3UG2A

Crystal structure of the mutated egfr kinase domain (g719s/t790m) in complex with gefitinib
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
299
Chain Sequence
EAPNQALLRILKETEFKKIKVLSSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLEDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Structural basis for the altered drug sensitivities of non-small cell lung cancer-associated mutants of human epidermal growth factor receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 299
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ug2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ug2A01
2VZ6A 5E91A 1OIUA 3HRFA 4K77A 4QNAA 3VUTA 4FV3A 5B0XA 5LVOA 2W99B 4I93A 5K5XA 4A07A 1STCE 1AD5A 4L7FA 2EXCX 4XEYA 5CT7A 4WT6A 5DOSA 2E9PA 3DBDA 4S32A 3A8XA 4IX3A 2XNBA 4ANSA 3NAYA 3UVRA 4QMXA 2W1GA 2BDWA 5JMSA 4DGNA 1Q8ZA 3TNWA 3MA3A 3K2LA 4F6WA 1WBPA 4P5ZA 2C6EA 4QOXA 2QKRA 2PE2A 4EJNA 2REIA 5I9YA 3UNKA 4CG9A 5HLNA 1H1QA 3OTUA 4GT4A 4KIKA 3FLSA 1XO2B 4MXAA 4FV6A 3W2OA 4U9AA 4TW9A 2O65A 3L9MA 5C03A 4CKIA 4H36A 4CT1A 1XJDA 2CGVA 3ZBXA 2F49A 2C1BA 4F6SA 4E1ZA 1KWPA 2QR8A 3QL8A 5L8JA 1YRPA 2JKQA 3A7GA 4ANBA 4QO9A 4GFOA 2QOHA 3Q9YA 4C2VA 2UZNA 4FKTA 5AADA 4JDKA 4C33A 2QG7A 2HW6A 4U42A 4QYYA 4BY9E 3PJ1A 4GUEA 4PL5A 4GL9A 1W0XC 3LW0A 5EDPA 2Y4IB 3UIUA 3ZXTA 5CVHA 2AC3A 3D5WA 5BVDA 4RFZA 2BALA 2JIUA 4EEVA 3WF6A 2XF0A 4RZVA 4ZAUA 4XP0A 4DFLA 5KCVA 2UZDA 2VWZA 3AC5A 4FEWA 4WO5A 5CAQA 5DWRA 2YDIA 4I92A 2PSQA 2PVRA 3VUGA 3WILA 5HBHA 4DT9A 1PYEA 2CNVA 2GQSA 3I7CA 3PSBA 4FTKA 4I22A 2H8HA 2GTMA 1RQQA 4C35A 3NCZA 5J9ZA 3GP0A 3TKUA 2OXYA 4NL0A 1R3CA 1UNLA 4ZOGA 4FIGA 3PZHA 3QKKA 2XA4A 5HBJA 2C0IA 3C13A 5E8UA 4D55A 5A4TA 2ZDUA 3R7EA 4G16A 4DITA 4FKSA 2J90A 4PMTA 3VS4A 2X1NA 3UYTA 3KCKA 2FSOX 5IUHA 5K0XA 3GFEA 4ASZA 1XBCA 4EUUA 4FR4A 2BVAA 5FEEA 4RBLA 4AT4A 4XLIA 2X7FA 4L42A 2R5TA 4I0SA 3MVJA 4IM3A 2CKPA 4DEEA 4MF0A 2JITA 5AP5A 4F9WA 1IAJA 3NX8A 4QMOA 4CCBA 3CQEA 3FUPA 4YC8A 4EOMA 3U6HA 3CP9A 4GSBA 2RSVA 4K0YA 4KKEA 2CGXA 1OL6A 1OIRA 3QKLA 4AQCA 3AMBA 2YCQA 3T8OA 3C5UA 4A9TA 3LCDA 1FGIA 4RWKA 3V5JA 4JAIA 4YJVA 4HGLA 1ZARA 4GCJA 4W4YA 4QMLA 4N4SA 1GIJA 4GJ3A 4NM3A 4AF3A 3PDTA 5BMSA 4DH1A 2OIDA 3F61A 4DCEA 3U54A 4IDVA 4RJ5A 3MYGA 4JXFA 4E6QA 4XLVA 2ITUA 4FKPA 3R7YA 2KULA 4I20A 3QTIA 1NW1A 3TNIA 4EORA 2XS0A 1SYKA 2GNLA 3V8TA 4W4WA 3MI9A 2RFNA 3ORXA 4FSYA 1EH4A 3R7UA 4YTCA 5CSVA 4OT6A 3F88A 4U44A 1HCLA 4DF3A 2I0HA 4WUNA 4ZP5A 2JKOA 3CE3A 5FDXA 3UIMA 3NW7A 1Q3WA 3BYOA 4IJ9A 3VUDA 4PDOA 3B8QA 4Q9SA 2B9FA 4BBEA 4PP7A 3MJ1A 4FOCA 2AUHA 2IW8A 3Q32A 4UEUA 2G2FA 1WVWA 4BZDA 2QOKA 5HE3A 3IW8A 4TWCA 4ZTRA 4EHEA 4U79A 3W33A 3TZ8A 1WVYA 3QTQA 1NA7A 4X2GA 3ULIA 3V8WA 2JDRA 3OCSA 2GFCA 4FNXA 5K0KA 4DYMA 4RJ3A 4YBKA 3ZBFA 5BVEA 2R9SA 2W1DA 1YHWA 2J0JA 3H4JA 1TVOA 2C0OA 4G6LA 4JG8A 4TWNA 3RAHA 3V5WA 2WMWA 2QO2A 2BTRA 4AACA 3C51A 3R8MA 1XH9A 4LUEA 4U40A 1J3HA 3AXWA 4R78A 2UZEA 5DRDA 4F7NA 5EM8A 2VX0A 3G9NA 3QGWA 5I5ZA 1VYWA 1K3AA 4JOAA 4UZDA 5EOLA 5FTQA 3WYYA 2XMYA 4J8NA 2H6DA 2VRXA 4BDEA 1I09A 4QTCA 4J99A 4BBFA 3NCGA 3LFEA 1OL2A 5M4FA 1YDRE 3II5A 1MQBA 3TNQB 3OMVA 5JRSA 4DGLC 4NEUA 4F9CA 2CN8A 4A4XA 5AV4A 2Y8OA 4WKQA 3MH2A 5BVNA 5IEXA 4BDFA 3QTWA 4WOVA 3OC1A 2PVJA 3S3IA 1ZY4A 4BHNA 1QPEA 3W32A 5CEPA 4YO6A 4RRVA 5J95A 2OXXA 3OOGA 4MNEB 5T68A 3SRVB 5FXSA 4BDGA 4R1VA 2YFXA 2F2CB 3PIXA 3QRUA 3ZONA 1JKSA 1JLUE 4QPSA 5HCYA 2V7AA 3CJFA 4JIKA 4TYHB 2WHBA 3N51A 4ZSLA 3PXZA 2O2UA 4Q5EA 3ZO1A 4BCGA 2Y4IC 3F3WA 5IQEA 4IB0A 2R2PA 2ZMCA 3HMOA 4DH8A 5C26A 3QAME 4GYGA 1UWHA 3QXOA 2JLDA 4RIYA 3UBDA 3FXWA 3FMDA 4RC3A 4UB7A 4ASXA 4F0GA 5L6PA 4ZTNA 3S0OA 5EW8A 4R3CA 1TKIA 5F1ZA 5C8KA 4QMYA 4YPSA 5IH6A 3WZJA 5I9ZA 2HWPA 4Y95A 5KKRB 1GNGA 4TKSA 5L8LA 2VO0A 4TRLA 2YISA 3RK5A 1M52A 2BIKB 4IWQA 4Z7HA 5E90A 3CKXA 4JS8A 5EHYA 3FI4A 5DA3A 3VW8A 4HW7A 2R3KA 3BV2A 5EDRA 5HORA 4R3PA 3BHHA 4GH2A 2GHGA 3FZOA 3OHTA 1AGWA 3MFRA 4YR8A 3P08A 2WQBA 3W2RA 4UXLA 2UVZA 3KXNA 5CF5A 1NVQA 3D5VA 4ZTLA 4IAYA 2BHHA 4S30A 4H1JA 1SNUA 5AV1A 3BPRA 3IW7A 3ALOA 4XHKB 2WQNA 2B7AA 3BBWA 3UGCA 5J79A 4FTOA 4UALA 4BICA 2P33A 2IO6A 3RM7A 4IADA 3AC3A 5L6WL 2ZVAA 3TUCA 1KE9A 5BYZA 3HV3A 4KSQA 3G0EA 2G2HA 4QYEA 1A06A 2FUMA 2JD5A 3QTUA 5HE1A 3HDNA 2OSCA 2X81A 4ZJJA 1JQHA 2VO7A 3NUSA 2IW6A 3BYUA 3HX4A 4O21A 1H1SA 4BL1A 3NVMB 4XG4A 3FKLA 3M42A 4LFIA 1FBNA 2XK8A 2Z7LA 1WBVA 3D2KA 3Q2MA 3QXPA 4QMMA 3VWAA 4EUTA 5BNJA 4IZ5A 1F0QA 2W1EA 1IASA 4AZWA 4XRLA 4L9IA 4TYEA 5T6KA 4E7WA 1CDKA 2X2MA 5HIBA 2F57A 1LEZA 4LMNA 4V0GA 1BMKA 4P90A 4FV1A 4JQEA 3SC1A 5GZ9A 3VBWA 3GVUA 4IVCA 3NS9A 4FSNA 4KBKA 4IQ6A 3R1YA 4XCUA 4F7SA 5CAVA 5HU3A 4LYNA 4IZ7A 1QMZA 4M84A 2AYPA 1QPCA 5AIRA 3P23A 2C6DA 2EB3A 3EN5A 5C27A 3CS9A 4C0TA 4MBJA 2HCKA 2WTDA 1UWJA 4PTEA 3NRMA 4IZYA 1YOLA 3ODYX 5KE0A 3SG9A 3ZEPA 5EOBA 3KULA 3WI6A 2WTIA 4JG6A 4BTKA 3EQDA 3CGFA 1M7NA 4K2RA 4FZ7A 5AP7A 2OLCA 2GS6A 2IZTA 3FMMA 3F3ZA 5JQ5A 3QCYA 3DCVA 4RC4A 1M2QA 3MPMA 4JLCA 4D28A 2J7TA 2R3JA 5EYKA 3BGQA 4G3DA 4BKZA 4CTCA 3I0OA 4GKIA 4XMOA 4KS7A 1UU3A 3RVGA 3IW5A 4FKIA 4OGRA 1Q8TA 4TWOA 4FT9A 4BYJA 1BUHA 4HYUA 5BYLA 1G8SA 4J7BA 5DYJA 4YZ9A 1WBSA 4XG2A 2HELA 2Y4PA 3GCSA 5IPJA 4KIKB 5CEIA 5GJFA 2B54A 4PWNA 3QZGA 2X39A 4OTHA 4LL5A 2QLUA 3OEZA 3MVHA 3NYNA 5CXZA 2HWOA 2Q0NA 4BYIA 2ZV2A 4GIIA 4KKGA 4AZSA 4CZUA 5TR6A 2FB8A 4E5BA 4FBXA 5I3RA 3F9NA 2IZUA 2Z2WA 5FLFA 1OIYA 1E1XA 2A1AB 2VTSA 4YZNA 4ACHA 3R6XA 4YPDA 1OECA 2C30A 2C69A 1OZ1A 4HZSA 4L3JA 4PPBA 4WSQA 2A2AA 3RPYA 3E3BX 5FRIA 3QRJA 1UNHA 4CD0A 3QD0A 4I6HA 5KX8A 4EOJA 3CXWA 4ONAA 4PL3A 2W5AA 3PJ3A 3LJ0A 2Y6MA 5JQ8A 2QKWB 3DBQA 2XNEA 4PV0A 2XIRA 4C34A 3HA6A 3Q6UA 3Q96A 4CRSA 5AFVA 4BF2A 4R7BA 4KKHA 4O6EA 5JSMA 5CALA 4AX8A 4M66A 4IHPA 3E88A 4OTWA 3G6HA 5J7BA 4GVAA 3WIKA 3ZOSA 3OY3A 1DM2A 2EUFB 1JOWB 2DS1A 5HZNA 3V5PA 4EK6A 3LLAA 5HX8A 3D5XA 4ZTHA 2QQ7A 4DFYA 5IDPA 2CGWA 3ZLSA 3THBA 4D1SA 5HICA 5LMAA 1YWRA 5L2IA 4IAFA 2BDFA 3CCNA 4XG3A 3L8SA 1Y91A 4R5YA 1CKJA 5DMZA 4M0YA 3EQBA 5CNOA 2IJMA 2ITOA 1Q41A 3GUBA 1A48A 3OY1A 3CBLA 3L9PA 3OEFX 4L01A 5LARA 5E92A 5IMXA 2E9OA 3W2QA 2UZTA 4QD6A 3NNUA 3BRBA 4FVQA 3E3PA 3HUBA 1ZYJA 2UZUE 4RC2A 4IAZA 4UMQA 2OU7A 3Q4ZA 4NT4A 4TZRA 1K9AA 2YLEA 2VX1A 4L45A 1Y6BA 3QLFA 3R04A 2UW5A 3BQRA 4EZ3A 4FKLA 3UMWA 4D2PA 4G9CA 4UX9A 2B55A 2PUNA 4HCVA 4QQTA 2HW7A 5H8GA 2VTIA 1Q5KA 5DLSA 2RG6A 1PY5A 2W1CA 4D4YA 3GU8A 4XOYA 5AUZA 2NNWB 1Y57A 4IIRA 3TJCA 1R39A 5M56A 3FZPA 3UJGA 4FYOA 4KINA 4MXXA 5HD4A 3FMHA 2XEZA 2VGPA 4RLKA 4JG7A 3D14A 3L9LA 4GYIA 3DAJA 5CT0A 4CMUA 5M57A 2Z8CA 3WF9A 3BX5A 3R7OA 1U59A 3DK3A 3KXXA 3Q9WA 3FPMA 4NSTA 4YU2A 4IWPA 3SXSA 2I6LA 2IZRA 5CEKA 4C7TA 2XP2A 5ETIA 5HVYA 4YO4A 2UZBA 4FNWA 5HLWA 3P1AA 5M44A 3I5ZA 4KS8A 4RVMA 4AA0A 5A14A 5AJQA 5TE0A 5AUWA 2G9XA 4EQUA 1CMKE 4K18A 5A6NA 5FUTA 3BBTB 5GHVA 4C62A 3MN3A 5ETFA 2X0GA 5EYMA 1QPJA 4FIIA 2VV9A 5B2KA 4ZLZA 3EWHA 4NU1A 2BIYA 3L8VA 4EOSA 3N4TA 1OKWA 4DG3E 3CY3A 3R0TA 4MD8E 3P7CA 3QUPA 5H2UA 3DPKA 5CANA 2HOGA 3FQSA 2CKOA 3KREA 2J50A 3Q53A 3ZO2A 5B7VA 4FTRA 5JN2A 1V0OA 2C68A 5DE2A 3A7FA 1UU7A 3QHWA 1JSTA 3P5KA 4EONA 3F5UA 2W1ZA 3MIYA 1KSWA 2C3LA 3BV3A 2UW6A 3PTGA 4N0SA 4NTSA 4YJNA 3KRXA 3TACA 4G6NA 3JVSA 1LPUA 3EQFA 2UZVA 1F5QA 4WNMA 3ELJA 4EH7A 4LGGA 5C9CA 2WMTA 4IX5A 3BU5A 3DJ7A 2QVSE 4X2NA 4EHGA 3LFAA 1H26A 1DAWA 3VRZA 3EQHA 4O6LA 3H0YA 3W55A 3UYSA 4O7RA 3R1NA 1J91A 4RQKA 4DINA 3R01A 1UU9A 3QQGA 4MX9A 4R6VA 3MGYA 4RFYA 4D4SA 4PMPA 1GJOA 4ALWA 3AC8A 5KZIA 2YAKA 3LIJA 3O7LD 1H25A 1JKLA 5M4CA 4IFCA 4O1PA 3ZO4A 5LQFA 3CSVA 4JX7A 2UVXA 4BIDA 3RI1A 4H3PA 3ZS5A 4IWOA 3VBQA 5L2SA 3QCSA 2W4OA 3EQCA 5IZFA 5K5NA 4FK6A 2GNIA 2UW7A 3QCQA 5E7RA 3MY5A 3PA5A 4TL0A 5KHXA 4DA5A 3TCPA 4EHVA 4RIYB 3ZTXA 2XK3A 1SM2A 3P7BA 4FZAB 1QL6A 4NK9A 5IQDA 3BGZA 5TO8A 4FTIA 4DEBA 4FV5A 3A2CA 3BWJA 1MRYA 1ZYCA 3QBNA 5HHWA 5DNRA 4YSJA 2XKCA 3DDPA 4YJSA 4RZWA 4CEGA 2WMRA 3FLYA 3WBLA 2BDJA 3ET7A 3FMLA 3QTRA 2R0IA 3SW7A 3QD3A 4BTFA 2X6DA 3VN9A 2VO6A 3FMNA 4I3ZA 3KRWA 4CZTA 5JFWA 3BEAA 5J1VA 4DT8A 4M68A 1XHAA 4I24A 5DRBA 2IVVA 4AWIA 3ZRKA 2HZ4A 2PE0A 3PRFA 3SRVA 4H39A 5JFXA 3PIZA 4V05A 4LOQA 5I9UA 3OT3A 5JH6A 2OFUA 3PY1A 1YKRA 3LE6A 4I5PA 3FL4A 1NY3A 1OB3A 1DAYA 2X8IA 2OZOA 2W05A 3PY0A 1RW8A 5KMNA 3ORKA 2XK6A 4QP9A 4FEUA 1PXKA 4BC6A 3ZYAA 4CV8A 4GT3A 4TYHA 4WUAA 4BTMA 3AMYA 3C7QA 4FTMA 4K6ZA 5ANGA 5D12A 4ID7A 1YI3A 3F6XA 4AZEA 1H24A 4CZYB 1W98A 3KXGA 4FUYA 4BDJA 5HTBA 4GS6A 4DFBA 5E8YA 4GRBA 5DR9A 3ITZA 4W9XA 3VIDA 5I9VA 4O84A 3UO5A 4EKLA 4F9AA 4I6FA 3C4FA 3TUBA 4ENXA 5ANEA 3DXPA 4L53A 4FEVA 3ORTA 4HVGA 2RGPA 3BEGA 4BDDA 3CGOA 3DQXA 4X0MA 3TTIA 1ZMWA 4PX6A 2QOCA 4BZNA 4O0VA 5IU2A 3TM0A 1F3MC 1JSUA 1Z5MA 4MD7E 2FSTX 4U5JA 4AE9A 3EQIA 1Q8YA 5F95A 3RJCA 3TI1A 4UV0A 4V0GB 2PZYA 1KOBA 1SVGA 4XV9A 2YEXA 3Q4CA 2QOFA 5KO1A 4EL9A 3IDCA 2W9ZB 2WTVA 4WNPA 2R3QA 3EFLA 3SHEA 4IH8A 3OWJA 4O7SA 1YWVA 3C0HA 4ACMA 3UE4A 3WF5A 2OGVA 2GNJA 3UNJA 3VO3A 5AP6A 3F2AA 1DS5A 3MBLA 5D10A 4E5AX 5GJDA 2QOOA 2PMOX 2PK9A 3VQHA 2GHMA 4GK4A 1P5EA 3KULB 4NFMA 4YJPA 4C4GA 5JFVA 4DGMA 3S1HA 2UW4A 3EZRA 3ORLA 4JBQA 4X3FC 4FEXA 2R3RA 4FKJA 4IM0A 1PXIA 5BUEA 5DHJA 2RFSA 2VWBA 3GC8A 3SOCA 4ZZOA 3QWJA 3ALNA 4U6RA 4O7LA 3QA0A 4NJDA 4Z7GA 5LWMA 3IGGA 4FV9A 2O63A 3IK3A 4FZDB 3AGMA 4X6RA 3C4XA 1KE8A 1VEBA 3CIKA 3OT8A 3PP1A 3PSCA 4NKSA 4A9YA 4AN9A 4XV1A 3UMXA 4A9RA 2VN9A 4AN2A 2HY81 2X9EA 3W2PA 1J7LA 5C4LA 5BUIA 3A99A 2JKMA 2RL5A 2J0IA 1URCA 2E2BA 2W5BA 3AC2A 4DEDA 3ZDIA 1IA8A 3VNTA 4I94A 4EQMA 4NM0A 5EDQA 5HOAA 1U5QA 4GVJA 4MKCA 3VS0A 3UQFA 3D94A 5HG7A 2GU8A 1WBNA 4E4NA 3GQIA 3FZ1A 1M17A 4EH8A 1PXNA 2F4JA 3ODZX 3F5PA 2BRBA 5ETCA 2Q83A 3NIZA 4Y85A 2XVDA 1H1PA 3EQGA 3VF8A 1M7QA 3EFKA 4JR3A 2NPQA 5IA0A 2WPAA 2GHLA 4AA4A 4D9TA 5CU3A 4C4JA 2FH9A 2W96B 2YA9A 2R0UA 3MY1A 2WB8A 4ZIMA 3KN6A 3V5TA 3QF9A 1ZOGA 3SKCA 3AT4A 3R7VA 2LGCA 1JAMA 2XK7A 3NDMA 5AA9A 3E64A 2DQ7X 3EFWA 4WBBB 5AAFA 3VBVA 1S9IA 1ATPE 3HA8A 2R3LA 3OUKA 3ZSGA 4PF4A 4LOPA 2AC5A 3ZM9A 3CTHA 2LAVA 3FHRA 4M0ZA 4RG0A 4B0GA 3ATSA 4UYNA 3K54A 3FC2A 4IM2A 5HI2A 3GBZA 3MIAA 4YURA 3QD2B 3EN6A 4W8DA 4AT5A 4BDHA 1SVHA 3A4OX 3I79A 2XYNA 2CNUA 3VAPA 4D5KA 2QOQA 4X2JA 1V1KA 3VUKA 3BKBA 3FY0A 4TNDA 4OT5A 1YHVA 2I40A 4FTAA 3GC0A 5K9IA 3RTPA 4TT7A 3DJ5A 4FX3A 3VQUA 5DEYA 2E9UA 2VD5A 2GCDA 4AOIA 5IEYA 2PVLA 2ETRA 3MPAA 3O17A 4MBLA 3RGFA 3QX2A 4O2PA 3GEQA 3RNIA 4E6CA 4EK4A 5A4EA 5M4UA 3MJ2A 4L3LA 1RE8A 4KBAA 2XKFA 3PUPA 4PDPA 2B0QA 3CD8A 3MW1A 1ND4A 2ITWA 4BCKA 4O83A 3FHIA 4UMUA 4JNWA 4H05A 3AT2A 5HCZA 3CLYA 4IE9A 4QP1A 3R9NA 2XRWA 2RIOA 3EYHA 2CN5A 3PSDA 4BI1A 3FYJX 4RJ8A 3M2WA 2VGOA 3I60A 4JQ7A 3LFDA 5I9WA 2PZ5A 1FQ1B 1JVPP 4IC7A 4UBAA 1FMKA 2R7BA 4UXQA 4NM7A 5EM6A 3VS3A 4DBXA 3NMUF 4IAIA 3NNVA 3IO7A 4O82A 4QP4A 2BZJA 2O8YA 3DBEA 4GW8A 5CEMA 2YM7A 3PLAE 3HAVA 3C4WA 3MWUA 5CEQA 4I5MA 5AWMA 5JZJA 5L8KA 3DAEA 5D1JA 1PW2A 3UOLA 3ZFMA 3OCGA 5FBNC 3AQVA 4MXZA 3BE2A 3CTJA 4NYEA 4ZY6A 4AZVA 3MS9A 3QLGA 3NUPA 5CSWA 3HV5A 3TV7A 3QQHA 3ANQA 3MB6A 5FD2A 1G3NA 4D1XA 2XKEA 4MQ1A 2GQRA 4YTHA 3KK9A 3F69A 3KFAA 2ITYA 4C37A 4KIQA 3UNZA 3HVCA 3R30A 3G2FA 1YWNA 2ZJWA 3NR9A 1ZY5A 2WD1A 5CLPA 3R8ZA 3MESA 3FBVA 1Q62A 4MTAA 1WCCA 1WBOA 2BAQA 2X6EA 4TWPA 2XH5A 2CNQA 3V5QA 4RJ6A 4RPVA 5M4IA 4RGJA 3PLSA 4UMTA 1MRUA 3GU4A 4TN6A 4OLIA 2W0JA 1Q97A 3DBFA 3QTSA 4HVSA 1ZMUA 5C8MA 4FV2A 3TUDA 2WXVA 2Y0AA 3LMHA 4FL2A 3ORZA 2WOTA 2WQMA 2UZLA 4NKAA 3QQLA 2C3IB 4II5A 5LWNA 2B53A 1Y8GA 3KQ7A 4CKRA 4RFMA 2J6MA 4X3FA 3HL7A 4PPAA 2E9VA 5CU6A 4KBCA 2A0CX 2OFVA 1OMWA 1PXOA 3R02A 2QHNA 3DA6A 2C6TA 3A7JA 3RP9A 3LXLA 2J0MB 4WG5A 5AP3A 3QZFA 4EK5A 5AUXA 2JC6A 2YIWA 5IQHA 4L43A 4ZSEA 2J5EA 3D7TA 4BCNA 1H4LA 2ZB1A 2OBJA 2BFYA 3IECA 1SVEA 3DQWA 4EH2A 3MB7A 2V62A 3E93A 2R3NA 3ZRLA 4I23A 2YWVA 3FLWA 4RIXB 3OCBA 2NO3A 1CKPA 1WBWA 3QALE 1S9JA 4IX4A 4NUSA 4QMSA 2O64A 4TYJA 4AOJA 3TDVA 4DGOA 2OKRA 4QRCA 2EVAA 3V6SA 5A9UA 3QX4A 4HPTE 4ASDA 4PDYA 4R77A 4FNZA 3MFTA 2HZNA 3F66A 5AR8A 5IMEA 4V04A 3P86A 4ZMEA 5A4LA 3FEGA 3V04A 4OTPA 3TEIA 4I0TA 2Q0BA 4OTFA 5J87A 3RPRA 1GZNA 4BKJA 4YTIA 3COIA 3D2IA 5A3XA 4CLIA 1OI9A 2E9NA 3OVVA 4FKRA 4PL4A 5FQDC 5FP5A 3VW6A 5E4HA 3OF0A 3FMKA 4XV2A 4H3QA 4HYIA 4C3PA 3FZSA 2CCIA 4L68A 5DN3A 3DJ6A 4MBIA 4AZTA 2JFMA 4EZ5A 3G51A 2B4SB 3S4QA 2ERZE 2WOUA 4QMPA 3D7ZA 3BYVA 2HAKA 2ZOQA 2JFLA 2BTSA 3E62A 5BVKA 3UVQA 5C8NA 1BLXA 5ITAA 4B9DA 2QNJA 3VS2A 2A27A 1PKDA 2F7XE 3ORNA 1WBTA 1OL1A 3V6RA 2CLQA 3GOKA 4X6QC 3BLHA 1DI8A 4O2ZA 1O6KA 3M1SA 4BDCA 4ANOA 4O0XA 1Q8WA 1WVXA 5J9LA 5IKWA 4QTBA 2BHEA 4FZFB 4BFMA 2PMLX 4UZHA 2EU9A 3GCUA 4FSUA 4Z9LA 3KU2A 4UWBA 2ERKA 5D7VA 5EFQA 4BCHA 1GIIA 5I4NA 4QYFA 4LG4A 2WQEA 2YM4A 4I41A 3FSFA 5J5SA 5AR3A 2W1IA 4IW0A 4A7CA 2ITZA 2YIYA 1X8BA 1M2RA 4XX9A 2FSLX 3R71A 3NAXA 4BDIA 2W7XA 4LOOA 2RF9A 4YGAA 2VWYA 3WE8A 4EH9A 5HGIA 3IGOA 3TL8A 5M55A 4NM5A 4USDA 3HV6A 4E8AA 4DLIA 2YDKA 4FIEA 5EKNA 1YOJA 3D15A 4FSMA 4GFGA 4EHZA 4E3CA 3F3VA 3LLTA 4CFVA 2GDOA 1Q24A 1IEPA 1B38A 3RZFA 1BYGA 3KK8A 1J1CA 1O9UA 2V22A 3PJ2A 5HX6A 5JGDA 4WG4A 5L2WA 5CTPA 4RX7A 3PA3A 4FL1A 3RPSA 5HNGA 3UQCA 3WF7A 3F2RA 5EI6A 2VTJA 5GJGA 4EH5A 3FZTA 4RVLA 4EYJA 1YOMA 3KY2A 2ITNA 2WTWA 5ACBC 4O81A 4MD9E 4QQCA 4N6YA 2QHMA 2PL0A 2V55A 3LFBA 3ACJA 1XBBA 4QT1A 4HVDA 4YMJA 1OKZA 2ETKA 1GIHA 2R3PA 1V0BA 3RALA 3R2BA 2WGJA 4YJRA 3KMMA 3UP2A 2PVNA 4ANMA 2ZV9A 3KRLA 2PTKA 3OXTA 3VJOA 4QMZA 4EOQA 1YXUA 4M13A 2GNGA 2EXEA 5AEPA 2B9HA 3OZ6A 3PIYA 3VULA 2XNPA 5GINE 5BYYA 2C1AA 2Z7RA 4ZJIA 4J52A 4DFZE 2VTPA 4IB3A 3LCSA 3QUDA 3LMIA 2XBAA 3KXZA 3ZLWA 4N70A 4AT3A 1P4OA 3DNDA 5J1WA 2YN8A 3AG9A 3LPBA 4G17A 4NZWB 1ZMVA 3CC6A 4JAJA 4DE4A 2ZV8A 3SQQA 2PZIA 2O3PA 3ZC6A 3KN5A 4IX6A 4M8TA 3W16A 3HV4A 3H0ZA 5IA1A 1OVEA 2C6MA 3ZCLA 4I6QA 3UG2A 3L9NA 2WMUA 4JDJA 4PNKA 3G33A 3NYXA 5CAPA 2IG7A 3R9HA 5IQAA 2PMIA 5EHOA 1P14A 4PDSA 4OTDA 1GOLA 3EFJA 2C6IA 3QQFA 5TF9A 3ZMMA 2ITXA 2QR7A 4ZTMA 5IEVA 2VTRA 3BU6A 3FE3A 4FYNA 4AGDA 3GCPA 4CV9A 2YDJA 1KE7A 4F1TA 2VO3A 2R3MA 1PXMA 2IVSA 2P0CA 3GU6A 3ZXZA 1GZ8A 2HXLA 4F9BA 2EXMA 1PXLA 5LVMA 3R1QA 2XBJA 3Q4UA 4IBMA 4RA5A 4Y8DA 1KV2A 4FZ6A 2JEDA 2GMXA 2YCFA 3H9RA 4TXCA 4XS2A 1ZZ2A 4ZLYA 3BHTA 3COKA 3HMMA 3FLZA 2WTCA 1OL5A 5HESA 5M08A 2WMSA 3Q04A 4O7ZA 2ZM1A 4QTAA 4C4IA 4C8BA 3LCTA 3PXRA 3HZTA 5HD7A 1OKVA 4FG9A 3OXIA 5IH5A 5AM6A 3RAKA 4RWIA 1KOAA 4C02A 3HRCA 5AAGA 3S2PA 1Y8YA 4XG7A 4OAUC 4FTCA 2JKKA 5DG5A 5JKGA 3BHYA 3OS3A 5AV2A 5HU9A 5KHWA 3K5VA 1XH8A 5CX9A 2PULA 3NUYA 2OH4A 3MV5A 4NTTA 4DH7A 3D83A 2B1PA 5AP0A 3O8PA 1PHKA 4FEQA 4LGHA 2NRUA 3AD6A 3KMWA 2C47A 1UU8A 2UV2A 4RIWB 4XYFA 2Z7QA 5LJJA 4L8MA 4FT5A 2VUWA 3EOCA 4GEOA 3KRJA 3R63A 3RAWA 5FP6A 4A9UA 3P9JA 4OR5A 4QMUA 1ZOEA 3ZUUA 3MTLA 4D2VA 3UP7A 4O91A 2O5KA 5AMNA 5AUVA 2B9IA 2ESMA 3F3UA 5F94A 4LL0A 1I44A 1ZOHA 2VU3A 3FDNA 3W1FA 3W2SA 3VUMA 5F9EA 1YXXA 3RKBA 4AOTA 4LRJA 3WZKA 5CASA 3E7OA 4J97A 2PU8A 3OBJA 4AZFA 2J0LA 2XNMA 3NUXA 1P4FA 4WNKA 4ZXTA 3BLRA 4AGUA 2JDVA 4YTFA 5CSPA 1ZYDA 2YJSA 3VBYA 4FKQA 3PJCA 3ZM4A 3QHRA 3PVBA 1U4DA 4OTIA 3PYYA 3VBTA 4FF8A 4CRLA 3C50A 4F09A 4KABA 3C9WA 4AP7A 2JAMA 4EOOA 5BVOA 4M69B 4DTKA 5FTOA 4LUDA 5CQUA 3MPTA 3G9LX 3IQ7A 3FWQA 2OK1A 1NVSA 4O22A 4MHAA 4YHTA 5KMOA 1G5SA 1JKKA 4GKHA 3W10A 4H1MA 1J1BA 4IAKA 2J0KA 5DI1A 4QPMA 3VBXA 4AG8A 2BAJA 3M11A 5M07A 5H8EA 2XK9A 4R5SA 3DS6A 1U54B 2UW3A 5LMBA 4YZDA 3PRIA 4LM5A 4X3FB 1JSVA 2WU6A 3K3JA 3RM6A 3VJNA 3NWWA 5EW9A 3FI3A 3QC4A 4LV8A 3ATTA 3LQ8A 3IOKA 4OTRA 3PZEA 4PMMA 4S2ZA 5CYIA 3OD6X 4WNOA 5FXRA 2P4IA 2XIXA 3A8WA 3EMGA 3UC4A 3TV6A 5JFSA 4ZTSA 2GPHA 2QOIA 4MXOA 4C57A 3ZH8A 3D7TB 4YJTA 4NFNA 5H3QA 3H3CA 2XNOA 3OW3A 4FTQA 4RMZA 3UTOA 1BI7A 2ACXA 2H9VA 4QYHA 4PPCA 3QYWA 5FEDA 1BKXA 2ONLC 2VTHA 5EYCA 3OWPA 5KMIA 1MP8A 2R3OA 5CENA 5AX3A 3PPZA 4HCTA 3CKWA 5DIAA 5E8VA 1U46A 3EN7A 3OP5A 4HGEA 4K11A 3TKIA 2VTMA 3UIXA 3O7LB 3G5DA 3OWKA 5CVGA 4QPAA 2C6KA 4C4EA 5A4QA 4IJPA 4DFUA 4O0TA 3PA4A 4IDTA 5HTIA 1NVRA 2QLQA 2R4BA 3MVMA 4ZZMA 5IUIA 4X2FA 3IDBA 4CFNA 4MXYA 3D9VA 4S33A 4G31A 4ENYA 4CQEA 4HOKA 2CHLA 4XOZA 5AP4A 3FY2A 5HVKA 3DDQA 3Q9ZA 4FTJA 2ZM3A 4FGBA 2G1TA 4L00A 3L8XA 4E6DA 3N4UA 2QONA 2HZ0A 3E92A 3HEGA 3IOPA 3NYOA 3O8UA 5E8ZA 4E20A 3DKFA 3RHKA 3T3UA 2R3GA 3U8WA 3HKOA 5KMLA 4EOLA 1XQZA 1YDTE 5HLPA 2GNFA 3FAAA 1RDQE 4KRDA 4RIXA 4QQJA 3G15A 4EH4A 3Q9XA 3R2YA 3BGPA 4KD1A 4W4XA 4EH6A 1K2PA 2PVMA 1LEWA 4WSYA 2B9JA 4YZCA 2HK5A 3JYAA 1H8FA 3RAIA 2BUJA 4FV4A 5IQBA 3ORIA 3QCXA 4QMWA 1OITA 4RX5A 1Q3DA 5AUYA 3IG7A 3PXYA 4IEBA 4I4FA 4ZLOA 2JDTA 3IKAA 4UYAA 4DTBA 3BI6A 3RWQA 4G3CA 3LXPA 5CZIA 2BRHA 1H08A 4D58A 4E4MA 2OZAA 5J8IA 5ACKA 1H0WA 4EQCA 3QRIA 3HLLA 3DB8A 2YITA 4ZY4A 3DNEA 4KIPA 3ZLXA 3MY0A 2PMNX 3CQUA 4PY1A 1QPDA 4HNIA 4AS0A 3LCKA 3NIEA 4ZS4A 4LRKA 3OXZA 2JAVA 3PVGA 2WZJA 3E5AA 4YJQA 3TIYA 3Q2JA 3ZZEA 5T3QA 2ZB0A 4BRXA 3BYSA 3DKGA 3KVWA 3V01A 4BZOA 2YM8A 5FWKK 4MYGA 3A60A 4GFMA 4FT3A 2YIQA 4JDIA 2EB2A 2BCJA 4Y46A 5ANJA 4ACGA 3FI8A 4E26A 1KV1A 5IQIA 2WFYA 2X8EA 4L46A 2FO0A 2WEIA 3P4KA 2VTQA 4EC9A 4ZSAA 5IG1A 4GK2A 5EH0A 3VS5A 5DH3A 4C58A 1XBAA 2W4JA 3ZDUA 1V0PA 4MCVA 2VX3A 3PE2A 2C5NA 3Q52A 2JIIA 2R3FA 1OBGA 2VTAA 3T3VA 3ZUVA 5AR4A 4FSWA 3BE9A 5FDPA 3MDYA 3VC4A 4F9YA 1AQ1A 4GV1A 3ZLYA 3NGAA 4RJ4A 2JDSA 3R00A 4YZBA 3HP2A 1ZRZA 3EHAA 3VHEA 5KBQA 2PY3A 3GGFA 4ERKA 4HYHA 2A4LA 3MSSA 3H9FA 3VHKA 2C5XA 1Q4LA 5CVFA 5E1EA 3U4UA 4ALVA 4UN0C 5CSXA 1JPAA 2YM5A 2WEVA 2OJIA 3UO4A 3DV3A 2X4FA 5D9HA 2OW3A 4P5QA 3CY2A 5DEWA 4K9YA 2HIWA 2OICA 2OIBA 3FYKX 5HNIX 4CXAA 2W9FB 2ZMDA 4GU9A 4O96A 5HO8A 3QQKA 3IW6A 4BN1A 5IH4A 4FG7A 4M14A 3DOGA 5HCXA 3QC9A 5D41A 2WIHA 3RMFA 4O0WA 2C5VA 3R9RA 3HMNA 4QTEA 3EIDA 5IA5A 3K5UA 4CFFA 3QU0A 4FTTA 3SX9A 3TKHA 1TQPA 4XP2A 5HKMA 3TXOA 2BZIB 2XIYA 4M97A 3EYGA 2R3HA 3KL8A 4YJUA 1WFCA 3JS2A 3RHXA 2F2UA 3G90X 5LCJA 1HOWA 3ZUTA 4X2KA 5IDNA 4U81A 4AFEA 3MVLA 1REKA 2C0TA 2VTLA 2X7GA 2Z7SA 5IF1A 4G5JA 4CMTA 5KBRA 3PE1A 3E8NA 4EKKA 3OOMA 3ZEWA 3DFCB 4K1BA 4BTJA 2BRNA 4YC6A 5HEZA 4O0YA 5TOZA 2BMCA 4L52A 3TTJA 3JXWA 4RJ7A 4KRCA 4TYGA 3HYHA 4R3RA 3FZRA 2GQGA 1FVVA 2CJMA 5EG3A 4JBOA 4H58A 4MWIA 5FM3A 2YZLA 1GZKA 2FYSA 4HNFA 3OROA 5AP2A 4CT2A 5LVPA 4UMRA 3QQUA 3LZBA 5FM2A 2VWWA 2CDZA 4B4LA 4BGGA 5CU4A 4FV8A 3KEXA 4F63A 2PUIA 3LFSA 1WMKA 3E7VA 2ZV7A 4OBQA 3LFCA 1IG1A 2VWXA 2WTJA 4U7ZA 5IUGA 3HRBA 4GIHA 2QC6A 2ZYBA 5E1SA 5HNBA 3ZU7A 3RK7A 4GJ2A 4DH5A 4XG9A 1PYXA 4RQVA 5FBOA 2RG5A 5IA3A 5IQGA 3QA8A 4Z55A 5DPVA 2C6OA 3EKNA 1REJA 3DKOA 4EWHA 5LMKC 5D7AA 5LVLA 1H28A 4WA9A 4CSVA 4O7VA 2A19B 4FKGA 3QTZA 4FODA 4UWYA 3WZDA 3NW5A 2XM9A 3PXQA 4FTNA 4PNIA 4W8EA 3DAKA 4BBMA 3FC1X 4MXCA 1BX6A 3W8QA 3FV8A 5CNNA 4AU8A 3O96A 4XJ0A 4CFUA 4NH1A 1MRVA 2WMQA 2XM8A 1J7IA 4EJ7A 3C0IA 3B8RA 3CQWA 5HBEA 3R9DA 3BWFA 2IN6A 4IVDA 2W4KA 4P2KA 2G01A 2C5YA 2XB7A 3JY9A 4I5CA 4USEA 1OUKA 3EZVA 4ZJVA 4FGRA 4MVFA 4A9SA 1OPJA 4YP8A 4EK3A 4U8ZA 3R73A 3F3TA 2HYYA 1VJYA 4ZSGA 5HQ0A 4E73A 3LHJA 3NSZA 2J2IB 4FSQA 5C4KA 3EB0A 3TNHA 3FI2A 1YXVA 3DY7A 3GU7A 2W1HA 2VWVA 3QKMA 4RIWA 3HDMA 1NT2A 4DTAA 3HMPA 4BWXA 2YM6A 5LCKA 3QGYA 4G3GA 1UVRA 4BI0A 5TT7A 3RWPA 1IR3A 4W9WA 3FXZA 4CFXA 3QFVA 4EBVA 4IAAA 4I0RA 5F4NA 4U45A 5CZHA 2XJ0A 4HVHA 3I7BA 4AA5A 2J4ZA 3SXRA 3N9XA 3FLNC 4GU6A 3E8CA 3O2MA 4RSSA 4CVAA 5DGZA 2YAAA 4DH3A 3E8DA 2I1MA 4WHZA 5KMMA 2VWIA 5HE0A 3H10A 5AV3A 2OJGA 2P2HA 3NPCA 3O51A 1FVTA 3BCEA 1WAKA 1HCKA 2UZOA 1PKGA 3NYVA 1FPUA 2GFSA 2UW9A 4QMNA 5L4QA 4QP7A 2YACA 2PZRA 1LUFA 4U0IA 4BCMA 1WZYA 4YC3A 3TZ9A 4M69A 3ZZWA 4GUBA 4QMQA 3LQ3A 2JIVA 3V5LA 5M51A 4WD5A 4D9UA 1E9HA 3TT0A 1FGKA 3Q5ZA 4U41A 3KF7A 4D1ZA 2WTKC 3DB6A 1R78A 4S31A 4BIBA 4AW0A 2X7OA 1Z57A 2ZDTA 1NXKA 3P7AA 3RBWA 3N4VA 2IVUA 2R3IA 1JWHA 4I4EA 3HMIA 4R8QA 4OBPA 3EL7A 4FICA 4KIOA 3LFNA 4L7SA 2QODA 4C38A 3I81A 3W18A 3COMA 5IQCA 1YDSE 4LV5A 4NW5A 3L1SA 3U55A 1JNKA 3Q5IA 3GI3A 3A61A 3KKVA 4QMVA 5AM7A 4B7TA 1KUTA 3LXNA 3WYXA 4HJOA 1U54A 4FUXA 3EN4A 4KA3A 4QP8A 1ZWSA 4O0SA 4L44A 1XH5A 4IVBA 4FSTA 4RA4A 5E8XA 1OM1A 3O23A 3EL8A 1O6LA 3UC3A 4FA2A 4U3ZA 4ANNA 4X7QA 3ZFXA 4KAOA 4FG8A 5AP1A 1JBPE 2I0EA 4RVKA 5EW3A 2W06A 2YLFA 3RK9A 2IWIA 5H8BA 1IAHA 4N6ZA 4YBJA 3DK7A 3SOAA 2ITVA 2UW8A 2BPMA 4L3PA 2ITPA 3REPA 3DGKA 2C6LA 4GT5A 2OWBA 1BI8A 4O0UA 4M12A 5H9BA 3UOHA 5B2MA 2QO9A 1LP4A 3P0MA 3D5UA 3OTVA 1PMNA 1XKKA 2J51A 4DGGA 4APPA 3T9TA 3KXMA 4BI2A 1ZYSA 4LRMA 4PRJA 5EM5A 4J53A 4DFXE 3LM5A 4AW1A 4UMPA 4V01A 4DCAA 3S00A 2X2LA 4MH7A 4BB4A 3R8PA 4B99A 4D2WA 4BCJA 2GS2A 2J5FA 5HG8A 5L2TA 2JBOA 3TV4A 5LOHA 3ZHPC 1IRKA 2VWUA 2GSFA 2QO7A 5E9EA 3E63A 2WQOA 3PWYA 3ROCA 3TZMA 3VF9A 4LI5A 5JEBA 2OZAB 3IW4A 4FT0A 2YCRA 3PXKA 2YIXA 3EQPA 3P79A 4IANA 4NIFB 3JUHA 3QUEA 4O0RA 2VTTA 1W83A 3ORMA 4ANQA 3OG7A 4DG0E 3IDPA 3NLBA 4WBOA 5HTCA 1CKIA 3AC4A 4YLLA 5EM7A 1CTPE 5HG5A 4APCA 4BKYA 3ENMA 3CEKA 3LFQA 3EH9A 4PTCA 5GZ8A 3OFMA 4U97A 5EI8A 2GNHA 3Q60A 4IZAA 4G5PA 3TIZA 4D2RA 4CKJA 4RWLA 4O7TA 3DKCA 3GCVA 3BU3A 5LMKA 4DN5A 3NUAA 5DBXA 1Q99A 4EOIA 4USFA 3IONA 3A7HA 2BZKB 4OBOA 1T45A 4G1WA 3JR1A 3AD4A 2BRMA 3A62A 5CU2A 5FEQA 4E5WA 4O7WA 3AT3A 4JR7A 4M15A 5DVRA 4KUJA 1FOTA 3LAUA 5IISA 2CSNA 4YHJA 2VNWA 4K8AA 3SVVA 1TQIA 1G8AA 1L3RE 4NCTC 2WU7A 4FV0A 5CEOA 4E4LA 4ARKA 1XH7A 1SNXA 4HGTA 3OBGA 4O7YA 2R7IA 4F7JA 4F08A 1E1VA 3QQJA 2QU6A 4W4VA 5BVWA 2XRUA 4F99A 1H01A 2W5HA 3I1AA 4BVUA 4P7EA 3BZ3A 4FSZA 4RLLA 4ZS0A 1UA2A 2JBPA 3GB2A 3TJDA 1MUOA 2HXQA 4K33A 4X21A 4EK8A 4FKOA 3LJ1A 3C5IA 3MH3A 4WG3A 5DR2A 5BX0A 5M53A 2PHKA 1BL7A 2YERA 4Y73A 1H07A 2XJ2A 2CCHA 5AIKA 2FVDA 4RWJA 4U80A 1OL7A 4CFWA 3I0QA 5EQPA 2OIQA 4YHFA 3ROYA 5CU0A 1URWA 2BFXA 3MH0A 5AR2A 4RIOA 4Q5HA 2SRCA 5AA8A 5LXMA 4D2TA 4EBWA 2XJ1A 2YWPA 3LCOA 4YLKA 1YW2A 2ITTA 1H1RA 4ERWA 3I6WA 3KXHA 4D0WA 4FSRA 1SZMA 1YVJA 3NZ0A 3DK6A 4EZ7A 5F20A 4QP3A 3RCJA 4MWHA 3MH1A 5HE2A 5CI7A 3LFFA 3TG1A 3QRTA 4X3JA 4DHFA 2YZAA 3AD5A 1CM8A 1PMEA 2QURA 4G6OA 4QP6A 3SXFA 5KMKA 5JK3A 3PVUA 3ETAA 4MF1A 2RFDA 4PMSA 3DU8A 4IFGA 4ASEA 4M67A 4Z16A 5KMJA 3UZRA 5J9YA 2BROA 2P55A 3LVPA 5JGAA 4CCUA 3I5NA 3UPZA 5A6OA 1ZXEA 3JPVA 2UUEA 5CF6A 2PZPA 4QNYA 3DBCA 2G15A 3GT8A 3LMGA 2FGIA 1OBDA 1UNGA 4OTGA 4HYSA 4IWDA 4GG5A 3KGAA 4EC8A 3F5GA 4XBRA 2I0VA 3JVRA 4JJRA 4YUQA 3UZPA 4DFNA 4HPUE 3TDWA 3R28A 5G6VA 2WIPA 3R1SA 3KVXA 3W2CA 4BHZA 3VS1A 4ZEGA 3KA0A 5CY3A 4C2WA 4F0IA 4B8LA 4G2FA 3O71A 3NNWA 1W7HA 1Q61A 3QRKA 5TKDA 2I7QA 2BKZA 2GTNA 1W8CA 4QMTA 4KNBA 4O7NA 4F7LA 5AAEA 3I4BA 2OG8A 4JRNA 4KB8A 3R8LA 4BDAA 2BKKA 4U43A 4PUZA 5CQWA 4C36A 3GU5A 5BUJA 3UOJA 4FV7A 2RFEA 3E87A 1YQJA 3TN8A 3ERKA 1DI9A 2WO6A 3F7WA 2QI8A 4L67A 4MQ2A 2QD9A 2OO8X 3ANRA 3RCDA 1QCFA 1GZOA 4OUCA 3GFWA 4RX8A 3PG3A 4XV3A 4BCPA 4DC2A 3ZFYA 2HY0A 3WIGA 3K3IA 3ORPA 5IA2A 2RKUA 4F4PA 3LJ2A 5JGBA 2C4GA 3CPCA 3KMUA 4BCOA 3T9IA 4BCFA 3RPVA 4F70A 1LR4A 4DG2E 3LKMA 4BDKA 4BGHA 4C4HA 3FMEA 4F1MA 4NJ3A 2XUUA 4FNYA 3QWKA 2QG5A 3D0EA 3DZOA 3PXFA 4TTHB 5E8TA 3UQGA 3AC1A 2DUVA 4P4CA 2YJRA 5KNJA 2DWBA 4Z3VA 3FKOA 1XWSA 5M09A 3COHA 3UPXA 3U9NA 5CSHA 1CSNA 5CF4A 3DZQA 3MFUA 1PXPA 4ITHA 2Y7JA 2V0DA 1PF8A 3DLZA 4XUFA 4MEDA 3U6JA 4AXAA 1RJBA 3U87A 4JI9A 3BIZA 3ACKA 2BAKA 4FE2A 4FKWA 3DXQA 3P78A 3POOA 2G2IA 4KSPA 4PP9A 1OPLA 4H3BA 4D4RA 2CMWA 2Y9QA 4JBVA 1OPKA 4F0FA 1YI6A 3R8UA 4B8MA 4LQMA 5HIDA 3GXLA 4EYMA 1YHSA 3O8TA 4TY1A 2X9FA 2YM3A 3MFSA 2QU5A 3IPHA 1IA9A 3BHVA 4TYIA 2PYWA 2BILB 4Q2AA 5CI6A 2BR1A 5FTGA 2UZWE 2R64A 2WMAA 5E8SA 4AW5A 3SD0A 4AW2A 5FXQA 4HGSA 3SG8A 4XRJA 1XR1A 3HGKA 2VTNA 4A4LA 5BMMA 4C3FA 2KTYA 3F2NA 3F82A 3FQHA 4IVAA 4MAOA 4O27B 3B2TA 5A4CA 1PMVA 4JX3A 3R83A 2NRYA 3VS7A 1PJKA 1SMHA 3VUHA 3LOKA 4MNFA 4J98A 4G3EA 5L6OA 2J9MA 4AUAA 4AAAA 3HAMA 4CGAA 5KKRC 5I9XA 3MA6A 3CPBA 1ERKA 4DLJA 4NCTA 4FMQA 1U5RA 3A4PA 2WMBA 2IVTA 4WRSA 2V5QA 4J1RA 5G1XA 2WELA 2PWLA 3UVPA 4D2SA 5JT2A 2W17A 3GNIB 3NW6A 3HECA 4I6BA 4FTLA 2JGZA 1FINA 2NP8A 2P2IA 4CG8A 3U9CA 1MQ4A 4FK3A 2XIZA 4EOKA 1PMUA 4U3YA 5AX9A 2QOLA 3VRYA 1YI4A 4RX9A 4WRGA 3BELA 2YIRA 4YZMA 4J96A 4ZTQA 3UOKA 3H9OA 3CTQA 2I0YA 3DTCA 5FG8A 4FT7A 3UDBA 1OGUA 3Q4TA 2WMXA 3GC7A 3NUNA 3KRRA 4NW6A 4O86A 4I21A 1XH4A 2C3KA 3FLQA 4QP2A 4YNEA 4A4OA 5ANIA 1R0EA 3UO6A 3R7GA 5GIPE 3D4QA 1H0VA 4BIEA 4JRVA 4ZMFA 4G9RA 5DT3A 3SGCA 1O6YA 4IMYA 3RINA 2CPKE 3IS5A 4ITJA 4PTGA 4BR3A 3WF8A 2W1FA 4AN3A 3OCTA 3UODA 4DBNA 2PVKA 1H00A 2F7ZE 3MTFA 5C1QB 5ANDA 5ICPA 4Q9ZA 4JIAA 4TNBA 1J7UA 3HUCA 1A9UA 4M3QA 3BLQA 2UW0A 4D5HA 5GZAA 4FI1A 4BWPA 4RT7A 3KCFA 3G0FA 3PPJA 4CFMA 3ZSHA 4LGDA 3CD3A 4OAVB 3R21A 3DT1A 4JBPA 2YABA 4YJOA 4ITIA 4XP3A 3WARA 4FIFA 1ZYLA 2Z60A 5ANOA 4YLJA 2OJFE 3W8LA 3R9OA 5DFPA 3SDJA 2PPQA 2ITQA 2WNTA 2XYUA 1GY3A 2XZSA 5EYDA 2C5OA 2C3JA 2PVFA 3C4ZA 2WAJA 3LXKA 3PFQA 4FOBA 1KE6A 4PQNA 3VUIA 4BDBA 4EI4A 3FSKA 3FQEA 4QQ5A 5AR7A 3GC9A 3V3VA 4G3FA 4IB5A 4Y5HA 3PPKA 1Z9XA 2BRGA 2XNNA 3DTWA 4FVRA 3SV0A 3SA0A 2CKEA 2CGUA 3BHUA 4TPTA 3C4CA 3NUUA 2XKDA 3BQCA 5AUTA 3ID6C 4R1YA 5CS6A 1OUYA 4E93A 4CQGA 4D0XA 2EWAA 5KZ0A 2V7OA 1B39A 1YXTA 4MK0A 4UWCA 3RZBA 5EHLA 4C4FA 3QZHA 5AR5A 4HCUA 4Y83A 5CWZA 2X8DA 4M7IA 4GG7A 4CLJA 5K4JA 2XNGA 2OJ9A 1FVRA 4XBUA 5ANKA 3BYMA 4FIHA 3F7ZA 2IW9A 4G34A 2Z02A 3PWDA 2OF4A 4YSMA 1PRYA 1M2PA 1VYZA 1Y6AA 2QCSA 4S34A 4EH3A 3PG1A 2YCSA 3WZUA 3LQ5A 1L8TA 5CXHA 5IA4A 1FMOE 2P3GX 3O50A 3AMAA 5BPYA 1VZOA 4NWMA 3KC3A 4FVPA 4AFJA 5HO7A 5EQYA 4A06A 2OH0E 3PP0A 3SLSA 5EK7A 1KE5A 2VTOA 5C01A 4R7HA 4FTUA 4NIFA 2CLXA 2O0UA 4XG6A 4XNEA 5K3YA 3V8SA 1Q8UA 5K4IA 4D4VA 3EN9A 2FSMX 4OW8A 3QD4A 4JDHA 3S95A 4C61A 2HZIA 2BZHB 2PE1A 4J95A 4JQ8A 3C0GA 3QZIA 1UKIA 3ULZA 3QTXA 3I6UA 1ZLTA 3R22A 5EI2A 3FJQE 5AV0A 4F6UA 5CAUA 5HO6A 4DEHA 2ETMA 2H96A 2F9GA 2JDOA 2UVYA 3U4WA 1T46A 4C59A 3WZEA 5DT4A 3C1XA 4MNEA 4DEGA 3ENHA 4HZRA 3DXNA 1R0PA 3V51A 4BGQA 4FKVA 3AOXA 3C4EA 4GMYA 4E6AA 5B2LA 2FA2A 1APME 2ZM4A 2IZSA 3OUNB 3R7IA 1VR2A 3HNGA 4UY9A 5L2QA 3EKKA 3ZSIA 5CF8A 3UZTA 3CR0A 5HG9A 4O1OA 3NVKI 5HVJA 5I3OA 5FGKA 2XCKA 1R1WA 5EKOA 4F64A 4QYGA 4HVIA 5M06A 3FL5A 4IC8A 4ACCA 4ZY5A 5GIOE 3LM0A 4O38A 3G6GA 3PJ8A 2X4ZA 3OW4A 4J8MA 3R8VA 3FKNA 3GCQA 1B6CB 3E8EA 2PUPA 3EJ1A 3Q3BA 4QTDA 4ZSJA 2ZAZA 1YXSA 1OIQA 2CKQA 5AUUA 4L6QA 2XCHA 4LMUA 4R7IA 4IACA 3H30A 3POZA 2OJJA 3GOPA 3O0GA 3OWLA 1ZZLA 4JT3A 2XK4A 4ORKA 4Y5QA 5JRQA 2WTKB 3EQRA 4CTBA 2PVYA 4FKUA 4WIHA 4C3RA 1P2AA 3RNYA 4CNHA 1ZAOA 5A46A 2HENA 5HIEA 4DEIA 1OKYA 2OXDA 2IPXA 5EQEA 4N57A 5BQ0A 1GAGA 4XG8A 3UG1A 4ALUA 5J7HA 4JVGA 4FC0A 3JY0A 3KF4A 4I5HA 3B2WA 4FL3A 3WE4A 4AGWA 4EWQA 1H1WA 3U6IA 5I0BA 3U51A 5CAOA 1XH6A 2DYLA 2X2KA 4DAWA 3DFAA 4IXPA 2OI4X 3KB7A 5BVFA 5IQFA 1M14A 1PXJA 5KUPA 3DLSA 5GNKA 3AGLA 2XEYA 4ACDA 3GQLA 4AGCA 4F65A 3Q6WA 2WMVA 2Y6OA 4I1ZA 4KWPA 4ZZNA 3FXXA 5L3AA 3TNPC 3VS6A 2VAGA 3ZO3A 4F1OA 5JZNA 5DR6A 4RVTA 2GS7A 2PVHA 2PUUA 3RPOA 4FIJA 3VVHA 4JL9A 5DT0A 2QOBA 5LVNA 5J5TA 4BWKA 2XIKA 4ZK5A 1TQMA 2F7EE 2ONLA 4YNOA 3TWJA 4BCQA 4E4XA 4B6LA 3A7IA 4ANLA 3F5XA 3GENA 4Y72A 1JKTA 5E8WA 3HP5A 4AE6A 4CMOA 4EOPA 1UV5A 4DEAA 3SW4A 1W84A 3HV7A 3PY3A 3QYZA 3WOWA 2H34A 3L8PA 3SAYA 2WKMA 3FPQA 1BL6A 3ZRMA 4OTQA 5ETAA 1H27A 1UKHA 2YHVA 3CJGA 3FMJA 3NEWA 3PVWA 4GK3A 4XH6A 2VNYA 5D11A 3UIBA 4BCIA 5A54A 4IB1A 3ZC5A 4CYIA 2B52A 3TZ7A 4CYJA 2OF2A 4J71A 3NNXA 1W82A
chains in the Genus database with same CATH superfamily
2VZ6A 5E91A 1OIUA 3HRFA 4K77A 4QNAA 3VUTA 4FV3A 5B0XA 5LVOA 2W99B 4I93A 5K5XA 4A07A 1STCE 1AD5A 4L7FA 2EXCX 4XEYA 5CT7A 4WT6A 5DOSA 2E9PA 3DBDA 4S32A 2X0QA 3A8XA 4IX3A 2XNBA 4ANSA 3NAYA 3UVRA 4QMXA 2W1GA 2BDWA 5JMSA 4DGNA 1Q8ZA 3TNWA 3MA3A 3K2LA 4F6WA 1WBPA 4P5ZA 2C6EA 4QOXA 2QKRA 2PE2A 4EJNA 2REIA 5I9YA 3UNKA 4CG9A 5HLNA 1H1QA 3OTUA 4GT4A 4KIKA 3FLSA 1XO2B 4MXAA 4FV6A 3W2OA 4U9AA 4TW9A 2O65A 3L9MA 5C03A 4CKIA 4H36A 4CT1A 1XJDA 2CGVA 3ZBXA 2F49A 2C1BA 4F6SA 4E1ZA 1KWPA 3BL7A 2QR8A 3QL8A 5L8JA 1YRPA 2JKQA 3A7GA 4ANBA 4QO9A 4GFOA 2QOHA 3Q9YA 4C2VA 2UZNA 4FKTA 5AADA 4JDKA 4C33A 2QG7A 2HW6A 4U42A 4QYYA 4BY9E 3PJ1A 4GUEA 4PL5A 4GL9A 1W0XC 3LW0A 5EDPA 2Y4IB 3UIUA 3ZXTA 5CVHA 2AC3A 3D5WA 5BVDA 4RFZA 2BALA 2JIUA 4EEVA 3WF6A 2XF0A 4RZVA 4ZAUA 4XP0A 4DFLA 5KCVA 2UZDA 2VWZA 3AC5A 4FEWA 4WO5A 5CAQA 5DWRA 2YDIA 4I92A 2PSQA 2PVRA 3VUGA 3WILA 5HBHA 4DT9A 1PYEA 2CNVA 2GQSA 3I7CA 3PSBA 2X0PA 4FTKA 4I22A 2H8HA 2GTMA 1RQQA 4C35A 3NCZA 5J9ZA 3GP0A 3TKUA 2OXYA 4NL0A 1R3CA 1UNLA 4ZOGA 4FIGA 3PZHA 3QKKA 2XA4A 5HBJA 2C0IA 3C13A 5E8UA 4D55A 5A4TA 2ZDUA 3R7EA 4G16A 4DITA 4FKSA 2J90A 4PMTA 3VS4A 2X1NA 3UYTA 3KCKA 2FSOX 5IUHA 5K0XA 3GFEA 4ASZA 1XBCA 4EUUA 4FR4A 2BVAA 5FEEA 4RBLA 4AT4A 4XLIA 5GINE 2X7FA 4L42A 2R5TA 4I0SA 3MVJA 4IM3A 2CKPA 4DEEA 4MF0A 2JITA 5AP5A 4F9WA 1IAJA 3NX8A 4QMOA 4CCBA 3CQEA 3FUPA 4YC8A 4EOMA 3U6HA 3CP9A 4GSBA 2RSVA 4K0YA 4KKEA 2CGXA 1OL6A 1OIRA 3QKLA 4AQCA 3AMBA 2YCQA 3T8OA 3C5UA 4A9TA 3LCDA 1FGIA 4RWKA 3V5JA 4JAIA 4YJVA 4HGLA 1ZARA 4GCJA 4W4YA 4QMLA 4N4SA 1GIJA 4GJ3A 4NM3A 4AF3A 3PDTA 5BMSA 4DH1A 2OIDA 3F61A 4DCEA 3U54A 4IDVA 4RJ5A 3MYGA 4JXFA 4E6QA 4XLVA 2ITUA 4FKPA 3R7YA 2KULA 4I20A 3QTIA 1NW1A 3TNIA 4EORA 3O5AA 2XS0A 1SYKA 2GNLA 3V8TA 4W4WA 3MI9A 2RFNA 3ORXA 4FSYA 1EH4A 3R7UA 4YTCA 5CSVA 4OT6A 3F88A 4U44A 1HCLA 4DF3A 2I0HA 4WUNA 4ZP5A 2JKOA 3CE3A 5FDXA 3UIMA 3NW7A 1Q3WA 3BYOA 4IJ9A 3VUDA 4PDOA 3B8QA 4Q9SA 2B9FA 4BBEA 4PP7A 3MJ1A 4FOCA 2AUHA 2IW8A 3Q32A 4UEUA 2G2FA 1WVWA 4BZDA 2QOKA 5HE3A 3IW8A 4TWCA 4ZTRA 4EHEA 4U79A 3W33A 3TZ8A 1WVYA 3QTQA 1NA7A 4X2GA 3ULIA 3V8WA 2JDRA 3OCSA 2GFCA 4FNXA 5K0KA 4DYMA 4RJ3A 4YBKA 3ZBFA 5BVEA 2R9SA 2W1DA 1YHWA 3KIOC 2J0JA 3H4JA 1TVOA 2C0OA 4G6LA 4JG8A 4TWNA 3RAHA 3V5WA 2WMWA 2QO2A 2BTRA 4AACA 3C51A 3R8MA 1XH9A 4LUEA 4U40A 1J3HA 3AXWA 4R78A 2UZEA 5DRDA 4F7NA 5EM8A 2VX0A 3G9NA 3QGWA 5I5ZA 1VYWA 1K3AA 4JOAA 4UZDA 5EOLA 5FTQA 3WYYA 2XMYA 4J8NA 2H6DA 2VRXA 4BDEA 1I09A 4QTCA 4J99A 4BBFA 3NCGA 3LFEA 1OL2A 5M4FA 4AXDA 1YDRE 3II5A 1MQBA 3TNQB 3OMVA 5JRSA 4DGLC 4NEUA 4F9CA 3NFFB 2CN8A 4A4XA 5AV4A 2Y8OA 4WKQA 3MH2A 5BVNA 5IEXA 4BDFA 3QTWA 4WOVA 3OC1A 2PVJA 3S3IA 1ZY4A 4BHNA 1QPEA 3W32A 5CEPA 4YO6A 4RRVA 5J95A 2OXXA 3OOGA 4MNEB 5T68A 3SRVB 5FXSA 4BDGA 4R1VA 2YFXA 2F2CB 3PIXA 3QRUA 3ZONA 1JKSA 1JLUE 4QPSA 5HCYA 2V7AA 3CJFA 4JIKA 4TYHB 2WHBA 3N51A 4ZSLA 3PXZA 2O2UA 4Q5EA 3ZO1A 4BCGA 2Y4IC 3F3WA 5IQEA 4IB0A 2R2PA 2ZMCA 3HMOA 4DH8A 5C26A 3QAME 4GYGA 1UWHA 3QXOA 2JLDA 4RIYA 3UBDA 3FXWA 3FMDA 4RC3A 4UB7A 4ASXA 4F0GA 5L6PA 4ZTNA 3S0OA 5EW8A 4R3CA 1TKIA 5F1ZA 5C8KA 4QMYA 4YPSA 5IH6A 3WZJA 5I9ZA 2HWPA 4Y95A 5KKRB 1GNGA 4TKSA 5L8LA 2VO0A 4TRLA 2YISA 3RK5A 1M52A 2BIKB 4IWQA 4Z7HA 5E90A 3CKXA 4JS8A 5EHYA 3FI4A 5DA3A 3VW8A 4HW7A 2R3KA 3BV2A 5EDRA 5HORA 4R3PA 3BHHA 4GH2A 2GHGA 3FZOA 3OHTA 1AGWA 3MFRA 4YR8A 3P08A 2WQBA 3W2RA 4UXLA 2UVZA 3KXNA 5CF5A 1NVQA 3D5VA 4ZTLA 4IAYA 2BHHA 4S30A 4H1JA 1SNUA 5AV1A 3BPRA 3IW7A 3ALOA 4XHKB 2WQNA 2B7AA 3BBWA 3UGCA 5J79A 4FTOA 4UALA 4BICA 2P33A 2IO6A 3RM7A 4IADA 3AC3A 5L6WL 2ZVAA 3TUCA 1KE9A 5BYZA 3HV3A 4KSQA 3G0EA 2G2HA 4QYEA 1A06A 2FUMA 2JD5A 3QTUA 5HE1A 3HDNA 3ML1A 2OSCA 2X81A 4ZJJA 3UDSA 1JQHA 2VO7A 3NUSA 2IW6A 3BYUA 3HX4A 4O21A 1H1SA 4BL1A 3NVMB 4XG4A 3FKLA 3M42A 4LFIA 1FBNA 2XK8A 2Z7LA 1WBVA 3D2KA 3Q2MA 3QXPA 4QMMA 3VWAA 4EUTA 5BNJA 4IZ5A 1F0QA 2W1EA 1IASA 4AZWA 4XRLA 4L9IA 4TYEA 5T6KA 4E7WA 1CDKA 2X2MA 5HIBA 2F57A 1LEZA 4LMNA 4V0GA 1BMKA 4P90A 4FV1A 4JQEA 3SC1A 5GZ9A 3VBWA 3GVUA 4IVCA 3NS9A 4FSNA 4KBKA 4IQ6A 3R1YA 4XCUA 4F7SA 5CAVA 5HU3A 4LYNA 4IZ7A 1QMZA 4M84A 2AYPA 1QPCA 5AIRA 3P23A 2C6DA 2EB3A 3EN5A 5C27A 3CS9A 4C0TA 4MBJA 2HCKA 2WTDA 1UWJA 4PTEA 3NRMA 4IZYA 1YOLA 3ODYX 5KE0A 3SG9A 3ZEPA 5EOBA 3KULA 3WI6A 2WTIA 4JG6A 4BTKA 3EQDA 3CGFA 1M7NA 4K2RA 4FZ7A 5AP7A 2OLCA 2GS6A 2IZTA 3FMMA 3F3ZA 5JQ5A 3QCYA 3DCVA 4RC4A 1M2QA 3MPMA 4JLCA 4D28A 2J7TA 4AQKA 2R3JA 5EYKA 3BGQA 4G3DA 4BKZA 4CTCA 3I0OA 4GKIA 4XMOA 4KS7A 1UU3A 3RVGA 3IW5A 4FKIA 4OGRA 1Q8TA 4TWOA 4FT9A 4BYJA 1BUHA 4HYUA 5BYLA 1G8SA 4BJJA 4J7BA 5DYJA 4YZ9A 1WBSA 4XG2A 2HELA 2Y4PA 3GCSA 5IPJA 4KIKB 5CEIA 5GJFA 2B54A 4PWNA 3QZGA 2X39A 4OTHA 4LL5A 2QLUA 3OEZA 3MVHA 3NYNA 5CXZA 2HWOA 2Q0NA 4BYIA 2ZV2A 4GIIA 4KKGA 4AZSA 4CZUA 5TR6A 2FB8A 4E5BA 4FBXA 5I3RA 3F9NA 2IZUA 2Z2WA 5FLFA 1OIYA 1E1XA 2A1AB 2VTSA 4YZNA 4ACHA 3R6XA 4YPDA 1OECA 2C30A 2C69A 1OZ1A 4HZSA 4L3JA 4PPBA 4WSQA 2A2AA 3RPYA 2X0OA 3E3BX 5FRIA 3QRJA 1UNHA 4CD0A 3QD0A 4I6HA 5KX8A 4EOJA 3CXWA 4ONAA 4PL3A 2W5AA 3PJ3A 3LJ0A 2Y6MA 5JQ8A 2QKWB 3DBQA 2XNEA 4PV0A 2XIRA 4C34A 3HA6A 3Q6UA 3Q96A 4CRSA 5AFVA 4BF2A 4R7BA 4KKHA 4O6EA 5JSMA 5CALA 4AX8A 4M66A 4IHPA 3E88A 4OTWA 3G6HA 5J7BA 4GVAA 3WIKA 3ZOSA 3OY3A 1DM2A 2EUFB 1JOWB 2DS1A 5HZNA 3V5PA 4EK6A 3LLAA 5HX8A 3D5XA 4ZTHA 2QQ7A 4DFYA 5IDPA 2CGWA 3ZLSA 3THBA 4D1SA 5HICA 5LMAA 1YWRA 5L2IA 4IAFA 2BDFA 3CCNA 4XG3A 3L8SA 1Y91A 4R5YA 1CKJA 5DMZA 4M0YA 3EQBA 5CNOA 2IJMA 2ITOA 1Q41A 3GUBA 1A48A 3OY1A 3CBLA 3L9PA 3OEFX 4L01A 5LARA 5E92A 5IMXA 2E9OA 3W2QA 2UZTA 4QD6A 3NNUA 3BRBA 4FVQA 3E3PA 3HUBA 1ZYJA 2UZUE 4RC2A 4IAZA 4UMQA 2OU7A 3Q4ZA 4NT4A 4TZRA 1K9AA 2YLEA 2VX1A 4L45A 1Y6BA 3QLFA 3R04A 2UW5A 3BQRA 4EZ3A 4FKLA 3UMWA 4D2PA 4G9CA 4UX9A 2B55A 2PUNA 2XAMA 4HCVA 4QQTA 2HW7A 5H8GA 2VTIA 1Q5KA 5DLSA 2RG6A 1PY5A 2W1CA 4D4YA 3GU8A 4XOYA 5AUZA 2NNWB 1Y57A 4IIRA 3TJCA 1R39A 5M56A 3FZPA 3UJGA 4FYOA 4KINA 4MXXA 5HD4A 3FMHA 2XEZA 2VGPA 4RLKA 4JG7A 3D14A 3L9LA 4GYIA 3DAJA 5CT0A 4CMUA 5M57A 2Z8CA 3WF9A 3W0QA 3BX5A 3R7OA 1U59A 3DK3A 3KXXA 3Q9WA 3FPMA 4NSTA 4YU2A 4IWPA 3SXSA 2I6LA 2IZRA 5CEKA 4C7TA 2XP2A 5ETIA 5HVYA 4YO4A 2UZBA 4FNWA 5HLWA 3P1AA 5M44A 3I5ZA 4KS8A 4RVMA 4AA0A 5A14A 5AJQA 5TE0A 5AUWA 2G9XA 4EQUA 1CMKE 4K18A 5A6NA 5FUTA 3BBTB 5GHVA 4C62A 4O4BB 3MN3A 5ETFA 2X0GA 5EYMA 1QPJA 4FIIA 2VV9A 5B2KA 4ZLZA 3EWHA 4NU1A 2BIYA 3L8VA 4EOSA 3N4TA 1OKWA 4DG3E 3CY3A 3R0TA 4MD8E 3P7CA 3QUPA 5H2UA 3DPKA 5CANA 2HOGA 3FQSA 2CKOA 3KREA 2J50A 3Q53A 3ZO2A 5B7VA 4FTRA 5JN2A 1V0OA 2C68A 5DE2A 3A7FA 1UU7A 3QHWA 1JSTA 3P5KA 4EONA 3F5UA 2W1ZA 3MIYA 1KSWA 2C3LA 3BV3A 2UW6A 3PTGA 4N0SA 4NTSA 4YJNA 3KRXA 3TACA 4G6NA 3JVSA 1LPUA 3EQFA 2UZVA 1F5QA 4O4DA 4WNMA 3ELJA 4EH7A 4LGGA 5C9CA 2WMTA 4IX5A 3BU5A 3DJ7A 2QVSE 4X2NA 4EHGA 3LFAA 1H26A 1DAWA 3VRZA 3EQHA 4O6LA 3H0YA 3W55A 3UYSA 4O7RA 3R1NA 1J91A 4RQKA 4DINA 3R01A 1UU9A 3QQGA 4MX9A 4R6VA 3MGYA 4RFYA 4D4SA 4PMPA 1GJOA 4ALWA 3AC8A 5KZIA 2YAKA 3LIJA 3O7LD 1H25A 1JKLA 5M4CA 4IFCA 4O1PA 3ZO4A 5LQFA 3CSVA 4JX7A 2UVXA 4BIDA 3RI1A 4H3PA 3ZS5A 4IWOA 3VBQA 5L2SA 3QCSA 2AQXA 2W4OA 3EQCA 5IZFA 5K5NA 4FK6A 2GNIA 2UW7A 3QCQA 5E7RA 3MY5A 3PA5A 4TL0A 5KHXA 4DA5A 3TCPA 4EHVA 4RIYB 3ZTXA 2XK3A 1SM2A 3P7BA 4FZAB 1QL6A 4NK9A 5IQDA 3BGZA 5TO8A 4FTIA 4DEBA 4FV5A 3A2CA 3BWJA 1MRYA 1ZYCA 3QBNA 5HHWA 5DNRA 4YSJA 3P5JC 2XKCA 3DDPA 4YJSA 4RZWA 4CEGA 2WMRA 3FLYA 3WBLA 2BDJA 3ET7A 3FMLA 3QTRA 2R0IA 3SW7A 3QD3A 4BTFA 2X6DA 3VN9A 2VO6A 3FMNA 4I3ZA 3KRWA 4CZTA 5JFWA 3BEAA 5J1VA 4DT8A 4M68A 1XHAA 4I24A 5DRBA 2IVVA 4AWIA 3ZRKA 2HZ4A 2PE0A 3PRFA 3SRVA 4H39A 5JFXA 3PIZA 4V05A 4LOQA 5I9UA 4AAYA 3OT3A 5JH6A 2OFUA 3PY1A 1YKRA 3LE6A 4I5PA 3FL4A 1NY3A 1OB3A 1DAYA 2X8IA 2OZOA 2W05A 3PY0A 1RW8A 5KMNA 3ORKA 2XK6A 4QP9A 4FEUA 1PXKA 4BC6A 3ZYAA 4CV8A 4GT3A 4TYHA 4WUAA 4BTMA 3AMYA 3C7QA 4FTMA 4K6ZA 5ANGA 5D12A 4ID7A 1YI3A 3F6XA 4AZEA 1H24A 4CZYB 1W98A 3KXGA 4FUYA 4BDJA 5HTBA 4GS6A 4DFBA 5E8YA 4GRBA 5DR9A 3ITZA 4W9XA 3VIDA 5I9VA 4O84A 3UO5A 4EKLA 4F9AA 4I6FA 3C4FA 3TUBA 4ENXA 5ANEA 3DXPA 4L53A 4FEVA 3ORTA 4HVGA 2RGPA 3BEGA 4BDDA 3CGOA 3DQXA 4X0MA 3TTIA 1ZMWA 4PX6A 2QOCA 4BZNA 4O0VA 5IU2A 3TM0A 1F3MC 1JSUA 1Z5MA 4MD7E 2FSTX 4U5JA 4AE9A 3EQIA 1Q8YA 5F95A 3RJCA 3TI1A 4UV0A 4V0GB 2PZYA 1KOBA 1SVGA 4XV9A 2YEXA 3Q4CA 2QOFA 5KO1A 4EL9A 3IDCA 2W9ZB 2WTVA 4WNPA 2R3QA 3EFLA 3SHEA 4IH8A 3OWJA 4O7SA 1YWVA 3C0HA 4ACMA 3UE4A 3WF5A 2OGVA 2GNJA 3UNJA 3VO3A 5AP6A 3F2AA 1DS5A 3MBLA 5D10A 4E5AX 5GJDA 2QOOA 2PMOX 2PK9A 3VQHA 2GHMA 4GK4A 1P5EA 3KULB 4NFMA 4YJPA 4C4GA 5JFVA 4DGMA 3S1HA 2UW4A 3EZRA 3ORLA 4JBQA 4X3FC 4FEXA 2R3RA 4FKJA 4IM0A 1PXIA 5BUEA 5DHJA 2RFSA 2VWBA 3GC8A 3SOCA 4ZZOA 3QWJA 3ALNA 4U6RA 4O7LA 3QA0A 4NJDA 4Z7GA 5LWMA 3IGGA 4FV9A 2O63A 3IK3A 4FZDB 3AGMA 4X6RA 3C4XA 1KE8A 1VEBA 3CIKA 3OT8A 3PP1A 3PSCA 4NKSA 4A9YA 4AN9A 4XV1A 3UMXA 4A9RA 2VN9A 4AN2A 2HY81 2X9EA 3W2PA 1J7LA 5C4LA 5BUIA 3A99A 2JKMA 2RL5A 1W2FA 2J0IA 1URCA 2E2BA 2W5BA 3AC2A 4DEDA 3ZDIA 1IA8A 3VNTA 4I94A 4EQMA 4NM0A 5EDQA 5HOAA 1U5QA 4GVJA 4MKCA 3VS0A 3UQFA 3D94A 5HG7A 2GU8A 1WBNA 4E4NA 3GQIA 3FZ1A 1M17A 4EH8A 1PXNA 2F4JA 3ODZX 3F5PA 2BRBA 5ETCA 2Q83A 3NIZA 3W0RA 4Y85A 2XVDA 1H1PA 3EQGA 3VF8A 1XMLA 1M7QA 3EFKA 4JR3A 2NPQA 5IA0A 2WPAA 2GHLA 4AA4A 4D9TA 5CU3A 4C4JA 2FH9A 2W96B 2YA9A 2R0UA 3MY1A 2WB8A 4ZIMA 3KN6A 3V5TA 3QF9A 1ZOGA 3SKCA 3AT4A 3R7VA 2LGCA 1JAMA 2XK7A 3NDMA 5AA9A 3E64A 2DQ7X 3EFWA 3AKJA 4WBBB 5AAFA 2IEWA 1S9IA 3VBVA 1ATPE 3HA8A 2R3LA 3OUKA 3ZSGA 4PF4A 4LOPA 2AC5A 3ZM9A 3CTHA 2LAVA 3FHRA 4M0ZA 4RG0A 4B0GA 3ATSA 4UYNA 4O4EA 3K54A 3FC2A 4IM2A 5HI2A 3GBZA 3MIAA 4YURA 3QD2B 3EN6A 4W8DA 4AT5A 4BDHA 1SVHA 3A4OX 3I79A 2XYNA 2CNUA 3VAPA 4D5KA 2QOQA 4X2JA 1V1KA 3VUKA 3BKBA 3FY0A 4TNDA 4OT5A 1YHVA 2I40A 4FTAA 3GC0A 5K9IA 3RTPA 4TT7A 3DJ5A 4FX3A 3VQUA 5DEYA 2E9UA 2VD5A 2GCDA 4AOIA 5IEYA 2PVLA 2ETRA 3MPAA 3O17A 4MBLA 3RGFA 3QX2A 4O2PA 3GEQA 3RNIA 4E6CA 4EK4A 5A4EA 5M4UA 3MJ2A 4L3LA 1RE8A 4KBAA 2XKFA 3PUPA 4PDPA 2B0QA 3CD8A 3MW1A 1ND4A 2ITWA 4BCKA 4O83A 3FHIA 4JMQA 4UMUA 4JNWA 4H05A 3AT2A 5HCZA 3CLYA 4IE9A 4QP1A 3R9NA 2XRWA 2RIOA 3EYHA 2CN5A 3PSDA 4BI1A 3FYJX 4RJ8A 3M2WA 2VGOA 3I60A 4JQ7A 3LFDA 5I9WA 2PZ5A 1FQ1B 1JVPP 1W2DA 4IC7A 1FMKA 2R7BA 4UBAA 4NM7A 4UXQA 3VS3A 4DBXA 3NMUF 4IAIA 3NNVA 3IO7A 4O82A 4QP4A 2BZJA 2O8YA 3DBEA 4GW8A 5CEMA 2YM7A 3PLAE 3HAVA 3C4WA 3MWUA 5CEQA 4I5MA 5AWMA 5JZJA 5L8KA 3DAEA 5D1JA 1PW2A 3UOLA 3ZFMA 3OCGA 5FBNC 3AQVA 4MXZA 3BE2A 3CTJA 1XMMA 4NYEA 4ZY6A 4AZVA 3MS9A 3QLGA 3NUPA 5CSWA 3HV5A 3TV7A 3QQHA 3ANQA 3MB6A 5FD2A 1G3NA 4D1XA 2XKEA 4MQ1A 2GQRA 4YTHA 3KK9A 3F69A 3KFAA 2ITYA 4C37A 4KIQA 3UNZA 3HVCA 3R30A 3G2FA 1YWNA 2ZJWA 3NR9A 1ZY5A 2WD1A 5CLPA 3R8ZA 3MESA 3FBVA 1Q62A 4MTAA 1WCCA 1WBOA 2BAQA 2X6EA 4TWPA 2XH5A 2CNQA 3V5QA 4RJ6A 4RPVA 5M4IA 4RGJA 3PLSA 4UMTA 1MRUA 3GU4A 4TN6A 4OLIA 2W0JA 1Q97A 3DBFA 3QTSA 4HVSA 1ZMUA 5C8MA 4FV2A 3TUDA 2WXVA 2Y0AA 3LMHA 4FL2A 3ORZA 2WOTA 2WQMA 2UZLA 4NKAA 3QQLA 2C3IB 4II5A 5LWNA 2B53A 1Y8GA 3KQ7A 4CKRA 4RFMA 2J6MA 4X3FA 3HL7A 4PPAA 2E9VA 5CU6A 4KBCA 2A0CX 2OFVA 1OMWA 1PXOA 3R02A 2QHNA 3DA6A 2C6TA 3A7JA 3RP9A 3LXLA 2J0MB 4WG5A 5AP3A 3QZFA 4EK5A 5AUXA 2JC6A 2YIWA 4AXFA 5IQHA 4L43A 4ZSEA 2J5EA 3D7TA 4BCNA 1H4LA 2ZB1A 2OBJA 2BFYA 3IECA 1SVEA 3DQWA 4EH2A 3MB7A 2V62A 3E93A 2R3NA 3ZRLA 4I23A 2YWVA 3FLWA 4RIXB 3OCBA 2NO3A 1CKPA 1WBWA 3QALE 1S9JA 4IX4A 4NUSA 4QMSA 2O64A 4TYJA 4AOJA 3TDVA 4DGOA 2OKRA 4QRCA 2EVAA 3V6SA 5A9UA 3QX4A 4HPTE 4ASDA 4PDYA 4R77A 4FNZA 3MFTA 2HZNA 3F66A 5AR8A 5IMEA 4V04A 3P86A 4ZMEA 5A4LA 3FEGA 3V04A 4DDGA 4OTPA 3TEIA 4I0TA 2Q0BA 4OTFA 5J87A 3RPRA 1GZNA 4BKJA 4YTIA 3COIA 3D2IA 5A3XA 4CLIA 1OI9A 2E9NA 3OVVA 4FKRA 4PL4A 5FQDC 5FP5A 3VW6A 5E4HA 3OF0A 3FMKA 4XV2A 4H3QA 4HYIA 4C3PA 3FZSA 2CCIA 4L68A 5DN3A 3DJ6A 4MBIA 4AZTA 2JFMA 4EZ5A 3G51A 2B4SB 3S4QA 2ERZE 3W0MA 2WOUA 4QMPA 3D7ZA 3BYVA 2HAKA 2ZOQA 2JFLA 2BTSA 3E62A 5BVKA 3UVQA 5C8NA 1BLXA 3W0OA 2NYAA 5ITAA 4B9DA 2QNJA 3VS2A 2A27A 1PKDA 2F7XE 3ORNA 1WBTA 1OL1A 3V6RA 2CLQA 3GOKA 4X6QC 3BLHA 1DI8A 4O2ZA 1O6KA 3M1SA 4BDCA 4ANOA 4O0XA 1Q8WA 1WVXA 5J9LA 5IKWA 4QTBA 2BHEA 4FZFB 4BFMA 2PMLX 4UZHA 2EU9A 3GCUA 4FSUA 4Z9LA 3KU2A 4UWBA 2ERKA 5D7VA 5EFQA 4BCHA 1GIIA 5I4NA 4QYFA 4LG4A 2WQEA 2YM4A 4I41A 3FSFA 5J5SA 5AR3A 2W1IA 4IW0A 4A7CA 2ITZA 2YIYA 1X8BA 1M2RA 4XX9A 2FSLX 3R71A 3NAXA 4BDIA 2W7XA 4LOOA 2RF9A 4YGAA 2VWYA 1ST0A 3WE8A 4EH9A 5HGIA 3IGOA 3TL8A 5M55A 4NM5A 4USDA 3HV6A 4E8AA 4DLIA 2YDKA 4FIEA 5EKNA 1YOJA 3D15A 4FSMA 3UDTA 4GFGA 4EHZA 4E3CA 3F3VA 3LLTA 4CFVA 2GDOA 1Q24A 1IEPA 1B38A 3RZFA 1BYGA 3KK8A 1J1CA 1O9UA 2V22A 3PJ2A 5HX6A 5JGDA 4WG4A 5L2WA 5CTPA 4RX7A 3PA3A 4FL1A 3RPSA 5HNGA 3UQCA 3WF7A 3F2RA 5EI6A 2VTJA 5GJGA 4EH5A 3FZTA 3PUFC 4RVLA 4EYJA 1YOMA 3KY2A 2ITNA 2WTWA 5ACBC 4O81A 4MD9E 4QQCA 4N6YA 2QHMA 2PL0A 2V55A 3LFBA 3ACJA 1XBBA 4QT1A 4HVDA 4YMJA 1OKZA 2ETKA 1GIHA 2R3PA 1V0BA 3RALA 3R2BA 2WGJA 4YJRA 3KMMA 3UP2A 2PVNA 4ANMA 2ZV9A 3KRLA 2PTKA 3OXTA 3VJOA 4QMZA 4EOQA 1YXUA 4M13A 2GNGA 2EXEA 5AEPA 2B9HA 3OZ6A 3PIYA 3VULA 2XNPA 1OGYA 5BYYA 2C1AA 2Z7RA 4ZJIA 4J52A 4DFZE 2VTPA 4IB3A 3LCSA 3QUDA 3LMIA 2XBAA 3KXZA 3ZLWA 4N70A 4AT3A 1P4OA 3DNDA 5J1WA 2YN8A 3AG9A 3LPBA 4G17A 4NZWB 1G8JA 1ZMVA 3CC6A 4JAJA 4DE4A 2ZV8A 3SQQA 2PZIA 2O3PA 3ZC6A 3KN5A 4IX6A 4M8TA 3W16A 3HV4A 3H0ZA 5IA1A 1OVEA 2C6MA 3ZCLA 4I6QA 3UG2A 3L9NA 2WMUA 4JDJA 4PNKA 3G33A 3NYXA 5CAPA 2IG7A 3R9HA 5IQAA 2PMIA 5EHOA 1P14A 4PDSA 4OTDA 1GOLA 3EFJA 2C6IA 3QQFA 5TF9A 3ZMMA 2ITXA 2QR7A 4ZTMA 5IEVA 2VTRA 3BU6A 3FE3A 4FYNA 4AGDA 3GCPA 4CV9A 2YDJA 1KE7A 4F1TA 2VO3A 2R3MA 1PXMA 2IVSA 2P0CA 3GU6A 3ZXZA 1GZ8A 2HXLA 4F9BA 2EXMA 1PXLA 5LVMA 2A98A 2XBJA 3R1QA 3Q4UA 4IBMA 4RA5A 4Y8DA 1KV2A 4FZ6A 2JEDA 2GMXA 2YCFA 3H9RA 4TXCA 4XS2A 1ZZ2A 4ZLYA 3BHTA 3COKA 3HMMA 3FLZA 2WTCA 1OL5A 5HESA 5M08A 2WMSA 3Q04A 4O7ZA 2ZM1A 4QTAA 4C4IA