3ORZA

Pdk1 mutant bound to allosteric disulfide fragment activator 2a2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
276
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFCFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Turning a protein kinase on or off from a single allosteric site via disulfide trapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase activator
total genus 89
structure length 276
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3orzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3orzA01
3U55A 1Q3WA 2VV9A 2A4LA 4CFVA 4FC0A 5L6WL 2F2UA 2GNFA 3O8PA 4KUJA 5EHLA 4LV5A 3NVKI 3V5WA 5I9YA 4CFWA 3BZ3A 2YABA 4HNFA 3IQ7A 3ZYAA 5GZAA 4LL5A 4FKSA 3HP5A 4EOPA 1OPJA 4GVJA 4IACA 4N6YA 4BDKA 2GDOA 4USFA 4CT2A 3MY1A 2W99B 1GNGA 2BROA 3U6JA 5CLPA 3F82A 4K0YA 2YWVA 3NIZA 3QGYA 1CSNA 3PXFA 3KULA 4FKVA 3BE2A 3ALNA 3D7ZA 3R04A 4G5JA 2X2MA 5J9ZA 3ORPA 5CQUA 3DAKA 5DIAA 3I1AA 4C62A 5AA8A 5IG1A 4H58A 2H9VA 3CJFA 3NW7A 4RIYA 4ZZMA 5J87A 3PPZA 4DGMA 4FA2A 3OUKA 3CR0A 3MYGA 4QP8A 5LARA 4CRLA 2YM4A 2YM6A 4G1WA 5IA1A 4O7TA 4QPSA 5CU4A 1H8FA 4IZ7A 1MQBA 2HZ4A 2P0CA 2UZDA 3H9FA 3OT3A 4KBCA 4W4VA 2VO3A 2CGVA 3CQEA 2XIZA 3HMPA 3QQUA 5IUHA 5JN2A 2YZLA 5M55A 5AR5A 3WBLA 3Q52A 4FYOA 3FHRA 4BWPA 4PUZA 3BIZA 5HO7A 3ZMMA 4YJUA 3NX8A 4MHAA 4Y72A 3HMMA 3UOJA 4LFIA 3WF5A 5DGZA 1ZARA 4JRVA 5LVOA 2NNWB 5JFWA 2JBOA 3C5IA 1M7NA 2ITOA 4FT5A 2ZAZA 2JKKA 2V22A 2CCHA 2V7OA 4EOQA 1VYZA 2XNOA 2YWPA 4I21A 4HGEA 3G90X 3W2RA 2E9UA 5FD2A 2XH5A 5F95A 4K33A 2I1MA 2W96B 3D4QA 2PHKA 5L6OA 3UOHA 4IC7A 4UYNA 1CKJA 4IHPA 4E4XA 4EK8A 5DRDA 3K3JA 4K6ZA 3EN6A 3QC4A 4GVAA 4Z9LA 4RJ5A 4IB3A 2VTOA 3AC4A 3GOKA 1GIHA 3PA4A 5JK3A 5D7AA 3EQRA 3LFDA 3R1NA 3DB8A 2PU8A 2W1DA 3KU2A 4QP9A 3DXPA 2R3IA 4GT5A 2ZMDA 4EK4A 1OGUA 2G15A 2XBAA 3G15A 3UPZA 4F7SA 5DEWA 3WZKA 4MCVA 3RPRA 5D7VA 1XKKA 4R7IA 1JOWB 4YP8A 5KZ0A 3PWDA 4A4LA 3O96A 4QMLA 3KA0A 2VWUA 4HPTE 4OUCA 3PA3A 4GG7A 2WXVA 2W5HA 1OL6A 1LEWA 1YOJA 3FE3A 4M15A 4DCEA 4F1MA 4JDJA 3HRBA 1Q8YA 5HEZA 4KKHA 3AMYA 4RLLA 4RRVA 1JSVA 4L01A 4RIWB 2XK4A 4AW0A 1BL6A 2XCKA 5AIKA 3TTJA 3F2AA 5BUJA 4BYIA 3PWYA 5J9YA 3THBA 5AP7A 2O63A 2UW3A 3ZOSA 4D4YA 5JEBA 3I6WA 4G6NA 4MNEA 4XHKB 2IZUA 2W0JA 1GIJA 2A0CX 3RCDA 1SYKA 3PJ1A 3SHEA 4CV8A 4O0XA 2WB8A 4FTOA 1ZYJA 4GMYA 3IOKA 5CAOA 4KBKA 1W0XC 4ZOGA 2PZRA 4MXZA 5DMZA 1G8SA 3QWJA 2VN9A 2XJ2A 2HK5A 4IW0A 3F88A 5BVOA 4TYJA 2UVYA 3IOPA 4FV3A 4BCHA 2FSOX 2E2BA 2BZHB 3OCTA 4FTJA 3KMUA 4IB1A 3WZUA 4F9AA 4QMTA 4GG5A 2UZUE 3JY9A 4P7EA 3S4QA 4Z55A 2CNVA 5KX8A 5K0KA 3VIDA 2OJJA 4P5QA 3H30A 4OTHA 4E20A 4O81A 4QNYA 5HQ0A 1HCLA 4MTAA 2F9GA 2QLUA 3HV3A 3Q9YA 4NYEA 4D55A 2C5YA 4JIKA 4HVSA 4O7WA 3R1YA 3Q4UA 4G6LA 5B2MA 4IDTA 1FVVA 5KBQA 4C0TA 1P2AA 2UW6A 3PRIA 4IVDA 3PE2A 2V5QA 4QPMA 4RT7A 4J53A 3GC8A 4CMOA 3VRYA 3N4VA 4BDJA 4IX5A 3ATSA 4O86A 3TN8A 4YZMA 2Q0NA 5AAFA 5ANGA 3HMNA 4UMQA 1V0BA 3NAYA 4NU1A 2YIXA 1G5SA 1TVOA 3HLLA 3CSVA 3D15A 4II5A 5HU3A 2QI8A 2WTKC 3KULB 4KS7A 2OF2A 3RPYA 3LJ1A 5ICPA 5HNIX 2WIPA 4I5HA 4QYEA 1SNUA 4HVHA 2RKUA 4RIYB 1QCFA 4O22A 4BCOA 3MDYA 4FV8A 1H1WA 4C2WA 3GU8A 3Q9WA 3TKUA 2WNTA 1XR1A 3FWQA 5HNBA 3PG3A 3DKCA 3E7VA 4EUTA 2YCRA 4AZWA 3HEGA 3PZEA 5HD4A 1YHWA 4BDIA 2W7XA 1ND4A 2KULA 2WTKB 1ZAOA 1M7QA 2QO2A 1SMHA 3WARA 3C51A 3CGOA 1FMKA 2XNBA 3F5XA 4DT8A 4ANLA 3AC2A 2XNGA 2C5NA 5H8BA 5BMSA 2B9IA 1P14A 1I44A 2BKKA 5HIBA 1JBPE 4BGHA 1H08A 4GW8A 4UMUA 3KFAA 2QU6A 2XYUA 2W4JA 4GFMA 2Z7QA 2XBJA 4BCKA 4O82A 2WOUA 1H1QA 3QX2A 4H36A 4FE2A 3SA0A 3QA8A 5K4IA 4CYJA 2FO0A 4YLLA 4QMWA 4L46A 2BZKB 3QZFA 2WO6A 1PRYA 5HNGA 4JLCA 3PVBA 5C26A 4PMSA 2OXDA 5D10A 4AT5A 2ACXA 4XCUA 4OAUC 1UV5A 4YC6A 3GU5A 3OWJA 4FKTA 4O91A 3VRZA 4BTFA 2UW4A 3DT1A 2B53A 3KXMA 2QKWB 2Q0BA 3POZA 4EWQA 3OCSA 3PPJA 1OZ1A 4XG3A 4UZHA 3ZH8A 3BU6A 3O0GA 5DLSA 2VTSA 3A8XA 3EIDA 2O0UA 4AZFA 4FUXA 4BCIA 4GK2A 4Q9SA 4P2KA 2XK8A 5CAUA 3IO7A 4DEIA 5CNNA 5J7HA 2W05A 3ZLXA 3I5NA 4GKHA 2XKFA 2RF9A 2PZIA 3CTJA 5HLPA 3D0EA 3MFRA 4I3ZA 3SW7A 3ZDIA 4NK9A 3GXLA 3WE4A 3OOGA 3KXXA 5J7BA 3CY2A 4K18A 5DR6A 2JDOA 5FTOA 4GIIA 3EFLA 2IJMA 3RZFA 4CD0A 2W5AA 2PMLX 2VNYA 5AUWA 3TIYA 3V5JA 4O1OA 3H0YA 1H1RA 2IVSA 1Q41A 2Z8CA 2V55A 3M11A 4FTCA 4QT1A 2IW9A 4KKGA 4MNEB 5KO1A 4FKGA 4XG9A 4JS8A 3AT2A 3GUBA 4X2GA 2WPAA 3GT8A 3GQIA 4P4CA 5I9WA 3ZC6A 1PYXA 3F2NA 4UMTA 2VTNA 3DFAA 3EQGA 4DFUA 4S30A 5FGKA 3PXRA 4FTNA 3G6HA 4G3EA 5C27A 4LGGA 4YC8A 1L3RE 3ZDUA 4ACHA 1JVPP 3D5UA 5FM2A 2WQNA 3UE4A 4V01A 3JVRA 4Q2AA 4JDHA 1H25A 3RKBA 5E8YA 2Z7SA 4XRLA 4EH8A 3FV8A 2UZBA 3RK9A 4MBJA 1CTPE 1MRUA 5M56A 1AQ1A 2YCFA 1X8BA 5M07A 2ETMA 1Q97A 3QQHA 2PULA 3EFWA 4EOSA 3A62A 4XOYA 3I5ZA 2C6DA 2OJFE 4L3JA 4DH3A 2I7QA 4QP6A 4IAFA 4EH4A 2PVLA 5CQWA 1DS5A 3ZFMA 5AUVA 2IZSA 4FODA 4E6QA 3TV4A 4DTBA 2KTYA 2Z60A 2QONA 3LCTA 4Q5EA 4U40A 3IK3A 4O0VA 2VWZA 1S9IA 4D9TA 2J5FA 3E88A 4BBFA 1Y8GA 3ZS5A 5CF6A 3LMIA 3SW4A 3ZEPA 2OIBA 3P23A 4FUYA 2UZWE 3ZSIA 5HG8A 4O7SA 2GTNA 4RX9A 1BUHA 5I3RA 4AW2A 5C4LA 3EQHA 5IH6A 3S2PA 4HGTA 4OTFA 5HI2A 2YACA 1HCKA 3ORNA 4X6RA 4IZAA 3Q4CA 4YZCA 4NCTA 1KV2A 3T3VA 4FEQA 3VHEA 3W8LA 4FYNA 3PVUA 5EFQA 3FSKA 4FG8A 3ZC5A 5FTGA 4KB8A 2JFMA 3GCQA 4UEUA 5AV4A 4QP1A 2QLQA 5HESA 4TYIA 4CKRA 3ZLYA 3I79A 3QD0A 3S0OA 2WMRA 1J7IA 1YHSA 2PSQA 3GGFA 3PVGA 4TWPA 4M13A 3TUDA 2JITA 4IMYA 5EW8A 3L8PA 3LW0A 5IZFA 4EUUA 5CU0A 3PRFA 4I0TA 4FSWA 4GU6A 5EYKA 3UZTA 4ZLZA 3GB2A 2V0DA 3M2WA 4A07A 4NM3A 4EKKA 5J1VA 3F7ZA 3BBWA 2H34A 2XS0A 2JKOA 3TUCA 1NVQA 1YDRE 3DDQA 3VBVA 5CI6A 3KB7A 3QKLA 5CZIA 4FNYA 4E4MA 2YEXA 3KMWA 1H1PA 3H4JA 4RLKA 3DY7A 3RALA 3MESA 3FI4A 3FZTA 4LUEA 4B0GA 1BMKA 1IA8A 1LUFA 4Z7HA 2PE0A 4V0GA 3QRIA 3QRJA 3FMNA 3FMMA 3VF9A 5H2UA 1J1CA 3QALE 4AFJA 2X2LA 3MPMA 5DOSA 1PMUA 2PTKA 1SM2A 4FSRA 4DT9A 3DNDA 1WVYA 3LJ2A 3MFUA 3OZ6A 1MRVA 4OW8A 4QMSA 1XBCA 2H96A 3VNTA 2C3JA 3RK7A 5JZJA 5BVKA 3TDVA 4DTAA 3VS6A 3EKNA 5F1ZA 2QO9A 4O2PA 4IWDA 4A9RA 3UO4A 5DE2A 4DGNA 3KRRA 4FEVA 4CFNA 4QQTA 4XOZA 3VUIA 4QMYA 3ET7A 5KMNA 3W2OA 3LM0A 3V8SA 4YHTA 5D1JA 4C38A 4WG5A 5LVNA 4MF1A 4XG6A 4I5PA 3EZVA 3QBNA 2DUVA 4XG7A 3DZQA 4PTEA 3PXYA 3UP2A 3QTIA 5A46A 2VNWA 4UBAA 3NVMB 3KCKA 1M2QA 3PIZA 3UTOA 3VJNA 2VRXA 1Q62A 4HZRA 4IX6A 4YGAA 1T46A 2UV2A 1KSWA 3B2TA 2CN5A 2XK3A 5ETCA 3T9IA 3SXFA 3D94A 4F9YA 3UDBA 4RWLA 3EL7A 3R9RA 3ORZA 4QOXA 4FV4A 4PMPA 4FZAB 2UW5A 3C7QA 4U8ZA 4C3RA 5A6OA 4BI0A 4U5JA 2OU7A 2OH0E 4FSQA 1UWHA 3I7BA 2XKCA 4Z7GA 4DA5A 4IM2A 4R77A 3QTQA 4UXQA 1H00A 3MJ2A 3L9NA 2BFXA 5I9ZA 5EKOA 4ACGA 3I7CA 4CFUA 1CDKA 3SQQA 5G1XA 3R7VA 2VTHA 5ETFA 5C03A 2R7IA 3U6HA 3FLNC 5GINE 3NNXA 4BCFA 2VTAA 2IVUA 4HNIA 3N9XA 4C4HA 4BTJA 2R2PA 5K0XA 5HBEA 4HCVA 2XRUA 3NUYA 3R22A 4FSZA 4NCTC 2NP8A 4DE4A 5GZ8A 2DS1A 4LRJA 2ZDTA 3NPCA 4I41A 4BCQA 4RJ7A 1URCA 1UVRA 3FY0A 2GNHA 3OXZA 3QRUA 4PX6A 4AUAA 4UMRA 3FJQE 3HV6A 2CHLA 3COKA 2GNGA 2WTVA 1M52A 3DOGA 5C8NA 2AUHA 3O7LD 4EHZA 3WOWA 3PP0A 4UWYA 5FEDA 4I4FA 4QMXA 2ZM3A 2OO8X 1J91A 2EWAA 4FTMA 3OW3A 2OJ9A 2CGUA 3AMAA 1IRKA 5CSXA 4BZNA 4BR3A 3R7YA 5KNJA 3KN6A 3DQXA 3T8OA 4BDFA 5CAQA 3CQWA 3Q53A 1YKRA 3QTWA 5L2TA 5LVPA 2ZV2A 3NIEA 4L7SA 3P7AA 5EYCA 5HO6A 3SKCA 1FGIA 2OJIA 4RX8A 5EH0A 1SVGA 3HL7A 4QP4A 1ZMUA 4USDA 4C4EA 5DA3A 2QODA 2QNJA 4AWIA 3HECA 1JKKA 2NPQA 1XWSA 4RJ8A 4ZJIA 5JQ8A 1Q3DA 2UVZA 3C4CA 2RSVA 4FKRA 3VUGA 4DFZE 3CQUA 5CEMA 5IQIA 4C4JA 2F57A 4ZZOA 3QCYA 4WIHA 3LCOA 5JH6A 2HZ0A 4TT7A 3U8WA 5FXRA 4U3YA 3TKIA 1ERKA 2OJGA 4RJ3A 4BKYA 4AA4A 4X0MA 4IXPA 1LEZA 4LG4A 4E5BA 3CS9A 3HX4A 4YPDA 5E8VA 3BV3A 2WKMA 4JX7A 5A54A 1Y6BA 2XIKA 5HCYA 5TKDA 3VBWA 4CSVA 4I0SA 3ZEWA 3FZRA 4GK4A 3MN3A 4FKJA 4BGGA 4C57A 4G3FA 4CLIA 5KCVA 5CXHA 2R3QA 4WKQA 5EQEA 4XP2A 5AR4A 4GJ3A 4TKSA 3FLQA 5CYIA 2OXYA 3IGOA 5IQCA 2O5KA 3WZDA 4DEHA 2PMIA 2W1GA 2AYPA 4IWQA 3VS7A 4D5KA 3OUNB 4C58A 3JY0A 3W10A 4G3GA 4LQMA 1XBAA 1UKHA 4CCBA 2XVDA 4J96A 3ZHPC 3EJ1A 3RPSA 3GI3A 4ZTQA 3DJ7A 3D14A 1UWJA 5FP6A 2CKEA 2GS2A 1YDTE 4Y5HA 5T68A 4AS0A 3HRCA 3EQFA 4F0GA 4R5YA 4QMOA 4NWMA 5CI7A 1OKZA 1F3MC 1BYGA 3QGWA 4FTUA 4UB7A 5A9UA 3CTHA 4NTSA 5DG5A 2VTJA 5LWNA 1M2PA 4XLVA 1WBTA 3PPKA 4IBMA 2O65A 2WMSA 4G16A 3AD6A 3TKHA 1KOAA 4M84A 2X8EA 3GENA 3MY5A 4BDHA 1ZOEA 5JKGA 2ZB1A 2VGOA 3LHJA 2X0GA 1OPLA 2BIKB 2VD5A 5M4FA 4O6LA 4BYJA 1V0PA 3F3TA 5L2IA 1AD5A 3UG2A 3CPCA 2EXCX 4O7RA 2PZPA 4RWIA 1YW2A 3IW6A 4WSQA 1LPUA 2XF0A 4LRKA 4L3LA 2DYLA 5A4TA 3H3CA 2CGXA 1IR3A 2XJ1A 4K1BA 2XK9A 4RZWA 1XO2B 2J7TA 3KK8A 4ASDA 4S32A 3EN4A 5KMJA 3GOPA 5KHXA 3CKWA 3G51A 4DN5A 4TZRA 4NKSA 2YERA 2JD5A 3O17A 4YLKA 3F2RA 4GSBA 2BRMA 4TXCA 2VWYA 4FTAA 4UALA 3E62A 3ZFYA 4B99A 3C50A 2VGPA 2WMQA 5GNKA 4UX9A 1PXOA 2X4FA 4X7QA 3ZRKA 3U4WA 4K9YA 5HOAA 2WTWA 2BAJA 3R21A 2UZNA 2X8IA 2ONLA 1R39A 3ORTA 4PTGA 2W9FB 4EQMA 4WNKA 1Q61A 3DDPA 4KSPA 4YZBA 4FTTA 4JR7A 3DTCA 3MWUA 4XNEA 3BGPA 2WTIA 4EOJA 3PJ8A 4JOAA 1XH8A 4APCA 2ZJWA 2P2HA 2GFSA 2B55A 4KD1A 3I0QA 3KKVA 3KCFA 4O6EA 4MWIA 3DBCA 2JIIA 4EH2A 2EVAA 3BQCA 5E4HA 1RW8A 4JVGA 3A7IA 5HGIA 2EB2A 3GC0A 4Y83A 4D2PA 5A4CA 5HICA 4RC2A 2WMVA 1KE5A 3VBTA 4FV2A 4L67A 4CV9A 2C6LA 2VUWA 3AC1A 3SX9A 2PVHA 3GEQA 3MBLA 3ZSHA 4ERWA 4ZY5A 5K9IA 3P08A 5C8MA 3DB6A 4GH2A 3WZEA 1WBNA 3C4ZA 5IUGA 2QKRA 3A61A 5DPVA 4FZ7A 3OWPA 5EM6A 1NVSA 3LFQA 2HW6A 2E9VA 3A4PA 4AGCA 5EDQA 3LFFA 4DH8A 4W9WA 1OPKA 5AV3A 4PP7A 4FZ6A 3PDTA 3QCSA 3Q2JA 3TEIA 5KUPA 3ETAA 1Z9XA 2WIHA 4KA3A 4ALUA 2OI4X 2YLFA 4ACCA 3DU8A 3E5AA 4HVDA 1OKWA 1ZYDA 3MH3A 2PUIA 4MEDA 5C1QB 3G2FA 2XKEA 3LFSA 4ZSEA 2BMCA 3LFBA 5J5TA 1VR2A 2PE2A 1P4OA 2C0IA 4FSMA 3OP5A 3Q4ZA 4FTIA 2PVJA 3RNIA 1V0OA 5DHJA 1B38A 1K9AA 3FL4A 4YJSA 1FGKA 4DFNA 1YXXA 3KQ7A 4XBUA 3MW1A 4EORA 3S95A 4ITJA 3ZRLA 4MF0A 4EWHA 3M42A 5L4QA 4B4LA 5M44A 2CKQA 5CSVA 4ZY4A 5DBXA 5E8ZA 4UN0C 4XMOA 4FMQA 2YM5A 1JLUE 4H1JA 1Q5KA 2OZAA 2VX0A 3R01A 3ZO2A 2P33A 3R6XA 4YJVA 5CZHA 2X9EA 1U54A 5DEYA 4YZ9A 4FNWA 3IG7A 4TY1A 1ZMWA 1W7HA 2BIYA 4XP3A 1ZOGA 2R3PA 4AP7A 3SOAA 4AOIA 3QCXA 2VX3A 4IVCA 4FG7A 4TTHB 3PXKA 4ERKA 5BX0A 4FIGA 3C1XA 3JS2A 4I94A 3UC4A 3TCPA 4AQCA 5AEPA 1O9UA 5IA5A 2ZOQA 3MFTA 4IEBA 3I60A 3VC4A 3QL8A 2RFNA 1FOTA 3MA6A 3V04A 3ZCLA 4EOOA 5AUTA 5J79A 3IGGA 3HAMA 4L42A 4BTKA 1XH4A 2GHLA 3EQIA 4MX9A 4YJNA 4PY1A 3QTXA 4GL9A 5CEIA 3Q6UA 2UZVA 1BLXA 5H9BA 1WVWA 4E1ZA 4EEVA 4D2RA 4UMPA 1KOBA 4CKJA 5M06A 3SG9A 4RQKA 5ANIA 1XQZA 2ONLC 2PY3A 4V05A 3TZ8A 4BZDA 2QG7A 4BDAA 3MS9A 1H0VA 5EM8A 3GNIB 4RPVA 1NW1A 4HYUA 4EJ7A 5KMOA 4PF4A 2BHEA 1F0QA 1CKIA 4A4XA 3TJDA 4ZY6A 3OXTA 3WF9A 1O6LA 2DWBA 4TN6A 3DGKA 2VWWA 5FEQA 4IE9A 1O6YA 3CGFA 3R1SA 5H3QA 4AE9A 4E6CA 2LGCA 2R3RA 2PMNX 4KWPA 5AM6A 4B7TA 4I23A 5CEQA 3R00A 3FI8A 4GCJA 4AX8A 3GFEA 1RE8A 3ZSGA 4RQVA 5JFSA 3NDMA 2HY0A 2J9MA 4EC8A 2HIWA 2XJ0A 4IM0A 4LUDA 4U41A 2ZVAA 4BB4A 5CT7A 3DNEA 3IW4A 2WZJA 4KSQA 2GSFA 2W4OA 3HA8A 4KIKA 2C6EA 3TM0A 2FH9A 5M09A 4ALWA 3CKXA 5CSWA 2WMBA 3ZXTA 4F65A 4ZTHA 2J50A 4YSJA 1XH6A 4F6SA 5ANDA 1TQPA 2HENA 3D7TA 4NEUA 4IDVA 3WF6A 5L3AA 2PUUA 5HKMA 3HAVA 2YJRA 1IG1A 2QHNA 4NZWB 3A60A 5AMNA 4CVAA 4OTGA 2OLCA 4IFCA 3V5LA 2PE1A 5E8SA 4U9AA 5M57A 1YXVA 4CEGA 4BWKA 3IW7A 5CU3A 3EMGA 2WTJA 1PXPA 2A1AB 1JKSA 2B7AA 3EL8A 5AP2A 2OWBA 3HVCA 3ZTXA 4ONAA 3E8DA 4I93A 4LL0A 1OKYA 1PKDA 4GYGA 3EQPA 5TF9A 3E8CA 4YO6A 2WAJA 2BTSA 4I5CA 5HBHA 3FEGA 3Q60A 2BAQA 4IH8A 5FDPA 4RX7A 4OBQA 1WBVA 4FT9A 3UQGA 3ZRMA 3QC9A 4W4XA 4QYHA 2X7OA 2QOIA 3QCQA 3ZBFA 4APPA 5IH5A 2BPMA 3ULIA 4BF2A 2J5EA 3GCSA 3JUHA 4HCTA 1E1XA 3DZOA 1XHAA 5FRIA 3BGZA 5M4UA 3WI6A 4X3FC 4A9UA 4P90A 4QTDA 2OIDA 5JRSA 4C4FA 4O0UA 2OW3A 3TV7A 3R9DA 4EH7A 2XKDA 4O21A 3W2QA 4FV7A 3L1SA 2C3KA 5AV0A 4C4GA 1JWHA 2OZAB 4I4EA 2CNUA 3ZM9A 4BIDA 4ZS0A 2WMXA 4OT5A 4MQ1A 4RX5A 3D2KA 2QR8A 4BBEA 3QTRA 4XV3A 4PPAA 1U54B 4GU9A 2FUMA 4OTQA 4S2ZA 3KF4A 4WG4A 1GAGA 1YVJA 2BRGA 1H01A 4IB5A 3P4KA 3ATTA 4IQ6A 3MV5A 1ZYSA 3MVHA 1Y8YA 2WMUA 3OWLA 3FC2A 3RINA 5E8WA 2ITPA 3KK9A 4TYEA 3HNGA 3UYTA 3WF8A 5H8GA 4CT1A 4FTRA 1ZWSA 5F20A 3E92A 2GNIA 3II5A 3N51A 3OF0A 4BHZA 3W2PA 4C2VA 4DBNA 4EKLA 1MUOA 4FV6A 3P86A 3TWJA 3F69A 2W1HA 3TDWA 4E7WA 2UW7A 3QKMA 3LQ3A 2HXQA 4LI5A 3TG1A 4FOBA 2GFCA 4G31A 2RGPA 4MVFA 5FXQA 3IKAA 3Q3BA 4M14A 4NT4A 2R3HA 2WQMA 1OVEA 2ZM4A 4M0YA 3R7UA 4AZVA 4D2SA 3HMIA 2ZYBA 3FZOA 5CANA 1UKIA 4FGRA 4XS2A 2FSLX 3QHRA 4CFMA 2ERZE 2VU3A 4KRDA 2VTRA 3MA3A 4MQ2A 2J0IA 2QOQA 4M12A 4BCJA 5BPYA 1YI3A 5FXSA 4AGUA 4D0WA 1KUTA 4GUBA 3WILA 1PHKA 4EBVA 2NRYA 4N70A 3QQJA 4DHFA 3FXWA 3R8LA 2P55A 4RJ6A 5FLFA 3ZXZA 4OAVB 5DNRA 3S1HA 4AAAA 2R5TA 3QKKA 4FKUA 4WUNA 3UMXA 3PY3A 4WRGA 4DTKA 1JSUA 5JGDA 3KREA 4UZDA 1R1WA 2W17A 4IAZA 4D1ZA 4XEYA 3QUPA 3VQUA 4F1OA 1R0EA 4O0SA 4E4LA 4LGHA 4A9TA 4K11A 4HCUA 5BQ0A 1OM1A 4QYYA 4BIBA 2ZV7A 3ZO1A 1LP4A 3TNHA 3C0IA 4WBBB 3UP7A 1U59A 3KXGA 5DVRA 3RWQA 3FUPA 5BVNA 3HYHA 4KIKB 2HW7A 3RCJA 3QUEA 3U87A 3VN9A 3DAEA 4IIRA 4LOQA 3PP1A 4O7LA 5CWZA 5F94A 4MXXA 3LXLA 3VO3A 2BUJA 5H8EA 3ORKA 3PYYA 4JBVA 4XV9A 2X4ZA 3D7TB 3QYZA 3GVUA 1WCCA 2GCDA 5HG9A 5HO8A 3ZZEA 3G6GA 5EQYA 3NNVA 3A7JA 4BKJA 3UO5A 3DKGA 3A7FA 2BRNA 3JPVA 3QRTA 3QXPA 3L8VA 2CDZA 4FKOA 3ZBXA 1ATPE 4JQ7A 3MJ1A 3TUBA 3LKMA 4V04A 5HTBA 3C5UA 4BBMA 3D5VA 4FT3A 3RZBA 1OBDA 3CBLA 3FMHA 3P7BA 2C6IA 3BHYA 4PNKA 1H24A 3A7GA 3FMKA 3GC7A 4R8QA 4B9DA 4ZS4A 2C5OA 4AN3A 5IU2A 3BHVA 4I6HA 1OL7A 1YWVA 2J6MA 4RVTA 5T6KA 3UGCA 5IMEA 3UC3A 5M53A 1BI8A 2BALA 3MIYA 3BQRA 2YN8A 4JBOA 2QOFA 4JG7A 3R83A 3VW8A 5CEPA 4O7YA 3GC9A 3OG7A 4FZDB 5FM3A 4GJ2A 5GJGA 2FVDA 3BU3A 3ORXA 5TR6A 3BPRA 4X2JA 3G9LX 4AE6A 4AA5A 3OOMA 5CVGA 4ZP5A 4ASZA 3EH9A 4TRLA 1GZNA 4PL5A 3ELJA 3UIBA 4PNIA 1APME 3NNWA 3CJGA 2EXMA 4ZLYA 4MK0A 2XIXA 1SVEA 3NYNA 5AX9A 4YHFA 4JL9A 2ITNA 2BHHA 4YUQA 4RC4A 1NVRA 3VUKA 5IA3A 5AWMA 2IPXA 4QRCA 5JFVA 2YA9A 2YIRA 4U43A 1DM2A 3V3VA 1M2RA 4DEAA 2JFLA 2I0VA 3QYWA 3V5TA 4J71A 4S31A 3G5DA 4O2ZA 3O23A 4BGQA 3EB0A 1J7UA 1L8TA 2XRWA 2RFEA 3U4UA 3NYOA 3IECA 4HYSA 5AR3A 4CXAA 4F7NA 1IAHA 1XH5A 5KMKA 3C4FA 3EZRA 5KMIA 4F7LA 1ZXEA 3DCVA 4PMMA 4PL3A 1OB3A 2FSMX 3LIJA 1A06A 4F6UA 3VVHA 3JYAA 2BCJA 4YBKA 3SC1A 5K4JA 3OS3A 3ENHA 2YDJA 4IAYA 4FIJA 4FVQA 1RDQE 1PW2A 3FYKX 5EW9A 5AAGA 3FKLA 3HMOA 4YTCA 2C6KA 2IVVA 3AC5A 5IQHA 3G33A 4IM3A 5HORA 5EOLA 3EN7A 4YTIA 2QOOA 3ZZWA 5IQBA 2R0IA 2GQGA 2IN6A 2VO6A 4IAAA 3QX4A 5E1SA 5T3QA 4DGGA 4Y8DA 4L9IA 4MKCA 2QVSE 2VO0A 4QMZA 1S9JA 3UMWA 2C6OA 3EYGA 5HVYA 1H07A 4AG8A 4ID7A 3BELA 1Z5MA 3TT0A 3DBFA 4S33A 3QQFA 5I3OA 2QOCA 2XM9A 1BI7A 3DV3A 2J2IB 3HGKA 1U5RA 4F6WA 1H1SA 3FSFA 1UU3A 4U44A 1ZY4A 4F4PA 5HLNA 2JKMA 4CFFA 3E93A 4IJ9A 5AV2A 3RP9A 1T45A 4FOCA 2VTQA 3KXHA 4EYJA 4I6FA 4WSYA 2C0TA 3OTUA 4KIOA 4BDBA 1O6KA 4LMUA 4C3PA 4F7JA 1Q8ZA 2EUFB 2WQOA 2GPHA 2BZJA 5JGAA 3LM5A 3E63A 2NRUA 2WEVA 4WG3A 4AU8A 2ZV9A 4A06A 5JRQA 4JI9A 4AFEA 2G2FA 2W1FA 2IW8A 3Q9ZA 1JQHA 5F4NA 4YPSA 5AM7A 2PUPA 4ASXA 1OIUA 3MGYA 4CG8A 4I24A 2J90A 1FMOE 5IH4A 2BILB 2SRCA 2OFVA 4HZSA 4KS8A 3CIKA 1OL5A 4NM5A 2QC6A 4CKIA 2JC6A 4DG2E 4PP9A 4F08A 3QTZA 4FIIA 4C59A 5IISA 3K54A 4CGAA 2Y4IC 3NRMA 3BYMA 5M51A 2JLDA 2Z2WA 1J1BA 4QQCA 3FC1X 3DBEA 3O2MA 3KF7A 4OLIA 3FDNA 3WYXA 4CRSA 4IVAA 4IX4A 5BVFA 5K5NA 4W9XA 1J7LA 2PVNA 4MD7E 3LFNA 4RWKA 5DRBA 3R02A 3ZU7A 3N4UA 1SZMA 2C5VA 3L8XA 3FLSA 2VWIA 1U46A 1ZOHA 3QXOA 4JBPA 3NEWA 2GQRA 1VEBA 2B52A 3R8VA 4O96A 4PPCA 1H4LA 1Q4LA 4M66A 2C4GA 3SDJA 4BVUA 2X8DA 3SG8A 1CMKE 3E7OA 3NW6A 2I0EA 5IQGA 3LJ0A 1FQ1B 5DT0A 4YU2A 3S3IA 4YMJA 5DT3A 2IG7A 1OITA 2X6DA 4RSSA 3QD2B 4N6ZA 3G9NA 3FMEA 5BYZA 4M68A 5HVJA 1XH7A 4R3CA 3BHTA 1YDSE 5E1EA 2C0OA 4CG9A 3DBDA 4HYIA 3FKNA 4MH7A 4R5SA 3VS1A 4UY9A 3RAHA 3SOCA 1UU7A 2GHGA 4W8EA 3UQFA 1REJA 4RIOA 4IWPA 2XK7A 3DBQA 3E3PA 2YDIA 3QAME 3UOKA 1JKLA 5LJJA 3L8SA 4W4YA 1ZY5A 4HGSA 3R8ZA 4IC8A 5HLWA 3D5XA 1KE8A 3LMGA 1FINA 2QOBA 2WMWA 3RBWA 4FSYA 4UWCA 1NA7A 3WE8A 4R78A 4USEA 3AT4A 5EM7A 3CC6A 5BNJA 4DGOA 4FX3A 4MXAA 5J8IA 5FBOA 3T3UA 2HZIA 1UU9A 2HWOA 3GFWA 4YHJA 5HE0A 3NUSA 3GCPA 4WBOA 4UYAA 4NH1A 5ETAA 4NFNA 3F3UA 5AA9A 5M4CA 4BIEA 3KXZA 4Y85A 5F9EA 2VO7A 4MXYA 2WOTA 3OC1A 3V8TA 3F66A 4RVMA 2WMTA 4GUEA 4EZ5A 4C8BA 3PE1A 4G9CA 4RA4A 2YM7A 5CY3A 5HIDA 1YI4A 2B1PA 3GP0A 2C1BA 2C5XA 3RGFA 1OKVA 5CNOA 2PZ5A 4G9RA 3KVWA 1REKA 4FT7A 4ZJJA 2WTCA 3PZHA 3TZ9A 1WBPA 4XX9A 4QMUA 4E5AX 3QFVA 5AV1A 5CF4A 4C02A 1E1VA 2QOKA 2BR1A 4QD6A 3FI2A 5CALA 4ORKA 4OT6A 5L8KA 4LYNA 3B8RA 3FLWA 4M67A 5HHWA 3DXQA 4TL0A 3E87A 1DI8A 1QMZA 5JSMA 5HG7A 4OBOA 3F61A 3OROA 4FI1A 2X39A 3CCNA 3KL8A 3V01A 4R1VA 4B8MA 3BGQA 4L6QA 2OXXA 3ERKA 4I92A 1J3HA 4DFLA 3GU4A 1JKTA 4IJPA 3MIAA 3OD6X 4D0XA 3DJ5A 3L9PA 3TXOA 3I6UA 3ORMA 2R3KA 4PDSA 1QPEA 3QWKA 4MD8E 1ZRZA 4XP0A 2UW9A 4BY9E 2RL5A 5C8KA 3Q5ZA 2UZOA 3PLAE 4O1PA 1Q8WA 4J97A 4JR3A 3BYOA 1B39A 3R7IA 5JGBA 3SXRA 4D4SA 3SVVA 4U42A 3VQHA 3TNWA 4JG6A 3W2SA 1FPUA 4QTCA 4GFOA 1WFCA 1BX6A 2DQ7X 4PDOA 1TQIA 3KVXA 4FEUA 4MWHA 3PSBA 4I5MA 2XEZA 5FDXA 4J99A 3GCVA 3OHTA 5E7RA 3EFKA 4O0WA 4CMTA 3SV0A 2QO7A 3WYYA 5AUUA 2ETKA 3FXZA 4CZUA 2X2KA 4F1TA 2X9FA 4J52A 3MVJA 3BI6A 4QYGA 4TPTA 4G2FA 2XB7A 4IANA 5JFXA 5DR9A 4RFZA 4ZLOA 3DPKA 3BWJA 2ITQA 4P5ZA 4B6LA 3PTGA 3HP2A 2QOHA 4DEBA 3LAUA 4LV8A 4FVRA 4O7VA 3GU7A 2WHBA 4RA5A 4CFXA 1MP8A 3NYVA 2VWXA 3D5WA 5AADA 3RPVA 5BUIA 4BDEA 1URWA 2GS6A 1PMNA 1YXSA 3I4BA 3AGLA 5HG5A 3ZUUA 5AR2A 3WIGA 3UIMA 4E4NA 2R3MA 4NSTA 1YOLA 2OF4A 3KRLA 4GV1A 5CT0A 3R9NA 4KRCA 4ANOA 5AAEA 3A2CA 1OIRA 5CAVA 4FEWA 2ZM1A 3P1AA 3R0TA 4FK6A 1Y91A 3ROYA 4Q9ZA 4FICA 1JSTA 5L8JA 5AUZA 1Q8UA 3QQGA 4N4SA 4ANMA 4BTMA 5EQPA 4O27B 4Z3VA 5BYYA 3JR1A 2JEDA 3LCDA 4YO4A 4G6OA 4ZIMA 2ITVA 4ZSAA 1P4FA 4D2TA 3MH2A 1OUYA 4ACMA 4ZSJA 4H3QA 3R2BA 4A9SA 1PXMA 4FKIA 1VZOA 3TZMA 3ID6C 4WT6A 4ANNA 4YTHA 5IA0A 4MBLA 3KEXA 5DH3A 3QF9A 2HCKA 3ZUVA 5E9EA 4NM0A 3K5UA 4QMMA 3LOKA 2W4KA 2FYSA 1MQ4A 3Q04A 4L8MA 2UVXA 4OTDA 4RVKA 2W1IA 4YZNA 3D2IA 3CPBA 3NAXA 5D9HA 3REPA 4AZSA 4DINA 5IF1A 3EQBA 2C3LA 1P5EA 2JKQA 2WEIA 3V8WA 5FUTA 3CEKA 2UW8A 3ACKA 3D83A 2ITXA 5GIOE 1NY3A 4EK5A 5EKNA 4NUSA 5J9LA 2VTLA 4ZAUA 4EC9A 5HX6A 5C4KA 3QD4A 3EN5A 4U6RA 4CNHA 4XYFA 4EOLA 5GIPE 2W5BA 2B9HA 3PA5A 2Q83A 2QURA 3LXPA 5DR2A 3U51A 2WGJA 3EQCA 4FV5A 4NW6A 3VS2A 5CSPA 4YJOA 3P79A 4FKLA 4KIPA 4LOOA 2BRHA 4D4RA 3ZLSA 3W32A 4H1MA 5DN3A 3UNZA 2QOLA 2F7XE 4MD9E 3QQLA 1PJKA 5A4LA 3PXZA 2J0JA 2WFYA 3FYJX 3KGAA 4Y95A 4YZDA 3FMJA 4RC3A 3SRVA 1IAJA 5HCXA 2R0UA 3ALOA 5FG8A 3QRKA 5ACBC 5LWMA 2JAVA 2OFUA 4E26A 4FL2A 5IA4A 3DA6A 4DF3A 3CTQA 5KE0A 4K8AA 4L43A 2IO6A 5A14A 4HPUE 4DG3E 3CE3A 2CMWA 4X3FA 2C47A 3IDPA 4JDKA 2ITWA 3QQKA 3NLBA 3BLRA 4FTKA 5L8LA 3QZGA 4GYIA 3VUDA 1XH9A 5HD7A 2C6TA 3QTSA 3MFSA 4D2WA 3F7WA 3MVMA 5CENA 3COHA 3UJGA 3PJCA 3TNIA 4QNAA 4PMTA 4QYFA 3V6RA 3S00A 2F7EE 3F9NA 3PIXA 2PVFA 3WIKA 4BN1A 4N0SA 3IDCA 4AXAA 4PV0A 5IQDA 3EQDA 4ZTNA 5GJDA 4W4WA 4NKAA 3D9VA 4F63A 2RFSA 4QP2A 5E8UA 5KBRA 5CSHA 4DEDA 3H0ZA 4MYGA 4ITIA 4WOVA 2J0KA 1Z57A 3BX5A 3NUNA 3EHAA 5IUIA 4EHVA 2H8HA 4C61A 2VTMA 3PVWA 4BICA 3MSSA 3NNUA 3PJ2A 5EHYA 5AIRA 5I9XA 3BU5A 4GIHA 2XIRA 4LRMA 1K2PA 1GIIA 3MTFA 2HYYA 4KIQA 3VF8A 3IDBA 4AOTA 4LM5A 3E64A 4XG8A 4CYIA 3LFEA 2JDSA 4LMNA 4A7CA 1QPDA 3MVLA 1GZ8A 4NIFA 3LPBA 4ENYA 4Q5HA 4QMQA 2ESMA 3FXXA 5TOZA 4U3ZA 5CAPA 3MB7A 5B0XA 4AN2A 5FEEA 5JMSA 3QU0A 4PDPA 1WBOA 2PWLA 1GOLA 3R8PA 3IONA 2ZDUA 3R1QA 4MNFA 4XBRA 2CPKE 3OFMA 2RG5A 1GZKA 1OIQA 5J95A 2F49A 4I6QA 4IADA 4WA9A 4WNMA 4ZEGA 5KMMA 4GT3A 4EYMA 3MPTA 4FIHA 1WMKA 4DH1A 2PMOX 5LCKA 1A9UA 5AP3A 3ZLWA 1G3NA 5J1WA 2W1CA 3FHIA 3PSDA 4DFXE 2QHMA 3Q4TA 5A3XA 5EYMA 4BKZA 4FIFA 3R28A 3R7EA 5HVKA 1GJOA 3HV7A 3PFQA 2CN8A 2XYNA 3V5PA 4O7ZA 4CTCA 3LCKA 4PWNA 4QO9A 5EOBA 5LVLA 3UPXA 4CTBA 2J0MB 5CS6A 4FSTA 1DI9A 1R0PA 3E8NA 4TNDA 4O83A 4O0YA 5JT2A 5FTQA 5HE3A 2J51A 2FGIA 4DG0E 1JPAA 1Q24A 2YDKA 3A99A 3ZFXA 4EJNA 3RVGA 2QG5A 4EH9A 5CVHA 3FPMA 3U54A 2ZMCA 5HE2A 5EYDA 3GU6A 2R3FA 4AA0A 3OY1A 4R6VA 5I9VA 4CQGA 3DTWA 2C1AA 3DS6A 4BCNA 3GBZA 5IPJA 3FY2A 4Z16A 3UVPA 4IFGA 4ZTLA 2PZYA 3VHKA 4JDIA 4AGDA 4XV2A 3BYSA 2A19B 3NUXA 5CEKA 3C4EA 3LFCA 2C3IB 3OEZA 4RFYA 5BVEA 2GNLA 3QZHA 3A4OX 2PL0A 3RHXA 3VS3A 4C37A 3Q5IA 4EH5A 4OGRA 4X3JA 3KRWA 4NW5A 5CX9A 4D1XA 4M97A 4F9BA 2WU7A 3HUCA 2PVMA 3KXNA 2JBPA 4U81A 4U80A 1PXJA 1H0WA 2ITZA 3ZO3A 2RG6A 2X81A 5I5ZA 2W9ZB 3LCSA 1Q8TA 2VZ6A 5HIEA 2XEYA 4PRJA 4WD5A 2VTTA 3C13A 3UVQA 3PUPA 3FZPA 5HX8A 4UXLA 3UQCA 4DCAA 5I4NA 5EG3A 3U9NA 1OBGA 4YSMA 2WMAA 3P78A 4BHNA 4NFMA 4FIEA 4WNPA 3TJCA 3C9WA 4YLJA 3UO6A 3F3ZA 5FQDC 4JJRA 5CF8A 4YJTA 2XMYA 4JX3A 1R78A 2P4IA 5HZNA 4OBPA 2XA4A 3QD3A 4YNEA 4I20A 2CCIA 3ULZA 5CEOA 4JQ8A 3SRVB 2YLEA 2OG8A 1ZMVA 4F9WA 4C3FA 4HW7A 1OUKA 3HRFA 4IZ5A 4D9UA 2ZV8A 3CP9A 1GY3A 3OVVA 4EONA 4FSUA 2R3JA 2O3PA 2BVAA 2Z7LA 4I0RA 2VWBA 5AUXA 1YXUA 4RJ4A 4X3FB 2NO3A 2UW0A 4M3QA 2XNEA 4J8NA 4C33A 1CM8A 2BKZA 4E73A 5IMXA 1QL6A 4EQUA 3POOA 4U0IA 5E91A 3ORIA 4YC3A 4FKWA 3VS5A 5B2KA 4DGLC 3QHWA 5IQAA 3F5GA 2Y7JA 5BYLA 2CKPA 1KV1A 5FP5A 1Y57A 5C9CA 5M4IA 3FL5A 4X2FA 4GRBA 5IEXA 4OR5A 4U97A 2Z7RA 3LQ5A 3CLYA 3O7LB 3Q96A 3MTLA 4WO5A 5LMKA 5AR7A 2PVRA 2Y0AA 4L68A 4AZEA 1DAWA 3WF7A 3DK3A 4F99A 1STCE 4CLJA 2GQSA 3COMA 1A48A 3MY0A 3NR9A 1KE6A 2CLXA 4YTFA 4NTTA 2BFYA 1YRPA 4GS6A 4ALVA 2R3LA 4GEOA 2F2CB 1PXLA 1SNXA 4FBXA 1GZOA 3FLYA 3L9MA 2F4JA 1PY5A 3NUPA 3ORLA 3OXIA 4IVBA 5CU6A 3VS4A 5KZIA 1NT2A 2UZLA 4D58A 4NIFB 4BDGA 3UODA 4XH6A 3O50A 2HAKA 4EQCA 4M8TA 4RMZA 4O7NA 5KKRC 1PXIA 4KBAA 5A4QA 2XCHA 3SXSA 3UVRA 4XG2A 3W18A 4KABA 1YI6A 4L45A 4PDYA 3R8MA 3FQHA 3RAIA 2YAAA 4FT0A 1OI9A 2BZIB 2RFDA 3KRJA 3LFAA 4QQ5A 4ZTRA 1Y6AA 5L2WA 4OTWA 1PXNA 4YR8A 3NMUF 4G34A 4IWOA 3QUDA 4HYHA 5C01A 2I40A 4DFYA 4EH3A 5B2LA 4IB0A 3VW6A 3KY2A 4R3RA 2VX1A 3AGMA 4FKPA 2AC5A 4JRNA 3SLSA 3ZUTA 4D28A 3ANQA 4AT4A 5KKRB 4NL0A 5TE0A 3SAYA 4X2KA 3UBDA 1KE9A 4RFMA 3MH0A 2JGZA 4ZMEA 1WZYA 3PLSA 3FAAA 1R3CA 2GHMA 3I81A 3PXQA 3C0GA 4FV1A 3OY3A 4HGLA 3CY3A 1KWPA 3QA0A 4FZFB 4JXFA 5J5SA 4ANBA 3EYHA 2FSTX 4GT4A 2Y6MA 4N57A 2GNJA 3R9OA 3AMBA 3B8QA 3VBXA 3EOCA 4Y46A 2CGWA 4R3PA 5DWRA 2B4SB 4TW9A 4BL1A 3FMDA 2CNQA 3SGCA 2EU9A 3NCZA 2PK9A 3LXNA 4MBIA 3G0EA 4KKEA 4DEGA 5HBJA 1HOWA 2G2HA 3BBTB 3AOXA 4FTLA 4ZK5A 3UIUA 2OIQA 5ANJA 1U4DA 1V1KA 4H05A 4AW1A 1IASA 3R8UA 5AR8A 4FG9A 4C7TA 4DYMA 2A2AA 2E9OA 4TWOA 4FK3A 1VYWA 3LMHA 3RPOA 5LMAA 4DLIA 2YJSA 5AP6A 2O64A 3AD4A 3NCGA 4BCMA 5JQ5A 3TI1A 3OCGA 4R7HA 5GHVA 5AFVA 3ITZA 2WELA 4JAJA 4EOKA 4BWXA 2WTDA 2Y8OA 2IWIA 3VWAA 4L53A 4FNXA 3RNYA 4XUFA 4J1RA 3R2YA 2YHVA 3FI3A 4E93A 5TT7A 4F70A 5EI6A 3U6IA 4M7IA 4E8AA 3Q6WA 3OBGA 5AP4A 3HA6A 1G8AA 3VUHA 3TTIA 1RJBA 3UZPA 2UZTA 3E3BX 5E8TA 4E3CA 3UNJA 5B7VA 2EXEA 4FNZA 2LAVA 2PYWA 2REIA 4EHEA 1KE7A 4ZSGA 4QQJA 5I9UA 1I09A 2IVTA 3HDNA 4ZXTA 3O51A 3QLFA 4JG8A 4O84A 3PIYA 1MRYA 4PPBA 4OTIA 3OWKA 4L00A 1YWRA 4E5WA 3W1FA 4DC2A 4QP7A 1IEPA 4E6AA 2QQ7A 3F5PA 4GFGA 4R1YA 3DLZA 2O8YA 3BEGA 3MH1A 3W8QA 5AP1A 2XZSA 4IAIA 5L2SA 4CZTA 4NJDA 5AP5A 1WAKA 2UUEA 4M0ZA 3RWPA 5IDNA 4FEXA 5D12A 4XG4A 5LMKC 2J0LA 4M69A 3BV2A 4FKQA 5E92A 2PVYA 5ETIA 1ZYLA 1YXTA 3BWFA 4YJQA 4QMNA 3CXWA 4FV0A 4CZYB 2A27A 4G3CA 2HY81 2HOGA 1F5QA 4JIAA 2XM8A 2V7AA 1W8CA 3BEAA 4YURA 1H28A 4OTRA 2C6MA 2VWVA 4XLIA 3DKFA 3IPHA 3OTVA 3LLTA 1QPCA 1PKGA 4YJPA 4ZSLA 4CQEA 4ENXA 3Q32A 4K2RA 1FVRA 4QTEA 4FL1A 3HV5A 1LR4A 3AC3A 4RBLA 3JXWA 4DH5A 3H10A 2YIWA 2IZRA 2YCQA 3R73A 4GK3A 2CLQA 3I0OA 4C35A 4GKIA 4MAOA 5CVFA 2R7BA 1WVXA 3Q2MA 4RGJA 4AN9A 2VTIA 3BLHA 3DAJA 5A6NA 3RM7A 5HU9A 4H3BA 2R3NA 3TIZA 1OIYA 3OCBA 4J95A 3AG9A 2C68A 2BDWA 4H39A 2WU6A 3SD0A 3W2CA 5BVDA 3BE9A 1RQQA 3O8TA 3QLGA 4AOJA 4DBXA 2VAGA 1YWNA 4HJOA 3NYXA 4RZVA 3UNKA 2YITA 5GJFA 5EK7A 4F9CA 2W1EA 4WHZA 1EH4A 5HTCA 2XP2A 2X1NA 3V6SA 4EOMA 2JDTA 4L44A 5G6VA 4QPAA 3LQ8A 4UWBA 1U5QA 3C4WA 3ENMA 5E90A 3LZBA 4ZMFA 2YIQA 3VUTA 2RIOA 2JDVA 4ARKA 4FR4A 4QP3A 2XUUA 2F7ZE 3FPQA 2JIVA 3ZM4A 1OL1A 2W1ZA 4I1ZA 4O0RA 4YJRA 3RAWA 5BUEA 5CXZA 4AGWA 5BMMA 4F0IA 3LVPA 3VJOA 1FBNA 3QTUA 3VS0A 3LXKA 2XIYA 4BRXA 3EWHA 4C36A 2R4BA 4CMUA 4AT3A 2BDJA 2UZEA 2WQBA 4UV0A 2G01A 2GTMA 2ZB0A 3HV4A 3V51A 4DAWA 3FZSA 2WQEA 4D5HA 1UA2A 4I6BA 2HELA 3R63A 4MXCA 2PPQA 4F64A 2ITYA 4WUAA 4RG0A 5ANOA 1XJDA 2JAMA 3GCUA 2OKRA 4HOKA 4QMVA 2XK6A 1JAMA 3NSZA 3VBYA 3Q9XA 3PSCA 4PL4A 2PUNA 4BDCA 2ERKA 3VBQA 3NUUA 4U7ZA 3E8EA 3PG1A 3F3WA 3IS5A 3R7GA 3OW4A 4L52A 5GZ9A 4JNWA 5LOHA 4AZTA 2ITUA 4QTBA 5JZNA 1ZLTA 2X7FA 2CSNA 5EM5A 5FBNC 1PXKA 1K3AA 4TYHA 2YCSA 3NWWA 5AP0A 4ASEA 2FB8A 3K5VA 4Y73A 3BKBA 1YQJA 5IEYA 2J4ZA 4BCPA 2B9FA 3TZ7A 1PMVA 4CCUA 1M17A 2JDRA 5IDPA 3NW5A 1WBSA 4ANQA 4ZTSA 2Y4IB 4LOPA 1ZZ2A 2JIUA 2OH4A 2QU5A 5E8XA 3RMFA 4NJ3A 5CU2A 2YM8A 3F5UA 2BAKA 3C4XA 4DLJA 4AF3A 1NXKA 1W83A 2R3GA 3NS9A 4J8MA 4LGDA 4TWCA 5D41A 2B54A 4DH7A 1E9HA 3HDMA 3W55A 4EH6A 3RK5A 3BHHA 5A4EA 3RHKA 5AJQA 4EBWA 1CKPA 4O0TA 3DK7A 2Y9QA 2IZTA 4EZ3A 2XNNA 3FLZA 3IW5A 3DK6A 4F09A 2YAKA 4PQNA 3A7HA 4H3PA 3HKOA 3MB6A 4ZJVA 3NUAA 4BDDA 2G2IA 3RAKA 1WBWA 3DFCB 2E9NA 2YISA 4JAIA 3TNQB 3BYVA 1QPJA 3R71A 5L2QA 4FGBA 4EK3A 2OK1A 4I22A 2G9XA 4DITA 2WD1A 1OECA 3UG1A 2BDFA 1UNGA 2VTPA 5I0BA 1W98A 4M69B 3OT8A 5EI2A 5CF5A 2QR7A 3NZ0A 3PY0A 3ZONA 1W84A 4RIXA 1AGWA 4A9YA 3UOLA 4EHGA 3H9OA 2AC3A 5K5XA 4RWJA 5DT4A 4L3PA 2I0HA 3C0HA 4ACDA 2GU8A 3F3VA 3ZO4A 1SVHA 3T9TA 4S34A 4E6DA 3K3IA 1TQMA 3A8WA 2BTRA 3AC8A 4D1SA 3HZTA 3O71A 3F6XA 3ROCA 5ITAA 5ANEA 3ODYX 3H9RA 5CASA 5HTIA 3GQLA 4FSNA 4TYGA 3R30A 5ACKA 2H6DA 3HUBA 4ITHA 4J98A 3RTPA 5LMBA 3EFJA 1XBBA 3DLSA 3L9LA 3TV6A 2YFXA 1BKXA 3OEFX 1H26A 4JBQA 4KINA 1PYEA 3EKKA 3BYUA 4XJ0A 3RM6A 3VUMA 3O8UA 4BFMA 4ANSA 2OBJA 4BI1A 5LVMA 2OSCA 5AUYA 5D11A 3R9HA 2GMXA 4TNBA 4AW5A 4G5PA 4O38A 4RVLA 4WRSA 5DI1A 2XNMA 4IAKA 4DFBA 3R7OA 2Y4PA 3ANRA 3FMLA 4V0GB 3IW8A 5IKWA 4C4IA 3FQSA 3V5QA 4IX3A 5HCZA 2IW6A 4IZYA 4HVGA 5EW3A 4ZTMA 1UU8A 2HWPA 3EN9A 2Y6OA 1UNLA 1UNHA 2C30A 4G17A 4U45A 3MI9A 5L6PA 3P7CA 2P3GX 1Q99A 3QZIA 3P5KA 3UZRA 4G3DA 1OMWA 2R64A 1W82A 3TACA 3WZJA 4OTPA 5IA2A 3CD3A 1OL2A 3ODZX 3VAPA 3PJ3A 2YZAA 4JQEA 4AACA 4BI2A 3PY1A 2OZOA 2B0QA 4X21A 3KC3A 2EB3A 2BRBA 3N4TA 4D2VA 2I6LA 5M08A 4U79A 5EDPA 3DXNA 2ETRA 3COIA 4D4VA 3DJ6A 4EOIA 1JNKA 5EDRA 5LQFA 5IEVA 2Z02A 5IQFA 3TNPC 2FA2A 3UYSA 3OBJA 3AQVA 2B9JA 4F0FA 2W06A 2HZNA 3MPAA 1YHVA 1ZZLA 2P2IA 3BHUA 4FVPA 4MXOA 3RI1A 1PF8A 3K2LA 3KMMA 4KNBA 3AT3A 3FZ1A 3DQWA 3AXWA 3RJCA 4A4OA 4YNOA 5LXMA 3OMVA 3KN5A 5K3YA 4C34A 2YM3A 1FVTA 3KRXA 3CD8A 3DKOA 4TYHB 4KAOA 4EZ7A 1IA9A 4JT3A 2V62A 3BRBA 2R3OA 3BLQA 4W8DA 3M1SA 2X6EA 4R7BA 1DAYA 5TO8A 4WNOA 3ACJA 1H27A 3U9CA 3NGAA 5HE1A 2QD9A 5KHWA 5BVWA 1ZYCA 3B2WA 5EHOA 4FF8A 4X6QC 4YBJA 3TL8A 3LE6A 3UIXA 5DYJA 3BCEA 4J7BA 4RIWA 3P0MA 3AD5A 3FKOA 4BC6A 4Y5QA 2G1TA 2XNPA 4DEEA 3W33A 2X7GA 1B6CB 1PMEA 4XRJA 5DFPA 1YOMA 4HVIA 4FV9A 4X2NA 4TWNA 3G0FA 2OICA 3W16A 4EI4A 2CKOA 3JVSA 2QCSA 4BZOA 5CTPA 4XV1A 2ITTA 4PTCA 5IQEA 1TKIA 2CJMA 2O2UA 4EK6A 2I0YA 4K77A 2HXLA 3P9JA 4FTQA 2PVKA 1BL7A 1M14A 4QTAA 4BCGA 5FWKK 4B8LA 5ANKA 4NM7A 4EL9A 3FQEA 2E9PA 4L7FA 2GS7A 2C69A 4FL3A 4ZZNA 4RIXB 5EI8A 5KMLA 5AX3A 2R9SA 4QMPA 3VULA 5LCJA 1VJYA 2OGVA 2YIYA 3FBVA 3LLAA
chains in the Genus database with same CATH superfamily
3U55A 1Q3WA 2VV9A 2A4LA 4CFVA 4FC0A 5L6WL 2F2UA 2GNFA 3O8PA 4KUJA 5EHLA 4LV5A 3NVKI 3V5WA 5I9YA 4CFWA 3BZ3A 2YABA 4HNFA 3IQ7A 3ZYAA 5GZAA 4LL5A 4FKSA 3HP5A 4EOPA 1OPJA 4GVJA 4IACA 4N6YA 4BDKA 2GDOA 4USFA 4CT2A 3MY1A 2W99B 1GNGA 2BROA 3U6JA 5CLPA 3F82A 4K0YA 2YWVA 3NIZA 3QGYA 1CSNA 3PXFA 3KULA 4FKVA 3BE2A 3ALNA 3D7ZA 3R04A 4G5JA 2X2MA 5J9ZA 3ORPA 5CQUA 3DAKA 5DIAA 3I1AA 4C62A 5AA8A 5IG1A 4H58A 2H9VA 3CJFA 3NW7A 4RIYA 4ZZMA 5J87A 3PPZA 4DGMA 4FA2A 3OUKA 3CR0A 3MYGA 4QP8A 5LARA 4CRLA 2YM4A 2YM6A 4G1WA 5IA1A 4O7TA 4QPSA 5CU4A 1H8FA 4IZ7A 1MQBA 2HZ4A 2P0CA 2UZDA 3H9FA 3OT3A 4KBCA 4W4VA 2VO3A 2CGVA 3CQEA 2XIZA 3HMPA 3QQUA 5IUHA 5JN2A 2YZLA 5M55A 5AR5A 3WBLA 3Q52A 4FYOA 3FHRA 4BWPA 4PUZA 3BIZA 5HO7A 3ZMMA 4YJUA 3NX8A 4MHAA 4Y72A 3HMMA 3UOJA 4LFIA 3WF5A 5DGZA 1ZARA 4JRVA 5LVOA 2NNWB 5JFWA 2JBOA 3C5IA 1M7NA 2ITOA 4FT5A 2ZAZA 2JKKA 2V22A 2CCHA 2V7OA 4EOQA 1VYZA 2XNOA 2YWPA 4I21A 4HGEA 3G90X 3W2RA 2E9UA 5FD2A 2XH5A 5F95A 4K33A 2I1MA 2W96B 3D4QA 2PHKA 5L6OA 3UOHA 4IC7A 4UYNA 1CKJA 4IHPA 4E4XA 4EK8A 5DRDA 3K3JA 4K6ZA 3EN6A 3QC4A 4GVAA 4Z9LA 4RJ5A 4IB3A 2VTOA 3AC4A 3GOKA 1GIHA 3PA4A 5JK3A 5D7AA 3EQRA 3LFDA 3R1NA 3DB8A 2PU8A 5BV3A 2W1DA 3KU2A 4QP9A 3DXPA 2R3IA 4GT5A 2ZMDA 4EK4A 1OGUA 2G15A 2XBAA 3G15A 3UPZA 4F7SA 5DEWA 3WZKA 4MCVA 3RPRA 5D7VA 1XKKA 4R7IA 1JOWB 4YP8A 4I6LA 5KZ0A 3PWDA 4A4LA 3O96A 4QMLA 3KA0A 2VWUA 4HPTE 4OUCA 3PA3A 4GG7A 2WXVA 2W5HA 1OL6A 1LEWA 1YOJA 3FE3A 4M15A 4DCEA 4F1MA 4JDJA 3HRBA 1Q8YA 5HEZA 4KKHA 3AMYA 4RLLA 4RRVA 1JSVA 4L01A 4RIWB 2XK4A 4AW0A 1BL6A 2XCKA 5AIKA 3TTJA 3F2AA 5BUJA 4BYIA 3PWYA 5J9YA 3THBA 5AP7A 2O63A 2UW3A 3ZOSA 4D4YA 5JEBA 3I6WA 4G6NA 4MNEA 4XHKB 2IZUA 2W0JA 1GIJA 2A0CX 3RCDA 1SYKA 3PJ1A 3SHEA 4CV8A 4O0XA 2WB8A 4FTOA 1ZYJA 4GMYA 3IOKA 5CAOA 4KBKA 1W0XC 4ZOGA 2PZRA 4MXZA 5DMZA 1G8SA 3QWJA 2VN9A 2XJ2A 2HK5A 4IW0A 3F88A 5BVOA 4TYJA 2UVYA 3IOPA 4FV3A 4BCHA 2FSOX 2E2BA 2BZHB 3OCTA 4FTJA 3KMUA 4IB1A 3WZUA 4F9AA 4QMTA 4GG5A 2UZUE 3JY9A 4P7EA 3S4QA 4Z55A 2CNVA 5KX8A 5K0KA 3VIDA 2OJJA 4P5QA 3H30A 4OTHA 4E20A 4O81A 4QNYA 5HQ0A 1HCLA 4MTAA 2F9GA 2QLUA 3HV3A 3Q9YA 4NYEA 4D55A 2C5YA 4JIKA 4HVSA 4O7WA 3R1YA 3Q4UA 4G6LA 5B2MA 4IDTA 1FVVA 5KBQA 4C0TA 1P2AA 2UW6A 3PRIA 4IVDA 3PE2A 2V5QA 4QPMA 4RT7A 4J53A 3GC8A 4CMOA 3VRYA 3N4VA 4BDJA 4IX5A 3ATSA 4O86A 3TN8A 4YZMA 2Q0NA 5AAFA 5ANGA 3HMNA 4UMQA 1V0BA 3NAYA 4NU1A 2YIXA 1G5SA 1TVOA 3HLLA 2XALA 3CSVA 3D15A 4II5A 5HU3A 2QI8A 2WTKC 3KULB 4KS7A 2OF2A 4DHJA 3RPYA 3LJ1A 5ICPA 5HNIX 4DDGA 2WIPA 4I5HA 4QYEA 1SNUA 4HVHA 2RKUA 4RIYB 1QCFA 4O22A 4BCOA 3MDYA 4FV8A 1H1WA 4C2WA 3GU8A 3Q9WA 3TKUA 2WNTA 1XR1A 3FWQA 5HNBA 3PG3A 3DKCA 3E7VA 4EUTA 2YCRA 4AZWA 3HEGA 3PZEA 5HD4A 1YHWA 4BDIA 2W7XA 1ND4A 2KULA 2WTKB 1ZAOA 1M7QA 2QO2A 1SMHA 3WARA 3C51A 3CGOA 1FMKA 2XNBA 3F5XA 4DT8A 4ANLA 3AC2A 2XNGA 2C5NA 5H8BA 5BMSA 2B9IA 1P14A 1I44A 2BKKA 5HIBA 1JBPE 4BGHA 1H08A 4GW8A 4UMUA 3KFAA 2QU6A 2XYUA 2W4JA 4GFMA 2Z7QA 2XBJA 4BCKA 4O82A 2WOUA 1H1QA 3QX2A 4O4DA 4H36A 4FE2A 3NFGB 3SA0A 3QA8A 5K4IA 4CYJA 2FO0A 4YLLA 4QMWA 4L46A 2BZKB 3QZFA 2WO6A 1PRYA 3BL9A 5HNGA 4JLCA 3PVBA 5C26A 4PMSA 2OXDA 5D10A 4AT5A 2ACXA 4XCUA 4OAUC 1UV5A 4YC6A 3PUFC 3GU5A 3OWJA 4FKTA 4O91A 3VRZA 2AQXA 4BTFA 2UW4A 3DT1A 2B53A 3KXMA 2QKWB 2Q0BA 3POZA 4EWQA 3OCSA 3PPJA 1OZ1A 4XG3A 4UZHA 3ZH8A 3BU6A 3O0GA 5DLSA 2VTSA 3A8XA 3EIDA 2O0UA 4AZFA 4FUXA 4BCIA 4GK2A 4Q9SA 4P2KA 2XK8A 5CAUA 3IO7A 4DEIA 5CNNA 5J7HA 2W05A 3ZLXA 3I5NA 4GKHA 2XKFA 2RF9A 2PZIA 3CTJA 5HLPA 3D0EA 3MFRA 4I3ZA 3SW7A 3ZDIA 4NK9A 2XAMA 3GXLA 3WE4A 3OOGA 3KXXA 5J7BA 3CY2A 4K18A 5DR6A 2JDOA 5FTOA 4GIIA 3EFLA 2IJMA 3RZFA 4CD0A 2W5AA 2PMLX 2VNYA 5AUWA 3TIYA 3V5JA 4O1OA 3H0YA 1H1RA 2IVSA 1Q41A 2Z8CA 2V55A 3M11A 4FTCA 4QT1A 2IW9A 4KKGA 4MNEB 5KO1A 4FKGA 4XG9A 4JS8A 3AT2A 3GUBA 4X2GA 2WPAA 3GT8A 3GQIA 4P4CA 5I9WA 3ZC6A 1PYXA 3F2NA 4UMTA 2VTNA 3DFAA 3EQGA 4DFUA 4S30A 5FGKA 3PXRA 4FTNA 3G6HA 4G3EA 5C27A 4LGGA 4YC8A 1L3RE 1TZDA 3ZDUA 4ACHA 1JVPP 2X0QA 3D5UA 5FM2A 2WQNA 3UE4A 4V01A 3JVRA 4Q2AA 4JDHA 1H25A 3RKBA 5E8YA 2Z7SA 4XRLA 4EH8A 3FV8A 2UZBA 3RK9A 4MBJA 1CTPE 1MRUA 5M56A 1AQ1A 2YCFA 1X8BA 5M07A 2ETMA 1Q97A 3QQHA 2PULA 3EFWA 4EOSA 3A62A 4XOYA 3I5ZA 2C6DA 2OJFE 4L3JA 4DH3A 2I7QA 4QP6A 4IAFA 4EH4A 2PVLA 5CQWA 1DS5A 3ZFMA 4QDEA 5AUVA 2IZSA 4FODA 4E6QA 3TV4A 4DTBA 2KTYA 2Z60A 2QONA 3LCTA 4Q5EA 4U40A 1ST4A 3IK3A 4O0VA 2VWZA 1S9IA 4D9TA 2J5FA 3E88A 4BBFA 1Y8GA 3ZS5A 5CF6A 3LMIA 3SW4A 3ZEPA 2OIBA 3P23A 4FUYA 2UZWE 3ZSIA 5HG8A 4O7SA 3TYKA 2GTNA 4RX9A 1BUHA 5I3RA 4AW2A 5C4LA 3EQHA 5IH6A 4AXCA 3S2PA 4HGTA 4OTFA 5HI2A 2YACA 1HCKA 3ORNA 4X6RA 4IZAA 3Q4CA 4YZCA 4NCTA 1KV2A 3T3VA 4FEQA 3VHEA 3W8LA 4FYNA 3PVUA 5EFQA 3FSKA 4FG8A 3ZC5A 5FTGA 4KB8A 2JFMA 3GCQA 4UEUA 5AV4A 4QP1A 2QLQA 5HESA 4TYIA 4CKRA 3ZLYA 3I79A 3QD0A 3S0OA 2WMRA 1J7IA 1YHSA 2PSQA 3GGFA 3PVGA 4TWPA 4M13A 3TUDA 2JITA 4IMYA 5EW8A 3L8PA 3LW0A 5IZFA 4EUUA 5CU0A 3PRFA 4I0TA 4FSWA 4GU6A 5EYKA 3UZTA 4ZLZA 3GB2A 2V0DA 3M2WA 4A07A 4NM3A 4EKKA 5J1VA 3F7ZA 3BBWA 2H34A 2XS0A 2JKOA 3TUCA 1NVQA 1YDRE 3DDQA 3VBVA 5CI6A 3KB7A 3QKLA 5CZIA 4FNYA 4E4MA 2YEXA 3KMWA 1H1PA 3H4JA 4RLKA 3DY7A 3RALA 3MESA 3FI4A 3FZTA 4LUEA 4B0GA 1BMKA 1IA8A 1LUFA 4Z7HA 2PE0A 4V0GA 3QRIA 3QRJA 3FMNA 3FMMA 3VF9A 5H2UA 1J1CA 3QALE 4AFJA 2X2LA 3MPMA 5DOSA 1PMUA 2PTKA 1SM2A 4FSRA 4DT9A 3DNDA 1WVYA 3LJ2A 3MFUA 3OZ6A 1MRVA 4OW8A 4QMSA 1XBCA 2H96A 3VNTA 2C3JA 3RK7A 5JZJA 5BVKA 3TDVA 3UDSA 3VS6A 3EKNA 4DTAA 5F1ZA 2QO9A 4O2PA 4IWDA 4A9RA 3UO4A 5DE2A 4DGNA 3KRRA 4FEVA 4CFNA 4QQTA 4XOZA 3VUIA 4QMYA 3ET7A 5KMNA 3W2OA 3LM0A 3V8SA 4YHTA 5D1JA 4C38A 4WG5A 5LVNA 4MF1A 4XG6A 4I5PA 3EZVA 3QBNA 2DUVA 4XG7A 3DZQA 4PTEA 3PXYA 3UP2A 3QTIA 5A46A 2VNWA 4UBAA 3NVMB 3KCKA 1M2QA 3PIZA 3UTOA 3VJNA 2VRXA 1Q62A 4HZRA 3W0OA 4IX6A 4YGAA 1T46A 2UV2A 1KSWA 3B2TA 2CN5A 2XK3A 5ETCA 3T9IA 3SXFA 3D94A 4F9YA 3UDBA 4RWLA 3EL7A 3R9RA 3ORZA 4QOXA 4FV4A 4PMPA 4FZAB 2UW5A 3C7QA 4U8ZA 4C3RA 5A6OA 4BI0A 4U5JA 2OU7A 2OH0E 4FSQA 1UWHA 3I7BA 2XKCA 4Z7GA 4DA5A 4IM2A 4R77A 3QTQA 4UXQA 1H00A 3MJ2A 4BJJA 3L9NA 2BFXA 5I9ZA 5EKOA 4ACGA 3I7CA 4CFUA 1CDKA 4O4BB 3SQQA 5G1XA 3R7VA 2VTHA 5ETFA 5C03A 2R7IA 3U6HA 3FLNC 5GINE 3NNXA 4BCFA 2VTAA 2IVUA 4HNIA 3N9XA 4C4HA 1OGYA 4BTJA 2R2PA 5K0XA 5HBEA 4HCVA 2XRUA 3NUYA 3R22A 4FSZA 4NCTC 2NP8A 4DE4A 5GZ8A 2DS1A 4LRJA 2ZDTA 3NPCA 4I41A 4BCQA 4RJ7A 1URCA 1UVRA 3FY0A 2GNHA 3OXZA 3QRUA 4PX6A 4AUAA 4UMRA 3FJQE 3HV6A 2CHLA 3COKA 2GNGA 2WTVA 1M52A 3DOGA 5C8NA 2AUHA 3O7LD 4EHZA 3WOWA 3PP0A 4UWYA 5FEDA 4I4FA 4QMXA 2ZM3A 2OO8X 1J91A 2EWAA 4FTMA 3OW3A 2OJ9A 2CGUA 3AMAA 1IRKA 5CSXA 4BZNA 4BR3A 3R7YA 5KNJA 3KN6A 3DQXA 3T8OA 4BDFA 5CAQA 3CQWA 3Q53A 1YKRA 3QTWA 5L2TA 5LVPA 2ZV2A 3NIEA 4L7SA 3P7AA 5EYCA 5HO6A 3SKCA 1FGIA 2OJIA 4RX8A 5EH0A 1SVGA 3HL7A 4QP4A 1ZMUA 4USDA 4C4EA 5DA3A 2QODA 2QNJA 4AWIA 3HECA 1JKKA 2NPQA 1XWSA 4RJ8A 4ZJIA 5JQ8A 1Q3DA 2UVZA 3C4CA 2RSVA 4FKRA 3VUGA 4DFZE 3CQUA 5CEMA 5IQIA 4C4JA 2F57A 4ZZOA 3QCYA 4WIHA 3LCOA 5JH6A 2HZ0A 4TT7A 3U8WA 5FXRA 4U3YA 3TKIA 1ERKA 2OJGA 4RJ3A 4BKYA 4AA4A 4X0MA 4IXPA 1LEZA 4LG4A 4E5BA 3CS9A 3HX4A 4YPDA 5E8VA 3BV3A 2WKMA 4JX7A 5A54A 1Y6BA 2XIKA 5HCYA 5TKDA 3VBWA 4CSVA 4I0SA 3ZEWA 3FZRA 4GK4A 3MN3A 4FKJA 4BGGA 4C57A 4G3FA 4CLIA 5KCVA 5CXHA 2R3QA 4WKQA 5EQEA 4XP2A 5AR4A 4GJ3A 4TKSA 3FLQA 5CYIA 2OXYA 3IGOA 5IQCA 2O5KA 3WZDA 4DEHA 2PMIA 2W1GA 2AYPA 4IWQA 3VS7A 4D5KA 3OUNB 4C58A 3JY0A 3W10A 4G3GA 4LQMA 4AQKA 1XBAA 1UKHA 4CCBA 2XVDA 4J96A 3ZHPC 3EJ1A 3RPSA 3GI3A 4ZTQA 3DJ7A 3D14A 1UWJA 5FP6A 2CKEA 2GS2A 1YDTE 4Y5HA 5T68A 4AS0A 3HRCA 3EQFA 4F0GA 4R5YA 4QMOA 4NWMA 5CI7A 1OKZA 1F3MC 1BYGA 3QGWA 4FTUA 4UB7A 5A9UA 3CTHA 4NTSA 5DG5A 2VTJA 5LWNA 1M2PA 4XLVA 1WBTA 3PPKA 4IBMA 2O65A 2WMSA 4G16A 3AD6A 3TKHA 1KOAA 4M84A 2X8EA 3GENA 3MY5A 4O4EA 1ZOEA 4BDHA 2ZB1A 2VGOA 3LHJA 5JKGA 2X0GA 1OPLA 2BIKB 2VD5A 5M4FA 4O6LA 4BYJA 1V0PA 3F3TA 5L2IA 1AD5A 3UG2A 3CPCA 2EXCX 4O7RA 2PZPA 4RWIA 1YW2A 3IW6A 4WSQA 1LPUA 2XF0A 4LRKA 4L3LA 2DYLA 5A4TA 3H3CA 2CGXA 1IR3A 2XJ1A 4K1BA 2XK9A 4RZWA 1XO2B 2J7TA 3KK8A 4ASDA 4S32A 3EN4A 5KMJA 3GOPA 5KHXA 3CKWA 3G51A 4DN5A 4TZRA 4NKSA 2YERA 2JD5A 4BJJB 3O17A 4YLKA 3F2RA 4GSBA 2BRMA 4TXCA 2VWYA 4FTAA 4UALA 3E62A 3ZFYA 4B99A 3C50A 2VGPA 2WMQA 5GNKA 4UX9A 1PXOA 2X4FA 4X7QA 3ZRKA 3U4WA 4K9YA 5HOAA 2WTWA 2BAJA 3R21A 2UZNA 2X8IA 2ONLA 1R39A 3ORTA 4PTGA 2W9FB 4EQMA 4WNKA 1Q61A 3DDPA 3AKLA 4KSPA 4YZBA 4FTTA 4JR7A 3DTCA 3MWUA 4XNEA 3BGPA 2WTIA 4EOJA 3PJ8A 4JOAA 1XH8A 4APCA 2ZJWA 2P2HA 2GFSA 2B55A 4KD1A 3I0QA 3KKVA 3KCFA 4O6EA 4MWIA 3DBCA 2JIIA 4EH2A 2EVAA 3BQCA 5E4HA 1RW8A 4JVGA 3A7IA 5HGIA 2AEGA 2EB2A 3GC0A 4Y83A 4D2PA 5A4CA 5HICA 4RC2A 2WMVA 1KE5A 3VBTA 4FV2A 4L67A 4CV9A 2C6LA 2VUWA 3AC1A 3SX9A 2PVHA 3GEQA 3MBLA 3ZSHA 4ERWA 4ZY5A 5K9IA 3P08A 5C8MA 3DB6A 4GH2A 3WZEA 1WBNA 3C4ZA 5IUGA 2QKRA 3A61A 5DPVA 4FZ7A 3OWPA 5EM6A 1NVSA 3LFQA 2HW6A 2E9VA 3A4PA 4AGCA 5EDQA 3LFFA 4DH8A 4W9WA 1OPKA 5AV3A 4PP7A 4FZ6A 3PDTA 3QCSA 3Q2JA 3TEIA 5KUPA 3ETAA 1Z9XA 2WIHA 4KA3A 4ALUA 2OI4X 2YLFA 4ACCA 3DU8A 3E5AA 4HVDA 1OKWA 1ZYDA 3MH3A 2PUIA 3W0NA 4MEDA 5C1QB 3G2FA 2XKEA 3LFSA 4ZSEA 2BMCA 3LFBA 5J5TA 1VR2A 2PE2A 1P4OA 2C0IA 4FSMA 3OP5A 3Q4ZA 4FTIA 2PVJA 3RNIA 1V0OA 5DHJA 1B38A 1K9AA 3FL4A 4YJSA 1FGKA 4DFNA 1YXXA 3KQ7A 4XBUA 3MW1A 4EORA 3S95A 4ITJA 3ZRLA 4MF0A 4EWHA 3M42A 5L4QA 4B4LA 5M44A 2CKQA 5CSVA 4ZY4A 5DBXA 5E8ZA 4UN0C 4XMOA 4FMQA 2YM5A 1JLUE 4H1JA 1Q5KA 2OZAA 2VX0A 3R01A 3ZO2A 2P33A 3R6XA 4YJVA 5CZHA 2X9EA 1U54A 5DEYA 4YZ9A 4FNWA 3IG7A 4TY1A 1ZMWA 4DDIA 1W7HA 2BIYA 4XP3A 1ZOGA 2R3PA 4AP7A 3SOAA 4AOIA 3QCXA 2VX3A 4IVCA 4FG7A 4TTHB 3PXKA 4ERKA 5BX0A 4FIGA 3C1XA 3JS2A 4I94A 3UC4A 3TCPA 4AQCA 5AEPA 1O9UA 5IA5A 2ZOQA 3MFTA 4IEBA 3I60A 3VC4A 3QL8A 2RFNA 1FOTA 3MA6A 3V04A 3ZCLA 4EOOA 5AUTA 5J79A 3IGGA 3HAMA 4L42A 4BTKA 1XH4A 2GHLA 3EQIA 4MX9A 4YJNA 4PY1A 3QTXA 4GL9A 5CEIA 3Q6UA 2UZVA 1BLXA 5H9BA 1WVWA 4E1ZA 4EEVA 4D2RA 4UMPA 1KOBA 4CKJA 5M06A 3SG9A 4RQKA 5ANIA 1XQZA 2ONLC 2PY3A 4V05A 3TZ8A 4BZDA 2QG7A 4BDAA 3MS9A 1H0VA 5EM8A 3GNIB 4RPVA 1NW1A 4HYUA 4EJ7A 5KMOA 4PF4A 2BHEA 1F0QA 3PFYA 1CKIA 4A4XA 2NYAA 3TJDA 4ZY6A 3OXTA 3WF9A 1O6LA 2DWBA 4TN6A 3DGKA 2VWWA 5FEQA 4IE9A 1O6YA 3CGFA 3R1SA 5H3QA 4AE9A 4E6CA 2LGCA 2R3RA 2PMNX 4KWPA 5AM6A 4B7TA 4I23A 5CEQA 3R00A 3FI8A 4GCJA 4AX8A 3GFEA 1RE8A 3ZSGA 4RQVA 5JFSA 3NDMA 2HY0A 2J9MA 4EC8A 2HIWA 2XJ0A 4IM0A 4LUDA 4U41A 2ZVAA 4BB4A 5CT7A 3DNEA 3IW4A 2WZJA 4KSQA 2GSFA 2W4OA 3HA8A 4KIKA 2A98A 2C6EA 2FH9A 3TM0A 5M09A 4ALWA 3CKXA 5CSWA 2WMBA 3ZXTA 4F65A 4ZTHA 2J50A 4YSJA 1XH6A 4F6SA 5ANDA 1TQPA 2HENA 3D7TA 4NEUA 4IDVA 3WF6A 5L3AA 2PUUA 5HKMA 3HAVA 2YJRA 1IG1A 2QHNA 4NZWB 3A60A 5AMNA 4CVAA 4OTGA 2OLCA 1XMMA 4IFCA 3V5LA 2PE1A 5E8SA 4U9AA 5M57A 1YXVA 4CEGA 4BWKA 3IW7A 5CU3A 3EMGA 2WTJA 1PXPA 2A1AB 1JKSA 2B7AA 3EL8A 5AP2A 2OWBA 3HVCA 3ZTXA 4ONAA 3E8DA 4I93A 4LL0A 1OKYA 1PKDA 4GYGA 3EQPA 5TF9A 3E8CA 4YO6A 2WAJA 2BTSA 4I5CA 5HBHA 3FEGA 3Q60A 2BAQA 4IH8A 5FDPA 4F78A 4RX7A 4OBQA 1WBVA 4FT9A 3UQGA 3ZRMA 3QC9A 4W4XA 4QYHA 2X7OA 2QOIA 3QCQA 3ZBFA 4APPA 5IH5A 3BL7A 2BPMA 3ULIA 4BF2A 2J5EA 3GCSA 3JUHA 4HCTA 1E1XA 3DZOA 1XHAA 5FRIA 2ZFYA 3BGZA 5M4UA 3WI6A 4X3FC 4A9UA 4P90A 4QTDA 2OIDA 5JRSA 4C4FA 4O0UA 2OW3A 3TV7A 3R9DA 4EH7A 2XKDA 4O21A 3AKKA 3W2QA 4FV7A 3L1SA 2C3KA 5AV0A 4C4GA 1JWHA 2OZAB 4I4EA 2CNUA 3ZM9A 4BIDA 4ZS0A 2WMXA 4OT5A 4MQ1A 4RX5A 3D2KA 2QR8A 4BBEA 3QTRA 4XV3A 4PPAA 1U54B 4GU9A 2FUMA 4OTQA 4S2ZA 3KF4A 4WG4A 1GAGA 1YVJA 2BRGA 1H01A 4IB5A 3P4KA 3ATTA 4IQ6A 3MV5A 1ZYSA 3MVHA 1Y8YA 2WMUA 3OWLA 3FC2A 3RINA 5E8WA 2ITPA 3KK9A 4TYEA 3HNGA 3UYTA 3WF8A 5H8GA 4CT1A 4FTRA 1ZWSA 5F20A 3E92A 2GNIA 3II5A 3N51A 3OF0A 4BHZA 3W2PA 4C2VA 4DBNA 4EKLA 1MUOA 4FV6A 3P86A 3TWJA 3F69A 2W1HA 3TDWA 4DHZA 4E7WA 2UW7A 3QKMA 3LQ3A 2HXQA 4LI5A 3TG1A 4FOBA 2GFCA 4G31A 2RGPA 4MVFA 5FXQA 3IKAA 3Q3BA 4M14A 4NT4A 2R3HA 2WQMA 1OVEA 2ZM4A 4M0YA 3R7UA 4AZVA 4D2SA 3HMIA 2ZYBA 2X0OA 3FZOA 5CANA 1UKIA 4FGRA 4XS2A 2FSLX 3QHRA 4CFMA 2ERZE 2VU3A 4KRDA 2VTRA 3MA3A 4MQ2A 2J0IA 2QOQA 4M12A 4BCJA 5BPYA 1YI3A 5FXSA 4AGUA 4D0WA 1KUTA 4GUBA 3WILA 1PHKA 4EBVA 2NRYA 4N70A 3QQJA 4DHFA 3FXWA 3R8LA 2P55A 4RJ6A 5FLFA 3ZXZA 4OAVB 5DNRA 3S1HA 3W0RA 4AAAA 2R5TA 3QKKA 4FKUA 4WUNA 3UMXA 3PY3A 4WRGA 4DTKA 1JSUA 5JGDA 3KREA 4UZDA 1R1WA 2W17A 4IAZA 4D1ZA 4XEYA 3QUPA 3VQUA 4F1OA 1R0EA 4O0SA 4E4LA 4LGHA 4A9TA 4K11A 4HCUA 5BQ0A 1OM1A 4QYYA 4BIBA 2ZV7A 3ZO1A 1LP4A 3TNHA 3C0IA 4WBBB 3UP7A 2X0PA 1U59A 3KXGA 5DVRA 3RWQA 3FUPA 5BVNA 3HYHA 4KIKB 2HW7A 3RCJA 3QUEA 3U87A 3VN9A 3DAEA 4IIRA 4LOQA 3PP1A 4O7LA 5CWZA 5F94A 4MXXA 3LXLA 3VO3A 2BUJA 5H8EA 3ORKA 3PYYA 4JBVA 4XV9A 2X4ZA 3D7TB 3QYZA 3GVUA 1WCCA 2GCDA 5HG9A 5HO8A 3ZZEA 3G6GA 5EQYA 3NNVA 3A7JA 4BKJA 3UO5A 3DKGA 3A7FA 2BRNA 3JPVA 3QRTA 3QXPA 3L8VA 2CDZA 4FKOA 3ZBXA 1ATPE 4JQ7A 3MJ1A 3TUBA 3LKMA 4V04A 5HTBA 3C5UA 4BBMA 3D5VA 4FT3A 3RZBA 1OBDA 3CBLA 3FMHA 3P7BA 2C6IA 3BHYA 4PNKA 1H24A 3A7GA 3FMKA 3GC7A 4R8QA 4B9DA 4ZS4A 2C5OA 4AN3A 5IU2A 3BHVA 4I6HA 1OL7A 1YWVA 2J6MA 4RVTA 5T6KA 3UGCA 5IMEA 3UC3A 5M53A 1BI8A 2BALA 3MIYA 3BQRA 2YN8A 4JBOA 2QOFA 4JG7A 3R83A 3VW8A 5CEPA 4O7YA 3GC9A 3OG7A 4FZDB 5FM3A 4GJ2A 5GJGA 2FVDA 3BU3A 3ORXA 5TR6A 3BPRA 4X2JA 3G9LX 4AE6A 4AA5A 3OOMA 5CVGA 4ZP5A 4ASZA 4LDTA 3EH9A 4TRLA 1GZNA 4PL5A 3ELJA 3UIBA 4PNIA 1APME 3NNWA 3CJGA 2EXMA 4ZLYA 4MK0A 2XIXA 1SVEA 3NYNA 5AX9A 4YHFA 4JL9A 2ITNA 2BHHA 4YUQA 4RC4A 1NVRA 3VUKA 5IA3A 5AWMA 2IPXA 4QRCA 5JFVA 2YA9A 2YIRA 4U43A 1DM2A 3V3VA 1M2RA 4DEAA 2JFLA 2I0VA 3QYWA 3V5TA 3W0MA 4J71A 4S31A 2XAOA 3G5DA 4O2ZA 3O23A 4BGQA 3EB0A 1J7UA 1L8TA 2XRWA 2RFEA 3U4UA 3NYOA 3IECA 4HYSA 5AR3A 4CXAA 4F7NA 1IAHA 1XH5A 5KMKA 3C4FA 3EZRA 1W2DA 5KMIA 4F7LA 1ZXEA 3DCVA 4PMMA 1XMLA 4PL3A 1OB3A 2FSMX 3LIJA 1A06A