1LUFA

Crystal structure of the musk tyrosine kinase: insights into receptor autoregulation
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
301
structure length
275
Chain Sequence
LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSFCSIHRILQRMCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords muscle-specific tyrosine kinase receptor musk
publication title Crystal structure of the MuSK tyrosine kinase: insights into receptor autoregulation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 95
structure length 275
sequence length 301
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2002-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1lufA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1lufA01
5HIEA 4A06A 4MD7E 3NYNA 2C30A 1YXTA 1PHKA 2JKKA 4EH3A 2BILB 4ACMA 4TYJA 4JBQA 2BVAA 5HNGA 3P0MA 2WU6A 4J52A 3MJ1A 5CF4A 4CFMA 5LCJA 5ACKA 3TNPC 2OH4A 3BX5A 4K8AA 4PPAA 5BNJA 3MA3A 5HTCA 2ITWA 3DFAA 4YZBA 4IVBA 1UU9A 5M4FA 2QOQA 2YJRA 4BGGA 2XH5A 1YXXA 3V3VA 5FUTA 3G90X 4QMOA 4LFIA 3EOCA 3WF9A 3I1AA 1URWA 2ZB1A 3LAUA 5M06A 4CV9A 3PY1A 3EMGA 4KSPA 3DAJA 1GIJA 1J7LA 2CNUA 5DE2A 4LG4A 3POZA 3UIBA 5AX3A 4CKRA 1U54B 2ZV8A 3AT2A 3U54A 2O0UA 4M13A 4UMPA 4Y46A 5D9HA 3DK6A 3F88A 3GU7A 5FGKA 5AUXA 2XZSA 5KBRA 1CTPE 3VUHA 2OU7A 4TWCA 3C51A 2B52A 2ESMA 4PP7A 3FEGA 1GOLA 3L8VA 5CALA 3ZO3A 5KMOA 2I0HA 3DLZA 3EQPA 5GZ9A 3R9HA 4IB1A 4EUTA 4DFUA 4XV1A 3BCEA 3KQ7A 3R9RA 4RLLA 1YI6A 3ENMA 2YM3A 3CS9A 3ACJA 1JBPE 2VWIA 3MWUA 2BKKA 5LMKC 4EJ7A 3LCTA 4ZTMA 5I9VA 5EOLA 4QNYA 3ULIA 4MX9A 5AV0A 5BVFA 4JAJA 4M66A 3D94A 4QMPA 3VAPA 3E8CA 4U40A 5E8WA 3RPVA 2OXYA 4RBLA 5IDNA 4JIAA 2IVTA 5LVNA 1BMKA 3CGOA 5LMBA 2X39A 4EORA 5GIOE 2VTLA 4AF3A 2GS6A 5T68A 3RTPA 2HY81 4FI1A 4RIXB 4EHGA 3P23A 4I22A 1OZ1A 1PXJA 2C6DA 2E9VA 3QTRA 5KHXA 5C01A 3NUNA 4NWMA 4O7ZA 3F6XA 4CV8A 1R0PA 4XJ0A 4XV3A 5D41A 1OPJA 2ZOQA 4OTWA 2G15A 3ROCA 3GUBA 3DBDA 4Z7GA 2H9VA 2ERZE 3OF0A 4TYHB 3HX4A 3R01A 4YO6A 1WMKA 4L53A 4Q5HA 4C58A 4D1ZA 1M2RA 3OT8A 4F9AA 2YAAA 4FIFA 3D83A 3H9OA 3LXLA 5AP0A 2EU9A 1Y91A 3UZRA 3QTSA 4OTPA 3SQQA 2QURA 1XH4A 3V5QA 2Z60A 4ZEGA 1PMNA 4AQCA 4DFXE 2KULA 4RVTA 3OG7A 1JKLA 1NVRA 4EZ5A 1A9UA 4NCTC 1IA9A 2X7GA 5HO7A 3C0HA 3UP2A 3SXFA 2JDOA 3DK7A 4P2KA 3M2WA 3BHYA 2VX3A 1I44A 4I6FA 4J1RA 3WIGA 4OR5A 5D12A 4IWOA 5AUZA 4GIIA 5I9UA 5IQFA 2XUUA 2O8YA 4AW2A 4BF2A 1BI7A 2GNJA 4QYEA 3FDNA 5AM7A 3C0IA 5LMAA 1SNUA 4A9UA 4TT7A 1OIQA 4BKJA 4FK6A 4XBUA 4TTHB 3TJCA 5J5SA 4YPSA 5L6PA 4O84A 1IASA 4Z16A 4XG6A 4LOQA 3EZVA 5EW9A 5H9BA 3OY1A 2F7ZE 2B4SB 2ZV9A 4NM5A 3GU4A 5GIPE 4E5AX 4EH9A 5KKRB 3HDNA 4ANLA 3UNZA 2VO7A 3VHEA 3AC5A 4ZTHA 5HBEA 3U6IA 3TNQB 4DLJA 5AA8A 2I1MA 2IJMA 4FSQA 1PKDA 3RVGA 3Q9YA 5J5TA 4RWKA 3KVXA 4A4LA 4IM3A 5K4IA 4FT7A 3KXGA 2XKEA 4YZMA 2VD5A 5AMNA 3DK3A 4C62A 4BCQA 5JMSA 1PJKA 2VTQA 2WMAA 3R83A 2RSVA 4AWIA 4P5QA 2PVYA 3QTZA 4BCFA 1M7QA 3D5WA 1H4LA 4U41A 3M11A 1KE9A 4B7TA 2VTIA 4I0SA 4G9RA 4QYHA 3RM6A 3R1YA 5IA5A 2YLFA 4FYOA 2VNYA 5FTQA 4FVRA 2C1BA 3QF9A 3SD0A 5LARA 4AW1A 4PQNA 4C38A 4C4IA 2R3FA 1YVJA 2GMXA 2ITUA 5DYJA 1U5RA 3WBLA 2WQNA 5M56A 2YHVA 3NIEA 3QQKA 4BCOA 3LFQA 3AMYA 3BU3A 4FTMA 4WG5A 3QKLA 4O2PA 4DEGA 3ZRLA 3JY9A 4AZSA 1PYEA 4APPA 4U80A 4DT8A 1P14A 2IZTA 1B39A 1H0VA 3C4EA 3VUKA 4PF4A 3WE4A 3MTLA 3COMA 2XEYA 1PMUA 4NFMA 4L01A 4M67A 4TXCA 3MB6A 1VZOA 3JVSA 2W1IA 5EHOA 2UV2A 3HMNA 3TNIA 3R7OA 3U8WA 3IO7A 4MTAA 4PP9A 3DKFA 3O23A 2R64A 4S31A 5KCVA 3SW7A 4O7TA 3TUBA 4LMUA 1G5SA 1W0XC 3I7BA 4APCA 4F9CA 3Q53A 3ZRKA 3FAAA 2WQMA 5KBQA 3MESA 4CCUA 5E90A 2BZIB 4FTJA 5D1JA 5FTOA 4DEBA 3B2TA 5DH3A 4I24A 3QD2B 4U97A 5M4CA 5FXSA 1NXKA 5HLWA 3GU8A 3VWAA 2IZUA 4K0YA 2XYNA 3ORKA 4CQGA 3WARA 3FKLA 1URCA 1UU7A 4U0IA 5I4NA 3ZBFA 4ZLYA 5BUIA 2PVKA 4CTCA 2R9SA 1ERKA 5LMKA 3ID6C 4IFCA 5CZHA 2VWXA 3NUUA 4XNEA 5JQ8A 2IW9A 5HX8A 1HCKA 3SRVB 2C6OA 4NTSA 4S32A 5ETCA 5KMIA 4YC8A 2HENA 4HVIA 4OTGA 4DBXA 1FMOE 4I20A 3NVMB 4F7LA 3GP0A 3F7WA 3HRFA 2WO6A 3AD5A 4P5ZA 4RVKA 4WA9A 4NT4A 5CVGA 5D11A 4FT9A 4YP8A 3FV8A 3HUCA 3U6HA 4DLIA 3KN6A 3SGCA 5EFQA 3D7ZA 4UYAA 4L52A 5AP7A 3RK7A 3OCBA 2XYUA 3HV4A 4BHZA 1OL2A 3FMKA 4OT6A 4C34A 5E8XA 4PDOA 4LMNA 2YCRA 3FWQA 3OMVA 5DLSA 1IEPA 4D4YA 2UZLA 3OWJA 3ZLXA 1M7NA 1OUYA 4ZIMA 2PZ5A 3TKHA 1YHWA 5DI1A 1GZ8A 4DTKA 5EW8A 3QYWA 5E1EA 5M57A 4FEWA 2O65A 5AWMA 4G3EA 4BFMA 3EL8A 5JEBA 4L6QA 3LHJA 4QMWA 4G9CA 1LEWA 4Y83A 5CEKA 4FUXA 5CSXA 3UGCA 2NPQA 2F7EE 2E2BA 4A9RA 1UNHA 3FQSA 2KTYA 4OW8A 5ACBC 2PUIA 1XR1A 5FM2A 2YISA 5JGAA 2XNPA 5J9ZA 4NCTA 4TYEA 4ZTNA 4D1SA 2C3LA 2VU3A 2E9NA 3QA8A 3UZTA 3W2SA 3RMFA 5HG8A 2OJFE 3OUKA 5H8GA 3CXWA 5AUUA 1Q8YA 5HICA 4AGCA 3OW3A 4HVDA 3R63A 4YJSA 4FV4A 4MF0A 5IF1A 1WAKA 4H3BA 1K3AA 4ID7A 2YDKA 3R8ZA 3KA0A 4USEA 3MVJA 4IX3A 2CCHA 4CKJA 2C5XA 2HELA 4X21A 3AG9A 2E9OA 2Z7RA 3AQVA 3OROA 5KHWA 5J9LA 4DE4A 3D15A 1SM2A 5H3QA 3K5VA 3DXPA 5ANEA 4U45A 2VRXA 2YWVA 3U87A 2W9FB 4JL9A 2GFSA 4M3QA 4BR3A 3UVQA 4MXZA 1U4DA 3VBTA 4RWIA 3MPMA 1QCFA 4FKGA 1M2QA 3IW5A 4IAKA 5E92A 4O1PA 4O7VA 3F2AA 2YA9A 5E4HA 5FBNC 3V6RA 3S0OA 3E8NA 2I7QA 3W32A 4C4JA 1XBAA 3C4FA 3NZ0A 3M1SA 3QUEA 3FY0A 4L3LA 4C3FA 2ETMA 2QQ7A 2XJ2A 4YURA 3HZTA 4PX6A 4BY9E 4XRLA 3MJ2A 2W4OA 3GFWA 5AV2A 2OWBA 3O8TA 4GIHA 5AR2A 3VS0A 1JSVA 4U81A 4BYJA 2ZJWA 3NAYA 4FIJA 4K1BA 5A54A 3OC1A 3C7QA 3QRUA 1YOJA 4BGHA 3OOGA 2OFVA 4BDEA 3PVGA 4S33A 3S3IA 4BN1A 4CFWA 5FTGA 3EIDA 4I4FA 4EEVA 3VW6A 3GCVA 4XX9A 4LV5A 4E4MA 3EYHA 4M14A 4IADA 4GH2A 4FL3A 4EC8A 1QL6A 1KOBA 2HW6A 3DJ6A 1NA7A 3FI2A 4IAZA 4IE9A 2C3JA 4MWIA 3F5XA 5IH4A 3R0TA 4M7IA 2XJ1A 5DMZA 2YDIA 3B8RA 3UQGA 4JAIA 4MHAA 2QOHA 3LQ8A 2QOBA 4FK3A 5F94A 5C9CA 5I9ZA 5HE1A 2CJMA 3DPKA 4FC0A 3RPRA 2VGOA 3UMXA 3RJCA 3FLNC 4FEVA 1WBPA 3L9MA 2HAKA 4CZTA 4O7LA 3NNVA 4F70A 3BHTA 3U9NA 2Y9QA 3TL8A 3B8QA 3BGQA 4X2KA 5IUGA 3CKXA 3SHEA 2RL5A 1H1SA 2RFSA 4FG7A 3VUIA 3ZYAA 5I9YA 3QRTA 3PA3A 3KMWA 1PXIA 1SNXA 4J98A 4UY9A 3G15A 4FL2A 5L8LA 3AGMA 4GUEA 3NLBA 3VS2A 5DR6A 4QYFA 2J2IB 3KF7A 4GFMA 3PSBA 3COHA 3QQGA 2GCDA 1J1BA 5C8MA 3P5KA 4XV2A 4ZSGA 2ITQA 3DQXA 3EFWA 4JG8A 3ANRA 4WKQA 3GQLA 4BDIA 3DJ7A 3QQHA 4F4PA 3PLAE 1Y6AA 1NVQA 4FZ6A 2AUHA 4F0FA 3F9NA 4HOKA 3FZPA 5C1QB 2WQEA 4L3JA 5FXQA 4BIEA 3QXOA 2VTHA 1FINA 5JKGA 2C5NA 3UTOA 4DH7A 4C2VA 3AT3A 3E63A 1UVRA 2PMOX 2X8IA 4EK4A 2ITOA 3ORIA 4ZZMA 4MXXA 4XG4A 4FV9A 4PPBA 4EH8A 2OK1A 5CNNA 2YIXA 4DFNA 3FLZA 5HLPA 4L7SA 4FZAB 5B0XA 3DBFA 3IQ7A 1BL7A 4BB4A 4EK8A 4EOLA 2B55A 5CAUA 1SYKA 5F20A 5KMLA 2XJ0A 4D5HA 5HX6A 3QZHA 3Q4ZA 1GNGA 4BDBA 3BV3A 5C4LA 2IO6A 3NGAA 3FJQE 1CMKE 4LQMA 4FEUA 5CQWA 3PA5A 1CKPA 2OG8A 4FV0A 2OZAA 3SDJA 1NVSA 2IVSA 2PZRA 2QOFA 4FL1A 4UZHA 3MVMA 4QNAA 4F08A 1BI8A 3P7BA 3SV0A 4FIIA 1J7IA 2CCIA 3MTFA 5HO8A 3BWFA 3R7UA 2YZAA 4UMUA 1YDRE 1O9UA 5DHJA 5IEVA 2X2LA 4FICA 4XRJA 2ZMDA 5CEPA 1XH8A 3QQFA 4K6ZA 3KXZA 4RFYA 4MNEA 2VNWA 4B99A 4QD6A 3HV7A 3P7AA 3BGPA 2Y4IC 3HV3A 4X0MA 5L2TA 3HAMA 1YOLA 4ZS0A 2XEZA 5CEOA 3KRWA 2WIHA 3FC1X 2WTWA 5IQCA 3PJ8A 3FBVA 4JX7A 5DR9A 4ACHA 2PTKA 2UZTA 3PXQA 4JQEA 5HIDA 1NW1A 1REKA 3A62A 4HW7A 4Z55A 4QP8A 5T6KA 3FE3A 3PYYA 4Q2AA 2W17A 3NDMA 4O7NA 3MW1A 4DFZE 5IA3A 3QTUA 2BFYA 4D1XA 1AD5A 3D2IA 3MH1A 2WMTA 3JYAA 4KBCA 4O21A 4QPAA 4XCUA 1DI9A 3Q2JA 4I0TA 3PJ1A 3VN9A 3KRLA 3K2LA 2QLUA 1O6KA 4IANA 4AN3A 2FSTX 2WHBA 2BR1A 2OJ9A 4MXOA 3TTIA 1PY5A 5KMNA 2V55A 3UG1A 4ARKA 4PL5A 1PKGA 4IAYA 3ZSGA 1Q8UA 4U44A 3HA6A 4IVDA 4C4FA 5AP2A 3AC1A 4CMOA 4ONAA 4D4VA 2C6EA 1E1VA 3TUCA 4UALA 4GS6A 3LFNA 4Y72A 3RINA 3PA4A 2ITXA 2H6DA 2Z2WA 4E4NA 2R3PA 1YWRA 2GNHA 4M69A 4GVJA 3Q52A 4KKGA 2VWWA 4F65A 4HVSA 4HGTA 3LVPA 5CTPA 4R77A 3L8PA 5E8SA 2HZNA 4EOIA 4OBOA 4FTUA 4V0GA 4IZ7A 3Q5ZA 4CCBA 5EYDA 3H0YA 1WCCA 3CD3A 4JDHA 4YNEA 5ETFA 4PNIA 5JT2A 2C0TA 1OECA 2VX1A 5CX9A 2PK9A 3OXIA 2OH0E 3R7GA 4AU8A 3W2RA 1FPUA 4YC3A 3D7TA 3NUPA 4J8NA 2JIUA 5LCKA 3M42A 1ND4A 2VZ6A 3Q04A 1TVOA 2XK3A 3A7HA 3ZC5A 3PIXA 4AN9A 4AA0A 4OTIA 1B6CB 2ITNA 3W2OA 4ANSA 3DBEA 1PMEA 3BHUA 3A4OX 4N57A 5AV3A 3NX8A 5IH6A 3CP9A 1GIIA 2SRCA 1Q99A 3A7GA 3DV3A 1OPLA 4GT5A 3T3UA 3F82A 4CGAA 3IDBA 5K0XA 2CDZA 2XKFA 4A07A 3CQUA 2WOUA 3Q6UA 2VWBA 1Q97A 2J5EA 1APME 2YIRA 2BAKA 2W99B 5E8ZA 3ZOSA 2PVHA 4FA2A 4DFLA 5CXZA 3DFCB 2QD9A 3R2BA 3EN6A 2R3HA 4FKIA 4PTGA 3N4UA 5DBXA 3QGYA 3O7LB 4WRGA 5EYCA 2C3IB 3LCOA 4C37A 5K4JA 3GVUA 3HV5A 1DM2A 1YXVA 4FR4A 4I6QA 4LYNA 4PL3A 5AUYA 5H8BA 4EC9A 5C8NA 4IJPA 4IQ6A 5IQBA 5AIKA 4AGDA 3QU0A 4KIKA 3OOMA 1JKTA 5L3AA 2Y0AA 4EYJA 4B8MA 3PSCA 4W9XA 5JGDA 2UZOA 3VF9A 4FBXA 1NY3A 3CSVA 3VS4A 5CAOA 4CFXA 1CM8A 3R22A 4GU9A 3EN7A 5IMEA 3WE8A 3SXRA 4HCTA 2OJIA 2OXXA 2QODA 5AR5A 3K3JA 3NWWA 4GT4A 3BYSA 3QZIA 3VS5A 2VWVA 4OTDA 1H25A 2JDRA 1Q5KA 4M84A 4L42A 2B54A 3KCKA 4GKHA 4I94A 4XH6A 2X6DA 4H36A 4UWYA 2O63A 3DNDA 3R1NA 3FXWA 4HYSA 3R8LA 4B6LA 2R3LA 2WTJA 1OL5A 3ZSIA 2BRNA 3FI3A 1UWHA 4OTFA 2XK6A 5A4EA 2IW6A 2WMUA 3L9PA 4XEYA 4F0IA 4D9UA 2R7BA 4N6YA 5A4LA 5AEPA 2BZKB 3ORMA 4FTCA 4GFGA 2BALA 2GFCA 3PP0A 4H58A 4RX7A 3ZDUA 4QT1A 1MUOA 3LJ1A 5IQAA 3QZGA 4O1OA 4ASZA 3OXTA 2BRMA 2R3RA 4ZP5A 3CTHA 2YIYA 3EQBA 3KGAA 4AUAA 5BVWA 4AZWA 4EYMA 3BE9A 1OIYA 3VVHA 2FYSA 4UXQA 3UOKA 3CY2A 2QCSA 3R04A 2RG6A 4JVGA 4FX3A 2WTKC 2EWAA 3GNIB 3P4KA 4K11A 3SX9A 4M15A 4FVQA 4W8DA 3F5PA 2GNGA 2XIYA 4JOAA 1K9AA 2PU8A 1Y6BA 2XA4A 2GSFA 1YI3A 2YCSA 2IVUA 1ZWSA 3IS5A 4QQCA 4TNDA 5EQYA 3IK3A 3ZM9A 1XO2B 4TWPA 3C0GA 3RKBA 1FGIA 1PXMA 1YQJA 4IDTA 3QBNA 3L8XA 4PV0A 2WIPA 4RFZA 4ANMA 4USFA 2B0QA 3F69A 3NMUF 3PDTA 2AC5A 4AS0A 1ZY4A 4UXLA 2W5HA 4DEDA 5AP3A 4BCHA 3QXPA 4MXCA 4G3DA 5E9EA 4RZVA 3W16A 4X3FC 3FL5A 3DA6A 5DWRA 1ZAOA 2I6LA 1RW8A 5A6OA 3SG8A 3NCGA 2VTJA 1YDTE 3VBVA 4U5JA 5JGBA 3RPYA 2PULA 2WB8A 3F3TA 4ANQA 1Q8ZA 1UKIA 4BHNA 1M2PA 4NL0A 4CEGA 2J0IA 2DUVA 1YHVA 3FMHA 4BWPA 4DITA 4F9YA 4H1MA 2HCKA 2OKRA 2VTSA 3MPAA 5F4NA 3PY0A 3FI4A 2Q0NA 4E5WA 2GPHA 3WZEA 3O50A 3C5IA 4J95A 4CQEA 4O6EA 4JQ7A 3GT8A 3IW4A 3K3IA 4XBRA 4BICA 5EM7A 3R7YA 4HNIA 4KBKA 4M0ZA 4FSTA 3CQWA 3R30A 1QMZA 2A0CX 4BIDA 4R3RA 4FKQA 2YABA 5E8UA 2GNIA 3WZJA 5ANJA 4D2RA 4HYUA 3OEZA 2F57A 4P4CA 4AA5A 4YZDA 4AXAA 4TL0A 3QTXA 5E8VA 3UQCA 4BTJA 3FY2A 3LM0A 4CLJA 5DVRA 4OTQA 4YNOA 1RDQE 5HVJA 4EQCA 2LAVA 4NM7A 1H07A 1G8SA 4QTCA 2LGCA 4H3PA 2PZIA 1OGUA 4TNBA 4WG4A 1H01A 5DEYA 4XOZA 1OPKA 5BVDA 5DIAA 4K2RA 5CY3A 2QOKA 3MFUA 3QX2A 1H1WA 2W1HA 2J0MB 4TYGA 4NFNA 1H1PA 4MF1A 3H9RA 5AR4A 2F49A 1JSUA 5DG5A 5HO6A 4XYFA 4YTHA 2C0IA 1PXOA 3DXNA 3MH2A 5CSHA 3MFSA 4RX8A 4AW5A 3E7VA 1VYWA 4IVCA 4JX3A 4L67A 3TZMA 5LVMA 2ZDUA 3TZ9A 4BDHA 4TYIA 4HGSA 5M07A 1XHAA 4IHPA 4PUZA 3LFFA 4FTIA 3WZUA 2C6IA 4BRXA 3GFEA 3V04A 4MD8E 4D55A 4C2WA 1MQ4A 4HGEA 2V7AA 5TOZA 3TV6A 4J96A 2PVNA 1MRUA 3IECA 3L1SA 3QCQA 5EW3A 3BE2A 2GQRA 2HZ4A 4QP9A 4TW9A 4A9YA 5DT4A 2VN9A 1G8AA 4I1ZA 4DT9A 1YDSE 5CS6A 2WXVA 4RJ6A 3MN3A 2DYLA 5LVLA 3V5LA 3COKA 3OD6X 1Q8WA 1OKZA 2B9JA 3FMEA 4CMTA 2OIBA 3NW6A 3LXNA 3O0GA 3UC4A 4UMRA 5CI6A 2Z02A 1RJBA 5EQEA 3UPZA 2GHLA 2C6LA 3NUAA 2EXEA 4IW0A 3F2NA 3UO6A 1O6YA 3VNTA 5CU6A 3R1SA 2WGJA 3FXXA 4MQ1A 2XNGA 5BPYA 3MA6A 2CNVA 4NIFA 3QHRA 3R9NA 4XP2A 5IPJA 5EG3A 4CVAA 4KIPA 2BAJA 2C5OA 3BZ3A 3ACKA 3EH9A 2GNLA 4EHVA 3PJ2A 4Y8DA 1W8CA 2HK5A 3DKOA 4KS8A 3ALNA 3PRFA 2ITTA 3Q3BA 3ETAA 4EKLA 1F5QA 2A2AA 2PYWA 1U5QA 3WF5A 4YLJA 3RBWA 3QFVA 5M51A 3RP9A 2XIKA 5BMMA 2A19B 4I6HA 4QP2A 5AADA 3NIZA 3QZFA 5AP4A 1P4FA 1YI4A 4LUEA 3HRBA 4IBMA 3TJDA 4A7CA 3MI9A 4XV9A 3UJGA 4JJRA 2DWBA 4RJ5A 4RIYA 2YN8A 3PXRA 2XS0A 1IR3A 4EQUA 4IWQA 4ZOGA 2WKMA 1GZKA 1RQQA 3ZUTA 5B2LA 5M4UA 2XKCA 3ZUVA 4O22A 1WBVA 4S34A 5HG7A 1ZY5A 2QOCA 3DB6A 4DCAA 4YZNA 3GCPA 3W2PA 2GHMA 1UA2A 1WBTA 4IJ9A 5AR3A 4TKSA 3TEIA 4AZEA 4GW8A 2IW8A 3UDBA 3FQEA 4U6RA 3FMDA 5AV1A 4DG2E 4L7FA 3QTQA 1FQ1B 4I5MA 4I92A 3LW0A 2PVRA 1OBDA 2EB2A 1JKSA 1WVXA 3MFRA 1KSWA 2HW7A 1KV2A 1RE8A 2JAMA 5CVFA 3LMIA 4X3FA 3LQ5A 4RRVA 2UW3A 3BEAA 2OZAB 4DG0E 1BUHA 3E3PA 2QLQA 3W8QA 2E9UA 3K5UA 4FT5A 3FKNA 2NRUA 3O8PA 4DH1A 2R0UA 2R2PA 3OHTA 1IG1A 4FKLA 2W1EA 3S4QA 4HVHA 4JDIA 4QQ5A 3THBA 1JVPP 4MNEB 2XMYA 1Z9XA 3WOWA 5JK3A 2FA2A 3S1HA 2UW5A 4F1OA 2J7TA 5CSPA 5L8KA 3FPQA 4QMLA 5ANKA 3DQWA 5EK7A 1YRPA 2DQ7X 3EWHA 2BAQA 3R9OA 4AOTA 4JRVA 3HMPA 3KCFA 4BDKA 4CTBA 2C47A 4FV6A 3DNEA 4PMPA 4D2WA 5JZJA 2ZDTA 1OL1A 2PUPA 4E5BA 4ALVA 3MY0A 2XVDA 5EKNA 5CAVA 1F3MC 4BKZA 2WEVA 4QMYA 1R3CA 3RAIA 4LL5A 3ALOA 3Q5IA 2R3OA 4ASDA 3KY2A 1H08A 3RGFA 2RG5A 2R3JA 4NTTA 4CG9A 5FEQA 2ITPA 2YZLA 4NUSA 2CPKE 3KK9A 2HZ0A 3ZU7A 5JZNA 3UYTA 2J5FA 4AX8A 2UVYA 3EJ1A 5CU3A 4R7IA 4E93A 1HOWA 3LCKA 4G6NA 2IVVA 3N4VA 3ZEPA 1JWHA 1Y57A 3E3BX 3KN5A 3RZFA 2WTIA 4ZTQA 4M69B 3JR1A 4YJTA 2X81A 5HVKA 1XH6A 5HTBA 4FZDB 4HYIA 1LPUA 3MYGA 3RAHA 4Z9LA 1YXUA 4V0GB 3ZRMA 5HCYA 5K5NA 2QG7A 4GU6A 4UMTA 1Q62A 4IM0A 3GB2A 2P2HA 3WI6A 5KUPA 2WMQA 4WNMA 3HECA 3W33A 2QKRA 3D7TB 2GS7A 4DGLC 5DNRA 3D5VA 3FZRA 1Z5MA 4FOCA 3W55A 4OAVB 5A9UA 3KK8A 3MH3A 3RHXA 4GG7A 1BX6A 1W7HA 4FIEA 1XH9A 3GCQA 2VAGA 3RWPA 1ZMVA 5BVEA 2OZOA 2BKZA 3SC1A 5HZNA 1FMKA 2XNMA 4GFOA 2B9FA 3IGGA 1WVWA 3KRXA 4WHZA 3N9XA 2BIYA 1PYXA 2C6KA 4KINA 5AX9A 5KZ0A 4ZJJA 3VULA 4EOJA 3EFLA 4D0XA 4G5JA 2XK9A 2JKQA 2ZAZA 4O2ZA 4QPSA 4NZWB 3FZSA 3O2MA 4JI9A 4H05A 5AR8A 5T3QA 2W9ZB 5CLPA 3U4WA 5A46A 3NUYA 4DGMA 2J90A 3O8UA 2VO3A 3ORTA 5ANDA 1EH4A 4LRKA 5I3OA 3TT0A 3HAVA 1VR2A 3T8OA 2OSCA 3FSKA 3KRJA 2GDOA 3A60A 1ZOGA 4CD0A 3FMMA 4QMZA 4KIKB 5CU0A 2WQOA 3D14A 2X6EA 1WBWA 2P0CA 5A3XA 2WOTA 5K9IA 4YO4A 3MIAA 5J1VA 4DTBA 4OTRA 4X3JA 1GZOA 2CKOA 4ZJIA 5AAFA 4ZSLA 4QMXA 3ORPA 3UZPA 4FKUA 4NW5A 3EQDA 4KD1A 3FHIA 3LMHA 3PIYA 3QQJA 2VGPA 1J1CA 4IACA 3BQRA 1ZYLA 3R8UA 3E7OA 5JFSA 2J4ZA 1F0QA 4RC4A 4FNZA 4PTEA 2ZB0A 4PRJA 3TIZA 2QHNA 3VUDA 4AE6A 2HWOA 2XKDA 4GUBA 4PL4A 4OBPA 3ZUUA 4GCJA 4AZFA 4FT0A 4J7BA 4JG7A 3ZO1A 3V6SA 1GJOA 1STCE 3F3ZA 4YHFA 5AUVA 4EZ7A 4QMNA 2WMVA 2C6MA 4X2NA 3SOCA 4CFNA 1OKVA 2WNTA 1KE7A 3OCSA 4ALUA 2UW0A 2O3PA 5J1WA 4GVAA 3EFKA 4IXPA 3BBWA 3GC8A 4NM0A 3SXSA 5AFVA 2VWZA 5LVOA 1J91A 3UMWA 4ANNA 3O51A 4KKHA 4HZRA 4DFYA 2YFXA 2XIXA 3Q2MA 2BZJA 4BZNA 3UC3A 4UZDA 3O7LD 4CZUA 3R8VA 3A7JA 3CJFA 3DS6A 3HMOA 4D4RA 2W1GA 3FC2A 1FOTA 2UW6A 4R7HA 3HEGA 5EI8A 4O7RA 3QWJA 1JOWB 1OIUA 3CTJA 3DKCA 4W8EA 1V1KA 1AGWA 4FF8A 2IWIA 4JDJA 4R3PA 4BIBA 3KRRA 1ZMWA 2X2KA 2X4ZA 5EOBA 3ODYX 4NKAA 4B4LA 2YDJA 4L8MA 2Y4IB 3PTGA 2YITA 5CT0A 1VJYA 1YW2A 3NCZA 4AW0A 4TYHA 4FTTA 4MVFA 3F5UA 2QONA 2Y7JA 4BKYA 3AGLA 1Q24A 4FKSA 3R8PA 4EQMA 2P2IA 5J7BA 4DYMA 5L2WA 3OY3A 3CTQA 3ENHA 2FSLX 4UYNA 3LQ3A 4DTAA 4GJ2A 3LFCA 3A2CA 4CG8A 3CQEA 4JXFA 4UV0A 3RCJA 4NEUA 3KL8A 4KKEA 5GZAA 3WYYA 1MQBA 5ICPA 2FO0A 4O0UA 1M17A 2R3GA 3OFMA 4LUDA 3WF7A 4O7SA 2WMBA 4XP0A 2P3GX 2XP2A 4CT1A 4XUFA 4G34A 5BX0A 2YAKA 3H9FA 3R8MA 4W4WA 3WZDA 4E6DA 4IB0A 1P5EA 2C4GA 5FP6A 3RAKA 3TZ7A 5G6VA 2WFYA 3ELJA 3FPMA 3LMGA 4XG8A 5D7VA 3VO3A 4RG0A 4ZSAA 3O71A 4RVLA 3RHKA 5BVOA 4WNKA 2F4JA 2PY3A 4V05A 4YR8A 2R4BA 5GJGA 3VRZA 5KMMA 4IZYA 4EH5A 4M97A 5AUTA 4EBVA 3D2KA 2EUFB 4IFGA 3IOPA 3TNWA 3P78A 2W5AA 2X7FA 5FQDC 4EOOA 4C61A 5LJJA 3E87A 2QU5A 4TWNA 4DCEA 4O0SA 3BYOA 3R71A 4CZYB 4JBPA 4TZRA 2J0LA 5JN2A 5CZIA 2XRUA 5IA0A 3JS2A 3OCGA 4R8QA 2BZHB 4MBLA 1FVVA 1SZMA 3C4WA 3HP5A 2Q0BA 4BYIA 3TXOA 4YTIA 4Y85A 4YJQA 3BQCA 3PWDA 1O6LA 4JNWA 3FXZA 2RF9A 3UYSA 3LFDA 1V0BA 4O83A 1E9HA 4YUQA 5DT3A 4F99A 2F7XE 3ZO2A 5BUEA 3V5TA 4FOBA 2JLDA 2CGWA 1GIHA 2HXQA 3FLQA 2W96B 3RPOA 4UB7A 3G2FA 3PPKA 4DA5A 1G3NA 3PLSA 3PE1A 3R2YA 3IGOA 5LWNA 3GBZA 1ZYDA 2WPAA 3CLYA 4IB3A 3G33A 2W4JA 4TWOA 3GC7A 2Z8CA 3FMLA 4JIKA 3PXFA 3NPCA 3Q4UA 4EH7A 3DJ5A 4YHJA 1QPDA 4BCMA 3QHWA 4Q5EA 3EQHA 4GJ3A 5HHWA 4BTFA 5HD4A 4C3RA 3DZQA 3FZ1A 4MNFA 3C4XA 4C35A 3E8DA 1GY3A 2BUJA 2YEXA 3C4CA 4JRNA 4RX5A 2F2CB 1W83A 4CRLA 1YOMA 4W4YA 2ITZA 3AD6A 2B53A 4O91A 3R6XA 3OW4A 3QL8A 4AGUA 4S30A 3NYOA 2PMLX 5CF8A 5HU3A 3W1FA 4EK3A 1WBSA 2PSQA 2V0DA 5BVNA 2PVFA 3CR0A 1MRVA 3R7VA 3DDQA 5CQUA 1DI8A 3JUHA 4FZ7A 3PPZA 1U46A 4N0SA 4WBOA 3VRYA 4ASEA 4FUYA 3TIYA 2OJGA 1H27A 3UNJA 4BDDA 4PNKA 2WD1A 4QMTA 4KWPA 4DGGA 2JEDA 3PVUA 3SAYA 5CU2A 4DC2A 3U6JA 4LI5A 2ERKA 2RIOA 4WO5A 5B7VA 3N4TA 3TV7A 4MCVA 4X7QA 2UZWE 3I6UA 4YJVA 2YLEA 4TY1A 5FEEA 4UX9A 2J50A 4ZY4A 3KFAA 5GINE 3ZFYA 4B0GA 4NIFB 2QOOA 2REIA 2W1ZA 3FQHA 3GXLA 4KNBA 4F09A 2ITVA 5ITAA 3PG3A 4RVMA 5GJFA 5JRQA 3TG1A 4MXAA 2WAJA 4QTAA 3Q4TA 1BL6A 2Q83A 3C5UA 3ZLSA 3HMIA 3E88A 3PVWA 3PP1A 3OWPA 2PHKA 1ZLTA 3POOA 4JR3A 3ORLA 4XOYA 5EM8A 2I0EA 5HCXA 4GG5A 4HVGA 4C02A 3MFTA 2NRYA 3R21A 1JNKA 2VTMA 1SVHA 2ZM1A 5F9EA 2JFLA 4RT7A 2A27A 4UEUA 3BLQA 3CY3A 2UZBA 3ZH8A 4I0RA 5IZFA 1FBNA 2RFEA 2OBJA 4NYEA 4RIYB 5M44A 5H8EA 3Q32A 4UN0C 2WTKB 4O0VA 5HNBA 4FKRA 5I9XA 4D4SA 4F7SA 3UIUA 3QC9A 4FIHA 4RQKA 4KB8A 4MEDA 5HI2A 4PMTA 5C03A 5FM3A 5AV4A 1GAGA 2PVJA 3LM5A 1MP8A 1ZXEA 2ONLA 3OBJA 4G17A 4AT3A 2R3QA 4ZLOA 4GSBA 4E4LA 4RQVA 2UZUE 3VJNA 2GS2A 1E1XA 2WTVA 3O96A 1GZNA 4LGHA 4NSTA 4XP3A 4YJOA 4YBJA 2F2UA 3ZFMA 4F1MA 2UW4A 4A4OA 5BVKA 2G2FA 4X3FB 4ZAUA 3ERKA 4P7EA 1NT2A 2XNBA 3NAXA 3SOAA 4IC8A 4EL9A 2BRHA 2VV9A 4H3QA 2UUEA 4PDSA 3BKBA 4G2FA 4WIHA 5JFWA 3FHRA 3K54A 4QMVA 1YXSA 1OUKA 2CGUA 3R73A 5FXRA 3FI8A 4XHKB 2YERA 3DTCA 4XG7A 2BDJA 3I5ZA 3PUPA 4GMYA 3RK9A 4I93A 2B7AA 3O17A 3W8LA 1VYZA 2BDWA 3QQUA 4PMMA 3VBWA 5BYZA 4QQTA 2PE0A 3BHVA 3KULA 3UG2A 4U9AA 3DLSA 2A4LA 4KBAA 2CLQA 4F9BA 5BYYA 3AC8A 3GU6A 3PPJA 4K77A 2QR7A 2ACXA 2RGPA 2XCKA 3E93A 2RKUA 3KMMA 3Q60A 5BYLA 2VTTA 2BHEA 3AC3A 3P86A 4F0GA 4BDJA 4JDKA 3QLFA 2QR8A 3HUBA 3OVVA 1XBBA 2WMSA 5HE3A 3VW8A 3ZEWA 4ACGA 3DKGA 4HPUE 3B2WA 5DOSA 4JBVA 5HBHA 1XWSA 2WTCA 4LGGA 5JRSA 3ATSA 3TNHA 3AMBA 4LOPA 4DN5A 5HTIA 4DGNA 2Y6MA 4FNWA 4BBEA 3G6GA 3I6WA 3DBCA 1ZRZA 5A4QA 5M4IA 3TUDA 4GKIA 4O81A 4BL1A 3GENA 4QRCA 2DS1A 4Q9ZA 4N6ZA 3PFQA 3BU5A 4PY1A 5JSMA 2G2IA 4FODA 4GK3A 1QPEA 4YLKA 5K5XA 2HIWA 3EL7A 3RWQA 3LFSA 1BLXA 3R02A 5F1ZA 5IQGA 5FWKK 2NO3A 4OBQA 4RJ3A 2QVSE 5HIBA 3IKAA 4MAOA 4EH2A 4I21A 3BU6A 3A8XA 5IQDA 3F2RA 4ERKA 2PUNA 3VJOA 5IQEA 3FKOA 3QALE 4W4XA 2PZYA 5C26A 3PY3A 3VQUA 4EHEA 2GNFA 4YTCA 2UZVA 4E1ZA 4UWBA 3AMAA 3MSSA 5D7AA 4EK5A 2FGIA 4MBIA 2XCHA 3DB8A 5IUHA 3GCUA 3KB7A 3E5AA 1A06A 2YWPA 3G9NA 3LIJA 2UW9A 1BYGA 3F3WA 4QMSA 4C4HA 3FZTA 4I5HA 2Z7QA 3IDCA 2WU7A 3NUSA 4GV1A 4X2GA 5KNJA 2CLXA 4LOOA 4C8BA 5IH5A 4E20A 5D10A 3U4UA 4FV7A 3F5GA 3FLSA 3MH0A 2X8DA 4A9SA 3Q96A 2XRWA 4JS8A 4D9TA 4QTEA 3UP7A 1OMWA 4YSJA 3OTUA 1MRYA 5KO1A 2W7XA 5AAGA 3RAWA 3COIA 3IW7A 1WBOA 2Y4PA 3FUPA 1B38A 3MBLA 4RFMA 3ZMMA 5ETAA 4AFJA 4BTKA 4BTMA 3Q9WA 3S95A 3QLGA 5L2QA 2JIVA 5KMKA 5A14A 4C57A 3MVHA 5DN3A 3LCDA 3H10A 3Q6WA 3F3VA 5EI2A 4EOMA 2HWPA 1OL7A 2BPMA 4BDGA 3GU5A 1DAYA 4JQ8A 5TF9A 3ZXZA 4DH5A 4RA5A 5AAEA 5AR7A 4AP7A 5A6NA 3WZKA 3KXXA 3SVVA 3W18A 4WUNA 3LXPA 3H3CA 4FZFB 4PDYA 3QKMA 3P1AA 4YTFA 3CC6A 3A7FA 3HMMA 3LFBA 4NJ3A 5CXHA 2C5YA 4BBFA 5CAPA 2GU8A 4YC6A 2PUUA 5FG8A 3RALA 1KUTA 2QO9A 2JBPA 3LE6A 4FNXA 4PTCA 4EZ3A 4ZY5A 3C50A 2YM4A 3A8WA 4EOQA 3TACA 3VQHA 3W2CA 2W1DA 2QO2A 2OFUA 2PPQA 3VC4A 4FSUA 3ZFXA 4LRJA 4U42A 3T3VA 4KRCA 2R3IA 3SW4A 3CPCA 4BZOA 4DEIA 4E8AA 1OKWA 4YJRA 3R7EA 3MB7A 3LOKA 4FIGA 3MV5A 4D5KA 1UV5A 3IONA 3OBGA 4QMUA 4QTDA 4S2ZA 4O86A 3QYZA 3DAEA 3VBYA 2CKQA 3IG7A 4ZMFA 3P9JA 1UU3A 3VUTA 4BI0A 3KXNA 3RPSA 4OTHA 2XIZA 4AOIA 5BMSA 2HY0A 2XM8A 4FSNA 3ZM4A 4ZTLA 2OF4A 2JKOA 4K33A 4WRSA 2XK8A 5HEZA 4YZCA 4FYNA 3SLSA 3I7CA 5DR2A 3GEQA 4BI2A 4GYGA 4O0RA 4XLIA 2GTMA 5CAQA 2VTAA 5ANIA 2PWLA 3OXZA 4G16A 4E26A 3AC4A 5IA2A 1OKYA 3D5UA 5TR6A 4BI1A 3QD4A 4NJDA 5C4KA 4FV2A 4IH8A 2JFMA 5HGIA 3CIKA 1XH5A 3BEGA 4IDVA 1QPJA 2C69A 2WMXA 5FDPA 5IEYA 3ZXTA 4E6AA 2WELA 2UZEA 3FMNA 2X1NA 2HOGA 4XLVA 1JLUE 2J6MA 3KC3A 1SMHA 3LJ0A 4L9IA 3ZHPC 5AIRA 2PVLA 2R3NA 4MK0A 4RC3A 3G0FA 3R7IA 3HA8A 3I60A 2R5TA 5JFVA 3UO5A 4R5SA 1W98A 5CEQA 3PXZA 2R3MA 3OTVA 4QMMA 3V01A 2ZVAA 1DS5A 4R6VA 3DY7A 4LL0A 5E91A 3GC9A 5EM6A 3OCTA 3CCNA 4RMZA 3VBXA 1Q3WA 4ZY6A 3I4BA 1CKJA 3EKKA 4RLKA 5HD7A 4RZWA 3NR9A 3ZTXA 5CASA 4RJ8A 3DDPA 3BV2A 5IQHA 3BHHA 3QRKA 2V5QA 5TE0A 4E4XA 3QC4A 1T45A 1SVEA 3EQGA 3PIZA 3QKKA 4K18A 4WNOA 4AFEA 3NVKI 1Y8GA 3BYUA 4QO9A 4O7WA 4YSMA 2ETKA 4IB5A 4WUAA 4IIRA 4QP4A 5B2MA 2PMIA 4EJNA 5CU4A 3NEWA 3U55A 4U43A 1YKRA 5EH0A 5L6OA 3LCSA 3QD3A 2FVDA 3AXWA 2ZMCA 4WSQA 3GOPA 3UOLA 4FTLA 5H2UA 2BRGA 1LUFA 3TN8A 5FBOA 3P7CA 5DRBA 3CD8A 1Q4LA 3EHAA 2A1AB 4FTQA 4FV5A 2JDVA 3G9LX 3II5A 3EQIA 3SA0A 3EFJA 4I4EA 5EDRA 4BCJA 4MXYA 2ZM4A 3UO4A 2X9FA 4EKKA 1QPCA 2J0JA 2XNOA 3BIZA 3PVBA 4F9WA 4FKJA 3QTWA 3OUNB 5BUJA 5L2IA 4Y95A 2QOLA 2I40A 2JC6A 2C0OA 4HNFA 3PG1A 2BMCA 2BTRA 3EQRA 1YHSA 1XKKA 2QC6A 2W1FA 4CLIA 3R1QA 4H39A 5TKDA 2BROA 3UBDA 3W10A 5KZIA 5JFXA 3FLWA 3DZOA 5F95A 4Y5HA 4G6OA 2FUMA 3ANQA 2QKWB 1Q3DA 1R39A 3PZEA 2EXCX 4UBAA 4XG2A 1KE6A 2O5KA 2X2MA 4ZTSA 4BCIA 4F7NA 3HKOA 5LXMA 1ZZ2A 1H00A 3DOGA 2O64A 3D0EA 5J79A 1P4OA 2JAVA 4C59A 3TI1A 5HQ0A 2J9MA 3LXKA 4U3ZA 3WF6A 4BC6A 4PMSA 2C6TA 5J7HA 5IUIA 2RFDA 4AAAA 1FVTA 4BCKA 2ZYBA 2YJSA 2P55A 2XF0A 2WTDA 3CE3A 5IA1A 4L45A 4MBJA 1S9IA 2GQSA 4O0WA 1LP4A 2B9IA 3ZCLA 1LEZA 5CF5A 2RFNA 3FYJX 3QGWA 5E8TA 5CSVA 5HE0A 4IX4A 3KF4A 4IEBA 4CFFA 4N70A 3A99A 3CPBA 3H0ZA 2AYPA 3EKNA 3I0QA 3ZZWA 2PE1A 1PF8A 3TKIA 4ALWA 4MH7A 2VWYA 1LR4A 3L9NA 3DGKA 3V51A 4D0WA 3UOJA 3RCDA 1ZYCA 5HLNA 2W1CA 5EDPA 3ULZA 2PZPA 3KEXA 1KOAA 4LGDA 4RIWA 4L43A 4II5A 4QP1A 4U3YA 5E7RA 3WYXA 4GYIA 3PSDA 3TV4A 5DEWA 4MKCA 1PRYA 2OXDA 4JLCA 4R1YA 4FV3A 3P08A 4ERWA 2BHHA 2C1AA 3L9LA 4FNYA 5HG5A 4KABA 3RI1A 4F1TA 4ZSJA 5CEMA 5KKRC 3HDMA 4DF3A 2YIQA 1W82A 2XK4A 1UU8A 2OIDA 4Z7HA 3VHKA 4EK6A 3NYXA 2CGXA 3OWLA 4F7JA 3BRBA 2IZRA 3ZZEA 4ASXA 4QTBA 4E6QA 2J51A 4V01A 1OVEA 4ZS4A 5E1SA 1L3RE 3CJGA 2Y8OA 3QRJA 4BVUA 5CF6A 2QG5A 3I79A 1M14A 1AQ1A 4CRSA 3WIKA 4OAUC 1JKKA 1OIRA 2XM9A 3I5NA 3UIXA 1IRKA 2E9PA 1XH7A 4QPMA 2UW7A 2XBJA 4FGRA 1TQIA 2O2UA 3CEKA 5DT0A 1UNLA 1KE5A 4H1JA 4EWHA 3U51A 2W5BA 3IDPA 3MY5A 4V04A 5BQ0A 4Z3VA 3FYKX 5I9WA 3FL4A 5HKMA 4A9TA 5CWZA 5EHYA 2BCJA 3IW8A 3Q4CA 3E62A 3UNKA 4O0XA 4R78A 3QQLA 4RGJA 4Y73A 4G31A 4AG8A 1ZOHA 4FGBA 4HCVA 5L6WL 3GGFA 4W4VA 4CMUA 5C8KA 3V8TA 2OGVA 3NS9A 1OITA 5E8YA 4LRMA 5CANA 5I5ZA 2CGVA 3DU8A 3PJCA 3LKMA 4D2SA 2YACA 3VF8A 3EQFA 1R1WA 2QNJA 2WMWA 4ITJA 1JPAA 2BTSA 3VUGA 2EXMA 3HYHA 1FGKA 3BYMA 2GHGA 4FKPA 5B2KA 3EN5A 3T9TA 3RNIA 4WNPA 2YM7A 4HZSA 3RK5A 2OICA 4YJPA 4WT6A 2JD5A 3N51A 1U54A 5ETIA 2VWUA 3TWJA 4K9YA 3GI3A 1ATPE 4FKVA 4AACA 1H0WA 3QCSA 4DAWA 4HCUA 5M09A 2G01A 5M53A 1PXLA 5EQPA 1U59A 2W4KA 3HNGA 4USDA 4BZDA 3WF8A 4E3CA 3LFAA 3NNUA 2P4IA 3KULB 5IISA 5L4QA 4HJOA 3AC2A 4AE9A 4QMQA 2Z7SA 4U79A 1UWJA 4YJUA 2ETRA 2VTPA 3PXYA 3QA0A 1IA8A 2CKEA 1JAMA 1H1QA 3DT1A 2QHMA 3EN9A 4G6LA 3UVPA 4YMJA 3HVCA 3ORXA 4MYGA 3BLHA 1IAJA 4B9DA 3OEFX 5EM5A 4EOSA 4IAIA 2EB3A 4DGOA 4QP7A 3V5JA 3TM0A 3DAKA 1J7UA 3UIMA 4JR7A 5IMXA 4R3CA 2IN6A 2CKPA 5EKOA 4O96A 3RZBA 3QTIA 4P90A 2PVMA 4AZVA 2H96A 4RIXA 4QOXA 2I0VA 4RC2A 3C9WA 4J8MA 2C3KA 4IX6A 5JH6A 2AC3A 4L00A 5CI7A 2V22A 5J87A 3DBQA 4EOKA 5KX8A 5GHVA 3FMJA 3LJ2A 5M55A 4BDFA 1PXKA 3UPXA 4WD5A 4I3ZA 2BFXA 3QAME 4L3PA 3NNXA 4IWPA 3EB0A 5ANOA 3QUDA 4TN6A 2PL0A 4NH1A 5CT7A 5GNKA 4DINA 4RWLA 2OJJA 5HOAA 1XBCA 2YIWA 4ITHA 2X4FA 5J9YA 2ONLC 5KMJA 3SG9A 4YLLA 3KREA 3ZSHA 3VS3A 4ANBA 2YCQA 4BDCA 3HLLA 4OLIA 3P79A 3ZONA 3RNYA 4UWCA 5HBJA 2OW3A 4FSZA 4KS7A 2P33A 4X6RA 3E8EA 1KE8A 4GT3A 3U9CA 3TZ8A 3HP2A 2ZV7A 1TQPA 4RPVA 2R7IA 4YZ9A 3ZC6A 4FEXA 5JQ5A 1H24A 2H8HA 4RJ4A 3VS7A 2UZNA 3NNWA 2C68A 2FSMX 3ROYA 4LM5A 3LFEA 5IQIA 2VTOA 4RA4A 4G3GA 5AM6A 1ZYSA 4HPTE 5L8JA 4U7ZA 2JIIA 3F7ZA 2X8EA 3DTWA 4KRDA 4BCNA 3CBLA 4PPCA 3UQFA 5IDPA 1OI9A 3JVRA 4D2VA 2XNEA 2XB7A 2G9XA 2UVZA 5EYMA 3TKUA 5IG1A 1A48A 2XK7A 4YJNA 2NNWB 4Q9SA 4RWJA 4C4EA 4EI4A 4X2FA 3REPA 2J0KA 4MD9E 3ET7A 5G1XA 2GTNA 4FSRA 4CXAA 4J53A 4KSQA 4L46A 4YGAA 3HGKA 5DPVA 5K0KA 5IKWA 4F64A 2CNQA 4ORKA 1IAHA 4O0YA 3KKVA 4FKOA 2OIQA 4N4SA 3NW7A 1PMVA 2Y6OA 3IPHA 1WVYA 3BYVA 5CYIA 3D5XA 4I41A 3H4JA 2XNNA 4MQ2A 4NW6A 4YPDA 3FSFA 4CYJA 3TDWA 4BDAA 4DH3A 1ZOEA 5AA9A 4GL9A 2YM6A 3ATTA 3EN4A 2UZDA 3BLRA 4CFUA 4F6WA 3KVWA 2PE2A 4F6UA 1H28A 3LZBA 4DFBA 2JDTA 5K3YA 4KIOA 4ENXA 3OT3A 3GCSA 4R5YA 3BGZA 4EH6A 4D28A 2UW8A 4FKTA 3A4PA 4IX5A 2CMWA 4O0TA 2ZV2A 4BGQA 4CNHA 4PWNA 5IU2A 4B8LA 5LQFA 3NRMA 4JT3A 1OB3A 3KU2A 3L8SA 3AT4A 2WZJA 4IZ5A 5DRDA 2R0IA 1JQHA 4IVAA 5AUWA 4PDPA 3UVRA 4WBBB 4BWKA 3QUPA 3MIYA 4FV1A 4GK2A 1PXNA 5EHLA 1V0OA 3V5PA 4KA3A 4X6QC 3JY0A 1ZARA 3QCYA 5AP6A 2JDSA 2OO8X 1JSTA 5HESA 4FG9A 1UNGA 1SVGA 4EONA 4KUJA 3DCVA 3JXWA 4CT2A 3TCPA 4IAFA 4BBMA 1OL6A 3H30A 2W05A 1BKXA 1YWVA 5DGZA 1ZZLA 4FTOA 3VS6A 3DXQA 4I23A 4U8ZA 4DG3E 4BCGA 4I6BA 4LV8A 4AT5A 3ZO4A 4EUUA 5HORA 1OBGA 3V8SA 1Z57A 4WG3A 1J3HA 5ANGA 4ZZOA 5A4TA 3TTJA 3F3UA 1HCLA 3OZ6A 4EHZA 5EDQA 5TO8A 3E64A 3KXMA 4C4GA 3C4ZA 4IMYA 2R3KA 1ZYJA 4ENYA 3CKWA 1R0EA 1R78A 5LVPA 4QYGA 2EVAA 5FRIA 1Y8YA 3MS9A 3V5WA 5EI6A 5FDXA 4DBNA 4FTKA 4C33A 4F63A 4UMQA 4FTRA 4G3CA 1Q61A 4NU1A 3KXHA 2VUWA 4D2PA 2H34A 5IEXA 3AOXA 4M68A 3D9VA 2Z7LA 1PW2A 2NP8A 3PE2A 3A61A 3QCXA 2OLCA 1DAWA 5I3RA 3BELA 4DEEA 3Q9ZA 4ZLZA 4QP3A 3VIDA 5GZ8A 2HZIA 4O27B 2W0JA 1Q41A 4FT3A 3D4QA 4ZXTA 4QP6A 4ACCA 3PZHA 2BDFA 4FSWA 2WMRA 3SRVA 1XQZA 3BBTB 1V0PA 2IG7A 4RJ7A 4IM2A 3I0OA 3NW5A 4CYIA 3UODA 3C1XA 4G5PA 5EYKA 5HE2A 4F6SA 4O7YA 2CHLA 1TQMA 4M8TA 1WBNA 4OGRA 4YHTA 2ZM3A 2IZSA 1PXPA 4EH4A 4Y5QA 4L44A 5FLFA 1H26A 3E92A 1CSNA 2XBAA 1I09A 4NM3A 2JITA 4JG6A 4FKWA 4XS2A 4ZMEA 1S9JA 4R7BA 4FVPA 3UOHA 4KIQA 3WILA 1YWNA 4FTAA 2VTNA 3ZLWA 3BWJA 4HYHA 4RIOA 4FSMA 4XG3A 4FE2A 2QI8A 2V7OA 3QRIA 5J8IA 3VBQA 1UKHA 3ORNA 3PJ3A 3G5DA 3IW6A 4YBKA 3ZDIA 4O82A 4RX9A 5CEIA 4NK9A 5M08A 3PXKA 5CSWA 4WOVA 3S2PA 4AA4A 4E6CA 4DEAA 5C27A 3GC0A 5TT7A 2X9EA 2FH9A 2G2HA 3OS3A 4FG8A 3ODZX 4J97A 4ZK5A 3FLYA 2FSOX 3JPVA 4G3FA 3AD4A 2HXLA 4C7TA 3I81A 3BPRA 4YU2A 5AP5A 2JKMA 2I0YA 3BI6A 4QYYA 3GOKA 3UE4A 4C36A 4J71A 3ZBXA 2W06A 3R9DA 2F9GA 5CVHA 5IA4A 1XJDA 1T46A 4QQJA 1W84A 4OT5A 2VTRA 3RM7A 1REJA 3NSZA 4BWXA 3NUXA 3MDYA 1Q8TA 2XIRA 4J99A 4M12A 4EWQA 4C0TA 5L2SA 4WSYA 3NYVA 3ORZA 4E73A 3G51A 1KWPA 3QX4A 2B1PA 3GQIA 4IC7A 1ZMUA 4D58A 3IOKA 1H1RA 2HYYA 3VUMA 4L68A 3A7IA 4CKIA 3G6HA 4GRBA 4FSYA 4W9WA 3PRIA 2GQGA 3QWKA 4ANOA 3KMUA 3MPTA 4DEHA 3T9IA 3F61A 2QOIA 4ACDA 4HGLA 4O6LA 3LPBA 4OUCA 3HL7A 3HRCA 4NKSA 4C3PA 5HVYA 3C13A 3W2QA 2JGZA 2CN8A 2YCFA 5HNIX 4AOJA 3CGFA 3LLAA 5I0BA 5AJQA 3ZLYA 4RSSA 5LWMA 4AT4A 4AN2A 2IPXA 2VO6A 4I5PA 4A4XA 4FEQA 3FZOA 4IAAA 1P2AA 2V62A 2QU6A 1K2PA 3OWKA 3G0EA 4FTNA 4O38A 3V8WA 2JBOA 5AP1A 4AGWA 3HV6A 3R28A 2BIKB 4ITIA 3EYGA 4ZJVA 5HCZA 2WQBA 3VS1A 3MVLA 5DA3A 3F66A 1WZYA 2FB8A 4FV8A 4TRLA 5GJDA 4RIWB 5J95A 4TPTA 2VO0A 5CNOA 2X7OA 3Q9XA 4I5CA 4MWHA 3MY1A 1VEBA 2CSNA 3OP5A 4IWDA 1FVRA 2YM8A 3S00A 4CSVA 4XMOA 5HU9A 2G1TA 4ZZNA 4GK4A 3MGYA 2X0GA 4G1WA 2PMNX 5A4CA 5FD2A 5LOHA 2B9HA 5KE0A 3LLTA 3QD0A 5FEDA 4FMQA 3ZS5A 2UVXA 4KAOA 1CDKA 1OM1A 2OI4X 1X8BA 4ZSEA 5HG9A 4E7WA 3TDVA 4ZTRA 4AZTA 1H8FA 4EOPA 3PWYA 2WEIA 4D2TA 3R00A 5CENA 5FP5A 4XG9A 2ITYA 3EZRA 2VX0A 1TKIA 1CKIA 4R1VA 4X2JA 3SKCA 2C5VA 4BCPA 4CFVA 4GEOA 4DHFA 2CN5A 5DFPA 2QO7A 1L8TA 4DH8A 1M52A 3EQCA 2OF2A 2YM5A 3ITZA 4IZAA 4EBWA 2BRBA 1KV1A 4M0YA 1WFCA 4JBOA
chains in the Genus database with same CATH superfamily
5HIEA 4A06A 4MD7E 3NYNA 2C30A 1YXTA 1PHKA 2JKKA 4EH3A 2BILB 4ACMA 4TYJA 4JBQA 2BVAA 5HNGA 3P0MA 2WU6A 4J52A 3MJ1A 5CF4A 4CFMA 5LCJA 5ACKA 3TNPC 2OH4A 3BX5A 4K8AA 4PPAA 5BNJA 3MA3A 5HTCA 2ITWA 3DFAA 4YZBA 4IVBA 1UU9A 5M4FA 2QOQA 2YJRA 4BGGA 2XH5A 1YXXA 3V3VA 5FUTA 3G90X 4QMOA 4LFIA 3EOCA 3WF9A 3I1AA 1URWA 2ZB1A 3LAUA 5M06A 4CV9A 3PY1A 3EMGA 4KSPA 3DAJA 1GIJA 1J7LA 2CNUA 5DE2A 4LG4A 3POZA 3UIBA 5AX3A 4CKRA 1U54B 2ZV8A 3AT2A 3U54A 5BV3A 2O0UA 4M13A 4UMPA 4Y46A 5D9HA 3DK6A 3F88A 3GU7A 5FGKA 5AUXA 2XZSA 5KBRA 1CTPE 3VUHA 2OU7A 4TWCA 3C51A 2B52A 2ESMA 4PP7A 3FEGA 1GOLA 3L8VA 5CALA 3ZO3A 5KMOA 2I0HA 3DLZA 3EQPA 5GZ9A 3R9HA 4IB1A 4EUTA 4DFUA 4XV1A 3BCEA 3KQ7A 3R9RA 4RLLA 1YI6A 3ENMA 2YM3A 3CS9A 3ACJA 1JBPE 2VWIA 3MWUA 2BKKA 5LMKC 4EJ7A 3LCTA 4ZTMA 5I9VA 5EOLA 4QNYA 3ULIA 4MX9A 5AV0A 5BVFA 4JAJA 2AQXA 4M66A 3D94A 4QMPA 3VAPA 3E8CA 4U40A 5E8WA 3RPVA 2OXYA 4RBLA 5IDNA 4JIAA 2IVTA 5LVNA 1BMKA 3CGOA 5LMBA 2X39A 4EORA 5GIOE 2VTLA 4AF3A 2GS6A 5T68A 3RTPA 2HY81 4FI1A 4RIXB 4EHGA 3P23A 4I22A 1OZ1A 1PXJA 2C6DA 2E9VA 3QTRA 5KHXA 5C01A 3NUNA 2XALA 4NWMA 4O7ZA 3F6XA 4CV8A 1R0PA 4XJ0A 4XV3A 5D41A 1OPJA 2ZOQA 4OTWA 2G15A 3ROCA 3GUBA 3DBDA 4Z7GA 2H9VA 2ERZE 3OF0A 4TYHB 3HX4A 3R01A 4YO6A 4DHZA 1WMKA 4L53A 4Q5HA 4C58A 4D1ZA 1M2RA 3OT8A 4F9AA 2YAAA 4FIFA 3D83A 3H9OA 3LXLA 5AP0A 2EU9A 1Y91A 3UZRA 3QTSA 4OTPA 3SQQA 2QURA 1XH4A 3V5QA 2Z60A 4ZEGA 1PMNA 4AQCA 4DFXE 2KULA 4RVTA 3OG7A 1JKLA 1NVRA 4EZ5A 1A9UA 4NCTC 1IA9A 2X7GA 5HO7A 3C0HA 3UP2A 3SXFA 2JDOA 3DK7A 4P2KA 3M2WA 3BHYA 2VX3A 1I44A 4I6FA 4J1RA 3WIGA 4OR5A 5D12A 4IWOA 5AUZA 4GIIA 5I9UA 5IQFA 2XUUA 2O8YA 4AW2A 4BF2A 1BI7A 2GNJA 4QYEA 3FDNA 5AM7A 3C0IA 5LMAA 1SNUA 4A9UA 4TT7A 1OIQA 4BKJA 4FK6A 4XBUA 4TTHB 3TJCA 5J5SA 4YPSA 5L6PA 4O84A 1IASA 4Z16A 4XG6A 4LOQA 3EZVA 5EW9A 5H9BA 3OY1A 2F7ZE 2B4SB 2ZV9A 4NM5A 3GU4A 5GIPE 4E5AX 4EH9A 5KKRB 3HDNA 4ANLA 3UNZA 2VO7A 3VHEA 3AC5A 4ZTHA 5HBEA 3U6IA 3TNQB 4DLJA 5AA8A 2I1MA 2IJMA 4FSQA 1PKDA 3RVGA 3Q9YA 5J5TA 4RWKA 3KVXA 4A4LA 4IM3A 5K4IA 4FT7A 3KXGA 2XKEA 4YZMA 2VD5A 5AMNA 3DK3A 4C62A 4BCQA 5JMSA 1PJKA 2VTQA 2WMAA 3R83A 2RSVA 4AWIA 4P5QA 2PVYA 3QTZA 4BCFA 1M7QA 3D5WA 1H4LA 4U41A 3M11A 1KE9A 4B7TA 2VTIA 4I0SA 4G9RA 4QYHA 3RM6A 3R1YA 5IA5A 2YLFA 4FYOA 2VNYA 5FTQA 4FVRA 2C1BA 3QF9A 3SD0A 5LARA 4AW1A 4PQNA 4C38A 4C4IA 2R3FA 1YVJA 2GMXA 2ITUA 5DYJA 1U5RA 3WBLA 1W2CA 2WQNA 5M56A 2YHVA 3NIEA 3QQKA 4BCOA 3LFQA 3AMYA 3BU3A 4FTMA 4WG5A 3QKLA 4O2PA 4DEGA 3ZRLA 3JY9A 4AZSA 1PYEA 4APPA 4U80A 4DT8A 1P14A 2IZTA 1B39A 1H0VA 3C4EA 3VUKA 4PF4A 3WE4A 3MTLA 3COMA 2XEYA 1PMUA 4NFMA 4L01A 4M67A 4TXCA 3MB6A 1VZOA 3JVSA 2W1IA 5EHOA 2UV2A 3HMNA 3TNIA 3R7OA 3U8WA 3IO7A 4MTAA 4PP9A 3DKFA 3O23A 2R64A 4S31A 5KCVA 3SW7A 4AQKA 4O7TA 3TUBA 4LMUA 1G5SA 1W0XC 3I7BA 4APCA 4F9CA 3Q53A 3ZRKA 3FAAA 2WQMA 5KBQA 3MESA 4CCUA 5E90A 2BZIB 4FTJA 5D1JA 5FTOA 4DEBA 3B2TA 5DH3A 4I24A 3QD2B 4U97A 5M4CA 5FXSA 1NXKA 5HLWA 3GU8A 3VWAA 2IZUA 4K0YA 2XYNA 3ORKA 4CQGA 3WARA 3FKLA 1URCA 1UU7A 4U0IA 5I4NA 3ZBFA 4ZLYA 5BUIA 2PVKA 4CTCA 2R9SA 1ERKA 5LMKA 3ID6C 4IFCA 5CZHA 2VWXA 3NUUA 4XNEA 5JQ8A 2IW9A 5HX8A 1HCKA 3SRVB 2C6OA 4NTSA 4S32A 5ETCA 5KMIA 4YC8A 2HENA 4HVIA 4OTGA 4DBXA 1FMOE 4I20A 3NVMB 4F7LA 3GP0A 3F7WA 3HRFA 2WO6A 3AD5A 4P5ZA 4RVKA 4WA9A 4NT4A 5CVGA 5D11A 4FT9A 4YP8A 3FV8A 3HUCA 3U6HA 4DLIA 3KN6A 3SGCA 5EFQA 3D7ZA 4UYAA 4L52A 5AP7A 3RK7A 3OCBA 2XYUA 3HV4A 4BHZA 1OL2A 3FMKA 4OT6A 4C34A 5E8XA 4PDOA 4LMNA 2YCRA 3FWQA 3OMVA 5DLSA 1IEPA 4D4YA 2UZLA 3OWJA 3ZLXA 1M7NA 1OUYA 4DDGA 4ZIMA 2PZ5A 3TKHA 1YHWA 5DI1A 1GZ8A 4DTKA 5EW8A 3QYWA 5E1EA 5M57A 4FEWA 2O65A 5AWMA 4G3EA 4BFMA 3EL8A 5JEBA 4L6QA 3LHJA 4QMWA 4G9CA 1LEWA 4Y83A 5CEKA 4FUXA 5CSXA 3UGCA 2NPQA 2F7EE 2E2BA 4A9RA 1UNHA 3FQSA 2KTYA 4OW8A 5ACBC 2PUIA 1XR1A 5FM2A 2YISA 5JGAA 2XNPA 5J9ZA 4NCTA 4TYEA 4ZTNA 4D1SA 2C3LA 2VU3A 2E9NA 3QA8A 3UZTA 3W2SA 3RMFA 5HG8A 2OJFE 3OUKA 5H8GA 3CXWA 5AUUA 1Q8YA 5HICA 4AGCA 3OW3A 4HVDA 3R63A 4YJSA 4FV4A 4MF0A 5IF1A 1WAKA 4H3BA 1K3AA 4ID7A 2YDKA 3R8ZA 3KA0A 4USEA 3MVJA 4IX3A 2CCHA 4CKJA 2C5XA 2HELA 4X21A 3AG9A 2E9OA 2Z7RA 3AQVA 3OROA 5KHWA 5J9LA 4DE4A 3D15A 1SM2A 5H3QA 3K5VA 3DXPA 5ANEA 4U45A 2VRXA 2YWVA 3U87A 2W9FB 4JL9A 2GFSA 4M3QA 4BR3A 3UVQA 4MXZA 1U4DA 3VBTA 4RWIA 3MPMA 1QCFA 4FKGA 1M2QA 3IW5A 4IAKA 5E92A 4O1PA 4O7VA 3F2AA 2YA9A 5E4HA 5FBNC 3V6RA 3S0OA 3E8NA 2I7QA 3W32A 3W0NA 4C4JA 1XBAA 3C4FA 3NZ0A 3M1SA 3QUEA 3FY0A 4L3LA 4C3FA 2ETMA 2QQ7A 2XJ2A 4YURA 3HZTA 4PX6A 4BY9E 4XRLA 3MJ2A 2W4OA 3GFWA 5AV2A 2OWBA 3O8TA 1ST4A 4GIHA 5AR2A 3VS0A 1JSVA 4U81A 4BYJA 2ZJWA 3NAYA 4FIJA 4K1BA 5A54A 3OC1A 3C7QA 3QRUA 1YOJA 4BGHA 3OOGA 2OFVA 4BDEA 3PVGA 4S33A 3S3IA 4BN1A 4CFWA 5FTGA 3EIDA 4I4FA 4EEVA 3VW6A 3GCVA 4XX9A 4LV5A 4E4MA 3EYHA 4M14A 4IADA 4GH2A 4DHIB 4FL3A 4EC8A 1QL6A 1KOBA 2HW6A 3DJ6A 1NA7A 3FI2A 4IAZA 4IE9A 2C3JA 4MWIA 3F5XA 5IH4A 3R0TA 4M7IA 2XJ1A 5DMZA 2YDIA 3B8RA 3UQGA 4JAIA 4MHAA 2QOHA 3LQ8A 2QOBA 4FK3A 5F94A 5C9CA 5I9ZA 5HE1A 2CJMA 3DPKA 4FC0A 3RPRA 2VGOA 3UMXA 3RJCA 3FLNC 4FEVA 1WBPA 3L9MA 2HAKA 4CZTA 4O7LA 3NNVA 4F70A 3BHTA 3U9NA 2Y9QA 3TL8A 3B8QA 3BGQA 4X2KA 5IUGA 3CKXA 3SHEA 2RL5A 1H1SA 2RFSA 4FG7A 3VUIA 3ZYAA 5I9YA 3QRTA 3PA3A 3KMWA 1PXIA 1SNXA 4J98A 4UY9A 3G15A 4FL2A 5L8LA 3AGMA 4GUEA 3NLBA 3VS2A 5DR6A 4QYFA 2J2IB 3KF7A 4GFMA 3PSBA 3COHA 3QQGA 2GCDA 1J1BA 5C8MA 3P5KA 4XV2A 4ZSGA 2ITQA 3DQXA 3EFWA 4JG8A 3ANRA 4WKQA 3GQLA 4BDIA 3DJ7A 3QQHA 4F4PA 3PLAE 1Y6AA 1NVQA 4FZ6A 2AUHA 4F0FA 3F9NA 4HOKA 3FZPA 5C1QB 2WQEA 4L3JA 5FXQA 4BIEA 3QXOA 2VTHA 1FINA 5JKGA 2C5NA 3UTOA 4DH7A 4C2VA 3AT3A 3E63A 1UVRA 2PMOX 2X8IA 4EK4A 2ITOA 3ORIA 4ZZMA 4MXXA 4XG4A 4FV9A 4PPBA 4EH8A 2OK1A 5CNNA 2YIXA 4DFNA 3FLZA 5HLPA 4L7SA 4FZAB 5B0XA 3DBFA 3IQ7A 1BL7A 4BB4A 4EK8A 4EOLA 2B55A 5CAUA 1SYKA 5F20A 3AKJA 5KMLA 2XJ0A 4D5HA 5HX6A 3QZHA 3Q4ZA 1GNGA 4BDBA 3BV3A 5C4LA 2IO6A 3NGAA 3FJQE 1CMKE 4LQMA 4FEUA 5CQWA 3PA5A 1CKPA 2OG8A 4FV0A 2OZAA 3SDJA 1NVSA 2IVSA 2PZRA 2QOFA 4FL1A 4UZHA 3MVMA 4QNAA 4F08A 1BI8A 3P7BA 3SV0A 4FIIA 1J7IA 2CCIA 3MTFA 5HO8A 3BWFA 3R7UA 2YZAA 4UMUA 1YDRE 1O9UA 5DHJA 5IEVA 2X2LA 4FICA 4XRJA 2ZMDA 5CEPA 1XH8A 3QQFA 4K6ZA 3KXZA 4RFYA 4MNEA 2VNWA 4B99A 4QD6A 3HV7A 3P7AA 3BGPA 2Y4IC 3HV3A 4X0MA 5L2TA 3HAMA 1YOLA 4ZS0A 2XEZA 5CEOA 3KRWA 2WIHA 3FC1X 2WTWA 5IQCA 3PJ8A 3FBVA 4JX7A 5DR9A 4ACHA 2PTKA 2UZTA 3PXQA 4JQEA 5HIDA 1NW1A 1REKA 3A62A 4HW7A 4Z55A 4QP8A 5T6KA 3FE3A 4QDEA 3PYYA 4Q2AA 2W17A 3NDMA 4O7NA 3MW1A 4DFZE 5IA3A 3QTUA 2BFYA 4O4BB 1AD5A 4D1XA 3D2IA 3MH1A 2WMTA 3JYAA 4KBCA 4O21A 4QPAA 4XCUA 1DI9A 3Q2JA 4I0TA 3PJ1A 3VN9A 3KRLA 3K2LA 2QLUA 1O6KA 4IANA 4AN3A 2FSTX 2WHBA 2BR1A 2OJ9A 4MXOA 3TTIA 1PY5A 5KMNA 2V55A 3UG1A 4ARKA 4PL5A 1PKGA 4IAYA 3ZSGA 1Q8UA 4U44A 3HA6A 4IVDA 4C4FA 5AP2A 3AC1A 4CMOA 4ONAA 4D4VA 2C6EA 1E1VA 3TUCA 4UALA 4GS6A 3LFNA 4Y72A 3RINA 3PA4A 2ITXA 2H6DA 2Z2WA 1ST0A 4E4NA 2R3PA 1YWRA 2GNHA 4M69A 4GVJA 3Q52A 4KKGA 2VWWA 4F65A 4HVSA 4HGTA 3LVPA 5CTPA 4R77A 1TZDA 3L8PA 5E8SA 2HZNA 4EOIA 4OBOA 4FTUA 4V0GA 4IZ7A 3Q5ZA 4CCBA 5EYDA 3H0YA 1WCCA 3CD3A 4JDHA 4YNEA 5ETFA 4PNIA 5JT2A 2C0TA 1OECA 2VX1A 5CX9A 2PK9A 3OXIA 2OH0E 3R7GA 4AU8A 3W2RA 1FPUA 4YC3A 3D7TA 3NUPA 4J8NA 2JIUA 3O5AA 5LCKA 3M42A 1ND4A 2VZ6A 3Q04A 1TVOA 2XK3A 3A7HA 3ZC5A 3PIXA 4AN9A 4AA0A 4OTIA 1B6CB 2ITNA 3W2OA 4ANSA 3DBEA 1PMEA 3BHUA 3A4OX 4N57A 5AV3A 3NX8A 5IH6A 3CP9A 4FRFA 1GIIA 2SRCA 1Q99A 3A7GA 3DV3A 1OPLA 4GT5A 3T3UA 3P5JC 3F82A 4CGAA 3IDBA 5K0XA 2CDZA 2XKFA 4A07A 3CQUA 2WOUA 3Q6UA 2VWBA 1Q97A 2J5EA 1APME 2YIRA 2BAKA 2W99B 5E8ZA 3ZOSA 2PVHA 4FA2A 4DFLA 5CXZA 3DFCB 2QD9A 3R2BA 3EN6A 2R3HA 4FKIA 4PTGA 3N4UA 5DBXA 3QGYA 3O7LB 4WRGA 5EYCA 2C3IB 3LCOA 4C37A 5K4JA 3GVUA 3HV5A 1DM2A 1YXVA 4FR4A 4I6QA 4LYNA 4PL3A 5AUYA 5H8BA 4EC9A 5C8NA 4IJPA 4IQ6A 5IQBA 5AIKA 4AGDA 3QU0A 4KIKA 3OOMA 1JKTA 5L3AA 2Y0AA 4EYJA 4B8MA 3PSCA 4W9XA 5JGDA 2UZOA 3VF9A 4FBXA 1NY3A 3CSVA 3VS4A 5CAOA 4CFXA 1CM8A 3R22A 4GU9A 3EN7A 5IMEA 3WE8A 3SXRA 4HCTA 2OJIA 2OXXA 2QODA 5AR5A 3K3JA 3NWWA 4GT4A 3BYSA 3QZIA 3VS5A 2VWVA 4OTDA 1H25A 2JDRA 1Q5KA 4M84A 4L42A 2B54A 3KCKA 4GKHA 4I94A 4XH6A 2X6DA 4H36A 4UWYA 2O63A 3DNDA 3R1NA 3FXWA 4HYSA 3R8LA 4B6LA 2R3LA 2WTJA 1OL5A 3ZSIA 2BRNA 3FI3A 1UWHA 4OTFA 2XK6A 5A4EA 2IW6A 2WMUA 3W0MA 3L9PA 4XEYA 4F0IA 4D9UA 2R7BA 4N6YA 5A4LA 5AEPA 2BZKB 3ORMA 4FTCA 4GFGA 2BALA 2GFCA 3PP0A 4H58A 4RX7A 3ZDUA 4QT1A 2XARA 1MUOA 3LJ1A 5IQAA 3QZGA 4O1OA 4ASZA 3OXTA 2BRMA 2R3RA 4ZP5A 3CTHA 2YIYA 3EQBA 3KGAA 4AUAA 5BVWA 4AZWA 4EYMA 3BE9A 1OIYA 3VVHA 2FYSA 4UXQA 3UOKA 3CY2A 2QCSA 3R04A 2RG6A 4JVGA 4FX3A 2WTKC 2EWAA 3GNIB 3P4KA 4K11A 3SX9A 4M15A 4FVQA 4W8DA 3F5PA 2GNGA 2XIYA 4JOAA 1K9AA 2PU8A 1Y6BA 2XA4A 2GSFA 1YI3A 2YCSA 2IVUA 1ZWSA 3IS5A 4QQCA 4TNDA 5EQYA 3IK3A 3ZM9A 1XO2B 4TWPA 3W0RA 3C0GA 3RKBA 1FGIA 1PXMA 1YQJA 4IDTA 3QBNA 3L8XA 4PV0A 2WIPA 4RFZA 4ANMA 4USFA 2B0QA 3F69A 3NMUF 3PDTA 2AC5A 4AS0A 1ZY4A 4UXLA 2W5HA 4DEDA 5AP3A 4BCHA 3QXPA 4MXCA 4G3DA 5E9EA 3UDZA 4RZVA 3W16A 4X3FC 3FL5A 3DA6A 5DWRA 1ZAOA 2I6LA 1RW8A 5A6OA 3SG8A 3NCGA 2VTJA 1YDTE 3VBVA 4U5JA 5JGBA 3RPYA 2PULA 2WB8A 3F3TA 4ANQA 1Q8ZA 1UKIA 4BHNA 1M2PA 4NL0A 4CEGA 2J0IA 2DUVA 1YHVA 3FMHA 4BWPA 4DITA 4F9YA 4H1MA 2HCKA 2OKRA 2VTSA 3MPAA 5F4NA 3PY0A 3FI4A 4DF3A 2Q0NA 4E5WA 2GPHA 3WZEA 3O50A 3C5IA 4J95A 4CQEA 4O6EA 4JQ7A 3GT8A 3IW4A 3K3IA 4XBRA 4BICA 5EM7A 3R7YA 4HNIA 4KBKA 4M0ZA 4FSTA 3CQWA 3R30A 1QMZA 2A0CX 4BIDA 4R3RA 4FKQA 2YABA 5E8UA 2GNIA 3WZJA 5ANJA 4D2RA 4HYUA 4QDVA 3OEZA 2F57A 4P4CA 4AA5A 4YZDA 4AXAA 4TL0A 3QTXA 5E8VA 3UQCA 4BTJA 3FY2A 3LM0A 4CLJA 5DVRA 4OTQA 4YNOA 1RDQE 5HVJA 4EQCA 2LAVA 4NM7A 1H07A 1G8SA 4QTCA 2LGCA 4H3PA 2PZIA 1OGUA 4TNBA 4WG4A 1H01A 5DEYA 4XOZA 1OPKA 5BVDA 5DIAA 4K2RA 5CY3A 2QOKA 3MFUA 3QX2A 1H1WA 2W1HA 2J0MB 4TYGA 4NFNA 1H1PA 4MF1A 3H9RA 5AR4A 2F49A 1JSUA 5DG5A 5HO6A 4XYFA 4YTHA 2C0IA 1PXOA 3DXNA 4AXEA 3MH2A 5CSHA 3MFSA 4RX8A 4AW5A 3E7VA 1VYWA 4IVCA 4JX3A 4L67A 3TZMA 5LVMA 2ZDUA 3TZ9A 4BDHA 4TYIA 4HGSA 5M07A 1XHAA 4IHPA 4PUZA 3LFFA 4FTIA 3WZUA 2C6IA 4BRXA 3GFEA 3V04A 4MD8E 4D55A 4C2WA 1MQ4A 4HGEA 2V7AA 5TOZA 3TV6A 4J96A 2PVNA 1MRUA 3IECA 3L1SA 3QCQA 5EW3A 3BE2A 2GQRA 2HZ4A 4QP9A 4TW9A 4A9YA 5DT4A 2VN9A 1G8AA 2XANA 4I1ZA 4DT9A 1YDSE 5CS6A 2WXVA 4RJ6A 3MN3A 2DYLA 5LVLA 3V5LA 3COKA 3OD6X 1Q8WA 1OKZA 2B9JA 3FMEA 4CMTA 2OIBA 3NW6A 3LXNA 3O0GA 3UC4A 4UMRA 5CI6A 2Z02A 1RJBA 5EQEA 3UPZA 2GHLA 2C6LA 3NUAA 2EXEA 4IW0A 3F2NA 3UO6A 1O6YA 3PFYA 3VNTA 5CU6A 3R1SA 2WGJA 3FXXA 4MQ1A 2XNGA 5BPYA 3MA6A 2CNVA 4NIFA 3QHRA 3R9NA 4XP2A 5IPJA 5EG3A 4CVAA 4KIPA 1W2FA 2BAJA 2C5OA 3BZ3A 3ACKA 3EH9A 1OGYA 2GNLA 4EHVA 3PJ2A 4Y8DA 1W8CA 2HK5A 3DKOA 4KS8A 3ALNA 3PRFA 2ITTA 3Q3BA 3ETAA 4EKLA 1F5QA 2A2AA 2PYWA 1U5QA 3WF5A 4YLJA 3RBWA 3QFVA 5M51A 3RP9A 2XIKA 5BMMA 2A19B 4I6HA 4QP2A 5AADA 3NIZA 3QZFA 5AP4A 1P4FA 1YI4A 4LUEA 3HRBA 4IBMA 3TJDA 4A7CA 3MI9A 4XV9A 3UJGA 4JJRA 2DWBA 4RJ5A 4RIYA 2YN8A 3PXRA 2XS0A 1IR3A 4EQUA 4IWQA 4ZOGA 2WKMA 1GZKA 1RQQA 3ZUTA 5B2LA 5M4UA 2XKCA 3ZUVA 4O22A 1WBVA 4S34A 5HG7A 1ZY5A 2QOCA 3DB6A 4DCAA 4YZNA 3GCPA 3W2PA 4LV7A 2GHMA 1UA2A 1WBTA 4IJ9A 5AR3A 4TKSA 3TEIA 4AZEA 4GW8A 2IW8A 3UDBA 3FQEA 4U6RA 3FMDA 5AV1A 4DG2E 4L7FA 3QTQA 1FQ1B 4I5MA 4I92A 3LW0A 2PVRA 1OBDA 2EB2A 1JKSA 1WVXA 3MFRA 1KSWA 2HW7A 1KV2A 1RE8A 2JAMA 5CVFA 3LMIA 4X3FA 3LQ5A 4RRVA 2UW3A 3BEAA 2OZAB 4DG0E 1BUHA 3E3PA 2QLQA 3W8QA 2E9UA 3K5UA 4FT5A 3FKNA 2NRUA 3O8PA 4DH1A 2R0UA 2R2PA 3OHTA 1IG1A 4FKLA 2W1EA 3S4QA 4HVHA 4JDIA 4QQ5A 3THBA 1JVPP 4MNEB 2XMYA 1Z9XA 3WOWA 5JK3A 2FA2A 3S1HA 2UW5A 4F1OA 2J7TA 5CSPA 5L8KA 1G8KA 3FPQA 4QMLA 5ANKA 3DQWA 5EK7A 1YRPA 2DQ7X 3EWHA 2BAQA 3R9OA 4AOTA 4JRVA 3HMPA 3KCFA 4BDKA 4CTBA 2C47A 4FV6A 3DNEA 4PMPA 4D2WA 5JZJA 2ZDTA 1OL1A 2PUPA 4E5BA 4ALVA 3MY0A 2XVDA 5EKNA 5CAVA 1F3MC 4BKZA 2WEVA 4QMYA 1R3CA 3RAIA 4LL5A 4AXFA 3ALOA 3Q5IA 2R3OA 4ASDA 3KY2A 1H08A 3RGFA 2RG5A 2R3JA 4NTTA 4CG9A 5FEQA 2ITPA 2YZLA 4NUSA 4F78A 2CPKE 3KK9A 2HZ0A 3ZU7A 5JZNA 3UYTA 2J5FA 4AX8A 2UVYA 3EJ1A 5CU3A 4R7IA 4E93A 1HOWA 3LCKA 4G6NA 2IVVA 3N4VA 3ZEPA 2X0PA 1JWHA 1Y57A 3E3BX 3KN5A 3RZFA 2WTIA 4ZTQA 4M69B 3JR1A 4YJTA 2X81A 5HVKA 1XH6A 5HTBA 4FZDB 4HYIA 1LPUA 3MYGA 3RAHA 4Z9LA 1YXUA 4V0GB 3ZRMA 5HCYA 5K5NA 2QG7A 4GU6A 4UMTA 1Q62A 4IM0A 3GB2A 2P2HA 3WI6A 5KUPA 2WMQA 4WNMA 3HECA 3W33A 2QKRA 3D7TB 2GS7A 4DGLC 5DNRA 3D5VA 3FZRA 1Z5MA 4FOCA 3W55A 4OAVB 5A9UA 3KK8A 3MH3A 3RHXA 4GG7A 1BX6A 1W7HA 4FIEA 1XH9A 3GCQA 2VAGA 3RWPA 1ZMVA 5BVEA 2OZOA 2BKZA 3SC1A 5HZNA 1FMKA 2XNMA 4GFOA 2B9FA 3IGGA 1WVWA 3KRXA 4WHZA 3N9XA 2BIYA 1PYXA 2C6KA 4KINA 5AX9A 5KZ0A 4ZJJA 3VULA 4EOJA 3EFLA 4D0XA 4G5JA 1W2DA 2XK9A 2JKQA 2ZAZA 4O2ZA 4QPSA 4NZWB 3FZSA 3O2MA 4JI9A 4H05A 5AR8A 5T3QA 2W9ZB 5CLPA 3U4WA 5A46A 3NUYA 4DGMA 2J90A 3O8UA 2VO3A 3ORTA 5ANDA 1EH4A 4LRKA 5I3OA 3TT0A 3HAVA 1VR2A 3T8OA 2OSCA 3FSKA 3KRJA 2GDOA 3A60A 1ZOGA 4CD0A 3FMMA 4QMZA 4KIKB 5CU0A 2WQOA 3D14A 2X6EA 1WBWA 2P0CA 5A3XA 2WOTA 5K9IA 4YO4A 3MIAA 5J1VA 4DTBA 4OTRA 4X3JA 1GZOA 2CKOA 4ZJIA 5AAFA 4ZSLA 4QMXA 3ORPA 3UZPA 4FKUA 4NW5A 3EQDA 4KD1A 3FHIA 3LMHA 3PIYA 3QQJA 2VGPA 1J1CA 4IACA 3BQRA 1ZYLA 3R8UA 3E7OA 5JFSA 2J4ZA 1F0QA 4RC4A 4FNZA 4PTEA 2ZB0A 4PRJA 3TIZA 2QHNA 3VUDA 4AE6A 2HWOA 2XKDA 4GUBA 4PL4A 4OBPA 3ZUUA 4GCJA 4AZFA 4FT0A 4J7BA 4JG7A 3ZO1A 3V6SA 1GJOA 1STCE 3F3ZA 4YHFA 5AUVA 4EZ7A 4QMNA 2WMVA 2C6MA 4X2NA 3SOCA 4CFNA 1OKVA 2WNTA 1KE7A 3OCSA 4ALUA 2UW0A 2O3PA 5J1WA 4GVAA 3EFKA 4IXPA 3BBWA 3GC8A 4NM0A 3SXSA 5AFVA 2VWZA 5LVOA 4JMQA 1J91A 3UMWA 4ANNA 3O51A 4KKHA 4HZRA 4DFYA 2YFXA 2XIXA 3Q2MA 2BZJA 4BZNA 3UC3A 4FJVA 4UZDA 3O7LD 4CZUA 3PUFC 3R8VA 3A7JA 3CJFA 3DS6A 3HMOA 4D4RA 2W1GA 3FC2A 1FOTA 2UW6A 4R7HA 3HEGA 5EI8A 4O7RA 3QWJA 1JOWB 1OIUA 3CTJA 3DKCA 4W8EA 1V1KA 1AGWA 4FF8A 2IWIA 4JDJA 4R3PA 4BIBA 3KRRA 1ZMWA 2X2KA 2X4ZA 5EOBA 3ODYX 4NKAA 4B4LA 2YDJA 4L8MA 2Y4IB 3PTGA 2YITA 5CT0A