3ORZA

Pdk1 mutant bound to allosteric disulfide fragment activator 2a2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
276
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFCFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Turning a protein kinase on or off from a single allosteric site via disulfide trapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase activator
molecule keywords 3-phosphoinositide-dependent protein kinase 1
total genus 89
structure length 276
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3orzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3orzA01
4JOAA 4FSZA 4ZSJA 4F7LA 4XNEA 3O51A 3HUCA 4O6LA 4V0GA 4GJ3A 2E9NA 3P7CA 4FIJA 2H9VA 3IONA 3TEIA 5DMZA 3MA6A 3QU0A 4AX8A 3FZ1A 2W0JA 3H0YA 1OPKA 1WBVA 3ENMA 1HOWA 2B9JA 3F3TA 3II5A 4RJ4A 3QUPA 5CY3A 5DH3A 3BYOA 4QMOA 1ZMUA 1ZOHA 2E9VA 2WMQA 3R00A 4GT3A 3LE6A 4MTAA 4YJUA 5A46A 2F4JA 1WBOA 3L9LA 5A6OA 3LPBA 1J7UA 5HORA 2QOLA 2QVSE 3F5PA 3MPTA 4XG8A 4YSMA 5H9BA 3C1XA 2FO0A 4RVMA 3WF8A 1OKVA 3TZ9A 2C0TA 4KKEA 4N6YA 4B9DA 5K4JA 3RHKA 5G6VA 4RX5A 2EXEA 2GQGA 3F69A 1PKGA 1CKPA 3HV7A 4FV4A 3VO3A 3WF5A 4DG2E 2ZOQA 4OTDA 3WE8A 5IKWA 3FAAA 4NIFB 5HBJA 4MD8E 3TCPA 1FPUA 2R3RA 3BKBA 5EI6A 2AC5A 5FTQA 4L9IA 4QYHA 5KKRB 3R2BA 5J9LA 4BDJA 2WQOA 4CYIA 3HMNA 5E7RA 1ZXEA 3C4CA 3CPBA 3PLAE 5AX9A 3TUDA 5BYZA 3A7IA 4EH3A 2PUUA 4N57A 4ALWA 1YXUA 4ZTSA 3VN9A 4E6AA 5K0KA 2AC3A 4BTFA 3NNXA 4BCKA 2GCDA 2C5VA 3DBFA 3U6HA 3DT1A 3MFUA 3RK5A 3TZMA 4NKAA 2YDIA 4AWIA 4L53A 2VWVA 4IDVA 5M07A 4G9RA 3IDPA 4XH6A 1RE8A 2W06A 4O0VA 4DEIA 1V0PA 4F99A 2JKKA 4IB5A 4R8QA 4G2FA 4XRJA 1GZOA 5DOSA 2V22A 3VJOA 4J52A 5FG8A 4C4FA 4G5JA 4AN3A 3UIMA 2RL5A 2YDJA 4OAUC 3POOA 4BI0A 3O71A 5A14A 4QT1A 2QCSA 4Q2AA 4RZWA 4RVKA 4ZTNA 2PK9A 4I6FA 4OTWA 4O27B 3TDVA 4XBRA 4BDDA 2C0IA 3CTHA 4UYAA 4XEYA 3G33A 3Q52A 2EWAA 2BAKA 3BU3A 4WG3A 5AP3A 3R0TA 5LQFA 3PVBA 3QKMA 3T8OA 5HE2A 3ZSGA 3F3WA 4O86A 4Q9ZA 5J9YA 1A48A 3R71A 5TF9A 4JS8A 4DC2A 2C6MA 3OG7A 5HICA 4G3FA 4YC6A 4EQCA 3FMHA 3UNZA 4XRLA 1FGKA 4QTDA 2UW0A 3WF7A 2HIWA 4PPAA 2WTIA 4AFEA 2O65A 2PE0A 3A8XA 4KA3A 5IQEA 3SV0A 2KTYA 3OTVA 3P79A 3VS7A 3MVLA 2V5QA 5FM3A 4IAIA 4M13A 2R3FA 3TV4A 2YM5A 2ZJWA 3LVPA 4JX7A 2JDVA 2PMLX 4D58A 2V7OA 5E90A 2Y0AA 1U5RA 4IHPA 4M12A 4TTHB 3KVXA 1J7LA 1TKIA 3VBXA 5LWMA 4BF2A 2QOOA 4CQGA 3UODA 4F9AA 4E6QA 4CZYB 4BFMA 5M4UA 2QG7A 2J51A 3LMIA 5DNRA 3HV5A 5HVKA 2EB3A 3SOCA 3DDQA 4YMJA 4BTJA 1Q8WA 3EIDA 4DTAA 2OO8X 1XR1A 2CHLA 3IGGA 3PLSA 2PVFA 4X2JA 3SVVA 5HD7A 3W8QA 4FK3A 1KE7A 1Q24A 3NNVA 2O3PA 1R3CA 4ZS4A 5TT7A 4M97A 1UNHA 2ITTA 3KXMA 3QTRA 5CVFA 2G2HA 3QHRA 4KB8A 5CU4A 3BGPA 1FVRA 4GUBA 2WMBA 4LV5A 4B7TA 2CKOA 1SVHA 4FTKA 2P2HA 4FV0A 3BQCA 4Y95A 3JR1A 2XNPA 1KE5A 2BZIB 4KBAA 2X8EA 4CMTA 5JQ8A 4C4HA 3KN6A 1G8AA 3E3BX 4S31A 4V05A 4ZSEA 4ALUA 2UW7A 5EI2A 2WMSA 4ZTLA 3QRUA 2UUEA 3HL7A 4BC6A 1H1SA 4IX5A 5K5XA 3MDYA 5ETFA 4AN9A 5C4KA 1PXLA 4EC9A 3KMUA 2UZNA 2W1FA 2XYUA 3F3UA 3NUYA 3DNDA 1K9AA 3QTUA 4X7QA 4YJSA 3MY1A 2JDOA 3Q5ZA 4F0GA 4IH8A 2VO6A 3VUTA 5B0XA 1KE6A 3QX4A 3VS1A 4RC2A 3OWJA 4FICA 2JFMA 3E3PA 1OVEA 4WUAA 3WARA 2X7OA 3R6XA 4QMUA 4QTEA 3NYXA 4EBWA 4ZY5A 2UZEA 3CP9A 1LEWA 1Y57A 3SGCA 2XK7A 4F6UA 2JDRA 1HCKA 3FJQE 3ZO1A 4GCJA 2I0VA 3BYUA 5KMOA 2WZJA 1KOBA 5HBEA 2XJ1A 3EN4A 3NS9A 4PMSA 4J8NA 5JQ5A 3PJ3A 2IPXA 2DWBA 4I22A 4RIXB 3FXXA 3UIUA 4LUDA 5A6NA 2C1BA 4X2NA 2XNNA 3KRRA 4QYEA 3NZ0A 5AV0A 4K9YA 4DN5A 3LLAA 3FLNC 1OIUA 1BL7A 2WQNA 3BBWA 3MJ1A 5BVEA 3KK8A 3NDMA 4AE6A 4BZDA 4UB7A 5E8YA 4A4LA 4A4XA 5JZJA 2R3OA 4XP0A 3FPQA 3AG9A 3BV2A 1UKIA 4ANBA 3AC1A 3QGYA 3O8PA 1BUHA 1NA7A 3RPOA 2WMAA 1SNXA 4KIOA 4JDJA 5E91A 4DEDA 4HVGA 4NW5A 3KXGA 4M15A 4H3PA 4NEUA 5HO6A 2HENA 3VS2A 1MRUA 2XK6A 1O6YA 4IAFA 2XIRA 3W2CA 2REIA 4FOCA 5I5ZA 1WBTA 2C3IB 3BRBA 5IA3A 5CEQA 3R7YA 5EKOA 1PJKA 1K3AA 2NPQA 2BZKB 3DBEA 4JVGA 2G01A 2JIVA 4PMMA 5BUEA 3VUGA 3JXWA 1PXNA 2QOBA 4RBLA 4FL1A 5JFXA 2X8DA 4J71A 2BAQA 3NX8A 2V0DA 4DGNA 4LRKA 5BVNA 2CGWA 3TKUA 3DY7A 1YKRA 2VTTA 4P5QA 4FKQA 1JKTA 3EH9A 2XRUA 3MSSA 5EW3A 2Y9QA 5AR5A 3LXNA 3UZPA 2IVSA 5HLNA 3FBVA 1AGWA 2OJGA 4RT7A 5EM7A 5LVLA 3DTCA 4Z16A 2J4ZA 5CI7A 4JDKA 2V55A 2YZLA 2PE1A 1R1WA 3A4OX 4DFBA 4BGHA 4XX9A 3ZBFA 2OGVA 4U79A 5DEWA 4D2RA 3EL7A 3PWYA 2C6LA 5LARA 4M0YA 1E1VA 3PVGA 3NGAA 3RNYA 3SLSA 3TT0A 3BEAA 4AXAA 4PP7A 4O0UA 4IAAA 4Q9SA 3QD2B 1OGUA 1QPEA 3AMYA 1XBCA 2OIDA 3QZIA 4GYGA 1H00A 5KKRC 3T3UA 3EQFA 4QQ5A 4S30A 4ZS0A 5A4QA 3VNTA 1M52A 3AOXA 1OPJA 3OBJA 4XV9A 1PXOA 3C4FA 4WSQA 1F0QA 2R3GA 2CN8A 3EQIA 3OXTA 2LGCA 4HNIA 4FNYA 2WD1A 3KKVA 4RWKA 4EOLA 4U80A 4BCHA 3DJ6A 5IZFA 4MQ2A 5L2QA 2GNHA 2PE2A 2ERKA 3VF9A 3JPVA 5IA1A 4IWOA 1BKXA 4N70A 1DI8A 4XG3A 3RM6A 3VIDA 4NYEA 4D55A 2OJJA 4FUYA 4O84A 1UWJA 4KRDA 3TI1A 2GTNA 3VULA 4YU2A 3RI1A 2P33A 1YVJA 1LEZA 2GHMA 1LR4A 2VWBA 3NUPA 4F7SA 4FZDB 3I1AA 3LFAA 4HVIA 5J5SA 5FQDC 4E4NA 3KRJA 4V0GB 3O8UA 5JN2A 2PULA 3BV3A 5EW8A 3C4WA 1BI7A 2GTMA 4AA4A 2WKMA 4ENXA 5BVKA 1NY3A 4YBKA 3CY3A 2BHEA 4C33A 4JDHA 5BVFA 1YHWA 2EXCX 3DJ5A 4YTFA 2I0YA 2XM9A 4HCVA 2YJRA 2F57A 3MA3A 2UZBA 5D11A 5CF5A 3ORMA 4ANSA 4DFUA 1P5EA 1CDKA 3D7TA 4LUEA 5HKMA 3LCSA 3GUBA 2F9GA 4M66A 3F5UA 4S32A 2YLEA 4BCFA 4NCTA 4ENYA 5E8VA 3KXHA 3MH1A 4TYHA 3QRTA 3TKHA 3ID6C 4JIAA 1P4FA 1ZOEA 4J99A 1YI4A 4JRNA 1RW8A 1ZYDA 3PE2A 5AR7A 3LXLA 3HRBA 5E92A 5AUTA 3EMGA 3S1HA 4M69A 3N51A 1M7QA 3RPRA 2VO7A 1UWHA 3M1SA 3V5QA 2I1MA 1ATPE 5E8TA 4CFUA 2CSNA 2FSOX 2IW8A 1H24A 3ZLWA 4DGLC 4NFMA 4EKLA 3KXXA 4ID7A 4U0IA 4DF3A 4L46A 5M08A 2O2UA 4YURA 1MQBA 4F9CA 4BBFA 3VS6A 2XCHA 3KU2A 4HGTA 2VTQA 3V5WA 4E4XA 5CAPA 3QCXA 4K18A 3PIYA 4IMYA 4BDAA 4O7SA 4XBUA 3OD6X 3HGKA 2VTHA 4OR5A 5JFSA 3G6GA 3OFMA 4R3PA 3ULIA 3IK3A 2R9SA 3VC4A 5L8KA 4FKGA 1UV5A 4G3DA 3RGFA 5EYKA 2VWYA 2Z7QA 4FT9A 2QU5A 3P5KA 4JRVA 4EUUA 3C7QA 3A4PA 5EHYA 4AOIA 1CKJA 2UZUE 2CKPA 1Q61A 1KE9A 4GH2A 4FKPA 3U9NA 4BTKA 1IA8A 2XIZA 5EDRA 3QAME 3VHEA 3FZOA 2RFNA 2ZYBA 3R9NA 4FVPA 1YXTA 5M57A 2ITPA 2P55A 4IWPA 4MCVA 5FLFA 1ND4A 5FTGA 5CI6A 4IC7A 3KK9A 1H1PA 3ZLXA 3H30A 4YBJA 5ANIA 3CY2A 3GQIA 3OOGA 2ITQA 3L9MA 1P14A 3MVJA 3Q9ZA 5KHWA 3D5XA 1M2QA 2JAVA 4LL0A 4YZBA 3UP7A 4A9SA 2XRWA 4BWKA 3PA5A 4ZSGA 4E4LA 4LL5A 1YWRA 1G3NA 3ZMMA 1W83A 4FEVA 4XG4A 2IZSA 4R3RA 4CFFA 2XH5A 4L8MA 3VUKA 2H34A 3QZFA 2W4OA 2R7BA 2B9IA 4MNEB 4X2KA 2WXVA 2UZLA 1UU3A 3Q96A 4YZMA 4TWCA 3DB6A 1JKKA 2W9ZB 4DGGA 4USEA 3FC1X 4FTUA 4MD9E 3VS0A 4TNBA 5CAOA 5JFWA 1Y8GA 4XV2A 5DYJA 4XG9A 5FD2A 3COHA 4O0TA 4GFGA 4DH7A 5BYYA 1U59A 2NP8A 2CMWA 3NYOA 3QGWA 3TM0A 3Q4TA 3FKNA 4IM0A 4QP4A 4RFYA 4UZDA 4RZVA 4YJPA 4BDBA 4IJPA 3FMNA 2G1TA 1YW2A 5IA2A 4D4SA 3IOPA 2BILB 2XKEA 3SKCA 2VD5A 3LFDA 4F6SA 3D7ZA 3GXLA 3R04A 4I6HA 3I81A 4BDEA 4PY1A 3KXZA 4YHJA 1SNUA 2YACA 4OTGA 1WAKA 4ANLA 5IF1A 2XKCA 4GT5A 4JR7A 4LGGA 5FRIA 2QHNA 3HLLA 3W2QA 4J95A 4E3CA 2WMXA 2B4SB 4UV0A 1FBNA 4RX7A 4F63A 1PYEA 2OH4A 2ITVA 3QD0A 3SHEA 4RMZA 1XH8A 4E7WA 3F3ZA 4GYIA 4NIFA 4XCUA 4B0GA 2OXXA 4YTIA 2B53A 1ZWSA 3PPKA 4KD1A 4LGDA 1OI9A 4DEAA 3N4VA 2YIRA 2OIBA 4X2GA 3RVGA 4AACA 4E6DA 5IEXA 5AP4A 3DTWA 3D9VA 4I21A 4ZMEA 4OTRA 4I20A 2R64A 2R3HA 2JEDA 3ZO2A 4BCOA 3TNWA 2XYNA 2UVXA 3RAIA 4F9BA 4QNYA 5KMIA 3ZZWA 5TKDA 4FIEA 4FV7A 5AV1A 4YZDA 4BCQA 1MRYA 4KS8A 5HNIX 1CTPE 3K2LA 1L8TA 5F4NA 1NVRA 2OF2A 3EOCA 4J98A 4C35A 5A4LA 5HCYA 4GVAA 5HX6A 4A4OA 3BZ3A 1F3MC 2PWLA 3Q9WA 5ETAA 4K2RA 3U4WA 2A0CX 2XVDA 4BI1A 5AA8A 4O7YA 2UZDA 2QU6A 2R0IA 3LJ1A 3C51A 3TTJA 4KUJA 1NVQA 1OUYA 4LG4A 4DEHA 3CIKA 1XBBA 5HQ0A 5CU2A 5AUWA 3ACKA 3KVWA 3ODYX 4IWQA 4LMUA 4TYHB 1XH4A 5E8WA 4O38A 1GZKA 3MVHA 4AOJA 5DI1A 2ITOA 4ZEGA 4X6RA 4FTRA 4MXZA 4O83A 3SG8A 3QTQA 1YHSA 4CZUA 4F65A 2YDKA 3PG3A 4UWBA 3A7FA 4QP6A 4FG8A 4A7CA 2W05A 5GINE 2CKEA 4F64A 4DH3A 5DR9A 3LFBA 4X21A 4PPBA 4BGQA 1S9JA 3PVWA 5JGBA 2VGPA 2PZYA 5D9HA 2VTSA 3BI6A 4PDYA 3PRFA 2OIQA 4BKJA 4O81A 3FMMA 3FHIA 2YM8A 5EH0A 2I0EA 2ITXA 4DH5A 4N0SA 5CS6A 2W1HA 4I92A 2C3KA 2BZHB 3NAXA 3KB7A 5IUIA 4L52A 2C6IA 5GZ9A 5IDNA 3ITZA 4FKSA 2GNIA 4FKUA 5E4HA 4H3QA 4O0RA 5J79A 3COKA 4EWHA 3OP5A 4QO9A 3KMMA 5ETCA 3FQEA 4X2FA 3R7OA 3RWPA 3ZUTA 4AGCA 4AZTA 1AD5A 3MFSA 4C36A 4ZLOA 3PXRA 3OWKA 3GOPA 1PRYA 3NEWA 2VAGA 2QG5A 1XHAA 3KN5A 2WGJA 2VTIA 3VBYA 3EQPA 1T45A 4ZZOA 3PXZA 2QURA 1FMKA 3UO4A 2J9MA 3HMIA 3KL8A 3KXNA 4DYMA 2R3IA 4C4IA 5L4QA 5J1WA 3L9PA 4ORKA 2B54A 4UY9A 5AAFA 3L9NA 4BL1A 4RWJA 5KMLA 3EYGA 5HG8A 4M0ZA 5HE1A 5CQWA 5AP6A 2JKOA 2WB8A 3F2AA 4C2VA 3UMXA 3FWQA 3GU5A 1WBNA 1XH9A 5A4EA 2O0UA 2OBJA 2OJIA 4YLKA 3AQVA 3Q60A 3LMHA 4MX9A 3E7OA 4K6ZA 2ITWA 5FXQA 2GFCA 1Y6BA 3V5PA 3KQ7A 5FWKK 2WHBA 3O8TA 5C01A 1YOMA 4RJ6A 4D4RA 4AZFA 3PY0A 3GU7A 2B0QA 3ZRLA 2PVMA 2UW9A 4FKIA 5JT2A 4FSQA 2YHVA 4ZZMA 5IH6A 4JAJA 4MVFA 4D0WA 3ZUVA 5AUYA 1W8CA 4LRMA 5AP5A 3KF4A 4QPMA 3N4TA 4N6ZA 4L68A 4IZAA 3BLQA 2WMVA 3WILA 2YIXA 3SW7A 1FGIA 2XZSA 4BGGA 5B2MA 4G34A 1FQ1B 5AUUA 3V8SA 2C5OA 4FV5A 4G17A 4EH6A 3C9WA 1OKYA 2UV2A 1SMHA 2Y4IB 1DS5A 1PY5A 3LCDA 4FBXA 5HBHA 1IAJA 4APPA 3NUAA 5I4NA 1BL6A 1BLXA 2UZWE 4JI9A 3UDBA 2B7AA 2WU7A 3QXOA 3QZHA 2BRNA 3WF9A 3FLZA 3RPVA 3LFEA 2XIXA 4OT6A 4D5KA 3QL8A 4BBMA 4PDOA 3H4JA 4FI1A 3UGCA 4F0IA 3UOHA 3ZM4A 3R83A 2JIIA 4GKIA 4DH8A 3HECA 4X0MA 5FP5A 3D5WA 3VRYA 3LM5A 4UMUA 2YN8A 4ZSAA 2YISA 4IB0A 5FEEA 4JDIA 1JQHA 2CGUA 4UMRA 4CFWA 5EHOA 3TNQB 3I60A 1OKZA 3U6IA 1F5QA 5H2UA 4OBPA 5HTCA 4J8MA 4RQVA 2OJFE 4ZJJA 3NUNA 4O7LA 4J1RA 1W84A 4CLJA 2R3JA 2XEYA 3R2YA 3TUCA 4IM3A 1WVXA 4RLLA 4PL5A 2VX3A 3ANQA 4D2TA 3WOWA 4WKQA 4HVSA 1BI8A 5CSWA 4Z7GA 1NT2A 5CEIA 2WMUA 1O6LA 2BRMA 5AMNA 5CF4A 2YFXA 3H9FA 3W2RA 1GJOA 4FSUA 2UW5A 4L00A 1SYKA 4TZRA 3V8WA 1SM2A 3BIZA 2BTSA 3PXFA 3LMGA 4Q5HA 4ZOGA 2C6KA 2HWPA 5GZAA 4NUSA 4CZTA 2VV9A 2ONLC 3ROYA 4L6QA 2XK8A 4FMQA 4ZTRA 3VW6A 3IDBA 3W16A 3GU4A 4D2WA 4ACGA 3QQLA 2XF0A 2EB2A 2JDTA 4DGOA 3UVQA 3FI3A 4TYIA 4HVDA 2JLDA 1JSVA 3UOKA 4ZTMA 1ZAOA 3KGAA 1J1CA 4E8AA 3RCDA 1PXPA 3BLHA 4FL2A 1O9UA 3P4KA 3SW4A 3ZO3A 5IQIA 2XK4A 4OTQA 2Q0NA 4UBAA 3ZRMA 3PIXA 5A4TA 3A99A 4CKIA 4FF8A 2BFYA 5LVMA 3OWLA 5AEPA 1ZYCA 5I9YA 3EFWA 3EKNA 4R3CA 3QLGA 1LUFA 3BLRA 2XKFA 4WNKA 3FLQA 4FTNA 4NJ3A 3ZC5A 4FEWA 4ACCA 4G31A 5ANKA 3BX5A 4HCTA 5IISA 2RG6A 4LMNA 1U54B 3LFSA 3ALOA 1CSNA 4QMWA 2IZTA 4G16A 5HU3A 3DQXA 4WO5A 3FXZA 4TWOA 2BZJA 3WZDA 3CKWA 4BBEA 3IW8A 5TO8A 3ATTA 2WTKC 4JIKA 2FVDA 2YCSA 5A3XA 3OWPA 1FVVA 3LQ8A 3GENA 4QMYA 4WRSA 1Y6AA 3PVUA 3FYKX 2FA2A 4YR8A 2YM6A 2AUHA 1YWVA 2G2IA 1CM8A 3ALNA 3EL8A 4I24A 4QMTA 5L2WA 3UNJA 5CXHA 3R8PA 3HDMA 3B8RA 5CNNA 2HZ0A 5J5TA 2HWOA 4RIWA 5CANA 3MFRA 5AJQA 5J9ZA 3O2MA 4NM7A 3F82A 4GRBA 5CEKA 2HW7A 2C47A 4RX9A 2RSVA 3NYVA 4LRJA 1ZYLA 4NTTA 4M69B 4O0WA 2VNWA 3RTPA 3OW4A 3ZC6A 3SOAA 4QMPA 2OK1A 3Q53A 4EZ7A 5LMKA 2QC6A 4D1XA 4O1PA 1FOTA 3G0EA 2WTJA 3FSKA 4BB4A 2VTLA 3IOKA 3PXYA 3QTSA 4UWYA 1U54A 5DT4A 5E1EA 4BHNA 2YCFA 4EOQA 3ZUUA 4O0SA 5DEYA 1Q62A 3RJCA 4FOBA 5AP2A 3OXZA 3TDWA 5DA3A 2W96B 4FKLA 2VN9A 5CT0A 3ZXZA 4EORA 3QUEA 5DGZA 4ZK5A 5T3QA 4IEBA 3CC6A 4FV3A 4J53A 4FNWA 1STCE 5HTBA 3LHJA 3C0HA 2O8YA 2NNWB 4QP1A 3NPCA 2QO7A 3RPSA 3V3VA 4JQEA 3HRCA 2RGPA 5KO1A 4CVAA 1Q3DA 5AWMA 3IW5A 4ZTHA 2WOUA 3PZHA 3HDNA 4TXCA 1YRPA 2QI8A 4IX4A 4JG6A 4JT3A 5JMSA 4RIWB 2YCQA 1A06A 3OT3A 4G9CA 2UW3A 3EN7A 5H8GA 3Q4ZA 3SAYA 5LVNA 5M4CA 3MJ2A 4FZAB 4WSYA 4UMQA 3DFCB 2CGXA 4DEGA 4MNFA 1OECA 2B9HA 2BALA 3QQHA 3ZDUA 4WBOA 4L45A 3DKGA 4FZFB 3FZPA 4BCJA 4AN2A 4ZAUA 3Q2JA 4WNPA 4QP8A 4AZWA 3RWQA 5EM5A 1QPDA 1UVRA 4HYHA 5L8JA 3MPAA 3VBQA 4EH7A 1EH4A 2ETRA 5IG1A 1PXKA 3PSCA 3EJ1A 1Z9XA 5T6KA 3CJGA 4XLVA 5KHXA 4II5A 3FLYA 3H3CA 4L7FA 4UYNA 2XA4A 5DT3A 4EBVA 4L42A 2YITA 1PMUA 3VUMA 4NKSA 3MBLA 4QP3A 3LQ3A 3EQHA 4PTCA 4BRXA 3DKOA 4AFJA 4XUFA 2DYLA 1PXMA 2H8HA 4BCPA 2J5EA 3CGFA 4ZY6A 3DZQA 4CFVA 2I0HA 3UZTA 4U43A 2QLUA 4P90A 5CZHA 4EKKA 3K5UA 3W8LA 2HY81 1OITA 5LOHA 5JGAA 5IMEA 3W2PA 3SA0A 2PZPA 2XK3A 4FKWA 2G15A 1PMNA 1R78A 3BYVA 1BYGA 3TUBA 2WMTA 5CX9A 3AC2A 4UZHA 4DEEA 4TN6A 4FV6A 3OCSA 4JNWA 2PHKA 4NFNA 4O2PA 4UXLA 5D1JA 5E8UA 3R8VA 3RKBA 1ZLTA 2W1ZA 2XNMA 3F5XA 5B2LA 1RJBA 3O23A 4AS0A 4IW0A 4YGAA 5AP1A 1PHKA 4KSQA 4PV0A 3NW7A 1OIYA 4FT0A 3DGKA 5M51A 1OIRA 3Q4UA 5IDPA 4FTCA 2QODA 4FTOA 2OU7A 1DAWA 4CTCA 2GS7A 1WMKA 2R3QA 3JVSA 5DBXA 4YUQA 4IWDA 4B8LA 3DXNA 2OH0E 4MNEA 3P78A 3NYNA 3L8PA 4L01A 4CKJA 3PJCA 5C27A 5EYCA 2R4BA 3MB7A 4MBIA 3CE3A 3PSBA 3D5UA 2FSLX 5K5NA 1YDTE 3GCSA 4EK8A 4FIFA 4F7NA 5ITAA 4CFXA 4E73A 4XMOA 5KX8A 4GJ2A 4ITIA 3RZBA 4TKSA 4B6LA 2ZV8A 5LCJA 5LVPA 4F70A 4MF0A 4HGLA 4C0TA 4DA5A 3D5VA 3OEZA 4GVJA 4DCAA 3R9RA 2VZ6A 2Z60A 1QPJA 1VEBA 3P08A 4LM5A 1WBSA 1YXXA 2BDJA 3QTZA 4OTPA 5KZ0A 2PZ5A 3RNIA 4K0YA 4R6VA 2YM4A 1LP4A 2CLXA 2WFYA 4DG3E 2WEIA 3T9TA 3D4QA 5TR6A 5I9ZA 4AT5A 3EQCA 2FSTX 5M53A 2XIKA 3OZ6A 4Y5HA 2GSFA 3TWJA 3NUSA 4O1OA 2RFSA 3UG2A 3LFCA 2JBPA 3UOLA 3R22A 4QYYA 2ZDUA 5FP6A 3VBVA 3Q9YA 2OF4A 4ZXTA 3ZTXA 5HO8A 4W9XA 1T46A 4L44A 3PG1A 4YHTA 2XNEA 4PMTA 4E5AX 4C4EA 1FMOE 1WBPA 5E9EA 5EYDA 2BVAA 2OFUA 4WNMA 3OUKA 1YWNA 3NWWA 3ZYAA 3P9JA 3LLTA 4AE9A 4FSRA 4ZMFA 2C3JA 1JNKA 1E1XA 4R7HA 5HTIA 1KSWA 2PU8A 3WIGA 4GSBA 4IQ6A 3OXIA 3R02A 3OCTA 4S2ZA 4J7BA 4G6LA 5EDPA 4FYOA 5HNBA 4KKGA 3WE4A 5EHLA 4RJ5A 3OUNB 4PP9A 1URWA 3NUUA 1HCLA 4IJ9A 3TV7A 4DCEA 3HMMA 2W1GA 3MGYA 5AP0A 2CCIA 2CNQA 3I7CA 4F1OA 3O7LB 4TYEA 2WTWA 3FMEA 3LIJA 3NRMA 3W32A 4C34A 1VYZA 1H25A 1WFCA 2IZUA 4WIHA 3GU8A 5L3AA 3DK7A 4M3QA 2G2FA 3W2OA 3K54A 3LCOA 2VTPA 3FKLA 4CCBA 3NNWA 5D41A 4D4YA 5FTOA 3DJ7A 4C7TA 5HE0A 1GOLA 2QNJA 5F95A 3V6RA 4I6QA 3NVMB 5HHWA 4YJTA 3UTOA 5IEYA 5KNJA 2Q0BA 1H8FA 4CRLA 5LVOA 2I7QA 1U4DA 3E5AA 5IU2A 3WYXA 2Z02A 3FZRA 4YP8A 3CPCA 3FXWA 3C5IA 2QR8A 4FSTA 4CRSA 2JBOA 2HZNA 4QNAA 3OVVA 3UG1A 3VF8A 3NSZA 3EQRA 3R1QA 4RVLA 2HK5A 3D15A 3ZBXA 1OL5A 4PUZA 4ITJA 2PZRA 3F7WA 3MH2A 3PA4A 3V8TA 4AA5A 5IA0A 4AW5A 4EK5A 4D1SA 1B6CB 2YJSA 1JSTA 2GPHA 5GZ8A 5I9WA 5L2SA 4EHEA 5JEBA 3C4XA 4C3RA 3Q2MA 3FDNA 3MPMA 3DBQA 1OUKA 2J7TA 3BEGA 4IB3A 3A61A 1APME 1XH7A 4FC0A 4OLIA 3W18A 3VUHA 4DLJA 4QMQA 4OAVB 1FVTA 4DFNA 1VYWA 4WNOA 4YC8A 5M09A 4BN1A 2BTRA 2NRUA 4ZIMA 4EEVA 4PTEA 4A9UA 3CEKA 1WCCA 1YDSE 2XP2A 3AD5A 2QKRA 3FSFA 3MWUA 2HCKA 5DRBA 3I5ZA 2CLQA 4FKOA 4BY9E 2PVHA 2YIQA 2Z8CA 3FUPA 3I4BA 1KUTA 1OB3A 5IMXA 2CKQA 5DIAA 2GFSA 3FLWA 4XJ0A 4XP3A 3UP2A 4QPSA 4ANNA 4X3FB 4WOVA 4AF3A 3AGLA 3DLSA 4M67A 3TG1A 2DS1A 2XKDA 1V0BA 4NH1A 3OT8A 4FZ7A 4YC3A 3GC7A 4RG0A 1G8SA 5AM7A 2Y7JA 3SRVB 2BRBA 2XJ0A 2WTDA 5AAGA 2PPQA 2QONA 4EOJA 3R9HA 2X39A 5GJDA 4CSVA 4FTQA 4TWPA 5DHJA 4FG7A 5GIPE 3FMLA 2J0IA 4GL9A 3LXPA 5I9UA 5CTPA 4KBCA 3AC8A 2VTMA 3K3JA 3ORZA 3HUBA 1JSUA 4JG8A 2OW3A 2IN6A 4IC8A 4NZWB 1U46A 2NO3A 4W8DA 5D10A 1K2PA 5CU6A 4O91A 4PNIA 2XJ2A 3HA8A 2BKZA 2ESMA 3BYSA 3FLSA 3QHWA 2J0LA 3AGMA 4OTIA 4WUNA 3ELJA 5D12A 3ZXTA 3MIYA 4JAIA 3ATSA 2C5NA 1ZY4A 3FI8A 2ITNA 4QOXA 5EDQA 4NL0A 4DFYA 3GBZA 3UZRA 1H26A 4DG0E 4ARKA 2ERZE 3I6UA 4KBKA 5IH5A 4YJNA 4NSTA 5AUZA 4C2WA 4DBNA 1J3HA 4BDGA 4DT8A 3BBTB 2X9EA 3IW7A 4LI5A 3E93A 3TTIA 3NCGA 4QQJA 5J7BA 3B2TA 4DITA 3ANRA 3UYSA 4YO6A 3TIZA 4A9YA 4S33A 3I0QA 3TXOA 2QOFA 4FV9A 5K3YA 1M2RA 2WNTA 3C5UA 5H8BA 3ZZEA 3CJFA 2GNFA 2YWPA 2RF9A 4H1JA 4CMOA 5HZNA 1J1BA 2YA9A 3EZRA 3F2NA 3KMWA 3NR9A 5HIBA 3EFKA 2I40A 4ZZNA 5EQEA 4BCIA 3FEGA 2VO0A 4L3LA 4MBLA 4KS7A 1P4OA 1H27A 2ZB0A 1H07A 3DZOA 3QQKA 5CVGA 5I9VA 2OLCA 4CTBA 4UXQA 1Q5KA 3CCNA 5L2IA 3QYZA 1W7HA 3FKOA 3MVMA 4BYJA 5BMMA 3QLFA 2GU8A 4C4JA 4GKHA 2JIUA 3ETAA 4BCMA 5FXRA 1Q97A 1XBAA 3GOKA 2QLQA 2WMRA 5EOLA 3R01A 1OL2A 3GB2A 5JK3A 4N4SA 3ZU7A 3LFNA 4O2ZA 2WQMA 2ZAZA 4K11A 4ACHA 5LJJA 3BHVA 3KA0A 4G6OA 4QRCA 5DPVA 2IVUA 4D1ZA 2JD5A 4NW6A 4DFZE 5FUTA 2W9FB 3AXWA 3HP2A 4YZ9A 2ZB1A 3AT3A 3E87A 2EVAA 4X3FC 2XIYA 2Y8OA 3UYTA 4QQTA 5EKNA 5K4IA 2EU9A 3OCGA 3V5TA 5EI8A 5CASA 2CGVA 3OY3A 4IAKA 3BHHA 1JAMA 2BCJA 5KMMA 4Y73A 2OXDA 1GZNA 5GHVA 4CFMA 4R1VA 4IAZA 3Q4CA 2PMIA 2R3LA 4Y83A 3KC3A 2Z7RA 3CD8A 3THBA 4XP2A 1CMKE 4YHFA 3QD4A 4D2SA 2R3KA 3NVKI 4EZ3A 1Q99A 3WZEA 4ZY4A 5HO7A 5LMBA 2Z2WA 3IGOA 5ETIA 1OBGA 5KE0A 3PY3A 4L7SA 3V5JA 2R5TA 5IQAA 2UZVA 4I0RA 3W10A 5F1ZA 4JXFA 1H0WA 3KREA 3PJ2A 3DKFA 4IDTA 5BMSA 3MV5A 3IS5A 4NJDA 2YWVA 5M06A 1JKSA 4F6WA 3RM7A 3AC3A 3ORLA 5IQGA 3RBWA 2VTOA 3QA8A 4LOOA 4GUEA 2WOTA 2E9OA 3QF9A 4D4VA 3NLBA 4D2PA 2CCHA 5DR2A 3A62A 2WPAA 4FTTA 1GIIA 2HZ4A 4JBQA 4M68A 4K77A 4DFLA 3BE2A 1H01A 3MTLA 2ZM1A 3Q32A 4NTSA 4BDIA 1UKHA 4ITHA 2VWZA 3UC4A 2RG5A 3DAJA 3U87A 4Z7HA 5ANDA 4BI2A 5KMKA 3U8WA 4FIGA 3ZSHA 4GK3A 3DQWA 3BU5A 3SDJA 1AQ1A 3T3VA 4GEOA 3FI4A 4YSJA 2X1NA 5K9IA 2WIPA 3VS5A 3L8SA 5CENA 4HZSA 3S00A 4QMVA 4DTKA 4PRJA 3I5NA 4DAWA 2Z7SA 1OIQA 2PZIA 3BCEA 5A9UA 3M42A 1UU8A 4G3EA 3ZH8A 1U5QA 2B55A 2PVLA 1PF8A 4FGBA 2IZRA 4W4VA 4WG5A 3Q3BA 3ZSIA 4IACA 4IVBA 3ZDIA 4TYGA 5CZIA 4C02A 3S0OA 4GIIA 4GT4A 1Q4LA 1KWPA 3LCTA 3A7GA 2BRHA 3E64A 4HNFA 3ZS5A 5ANGA 1E9HA 3QRKA 3UQGA 2ETKA 4PTGA 3M2WA 3MS9A 3RALA 2QD9A 3R9OA 2PUNA 3SX9A 1PMVA 3DXQA 2IO6A 2H96A 4FK6A 3SQQA 4LOQA 3CSVA 4FKRA 3IECA 4AOTA 3DK6A 4OBQA 4BZNA 1OM1A 2ZV9A 3SD0A 4R1YA 4JQ8A 4EK6A 3CLYA 2EUFB 5AIKA 4IM2A 3UPXA 4RJ7A 3PIZA 3DCVA 2ZM4A 4FZ6A 3V6SA 2HOGA 3MW1A 2YABA 5CNOA 4EYJA 2F2CB 4QYFA 3TACA 4EOIA 2HZIA 4FEUA 3NIEA 2RFEA 3MY0A 3NIZA 3PYYA 1QPCA 2OFVA 4I6BA 4DTBA 4U7ZA 3F2RA 4C57A 2WEVA 1M2PA 4IZ7A 3PP1A 3TKIA 4IB1A 3QTIA 4JX3A 3SRVA 4IZYA 4CT1A 2PYWA 2XB7A 2W5AA 4ANMA 5HNGA 1UNLA 4FVRA 3QYWA 4I93A 4LOPA 4S34A 2JAMA 4NM5A 4MXCA 4PPCA 1GAGA 5DN3A 4DHFA 4A9RA 2XCKA 2VUWA 3JS2A 4KKHA 4LV8A 5CSXA 3UQFA 2BDWA 2J2IB 4GU6A 5M55A 2KULA 4QP7A 1XO2B 3PXQA 2W99B 3D83A 4NWMA 2A2AA 3LJ0A 3MIAA 3B2WA 1XJDA 4FT5A 2CNVA 2C4GA 5CSHA 4ERKA 4ASEA 5FBNC 4U3YA 4C3FA 1IAHA 3UIBA 4AG8A 3QKLA 4W4WA 4O22A 4D28A 2OICA 3G90X 4MD7E 4Y72A 1ZZ2A 3D14A 3GVUA 4L3JA 3TNPC 4EUTA 3PZEA 5EM8A 1SZMA 2R2PA 4IVCA 4QMZA 3N9XA 3DBCA 3PXKA 3OOMA 3S3IA 3R7UA 2O64A 3GU6A 4YTCA 4F0FA 1H28A 5HE3A 5L6WL 4KRCA 3HEGA 4MK0A 3WYYA 4OUCA 1ZMWA 2J6MA 2JDSA 4BDFA 3R21A 4UMTA 2ZV7A 4U44A 4GFMA 4ZLZA 5BUJA 2C5YA 2HY0A 3GCUA 3KY2A 3O0GA 4I0TA 5HG5A 5HLPA 4R7BA 3P23A 5B7VA 3VAPA 1RDQE 2BR1A 4FSMA 2VRXA 4I5PA 2XMYA 1V0OA 3QTXA 2X2MA 4EWQA 5IUHA 3GC8A 3F3VA 2I6LA 3VS4A 3U6JA 3OY1A 3QALE 1MQ4A 3FMJA 4ONAA 4AT3A 3EN6A 4K1BA 4U45A 2J0MB 1JVPP 4GS6A 5KMJA 4M7IA 3DXPA 4RIYB 1G5SA 3HAMA 4EOPA 4LQMA 3ZRKA 1H1RA 3FMKA 1QMZA 3COMA 4H36A 2PVJA 5M56A 2PVRA 2X81A 3L8VA 4HGEA 4YNOA 3O7LD 4XV3A 3DNEA 5HGIA 4EH9A 2GDOA 3EN5A 4YLJA 4D5HA 4IBMA 3A7HA 5HLWA 3CD3A 4H58A 4RIOA 1I09A 2HW6A 4FT3A 4AGDA 3WIKA 2PL0A 4M14A 4FNXA 4Z9LA 2WELA 4BZOA 3QFVA 3CQEA 3ZFYA 4V04A 1KV2A 2FUMA 3FI2A 2OJ9A 4XV1A 3F7ZA 4RA4A 4WD5A 2XEZA 1IRKA 2QOCA 2HAKA 2OZOA 2GQSA 4HGSA 4PL3A 5HCZA 5CAVA 2FGIA 3AT2A 3QCYA 4FG9A 4Y8DA 4E1ZA 3BPRA 4PF4A 2OI4X 3PFQA 2JKMA 3QWJA 4WRGA 3DFAA 2OZAB 3WF6A 4KAOA 3F5GA 3ZFMA 4BIBA 4I3ZA 1PXIA 4MXYA 4EOMA 5CEMA 1YXSA 5FDXA 4NM3A 5IA4A 1MRVA 4QMLA 4YPDA 3S95A 3P7BA 2VWXA 2CPKE 2O63A 4RFMA 4RRVA 4UMPA 2X6DA 3PJ1A 4O7WA 2YZAA 3LXKA 4AW1A 1YQJA 3G9LX 2IG7A 4K33A 4CGAA 4MBJA 4JLCA 4WT6A 4NT4A 5CF6A 1M7NA 3MH0A 5EQYA 3TNHA 2VU3A 5K0XA 3A2CA 2W1EA 4TRLA 3BELA 3RINA 4BDCA 4DGMA 3I6WA 4E93A 2A19B 2W1IA 3R1NA 2YM3A 4KABA 1ZMVA 1VZOA 3D94A 4XOZA 4GG7A 3AC5A 5C8MA 1ZZLA 4K8AA 1URCA 2SRCA 4RIYA 1OPLA 5ANJA 5EM6A 3ZFXA 5IUGA 2ITYA 5L2TA 2BDFA 4XLIA 4F1MA 5A4CA 4ANOA 1REKA 4L43A 1WBWA 1DAYA 2A4LA 4IX3A 3IO7A 3IW4A 4O96A 5AR3A 3SC1A 3QRIA 3SXRA 5DE2A 3V01A 3ZCLA 4A07A 4F9YA 1OMWA 4KIKA 3C4EA 4U40A 3F88A 4MQ1A 4RGJA 4RX8A 2IVTA 3HA6A 3PE1A 4W4YA 4D2VA 2FYSA 2X6EA 4YJRA 1I44A 3REPA 4U97A 3VJNA 2J90A 2IJMA 3EFJA 5LMAA 3LQ5A 4UWCA 1GNGA 4IAYA 4V01A 5TE0A 5AIRA 3QCQA 2XNGA 2YAAA 4WG4A 2C6DA 5CT7A 3S4QA 2V7AA 3H9RA 3W2SA 4ZTQA 4P5ZA 1OL1A 1YXVA 5CLPA 2VO3A 5LWNA 4LYNA 5EW9A 3ORXA 1KE8A 4RVTA 2IWIA 3EZVA 3HV6A 4RC3A 5CVHA 3KCKA 2Y4IC 3R7EA 4MAOA 2BAJA 2C6OA 3FC2A 2R3NA 3QQJA 1IR3A 3ET7A 5TOZA 4O7TA 3QA0A 5C9CA 3VVHA 3ZOSA 4F08A 3EWHA 4C38A 4O0YA 2Y6MA 3ZHPC 2JFLA 2QOHA 3TV6A 3MY5A 2BHHA 4EHZA 4GG5A 2C1AA 3HAVA 3A8WA 5HCXA 4AW0A 2BUJA 5JGDA 1TVOA 3DOGA 3LCKA 4EQUA 4MKCA 3OTUA 4BR3A 2YM7A 4QMXA 1PXJA 3UOJA 5EG3A 3PRIA 2XK9A 4ZJIA 3DDPA 5GNKA 4E5WA 3QZGA 4R5SA 2WTCA 3O50A 2PVKA 2W17A 5KBRA 1IA9A 3HNGA 3KRWA 4RC4A 3KRLA 4YPSA 5CAUA 3A7JA 2OZAA 3KRXA 3OW3A 4J97A 2YEXA 2QKWB 2B52A 5DT0A 4UX9A 4FIHA 5LMKC 4U9AA 2JC6A 4GK4A 4JJRA 5JSMA 4ZLYA 2IVVA 4KSPA 5FDPA 4RLKA 3L1SA 5HOAA 3U51A 1UNGA 2J50A 1DI9A 2GNJA 3ENHA 5DVRA 5HVJA 5BQ0A 3F6XA 5DWRA 3ZEPA 4CCUA 3RK9A 4MEDA 4PMPA 3FQHA 3PJ8A 4RFZA 4IVDA 3WZUA 3FZTA 4AQCA 3C0IA 4FX3A 5JRQA 2VGOA 3PY1A 3HYHA 4Y46A 4OTFA 1W82A 3G15A 3UJGA 2ITUA 3BWJA 1VR2A 2YAKA 4QTAA 2P4IA 4OTHA 5J95A 4CQEA 4BICA 3LM0A 5CEPA 4BVUA 4IZ5A 4A9TA 4B8MA 5AR2A 4CXAA 2QOKA 2PMNX 4IE9A 4O6EA 4QD6A 4YZNA 5HG7A 3UBDA 2XS0A 3ZLSA 4BDHA 1OBDA 3ORIA 1ZRZA 2BMCA 2WMWA 3GEQA 3DAEA 3HZTA 3Q6WA 4QMNA 4QP2A 1W0XC 3R7GA 2ZV2A 2G9XA 4FR4A 3BHTA 5EQPA 3V51A 1Q41A 2CN5A 3UE4A 4PDSA 3GNIB 4E5BA 5IH4A 4RJ8A 5CWZA 3RMFA 3POZA 4O0XA 3C13A 3HV3A 2W4KA 2P2IA 5AR4A 1J7IA 2GNGA 2GMXA 3V04A 4GV1A 4FKJA 4ACMA 3FL4A 3TNIA 4BYIA 4A06A 4FUXA 4NM0A 5BVWA 3R8UA 5CF8A 5KCVA 2YIWA 3TJCA 5M4IA 4DBXA 4L67A 2E9PA 1SVEA 4W9WA 3QXPA 3QKKA 3G5DA 1LPUA 4FEQA 5HVYA 4C62A 4MXOA 4BHZA 2P3GX 2CNUA 4RIXA 5ICPA 3QBNA 4QTBA 4RWLA 1R39A 4BDKA 4AW2A 3MB6A 3FE3A 4YJQA 4BWXA 3RAWA 3QTWA 4FIIA 4FSYA 4AGWA 4U81A 3UVPA 4MHAA 3HKOA 1TQMA 4JBVA 5DR6A 3HX4A 3EQGA 2WIHA 3VS3A 5CSPA 5CAQA 4Y85A 2CJMA 5IA5A 3I7BA 2R0UA 3L8XA 2C0OA 3I0OA 1TQIA 3QWKA 4CFNA 4C4GA 3H0ZA 4HPTE 2VWUA 4G1WA 4E4MA 1X8BA 2DUVA 3OS3A 2RKUA 3P1AA 3ORNA 4R5YA 3TZ8A 5CU0A 3AD4A 3NNUA 3COIA 3FPMA 3H10A 2GS2A 2B9FA 5AUVA 4Q5EA 3PP0A 4ZP5A 3SXSA 4ASXA 4E6CA 3KULA 5AV3A 2Z7LA 3NW6A 5AFVA 3GCVA 5AUXA 5CQUA 3N4UA 3EFLA 4B4LA 2GS6A 5I9XA 3G9NA 1BX6A 4CD0A 4QTCA 2WAJA 4HCUA 3VWAA 5C8NA 1ZYJA 5CXZA 4O7VA 3ODZX 5CSVA 3CGOA 4OGRA 5C8KA 4CNHA 4ASZA 2Y4PA 3QC4A 2W7XA 3WZJA 5J8IA 4UN0C 3UNKA 4I41A 1WVWA 4FT7A 3QQUA 5L8LA 4P4CA 3R1YA 3R8ZA 5AA9A 2W5BA 2GNLA 2QO9A 4FL3A 4IFGA 4CYJA 1OL6A 3R28A 3LZBA 4C61A 3G0FA 4AZSA 2UW4A 3PDTA 5H3QA 2FH9A 4EJ7A 2CDZA 1GIJA 2J0KA 4DLIA 5CALA 4AUAA 1M14A 4KWPA 4AZVA 2PUIA 2QOQA 4TYJA 2FB8A 4FNZA 3RP9A 5HX8A 3CKXA 2OWBA 4W8EA 5FEDA 2PSQA 4U41A 4CV8A 3ULZA 5E1SA 3TJDA 3ZO4A 4C58A 3FL5A 5JH6A 3PSDA 4F9WA 3ZONA 3P7AA 3VUDA 4HPUE 3AT4A 3G6HA 2PMOX 3R7IA 2ITZA 3OMVA 4I5CA 1YHVA 2XNOA 4KNBA 5BPYA 2QR7A 3O17A 3OBGA 4EOSA 4M8TA 2ZVAA 5L6PA 1IEPA 4BWPA 1QCFA 3OF0A 2X7GA 5HIEA 2ETMA 3FY0A 1KOAA 1H4LA 3W33A 3ROCA 3NMUF 1NXKA 4EONA 2H6DA 1ERKA 3UVRA 3IG7A 5L6OA 4XHKB 3E8EA 4O21A 3R7VA 4OW8A 5DRDA 2OKRA 3SXFA 4EH8A 3OCBA 3OHTA 5B2KA 3C0GA 3PPJA 3B8QA 4JBOA 5ANEA 2X0GA 2UZTA 3UO6A 3VBTA 2X2LA 4BCNA 4DEBA 4GFOA 1B39A 2GHLA 4I0SA 3LW0A 5T68A 4CV9A 3UIXA 2ZMDA 1ZY5A 1VJYA 3VRZA 3LJ2A 2NRYA 2F2UA 3NCZA 4HW7A 1IG1A 4LGHA 3G2FA 5CU3A 2GQRA 4D0XA 3OROA 1R0EA 4KIPA 4HYUA 3QD3A 2XM8A 3BYMA 1PYXA 1UA2A 2AYPA 4EH5A 4MXAA 4O7ZA 2ZM3A 2C3LA 2Q83A 1O6KA 3VHKA 1R0PA 2C69A 2JITA 3DBDA 2BRGA 4JG7A 3EQDA 3E88A 2YERA 4FYNA 5GIOE 1OZ1A 5KMNA 1Q8TA 4UALA 4IADA 5IPJA 3GCQA 2E2BA 3RHXA 4G6NA 3LOKA 4PDPA 2C68A 4BKYA 4FEXA 1JOWB 3R8LA 4NK9A 4I5MA 3BQRA 3KULB 3JY9A 2WQEA 2X2KA 3P86A 3GFEA 2HYYA 2FSMX 2YIYA 2R3MA 4FKTA 5DG5A 3GCPA 1Q8YA 4R7IA 3VUIA 4H05A 5IQFA 4Z3VA 3QUDA 3QCSA 3IKAA 3RAHA 4QYGA 5ANOA 3NAYA 3AMAA 3FY2A 2O5KA 1MP8A 2DQ7X 2VTAA 4IXPA 4WA9A 4RWIA 3BWFA 1H0VA 4XS2A 2XBJA 2JKQA 3IQ7A 3EQBA 4FV1A 4FSWA 2PVYA 3BHYA 3NUXA 5GJGA 2UW6A 3DS6A 4APCA 1XH6A 3FQSA 5AR8A 1PW2A 4QMMA 5DFPA 5M4FA 4Z55A 3KFAA 2IW6A 3FMDA 4XG6A 4PL4A 2F7XE 3MTFA 4EHVA 1WVYA 2VWIA 3BGQA 4KINA 3QX2A 4C3PA 1KV1A 2VX1A 2IW9A 4CEGA 3DPKA 4JR3A 4TPTA 4U5JA 5IQDA 3CTJA 2X7FA 5AV4A 4TWNA 3G51A 2UZOA 4PWNA 2X4FA 5E8ZA 1MUOA 3HVCA 4Y5QA 1J91A 3RPYA 3R1SA 2HELA 1ZYSA 3E63A 3SG9A 5D7AA 4EI4A 4H3BA 4EJNA 3BU6A 2XUUA 3M11A 4QMSA 5AM6A 2F7EE 2GHGA 3D2KA 5D7VA 1GY3A 5HD4A 5CYIA 3MYGA 2W1DA 3HP5A 4IIRA 5EYMA 4EOKA 4ERWA 4CT2A 4AP7A 4HZRA 3R30A 4XYFA 2OG8A 4YZCA 5AV2A 4BKZA 3ACJA 3GGFA 4JL9A 4USDA 4EL9A 4EQMA 5CEOA 4QPAA 5ACBC 1FINA 3DA6A 5I3OA 3Q04A 3ZLYA 5KZIA 4FTLA 4AGUA 5J87A 2WQBA 3Q6UA 2X8IA 2V62A 4GIHA 5HIDA 4EH4A 5IQCA 4E20A 3H9OA 3T9IA 3CQWA 3VBWA 3JYAA 4TT7A 4YTHA 5F20A 4AAAA 1XH5A 2PTKA 3QQGA 3CS9A 4XG2A 5C26A 3UPZA 2UW8A 2BKKA 4O7NA 4F7JA 3PA3A 2WTKB 4IANA 5ACKA 4U3ZA 4U42A 4AU8A 3E62A 5AAEA 2F7ZE 4X3JA 4NCTC 5AP7A 3TN8A 3VQUA 5I0BA 1BMKA 5HESA 3E8DA 4IVAA 3PUPA 3VQHA 4DINA 4EK4A 1GZ8A 3Q5IA 3WI6A 3GP0A 4MWHA 4F4PA 2J0JA 5E8XA 1JLUE 3C50A 3EB0A 3JUHA 3KF7A 3MN3A 1UU7A 4FTJA 4C59A 3D0EA 4RQKA 5E8SA 5GJFA 4TNDA 5KUPA 2OSCA 4YNEA 3FYJX 2BIYA 3TL8A 2ZMCA 5HI2A 2BPMA 2BIKB 2ZDTA 4EHGA 3TZ7A 5AADA 4J96A 2J5FA 4YJOA 4AA0A 5EFQA 4HVHA 1H1WA 4ZJVA 1XQZA 2F49A 1QL6A 3DKCA 4GU9A 3WZKA 4W4XA 4XOYA 4ALVA 4H1MA 4AZEA 3MFTA 4I23A 3A60A 4YO4A 2ACXA 1Y8YA 4MXXA 4TY1A 4IFCA 2C5XA 5F94A 3PPZA 4HYSA 4X3FA 3RZFA 5BUIA 4FGRA 4FVQA 4D9UA 3ZEWA 4O7RA 3FV8A 1A9UA 4F1TA 1S9IA 5DLSA 3HMPA 1XWSA 3HV4A 3LAUA 3QRJA 1IASA 3MESA 4YLLA 4C37A 3S2PA 4OBOA 5I3RA 4FA2A 1L3RE 3ORKA 5HU9A 5IEVA 4CKRA 4R77A 3WBLA 3UMWA 3DAKA 4DFXE 3VW8A 1OKWA 3MI9A 3FHRA 4EZ5A 3F9NA 3DU8A 5LCKA 3U54A 3JVRA 3RAKA 4RA5A 1UU9A 4AT4A 4ASDA 4BCGA 4EH2A 1V1KA 4R78A 4YJVA 3AD6A 5HG9A 4FE2A 4GMYA 3MH3A 4HOKA 2VTNA 4FSNA 4O82A 2X4ZA 5A54A 3CXWA 5M44A 3W1FA 1YI6A 2WO6A 4JBPA 2WTVA 4GK2A 2P0CA 2VWWA 1JKLA 3OC1A 1JPAA 4I1ZA 2BFXA 5C1QB 3C4ZA 3DV3A 3QC9A 5EK7A 1JWHA 3FZSA 3GFWA 3UC3A 1YDRE 3DLZA 4EOOA 4HJOA 1Q3WA 5EOBA 2XNBA 3BHUA 2PUPA 5AX3A 3LFQA 3E92A 3GT8A 2QO2A 3IW6A 3PWDA 5BX0A 2PY3A 3W55A 4EK3A 4ANQA 4NU1A 3O96A 4RSSA 1DM2A 2A1AB 4MWIA 1PMEA 5H8EA 3LKMA 5F9EA 4DE4A 2X9FA 5FXSA 3K5VA 3GI3A 2UVZA 3GC9A 3Q9XA 4RJ3A 4KIKB 5FGKA 2WU6A 4IX6A 1B38A 4HYIA 4TW9A 3TIYA 4TL0A 4EYMA 1OL7A 4G5PA 4MF1A 4I4FA 3F61A 1P2AA 3DK3A 3HMOA 4FTAA 5BNJA 3EYHA 5J1VA 3R8MA 4RPVA 2B1PA 2R3PA 3R9DA 5FBOA 2QQ7A 4USFA 3AMBA 3JY0A 1ZOGA 4BIDA 2ONLA 2JGZA 3UQCA 3F66A 4PX6A 4CMUA 1Y91A 3U9CA 4FV8A 3ERKA 4CG9A 3ZM9A 5BYLA 5FEQA 3QQFA 4FTIA 3KCFA 3RK7A 3GC0A 4MH7A 4M84A 1JBPE 3AC4A 3EKKA 5LXMA 4WHZA 4LFIA 4I5HA 4E26A 3E7VA 1H1QA 4CG8A 1H08A 1W98A 3D2IA 3EN9A 4PNKA 5G1XA 3R63A 1NW1A 1PKDA 4UEUA 4U8ZA 5IQBA 4KIQA 4F09A 1WZYA 4WBBB 4DH1A 4MYGA 4OT5A 3BE9A 2W1CA 4X6QC 3E8NA 4BIEA 1YI3A 3K3IA 3ORTA 4ACDA 1Z57A 2PVNA 5JZNA 3CTQA 2UVYA 5C4LA 3NW5A 2LAVA 2QHMA 4U6RA 3GQLA 3KEXA 2HXLA 4FKVA 3R73A 2XBAA 4D9TA 1NVSA 1Z5MA 2HXQA 3CQUA 3U55A 4G3CA 5IQHA 1REJA 2RFDA 4GW8A 1Q8ZA 4JQ7A 5JRSA 2VTRA 3HRFA 2A27A 5BVDA 2E9UA 2YLFA 4P7EA 3DB8A 3OEFX 4ZSLA 2YCRA 4I4EA 4L3PA 4EC8A 2EXMA 4FTMA 4G3GA 3IDCA 4B99A 4FV2A 4QQCA 1YOJA 2RIOA 3V5LA 1M17A 3UO5A 5HEZA 2W4JA 2W5HA 5KBQA 1Q8UA 2Y6OA 5FM2A 5C03A 1XKKA 3ORPA 2QOIA 3PTGA 5J7HA 3CBLA 4CLIA 3CR0A 4FODA 3E8CA 2VTJA 2VX0A 5BVOA 4H39A 4PQNA 3RCJA 1RQQA 5JKGA 3P0MA 4BTMA 2VNYA 1GIHA 2BROA 3U4UA 2R7IA 4C8BA 1TQPA 2C6EA 3BGZA 2OXYA 1YOLA 2C30A 3IPHA 3LFFA 1SVGA 2C6TA 4I94A 4QP9A 4XG7A 4DT9A 1CKIA 1ZARA 3D7TB 5JFVA 4P2KA 3I79A 3EHAA
chains in the Genus database with same CATH superfamily
4JOAA 4FSZA 4ZSJA 4F7LA 4XNEA 3O51A 3HUCA 4O6LA 4V0GA 4GJ3A 2E9NA 3P7CA 4FIJA 2H9VA 3IONA 3TEIA 5DMZA 3MA6A 3QU0A 4AX8A 3FZ1A 2W0JA 3H0YA 1OPKA 1WBVA 3ENMA 1HOWA 2B9JA 3F3TA 3II5A 4RJ4A 3QUPA 5CY3A 5DH3A 3BYOA 4QMOA 1ZMUA 1ZOHA 2E9VA 2WMQA 3R00A 4GT3A 3LE6A 4MTAA 4YJUA 5A46A 2F4JA 1WBOA 3L9LA 5A6OA 3LPBA 1J7UA 5HORA 2QOLA 2QVSE 3F5PA 3MPTA 4XG8A 4YSMA 5H9BA 3C1XA 2FO0A 4RVMA 3WF8A 1OKVA 3TZ9A 2C0TA 4KKEA 4N6YA 4B9DA 5K4JA 3RHKA 5G6VA 4RX5A 2EXEA 2GQGA 3F69A 1PKGA 2XANA 1CKPA 3HV7A 4FV4A 3VO3A 3WF5A 4DG2E 2ZOQA 4OTDA 3WE8A 5IKWA 3FAAA 4NIFB 5HBJA 4MD8E 3TCPA 1FPUA 2R3RA 3BKBA 5EI6A 2AC5A 5FTQA 4L9IA 4QYHA 5KKRB 3R2BA 5J9LA 4BDJA 2WQOA 4CYIA 3HMNA 5E7RA 1ZXEA 3C4CA 3CPBA 3W0MA 3PLAE 5AX9A 3TUDA 5BYZA 3A7IA 4EH3A 2PUUA 4N57A 4ALWA 1YXUA 4ZTSA 3VN9A 4E6AA 5K0KA 2AC3A 4BTFA 4I6LA 3NNXA 4BCKA 2GCDA 2C5VA 3DBFA 3U6HA 3DT1A 3MFUA 3RK5A 3TZMA 4NKAA 2YDIA 4AWIA 4L53A 2VWVA 4IDVA 5M07A 4G9RA 3IDPA 4XH6A 1RE8A 2W06A 4O0VA 4DEIA 1V0PA 4F99A 2JKKA 4IB5A 4R8QA 4G2FA 4XRJA 1GZOA 5DOSA 2V22A 3VJOA 4J52A 5FG8A 4C4FA 4G5JA 4AN3A 3UIMA 3VONA 2RL5A 2YDJA 4OAUC 3POOA 4BI0A 4AXCA 3O71A 5A14A 4QT1A 2QCSA 4Q2AA 4RZWA 4RVKA 4ZTNA 2PK9A 4I6FA 4OTWA 4O27B 3TDVA 4XBRA 4BDDA 2C0IA 3CTHA 4UYAA 4XEYA 3G33A 3Q52A 2EWAA 2BAKA 3BU3A 4WG3A 5AP3A 3R0TA 4O4BB 5LQFA 3PVBA 3QKMA 3T8OA 5HE2A 3ZSGA 4AQKA 3F3WA 4O86A 4Q9ZA 5J9YA 1A48A 3R71A 5TF9A 4JS8A 4DC2A 2C6MA 3OG7A 5HICA 4G3FA 4YC6A 4EQCA 3FMHA 3UNZA 4XRLA 1FGKA 4QTDA 2UW0A 3WF7A 2HIWA 4PPAA 2WTIA 4AFEA 2O65A 2PE0A 3A8XA 4KA3A 5IQEA 3SV0A 2KTYA 3OTVA 3P79A 3VS7A 3MVLA 2V5QA 5FM3A 4IAIA 4M13A 2R3FA 3TV4A 2YM5A 2ZJWA 3LVPA 4JX7A 2JDVA 2PMLX 4D58A 2V7OA 5E90A 2Y0AA 1U5RA 4IHPA 4M12A 4TTHB 3KVXA 1J7LA 1TKIA 3VBXA 5LWMA 4BF2A 2QOOA 4CQGA 3UODA 4F9AA 4E6QA 4CZYB 4BFMA 5M4UA 2QG7A 2J51A 3LMIA 5DNRA 3HV5A 5HVKA 2EB3A 3SOCA 2XARA 3DDQA 4YMJA 4BTJA 1Q8WA 3EIDA 4DTAA 2OO8X 1XR1A 2CHLA 3IGGA 3PLSA 2PVFA 4X2JA 3SVVA 5HD7A 3W8QA 4FK3A 1KE7A 1Q24A 3NNVA 2O3PA 1R3CA 4ZS4A 5TT7A 4M97A 1UNHA 2ITTA 3KXMA 3QTRA 5CVFA 2G2HA 3QHRA 4KB8A 5CU4A 3BGPA 1FVRA 4GUBA 2WMBA 4LV5A 4B7TA 2CKOA 1SVHA 4FTKA 2P2HA 4FV0A 3BQCA 4Y95A 3JR1A 2XNPA 1KE5A 2BZIB 4KBAA 2X8EA 4CMTA 5JQ8A 4C4HA 3KN6A 1G8AA 3E3BX 4S31A 4V05A 4ZSEA 4ALUA 2UW7A 5EI2A 2WMSA 4ZTLA 3QRUA 2UUEA 3HL7A 4BC6A 1H1SA 4IX5A 5K5XA 3MDYA 5ETFA 4AN9A 5C4KA 1PXLA 4EC9A 3KMUA 2UZNA 2W1FA 2XYUA 3F3UA 3NUYA 3DNDA 1K9AA 3QTUA 4X7QA 4YJSA 3MY1A 2JDOA 3Q5ZA 4F0GA 4IH8A 2VO6A 3VUTA 5B0XA 1KE6A 2X0OA 3QX4A 3VS1A 4RC2A 3OWJA 4FICA 2JFMA 3E3PA 1OVEA 4WUAA 3WARA 2X7OA 3R6XA 4QMUA 4QTEA 3NYXA 4EBWA 4ZY5A 2UZEA 3CP9A 1LEWA 1Y57A 3SGCA 2XK7A 4F6UA 2JDRA 1HCKA 3FJQE 3ZO1A 4GCJA 2I0VA 3BYUA 5KMOA 2WZJA 1KOBA 5HBEA 2XJ1A 3EN4A 3NS9A 4PMSA 4J8NA 5JQ5A 3PJ3A 2IPXA 2DWBA 4I22A 4RIXB 3FXXA 3UIUA 4LUDA 5A6NA 2C1BA 4X2NA 2XNNA 3KRRA 4QYEA 3NZ0A 5AV0A 4K9YA 4DN5A 3LLAA 3FLNC 1OIUA 1BL7A 2WQNA 3BBWA 3MJ1A 5BVEA 3KK8A 3NDMA 4AE6A 4BZDA 1G8KA 4UB7A 5E8YA 4A4LA 4A4XA 5JZJA 2R3OA 4XP0A 3FPQA 3AG9A 3BV2A 1UKIA 4ANBA 3AC1A 3QGYA 3O8PA 1BUHA 1NA7A 3RPOA 2WMAA 1SNXA 4KIOA 4JDJA 5E91A 4DEDA 4HVGA 4NW5A 3KXGA 4M15A 4H3PA 4NEUA 5HO6A 2HENA 3VS2A 1MRUA 2XK6A 1O6YA 4IAFA 2XIRA 3W2CA 2REIA 4FOCA 5I5ZA 1WBTA 2C3IB 3BRBA 5IA3A 5CEQA 3R7YA 5EKOA 1PJKA 1K3AA 2NPQA 2BZKB 3DBEA 4JVGA 2G01A 2JIVA 4PMMA 5BUEA 3VUGA 3JXWA 1PXNA 2QOBA 4RBLA 4FL1A 5JFXA 2X8DA 4J71A 2BAQA 3NX8A 2V0DA 4DGNA 4LRKA 5BVNA 2CGWA 3TKUA 3DY7A 1YKRA 2VTTA 4P5QA 4FKQA 1JKTA 3EH9A 2XRUA 3MSSA 5EW3A 2Y9QA 5AR5A 3LXNA 3UZPA 1ST0A 2IVSA 5HLNA 2ZFYA 3FBVA 1AGWA 2OJGA 4RT7A 5EM7A 5LVLA 3DTCA 4Z16A 2J4ZA 5CI7A 4JDKA 2V55A 2YZLA 2PE1A 1R1WA 3A4OX 4DFBA 4BGHA 4XX9A 3ZBFA 2OGVA 4U79A 5DEWA 4D2RA 3EL7A 3PWYA 2C6LA 5LARA 4M0YA 1E1VA 3PVGA 3NGAA 3RNYA 3SLSA 3TT0A 3BEAA 4AXAA 4PP7A 4O0UA 4FJVA 4IAAA 4Q9SA 3QD2B 1OGUA 1QPEA 3AMYA 3KIOC 1XBCA 2OIDA 3QZIA 4GYGA 1H00A 5KKRC 3T3UA 3EQFA 4QQ5A 4S30A 4ZS0A 5A4QA 3VNTA 1M52A 3AOXA 1OPJA 3OBJA 4XV9A 1PXOA 3C4FA 4WSQA 1F0QA 2R3GA 2CN8A 3EQIA 3OXTA 2LGCA 4HNIA 4FNYA 2WD1A 3KKVA 4RWKA 4EOLA 4U80A 4BCHA 3DJ6A 5IZFA 4MQ2A 5L2QA 2GNHA 2PE2A 2ERKA 3VF9A 3JPVA 5IA1A 4IWOA 1BKXA 4N70A 1DI8A 4XG3A 3RM6A 3VIDA 4NYEA 4D55A 2OJJA 4FUYA 4O84A 1UWJA 4KRDA 3TI1A 2GTNA 3VULA 4YU2A 3RI1A 2P33A 1YVJA 1LEZA 2GHMA 1LR4A 2VWBA 3NUPA 4F7SA 4FZDB 3I1AA 3LFAA 4HVIA 5J5SA 5FQDC 4E4NA 3KRJA 4V0GB 3O8UA 5JN2A 2PULA 3BV3A 5EW8A 3C4WA 1BI7A 2GTMA 4AA4A 2WKMA 4ENXA 5BVKA 1NY3A 4YBKA 3CY3A 2BHEA 4C33A 4JDHA 5BVFA 1YHWA 2EXCX 3DJ5A 4YTFA 2I0YA 2XM9A 4HCVA 2YJRA 2F57A 3MA3A 2UZBA 5D11A 5CF5A 2X0QA 3ORMA 4ANSA 4DFUA 1P5EA 1CDKA 3D7TA 4LUEA 5HKMA 3LCSA 3GUBA 2F9GA 4M66A 3F5UA 4S32A 2YLEA 4BCFA 4DHIB 4NCTA 4ENYA 5E8VA 3KXHA 3MH1A 4TYHA 3QRTA 3TKHA 3ID6C 4JIAA 1P4FA 1ZOEA 4J99A 1YI4A 4JRNA 1RW8A 1ZYDA 3PE2A 5AR7A 3LXLA 3HRBA 5E92A 5AUTA 3EMGA 3S1HA 4M69A 3N51A 1M7QA 3RPRA 2VO7A 1UWHA 3M1SA 4O4DA 2I1MA 1ATPE 5E8TA 3V5QA 4CFUA 2CSNA 2FSOX 2IW8A 1H24A 3ZLWA 4DGLC 4NFMA 4EKLA 3KXXA 4ID7A 4U0IA 4DF3A 4L46A 5M08A 2O2UA 4YURA 1MQBA 4F9CA 4BBFA 3VS6A 2XCHA 3KU2A 4HGTA 2VTQA 3V5WA 4E4XA 5CAPA 3QCXA 4K18A 3PIYA 4IMYA 4BDAA 4O7SA 4XBUA 3OD6X 3HGKA 2VTHA 4OR5A 5JFSA 3G6GA 3OFMA 4R3PA 3ULIA 3IK3A 2R9SA 3VC4A 5L8KA 4FKGA 1UV5A 4G3DA 3RGFA 5EYKA 2VWYA 2Z7QA 4FT9A 2QU5A 3P5KA 4JRVA 4EUUA 3C7QA 3A4PA 5EHYA 4AOIA 1CKJA 2UZUE 2CKPA 1Q61A 1KE9A 4GH2A 4FKPA 3U9NA 4BTKA 1IA8A 2XIZA 3UDSA 5EDRA 3QAME 3VHEA 3FZOA 2RFNA 2ZYBA 3R9NA 4FVPA 1YXTA 5M57A 2ITPA 2P55A 4IWPA 4MCVA 5FLFA 1ND4A 5FTGA 5CI6A 4IC7A 3KK9A 1H1PA 3ZLXA 3H30A 4YBJA 5ANIA 3CY2A 3GQIA 3OOGA 2ITQA 3L9MA 1P14A 3MVJA 3Q9ZA 5KHWA 3D5XA 1M2QA 2JAVA 4LL0A 4YZBA 3UP7A 4A9SA 2XRWA 4BWKA 1W2CA 3PA5A 4ZSGA 4E4LA 4LL5A 1YWRA 1G3NA 3ZMMA 1W83A 4FEVA 4XG4A 2IZSA 4R3RA 4CFFA 2XH5A 4L8MA 3VUKA 2H34A 3QZFA 2W4OA 2R7BA 2B9IA 4MNEB 4X2KA 2WXVA 2UZLA 1UU3A 3Q96A 4YZMA 4TWCA 3DB6A 1JKKA 2W9ZB 1ST4A 2IEWA 4DGGA 4USEA 3FC1X 4FTUA 4MD9E 3VS0A 4TNBA 5CAOA 5JFWA 1Y8GA 4XV2A 5DYJA 4XG9A 5FD2A 3COHA 4O0TA 4GFGA 4DH7A 5BYYA 1U59A 2NP8A 2CMWA 3NYOA 3QGWA 3TM0A 3Q4TA 3FKNA 4IM0A 4QP4A 4RFYA 4UZDA 4RZVA 4YJPA 4BDBA 4IJPA 3FMNA 2G1TA 1YW2A 5IA2A 4D4SA 3IOPA 2BILB 2XKEA 3SKCA 2VD5A 3LFDA 4F6SA 3D7ZA 3GXLA 3R04A 4I6HA 3I81A 4BDEA 4PY1A 3KXZA 4YHJA 1SNUA 2YACA 4OTGA 1WAKA 3BL9A 4ANLA 5IF1A 2XKCA 4GT5A 4JR7A 4LGGA 5FRIA 2QHNA 3HLLA 3W2QA 4J95A 4E3CA 1OGYA 2WMXA 2B4SB 4UV0A 1FBNA 4RX7A 4F63A 1PYEA 2OH4A 2ITVA 3QD0A 3SHEA 4RMZA 1XH8A 4E7WA 3F3ZA 4GYIA 4NIFA 4XCUA 4B0GA 2OXXA 4YTIA 2B53A 1ZWSA 3PPKA 4KD1A 4LGDA 1OI9A 4DEAA 3N4VA 2YIRA 2OIBA 4X2GA 3RVGA 4AACA 4E6DA 5IEXA 5AP4A 3DTWA 3D9VA 4I21A 4ZMEA 4OTRA 4I20A 2R64A 2R3HA 2JEDA 3ZO2A 4BCOA 3TNWA 2XYNA 2UVXA 3RAIA 4F9BA 4QNYA 5KMIA 3ZZWA 5TKDA 4FIEA 4FV7A 5AV1A 4YZDA 4BCQA 1MRYA 4KS8A 5HNIX 1CTPE 3K2LA 1L8TA 5F4NA 1NVRA 2OF2A 3EOCA 4J98A 4C35A 5A4LA 5HCYA 4GVAA 5HX6A 4A4OA 3BZ3A 1F3MC 2PWLA 3Q9WA 5ETAA 4K2RA 3U4WA 2A0CX 2XVDA 4BI1A 5AA8A 4O7YA 2UZDA 2QU6A 2R0IA 3LJ1A 3C51A 3TTJA 4KUJA 1NVQA 1OUYA 4LG4A 4DEHA 3CIKA 1XBBA 5HQ0A 3W0OA 5CU2A 5AUWA 3ACKA 3KVWA 3ODYX 4IWQA 4LMUA 4TYHB 1XH4A 4BJJA 5E8WA 4O38A 1GZKA 3MVHA 4AOJA 5DI1A 2ITOA 4ZEGA 4X6RA 4FTRA 4MXZA 4O83A 3SG8A 3QTQA 1YHSA 4CZUA 4F65A 2YDKA 3PG3A 4UWBA 3A7FA 3UDTA 4QP6A 4FG8A 4A7CA 2W05A 5GINE 2CKEA 4F64A 2IF8A 4DH3A 5DR9A 3LFBA 4X21A 4PPBA 4BGQA 1S9JA 3PVWA 5JGBA 2VGPA 2PZYA 5D9HA 2VTSA 3BI6A 4PDYA 3PRFA 2OIQA 4BKJA 4O81A 3FMMA 3FHIA 2YM8A 5EH0A 2I0EA 2ITXA 4DH5A 4N0SA 5CS6A 2W1HA 4I92A 2C3KA 2BZHB 3NAXA 3KB7A 5IUIA 4L52A 2C6IA 5GZ9A 5IDNA 3ITZA 4FKSA 2GNIA 4FKUA 5E4HA 4H3QA 4O0RA 5J79A 1G8JA 3COKA 4EWHA 3OP5A 4QO9A 3KMMA 5ETCA 3FQEA 4X2FA 3R7OA 3RWPA 3ZUTA 4AGCA 4AZTA 1AD5A 3MFSA 4C36A 4ZLOA 3PXRA 3OWKA 3GOPA 1PRYA 3NEWA 2VAGA 2QG5A 1XHAA 3KN5A 2WGJA 2VTIA 3VBYA 3EQPA 1T45A 4ZZOA 3PXZA 2QURA 1FMKA 3UO4A 2J9MA 3HMIA 3KL8A 3KXNA 4DYMA 2R3IA 4C4IA 5L4QA 5J1WA 3L9PA 4ORKA 2B54A 4UY9A 5AAFA 3L9NA 4BL1A 4RWJA 5KMLA 3EYGA 5HG8A 4M0ZA 5HE1A 5CQWA 5AP6A 2JKOA 2WB8A 3F2AA 4C2VA 3UMXA 3FWQA 3GU5A 1WBNA 1XH9A 5A4EA 2O0UA 2OBJA 2OJIA 4YLKA 3AQVA 3Q60A 4F78A 3LMHA 4MX9A 3E7OA 4K6ZA 2ITWA 5FXQA 2GFCA 1Y6BA 3V5PA 3KQ7A 5FWKK 2WHBA 3O8TA 5C01A 1YOMA 4RJ6A 4D4RA 4AZFA 3PY0A 3GU7A 2B0QA 3ZRLA 2PVMA 2UW9A 4FKIA 4DHJA 5JT2A 4FSQA 2YHVA 4ZZMA 5IH6A 4JAJA 4MVFA 4D0WA 3ZUVA 4O4EA 5AUYA 1W8CA 4LRMA 5AP5A 3KF4A 4QPMA 3N4TA 4N6ZA 4L68A 4IZAA 3BLQA 2WMVA 3WILA 2YIXA 3SW7A 1FGIA 2XZSA 4BGGA 5B2MA 4G34A 1FQ1B 5AUUA 3V8SA 2C5OA 4FV5A 4G17A 4EH6A 3C9WA 4LDTA 1OKYA 2UV2A 1SMHA 2Y4IB 1DS5A 1PY5A 3LCDA 4FBXA 5HBHA 1IAJA 4APPA 3NUAA 5BV3A 5I4NA 1BL6A 1BLXA 2UZWE 4JI9A 3UDBA 2B7AA 2WU7A 3QXOA 3QZHA 2BRNA 3WF9A 3FLZA 3RPVA 3LFEA 2XIXA 4OT6A 4D5KA 3QL8A 4BBMA 4PDOA 3H4JA 4FI1A 3UGCA 4F0IA 3UOHA 3ZM4A 3R83A 2JIIA 4GKIA 4DH8A 4QEBA 3HECA 4X0MA 5FP5A 3D5WA 3VRYA 3LM5A 4UMUA 2YN8A 4ZSAA 2YISA 4IB0A 5FEEA 4FRFA 4JDIA 1JQHA 2CGUA 4UMRA 4CFWA 5EHOA 3TNQB 3I60A 1OKZA 3U6IA 1F5QA 5H2UA 4OBPA 5HTCA 4J8MA 4RQVA 2OJFE 4ZJJA 3NUNA 4O7LA 4J1RA 1W84A 4CLJA 2R3JA 2XEYA 3R2YA 3TUCA 4IM3A 1WVXA 4RLLA 4PL5A 2VX3A 3ANQA 4D2TA 3WOWA 4WKQA 4HVSA 1BI8A 5CSWA 4Z7GA 1NT2A 5CEIA 2WMUA 1O6LA 2BRMA 5AMNA 5CF4A 2YFXA 3H9FA 3W2RA 1GJOA 4FSUA 2UW5A 4L00A 1SYKA 4TZRA 3V8WA 1SM2A 3BIZA 2BTSA 3PXFA 3LMGA 4Q5HA 4ZOGA 2C6KA 2HWPA 5GZAA 4NUSA 4CZTA 2VV9A 2ONLC 3ROYA 4L6QA 2XK8A 4FMQA 4ZTRA 3VW6A 3IDBA 3W16A 3GU4A 4D2WA 4ACGA 3QQLA 2XF0A 2EB2A 2JDTA 4DGOA 3UVQA 3FI3A 4TYIA 4HVDA 2JLDA 1JSVA 3UOKA 4ZTMA 1ZAOA 3KGAA 1J1CA 1W2DA 4E8AA 3RCDA 1PXPA 3BLHA 4FL2A 1O9UA 3P4KA 3SW4A 3ZO3A 5IQIA 2XK4A 4OTQA 2Q0NA 4UBAA 3ZRMA 3PIXA 5A4TA 3A99A 4CKIA 4FF8A 2BFYA 5LVMA 3OWLA 5AEPA 1ZYCA 5I9YA 3EFWA 3EKNA 4R3CA 3QLGA 1LUFA 3BLRA 2XKFA 4WNKA 3FLQA 4FTNA 4NJ3A 3ZC5A 4FEWA 4ACCA 4DHZA 4G31A 5ANKA 3BX5A 4HCTA 5IISA 2RG6A 4LMNA 1U54B 3LFSA 3ALOA 1CSNA 4QMWA 2IZTA 4G16A 5HU3A 3DQXA 4WO5A 3FXZA 4TWOA 2BZJA 3WZDA 3CKWA 4BBEA 3IW8A 5TO8A 3ATTA 2WTKC 4JIKA 2FVDA 2YCSA 5A3XA 3OWPA 1FVVA 3LQ8A 3GENA 4QMYA 4WRSA 1Y6AA 3PVUA 3FYKX 2FA2A 4YR8A 2YM6A 2AUHA 1YWVA 2G2IA 1CM8A 3ALNA 3EL8A 4I24A 4QMTA 5L2WA 3UNJA 5CXHA 3R8PA 3HDMA 3B8RA 5CNNA 2HZ0A 5J5TA 2HWOA 4RIWA 5CANA 3MFRA 5AJQA 5J9ZA 3O2MA 4NM7A 3F82A 4GRBA 5CEKA 2HW7A 2C47A 4RX9A 2RSVA 3NYVA 4LRJA 1ZYLA 4NTTA 4M69B 4O0WA 2VNWA 3RTPA 3OW4A 3ZC6A 1TZDA 3SOAA 4QMPA 2OK1A 3Q53A 4EZ7A 5LMKA 2QC6A 4D1XA 4O1PA 1FOTA 3G0EA 2WTJA 3FSKA 4BB4A 2VTLA 3IOKA 3PXYA 3QTSA 4UWYA 1U54A 5DT4A 5E1EA 4BHNA 2YCFA 4EOQA 3ZUUA 4O0SA 5DEYA 1Q62A 3RJCA 4FOBA 5AP2A 3OXZA 3TDWA 5DA3A 2W96B 4FKLA 2VN9A 5CT0A 3ZXZA 4EORA 3QUEA 5DGZA 4ZK5A 5T3QA 4IEBA 3CC6A 4FV3A 4AAYA 4J53A 4FNWA 1STCE 5HTBA 3LHJA 3C0HA 2O8YA 2NNWB 4QP1A 3NPCA 2QO7A 3RPSA 3V3VA 4JQEA 3HRCA 2RGPA 5KO1A 4CVAA 1Q3DA 5AWMA 3IW5A 4ZTHA 2WOUA 3PZHA 3HDNA 4TXCA 1YRPA 2QI8A 4IX4A 4JG6A 4JT3A 5JMSA 4RIWB 2YCQA 1A06A 3OT3A 4G9CA 2UW3A 3EN7A 5H8GA 3Q4ZA 3SAYA 5LVNA 5M4CA 3MJ2A 4FZAB 4WSYA 4UMQA 3DFCB 2CGXA 4DEGA 4MNFA 1OECA 2B9HA 2BALA 3QQHA 3ZDUA 4WBOA 4L45A 3DKGA 4FZFB 3FZPA 4BCJA 4AN2A 4ZAUA 3Q2JA 4WNPA 4QP8A 4AZWA 3RWQA 5EM5A 1QPDA 1UVRA 4HYHA 5L8JA 3MPAA 3VBQA 4QDVA 4EH7A 1EH4A 2ETRA 5IG1A 1PXKA 3PSCA 3EJ1A 1Z9XA 5T6KA 3CJGA 4XLVA 5KHXA 4II5A 3FLYA 3H3CA 4L7FA 4UYNA 2XA4A 5DT3A 4EBVA 4L42A 2YITA 1PMUA 3VUMA 4NKSA 3MBLA 4QP3A 3LQ3A 3EQHA 4PTCA 4BRXA 3DKOA 4AFJA 4XUFA 2DYLA 1PXMA 2H8HA 4BCPA 2J5EA 3CGFA 4ZY6A 3DZQA 4CFVA 2I0HA 3UZTA 4U43A 2QLUA 4P90A 5CZHA 4EKKA 3K5UA 3W8LA 2HY81 1OITA 5LOHA 5JGAA 5IMEA 3W2PA 3SA0A 2PZPA 2XK3A 4FKWA 2G15A 1PMNA 1R78A 3BYVA 1BYGA 3TUBA 2WMTA 5CX9A 3AC2A 4UZHA 4DEEA 4TN6A 4FV6A 3OCSA 4JNWA 2PHKA 4NFNA 4O2PA 4UXLA 5D1JA 5E8UA 3R8VA 3RKBA 1ZLTA 2W1ZA 2XNMA 3F5XA 5B2LA 1RJBA 3O23A 4AS0A 4IW0A 4YGAA 5AP1A 1PHKA 4KSQA 4PV0A 3NW7A 1OIYA 4FT0A 3DGKA 5M51A 1OIRA 3Q4UA 5IDPA 4FTCA 2QODA 4FTOA 2OU7A 1DAWA 4CTCA 2GS7A 1WMKA 2AQXA 2R3QA 3JVSA 5DBXA 4YUQA 4IWDA 4B8LA 3DXNA 2OH0E 4MNEA 3P78A 3NYNA 3L8PA 4L01A 4CKJA 3PJCA 5C27A 5EYCA 2R4BA 3MB7A 4MBIA 3CE3A 3PSBA 3D5UA 2FSLX 5K5NA 1YDTE 3GCSA 4EK8A 4FIFA 4F7NA 3O5AA 5ITAA 4CFXA 4E73A 4XMOA 5KX8A 4GJ2A 4ITIA 3RZBA 4TKSA 4B6LA 2ZV8A 5LCJA 5LVPA 4F70A 4MF0A 4HGLA 4C0TA 4DA5A 3D5VA 3OEZA 4GVJA 4DCAA 2X0PA 2VZ6A 2Z60A 1QPJA 3R9RA 1VEBA 3P08A 4LM5A 1WBSA 1YXXA 2BDJA 3QTZA 4OTPA 5KZ0A 2PZ5A 3RNIA 4K0YA 4R6VA 2YM4A 1LP4A 2CLXA 2WFYA 4DG3E 2WEIA 3T9TA 3D4QA 5TR6A 5I9ZA 4AT5A 3EQCA 2FSTX 5M53A 2XIKA 3OZ6A 4Y5HA 2GSFA 3TWJA 3NUSA 4O1OA 2RFSA 3UG2A 3LFCA 2JBPA 3UOLA 3R22A 4QYYA 2ZDUA 5FP6A 3VBVA 3Q9YA 2OF4A 4ZXTA 3ZTXA 5HO8A 4W9XA 1T46A 4L44A 3PG1A 4YHTA 2XNEA 4PMTA 4E5AX 4C4EA 1FMOE 1WBPA 5E9EA 5EYDA 2BVAA 2OFUA 4WNMA 3OUKA 1YWNA 3NWWA 3ZYAA 3P9JA 3LLTA 4AE9A 4FSRA 4ZMFA 2C3JA 1JNKA 1E1XA 4R7HA 5HTIA 1KSWA 2PU8A 3WIGA 4GSBA 4IQ6A 3OXIA 3R02A 3OCTA 4S2ZA 4J7BA 4G6LA 5EDPA 4FYOA 5HNBA 4KKGA 3WE4A 5EHLA 4RJ5A 3OUNB 4PP9A 1URWA 3NUUA 1HCLA 4IJ9A 3TV7A 4DCEA 3HMMA 2W1GA 3MGYA 5AP0A 2CCIA 2CNQA 3I7CA 4F1OA 3O7LB 4TYEA 2WTWA 3FMEA 3LIJA 3NRMA 3W32A 4C34A 1VYZA 1H25A 1WFCA 2IZUA 4WIHA 3GU8A 5L3AA 3DK7A 4M3QA 2G2FA 3W2OA 3K54A 3LCOA 2VTPA 3FKLA 4CCBA 3NNWA 5D41A 4D4YA 5FTOA 3DJ7A 4C7TA 5HE0A 1GOLA 2QNJA 5F95A 3V6RA 4I6QA 3NVMB 5HHWA 4YJTA 3UTOA 5IEYA 5KNJA 2Q0BA 1H8FA 4CRLA 5LVOA 2I7QA 4BJJB 1U4DA 3E5AA 5IU2A 3WYXA 2Z02A 3FZRA 4YP8A 3CPCA 3FXWA 3C5IA 2QR8A 4FSTA 4CRSA 2JBOA 2HZNA 4QNAA 3OVVA 3UG1A 3VF8A 3NSZA 3EQRA 3R1QA 4RVLA 2HK5A 3D15A 3ZBXA 3UDZA 1OL5A 4PUZA 3BL7A 4ITJA 2PZRA 3F7WA 3MH2A 3PA4A 3V8TA 4AA5A 5IA0A 4AW5A 4EK5A 4D1SA 1B6CB 2YJSA 1JSTA 2GPHA 5GZ8A 5I9WA 5L2SA 4EHEA 5JEBA 3C4XA 4C3RA 3Q2MA 3FDNA 3MPMA 3DBQA 1OUKA 2J7TA 3BEGA 4IB3A 3A61A 1APME 1XH7A 4FC0A 4OLIA 3W18A 3VUHA 4DLJA 4QMQA 4OAVB 1FVTA