1LUFA

Crystal structure of the musk tyrosine kinase: insights into receptor autoregulation
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
301
structure length
275
Chain Sequence
LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSFCSIHRILQRMCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords muscle-specific tyrosine kinase receptor musk
publication title Crystal structure of the MuSK tyrosine kinase: insights into receptor autoregulation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 95
structure length 275
sequence length 301
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2002-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1lufA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1lufA01
2CPKE 4QMLA 4FEXA 3OCTA 4BDAA 4KAOA 5I9WA 3O7LD 4EORA 3QQUA 5AP4A 2VTSA 5FP5A 3VS5A 4RC4A 5E92A 5K3YA 3AC8A 3CGOA 5BVFA 1YOJA 2VTRA 3F2AA 3GCPA 4I0SA 2QO9A 4L3LA 4WUNA 4D5KA 4YSJA 1WBPA 3GC0A 3FQSA 3I5NA 2GNHA 5CI6A 4UZDA 4FEQA 4YLKA 5CU6A 3LM5A 2W99B 4NIFA 2VTJA 4FL1A 3W8LA 1H1WA 3DKGA 3D5XA 2P4IA 3NYOA 3TZMA 4F9WA 3OWPA 3QTZA 4AA5A 4AZEA 3CY2A 1X8BA 2WMXA 4FTTA 3KEXA 1OBDA 2B4SB 3WBLA 2YM6A 2GHLA 5JN2A 3AT3A 3NAYA 1I09A 2UVZA 3RK5A 3KVWA 1SMHA 4FV7A 5KHWA 1YDSE 2FB8A 1Z57A 4D2WA 4UN0C 5IA3A 3V5PA 1MRUA 5IQDA 2XKFA 3OCGA 4PUZA 5IQHA 4O7ZA 3L8SA 5CSWA 4U43A 3VBWA 4U42A 4ZK5A 4B4LA 4I0TA 3ZRMA 1NW1A 4O7VA 3LXLA 4FG7A 4MD8E 4A9SA 3R8UA 4ERWA 3LZBA 3F66A 2X7FA 4MH7A 2JKQA 3R8ZA 1WVXA 4ACMA 3SA0A 3AXWA 2XBJA 4KB8A 1RW8A 2HZNA 4AOIA 4IVAA 4EWHA 4BKYA 2ONLA 2QO2A 1BMKA 2UW3A 2YIRA 4NM0A 5EG3A 3RAKA 2F57A 2F7EE 3HP5A 5JRSA 3FMEA 2QO7A 4NKAA 4RJ7A 4IJPA 3VRZA 5HE0A 3QQHA 4YGAA 2XCHA 3S95A 5T6KA 4BDDA 2QR7A 2XK9A 2VO7A 2GSFA 3VJOA 5HVJA 5HIEA 4APCA 1YQJA 4JQ8A 4LG4A 3VS3A 3TV6A 4EHZA 5A4CA 4BGHA 3LIJA 5AR2A 2IZUA 4FOBA 4BDEA 3DBEA 4F6SA 2O3PA 3W33A 5K4JA 4JVGA 5FP6A 4PY1A 4DCAA 3AT4A 4R1VA 3IW5A 2XNOA 2B53A 3N51A 4QMZA 4XG3A 4YZBA 2UZOA 5AA8A 4DA5A 3ERKA 3PLSA 4KWPA 3FPQA 4C61A 2X9FA 3ZSGA 2W9FB 3R8MA 2QOIA 2CN5A 2VWWA 2XH5A 2ZM1A 4G3CA 4IACA 4USEA 4O0YA 4GEOA 1KE5A 3R2BA 1H27A 4FTUA 5HESA 4NM5A 3O8PA 2RL5A 2JDVA 4YHTA 2QKRA 1JNKA 1HCKA 3FKNA 2NO3A 3QLGA 3SOAA 5CWZA 1YW2A 5E8YA 1O9UA 4WA9A 4M67A 4JQEA 5AEPA 4APPA 3LJ2A 4G9RA 4HVGA 3QZGA 5DRBA 3GT8A 2YDKA 3W16A 2XNEA 2W5HA 3HA8A 4YJNA 2PULA 2UVYA 4ID7A 4FSWA 5IUHA 1U54B 2WHBA 3EFJA 2XVDA 4L52A 1XH5A 3PVBA 5HZNA 2ITPA 4EOQA 5GINE 4TY1A 2OLCA 3FMNA 1DI8A 2BDWA 2ETKA 3BBTB 3PG3A 5EW3A 5CAUA 2X8EA 4RJ5A 3PRIA 4RA5A 3RJCA 3B2WA 2V0DA 4FL2A 2WMTA 3Q3BA 3HV6A 4H3BA 4O91A 1H1QA 3P86A 3U6HA 2XK3A 5DEWA 2QONA 1BL6A 5B2KA 2YIYA 4MHAA 4ZLZA 3BYVA 3BBWA 3GC9A 1B6CB 4CNHA 3OZ6A 2VGOA 5L8LA 4KD1A 3MPAA 4K33A 1P14A 4IEBA 3R83A 3S4QA 4FA2A 5LVNA 1ZARA 4F6WA 2G15A 1G5SA 4CMUA 2HELA 1ZYSA 4AE9A 3FLSA 4J95A 5IH4A 4O7TA 2A27A 2JAMA 2GU8A 4YHFA 3BX5A 3UYSA 4YUQA 2QCSA 4EONA 5H8GA 5JGDA 2NPQA 2UZDA 1PXKA 3F5XA 3G33A 3CTJA 3RCJA 4A9UA 5EHOA 3OY1A 3I0OA 1ZAOA 3QD3A 1CM8A 2WQBA 3JS2A 4IM3A 3ORKA 4YZNA 1ZZLA 5AUTA 1ZMVA 1OZ1A 3AGLA 3HAMA 1WBWA 1KE9A 4FIIA 4OT6A 4ZSLA 3AD6A 3TTIA 3EL8A 1FVVA 5IDPA 4JAIA 1UV5A 1UVRA 4RVMA 5CXZA 2OF4A 4C4IA 2XK6A 2C5VA 1DS5A 4GG7A 5CNNA 2BVAA 5JGAA 2HYYA 3TV7A 2VTAA 3F5PA 5DNRA 4C2WA 3EN6A 1H24A 4YPDA 4ANLA 5IMXA 3LCKA 3DQWA 1M7NA 3KXZA 1LP4A 2F2UA 2OKRA 3ULIA 2PY3A 4GK4A 3FUPA 5DGZA 3ZRLA 2VTPA 2C69A 1JSUA 5BNJA 2ITQA 2PZIA 3GNIB 4QMNA 1OIQA 4KRDA 3I1AA 3KXHA 3DDQA 4UWBA 4Z7HA 3WI6A 3EQFA 4FKVA 1GIHA 4LYNA 2OJIA 1VYWA 5BYYA 4XG8A 3RZBA 5KMNA 3OY3A 4K11A 5GZ8A 1U46A 4FK3A 2I0EA 3H0YA 3NIEA 4OBOA 3E63A 3MYGA 4G9CA 3JYAA 4J97A 4CCBA 2XNNA 2PUIA 3D7TB 4A06A 3C4WA 4UY9A 5K5XA 1OKYA 4X2FA 2O0UA 4C4FA 5M55A 4F08A 2ETRA 3TDVA 1Q62A 4FUYA 4AGCA 4LOOA 3SXRA 3P9JA 4QPMA 3VC4A 5E91A 3GBZA 4QMUA 1FOTA 4IDTA 2R9SA 1QPDA 2PVFA 2RFSA 4IAFA 3FXZA 4EH6A 4EOJA 4OAUC 4YBKA 2VX1A 5IQEA 5CTPA 5BQ0A 5HTIA 4YZDA 2PZ5A 2UVXA 3ROYA 3JY9A 4DF3A 1QPJA 3P08A 4FC0A 5L8JA 1IA9A 1OIYA 4MF1A 3DK3A 4IX5A 4YLJA 3QYZA 3GI3A 3FWQA 4E20A 4MNFA 3ZZWA 4PP7A 3UG2A 3EZVA 4RIYB 5KZ0A 3SG8A 5KKRC 3UBDA 3MFRA 2VWBA 2R3LA 4QOXA 5FBNC 4QMXA 2ITWA 3PPJA 3RPOA 4QMOA 4BI1A 4DH7A 2EWAA 4Z7GA 3ATSA 2DUVA 3MPTA 3FC1X 5CU3A 4FIHA 4JQ7A 3TN8A 4CLJA 1QCFA 4JAJA 3NRMA 2BDJA 4O27B 4UEUA 4OBPA 5E8WA 5A4LA 4FX3A 3NW5A 1YRPA 3PZHA 4FK6A 4I21A 4DH8A 3TUDA 3DY7A 3EFKA 2ZB1A 3MY0A 4X3JA 5A6OA 4G5JA 3CQUA 2H8HA 3OCBA 4NUSA 3L9NA 4DT9A 4C34A 4TTHB 2YACA 4W8DA 1IAHA 2PHKA 4BDBA 4CRLA 4DINA 1PRYA 2VWXA 4TWNA 2X4FA 3BWJA 4LMNA 4QPSA 2YZLA 4YHJA 2W1FA 2GPHA 1H0VA 3BYMA 5BVWA 5AUUA 2FGIA 2JLDA 3SV0A 5D7VA 4E5BA 5JH6A 1U54A 4KBAA 3ZUUA 2ZMCA 4U5JA 4NEUA 3RPVA 4G6NA 3BHUA 3P7AA 2BRMA 3L8VA 4U40A 4O7SA 3LW0A 3EQCA 4KSPA 2XJ1A 2OJGA 3FV8A 2Y9QA 4G6OA 4EHVA 4R3CA 4MQ1A 3CSVA 2HXLA 3IKAA 4H3QA 1SNUA 2B55A 3PXQA 5BUJA 4J1RA 4MXYA 3ROCA 3W2PA 3FZRA 1JAMA 3CGFA 2VAGA 3LJ1A 4YZCA 4UMTA 5GJGA 4B7TA 3RINA 3LOKA 4R7IA 5DT4A 4ANOA 3LLTA 2UZLA 3D9VA 4Y46A 2XIKA 4CKRA 1UA2A 2XJ0A 3FXXA 3VUGA 4XG7A 4ANMA 2O8YA 3BZ3A 1H00A 5FUTA 3R04A 4E5WA 3NYVA 3ULZA 3U55A 2R7BA 3CTQA 5C4KA 1FBNA 4RX8A 4H58A 4ASEA 4UMPA 2F9GA 4JI9A 5HU3A 4XS2A 2HZIA 3Q9WA 1PXOA 5F1ZA 3EL7A 5CS6A 3QTRA 4BHZA 4DGLC 3ZFYA 2B54A 5L2IA 3LKMA 4ZLYA 3MS9A 3I7CA 2BROA 3FC2A 3WF9A 3HRFA 4J71A 4FSQA 3U87A 3QZHA 2DWBA 3ODYX 4FZAB 5JSMA 4GFMA 2CKPA 3O23A 3OWKA 2LAVA 3FZSA 4I41A 2BDFA 4I20A 3QX2A 5FDXA 1TVOA 4D4SA 3KMWA 1ZY4A 4AA0A 4F1OA 3PJ1A 3LVPA 5J7BA 1OL5A 4RLLA 1PXJA 2I0YA 3AQVA 2BHEA 1IR3A 4IDVA 5AM7A 1RE8A 3TJCA 1VYZA 4EKKA 2R2PA 3NNWA 3UNZA 1PXPA 3QCSA 5FWKK 3ETAA 1UWHA 4UB7A 4EH7A 4ZXTA 1ND4A 5AR7A 5KUPA 4FSUA 1OECA 4QP4A 3V8WA 3ZXTA 1RDQE 3QRIA 3EQHA 2PU8A 4K77A 4ZTNA 3S1HA 3MH1A 5BVEA 2CGUA 4KBKA 3HRCA 4MXAA 3EQGA 4E6QA 4I6HA 4U6RA 2PPQA 4ZTMA 2C3IB 2R3PA 3QLFA 3KKVA 2IW9A 5EKNA 3MN3A 4I24A 3FJQE 3RHKA 2OGVA 3BU6A 4C4HA 3LMGA 4Y85A 5HD7A 5HTCA 3CY3A 4H36A 3K3IA 3H10A 4D4RA 1W8CA 5BX0A 1M2PA 4FT9A 2IVTA 2GHGA 2YM3A 3R9OA 4ZJVA 3KRJA 3IW6A 5H2UA 3ID6C 3F7WA 3L9LA 4FKIA 2ZYBA 3D7TA 5DE2A 1J1BA 5FRIA 3IGGA 3DNEA 4IVDA 5KKRB 2E9OA 1H08A 2GS7A 2GDOA 4PL5A 2PVJA 2B9HA 5JZNA 3ZZEA 3IOPA 5CU0A 1B39A 3OBGA 3MJ2A 3VF8A 4JRNA 1IEPA 3PFQA 5GJFA 3VUDA 4NSTA 4D4YA 4XJ0A 4CFWA 4EYJA 4FKTA 5EQYA 3HMOA 1WBTA 3ZU7A 3BQRA 3PY3A 4E6DA 1P4FA 4RIYA 2WD1A 4TZRA 1OKVA 5DHJA 2J0IA 2A2AA 3DQXA 3PZEA 4PMTA 5EYDA 4GU9A 2R3OA 2GS2A 2HOGA 3PSDA 1TQPA 3KU2A 3PYYA 3UOLA 5ANIA 3V5TA 2CGVA 3G6GA 4EZ3A 2VGPA 1KV1A 3MVLA 3ZBFA 2YISA 2ZM3A 4PTEA 4IZAA 5IEYA 5AFVA 3A8XA 3OS3A 3RM6A 4HYUA 4FKWA 4XUFA 4AZVA 1CSNA 2X81A 5AP2A 2ZDUA 3DT1A 4RWLA 5FXQA 2J0LA 3HUCA 5CF5A 2J4ZA 3EN9A 3RNYA 3QHRA 5LXMA 2VTOA 2OICA 3PXFA 3SHEA 4GT3A 4OTWA 2XEYA 5E7RA 3LQ3A 4FSTA 3AT2A 1J7UA 5DR6A 4BCGA 2EB3A 4O0SA 3DFCB 4YNOA 5HKMA 5FEEA 5A3XA 4BL1A 3I60A 4AT4A 3Q5ZA 1JWHA 1SVEA 4W4VA 2BCJA 3POZA 5E9EA 3CP9A 3HYHA 3I5ZA 1WAKA 2YLFA 2ZDTA 2J6MA 4ZTHA 4NH1A 5AV4A 3V6RA 3ZUVA 4DEEA 3E8DA 3EQDA 4HVSA 2XZSA 2C6OA 3GVUA 4X21A 3DS6A 4JDJA 4FR4A 3KVXA 4CYIA 4OGRA 1IA8A 3QQLA 4BKJA 1HCLA 3KN5A 1RJBA 4X7QA 4DFUA 4AE6A 3OHTA 2C6LA 4MXCA 3O8TA 4YMJA 4BYJA 4ITJA 4O0VA 3GXLA 2BZJA 4OTGA 2C68A 3UVRA 4AXAA 4Z55A 2V5QA 1WVWA 2PVKA 3R7IA 5IU2A 3DTCA 4D1XA 2ZV9A 4DEDA 3KXNA 4BRXA 4RFMA 4E4MA 2BZIB 2B7AA 3G5DA 3F3UA 4ASZA 1UWJA 4F0GA 2W4OA 3E3BX 4XLIA 5IA0A 2IVSA 3ANRA 4EZ7A 1YDRE 2C5XA 4CQGA 4XP0A 4ZTSA 5HICA 5JQ5A 3QCYA 4NIFB 1OI9A 3ZBXA 3CPBA 4NWMA 3R7UA 5IQGA 3VW8A 2XMYA 2OXDA 1XH8A 3QYWA 1NT2A 1V1KA 3FDNA 4RVLA 5IQCA 3IK3A 4RPVA 4YR8A 4WBBB 2VWZA 2Y8OA 2UW8A 4F9AA 5LQFA 4X6RA 4AFEA 2ACXA 5IA5A 4BN1A 4F7LA 5J9LA 4FKUA 3H3CA 1JKLA 2BKZA 4PTCA 4EC9A 3DNDA 4NJDA 5I4NA 1P5EA 3NYXA 3SDJA 4BCHA 2PVHA 1PW2A 2GTMA 2OJ9A 2YERA 4HCUA 5AV2A 1IG1A 3A7FA 3AC1A 4I5HA 3ZEPA 5LWMA 3H4JA 5FM3A 5L2TA 4F9CA 4X2JA 4DFZE 2W1HA 5DYJA 4O6LA 2OIQA 3W2OA 4TYJA 4XBUA 1JVPP 1XR1A 2PL0A 2R4BA 2YAKA 2ZV8A 2PE0A 3TXOA 4DG3E 4BDIA 4AS0A 3L8XA 3NS9A 1J1CA 3CC6A 5L2SA 5CNOA 3FQHA 5EHLA 5IUIA 1U5RA 3VQUA 4F4PA 1XQZA 2VTNA 5FM2A 2X8IA 4EQCA 4ZLOA 5HE2A 4TWPA 2C30A 5HG8A 2BRGA 4GK3A 4G34A 3BLRA 3OWJA 5IISA 3Q04A 3FL4A 1XO2B 2VD5A 3UGCA 3UIUA 4ZMEA 3F61A 3RALA 4YC3A 2RFDA 4RA4A 3P1AA 5ETFA 3FI3A 5C27A 3RKBA 3R9RA 3GGFA 3NZ0A 4OTRA 5EH0A 5ETAA 4QTEA 5J7HA 4ZTLA 4EH5A 3DA6A 2VO0A 3QRJA 2GMXA 1OUKA 2ITOA 4DTAA 3O0GA 4TYEA 4KRCA 4ZS0A 1GAGA 3PA3A 4FT5A 4F9BA 1YXSA 2Y4IB 4EHGA 3HZTA 3D4QA 4RZVA 3HECA 4G5PA 4E6AA 2ZAZA 3R7GA 3F2RA 3MB6A 4AGWA 5E4HA 2BUJA 2QOQA 4J99A 3QQKA 4YJVA 4TRLA 4N70A 2C1AA 3LFFA 4M0YA 5E90A 2R3NA 2Z7SA 3UPZA 3VQHA 3V3VA 3F7ZA 2H6DA 4NJ3A 4D9UA 2YDIA 4MKCA 5M4FA 1FINA 2CGXA 4CLIA 4FSMA 3U4WA 3NUAA 5BUIA 3PG1A 1PKDA 3TNPC 3I6UA 5JGBA 3HV3A 2OK1A 3Q6WA 4GG5A 4O81A 5LCJA 3EQBA 4EOOA 4QYHA 2XM9A 2ERKA 3R28A 4JLCA 3R9HA 3VUMA 4MX9A 5KE0A 3ZTXA 4FT7A 4HGSA 2WQEA 3MSSA 5CAPA 4BGQA 3MB7A 3RGFA 3NR9A 1H1SA 4R77A 4EK3A 4PMMA 3C0HA 4FG9A 3DGKA 4ZZOA 4RWKA 1H8FA 3FSFA 4AZFA 3UQGA 4WIHA 3S3IA 3Q2MA 2E9UA 3UOHA 1OPKA 3FMLA 4TL0A 2X0GA 2XBAA 1BI7A 4CD0A 1SVGA 2GNGA 4YO4A 4RWIA 4TPTA 3F3WA 3GCUA 3JXWA 4L68A 4YBJA 5FTOA 4AGUA 4BTKA 1XH6A 4JX3A 2WTDA 2X7GA 4DTKA 2ZJWA 5CENA 1JOWB 3D7ZA 4L6QA 4G1WA 3SW4A 5E8VA 5HLPA 3NVKI 4AA4A 3SOCA 4EUUA 4FNYA 5CU2A 3KK9A 4GJ2A 1OPJA 4YO6A 4DGMA 3PPZA 4K0YA 2VTTA 3TJDA 3ZXZA 3UOKA 3FKOA 4BTJA 4YLLA 2G2IA 4DGNA 5AV3A 3LFCA 4L9IA 1REKA 3ACKA 1XKKA 2W9ZB 1FMKA 4FZDB 4C0TA 5L6OA 3ZHPC 2UW5A 2OFVA 4GVJA 4UWYA 5CXHA 4EI4A 2PMNX 3LFQA 2Z2WA 3LJ0A 4O86A 4I93A 4BDJA 4FE2A 3IS5A 4BI2A 4DGOA 1R39A 1WBNA 3COMA 4YC8A 3D5WA 4M13A 3ALNA 5CEMA 4RFZA 3HEGA 2J9MA 4G17A 5H3QA 3UTOA 3CJGA 5DFPA 2UZUE 1YVJA 4OBQA 1JSVA 5DRDA 5EM7A 4MBJA 4S32A 4IWPA 5KMIA 5CU4A 2QLUA 1KUTA 4LUDA 3D14A 1Q99A 4D2VA 1MRVA 4ANNA 3NEWA 4IWOA 4QO9A 3E3PA 4EUTA 2GQRA 4ITHA 1H1PA 1Q24A 2JITA 1U4DA 2PMIA 4FBXA 3BYSA 1E1XA 1OITA 2B9JA 3EKKA 2LGCA 5DIAA 3FBVA 4CZTA 4EOMA 3PXZA 4RVTA 3KB7A 1UKIA 4KUJA 5E1SA 4KABA 4J8NA 4CTBA 3WZJA 5F4NA 4D2TA 4EH4A 3UO4A 4KIOA 2YCSA 5FDPA 1H0WA 4HCTA 4M66A 2WQMA 4USDA 4ZSEA 2FSOX 2REIA 3P4KA 1O6YA 2FYSA 4N6ZA 4QP6A 1PXLA 1H1RA 3A61A 4DFLA 3GP0A 3V51A 4M68A 4QP3A 2BPMA 1YHWA 2VV9A 3C13A 4K8AA 5I9ZA 5HX6A 3R00A 3C9WA 2QOLA 3R2YA 3WIGA 2EXEA 4QTDA 4DE4A 3P5KA 3HRBA 4BBFA 3D2IA 4BWXA 3UO6A 4L7FA 4BCKA 4BC6A 4YJQA 2BZKB 3U4UA 3UNJA 2YWVA 4QRCA 3DKFA 5HOAA 3W2QA 3OG7A 2YEXA 2GTNA 2JDOA 3FYJX 4V0GA 2KULA 5HO7A 3MH2A 3EQRA 2WPAA 2WTIA 3IO7A 4IIRA 5LARA 2Q0NA 4LOPA 3OXIA 4S34A 3V04A 3BYOA 2W1DA 2BAQA 2OO8X 4HVIA 3E92A 4EBWA 3CKXA 5J5SA 3RPSA 3ZUTA 2A4LA 2I7QA 2BAKA 3QUDA 1Q8ZA 3RAWA 2JKMA 2C4GA 5ICPA 4O0RA 4YJUA 4FVRA 4JG6A 3PJ8A 3QWJA 5AR8A 4O2ZA 3EZRA 3PP1A 4M97A 4QYGA 3KXMA 5M53A 5JFXA 4MF0A 3DCVA 4XRLA 3D5VA 3NAXA 4OTHA 3S0OA 1MQ4A 1GY3A 1NY3A 4YNEA 5AUWA 3TNIA 4WNPA 4DH5A 2ITZA 2XB7A 4I5CA 4IQ6A 4XOZA 4JXFA 3M1SA 3PRFA 4FT0A 5CASA 1UU8A 5CX9A 1WBOA 5AUYA 3T9TA 1Q61A 2P3GX 2PK9A 2WB8A 4BVUA 4GKIA 3W10A 4U97A 1P2AA 3QX4A 3RWQA 4ENYA 3DBFA 2V55A 4XMOA 1Q3WA 4KKGA 5DOSA 4QTCA 4RBLA 4W9WA 4FSNA 2QD9A 4CXAA 5JKGA 2UW7A 4MBIA 4WG4A 3R30A 5AUXA 3MFTA 5C9CA 5C03A 4L3JA 4F1TA 2RG6A 4D2RA 3HMNA 1STCE 2BIKB 2BMCA 4EQMA 4GCJA 5ACBC 1A9UA 4I6FA 3RPYA 3MWUA 2CGWA 4IM0A 4UXQA 4C59A 3VUIA 4E5AX 3ORMA 2XEZA 3QD2B 4GV1A 4IAIA 4ALWA 2UZWE 2VWUA 3NUUA 2FUMA 3VAPA 2VWYA 1A06A 4CG9A 1YWRA 2W0JA 4DN5A 4R6VA 3ITZA 3T9IA 3VBXA 5KBQA 5M51A 5BYLA 3PVWA 3MBLA 4MEDA 3G6HA 4UMRA 3Q9YA 2XKEA 4BCNA 2O63A 2C6TA 1KOAA 3F3ZA 4QMYA 4Z16A 3COKA 5AV0A 4ENXA 2PYWA 1W83A 3FI4A 3A7GA 3K3JA 3LXPA 3VUTA 5C26A 2ITVA 3DZOA 2CCHA 4EOPA 4XG9A 3OOGA 4YJOA 3NNXA 4QP2A 2ESMA 3PA4A 3DKOA 5E1EA 3R8LA 4BGGA 3CD8A 3QRUA 3R9DA 3BWFA 3DXNA 5L2WA 2VTHA 1YWNA 5DPVA 3EB0A 2CJMA 5AMNA 4CFXA 3GQLA 3QGYA 5EDQA 4RIXA 5DT0A 4C38A 1ZYJA 5HNGA 4D58A 4BIEA 4TWOA 4DEGA 3E7VA 3ZS5A 3VBQA 4F1MA 4MAOA 1PJKA 2C0OA 3QTWA 1WFCA 4FV9A 4TW9A 5F20A 4IZ7A 2RKUA 5IQFA 3A4PA 3CCNA 1GNGA 4MXZA 4R8QA 1GIJA 4DFNA 3LFEA 4X2GA 3CQWA 4O0UA 4X0MA 1IRKA 4BB4A 5ANGA 4BF2A 4GFGA 4ZP5A 5HE3A 2ERZE 2VO3A 4M14A 4W9XA 4LRMA 4QMWA 1YKRA 5HU9A 4IWQA 2PVMA 4V05A 5DLSA 4JX7A 5HEZA 4ANQA 3H9OA 3FQEA 4GW8A 4ACDA 2NP8A 5HG5A 3RMFA 5JQ8A 4RG0A 4ACCA 4WRGA 4O22A 1PMUA 4IC7A 2PVYA 1M2RA 3HNGA 3EFWA 1VEBA 3GC8A 3PXRA 5EYKA 2CKQA 3QF9A 5KHXA 1PYXA 5AP0A 1XBAA 3HMMA 4XG4A 5CAOA 1Y91A 5EI8A 3UC4A 1FPUA 3MVHA 3FPMA 2QODA 3NWWA 3WIKA 3GOKA 3VN9A 3AOXA 5ANJA 2RIOA 2QC6A 4TXCA 3OEFX 4BTMA 3TACA 4DLJA 1R0PA 4G3EA 2GFSA 5FEQA 2NRYA 5L8KA 3EYGA 2C0IA 3AGMA 3RCDA 5CSVA 4LRKA 3SXFA 2WELA 5A4TA 2DYLA 5T68A 5M07A 5AV1A 2HW6A 3OVVA 4YU2A 5IA2A 3E62A 3CLYA 4DH1A 4IMYA 4FKOA 5DBXA 5LVMA 5IQBA 4FZ7A 2R64A 3MESA 2BALA 2X1NA 4EH2A 4NYEA 2X2LA 4FKRA 4MXOA 3F69A 5FLFA 3QD4A 4AG8A 3IW7A 3FLYA 1Q8TA 3ZLSA 2DS1A 2VU3A 4BBMA 4IC8A 3NMUF 2CMWA 4YZ9A 5GIPE 4CEGA 4WBOA 3E5AA 2CHLA 5I9XA 3PLAE 4FV1A 4F63A 1Q5KA 2YABA 4KA3A 3R1QA 2IW8A 4F70A 3LM0A 5CF6A 1OPLA 5C1QB 5HBJA 3KXGA 3LQ8A 3RK7A 4RQKA 3ORPA 5CYIA 4C37A 5HD4A 3ZSHA 5EDPA 4W4XA 4NCTC 5ITAA 5EI2A 3GU6A 3GB2A 3TG1A 2WKMA 4TNBA 1Q3DA 4WG3A 3V6SA 2IVUA 4PDYA 3D94A 5DEYA 4YTIA 2BZHB 1SM2A 5KZIA 5G1XA 5TF9A 4EL9A 4YJPA 5H8EA 2CNVA 1U5QA 1GZKA 1QL6A 3C4FA 4CG8A 3ZM9A 3FAAA 2OIBA 4CZUA 2W7XA 4OTDA 1H01A 4JR3A 5AP6A 1KSWA 2WMRA 2P2HA 4CYJA 3G0EA 3MDYA 5JT2A 4TKSA 3WE8A 3RWPA 2ITTA 5EDRA 4AACA 3FMMA 4V01A 4HCVA 2ITYA 4KNBA 4CKIA 2UV2A 4OTPA 2QOFA 1M2QA 4A07A 5J1WA 4I92A 4K9YA 2J7TA 1PY5A 3K5VA 2RFEA 1XHAA 4FTRA 4MWIA 4QMVA 4C3FA 3JPVA 4PMPA 2EU9A 3KQ7A 2HW7A 3ZLXA 3RNIA 2P33A 4R5YA 4PNKA 4DTBA 2RG5A 3VRYA 2B9FA 2IWIA 3P7BA 4QP7A 3PVGA 5A9UA 5AAFA 2C6IA 2C3KA 3FZTA 4W8EA 2BTRA 2X6DA 4A9YA 3NNUA 3BHTA 2Z7LA 1ZXEA 5M56A 4FYNA 2SRCA 3MFSA 4U7ZA 4ORKA 2QHMA 4B6LA 5M06A 2C47A 2IZTA 3K5UA 4HGLA 2QOOA 3GCSA 5HO8A 3WF8A 5JZJA 2R3JA 3QZFA 4PPBA 1Q8YA 3MVMA 2R0UA 1DI9A 4YSMA 5BMMA 4DCEA 2YCQA 3NPCA 1XWSA 4I0RA 3RVGA 5A54A 4LL0A 2BHHA 5KX8A 3R02A 1CKIA 1TQIA 4FSRA 4R3PA 4NW5A 3B8RA 4TYHA 4AQCA 5IQAA 5AM6A 4ZS4A 4FV5A 3SKCA 3V8TA 5TE0A 2GNLA 3TTJA 3DJ5A 4BYIA 1UU3A 2JFLA 3NW7A 4IWDA 3WE4A 4O82A 2UZVA 4DBNA 4EJ7A 5CAQA 1Q8WA 2E9NA 4I5PA 2FSLX 4CSVA 3LFDA 3OC1A 3OXTA 4YZMA 3SRVA 4NM7A 1RQQA 4M69B 4WSYA 2RFNA 2PWLA 4DEHA 4RX7A 1DAYA 4AOJA 1DAWA 4GJ3A 4D1ZA 2GCDA 3GC7A 5IF1A 4BWKA 2XNGA 3BCEA 2O2UA 3BV3A 3PSBA 2WMBA 4H1MA 4C58A 5I9VA 4BCJA 1OBGA 5CSPA 4GS6A 4D5HA 3ELJA 3EN4A 3PJ2A 3Q60A 3QC9A 2XYUA 2JBPA 4GSBA 4U81A 4XV3A 4DG0E 3DXQA 4HNFA 3QKKA 2XYNA 2PUNA 4L46A 2JBOA 1CTPE 3R22A 4M0ZA 2X8DA 3IW4A 1H07A 4DH3A 5L6PA 2P0CA 4BDGA 2BILB 3QTUA 5TOZA 5IA1A 3BI6A 2BIYA 4QMPA 5K0KA 3LCDA 4FV6A 5IKWA 3NDMA 1IAJA 4JBOA 3MJ1A 3ORTA 2R3FA 4CFFA 3DAKA 5HLWA 1IASA 1Z5MA 4C8BA 3P78A 5G6VA 3FKLA 2BFXA 3R1YA 3R63A 1OIUA 4O38A 4E6CA 5J5TA 5AP1A 4ASXA 4J53A 2QHNA 4IXPA 1GJOA 2P55A 2WTWA 3JUHA 4H39A 4D1SA 5IZFA 4HYIA 3FLQA 5KMMA 2IPXA 2OZOA 3FL5A 4O21A 4ALUA 5AR3A 4GUEA 3IECA 3AC2A 2O5KA 5CVGA 2CCIA 3F5GA 5EI6A 3TNQB 4ASDA 1V0BA 5B0XA 2GS6A 2J2IB 3MH0A 4M3QA 1OKZA 4M8TA 4PX6A 4QP9A 4F7NA 2R3KA 2H96A 3KGAA 2VTIA 3BE9A 5LMKC 5LMBA 5LOHA 2HK5A 3PUPA 5I9UA 4EOLA 3PA5A 2J51A 3BKBA 5ETCA 2VZ6A 2JD5A 4L00A 3BIZA 5FXRA 3PIXA 2BRBA 3W8QA 4UMUA 5AAGA 3LFNA 4DT8A 3KMUA 4MD7E 4Q9SA 4YTFA 5JRQA 3CXWA 2WEIA 2ZM4A 5A46A 4Z3VA 1V0OA 1O6KA 4IX3A 4XV2A 3CJFA 4IB0A 3ORIA 4AP7A 4UX9A 3TI1A 4TNDA 4WNKA 3ZC5A 2B9IA 3A99A 4FSYA 3T3VA 3W2SA 5CEPA 2OXXA 2FA2A 3PVUA 4L42A 2J50A 4R3RA 4WSQA 5I5ZA 3RM7A 2QOCA 4BCFA 3IDBA 2YZAA 3NYNA 5HGIA 1K3AA 4QMTA 5HCYA 2VO6A 4O1OA 5EOBA 5HHWA 1H28A 2CLQA 1E9HA 4W4YA 2QR8A 2YITA 2WFYA 4EHEA 3MI9A 4R1YA 5K5NA 5HG7A 3CQEA 5CF4A 3UNKA 3ORNA 4ZY5A 2Y4PA 5IEVA 3PPKA 3HUBA 4PPAA 3FMHA 5FTGA 4IADA 4NK9A 4QTAA 1LEWA 3TKIA 5FEDA 3D0EA 4O1PA 1ZOHA 5CEQA 4IB5A 1W7HA 5CF8A 2GQSA 1Y6AA 2JDRA 2A19B 3TZ9A 4XYFA 4CFMA 3A4OX 4FT3A 4JJRA 3TNWA 2E2BA 4MCVA 4ZSJA 2PUUA 3UODA 2A0CX 4BHNA 3VS1A 2W05A 4P90A 2XRWA 1ZRZA 2GHMA 1VZOA 3F9NA 5J8IA 2VX0A 5E8TA 3WYXA 4LOQA 5HCXA 2G9XA 5CALA 4P2KA 2YM7A 4QP8A 4V04A 3FY2A 2XK7A 3FMJA 2VNWA 4FV2A 3QQFA 4CV8A 4RX5A 5T3QA 4QNAA 4IZYA 4FVPA 3OT3A 4ITIA 1UKHA 4U41A 3E93A 3NUSA 2EXCX 3DU8A 5TR6A 4HZRA 3WF7A 3DLSA 4RX9A 4D2PA 3IDPA 2QI8A 4RJ8A 4S2ZA 3ZLWA 2UZBA 3Q96A 4ZTQA 4FTQA 4FG8A 5I9YA 3O51A 3KN6A 2CNQA 1TKIA 4GYGA 2FH9A 3UPXA 1FGIA 3GOPA 3QL8A 1PHKA 1R78A 4E93A 4F0IA 3UQFA 4QD6A 3CPCA 5DN3A 4BI0A 4ZY6A 4DFBA 1K2PA 4BZNA 2HIWA 5H8BA 4IW0A 3ZONA 3UYTA 3UDBA 3RP9A 4M69A 3BEAA 2R3QA 2XRUA 2W1ZA 4FSZA 3FE3A 3KA0A 1S9IA 3E8EA 5JMSA 4PNIA 3TEIA 5IMEA 1K9AA 4KKHA 1YI6A 4FVQA 4RMZA 3ZO2A 5AX3A 4BCOA 2X2MA 2RGPA 2J90A 2Y6OA 4KS7A 3ZFMA 4DG2E 1G8SA 4CQEA 1YOMA 4W4WA 3V5LA 4XBRA 4O7RA 1OGUA 3FY0A 2G01A 3A60A 3IG7A 3LE6A 3LCOA 4LV8A 4BCPA 1WCCA 3F2NA 3BGPA 3T8OA 4FKSA 5IUGA 3CR0A 2VWIA 3H0ZA 4BBEA 4O7NA 2XM8A 2JFMA 3D5UA 3GFEA 5HBEA 4HVDA 2IN6A 4RSSA 5EKOA 4O6EA 3O71A 3DB6A 4NFMA 4CFUA 3LMIA 1CMKE 5ANDA 2YLEA 5DT3A 3R73A 5FGKA 3TL8A 3PWDA 3V01A 2BRHA 3MW1A 2YFXA 3E87A 3UE4A 5J9YA 1CKJA 2W1EA 4S33A 4N57A 2Z7QA 4Z9LA 2HY0A 2C5YA 2OU7A 4G16A 2XCKA 4JDHA 3CTHA 4WG5A 4V0GB 3SXSA 2V62A 4G3DA 2YCFA 2ZOQA 3P79A 3Q53A 1NVSA 1OUYA 5A4EA 3KF7A 4HPTE 5LWNA 1W98A 4RRVA 4MK0A 2ZB0A 3FHIA 2C5NA 3ZH8A 3SX9A 2YN8A 3HA6A 4RJ4A 1KWPA 2VRXA 2YWPA 3QFVA 1U59A 3Q9XA 4FTOA 2H9VA 4FKGA 3DKCA 3TKUA 5GHVA 4U3YA 3WF5A 2PSQA 3C51A 3HMPA 4IAAA 5EOLA 4NCTA 4PDPA 3V8SA 3LLAA 4S31A 4AF3A 4OR5A 4DC2A 5J1VA 5J95A 5J79A 1BLXA 1J91A 5C4LA 4UMQA 2KTYA 1YHSA 2IZSA 2W5BA 1JPAA 4CT2A 4Q5HA 5JFWA 4E8AA 3ENMA 4LM5A 3GQIA 3OUNB 3U6JA 1OIRA 3MIAA 5C8NA 2FSMX 4RGJA 4B0GA 2YCRA 3N9XA 4K18A 3QKMA 4RC3A 2YJSA 3A7HA 1NA7A 3MA6A 1YXUA 3II5A 4DAWA 2QU5A 2EB2A 5ANOA 3VJNA 2VWVA 3VS4A 3TCPA 5CT7A 4FEWA 1CKPA 1OM1A 1ZZ2A 2IZRA 3FLWA 2AUHA 4R7BA 1G3NA 4LV5A 2UW0A 3UMWA 4JS8A 4C3PA 4JR7A 3PTGA 2W5AA 3IDCA 2A1AB 1Q8UA 1CDKA 2VNYA 3RHXA 5EQEA 3MA3A 4AZWA 3C4ZA 1GIIA 3K54A 4M7IA 2QU6A 4C02A 3D2KA 4J7BA 4JT3A 3PIYA 2ITXA 4NFNA 4K2RA 2YHVA 3IPHA 4LI5A 4U3ZA 4ZJJA 4PWNA 3ENHA 4L67A 4MQ2A 3LXKA 4Q9ZA 5GZAA 2Z8CA 2DQ7X 4J96A 3AMYA 3R01A 3HVCA 3E88A 3TIZA 2WAJA 1KOBA 4FTNA 3QXPA 4FIGA 4TT7A 5HCZA 4GMYA 4KKEA 1ATPE 2XS0A 2C6MA 4YPSA 1SNXA 5HLNA 3DTWA 4IB3A 2V22A 5AP5A 1JQHA 5AUVA 5HQ0A 4KINA 4LGDA 3LCTA 3KREA 1T46A 4YC6A 4LMUA 5BUEA 4UYAA 3WZKA 4PL3A 5E8SA 4E4LA 1QPEA 3I79A 2CKOA 3QC4A 3NUPA 3P7CA 4J98A 5L3AA 4I23A 4M12A 4O0WA 4FV8A 1JKTA 3E8CA 5BYZA 3IONA 4RLKA 3UZRA 4RIXB 4PV0A 3REPA 1LUFA 3C0GA 3OTVA 3GU8A 3ORLA 1H25A 2W17A 1YI3A 3A62A 3AMBA 3UIBA 3EHAA 4QNYA 3U9CA 5EHYA 3SVVA 4WD5A 3QUEA 2PZPA 1J7LA 5JFSA 4QMQA 4RWJA 2G1TA 2EUFB 3JY0A 4N4SA 4EBVA 2WQNA 1BUHA 4OLIA 1OL7A 4B99A 3VS2A 3M2WA 4DEAA 4DITA 4EKLA 5IG1A 4HJOA 5AAEA 4PL4A 1XH7A 2JIVA 5DVRA 1FVRA 4XP3A 3R21A 4CGAA 2UZNA 3LHJA 3DK7A 3CE3A 3WYYA 5HVKA 2W4JA 3Q4ZA 2QQ7A 4JRVA 4MWHA 3R9NA 4AW5A 4OAVB 3AD4A 5B7VA 5EW9A 3SG9A 1PMNA 1R0EA 4XLVA 2JIIA 3THBA 2Y6MA 3V5QA 4GU6A 3EQIA 2OI4X 4EK5A 3L8PA 4FNXA 5BVNA 3SC1A 4BDFA 3VS7A 3DZQA 4A4LA 4HGTA 2CNUA 4BFMA 4BDKA 3G9NA 5HIDA 3SLSA 3FEGA 3QD0A 4RQVA 3QQGA 4U8ZA 1JSTA 2B52A 5HNBA 5HORA 5IQIA 3A7JA 1Y8GA 2W06A 3U8WA 3O7LB 4UZHA 2VTQA 4PMSA 4RZWA 2WMWA 3VBTA 1V0PA 4OTIA 4UWCA 5KNJA 5M4UA 2OF2A 2AC3A 1LEZA 3BV2A 3QZIA 4XRJA 2I0VA 3DAEA 3QBNA 5AR5A 5LMKA 4CFVA 2PUPA 4KBCA 4FTMA 3VS0A 1AQ1A 4EYMA 3VBVA 3NLBA 5M4CA 4HOKA 3POOA 5CY3A 5TKDA 2UW9A 1SZMA 3ET7A 4G3FA 4E4XA 3WOWA 5CEKA 3E64A 3F6XA 3GFWA 4FNZA 4A4OA 2PTKA 3QTQA 4JBVA 2PZYA 3PIZA 3UMXA 3VIDA 2PVRA 3WZEA 4EK8A 3N4TA 4FODA 4AUAA 4IAZA 5M08A 4HYSA 4QQCA 1ZY5A 1URCA 4X3FC 1OVEA 1B38A 1SVHA 3BHVA 5EW8A 3UIXA 3WARA 3CD3A 4CRSA 2BAJA 3QWKA 3EWHA 4FYOA 4IZ5A 3TKHA 4CTCA 3ALOA 3ZO3A 3CEKA 2GNFA 5KO1A 5GNKA 2GNIA 3KRLA 3OBJA 4GT5A 3ZDUA 4CMOA 4USFA 2WIPA 1YXVA 2WOUA 2YAAA 5GJDA 4E4NA 5CZIA 3QCQA 4OTQA 2YIWA 3SAYA 3OOMA 1Y8YA 4H05A 4GVAA 4EJNA 3DJ7A 4DHFA 1KE7A 1VR2A 4XG2A 5DR9A 4AFJA 3F88A 3ODZX 4C4JA 5H9BA 4U44A 4CFNA 1SYKA 2WQOA 2OBJA 2ZMDA 4DEBA 2JKKA 3KC3A 5LVOA 1APME 3EJ1A 4IX6A 4U80A 2O64A 3GEQA 4J52A 4DYMA 5KCVA 5IH5A 4GL9A 1Y57A 3OROA 3G15A 4ZEGA 4BZDA 2Q83A 2ZV7A 1W84A 1Q97A 2AC5A 2JGZA 2V7OA 3NCZA 3QA0A 5TO8A 2YM4A 4FZ6A 4AW0A 3BGQA 2HENA 3ZCLA 3U54A 3KFAA 3HGKA 4EQUA 5B2MA 4S30A 2YM8A 3KF4A 4WUAA 1EH4A 5K4IA 2QOHA 1UNLA 1M14A 3MV5A 5CAVA 1XBCA 2IJMA 4PPCA 2X7OA 2J0KA 5D11A 4FGBA 3RBWA 4FKQA 3ZC6A 3FLNC 4D2SA 5IA4A 2IG7A 4EK4A 2YIXA 3H30A 2J0MB 4JIAA 4DBXA 4KIQA 3BELA 4QMMA 5IPJA 4LGHA 1PMEA 3UVQA 5IH6A 4EH8A 3UP2A 1JKSA 2O65A 4AZTA 1ERKA 1KE8A 2JEDA 2E9VA 3OW4A 3ZFXA 4EEVA 3SGCA 5CI7A 4WHZA 3C50A 2ITNA 3QRTA 3FMDA 4BIDA 5GIOE 4TYHB 3UJGA 4I1ZA 4O96A 4CCUA 3VWAA 4CT1A 4DLIA 1L3RE 3QTXA 3QTIA 3O8UA 3PXKA 3JR1A 3ZEWA 2F7ZE 4IVCA 4E73A 1M17A 1BKXA 1MP8A 3EOCA 3O96A 5E8XA 3LXNA 4NTSA 3I6WA 3A7IA 2OIDA 3NW6A 3SRVB 4KSQA 4C3RA 2RSVA 4WRSA 2W4KA 2R3MA 4IAKA 3DLZA 5DWRA 3HP2A 3HV5A 4WKQA 1ZLTA 4JDIA 1UU7A 3TIYA 2X4ZA 4BTFA 3UOJA 2JAVA 5M09A 4PQNA 5CVFA 3NX8A 4C7TA 4JBQA 3UQCA 3PSCA 3BQCA 4L3PA 3EKNA 1PYEA 1I44A 3UIMA 3DBQA 2WMVA 3FHRA 3FXWA 3BU5A 3MPMA 3O17A 3ORXA 4FI1A 4FV4A 4OT5A 1WVYA 2ZVAA 4KIPA 3GCQA 4R7HA 3IOKA 4QYFA 2WU7A 3HL7A 3W18A 3EMGA 2X2KA 2CSNA 3COHA 2RF9A 4D9TA 5EQPA 2BR1A 3DDPA 3LMHA 2YM5A 3NVMB 1W82A 5AUZA 5FXSA 5BVOA 1AD5A 4ZJIA 1PXIA 1PF8A 1WBSA 2ITUA 1BI8A 4O0XA 3OUKA 1GOLA 1OB3A 3O2MA 4QYYA 4BZOA 4LFIA 3SW7A 4IBMA 4QYEA 4MVFA 3CKWA 1WMKA 5ACKA 4AN3A 3JVSA 2HZ4A 3AMAA 5LMAA 4ZMFA 4YP8A 4N6YA 3R71A 3EFLA 4X3FB 4O0TA 2XA4A 3R8VA 1S9JA 3B2TA 4I6BA 3EYHA 4AT5A 4I3ZA 3JVRA 2QOBA 4E3CA 5KMLA 3OP5A 5EYCA 3LFSA 4YJTA 4D0XA 4IH8A 3KCFA 4C62A 3A8WA 3RTPA 3OF0A 2H34A 2QNJA 2CLXA 5FBOA 3ZM4A 4NL0A 4UYNA 3OMVA 5IDNA 1KE6A 3C4EA 4E26A 2W96B 4PDOA 4I6QA 3EQPA 4QQJA 4RFYA 5CQWA 2WTKC 2QKWB 3FMKA 3ORZA 5HTBA 3GU4A 4TWCA 3T3UA 5D9HA 4EK6A 4AN2A 4BWPA 4O7YA 4JIKA 1ZOEA 1ZWSA 3TUCA 3BU3A 5FD2A 3W2CA 4QP1A 4QQTA 3GCVA 2VUWA 1ZOGA 4HYHA 4Y5HA 4D4VA 1MUOA 1ZMUA 1OL2A 3BE2A 5M4IA 2R3IA 1PKGA 2WGJA 3Q4UA 3MY1A 1NVRA 5CT0A 5I3RA 4FF8A 3TUBA 3DBDA 3OD6X 4A7CA 4XHKB 1G8AA 4BDHA 2PVNA 4PP9A 4A4XA 3OW3A 2WO6A 4R5SA 4X2KA 3ZO1A 1QMZA 3OXZA 3PDTA 5K0XA 2E9PA 3FSKA 5FTQA 2EXMA 3MY5A 4FTLA 3HLLA 4YJSA 2R3RA 2WTCA 4C4GA 1YXXA 2VTLA 5F94A 2R7IA 4ACGA 4YTCA 3L1SA 1URWA 5HE1A 4FIJA 3LQ5A 4FV3A 5CEOA 4FEVA 5M44A 5A6NA 2QG7A 3VO3A 5HX8A 4JG7A 5HG9A 3ATTA 2JC6A 2WXVA 3Q4CA 2UZEA 1L8TA 4XV1A 2YJRA 4Q2AA 4HZSA 3PJCA 3UZTA 3ZYAA 1ZMWA 4ZSAA 3C5UA 4B9DA 4Y5QA 3VUHA 3R7VA 3C0IA 3FI8A 3Q2JA 1WZYA 3HDNA 3LCSA 4FTCA 3BLQA 3ZDIA 4C4EA 4B8MA 5CQUA 3RPRA 4BIBA 2B1PA 3BHYA 5AA9A 2V7AA 3D83A 2UZTA 2R3GA 4P5QA 4G6LA 4K6ZA 4FTIA 5F95A 2J5FA 4XOYA 4F65A 5I0BA 3OEZA 3VHEA 1OL6A 4AX8A 3WILA 3LFBA 3C1XA 3K2LA 1UNHA 3QU0A 4F09A 2OJFE 2CKEA 3EN7A 3NUXA 3V5JA 4D0WA 3HV7A 2WMSA 3RI1A 3QHWA 3OTUA 3TNHA 4F7JA 3DV3A 3G9LX 2C1BA 1DM2A 4QPAA 3VULA 2F4JA 2XKCA 3CS9A 3KY2A 2WZJA 3PWYA 4IB1A 3W32A 4FKJA 4Y95A 3I0QA 3KRRA 4QT1A 5D10A 3OFMA 4NKSA 3QUPA 3ZLYA 2FSTX 4G3GA 3VF9A 2AYPA 4MBLA 4BDCA 4X2NA 1Q4LA 3AD5A 3FYKX 4GIHA 5TT7A 3OCSA 2BRNA 3DB8A 4FIFA 1OKWA 3UC3A 4A9RA 2OZAB 3G0FA 4A9TA 4D55A 3F82A 4FL3A 1PXMA 4GFOA 4GRBA 2R3HA 4ZIMA 4I4EA 4IJ9A 1XH4A 2XNMA 3C4CA 4JOAA 5DA3A 5CEIA 2HY81 2XK8A 3MTLA 4HNIA 4IFGA 4CV9A 4JG8A 3RAHA 5IEXA 4O7WA 4NW6A 2G2HA 2XNPA 3MH3A 4BY9E 4O2PA 3VS6A 4FGRA 1F3MC 3DFAA 5CLPA 2XF0A 3BLHA 2F7XE 3NGAA 2HXQA 2YA9A 3OT8A 3CBLA 3PP0A 4LL5A 1M52A 4M84A 4O83A 2J5EA 3PY0A 4NZWB 3KK8A 4TYGA 5HO6A 4WO5A 2FO0A 2Z60A 3DPKA 4BR3A 1YXTA 4JBPA 3U6IA 1GZ8A 5ANKA 2W1IA 2X9EA 4L44A 2HZ0A 2X39A 3LFAA 3NIZA 4RJ3A 2Y7JA 5AR4A 4NM3A 2C0TA 2GFCA 3S00A 2XNBA 1YWVA 3KRXA 3R8PA 4QQ5A 4CKJA 3DAJA 3G2FA 2BKKA 5E8UA 4XX9A 3Q6UA 3Q52A 5J9ZA 2Z02A 2OXYA 2XK4A 2XIXA 3QQJA 3S2PA 5AIKA 2IO6A 4ZOGA 3NNVA 5D12A 1MRYA 2JIUA 4BCIA 2GQGA 2WTKB 4D28A 2UW4A 4FV0A 3QXOA 3MVJA 3PE2A 4FOCA 4L45A 5AP7A 4TYIA 4X6QC 5EK7A 1VJYA 4X3FA 2UUEA 4QTBA 1F0QA 5I3OA 3KMMA 3WZUA 2X6EA 5CSHA 4MYGA 4MNEB 3BGZA 2Y0AA 5GZ9A 3TDWA 3KL8A 1YI4A 5AJQA 5AWMA 3M11A 2Z7RA 2I1MA 3NSZA 2XIYA 1QPCA 4KIKB 4E1ZA 4NT4A 5A14A 5EM8A 5C01A 2PE1A 2FVDA 2WTJA 1J3HA 2PE2A 5HBHA 4WT6A 4XNEA 3U9NA 4LGGA 2XKDA 3MGYA 3PJ3A 3C7QA 5D7AA 5L6WL 2NRUA 4AZSA 3COIA 1REJA 1T45A 4P5ZA 2C6DA 1BL7A 4PTGA 4RJ6A 3C4XA 4XEYA 5CVHA 5CZHA 3KULB 3UVPA 4ALVA 4C36A 4ANSA 5BMSA 3FLZA 3I4BA 2IVVA 4GYIA 3RK9A 2IW6A 5LCKA 4R78A 4IM2A 4TN6A 2C6EA 2ONLC 1NXKA 1BX6A 5DMZA 4FUXA 1JBPE 4Y8DA 2PMOX 3ANQA 4LQMA 2HCKA 1E1VA 5DG5A 3H9RA 1UU9A 4GK2A 4RVKA 4NTTA 4CZYB 4FTKA 4WNMA 3N4VA 5EFQA 2CDZA 4H1JA 3TM0A 3R1SA 5B2LA 2PVLA 4EOIA 5AADA 1PXNA 1MQBA 4G2FA 4OW8A 4ZZNA 2HWOA 1FMOE 2WIHA 3QKLA 5BPYA 1P4OA 1TQMA 3R7OA 4AAAA 3N4UA 4PF4A 2OG8A 2XJ2A 3O50A 4RIWB 3VHKA 2Y4IC 3OWLA 3BYUA 4AOTA 2F49A 3R0TA 3U51A 2W1GA 3WZDA 4AU8A 3IQ7A 4QMSA 3C5IA 4K1BA 4U45A 1GZOA 4XP2A 2JDSA 4F6UA 4FEUA 1XJDA 5AX9A 3NUYA 3WF6A 2VTMA 2HWPA 3H9FA 2WMUA 3UG1A 4E7WA 1LR4A 5HVYA 3QTSA 2OH4A 2WMQA 3BPRA 4IVBA 4DFYA 2PZRA 4EWQA 4KS8A 2XP2A 4P4CA 4U0IA 5M57A 4DFXE 3GU5A 4EC8A 3HAVA 1ZYCA 2G2FA 2C3JA 3IGOA 4Y73A 3EH9A 3TZ7A 5HNIX 3AG9A 3MIYA 3Q32A 3BHHA 4G31A 5JEBA 3I81A 3F3VA 3W2RA 5DH3A 2WOTA 3R6XA 1F5QA 4JL9A 3LPBA 1AGWA 4C35A 3UZPA 4MXXA 5F9EA 2B0QA 3VUKA 1YHVA 5DR2A 2ZV2A 2OFUA 3VVHA 4B8LA 4O7LA 2OZAA 2NNWB 2R5TA 4JNWA 3W55A 4ZY4A 4BICA 5D41A 3Q9ZA 4HW7A 3TT0A 3KRWA 4HGEA 3ACJA 1OL1A 1YOLA 3CIKA 3KXXA 1FQ1B 2VX3A 3MFUA 2C6KA 4MTAA 2EVAA 4I94A 1YDTE 1KV2A 5AP3A 1PMVA 4FZFB 1H4LA 4IX4A 3BEGA 4BKZA 4F9YA 1A48A 4FIEA 3M42A 4I4FA 1Y6BA 2XUUA 3PXYA 4WOVA 2CN8A 2OSCA 4ZTRA 3SD0A 4AN9A 4ONAA 4O84A 3BRBA 3Q5IA 2OH0E 3HDMA 4FKLA 4EOKA 2YIQA 2OWBA 4L43A 4JDKA 2I40A 4WNOA 4HVHA 2R0IA 3AC3A 1BYGA 4DGGA 4Y72A 4FMQA 2J0JA 2C5OA 3PE1A 4GUBA 4XG6A 3EIDA 1JLUE 2JDTA 3R1NA 5KMOA 3NCGA 5C8MA 5A4QA 5D1JA 3DXPA 1FGKA 4M15A 1UNGA 5L4QA 4L8MA 4F99A 5BVKA 5KBRA 3Q4TA 3MTFA 4UV0A 4RC2A 3A2CA 4IAYA 3GUBA 3QA8A 1J7IA 4IE9A 4L53A 4UXLA 5LVPA 2QG5A 4MNEA 4FTJA 3LAUA 2WNTA 2QVSE 3DOGA 3HX4A 4YTHA 1ZYLA 2P2IA 5ETIA 3TZ8A 4KIKA 3L9MA 3G51A 4ARKA 1Q41A 4GH2A 3QAME 4C57A 3UO5A 5C8KA 4ZSGA 2BFYA 1HOWA 4F64A 3ZO4A 5J87A 3HMIA 3HV4A 2YDJA 4YJRA 3VNTA 3GU7A 3TWJA 4L01A 3KULA 4AW2A 4DEIA 4FTAA 4XCUA 1ZYDA 2QURA 4RT7A 4ZZMA 5E8ZA 5JK3A 1O6LA 3I7BA 3PY1A 4IHPA 4FICA 3KCKA 4F7SA 3QGWA 2QLQA 4MD9E 4RIOA 4BCMA 4J8MA 2I6LA 3NUNA 4L7SA 4PRJA 1Z9XA 1R3CA 3RAIA 2WU6A 1NVQA 3G90X 5HI2A 5K9IA 2W1CA 4HPUE 1FVTA 4EH3A 4ACHA 3ZMMA 5FG8A 2XIZA 2QOKA 1H26A 3DBCA 4IFCA 4AW1A 4F0FA 3DK6A 4II5A 3VBYA 3FZPA 5AIRA 3ZOSA 4Q5EA 5FQDC 3TV4A 4GT4A 4EZ5A 1XH9A 3P0MA 4OTFA 5HIBA 5BVDA 4OUCA 1XBBA 4GIIA 3B8QA 2XIRA 3EN5A 4I22A 1OMWA 3FZOA 4EOSA 3AC4A 3SQQA 5DI1A 4CVAA 5CSXA 4RIWA 1R1WA 4PDSA 5EM6A 5L2QA 2VN9A 2WMAA 3E8NA 3D15A 3FI2A 4XV9A 3QALE 3QCXA 3GENA 4CMTA 3R7EA 4FKPA 4ERKA 4P7EA 2ETMA 3VW6A 3QRKA 4FNWA 2OW3A 2C3LA 1WBVA 4BCQA 1W0XC 4UALA 3RZFA 4ANBA 4U9AA 4AGDA 4H3PA 3R7YA 4LUEA 2WTVA 4EH9A 4IANA 3L9PA 2WEVA 3HKOA 2PMLX 4I5MA 4UBAA 4LRJA 1LPUA 1JKKA 3DJ6A 5LVLA 3UP7A 4C2VA 4U79A 4ZAUA 3ZSIA 3F5UA 3E7OA 1M7QA 2JKOA 2OJJA 5CANA 3FZ1A 2HAKA 4C33A 4XH6A 2I0HA 5KMJA 3V5WA 3IW8A 5JFVA 2GNJA 4GKHA 5LJJA 3AC5A 1GZNA 4Y83A 4AWIA 3F3TA 5ANEA 3ZRKA 5KMKA 3W1FA 5EM5A 5EYMA 4AT3A 4YURA 4N0SA 2BTSA 2F2CB 2UW6A 2Q0BA 4NU1A 3P23A
chains in the Genus database with same CATH superfamily
2CPKE 4QMLA 4FEXA 3OCTA 4BDAA 4KAOA 5I9WA 3O7LD 4EORA 3QQUA 5AP4A 2VTSA 5FP5A 3VS5A 4RC4A 5E92A 5K3YA 3AC8A 3CGOA 5BVFA 1YOJA 2VTRA 3F2AA 3GCPA 4I0SA 2QO9A 4L3LA 4WUNA 4D5KA 4YSJA 1WBPA 3GC0A 3FQSA 3I5NA 2GNHA 5CI6A 4UZDA 4FEQA 4YLKA 5CU6A 3LM5A 2W99B 4NIFA 2VTJA 4FL1A 3W8LA 1H1WA 3DKGA 3D5XA 2P4IA 3NYOA 3TZMA 4F9WA 3OWPA 3QTZA 4AA5A 4AZEA 3CY2A 1X8BA 2WMXA 4FTTA 3KEXA 1OBDA 2B4SB 3WBLA 2YM6A 2GHLA 5JN2A 3AT3A 3NAYA 1I09A 2UVZA 3RK5A 3KVWA 1SMHA 4FV7A 5KHWA 1YDSE 2FB8A 1Z57A 4D2WA 4UN0C 5IA3A 3V5PA 1MRUA 5IQDA 2XKFA 3OCGA 4PUZA 5IQHA 4O7ZA 3L8SA 5CSWA 4U43A 3VBWA 4U42A 4ZK5A 4B4LA 4I0TA 3ZRMA 1NW1A 4O7VA 3LXLA 4FG7A 4MD8E 4A9SA 4O4DA 3R8UA 4ERWA 3LZBA 3F66A 2X7FA 4MH7A 2JKQA 3R8ZA 1WVXA 4ACMA 3SA0A 3AXWA 2XBJA 4KB8A 1RW8A 2HZNA 3PUFC 3W0PA 4AOIA 4IVAA 4EWHA 4BKYA 2ONLA 2QO2A 1BMKA 2UW3A 2YIRA 4NM0A 5EG3A 3RAKA 2F57A 2F7EE 3HP5A 5JRSA 3FMEA 2QO7A 4NKAA 4RJ7A 2AQXA 4IJPA 3VRZA 5HE0A 3QQHA 4YGAA 2XCHA 3S95A 5T6KA 4BDDA 2QR7A 2XK9A 2VO7A 2GSFA 3VJOA 5HVJA 5HIEA 4APCA 1YQJA 4JQ8A 5BV3A 4LG4A 3VS3A 3TV6A 4EHZA 5A4CA 4BGHA 3LIJA 5AR2A 2IZUA 4FOBA 4BDEA 3DBEA 4F6SA 2O3PA 3W33A 5K4JA 4JVGA 5FP6A 4PY1A 4DCAA 2IEWA 3AT4A 4R1VA 3IW5A 2XNOA 2B53A 3N51A 4QMZA 4XG3A 4YZBA 2UZOA 5AA8A 4DA5A 3ERKA 3PLSA 4KWPA 3FPQA 4C61A 2X9FA 3ZSGA 2W9FB 3R8MA 2QOIA 2CN5A 2VWWA 2XH5A 2ZM1A 4G3CA 4IACA 4LDTA 4USEA 4O0YA 4GEOA 1KE5A 3R2BA 1H27A 4FTUA 5HESA 4NM5A 3O8PA 2RL5A 2JDVA 4YHTA 2QKRA 1JNKA 1HCKA 3FKNA 2NO3A 3QLGA 3SOAA 5CWZA 1YW2A 5E8YA 1O9UA 4WA9A 4M67A 4JQEA 5AEPA 4APPA 3LJ2A 4G9RA 4HVGA 3QZGA 5DRBA 3GT8A 2YDKA 3W16A 2XNEA 2W5HA 4DDGA 3HA8A 4YJNA 2PULA 2UVYA 4ID7A 4FSWA 5IUHA 1U54B 2WHBA 3EFJA 2XVDA 4L52A 1XH5A 3PVBA 5HZNA 2ITPA 4EOQA 5GINE 4TY1A 2OLCA 3FMNA 1DI8A 2BDWA 2ETKA 3BBTB 3PG3A 5EW3A 5CAUA 2X8EA 4RJ5A 3PRIA 4RA5A 3RJCA 3B2WA 2V0DA 4FL2A 2WMTA 3Q3BA 3HV6A 4H3BA 4O91A 1H1QA 3P86A 3U6HA 2XK3A 5DEWA 2QONA 1BL6A 5B2KA 2YIYA 3ML1A 4MHAA 4ZLZA 3BYVA 1G8JA 3BBWA 3GC9A 1B6CB 4CNHA 3OZ6A 2VGOA 2A98A 5L8LA 4KD1A 3MPAA 4K33A 1P14A 4IEBA 3R83A 3S4QA 4FA2A 4AXEA 5LVNA 1ZARA 4F6WA 2G15A 1G5SA 4CMUA 2HELA 1ZYSA 4AE9A 3FLSA 4J95A 5IH4A 4O7TA 2A27A 2JAMA 2GU8A 4YHFA 3BX5A 3UYSA 4YUQA 2QCSA 4EONA 5H8GA 5JGDA 2NPQA 2UZDA 1PXKA 3F5XA 3G33A 3CTJA 3RCJA 4A9UA 5EHOA 3OY1A 3I0OA 1ZAOA 3QD3A 1CM8A 2WQBA 3JS2A 4IM3A 3ORKA 4YZNA 1ZZLA 5AUTA 1ZMVA 1OZ1A 3AGLA 3HAMA 1WBWA 1KE9A 4FIIA 4OT6A 4ZSLA 3AD6A 3TTIA 3EL8A 1FVVA 5IDPA 4JAIA 1UV5A 1UVRA 4RVMA 5CXZA 2OF4A 4C4IA 2XK6A 2C5VA 1DS5A 4GG7A 5CNNA 2BVAA 5JGAA 2HYYA 3TV7A 2VTAA 3F5PA 5DNRA 4C2WA 3EN6A 1H24A 4YPDA 4ANLA 5IMXA 3LCKA 3DQWA 1M7NA 3KXZA 1LP4A 2F2UA 2OKRA 3ULIA 2PY3A 4GK4A 3FUPA 5DGZA 3ZRLA 2VTPA 2C69A 1JSUA 5BNJA 2ITQA 2PZIA 3GNIB 4QMNA 1OIQA 4KRDA 3I1AA 3KXHA 3DDQA 4UWBA 4Z7HA 3WI6A 3EQFA 4FKVA 1GIHA 4LYNA 2OJIA 1VYWA 5BYYA 4XG8A 3RZBA 5KMNA 3OY3A 4K11A 5GZ8A 3W0QA 1U46A 4FK3A 2I0EA 3H0YA 3NIEA 4OBOA 3E63A 3MYGA 4G9CA 3JYAA 4J97A 4CCBA 2XNNA 2PUIA 3D7TB 4A06A 3C4WA 4UY9A 5K5XA 1OKYA 4X2FA 2O0UA 4C4FA 5M55A 4F08A 2ETRA 3TDVA 1Q62A 4FUYA 4AGCA 4LOOA 3SXRA 3P9JA 4QPMA 3VC4A 5E91A 3GBZA 4QMUA 1FOTA 4IDTA 2R9SA 1QPDA 2PVFA 2RFSA 4IAFA 3FXZA 4EH6A 4EOJA 4OAUC 2XALA 4YBKA 2VX1A 5IQEA 5CTPA 5BQ0A 5HTIA 4YZDA 2PZ5A 2UVXA 3ROYA 3JY9A 4DF3A 1QPJA 3P08A 4FC0A 5L8JA 1IA9A 1OIYA 4MF1A 3DK3A 4IX5A 4YLJA 3QYZA 3GI3A 3FWQA 4E20A 4MNFA 3ZZWA 4PP7A 3UG2A 3EZVA 4RIYB 5KZ0A 3SG8A 5KKRC 3UBDA 3MFRA 2VWBA 2R3LA 4QOXA 5FBNC 3W0NA 4QMXA 2ITWA 3PPJA 3RPOA 4QMOA 4BI1A 4DH7A 2EWAA 4Z7GA 3ATSA 2DUVA 3MPTA 3FC1X 5CU3A 4FIHA 4JQ7A 3TN8A 4CLJA 1QCFA 4JAJA 3NRMA 2BDJA 4O27B 4UEUA 4OBPA 5E8WA 5A4LA 4FX3A 3NW5A 1YRPA 3PZHA 4FK6A 4I21A 4DH8A 3TUDA 3DY7A 3EFKA 2ZB1A 3MY0A 4X3JA 5A6OA 4G5JA 3CQUA 2H8HA 3OCBA 4NUSA 3L9NA 4DT9A 4C34A 4TTHB 2YACA 4W8DA 1IAHA 2PHKA 4BDBA 4CRLA 4DINA 1PRYA 2VWXA 4TWNA 2X4FA 3BWJA 4LMNA 4QPSA 2YZLA 4YHJA 2W1FA 2GPHA 1H0VA 3BYMA 5BVWA 5AUUA 4FJVA 2FGIA 2JLDA 3SV0A 5D7VA 4E5BA 5JH6A 1U54A 4KBAA 3ZUUA 2ZMCA 4U5JA 4NEUA 3RPVA 4G6NA 3BHUA 3P7AA 2BRMA 3L8VA 4U40A 4O7SA 3LW0A 3EQCA 4KSPA 2XJ1A 4AAYA 2OJGA 3FV8A 2Y9QA 4G6OA 4EHVA 4QEBA 4R3CA 4MQ1A 3CSVA 2HXLA 3IKAA 4H3QA 1SNUA 2B55A 3PXQA 5BUJA 4J1RA 4MXYA 3ROCA 3W2PA 3FZRA 1JAMA 3CGFA 2VAGA 3LJ1A 4YZCA 4UMTA 5GJGA 4B7TA 3W0MA 3RINA 3LOKA 4R7IA 5DT4A 4ANOA 3LLTA 2UZLA 3D9VA 4Y46A 2XIKA 4CKRA 1UA2A 2XJ0A 3FXXA 3VUGA 4XG7A 4ANMA 2O8YA 3BZ3A 1H00A 5FUTA 3R04A 4E5WA 3NYVA 3ULZA 3U55A 2R7BA 3CTQA 5C4KA 1FBNA 4RX8A 4H58A 4ASEA 4UMPA 2F9GA 4JI9A 5HU3A 4XS2A 2HZIA 3Q9WA 1PXOA 5F1ZA 3EL7A 5CS6A 3QTRA 4BHZA 4DGLC 3ZFYA 2B54A 5L2IA 3LKMA 4ZLYA 3MS9A 3I7CA 3W0SA 2BROA 3FC2A 3WF9A 3HRFA 4J71A 4FSQA 3U87A 1W2CA 3QZHA 2DWBA 3ODYX 4FZAB 5JSMA 4GFMA 2CKPA 3O23A 3OWKA 2LAVA 3FZSA 4I41A 2BDFA 4I20A 3QX2A 5FDXA 1TVOA 4D4SA 3KMWA 1ZY4A 4AA0A 4F1OA 3PJ1A 3LVPA 5J7BA 1OL5A 4RLLA 1PXJA 2I0YA 3AQVA 2BHEA 1IR3A 4IDVA 5AM7A 1RE8A 3TJCA 3W0RA 1VYZA 4EKKA 2R2PA 3NNWA 3UNZA 1PXPA 3QCSA 5FWKK 3ETAA 1UWHA 4UB7A 4EH7A 4ZXTA 1ND4A 5AR7A 5KUPA 1ST4A 4FSUA 1OECA 4QP4A 3V8WA 3ZXTA 4DHIB 1RDQE 3QRIA 3EQHA 2PU8A 4K77A 4ZTNA 3S1HA 3MH1A 5BVEA 2CGUA 4KBKA 3HRCA 4MXAA 3EQGA 4E6QA 4I6HA 4U6RA 2PPQA 4ZTMA 2C3IB 2R3PA 3QLFA 3KKVA 2IW9A 5EKNA 3MN3A 4I24A 3FJQE 3RHKA 2OGVA 3BU6A 4C4HA 3LMGA 4Y85A 5HD7A 5HTCA 3CY3A 4H36A 3K3IA 3H10A 4D4RA 1W8CA 5BX0A 1M2PA 4FT9A 2IVTA 2GHGA 2YM3A 3R9OA 4ZJVA 3KRJA 3IW6A 5H2UA 3ID6C 3F7WA 3L9LA 4FKIA 2ZYBA 3D7TA 5DE2A 1J1BA 5FRIA 3IGGA 3DNEA 4IVDA 5KKRB 2E9OA 1H08A 2GS7A 2GDOA 4PL5A 2PVJA 2B9HA 5JZNA 3ZZEA 3IOPA 5CU0A 1B39A 3OBGA 3MJ2A 3VF8A 4JRNA 1IEPA 3PFQA 5GJFA 3VUDA 4NSTA 4D4YA 4XJ0A 4CFWA 4EYJA 4FKTA 5EQYA 3HMOA 1WBTA 3ZU7A 3BQRA 3PY3A 4E6DA 1P4FA 4RIYA 2WD1A 4TZRA 1OKVA 5DHJA 2J0IA 2A2AA 3DQXA 3PZEA 4PMTA 5EYDA 4GU9A 2R3OA 2GS2A 2HOGA 3PSDA 1TQPA 3KU2A 3PYYA 3UOLA 5ANIA 3V5TA 2CGVA 3G6GA 4EZ3A 2VGPA 1KV1A 3MVLA 3ZBFA 2YISA 2ZM3A 4PTEA 4IZAA 5IEYA 5AFVA 3A8XA 3OS3A 3RM6A 4HYUA 4FKWA 4XUFA 4AZVA 1CSNA 2X81A 5AP2A 2ZDUA 3DT1A 4RWLA 5FXQA 2J0LA 3HUCA 5CF5A 2J4ZA 3EN9A 3RNYA 3QHRA 5LXMA 2VTOA 2OICA 3PXFA 3SHEA 4GT3A 4OTWA 2XEYA 5E7RA 3LQ3A 4FSTA 3AT2A 1J7UA 5DR6A 4BCGA 2EB3A 4O0SA 3DFCB 4YNOA 5HKMA 5FEEA 5A3XA 4BL1A 3I60A 4AT4A 3Q5ZA 1JWHA 1SVEA 4W4VA 2BCJA 3POZA 5E9EA 3CP9A 3HYHA 3I5ZA 1WAKA 2YLFA 2ZDTA 2J6MA 4ZTHA 4NH1A 5AV4A 3V6RA 3ZUVA 4DEEA 3E8DA 3EQDA 4HVSA 2XZSA 2C6OA 3GVUA 4X21A 3DS6A 4JDJA 4FR4A 3KVXA 4CYIA 1ST0A 4OGRA 4F78A 1IA8A 3QQLA 4BKJA 1HCLA 3KN5A 1RJBA 4X7QA 4DFUA 4AE6A 3OHTA 2C6LA 4MXCA 3O8TA 4YMJA 4BYJA 4ITJA 4O0VA 3GXLA 2BZJA 4OTGA 2C68A 3UVRA 4AXAA 4Z55A 2V5QA 1WVWA 2PVKA 3R7IA 5IU2A 3DTCA 4D1XA 2ZV9A 4DEDA 3KXNA 4BRXA 4RFMA 4E4MA 2BZIB 2B7AA 3G5DA 3F3UA 4ASZA 1UWJA 4F0GA 2W4OA 3E3BX 4XLIA 5IA0A 2IVSA 3ANRA 4EZ7A 1YDRE 2C5XA 4CQGA 4XP0A 4ZTSA 5HICA 5JQ5A 3QCYA 4NIFB 1OI9A 3ZBXA 3CPBA 4NWMA 3R7UA 5IQGA 3VW8A 2XMYA 2OXDA 1XH8A 3QYWA 1NT2A 1V1KA 3FDNA 4RVLA 5IQCA 3IK3A 4RPVA 4YR8A 4WBBB 2VWZA 2Y8OA 2UW8A 4F9AA 5LQFA 4X6RA 4AFEA 2ACXA 5IA5A 4BN1A 4F7LA 5J9LA 4FKUA 3BL7A 3H3CA 1JKLA 2BKZA 4PTCA 4EC9A 3DNDA 4NJDA 5I4NA 1P5EA 3NYXA 3SDJA 4BCHA 3AKJA 2PVHA 1PW2A 2GTMA 2OJ9A 2YERA 4HCUA 5AV2A 1IG1A 3A7FA 3AC1A 4I5HA 3ZEPA 5LWMA 3H4JA 5FM3A 5L2TA 4F9CA 4X2JA 4DFZE 2W1HA 3PFYA 5DYJA 4O6LA 2OIQA 3W2OA 4TYJA 4XBUA 1JVPP 1XR1A 2PL0A 2R4BA 2YAKA 2ZV8A 2PE0A 3TXOA 4DG3E 4BDIA 4AS0A 3L8XA 3NS9A 1J1CA 3CC6A 5L2SA 5CNOA 3FQHA 5EHLA 5IUIA 1U5RA 3VQUA 4F4PA 1XQZA 2VTNA 5FM2A 2X8IA 4EQCA 4ZLOA 5HE2A 4TWPA 2C30A 5HG8A 2BRGA 4GK3A 4G34A 3BLRA 3OWJA 5IISA 3Q04A 3FL4A 1XO2B 2VD5A 3UGCA 3UIUA 4ZMEA 3F61A 3RALA 4DHJA 4YC3A 2RFDA 4RA4A 3P1AA 5ETFA 3FI3A 5C27A 3RKBA 3R9RA 3GGFA 3NZ0A 4OTRA 5EH0A 5ETAA 4QTEA 5J7HA 4ZTLA 4EH5A 3DA6A 2VO0A 3QRJA 2GMXA 1OUKA 2ITOA 4DTAA 3O0GA 4TYEA 4KRCA 4ZS0A 2AEGA 1GAGA 3PA3A 4FT5A 4F9BA 1YXSA 2Y4IB 4EHGA 3HZTA 3D4QA 4RZVA 3HECA 4G5PA 4E6AA 2ZAZA 3R7GA 3F2RA 3MB6A 4AGWA 5E4HA 2BUJA 2QOQA 4J99A 3QQKA 4YJVA 4TRLA 2X0PA 2C1AA 3LFFA 4M0YA 4N70A 5E90A 2R3NA 2Z7SA 3UPZA 3VQHA 3V3VA 3F7ZA 2H6DA 4NJ3A 4D9UA 2YDIA 4MKCA 5M4FA 1FINA 2CGXA 4CLIA 4FSMA 3U4WA 3NUAA 5BUIA 3PG1A 1PKDA 3TNPC 3I6UA 5JGBA 3HV3A 2OK1A 3Q6WA 4GG5A 4O81A 5LCJA 3EQBA 4EOOA 4QYHA 2XM9A 2ERKA 3R28A 4JLCA 3R9HA 3VUMA 4MX9A 5KE0A 3ZTXA 4FT7A 4HGSA 2WQEA 3MSSA 5CAPA 4BGQA 3MB7A 3RGFA 2X0OA 3NR9A 1H1SA 4R77A 4EK3A 4PMMA 3C0HA 4FG9A 3DGKA 4ZZOA 4RWKA 1H8FA 3FSFA 4AZFA 3UQGA 4WIHA 3S3IA 3Q2MA 2E9UA 3UOHA 1OPKA 3FMLA 4TL0A 2X0GA 2XBAA 1BI7A 4CD0A 1SVGA 2GNGA 4YO4A 4RWIA 4TPTA 3F3WA 3GCUA 3JXWA 4L68A 4YBJA 5FTOA 4AGUA 4BTKA 1XH6A 4JX3A 2WTDA 2X7GA 4DTKA 2ZJWA 5CENA 1JOWB 3D7ZA 4L6QA 4G1WA 3SW4A 5E8VA 5HLPA 3NVKI 4AA4A 3SOCA 4EUUA 4FNYA 5CU2A 3KK9A 4GJ2A 1OPJA 4YO6A 4DGMA 3PPZA 4K0YA 2VTTA 3TJDA 3ZXZA 3UOKA 3FKOA 4BTJA 4YLLA 2G2IA 4DGNA 5AV3A 3LFCA 4L9IA 1REKA 3ACKA 1XKKA 2W9ZB 1FMKA 4FZDB 4C0TA 5L6OA 3ZHPC 2UW5A 2OFVA 4GVJA 4UWYA 5CXHA 4EI4A 2PMNX 3LFQA 2Z2WA 3LJ0A 4O86A 4I93A 4BDJA 4FE2A 3IS5A 4BI2A 4DGOA 1R39A 1WBNA 3COMA 4YC8A 3D5WA 4M13A 3ALNA 5CEMA 4RFZA 3HEGA 2J9MA 4G17A 5H3QA 3UTOA 3CJGA 5DFPA 2UZUE 1YVJA 4OBQA 1JSVA 5DRDA 5EM7A 4MBJA 4S32A 4IWPA 5KMIA 5CU4A 2QLUA 1KUTA 4LUDA 3D14A 1Q99A 4D2VA 1MRVA 4ANNA 3NEWA 4IWOA 4QO9A 3E3PA 4EUTA 2GQRA 4ITHA 1H1PA 1Q24A 2JITA 1U4DA 2PMIA 4FBXA 3BYSA 1E1XA 1OITA 2B9JA 3EKKA 2LGCA 5DIAA 3FBVA 4CZTA 4EOMA 3AKLA 3PXZA 4RVTA 3KB7A 1UKIA 4KUJA 5E1SA 4KABA 4J8NA 4CTBA 3WZJA 5F4NA 4D2TA 4EH4A 3UO4A 4KIOA 2YCSA 1TZDA 5FDPA 1H0WA 4HCTA 4M66A 2WQMA 4USDA 4ZSEA 2FSOX 2REIA 3P4KA 1O6YA 2FYSA 4N6ZA 4QP6A 1PXLA 1H1RA 3A61A 4DFLA 3GP0A 3V51A 4M68A 4QP3A 2BPMA 1YHWA 2VV9A 3C13A 4K8AA 5I9ZA 5HX6A 3R00A 3C9WA 2QOLA 3R2YA 3WIGA 2EXEA 4QTDA 4DE4A 3P5KA 3HRBA 4BBFA 3D2IA 4BWXA 3UO6A 4L7FA 4BCKA 4BC6A 4YJQA 2BZKB 3U4UA 3UNJA 2YWVA 4QRCA 3DKFA 5HOAA 3W2QA 3OG7A 2YEXA 2GTNA 2JDOA 3FYJX 4V0GA 2KULA 5HO7A 3MH2A 3EQRA 2WPAA 2WTIA 3IO7A 4IIRA 5LARA 2Q0NA 4LOPA 3OXIA 4S34A 3V04A 3BYOA 2W1DA 2BAQA 2OO8X 4HVIA 3E92A 4EBWA 3CKXA 5J5SA 3RPSA 3ZUTA 2A4LA 2I7QA 2BAKA 3QUDA 1Q8ZA 3RAWA 2JKMA 2C4GA 5ICPA 4O0RA 4YJUA 4FVRA 4JG6A 3PJ8A 3QWJA 5AR8A 2XAMA 4O2ZA 3EZRA 3PP1A 4M97A 4QYGA 3KXMA 5M53A 5JFXA 4MF0A 3DCVA 4XRLA 3D5VA 3NAXA 4OTHA 3S0OA 1MQ4A 1GY3A 1NY3A 4YNEA 5AUWA 3TNIA 4WNPA 4DH5A 2ITZA 2XB7A 4I5CA 4IQ6A 4XOZA 4JXFA 4DHZA 3M1SA 3PRFA 4FT0A 5CASA 1UU8A 5CX9A 1WBOA 5AUYA 3T9TA 1Q61A 2P3GX 2PK9A 2WB8A 4BVUA 4GKIA 3W10A 4U97A 1P2AA 3QX4A 3RWQA 4ENYA 3DBFA 2V55A 4XMOA 1Q3WA 4KKGA 5DOSA 4QTCA 4RBLA 4W9WA 4FSNA 2QD9A 4CXAA 5JKGA 2UW7A 4MBIA 4WG4A 3R30A 5AUXA 3MFTA 5C9CA 5C03A 4L3JA 4F1TA 2RG6A 4D2RA 3HMNA 1STCE 2BIKB 2BMCA 4EQMA 4AXFA 4GCJA 5ACBC 1A9UA 4I6FA 3RPYA 3MWUA 2CGWA 4IM0A 4UXQA 4C59A 3VUIA 4E5AX 3ORMA 2XEZA 3QD2B 4GV1A 4IAIA 4ALWA 2UZWE 2VWUA 3NUUA 2FUMA 3VAPA 2VWYA 1A06A 4CG9A 1YWRA 2W0JA 4DN5A 4R6VA 3ITZA 3T9IA 3VBXA 3KIOC 1G8KA 5KBQA 5M51A 5BYLA 3PVWA 3MBLA 4MEDA 3G6HA 4UMRA 3Q9YA 2XKEA 4BCNA 2O63A 2C6TA 1KOAA 3F3ZA 4QMYA 4Z16A 3COKA 5AV0A 4ENXA 2PYWA 1W83A 3FI4A 3A7GA 3K3JA 3LXPA 3VUTA 5C26A 2ITVA 3DZOA 2CCHA 4EOPA 4XG9A 3OOGA 4YJOA 3NNXA 4QP2A 2ESMA 3PA4A 3DKOA 5E1EA 3R8LA 4BGGA 3CD8A 3QRUA 3R9DA 3BWFA 3DXNA 5L2WA 2VTHA 1YWNA 5DPVA 3EB0A 2CJMA 5AMNA 4CFXA 3GQLA 3QGYA 5EDQA 4RIXA 5DT0A 4C38A 1ZYJA 5HNGA 4D58A 4BIEA 4TWOA 4DEGA 3E7VA 3ZS5A 3VBQA 4F1MA 4MAOA 1PJKA 2C0OA 3QTWA 1WFCA 4FV9A 4TW9A 5F20A 4IZ7A 2RKUA 5IQFA 3A4PA 3CCNA 1GNGA 4MXZA 4R8QA 1GIJA 4DFNA 3LFEA 4X2GA 3CQWA 4O0UA 4X0MA 1IRKA 4BB4A 5ANGA 4BF2A 4GFGA 4ZP5A 5HE3A 2ERZE 2VO3A 4M14A 3UDSA 4W9XA 4LRMA 4QMWA 1YKRA 5HU9A 4IWQA 2PVMA 4V05A 3TYKA 5DLSA 4JX7A 5HEZA 4ANQA 3H9OA 3FQEA 4GW8A 4ACDA 2NP8A 5HG5A 3RMFA 5JQ8A 4RG0A 4ACCA 4WRGA 4O22A 1PMUA 4IC7A 2PVYA 1M2RA 3HNGA 3EFWA 1VEBA 3GC8A 3PXRA 5EYKA 2CKQA 3QF9A 5KHXA 1PYXA 5AP0A 1XBAA 3HMMA 4XG4A 5CAOA 1Y91A 5EI8A 3UC4A 1FPUA 3MVHA 2XARA 3FPMA 2QODA 3NWWA 3WIKA 3BLAA 3GOKA 3VN9A 3AOXA 5ANJA 2RIOA 2QC6A 4TXCA 3OEFX 4BTMA 3TACA 4DLJA 1R0PA 4G3EA 2GFSA 5FEQA 2NRYA 5L8KA 3EYGA 2C0IA 3AGMA 3RCDA 5CSVA 4LRKA 3SXFA 2WELA 5A4TA 2DYLA 5T68A 5M07A 5AV1A 2HW6A 3OVVA 4YU2A 5IA2A 3E62A 3CLYA 4DH1A 4IMYA 4FKOA 5DBXA 5LVMA 5IQBA 4FZ7A 2R64A 3MESA 2BALA 2X1NA 4EH2A 4NYEA 2X2LA 4FKRA 4MXOA 3F69A 5FLFA 3QD4A 4AG8A 3IW7A 3FLYA 1Q8TA 3ZLSA 2DS1A 2VU3A 4BBMA 4IC8A 3NMUF 2CMWA 4YZ9A 5GIPE 4CEGA 4WBOA 3E5AA 2CHLA 5I9XA 3PLAE 4FV1A 4F63A 1Q5KA 2YABA 4KA3A 3R1QA 2IW8A 4F70A 3LM0A 5CF6A 1OPLA 5C1QB 5HBJA 3KXGA 3LQ8A 3RK7A 4RQKA 3ORPA 5CYIA 4C37A 5HD4A 3ZSHA 5EDPA 4W4XA 4NCTC 5ITAA 5EI2A 3GU6A 3GB2A 3TG1A 2WKMA 4TNBA 1Q3DA 4WG3A 3V6SA 2IVUA 4PDYA 3D94A 5DEYA 4YTIA 2BZHB 1SM2A 5KZIA 5G1XA 5TF9A 4EL9A 4YJPA 5H8EA 2CNVA 1U5QA 1GZKA 1QL6A 3C4FA 4CG8A 3ZM9A 3FAAA 2OIBA 4CZUA 2W7XA 4OTDA 1H01A 4JR3A 5AP6A 1KSWA 2WMRA 2P2HA 4CYJA 3G0EA 3MDYA 5JT2A 4TKSA 3WE8A 3RWPA 2ITTA 5EDRA 4AACA 3FMMA 4V01A 4HCVA 2ITYA 4KNBA 4CKIA 2UV2A 4OTPA 2QOFA 1M2QA 4A07A 5J1WA 4I92A 4K9YA 2J7TA 1PY5A 3K5VA 2RFEA 1XHAA 4FTRA 4MWIA 4QMVA 4C3FA 3JPVA 4PMPA 2EU9A 3KQ7A 3UDZA 2HW7A 3ZLXA 3RNIA 2P33A 4R5YA 4PNKA 4DTBA 2RG5A 3VRYA 2B9FA 2IWIA 3P7BA 4QP7A 3PVGA 5A9UA 5AAFA 2C6IA 2C3KA 3FZTA 4W8EA 2BTRA 2X6DA 4A9YA 3NNUA 3BHTA 2Z7LA 1ZXEA 5M56A 4FYNA 2SRCA 3MFSA 4U7ZA 4ORKA 2QHMA 4B6LA 5M06A 2C47A 2IZTA 3K5UA 4HGLA 2QOOA 3GCSA 5HO8A 3WF8A 5JZJA 2R3JA 3QZFA 4PPBA 1Q8YA 3MVMA 2R0UA 1DI9A 4YSMA 5BMMA 4DCEA 2YCQA 3NPCA 1XWSA 4I0RA 3RVGA 5A54A 4LL0A 2BHHA 5KX8A 3R02A 1CKIA 1TQIA 4FSRA 4R3PA 4NW5A 3B8RA 4TYHA 4AQCA 5IQAA 5AM6A 4ZS4A 4FV5A 3SKCA 3V8TA 5TE0A 2GNLA 3TTJA 3DJ5A 4BYIA 1UU3A 2JFLA 3NW7A 4IWDA 3WE4A 4O82A 2UZVA 4DBNA 4EJ7A 5CAQA 1Q8WA 2E9NA 4I5PA 2FSLX 4CSVA 3LFDA 3OC1A 3OXTA 4YZMA 3SRVA 4NM7A 1RQQA 4M69B 4WSYA 2RFNA 2PWLA 4DEHA 4RX7A 1DAYA 4AOJA 1OGYA 1DAWA 4GJ3A 4D1ZA 2GCDA 3GC7A 5IF1A 4BWKA 2XNGA 3BCEA 2O2UA