E91A 4XMOA 4FKWA 5HNGA 2QHMA 4KIKB 3UG2A 2IEWA 4B6LA 4GW8A 2VD5A 3EFKA 3OCBA 4XEYA 5IA3A 1YDRE 3BRBA 3E8NA 2PULA 2YAKA 5E8WA 5IQAA 4KBKA 3VUHA 2UW4A 4G34A 2AEGA 3HP2A 3UVPA 3NAXA 2I0HA 4C4JA 2Y4PA 3OT3A 4FTCA 4APPA 1Y57A 2ZV7A 3O8TA 3C50A 5DFPA 4FSNA 4I4EA 4PP7A 3LCDA 3NUPA 5EHYA 4XOYA 3GB2A 2GHLA 1W2CA