4YJSA

The kinase domain of human spleen tyrosine (syk) in complex with gtc000226
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
269
structure length
257
Chain Sequence
YLDRKLLTLEDKELGTVKKGYYQMKKVVKTVAVKILALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
publication title Discovery of GSK143, a highly potent, selective and orally efficacious spleen tyrosine kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 257
sequence length 269
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yjsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yjsA01
4ORKA 4OAVB 4BIDA 5JEBA 3W32A 3DAJA 2QU6A 3FE3A 4FBXA 1OI9A 3FMHA 4G6OA 5ETIA 1GIJA 5DT3A 4JQ7A 3ZYAA 2WOTA 2GS6A 3E8EA 3MVMA 3BIZA 3DXNA 1LEZA 2OLCA 4FIFA 4I41A 4IWPA 1ZZ2A 4D0WA 2XIXA 4RFZA 2ITZA 2HXLA 1H0VA 2OJJA 3AMAA 4OW8A 5HO8A 2GNIA 1OPLA 5K5NA 5H3QA 1UU7A 4WT6A 5J5SA 2E9PA 5F9EA 5HE3A 4D58A 4USFA 2P0CA 4I24A 4XV9A 2IWIA 3WYYA 4WG5A 4PMSA 4X2NA 3VW6A 1JKLA 2RF9A 4QYFA 3QLFA 1YXSA 4DGNA 5DT0A 1IEPA 5HNBA 3DCVA 3QLGA 3LFNA 4RFMA 3A62A 2WMTA 1UU8A 3OFMA 3UZRA 3DB6A 5FP5A 3D14A 4JG8A 4YPDA 3U9NA 4EQCA 4USEA 1KV1A 3EB0A 4IAZA 4RJ5A 1P14A 3QCSA 3FKOA 2R3QA 2W4KA 4ZTRA 3VUMA 2QODA 4E20A 3PIZA 1UNLA 3QQGA 3LW0A 2XJ1A 4QTDA 2PUNA 5KMKA 2NRUA 3AT4A 4OBQA 4QMMA 4Q9ZA 3ZU7A 2JDSA 2EB3A 1U5QA 5A54A 4L3JA 3BYMA 2WGJA 3OXZA 3FQSA 1XBCA 2JIUA 3GFEA 4Q9SA 2XF0A 3ZSGA 4USDA 3P79A 1OUKA 3LQ8A 4S34A 4PTGA 5M4IA 3NNUA 4Z7HA 1R0PA 4BDEA 3BGQA 3Q53A 5IISA 3HKOA 4NJDA 4FZDB 1UWJA 2VTNA 2GTMA 3PG3A 4IJPA 4D2SA 4EOMA 2NP8A 5IU2A 3I5NA 3UTOA 1WBSA 5EDRA 4DEIA 4JIAA 2ZV9A 4U79A 2F4JA 4BDJA 2HELA 3MB6A 4X3FA 3FSKA 2C4GA 1LUFA 2FGIA 3ATSA 2R3FA 4YSJA 3R83A 3ET7A 4I5PA 3F7WA 5CLPA 5FM3A 1MRUA 3OEZA 4LOOA 5EK7A 4R7IA 2LAVA 5EKNA 5J1VA 4BN1A 3MY1A 4AE6A 4PNKA 5C8KA 3GGFA 3VUDA 2RKUA 4ZEGA 3EYGA 4D2TA 3FEGA 5IQHA 5M57A 3FUPA 5BYYA 5AR2A 3BGPA 4CMTA 4D2PA 3C4EA 3VJNA 3UNKA 3FPQA 2W9ZB 4BCGA 3FQHA 2PE2A 3VN9A 2ZMDA 4MXXA 1JVPP 4I6BA 3PWYA 2B52A 4A9UA 4ZAUA 4G9CA 4NUSA 4O96A 4TWCA 1OKZA 4QRCA 5HIDA 5G1XA 3UC4A 3VBWA 4I20A 5BPYA 4L9IA 2AC3A 3QTZA 4MQ1A 4JJRA 4H58A 4FTLA 4RIXA 3P86A 4RVTA 4XLVA 5CEQA 4BDHA 3I6WA 2JFMA 3M1SA 3WBLA 3LCSA 4JX3A 2PPQA 4ZY6A 4O1PA 2PVYA 5L2QA 1REJA 5L6OA 3ULIA 1A9UA 4YC3A 4BIEA 5HX6A 4JVGA 5J1WA 3SC1A 4TYHB 4QMXA 1YHVA 3E63A 4ACMA 4RX8A 4UALA 2Z60A 2PY3A 3IGOA 4LMNA 2QOKA 4NCTC 3ZM4A 4YTFA 2UW9A 3C4WA 4PDSA 4Q5EA 5B2KA 3A8WA 2ITUA 2YA9A 2DYLA 5M08A 5AUWA 4IBMA 2WZJA 2YLEA 4AACA 3FYKX 2WMSA 4G31A 4B8LA 2VWZA 2C6EA 2VWBA 3O8UA 4KUJA 3EL8A 3QFVA 4D4YA 5KKRC 3D4QA 4D2RA 3QRKA 3NMUF 3QALE 2YERA 3BRBA 2OBJA 4FG8A 3QGYA 4GUBA 4C35A 5M4CA 3C5IA 4L3LA 4AZTA 2OF2A 2WNTA 3R7GA 4FODA 4EH8A 2BRMA 2PZIA 2Y4IC 2W4JA 2J5EA 2YDIA 4P90A 3ORXA 4C61A 4QYYA 3NUXA 4FL1A 3PJ1A 4GMYA 4GT5A 3BZ3A 3F82A 4IB1A 3QA8A 3ALNA 3ZSHA 2XBJA 5EHLA 3TNQB 3WZKA 2FYSA 1S9JA 5CVFA 2Q83A 3QKKA 5HG5A 4FIIA 5AAGA 2R3OA 3E8NA 4GT3A 5L2IA 3GQIA 3PY1A 4RBLA 4W9WA 3IQ7A 3Q9WA 3ZLWA 4ACDA 3W2PA 2X8DA 3IS5A 4OUCA 1FGKA 5HX8A 3R7IA 2PSQA 4FTUA 5KZIA 5JK3A 5DBXA 3R73A 2W96B 4IVDA 3CGFA 2AUHA 3NPCA 3LCOA 3CD3A 4AFJA 5HBJA 1J7UA 3SGCA 4C0TA 3WZJA 3ZO2A 1P4OA 2DS1A 3MGYA 4FNZA 5HTCA 3QUEA 5EW3A 4EYMA 1LR4A 4M15A 4C02A 4LL0A 1PXMA 4MBIA 3AMYA 1GIIA 1UKIA 5LCJA 2QKRA 3NW6A 3KMWA 4F1OA 2X4FA 2GQGA 1Y6BA 2ESMA 4FKWA 1AQ1A 5CSHA 5EM6A 5BUJA 3F3WA 3H0ZA 4IE9A 5BVFA 3E87A 5GZ8A 3NW7A 3SOCA 4EI4A 3BI6A 3LE6A 5IQEA 2C5YA 5JFWA 1QCFA 5EI6A 5KNJA 3I79A 2W1FA 4EH9A 4U3ZA 4DLJA 3NX8A 4FC0A 3LM5A 4G5PA 4H3QA 3SV0A 4E4LA 4BWKA 4OTFA 1TQIA 3MTFA 4S31A 3DU8A 1APME 2ZV8A 5KX8A 3W16A 3BGZA 3DBCA 3TNHA 5GNKA 5TF9A 4ZY5A 5ICPA 3BQRA 5AM6A 4IADA 2YZLA 3BCEA 4IWDA 5BUIA 2EXCX 4YTHA 2E9OA 4QTBA 3RVGA 4LQMA 4PMTA 4KBAA 4S30A 5FD2A 3DK6A 1REKA 5JMSA 3KVWA 1KE6A 1J7IA 4AGCA 3CC6A 3OXTA 4J95A 3KXMA 4D4RA 1YRPA 4FTNA 3CJFA 3E92A 5FXQA 3R8PA 3QBNA 3U51A 2I0EA 4KINA 2WMAA 3T3UA 4JG6A 5IMXA 3TKHA 2YIQA 2PVLA 3RKBA 3D94A 1OECA 3LFBA 1E1XA 3DK7A 2RGPA 4R1VA 3QKLA 5L2SA 4F70A 4ACCA 5EW8A 4QO9A 2RL5A 3FLZA 2XNEA 1HOWA 1PXLA 3PXZA 3EQRA 4HVGA 5K0KA 2OIDA 3Q52A 4N4SA 4WNOA 4AZFA 1KE9A 4TXCA 2VWIA 2QOIA 3BHYA 3C4ZA 5FGKA 5HICA 4BCKA 4LGHA 3AXWA 1PXKA 3II5A 1WBVA 4QP8A 2XCKA 4DGLC 3EMGA 1E9HA 1H26A 5KE0A 3SLSA 3B2TA 4L6QA 2QR8A 4FEWA 1JSUA 3OS3A 3V6RA 4MNFA 4FA2A 3KGAA 4U6RA 4AWIA 5FEDA 4ZLYA 4M7IA 3HP5A 4ZTQA 4BTJA 4BZOA 3OHTA 1G8AA 4JQEA 3EN7A 4YHTA 3MB7A 5EHYA 4YLLA 3MFTA 5F95A 4E7WA 2JEDA 4L43A 5HNIX 1U54A 1FVVA 3LKMA 4QD6A 2FSMX 2W17A 3CKWA 2IW8A 1IAHA 2PVMA 1DM2A 5FTGA 3SW7A 4OTGA 2IJMA 5AAFA 4CKRA 3MFRA 1LPUA 5ETFA 4F1TA 2P2IA 4PDYA 4TNBA 5M06A 5AV3A 4FL2A 4YLJA 5CEKA 3DBFA 4I5CA 3GB2A 2WMUA 3EN5A 4O0WA 5T3QA 3C9WA 4EOLA 3V5TA 5JRQA 3F69A 3VUTA 5CYIA 5HCYA 1CMKE 3R63A 4QPMA 3ZEWA 3MSSA 1Q24A 5HNGA 4EUUA 4N57A 4EHGA 3K3IA 5IPJA 4FEVA 2VTIA 2W5AA 3JY0A 2C1AA 4BI1A 3FMEA 4EC8A 1TVOA 3P0MA 5ANOA 1PXNA 5CALA 4BCIA 1JSVA 5B2MA 2UW0A 2BRBA 3OMVA 4L68A 4HJOA 3BBTB 4A06A 2IZSA 4CSVA 4EK5A 4RX5A 3P9JA 3NGAA 1RDQE 2PU8A 5K9IA 3WF9A 2W4OA 5L6WL 3ZDIA 1NVSA 4CEGA 3QD2B 3ACKA 2W06A 5DFPA 1ATPE 1UWHA 2VTLA 4D9TA 2Y7JA 3Q9YA 2B9IA 4O27B 1SZMA 4P5ZA 4EHVA 3TT0A 5HG8A 4APCA 3H9OA 4HVIA 5FXSA 1ZMVA 3OTVA 4MAOA 3LCKA 1JSTA 1XH5A 5JQ5A 3DAEA 4YNEA 5E8WA 3ZS5A 3R9HA 5IUHA 3QQFA 3DXPA 4JDJA 4AG8A 1WBOA 2YM8A 3Q4CA 1KWPA 2Z7LA 4Y73A 4K6ZA 2QD9A 4G9RA 3TZ9A 3H9RA 3QX4A 4ZTMA 2RG6A 2P33A 2VWVA 4D1ZA 5AEPA 4BWPA 4OTPA 1HCKA 1ZMUA 3BV3A 3FL4A 5IA5A 3ZFMA 4I22A 1UV5A 5ANDA 3D5WA 3RHXA 3U4WA 4DCAA 3PIXA 2FA2A 4U5JA 2EWAA 3A99A 4O0UA 3T8OA 3ZH8A 3R00A 3Q4TA 4QQJA 3NUPA 5AX9A 3TKIA 3FC2A 4PPAA 3QL8A 5AR7A 2VO6A 2JIVA 4PL4A 5HZNA 3VUHA 1W7HA 3QCQA 4DEHA 5E1EA 3T3VA 3QKMA 1WAKA 5T68A 3NIEA 4FNXA 4E6QA 1BX6A 3VBQA 1Y91A 3FMKA 2X8IA 2ZVAA 3EZVA 2ZAZA 3QUPA 3C0IA 2F2CB 3EQPA 2PL0A 4EJNA 5CT0A 2DUVA 3NWWA 3F9NA 5DVRA 2A2AA 1PXOA 3QTQA 2J5FA 3SXRA 3DPKA 3QZFA 4DCEA 4M0YA 2QOQA 1RW8A 1QPEA 3KCFA 1Q99A 2Y4PA 4J53A 4XG9A 3H0YA 3EN6A 3O0GA 2C47A 4RQVA 3MPAA 4IXPA 4XG6A 3R8LA 4KA3A 3OUNB 3UMXA 3DB8A 4NWMA 2WKMA 4EEVA 4HOKA 3HRBA 4M84A 1LP4A 2PVJA 5CZHA 5GJFA 4DFLA 4E93A 4XG4A 4FKUA 3UQCA 2R3NA 4IANA 3O8TA 3ZFYA 5CAUA 4KRCA 5JH6A 4XV2A 2OKRA 1PJKA 4DEGA 5I9UA 4J8MA 4XJ0A 5CI6A 4FSRA 4IWQA 1KE8A 4CYJA 4GVJA 4Y95A 3UZPA 4W4WA 4HGTA 3ID6C 4NH1A 3RAKA 2QNJA 4ANBA 4TL0A 2CMWA 3PIYA 2I6LA 4C59A 1TKIA 2B1PA 4ZJVA 2Z02A 4LOQA 3OT3A 3F2NA 3QGWA 5E1SA 2GS7A 4JDIA 3UODA 5EYDA 4TWOA 3F66A 2XK9A 3HEGA 4DF3A 4O0VA 3OY1A 4R3RA 4GIIA 4RMZA 3QTXA 4JT3A 1FBNA 4GYGA 1XBAA 4A7CA 1YOLA 5IQFA 3UNZA 2VTJA 4YU2A 4DHFA 2JIIA 2QONA 4PUZA 1YXXA 3EJ1A 2YM6A 3KXZA 3R8ZA 3TV4A 1OVEA 2XJ2A 4GKIA 3NSZA 3BHUA 2CN8A 5HU9A 1NY3A 4WUAA 4UN0C 4CFFA 1BKXA 3O17A 4I3ZA 4W4YA 2G9XA 3CP9A 2PMOX 3ENMA 1H24A 2YIYA 3KULA 3Q2MA 4S32A 2HOGA 2XYUA 3KXNA 4WG4A 3VS5A 4RVKA 4PMMA 2GU8A 5ITAA 4N6YA 2ZM3A 4FG9A 4G5JA 2W9FB 3IECA 4KS7A 4YZBA 1ZOGA 4M13A 5KHXA 3LXNA 4PPCA 2J90A 4Y5HA 3D7TA 4A9YA 1OGUA 3R7VA 2VTPA 3HAVA 5FXRA 3NUYA 1CKJA 4ACHA 4B0GA 1KSWA 5EHOA 1ND4A 4FSUA 4IWOA 5AADA 3F3ZA 3SHEA 1XKKA 2OH4A 3GU7A 1YDTE 1ZRZA 3PJ8A 3RK9A 4CNHA 5FDPA 3OD6X 3DKOA 4FKSA 4WO5A 4EHZA 3BEAA 3RPSA 1VEBA 5JZNA 4FI1A 3TV7A 3ZO3A 4WSQA 5T6KA 4HVHA 1YWRA 4MXOA 1H1RA 4DH7A 4J71A 4TYIA 4N0SA 4H1MA 3KRXA 4GFGA 4HNIA 3SDJA 1ZMWA 4XS2A 4PP7A 3RTPA 2A27A 2XIZA 4QQCA 3DGKA 3TXOA 3Q9XA 3ENHA 5BX0A 4TYJA 4G6NA 2VU3A 3PJ3A 4K11A 2XIRA 2Y8OA 3CQEA 4FTTA 5E8YA 4CG9A 1L3RE 2GHLA 4ZXTA 1V0BA 3E8CA 3NEWA 5AAEA 3GU6A 3OROA 3P5KA 3UOLA 4TWNA 3V8SA 2YWPA 4HVDA 3QTWA 3GXLA 4DAWA 2WMXA 3FAAA 4HCUA 2IVUA 5IF1A 5BVDA 3MH1A 4QYHA 2OI4X 1KOAA 4K9YA 2QU5A 4AA4A 4M66A 2UW4A 4U9AA 1IR3A 2XNMA 5DNRA 4G6LA 3FZPA 4M3QA 4G3CA 3CTQA 5LMKC 4RLLA 3C0GA 3TZMA 3CEKA 2XYNA 4QOXA 4YLKA 5KCVA 3T9TA 5HLPA 2RFDA 2PUIA 4O7ZA 2HZIA 2JDVA 2CGXA 1UU9A 2WOUA 4KIKB 4DC2A 4EQUA 4CKJA 3VO3A 3H3CA 1NVQA 4GRBA 3KN6A 4YC6A 3PFQA 4DBNA 3W2CA 5JN2A 1YW2A 3ZMMA 2J0MB 4AZEA 3PYYA 4CTCA 4F9CA 2W1EA 1W0XC 4IHPA 4CRSA 3A60A 3E3PA 2HXQA 2PVFA 2WTVA 4RIOA 4FSNA 4JBQA 4NFNA 2JAVA 2WU7A 4NU1A 3UMWA 5AA8A 3U6HA 4LM5A 4TW9A 3BX5A 3FL5A 4CZTA 4AOJA 4D1XA 3BLQA 1SYKA 2OWBA 2XRWA 3RAHA 2R3HA 2XK8A 4FSYA 4F7SA 5CEMA 5I9VA 5AV4A 4CQGA 4EH7A 3DJ5A 4FYNA 4ACGA 5CVGA 4Q5HA 4HNFA 5M4FA 1ZYJA 1PKDA 4QP3A 4Z55A 3C4CA 3ORPA 2JDTA 3HX4A 3QXPA 4F6SA 3V04A 4YO6A 3NUNA 4FNYA 3VIDA 3VRZA 4LYNA 4MF1A 4LUDA 3ZC6A 4M69A 2BAQA 2ERKA 4W8EA 5AA9A 2PMLX 2XNOA 3TDVA 4ALUA 2EB2A 4ZTLA 5HVJA 3ITZA 4QP2A 1YWNA 5FM2A 2R64A 4ANLA 4E6AA 2WQOA 2KTYA 2R9SA 4QQ5A 4ZSLA 4MNEB 1FQ1B 3QWJA 2HAKA 4FSMA 2NNWB 2C69A 3EQCA 5IEVA 4F99A 4F63A 3HAMA 4R5SA 3POZA 5L3AA 3AC3A 2ITQA 5B7VA 3ATTA 4ZSGA 4EWQA 4K33A 1Q8TA 4FV8A 5CXZA 5IQCA 4RC2A 1Q62A 2CSNA 4H3BA 2WFYA 4O21A 4WUNA 3KN5A 1QL6A 3R2YA 3LXLA 2GDOA 4IM0A 4KBCA 2X7FA 1R1WA 3QC4A 3FZOA 3VF9A 5H2UA 1T45A 2XRUA 3QQHA 5E8ZA 3JR1A 1H00A 5KMMA 4BTKA 2R3MA 3KA0A 2JD5A 2GS2A 2VX1A 5KBRA 2WEIA 4FG7A 4LRMA 3LXPA 3VS2A 3SOAA 5I5ZA 3RBWA 3FMMA 2YM3A 4C8BA 5HD7A 4D9UA 2XKFA 5AJQA 3TWJA 5A4QA 2X4ZA 3O7LB 4FTKA 2JDRA 3VS1A 2VAGA 4QPAA 1UU3A 4ZSEA 4YR8A 4O7SA 5GJGA 3FLYA 1HCLA 3F6XA 2OICA 2X6EA 3PVWA 1Q5KA 3A61A 3R28A 4IIRA 5CSWA 1GZNA 4D2WA 3DT1A 3QTSA 3MY5A 4RT7A 3GCPA 3DTWA 3G90X 4BCFA 5KBQA 3R7OA 3KVXA 4QMUA 3NZ0A 2GFCA 4M14A 1W84A 2F49A 1PF8A 1OPKA 3IW7A 3QA0A 5LCKA 5L8KA 3OF0A 1ERKA 4ZK5A 3JVRA 2GQRA 4O7WA 3F61A 3TDWA 1URCA 1V0PA 4AX8A 1WBNA 3EOCA 3OT8A 1WFCA 3CJGA 3G0EA 3QQLA 4V0GA 1GY3A 1TQMA 3GC0A 3DOGA 1SMHA 4UB7A 5CSPA 4TYGA 1YOJA 5C03A 4KSPA 1M2RA 5IH4A 2CNQA 4JDHA 2PMIA 4QMPA 4EK6A 4BCPA 5M56A 3QQUA 4IZ5A 3MH3A 2GNHA 3FMLA 5ACBC 2YCRA 4IAYA 4EONA 1ZYLA 5AP4A 3QHWA 4CFMA 3FKNA 2C6LA 5DEWA 5LVLA 4DGMA 2UW3A 1AGWA 2O63A 2YACA 2WMBA 1PMNA 1OPJA 3I0OA 1JKKA 4O7RA 2RFSA 2JKMA 4ZOGA 4RJ4A 1Q8UA 4G16A 5CZIA 1ZOEA 4OTDA 3M11A 2J0JA 4OGRA 5IQDA 2YZAA 2W05A 4FKPA 1FVRA 4BDCA 3AQVA 3KK9A 4RIYB 3BHHA 4CT1A 4YNOA 3D7ZA 3PWDA 4GK3A 5JT2A 4I0SA 3SRVA 2ONLC 4TY1A 2IG7A 3ZFXA 4GU9A 1UVRA 4PRJA 1KE7A 1J3HA 4CLIA 5AMNA 5CU2A 4PX6A 2WTWA 1J1BA 4FTIA 3TCPA 3WIKA 2GNFA 4YJPA 4MD9E 3OC1A 4QMZA 5JKGA 3EZRA 1FMOE 2R3GA 3EQBA 2UZVA 3RCDA 2A0CX 2G2IA 2R3IA 3C13A 2WXVA 1A06A 5C8NA 3RI1A 2HK5A 2OGVA 4UYAA 2WQBA 3EQDA 3LM0A 4XBUA 3EH9A 1Q97A 2LGCA 1STCE 3HP2A 4I4FA 4IVAA 2UW7A 4RZWA 2JKOA 4IB5A 2QOLA 4BY9E 2J50A 4X2KA 1SVEA 2XEZA 3UQGA 4E4NA 5EOLA 4BKJA 1DAWA 5BQ0A 3PVUA 4IC7A 5EYMA 2PWLA 4MH7A 4J99A 1O6YA 3PUPA 4HCTA 4YJSA 2B55A 4UBAA 2IVVA 2R3KA 4PQNA 2PMNX 2IZTA 3GQLA 3O23A 5M53A 3HZTA 5DR2A 2XVDA 4YHJA 1JKTA 3DDQA 3DQXA 4FIEA 1NXKA 3WOWA 1OMWA 1XH4A 2X7GA 4DFYA 4HPTE 4EH5A 4U44A 3BELA 1QPJA 5K5XA 2SRCA 1KV2A 5IDPA 2BRGA 3OCGA 3QQKA 1MQBA 1Q41A 4FTOA 1XH6A 2RSVA 4OBOA 4AOTA 2H96A 5CXHA 3PRFA 4L42A 2JBOA 3S95A 3ZBXA 3JY9A 5AV2A 4NKAA 4AT4A 3E93A 5C27A 2BIYA 2PHKA 1R0EA 4HGSA 3ZSIA 3NUAA 3PXKA 4I6HA 2PVHA 3LJ0A 2F57A 1O6KA 3EHAA 5CX9A 3W1FA 3HV7A 3Q3BA 2P3GX 3HV4A 4DG0E 4H05A 4J1RA 2CLQA 4IZ7A 4LMUA 4FT3A 4DEAA 5D1JA 2R3RA 4FK3A 3HRFA 3I7CA 4V05A 5IA0A 1PRYA 3F3UA 3B2WA 3RMFA 3KRRA 4GK2A 3QC9A 4I93A 4N70A 5CNNA 4ZLOA 2ITVA 1VZOA 2RG5A 4E8AA 3R22A 4L44A 3ORZA 4RX7A 1I44A 2C30A 2QOCA 4RIWA 4Y83A 5FEQA 3FBVA 4EZ7A 3KF4A 3OCBA 3NYNA 3I0QA 3V6SA 2VTQA 5B0XA 4BCHA 3KC3A 2F9GA 2Y0AA 3PXYA 3Q4UA 5EM7A 5AP3A 3GC7A 4DA5A 4O6LA 5DWRA 3EKNA 5HHWA 5J87A 1IAJA 3PLAE 3R9NA 2B0QA 2PVRA 3ANQA 5F4NA 4O0YA 4BDGA 2VN9A 1K3AA 1YOMA 2IZUA 4NM5A 4WNPA 5I9YA 4CD0A 3G15A 2J0IA 4OTIA 4FSWA 4RQKA 2VO0A 4TWPA 4BBEA 4IH8A 1OBGA 2V55A 4HYSA 2QO2A 3D0EA 5HG9A 2I0VA 3OWJA 4KBKA 4MD8E 2IPXA 3VF8A 1BI8A 3HRCA 1OL1A 4UV0A 4R3PA 3TUCA 3DKCA 3OOMA 3PP0A 5AR3A 2C1BA 4WRSA 3RP9A 2YM4A 4R77A 3VW8A 2QOHA 3L8VA 3Q6UA 1GZOA 2R3PA 3HYHA 4RA5A 3R1NA 5CTPA 2GPHA 3G0FA 4G1WA 1YDSE 4LRKA 3R9DA 3BV2A 3PDTA 3KFAA 4APPA 3OBGA 4I23A 3WF8A 4FSQA 2B9HA 3G6GA 4IX6A 1Y6AA 4S2ZA 2VO7A 3EQGA 3AT2A 5DEYA 3VAPA 4PF4A 1K9AA 3MTLA 4FV0A 3VHKA 1GZKA 3K54A 4F09A 2CPKE 3UIMA 3CR0A 3FXXA 3F2AA 4NZWB 4I1ZA 5DRDA 5DG5A 4U45A 3W33A 2JITA 4X7QA 5CQUA 2R3JA 4ITHA 4BDKA 1M2QA 3HMOA 2X2KA 4MD7E 1QPDA 4QTCA 4FV9A 2W7XA 2WTKB 5LOHA 2OZOA 1W82A 4C4IA 4ASDA 5F1ZA 3AG9A 3KL8A 3QZIA 4FZAB 2OZAA 3DNEA 5DRBA 3TEIA 3JXWA 3FPMA 2H34A 3L1SA 3NRMA 3UBDA 4C3RA 2X0GA 1L8TA 3OEFX 4JX7A 2H8HA 4FEQA 4NCTA 4AA0A 4FKJA 3LFDA 2WQMA 3FHRA 4C33A 4L45A 5EH0A 3RM7A 4K0YA 3QYZA 4V01A 3UOKA 2XK4A 4EK3A 1DS5A 4DH1A 3W2QA 3F5PA 4I6FA 1XJDA 3WF7A 4L8MA 3EWHA 4BHNA 2ZM1A 4O83A 4K8AA 1JPAA 3V5QA 3TI1A 3DJ7A 2JBPA 3ZHPC 3NAYA 2J0LA 4NM0A 4U0IA 4NIFB 4DEBA 4RJ8A 3KRJA 4TKSA 5ANEA 5IQBA 5FBNC 3OWLA 3NYXA 3HGKA 4X6RA 5DGZA 3JVSA 2WTDA 3SVVA 2V62A 3IDPA 2FO0A 5BVOA 4JBVA 2BDFA 4XOYA 3QD3A 5LWMA 2FSOX 3KY2A 4RJ3A 2CN5A 4M8TA 4U3YA 4BDAA 3FYJX 3QYWA 5AP7A 3OP5A 3OTUA 4K1BA 1H27A 2FSLX 4JXFA 4HCVA 1NT2A 4JBOA 4IDVA 4FTQA 4IB3A 5TE0A 4GG5A 5HIBA 4DINA 1OUYA 3OUKA 4L46A 1BI7A 2XIYA 2ZDUA 4WD5A 5FUTA 2UUEA 3VS7A 4GJ2A 4TNDA 2B54A 3MBLA 4EH4A 1SVHA 5KHWA 4CLJA 4ANQA 3M42A 4OAUC 4G3GA 3SXFA 3RAWA 2BR1A 2EU9A 1OZ1A 4MCVA 3UZTA 3PP1A 2YIWA 3RPVA 3A7IA 3ZZEA 4PTEA 2QG7A 4AZSA 1U59A 4ZTSA 3FI4A 4U7ZA 3VBXA 3EKKA 4ZY4A 1B38A 1M7NA 2IN6A 3P08A 4BGQA 3ZBFA 3BU6A 5CI7A 5HE1A 3GVUA 4BZNA 3TACA 2ETRA 4HZRA 2JAMA 4GL9A 4CTBA 3UPZA 1F5QA 4IVBA 2CGVA 1H8FA 2BKKA 4BYJA 5JSMA 4OR5A 4LRJA 2WTCA 4IX4A 4AF3A 3DZQA 3IW8A 2ZYBA 3NR9A 2O64A 3U6JA 4PMPA 1YWVA 4I5HA 3FQEA 4U42A 3DZOA 4L01A 3VRYA 3MWUA 5J7HA 2XBAA 2OJIA 2UVXA 2BAKA 2CHLA 4DH5A 3DQWA 2ERZE 4BWXA 4F4PA 3S00A 5IUIA 3FI2A 4DH8A 4XBRA 1Q61A 5J5TA 1XHAA 4BGHA 2OFVA 3QU0A 1U4DA 1BYGA 3DXQA 3Q5ZA 4ZTNA 3THBA 3JUHA 4ITJA 4TRLA 2VO3A 4NEUA 3QCXA 2HY81 3A8XA 4R78A 4IQ6A 3DLSA 5DOSA 5EW9A 3NVKI 5HOAA 3OZ6A 2Z7QA 4X0MA 1UA2A 3FWQA 4DN5A 3E8DA 3OOGA 5I4NA 2BCJA 2BTSA 3MW1A 4G3FA 3Q96A 2XNGA 2X1NA 2R2PA 4FZFB 3LFQA 4RSSA 2HZ4A 4LUEA 5AV1A 2E9VA 1JQHA 2F7EE 4HZSA 4J7BA 2UVZA 4CFXA 1RQQA 2W99B 4RFYA 1B39A 4XV1A 3VUKA 3RPOA 2YITA 3CE3A 4OTRA 4R7BA 4EOOA 2XK6A 3FLWA 2XNNA 3MH2A 1Q3WA 4C7TA 5DH3A 2VGOA 1SNUA 4KS8A 4ANNA 5J9ZA 1O6LA 4A4OA 3FZSA 3R04A 3HV3A 3SQQA 2RFEA 5AIKA 4KKHA 3LVPA 3ZLXA 3K5VA 3ZRKA 5CQWA 2BMCA 3C0HA 4ASXA 3MESA 3K5UA 2VNYA 1H25A 2BHEA 5JGBA 1ZOHA 4RPVA 2WQEA 2FH9A 3MA3A 3P7AA 3ZUUA 3QHRA 3FJQE 4K2RA 4ANOA 1XO2B 1PMVA 1I09A 5LMAA 5CS6A 4DH3A 4A07A 3Q04A 4FSTA 3G6HA 2C3KA 3ACJA 3CY3A 3OG7A 4M0ZA 3GI3A 4NJ3A 3P7CA 5I3RA 2XM8A 3TL8A 4GVAA 5L6PA 1IA8A 2HZNA 2V7OA 2WIHA 3EQIA 3BYOA 4AGDA 3L9NA 5D9HA 3UOHA 4AUAA 3F5UA 4QP1A 4XMOA 4XRJA 3ORMA 4PDOA 4E4MA 4UMPA 4O7VA 3SG9A 1YI6A 3QTRA 1YXTA 2UZUE 3GEQA 3BE2A 3ZO4A 1RE8A 3R9OA 5E7RA 5J9YA 2CKOA 3IKAA 2J0KA 3DLZA 1PKGA 3BLHA 4YTIA 4IFCA 4ANSA 2XB7A 2XKDA 1XH7A 4X3FB 3G33A 3QTUA 1H1WA 5DE2A 1OL2A 5HBHA 5HEZA 1QMZA 3HV6A 4I0RA 4MWIA 4I92A 5EYKA 4F9BA 2QHMA 4GJ3A 3SD0A 3BQCA 4CYIA 3VBYA 5HI2A 3PPZA 5CAVA 3CTHA 3HNGA 2YJSA 4FVQA 3TJDA 4BKZA 4ZZOA 1Y8YA 5ANJA 5HU3A 4FKGA 4NK9A 1LEWA 3UJGA 2WTKC 4WG3A 4D4VA 4TYHA 2ITNA 3U4UA 3U8WA 3RCJA 4U81A 3TNIA 1YXUA 3FHIA 4GW8A 2QO9A 4UZDA 4K77A 3PVBA 4AW0A 4C57A 4LOPA 4PV0A 4FMQA 4MKCA 5A6NA 4O82A 5AUTA 3COKA 3MVLA 4PL3A 4TTHB 4U8ZA 4RIXB 3WE8A 4F0GA 4FUYA 4W4XA 5CU6A 4BCJA 1IG1A 5J9LA 3BYVA 2FB8A 4O38A 2QQ7A 4JIKA 2G1TA 5JQ8A 5LVOA 3OWKA 5KZ0A 5M07A 2W5HA 4NM7A 1PHKA 3CS9A 2YN8A 1DI8A 3R1QA 5CVHA 3PSBA 2YDJA 3W8LA 1JAMA 4EBWA 4ENYA 2GHMA 5IG1A 3ORTA 3D5UA 4PP9A 3ULZA 5E9EA 3EFJA 3FC1X 1BLXA 3HVCA 2VWUA 4YJNA 2WD1A 4R7HA 3UC3A 5HTIA 5C26A 3JYAA 3ZXTA 4CFNA 4ASEA 4DYMA 3A7JA 4YC8A 5FBOA 1PY5A 1F3MC 3ZM9A 4YP8A 4EZ5A 4ALVA 1R3CA 1Z57A 4F9AA 3GU4A 4GSBA 5HESA 5DN3A 5LXMA 4YHFA 4YTCA 4QYEA 3C5UA 3DBDA 3RWPA 3GCUA 4WBBB 1JOWB 3HV5A 5FQDC 4XG3A 4YZCA 1P4FA 4XH6A 4MF0A 4EOQA 4AT5A 3K3JA 3P7BA 4NM3A 3AD4A 4WBOA 5G6VA 4UMTA 4YZDA 3R7YA 4QQTA 4Z3VA 2WIPA 2AYPA 4X2FA 2WPAA 2XK3A 3FSFA 2E9NA 3NS9A 2FUMA 4CZYB 3P23A 2PK9A 2G01A 3BEGA 4CRLA 3C4FA 4M68A 3IG7A 4E6DA 1XQZA 2VWWA 2VTOA 2ETMA 4RVLA 3GP0A 3WZUA 2BPMA 3FZTA 4FZ6A 5M55A 2W1DA 5M44A 4C4EA 5IA1A 5AFVA 4FT9A 1E1VA 2QI8A 3KMUA 4J52A 4UXQA 5JFVA 1ZYDA 2G2FA 5DR9A 5EQYA 2BFYA 5KMLA 1OIUA 3LQ5A 4LV5A 5GHVA 2DWBA 2X9FA 3K2LA 4IZAA 4ARKA 4CFVA 2C68A 4C38A 4FKOA 2Y6OA 1VYZA 2R0UA 2VZ6A 2E2BA 4FT0A 5EI2A 3F3VA 4C4HA 4D5HA 4DFUA 3S1HA 3RZBA 2C3LA 3T9IA 1JLUE 4KB8A 3AGLA 3ALOA 4HGLA 4B7TA 3R21A 4W9XA 3MIAA 4FV6A 4JG7A 4X3JA 5I9XA 1MRYA 5EYCA 3EN9A 1OBDA 3N4VA 3MVHA 2NO3A 3I5ZA 3TN8A 5AR5A 3POOA 4ZZNA 1QPCA 3FMDA 4HYUA 3RNYA 3SW4A 1PW2A 3FLQA 5CSVA 3WF6A 5HO7A 3LMGA 3LQ3A 3R7UA 5EQEA 4WIHA 2GSFA 4IDTA 3HA6A 1FOTA 2YAAA 4JNWA 1G5SA 4R5YA 4FICA 3SAYA 4GKHA 4EHEA 2Z2WA 5IZFA 2QVSE 4XV3A 2XZSA 1CKIA 2Q0BA 3KRLA 4E5AX 3LLTA 3UGCA 3RNIA 2Y9QA 2FSTX 3O50A 4XHKB 2JFLA 2VX0A 3LJ2A 5I0BA 2O5KA 3UG1A 3EL7A 3GUBA 4W8DA 4Z7GA 5JZJA 2CGUA 3HMMA 1CM8A 4DTBA 1G3NA 4GG7A 3F5GA 5L4QA 1VJYA 5CAOA 1M7QA 4QT1A 5BNJA 4BBMA 2XP2A 4F9WA 3FMJA 4FIJA 4KWPA 4OT6A 5CEOA 3R8MA 2PE1A 4F0FA 3U55A 1YI4A 4DLIA 5A4TA 4EK8A 3HDNA 4LGGA 2QLQA 3ELJA 4D0XA 4MWHA 3PVGA 2BDJA 4IJ9A 4JR3A 5I9ZA 4FTCA 4BIBA 2C5OA 2B4SB 3R2BA 1P5EA 2UW6A 3S3IA 1DI9A 3UO6A 4A9SA 4FX3A 3DNDA 1T46A 4JS8A 4KIPA 3UOJA 2E9UA 4CT2A 4I6QA 4A9TA 5A4CA 3MVJA 3FY2A 3E7OA 5IDNA 1KUTA 5CSXA 4RZVA 2OIBA 5IA3A 4FV7A 4I94A 4RWIA 2HY0A 3PXQA 4A9RA 4EUTA 5C4LA 2W1GA 2IVSA 3P78A 3ZC5A 4UWBA 5F94A 2Y6MA 4BDBA 5IEYA 5CU0A 3B8RA 3W18A 4TT7A 5AP1A 4IVCA 5BMMA 2CJMA 2H9VA 5TOZA 3KB7A 4L7FA 1H1PA 5EDQA 2O2UA 5M09A 4YGAA 3KF7A 5DYJA 5C8MA 5LVNA 2OXDA 3O7LD 5D7AA 5GZAA 3FMNA 2QKWB 3QF9A 2CNUA 3UE4A 2FVDA 1WBPA 2C5VA 4X3FC 4CFWA 4OTHA 2W0JA 1IA9A 2WU6A 3LAUA 3TJCA 4ZP5A 2C6IA 4BCMA 3TKUA 1M17A 2P4IA 1X8BA 5AUUA 4GIHA 2VTSA 3PPJA 1GAGA 2VTTA 2ZMCA 3TUDA 3I7BA 3N51A 4WNMA 3EQHA 3R6XA 5EOBA 4BVUA 3FKLA 3OCSA 3NLBA 5J7BA 4IB0A 3N4TA 4UZHA 4EK4A 5LMKA 2QG5A 2HWOA 3Q32A 3ZXZA 2HZ0A 4FUXA 1U54B 5HBEA 3DJ6A 1TQPA 1W83A 4UYNA 1NW1A 1WVXA 4DEDA 4GFOA 2I1MA 4G2FA 3PJ2A 4UWCA 2ITTA 2C0IA 2F7ZE 5M4UA 4IAAA 4TPTA 3R8UA 1H28A 1Q8WA 2ZJWA 4RWKA 5DHJA 4RLKA 2WELA 4YURA 4FTMA 1URWA 2CLXA 3CBLA 3R30A 4C62A 4DTKA 2GQSA 2YM7A 2F2UA 4JLCA 4O2PA 5D12A 4XP0A 3QAME 4Z9LA 2XNBA 1RJBA 4XRLA 5HE0A 2R3LA 3IDCA 3PE2A 5AP6A 1YKRA 5IH6A 4WKQA 4R8QA 1JBPE 5H9BA 3WARA 4DFBA 5KMOA 5BUEA 4O7NA 4JQ8A 2QR7A 4HYHA 3H10A 3OW3A 1MUOA 3FLSA 4Y5QA 5E8VA 5CY3A 4CV9A 4AN9A 4RJ6A 5HKMA 2BROA 4YBJA 1CSNA 2XA4A 4NW6A 2W1ZA 2YABA 3O2MA 4MQ2A 2BRHA 3RK5A 3V5PA 3L8XA 2ITXA 4JDKA 2X2MA 2C5XA 3AD6A 1IASA 2BDWA 3ORNA 4QMQA 2HW7A 1IRKA 5GZ9A 4QP7A 1ZLTA 3OWPA 4NTTA 1Q3DA 3DS6A 3TTIA 4DG3E 3GOKA 5IA2A 5BVNA 2BZJA 3WI6A 4ID7A 3D15A 4GYIA 3R71A 4PPBA 1ZXEA 4EOIA 3C50A 3LMHA 2HIWA 4UXLA 3U9CA 3H4JA 5F20A 1FMKA 3A4OX 4QMYA 2ETKA 3QRTA 3NUUA 3ZEPA 1M2PA 1PMEA 3O8PA 4PL5A 3IK3A 4EOJA 3OBJA 3I60A 2I40A 1J91A 3ROYA 4F7NA 4YJVA 4XEYA 4EH3A 4YO4A 2UZBA 4YJTA 5D10A 4C4GA 3P4KA 5AWMA 2J2IB 4NT4A 3LFCA 5ETAA 3L9MA 3R9RA 1XH9A 4P7EA 1Y8GA 2WAJA 3EYHA 3IDBA 2VD5A 2WTJA 4GH2A 5BVEA 5B2LA 3R1YA 3VS4A 3EQFA 3GC8A 4W4VA 4XYFA 4F6WA 3H30A 3NDMA 2H6DA 2W1HA 4BDIA 3TZ8A 2GFSA 3O51A 5EKOA 4ZLZA 5CU3A 5EQPA 2RIOA 1XBBA 3F3TA 3MPMA 4IMYA 4GK4A 3ZOSA 4RRVA 4R1YA 5TR6A 2JKQA 4WSYA 2X81A 2QO7A 3AMBA 3CLYA 1J7LA 2YHVA 5CF8A 3ZTXA 2J7TA 2C3IB 4B4LA 2CNVA 2REIA 3EN4A 3UP7A 4DFNA 2QC6A 4IAFA 4MXCA 5CASA 3LOKA 4KIOA 4MTAA 5AR4A 3N4UA 2XCHA 3ETAA 4O2ZA 4Q2AA 3SG8A 4WA9A 4G34A 1H0WA 2JGZA 2BAJA 4FEXA 4O22A 4XG7A 4UMRA 5L8LA 1U5RA 1W8CA 4AN2A 4WHZA 2CCIA 4D28A 4EORA 2ITWA 4O0SA 4P4CA 4JI9A 2UZTA 4X2JA 3IOPA 4GUEA 4J8NA 1JKSA 3LFFA 4I0TA 3Q2JA 3LCTA 5EFQA 5HD4A 2R7IA 4FT5A 4PWNA 3MFUA 2J9MA 5FG8A 1OM1A 3HECA 2CGWA 3VQHA 4CZUA 4F7LA 5IQGA 5AUVA 3UIBA 1WBWA 1Q8YA 5AP2A 3TIZA 5HVYA 3CPCA 4NSTA 5K4IA 3WILA 1H01A 2O65A 3O96A 3QX2A 1H4LA 2EUFB 5AR8A 4U80A 2XEYA 2WMWA 4CFUA 4ZTHA 4J98A 5GINE 4C3FA 3C51A 3TNPC 2B7AA 2W1CA 3AT3A 4FTAA 4BBFA 4HW7A 5C1QB 4AP7A 4GT4A 5BMSA 3TV6A 4Y72A 1CTPE 2HWPA 2YCQA 4RX9A 3V01A 3MY0A 3VULA 3E62A 3GU8A 4YZNA 3W2OA 4EBVA 2C0OA 3CXWA 3Q5IA 4J96A 4KAOA 4RVMA 5AIRA 2ONLA 3QZHA 2GMXA 4C4JA 4B6LA 4DITA 4BRXA 2UV2A 4FOCA 3QUDA 5H8GA 5A6OA 4KKEA 4TZRA 3FDNA 4PTCA 4O81A 3VS0A 3LXKA 2R7BA 4ZZMA 3KULB 3RK7A 4O7TA 3CGOA 1YI3A 4FKTA 4CXAA 4EOKA 4DEEA 3VVHA 3IW4A 4ZJJA 4UWYA 3S4QA 4DGOA 4F9YA 4ZMEA 3RHKA 3GCQA 4O86A 3D7TB 4FV4A 1A48A 4OT5A 5DR6A 3HMPA 1OIYA 1ZYCA 2PTKA 1MP8A 2YEXA 1M52A 4ZS0A 3ZRMA 4MX9A 4A4XA 3C1XA 2XIKA 2VTRA 4GFMA 3DY7A 2Z8CA 4LV8A 5L8JA 3GBZA 3VWAA 4AW5A 5HLNA 5IMEA 4NKSA 5HG7A 3ZONA 2ZDTA 1H1SA 4PY1A 2OJFE 3CD8A 1W98A 2B9JA 2X39A 1Y57A 4C36A 4C2VA 3REPA 4DFZE 2UW8A 3NYOA 2YAKA 2R0IA 1VYWA 2VTHA 4KRDA 4LG4A 4U40A 4EZ3A 4QMNA 5E91A 3WE4A 3RJCA 4EQMA 2V0DA 4IAIA 3FLNC 2PUPA 4F64A 4FF8A 2UZLA 3QWKA 1Q8ZA 5HGIA 1O9UA 3FXWA 3PJCA 4E5BA 5EM8A 5KO1A 2P55A 5ANGA 1BL6A 2V22A 1WZYA 4XP2A 3MI9A 1YHSA 5CEIA 4JR7A 5K0XA 2Z7SA 1G8SA 5FLFA 5A46A 3ZZWA 4IACA 2UZDA 3UNJA 1F0QA 4II5A 5CF4A 4RGJA 2O3PA 2PULA 4QMLA 2ZB0A 3GCVA 3TZ7A 4AU8A 4KIKA 2I7QA 5IH5A 3WIGA 1YHWA 2I0HA 2OSCA 3C4XA 3MIYA 3VHEA 1WBTA 2G2HA 3RWQA 4ONAA 3BPRA 1JWHA 4WOVA 4G3EA 4YMJA 4U43A 3HUBA 4O0RA 4IEBA 5AX3A 2OU7A 4R6VA 2A1AB 5GJDA 3NCZA 5E92A 4L7SA 3R7EA 4D55A 1ZAOA 2BVAA 5E90A 2VTAA 4X6QC 5KUPA 2QLUA 4L3PA 3IO7A 4HVSA 3BU3A 3KCKA 3LHJA 3BBWA 3D5XA 3Q60A 4RG0A 3W8QA 4DG2E 2WMQA 3QRUA 4M67A 2J51A 2PE0A 1B6CB 2IZRA 3QXOA 3UO5A 4JRNA 4E6CA 2ZV7A 2W5BA 1PYXA 4FT7A 2P2HA 4YSMA 4QYGA 5EDPA 3M2WA 2WO6A 3VS3A 3F2RA 3RM6A 5L2WA 2OXXA 3LZBA 3RGFA 3E3BX 5JFSA 3CKXA 2Z7RA 5LARA 4H36A 3F7ZA 4MNEA 3E88A 2OFUA 3G9LX 4QTAA 1XR1A 4AGWA 3ZUTA 4KABA 3UYTA 3TM0A 2BZHB 4O1OA 1OKVA 3E5AA 3V3VA 4FV1A 4YJRA 2B9FA 2OIQA 4AQCA 4XP3A 2XNPA 4GCJA 4AW1A 3I6UA 4EOPA 3U87A 1H1QA 3MH0A 3AC8A 1S9IA 4U41A 4Y8DA 4FGBA 3QCYA 1FVTA 2WQNA 3ORLA 3EFLA 4M69B 3GCSA 4IX5A 3R1SA 4IW0A 3DKGA 4AE9A 3R02A 3PY3A 4XNEA 3GFWA 4UY9A 1WCCA 5LMBA 4OTQA 4AGUA 2DQ7X 3BYSA 4MYGA 4C4FA 3HA8A 4CCBA 2CKQA 3MV5A 5AUXA 4DFXE 4NW5A 4EKKA 3VS6A 1GOLA 1JNKA 3OXIA 4G17A 3CSVA 2C3JA 4DE4A 2RFNA 2R5TA 3OVVA 4U97A 1P2AA 3V5JA 1XWSA 3W2RA 4EC9A 4E1ZA 3Q4ZA 1SVGA 1YXVA 1AD5A 2WEVA 5HO6A 1WMKA 5DLSA 5FTOA 3U6IA 5JFXA 4L67A 3JS2A 3PA3A 4X21A 2W1IA 2ITYA 3BYUA 4Y46A 5AUYA 4MK0A 3ZRLA 4ITIA 4KSQA 3ERKA 2ZOQA 4H39A 5H8EA 3W55A 4JL9A 4ZIMA 3I81A 4BF2A 4B8MA 2NPQA 3AC4A 5AV0A 2XKEA 4XOZA 4LL5A 3Q6WA 4RJ7A 4FKVA 3WZEA 2NRYA 1WVYA 4X2GA 4BDDA 3DBQA 2VX3A 2C0TA 3OCTA 5DMZA 3CQWA 5CU4A 4CKIA 2KULA 2PZPA 1Q4LA 3KXGA 4FKQA 2JDOA 2OK1A 3IONA 3NNVA 4NL0A 2BTRA 1FINA 3ODZX 2ZM4A 4OBPA 3S0OA 4CCUA 2V7AA 4CVAA 4GS6A 2XMYA 3GENA 4YJUA 2JLDA 5CT7A 4NTSA 1OB3A 5H8BA 2PVKA 3FXZA 3QTIA 3GC9A 2UW5A 4EWHA 4M97A 5A4LA 4EKLA 3JPVA 3N9XA 4CG8A 2UVYA 4NFMA 5IQIA 4FV2A 3CPBA 2ITOA 3LFEA 3KKVA 4BZDA 4FEUA 3DK3A 4BCOA 3UYSA 4C58A 5EM5A 4UX9A 3WYXA 4GEOA 4EYJA 4YBKA 4IM3A 2YFXA 5IA4A 4IC8A 2HENA 2BHHA 2ACXA 1M14A 3L9LA 5DA3A 4F7JA 3KREA 4O6EA 3AGMA 2OXYA 2JC6A 3LLAA 2XUUA 5HORA 5C4KA 4V0GB 3ZLYA 2AC5A 3DV3A 2C6DA 3ROCA 5D7VA 4MBLA 4TYEA 2PYWA 4V04A 5A4EA 4BR3A 3LMIA 3PPKA 4FOBA 3ZLSA 5GIPE 2VTMA 3FI8A 5L2TA 3MJ1A 4RIYA 4WNKA 4L53A 1Z9XA 1YQJA 1EH4A 1R39A 2C5NA 3KEXA 2YJRA 3NYVA 3PLSA 2WMRA 3FZRA 4F1MA 3UPXA 3COIA 3DBEA 3NNXA 5J79A 3UVPA 4AAAA 4BGGA 3ANRA 2YIRA 4L52A 5BVWA 2BKZA 4J97A 2OW3A 4JBPA 4AOIA 3NAXA 4BC6A 1OIQA 1GJOA 3PA4A 4WRGA 5A14A 1ZZLA 2A19B 2OG8A 4LGDA 5BYZA 3IPHA 4FV3A 2YIXA 3A7HA 3FV8A 2YWVA 5AM7A 4A4LA 3PXFA 1PXIA 2VV9A 2Q0NA 4F65A 5CF6A 4XX9A 4FKLA 4D1SA 3DTCA 3CTJA 3SRVB 4CQEA 5DIAA 4E26A 4ERKA 3UG2A 5HE2A 4MXYA 4NYEA 5CENA 4KD1A 5CAQA 1PXJA 5LVPA 2HW6A 3KXHA 2GNGA 2VWXA 4C2WA 5K3YA 5E4HA 3ZCLA 4ZSAA 2EVAA 2QURA 3GT8A 3NCGA 3OY3A 4RWLA 5CF5A 5HLWA 2C6TA 5TKDA 4QTEA 4ZJIA 2OF4A 2C6KA 3GNIB 4FYOA 4BYIA 4MEDA 3AOXA 4O0XA 2BZIB 3RALA 4BTFA 5JGAA 4FGRA 4GV1A 4CGAA 1MQ4A 4Y85A 2XM9A 3AC2A 3WF5A 3DFCB 4CMUA 2BALA 3NW5A 2YCSA 4BHZA 4DGGA 1PXPA 3LJ1A 3DA6A 3LPBA 5E8XA 4XLIA 5K4JA 5D41A 2X9EA 1V1KA 1ZYSA 3UVRA 2UZNA 4XG2A 3TUBA 3UDBA 1J1CA 4P2KA 4AFEA 2PZRA 3PZEA 4DT8A 1WVWA 3NNWA 4E5WA 1ZWSA 4OTWA 4QP6A 3BWJA 4QPSA 4XCUA 4PNIA 1OKWA 4MBJA 2VRXA 2BIKB 3PRIA 4KIQA 3IW6A 4O7YA 1U46A 4AXAA 3V5LA 1UKHA 3FY0A 3D2IA 2X8EA 4F08A 1FGIA 2IVTA 5BYLA 1KOBA 1ZY5A 3PE1A 4EH2A 3KU2A 4C34A 3FZ1A 4CMOA 5FEEA 3COMA 3O71A 3PXRA 4E73A 3ZO1A 4FL3A 1NVRA 4H1JA 4E4XA 3QZGA 4I21A 4FKRA 4KKGA 1BMKA 2CKPA 5CEPA 3MA6A 2QOFA 2CDZA 4IZYA 1KE5A 1V0OA 2A4LA 2B53A 3Q9ZA 4QP4A 3V51A 4FE2A 1UNGA 4JAIA 3RINA 2J4ZA 3D5VA 3KK8A 4FK6A 3BU5A 5TO8A 5A3XA 5HTBA 4EH6A 5A9UA 4ANMA 1ZARA 2X7OA 2YM5A 5E8TA 5JGDA 4G3DA 2HCKA 3U54A 3NVMB 3HLLA 4LI5A 4I4EA 3MN3A 3COHA 5CANA 3C7QA 3OW4A 3KQ7A 1SM2A 5TT7A 2BFXA 3NUSA 1Z5MA 4O91A 3TNWA 5LWNA 4HYIA 2VWYA 4O7LA 4L00A 3VUGA 2PUUA 5BVKA 4BKYA 3IW5A 1FPUA 3KMMA 4BCQA 3CCNA 3LIJA 3BLRA 4JAJA 5ETCA 3PG1A 3RAIA 4QMWA 3W2SA 5LQFA 5ANKA 4RIWB 4FTJA 2GTNA 3E64A 3BKBA 3ODYX 5E8SA 4FR4A 3KRWA 4QMTA 3SKCA 3SX9A 4MHAA 3ZUVA 2CKEA 3F88A 2X6DA 4BFMA 2VNWA 2WTIA 3RPRA 3VUIA 3B8QA 5FDXA 4BDFA 4ENXA 5IEXA 4F0IA 3A7GA 3MYGA 4RC4A 4BICA 2XJ0A 2GHGA 1BUHA 5M51A 4XUFA 4AN3A 4CV8A 3CIKA 2JKKA 4IFGA 5IUGA 4C37A 4XG8A 4YUQA 3CY2A 2QOOA 3HMNA 1XH8A 4K18A 3D9VA 5J95A 4AZWA 2UZOA 3S2PA 5FWKK 5IKWA 2UZWE 3ZDUA 2CCHA 1OIRA 4YZ9A 3PZHA 4QP9A 2EXMA 2OH0E 2V5QA 4GU6A 5LVMA 3QQJA 2GCDA 3A4PA 3L8PA 5EI8A 3G5DA 3MDYA 4F6UA 3QD4A 5FRIA 4QMSA 3VBVA 3G51A 4TN6A 4N6ZA 4UEUA 2C6OA 3L9PA 5ACKA 4MXZA 5LJJA 5CAPA 2YCFA 3GOPA 3IOKA 3MFSA 3R0TA 2OJ9A 3EFKA 5DI1A 3KXXA 3MJ2A 3A2CA 3H9FA 3V5WA 2XK7A 4MVFA 2C6MA 4ZSJA 4O84A 3LCDA 1CKPA 3AC1A 4FIHA 4QMOA 1OL5A 4YJQA 4YJOA 5HCZA 4BI0A 2UZEA 3RZFA 4YPSA 3F5XA 1YDRE 1H07A 1PYEA 4HGEA 5KMJA 2G15A 1YVJA 4AT3A 4C3PA 4EJ7A 2QCSA 3R01A 3TIYA 4R3CA 1BL7A 2I0YA 3BWFA 1PMUA 4RA4A 2IO6A 5HCXA 1OITA 3L8SA 4QNYA 2J6MA 3VNTA 4RC3A 4HPUE 2BRNA 5I9WA 2QOBA 4DBXA 5DT4A 2BILB 2PZ5A 2WMVA 3G2FA 2ZV2A 3AC5A 3HMIA 4FKIA 3UQFA 1VR2A 5EG3A 1UNHA 4KNBA 2OZAB 2OJGA 4NIFA 4FV5A 2YISA 4BCNA 3VJOA 4BB4A 3TG1A 3PSDA 1CDKA 4I5MA 4S33A 5CNOA 5GIOE 3UO4A 3EIDA 3HL7A 2YDKA 3VQUA 3CQUA 3D2KA 3PA5A 4QMVA 1R78A 2IW9A 3LFSA 3DAKA 4UMUA 2OO8X 2PZYA 3I1AA 2XH5A 4MXAA 1H08A 5HQ0A 3I4BA 4UMQA 2F7XE 3UIUA 4ZS4A 4ZMFA 4FNWA 3QRJA 4JOAA 4D5KA 4AS0A 2PVNA 4EL9A 5KKRB 3HUCA 3R8VA 3DKFA 5I3OA 5IQAA 4H3PA 1NA7A 2GNJA 2HYYA 5KMIA 1GNGA 3GU5A 3BHVA 4ALWA 3BHTA 2WB8A 4FIGA 4B9DA 3P1AA 1OKYA 3NIZA 5HIEA 3FI3A 1K2PA 2Y4IB 4JRVA 5JRSA 4B99A 4DT9A 3MS9A 2ITPA 4M12A 2WHBA 3RPYA 1ZY4A 3V8WA 2VUWA 1DAYA 1OL7A 3D83A 2O8YA 2XS0A 4IM2A 1GIHA 3BE9A 4LFIA 3UP2A 4AW2A 4E3CA 4EOSA 5E8UA 5C9CA 1MRVA 3QD0A 2X2LA 5AP5A 3V8TA 2GNLA 3ORKA 3PSCA 2YLFA 4O0TA 4BL1A 3A7FA 5KMNA 4QNAA 3WZDA 4ERWA 4FSZA 3DDPA 3ORIA 2VGPA 5D11A 3VBTA 3SA0A 4PDPA 3UIXA 4OLIA 1OL6A 1SNXA 3SXSA 4FZ7A 5FP6A 5ANIA 4FTRA 3W10A 2ZB1A 4RWJA 4Z16A 3DFAA 3MPTA 3TTJA 5AUZA 4IX3A 3VC4A 3QRIA 5DPVA 4ASZA 4D2VA 5CWZA 3E7VA 3UVQA 4D4SA 4BTMA 2O0UA 4FVPA 3EFWA 4AA5A 5HVKA 3PTGA 3G9NA 3PY0A 4P5QA 5C01A 4DTAA 2BZKB 2BUJA 4IAKA 2IW6A 4YZMA 4FVRA 4BI2A 5AP0A 4AZVA 5FTQA 2XKCA 3IGGA 5J8IA 1GZ8A 2EXEA 3HDMA 2QHNA 2R4BA 3LFAA 3AD5A
chains in the Genus database with same CATH superfamily
4ORKA 4OAVB 4BIDA 5JEBA 3W32A 3DAJA 2QU6A 3FE3A 4FBXA 1OI9A 3FMHA 4G6OA 5ETIA 1GIJA 5DT3A 4JQ7A 3ZYAA 2WOTA 2GS6A 3E8EA 3MVMA 3BIZA 3DXNA 1LEZA 2OLCA 4FIFA 4I41A 4IWPA 1ZZ2A 4D0WA 2XIXA 4RFZA 2ITZA 2HXLA 1H0VA 2OJJA 3AMAA 4OW8A 5HO8A 2GNIA 1OPLA 5K5NA 5H3QA 1UU7A 4WT6A 5J5SA 2E9PA 5F9EA 5HE3A 4D58A 4USFA 2P0CA 4I24A 4XV9A 2IWIA 3WYYA 4WG5A 4PMSA 4X2NA 3VW6A 1JKLA 2RF9A 4QYFA 3QLFA 1YXSA 4DGNA 5DT0A 1IEPA 5HNBA 3DCVA 3QLGA 3LFNA 4RFMA 3A62A 2WMTA 1UU8A 3OFMA 3UZRA 3DB6A 5FP5A 3D14A 4JG8A 4YPDA 3U9NA 4EQCA 4USEA 1KV1A 3EB0A 4IAZA 4RJ5A 1P14A 3QCSA 3FKOA 2R3QA 2W4KA 4ZTRA 3VUMA 2QODA 4E20A 3PIZA 1UNLA 3QQGA 3LW0A 2XJ1A 4QTDA 2PUNA 5KMKA 2NRUA 3AT4A 4OBQA 4QMMA 4Q9ZA 3ZU7A 2JDSA 2EB3A 1U5QA 5A54A 4L3JA 3BYMA 2WGJA 3OXZA 3FQSA 1XBCA 2JIUA 3GFEA 4Q9SA 2XF0A 3ZSGA 4USDA 3P79A 1OUKA 3LQ8A 4S34A 4PTGA 5M4IA 3NNUA 4Z7HA 1R0PA 4BDEA 3BGQA 3Q53A 5IISA 3HKOA 4NJDA 4FZDB 1UWJA 2VTNA 2GTMA 3PG3A 4IJPA 4D2SA 4EOMA 2NP8A 5IU2A 3I5NA 3UTOA 1WBSA 5EDRA 4DEIA 4JIAA 2ZV9A 4U79A 2F4JA 4BDJA 2HELA 3MB6A 4X3FA 3FSKA 2C4GA 1LUFA 2FGIA 3ATSA 2R3FA 2XAOA 4YSJA 3R83A 3ET7A 4I5PA 3F7WA 5CLPA 5FM3A 1MRUA 3OEZA 4LOOA 5EK7A 4R7IA 2LAVA 5EKNA 5J1VA 4BN1A 3MY1A 4AE6A 4PNKA 5C8KA 3GGFA 3VUDA 2RKUA 4ZEGA 3EYGA 4D2TA 3FEGA 5IQHA 5M57A 3FUPA 5BYYA 5AR2A 3BGPA 4CMTA 4D2PA 3C4EA 3VJNA 3UNKA 3FPQA 2W9ZB 4BCGA 3FQHA 2PE2A 3VN9A 2ZMDA 4MXXA 1JVPP 4I6BA 3PWYA 2B52A 4A9UA 4ZAUA 4G9CA 4NUSA 4O4DA 4O96A 1OKZA 4QRCA 4TWCA 5G1XA 5HIDA 3UC4A 3VBWA 4I20A 5BPYA 4L9IA 2AC3A 3QTZA 4MQ1A 4JJRA 4H58A 4FTLA 4RIXA 3P86A 4RVTA 4XLVA 5CEQA 4BDHA 3I6WA 2JFMA 3M1SA 3WBLA 3LCSA 4JX3A 2PPQA 4ZY6A 3W0NA 4O1PA 2PVYA 5L2QA 1REJA 5L6OA 3ULIA 1A9UA 4YC3A 4BIEA 5HX6A 4JVGA 5J1WA 3SC1A 4TYHB 4QMXA 1YHVA 3E63A 4BJJA 4ACMA 4RX8A 4UALA 3KIOC 2Z60A 2PY3A 3IGOA 4LMNA 2QOKA 4NCTC 3ZM4A 4YTFA 2UW9A 3C4WA 4PDSA 4Q5EA 5B2KA 3A8WA 2ITUA 2YA9A 2DYLA 5M08A 5AUWA 4IBMA 2WZJA 2YLEA 4AACA 3FYKX 2WMSA 4G31A 4B8LA 2VWZA 2C6EA 2VWBA 3O8UA 4KUJA 3EL8A 3QFVA 4D4YA 5KKRC 3D4QA 4D2RA 3QRKA 3NMUF 3QALE 2YERA 3BRBA 2OBJA 4FG8A 3QGYA 4GUBA 4C35A 5M4CA 3C5IA 4L3LA 4AZTA 2OF2A 2WNTA 3R7GA 4FODA 4EH8A 2BRMA 2PZIA 2Y4IC 2W4JA 2J5EA 2YDIA 4P90A 3ORXA 4C61A 2X0QA 4QYYA 3P5JC 3NUXA 4FL1A 3PJ1A 4GMYA 4GT5A 3BZ3A 3F82A 4IB1A 3QA8A 3ALNA 3ZSHA 2XBJA 5EHLA 3TNQB 3WZKA 2FYSA 1S9JA 5CVFA 2Q83A 3QKKA 5HG5A 4FIIA 5AAGA 2R3OA 3E8NA 4GT3A 5L2IA 3GQIA 3PY1A 4RBLA 4W9WA 3IQ7A 3Q9WA 3ZLWA 4ACDA 3W2PA 2X8DA 3IS5A 4OUCA 1FGKA 5HX8A 3R7IA 2PSQA 4FTUA 5KZIA 5JK3A 5DBXA 3R73A 2W96B 4IVDA 3CGFA 2AUHA 3NPCA 3LCOA 3CD3A 4AFJA 5HBJA 1J7UA 3SGCA 4C0TA 3WZJA 3ZO2A 1P4OA 2DS1A 3MGYA 4FNZA 5HTCA 3QUEA 5EW3A 4EYMA 1G8KA 1LR4A 4M15A 4C02A 4LL0A 1PXMA 4MBIA 3AMYA 1GIIA 1UKIA 5LCJA 2QKRA 3NW6A 4QDVA 3KMWA 4F1OA 2X4FA 2GQGA 5M06A 1Y6BA 2ESMA 4FKWA 1AQ1A 5CSHA 5EM6A 5BUJA 3F3WA 3H0ZA 4IE9A 5BVFA 3E87A 5GZ8A 3NW7A 3SOCA 4EI4A 3BI6A 3LE6A 2ZFYA 5IQEA 2C5YA 5JFWA 1QCFA 5EI6A 5KNJA 3I79A 2W1FA 4EH9A 4U3ZA 4DLJA 3NX8A 4FC0A 3LM5A 4G5PA 4H3QA 3SV0A 4E4LA 4BWKA 4OTFA 1TQIA 3MTFA 4S31A 3DU8A 1APME 2ZV8A 5KX8A 3W16A 3BGZA 3DBCA 3TNHA 5GNKA 5TF9A 4ZY5A 5ICPA 3BQRA 5AM6A 4DDGA 4IADA 2YZLA 3BCEA 4IWDA 5BUIA 2EXCX 4YTHA 2E9OA 4QTBA 3RVGA 4LQMA 4PMTA 4KBAA 4S30A 5FD2A 3DK6A 1REKA 5JMSA 3KVWA 1KE6A 1J7IA 4AGCA 3CC6A 3OXTA 4J95A 3KXMA 4D4RA 1YRPA 4FTNA 3CJFA 3E92A 5FXQA 3R8PA 3QBNA 3U51A 2I0EA 4KINA 2WMAA 3T3UA 4JG6A 5IMXA 3TKHA 2YIQA 2PVLA 3RKBA 3D94A 1OECA 3LFBA 1E1XA 3DK7A 2RGPA 4R1VA 3QKLA 5L2SA 4F70A 4ACCA 5EW8A 4QO9A 2RL5A 3FLZA 2XNEA 1HOWA 1PXLA 3PXZA 3EQRA 4HVGA 5K0KA 2OIDA 3Q52A 4N4SA 4WNOA 4AZFA 1KE9A 4TXCA 2VWIA 2QOIA 3BHYA 3C4ZA 5FGKA 5HICA 4BCKA 4LGHA 3AXWA 1PXKA 3II5A 1WBVA 4QP8A 2XCKA 4DGLC 3EMGA 1E9HA 1H26A 5KE0A 3SLSA 3B2TA 4L6QA 2QR8A 4FEWA 1JSUA 3OS3A 3V6RA 4MNFA 4FA2A 3KGAA 4U6RA 4AWIA 5FEDA 4ZLYA 4M7IA 3HP5A 4ZTQA 4BTJA 4BZOA 3OHTA 1G8AA 4JQEA 3EN7A 4YHTA 3MB7A 5EHYA 4YLLA 3MFTA 5F95A 4E7WA 2JEDA 4L43A 5HNIX 1U54A 1FVVA 3LKMA 4QD6A 2FSMX 2W17A 3CKWA 2IW8A 1IAHA 2PVMA 1DM2A 5FTGA 3SW7A 4OTGA 2IJMA 5AAFA 4CKRA 3MFRA 1LPUA 5ETFA 4F1TA 2P2IA 4PDYA 4TNBA 2IEWA 5AV3A 4FL2A 4YLJA 5CEKA 3DBFA 4I5CA 3GB2A 2WMUA 3EN5A 4O0WA 5T3QA 3C9WA 4EOLA 3V5TA 5JRQA 3F69A 3VUTA 5CYIA 5HCYA 1CMKE 3R63A 4QPMA 3ZEWA 3MSSA 1Q24A 5HNGA 4EUUA 4N57A 4EHGA 3K3IA 5IPJA 4FEVA 2VTIA 2W5AA 3JY0A 2C1AA 4BI1A 3FMEA 4EC8A 1TVOA 3P0MA 5ANOA 1PXNA 5CALA 4BCIA 1JSVA 5B2MA 2UW0A 2BRBA 3OMVA 4L68A 4HJOA 3BBTB 4A06A 2IZSA 4CSVA 4EK5A 4RX5A 3P9JA 3NGAA 1RDQE 2PU8A 5K9IA 3WF9A 2W4OA 5L6WL 3ZDIA 1NVSA 4CEGA 3QD2B 3ACKA 2W06A 5DFPA 1ATPE 1ST4A 1UWHA 2VTLA 4D9TA 2Y7JA 3Q9YA 2B9IA 4O27B 1SZMA 4P5ZA 4EHVA 3TT0A 5HG8A 4APCA 3H9OA 4HVIA 5FXSA 1ZMVA 3OTVA 4MAOA 3LCKA 1JSTA 1XH5A 5JQ5A 3DAEA 4YNEA 5E8WA 3ZS5A 3R9HA 5IUHA 3QQFA 3DXPA 4JDJA 4AG8A 1WBOA 2YM8A 3Q4CA 1KWPA 2Z7LA 4Y73A 4K6ZA 2QD9A 4G9RA 3TZ9A 3H9RA 3QX4A 4ZTMA 2RG6A 2P33A 2VWVA 4D1ZA 5AEPA 4BWPA 4OTPA 1HCKA 1ZMUA 3BV3A 3FL4A 5IA5A 3ZFMA 4I22A 1UV5A 5ANDA 3D5WA 3RHXA 3U4WA 4DCAA 3PIXA 2FA2A 4U5JA 2EWAA 3A99A 4O0UA 3T8OA 3ZH8A 3R00A 3Q4TA 4QQJA 3NUPA 5AX9A 3TKIA 3FC2A 4PPAA 3QL8A 5AR7A 2VO6A 2JIVA 4PL4A 5HZNA 3VUHA 1W7HA 3QCQA 4DEHA 5E1EA 2NYAA 3T3VA 3QKMA 1WAKA 5T68A 3NIEA 4FNXA 4E6QA 1BX6A 3VBQA 1Y91A 3FMKA 2X8IA 2ZVAA 3EZVA 4DHIB 2ZAZA 3QUPA 3C0IA 2F2CB 3EQPA 2PL0A 4EJNA 5CT0A 2DUVA 3NWWA 3F9NA 5DVRA 2A2AA 1PXOA 3QTQA 2J5FA 3SXRA 3DPKA 3QZFA 4DCEA 4M0YA 2QOQA 1RW8A 1QPEA 3KCFA 1Q99A 2Y4PA 4J53A 4XG9A 3H0YA 3EN6A 3O0GA 2C47A 4RQVA 3MPAA 4IXPA 4XG6A 3R8LA 4KA3A 3OUNB 3UMXA 3DB8A 4NWMA 2WKMA 4EEVA 4HOKA 3HRBA 4M84A 1LP4A 2PVJA 5CZHA 5GJFA 4DFLA 4E93A 4XG4A 4FKUA 3UQCA 2R3NA 4IANA 3O8TA 3ZFYA 5CAUA 4KRCA 5JH6A 4XV2A 2OKRA 1PJKA 4DEGA 5I9UA 4J8MA 4XJ0A 5CI6A 4FSRA 4IWQA 2A98A 1KE8A 4CYJA 4GVJA 4Y95A 3UZPA 4W4WA 4HGTA 3ID6C 4NH1A 3RAKA 2QNJA 4O4CA 4ANBA 4TL0A 2CMWA 3PIYA 2I6LA 4C59A 1TKIA 2B1PA 4ZJVA 2Z02A 4LOQA 3OT3A 3F2NA 3QGWA 5E1SA 2GS7A 4JDIA 3UODA 5EYDA 4DDIA 4TWOA 3F66A 2XK9A 3HEGA 4DF3A 4O0VA 3OY1A 4R3RA 4GIIA 4RMZA 3QTXA 4JT3A 1FBNA 4GYGA 1XBAA 4A7CA 1YOLA 5IQFA 3UNZA 2VTJA 4YU2A 4DHFA 2JIIA 2QONA 4PUZA 1YXXA 3EJ1A 2YM6A 3KXZA 3R8ZA 3TV4A 1OVEA 2XJ2A 4GKIA 3NSZA 3BHUA 2CN8A 5HU9A 1NY3A 4WUAA 4UN0C 4CFFA 1BKXA 3O17A 4I3ZA 4W4YA 2G9XA 3CP9A 2PMOX 3ENMA 1H24A 2YIYA 3KULA 3Q2MA 4S32A 2HOGA 2XYUA 3KXNA 4WG4A 3VS5A 4RVKA 4PMMA 2GU8A 5ITAA 4N6YA 2ZM3A 4FG9A 4G5JA 2W9FB 3IECA 4KS7A 4YZBA 1ZOGA 4M13A 5KHXA 3LXNA 4PPCA 2J90A 4Y5HA 3D7TA 4A9YA 1OGUA 3R7VA 2VTPA 3HAVA 5FXRA 3NUYA 1CKJA 4ACHA 4B0GA 1KSWA 5EHOA 1ND4A 3AKLA 4FSUA 4IWOA 5AADA 3F3ZA 3SHEA 1XKKA 2OH4A 3GU7A 1YDTE 1ZRZA 3PJ8A 3RK9A 4CNHA 5FDPA 3OD6X 3DKOA 4FKSA 4WO5A 4EHZA 3BEAA 3RPSA 1VEBA 5JZNA 4FI1A 3TV7A 3ZO3A 4WSQA 5T6KA 4HVHA 1YWRA 4MXOA 1H1RA 4DH7A 4J71A 4TYIA 4N0SA 4H1MA 3KRXA 4GFGA 4HNIA 3SDJA 1ZMWA 4XS2A 4PP7A 3RTPA 2A27A 2XIZA 4QQCA 3DGKA 3TXOA 3Q9XA 3ENHA 5BX0A 4TYJA 4G6NA 2VU3A 3PJ3A 4K11A 2XIRA 2Y8OA 3CQEA 4FTTA 5E8YA 4CG9A 1L3RE 2GHLA 4ZXTA 1V0BA 3E8CA 3NEWA 5AAEA 3GU6A 3OROA 3P5KA 3UOLA 4TWNA 3V8SA 2YWPA 4HVDA 3QTWA 3GXLA 4DAWA 2WMXA 3FAAA 4HCUA 2IVUA 5IF1A 5BVDA 3MH1A 4QYHA 2OI4X 1KOAA 4K9YA 2QU5A 4AA4A 4M66A 2UW4A 4O4BB 4U9AA 1IR3A 2XNMA 5DNRA 4G6LA 3FZPA 4M3QA 4G3CA 3CTQA 5LMKC 4RLLA 3C0GA 3TZMA 3CEKA 2XYNA 4QOXA 4YLKA 5KCVA 3T9TA 5HLPA 2RFDA 2PUIA 4O7ZA 2HZIA 2JDVA 2CGXA 1UU9A 2WOUA 4KIKB 4DC2A 4EQUA 4CKJA 3VO3A 3H3CA 1NVQA 4GRBA 3KN6A 4YC6A 3PFQA 4DBNA 3W2CA 5JN2A 1YW2A 3ZMMA 2J0MB 4AZEA 3PYYA 4CTCA 4F9CA 2W1EA 1W0XC 4IHPA 4CRSA 3A60A 3E3PA 2HXQA 2PVFA 2WTVA 4RIOA 4FSNA 4JBQA 4NFNA 2JAVA 2WU7A 4NU1A 3UMWA 5AA8A 3U6HA 3ML1A 4LM5A 4TW9A 3BX5A 3FL5A 4CZTA 4AOJA 4D1XA 3BLQA 1SYKA 2OWBA 2XRWA 3RAHA 2R3HA 2XK8A 4FSYA 4F7SA 5CEMA 5I9VA 5AV4A 4CQGA 4EH7A 3DJ5A 4FYNA 4ACGA 5CVGA 4Q5HA 4HNFA 5M4FA 1ZYJA 1PKDA 4QP3A 4Z55A 3C4CA 3ORPA 2JDTA 3HX4A 3QXPA 4F6SA 3V04A 4YO6A 3NUNA 4FNYA 3VIDA 3VRZA 4LYNA 4MF1A 4LUDA 3ZC6A 4M69A 2BAQA 2ERKA 4W8EA 5AA9A 2PMLX 2XNOA 3TDVA 4ALUA 2EB2A 4ZTLA 5HVJA 3ITZA 4QP2A 1YWNA 5FM2A 2R64A 4ANLA 4E6AA 2XANA 2WQOA 2KTYA 2R9SA 4QQ5A 4ZSLA 4MNEB 1FQ1B 3QWJA 2HAKA 4FSMA 2NNWB 2C69A 3EQCA 5IEVA 4F99A 4F63A 3HAMA 4R5SA 3POZA 5L3AA 3AC3A 2ITQA 5B7VA 3ATTA 4ZSGA 4EWQA 4K33A 2X0OA 1Q8TA 4FV8A 5CXZA 5IQCA 4RC2A 1Q62A 2CSNA 4H3BA 2WFYA 4O21A 4WUNA 3KN5A 1QL6A 3R2YA 3LXLA 2GDOA 4IM0A 4KBCA 2X7FA 1R1WA 3QC4A 3FZOA 3VF9A 5H2UA 1T45A 2XRUA 3QQHA 5E8ZA 3JR1A 1H00A 5KMMA 4BTKA 2R3MA 3KA0A 2JD5A 1XMLA 2XALA 2GS2A 2VX1A 5KBRA 2WEIA 4FG7A 2XARA 5BV3A 4LRMA 3LXPA 3VS2A 3SOAA 5I5ZA 3RBWA 3FMMA 2YM3A 4C8BA 5HD7A 4D9UA 2XKFA 5AJQA 3TWJA 5A4QA 3W0SA 2X4ZA 3O7LB 4FTKA 2JDRA 3VS1A 4AQKA 2VAGA 4QPAA 1UU3A 4ZSEA 4YR8A 4O7SA 5GJGA 3FLYA 1HCLA 3F6XA 2OICA 2X6EA 3PVWA 1Q5KA 3A61A 3R28A 4IIRA 5CSWA 1GZNA 4D2WA 3DT1A 3QTSA 3MY5A 4RT7A 3GCPA 3DTWA 3G90X 4BCFA 5KBQA 3VONA 3R7OA 3KVXA 4QMUA 3NZ0A 2GFCA 4M14A 1W84A 2F49A 1PF8A 1OPKA 3IW7A 3QA0A 5LCKA 5L8KA 3OF0A 1ERKA 4ZK5A 3JVRA 2GQRA 4O7WA 3F61A 3TDWA 1URCA 1V0PA 4AX8A 1WBNA 3EOCA 3OT8A 1WFCA 3CJGA 3G0EA 3QQLA 4V0GA 1GY3A 1TQMA 3GC0A 3DOGA 1SMHA 4UB7A 5CSPA 4TYGA 3NFFB 1YOJA 5C03A 4KSPA 1M2RA 5IH4A 2CNQA 4JDHA 2PMIA 4QMPA 4EK6A 4BCPA 5M56A 3QQUA 4IZ5A 3MH3A 2GNHA 3FMLA 5ACBC 2YCRA 4IAYA 4EONA 1ZYLA 5AP4A 3QHWA 4CFMA 1OGYA 3FKNA 2C6LA 5DEWA 5LVLA 4DGMA 3PFYA 2UW3A 1AGWA 2O63A 2YACA 2WMBA 1PMNA 1OPJA 3I0OA 1JKKA 4O7RA 2RFSA 2JKMA 4ZOGA 4RJ4A 1Q8UA 4G16A 5CZIA 1ZOEA 4OTDA 3M11A 2J0JA 4OGRA 5IQDA 2YZAA 2W05A 4FKPA 1FVRA 4BDCA 3AQVA 3KK9A 4RIYB 3BHHA 4CT1A 4YNOA 3D7ZA 3PWDA 4GK3A 5JT2A 4I0SA 3SRVA 2ONLC 4TY1A 2IG7A 3ZFXA 4GU9A 1UVRA 4PRJA 1KE7A 1J3HA 4CLIA 5AMNA 5CU2A 4PX6A 2WTWA 1J1BA 4FTIA 3TCPA 3WIKA 2GNFA 4YJPA 4MD9E 1TZDA 3OC1A 4QMZA 5JKGA 3SG9A 3EZRA 1FMOE 2R3GA 3EQBA 2UZVA 3RCDA 2A0CX 2G2IA 2R3IA 3C13A 2WXVA 1A06A 5C8NA 3RI1A 2HK5A 2OGVA 4UYAA 2WQBA 3EQDA 3LM0A 4XBUA 3EH9A 1Q97A 2LGCA 1STCE 3HP2A 4I4FA 4IVAA 2UW7A 3AKJA 4RZWA 2JKOA 4IB5A 2QOLA 4BY9E 2J50A 4X2KA 1SVEA 2XEZA 3UQGA 4E4NA 5EOLA 4BKJA 1DAWA 5BQ0A 3PVUA 4IC7A 5EYMA 2PWLA 4MH7A 4J99A 1O6YA 3PUPA 4HCTA 4YJSA 2B55A 3AKKA 4UBAA 2IVVA 2R3KA 4PQNA 2PMNX 2IZTA 3GQLA 3O23A 5M53A 3HZTA 5DR2A 2XVDA 4YHJA 1JKTA 3DDQA 3DQXA 4FIEA 1NXKA 3WOWA 1OMWA 1XH4A 2X7GA 4DFYA 4HPTE 4EH5A 4U44A 3BELA 1QPJA 5K5XA 2SRCA 1KV2A 5IDPA 2BRGA 3OCGA 3QQKA 1MQBA 1Q41A 4FTOA 1XH6A 2RSVA 4OBOA 4AOTA 2H96A 5CXHA 3PRFA 4L42A 2JBOA 3S95A 3ZBXA 3JY9A 5AV2A 4NKAA 4AT4A 3E93A 5C27A 2BIYA 2PHKA 1R0EA 4HGSA 3ZSIA 3NUAA 3PXKA 4I6HA 2PVHA 3LJ0A 2F57A 1O6KA 3EHAA 5CX9A 3W1FA 3HV7A 3Q3BA 2P3GX 3HV4A 4DG0E 4H05A 4DHZA 4J1RA 2CLQA 4IZ7A 4LMUA 4FT3A 4DEAA 5D1JA 2R3RA 4FK3A 3HRFA 3I7CA 4V05A 5IA0A 1PRYA 3F3UA 3B2WA 3RMFA 3KRRA 4GK2A 3QC9A 4I93A 4N70A 5CNNA 4ZLOA 2ITVA 1VZOA 2RG5A 4E8AA 3R22A 4L44A 3ORZA 4RX7A 1I44A 2C30A 2QOCA 4RIWA 4Y83A 5FEQA 3FBVA 4EZ7A 3KF4A 3OCBA 3NYNA 3I0QA 3V6SA 2VTQA 5B0XA 4BCHA 3KC3A 2F9GA 2Y0AA 3PXYA 3Q4UA 5EM7A 5AP3A 3GC7A 4DA5A 4O6LA 5DWRA 3EKNA 5HHWA 5J87A 1IAJA 3PLAE 3R9NA 2B0QA 2PVRA 3ANQA 5F4NA 4O0YA 4BDGA 2VN9A 1K3AA 1YOMA 2IZUA 4NM5A 4WNPA 5I9YA 4CD0A 3G15A 2J0IA 4OTIA 4FSWA 4RQKA 2VO0A 4TWPA 4BBEA 4IH8A 1OBGA 2V55A 4HYSA 2QO2A 3D0EA 5HG9A 2I0VA 3OWJA 4KBKA 4MD8E 2IPXA 3VF8A 1BI8A 3HRCA 1OL1A 4UV0A 4R3PA 3TUCA 3DKCA 3OOMA 3PP0A 5AR3A 2C1BA 4WRSA 3RP9A 2YM4A 4R77A 3VW8A 2QOHA 4AXCA 3L8VA 3Q6UA 1GZOA 2R3PA 3HYHA 4RA5A 3R1NA 5CTPA 3BL7A 2GPHA 3G0FA 4G1WA 1YDSE 4LRKA 3R9DA 3BV2A 3PDTA 3KFAA 4APPA 3OBGA 4I23A 3WF8A 4FSQA 2B9HA 3G6GA 4IX6A 1Y6AA 4S2ZA 2VO7A 3EQGA 3AT2A 5DEYA 3VAPA 4PF4A 1K9AA 3MTLA 4FV0A 3VHKA 1W2FA 1GZKA 3K54A 4F09A 2CPKE 3UIMA 3CR0A 3FXXA 3F2AA 4NZWB 4I1ZA 5DRDA 5DG5A 4U45A 3W33A 2JITA 4X7QA 5CQUA 2R3JA 4ITHA 4BDKA 1M2QA 3HMOA 2X2KA 4MD7E 1QPDA 4QTCA 4FV9A 2W7XA 2WTKB 5LOHA 2OZOA 1W82A 4C4IA 4ASDA 5F1ZA 1ST0A 3AG9A 3KL8A 3QZIA 4FZAB 2OZAA 3DNEA 5DRBA 3TEIA 3JXWA 3FPMA 2H34A 3L1SA 3NRMA 3UBDA 4C3RA 2X0GA 1L8TA 3OEFX 4JX7A 2H8HA 4FEQA 4NCTA 4AA0A 4FKJA 3LFDA 2WQMA 3FHRA 4C33A 4L45A 5EH0A 3RM7A 4K0YA 3QYZA 4V01A 3UOKA 2XK4A 4EK3A 1DS5A 4DH1A 3W2QA 3F5PA 4I6FA 1XJDA 3WF7A 4L8MA 3EWHA 4BHNA 2ZM1A 4O83A 4K8AA 1JPAA 3V5QA 3TI1A 3W0OA 3DJ7A 2JBPA 3ZHPC 3NAYA 2J0LA 4NM0A 4U0IA 4NIFB 4DEBA 4RJ8A 3KRJA 4TKSA 5ANEA 5IQBA 5FBNC 3OWLA 3NYXA 3HGKA 4X6RA 5DGZA 3JVSA 2WTDA 3SVVA 2V62A 3IDPA 2FO0A 5BVOA 4JBVA 2BDFA 4XOYA 3QD3A 5LWMA 2FSOX 3KY2A 4RJ3A 2CN5A 4M8TA 4U3YA 4BDAA 3FYJX 3QYWA 5AP7A 3OP5A 3OTUA 4K1BA 1H27A 2FSLX 4JXFA 4HCVA 1NT2A 4JBOA 4IDVA 4FTQA 4IB3A 5TE0A 4GG5A 5HIBA 4DINA 1OUYA 3OUKA 4L46A 1BI7A 2XIYA 2ZDUA 4WD5A 5FUTA 2UUEA 3VS7A 4GJ2A 4TNDA 2B54A 3MBLA 4EH4A 1SVHA 5KHWA 4CLJA 4ANQA 3M42A 4OAUC 4G3GA 3SXFA 3RAWA 2BR1A 2EU9A 1OZ1A 4MCVA 3UZTA 3PP1A 2YIWA 3RPVA 3A7IA 3ZZEA 4PTEA 2QG7A 4AZSA 1U59A 4ZTSA 3FI4A 4U7ZA 3VBXA 3EKKA 4ZY4A 1B38A 1M7NA 2IN6A 3P08A 4BGQA 3ZBFA 3BU6A 5CI7A 5HE1A 3GVUA 4BZNA 3TACA 2ETRA 4HZRA 2JAMA 4GL9A 4CTBA 3UPZA 1F5QA 4IVBA 2CGVA 2AQXA 1H8FA 2BKKA 4BYJA 5JSMA 4OR5A 4LRJA 2WTCA 4IX4A 4AF3A 3DZQA 3IW8A 2ZYBA 3NR9A 2O64A 3U6JA 4PMPA 1YWVA 4I5HA 3FQEA 4U42A 3DZOA 4L01A 3VRYA 3MWUA 5J7HA 2XBAA 2OJIA 2UVXA 2BAKA 2CHLA 4DH5A 3DQWA 2ERZE 4BWXA 4F4PA 3S00A 5IUIA 3FI2A 4DH8A 4XBRA 1Q61A 5J5TA 1XHAA 4BGHA 2OFVA 3QU0A 1U4DA 1BYGA 3DXQA 3Q5ZA 4ZTNA 3THBA 3JUHA 4ITJA 4TRLA 2VO3A 4NEUA 3QCXA 2HY81 3A8XA 4R78A 4IQ6A 3DLSA 5DOSA 5EW9A 3NVKI 5HOAA 3OZ6A 2Z7QA 4X0MA 1UA2A 3FWQA 4DN5A 3E8DA 3OOGA 5I4NA 2BCJA 2BTSA 3MW1A 4G3FA 3Q96A 2XNGA 2X1NA 2R2PA 4FZFB 3LFQA 4RSSA 2HZ4A 4LUEA 5AV1A 2E9VA 1JQHA 2F7EE 4HZSA 4J7BA 2UVZA 4CFXA 1RQQA 2W99B 4RFYA 1B39A 4XV1A 3VUKA 3RPOA 2YITA 3CE3A 4OTRA 4R7BA 4EOOA 2XK6A 3FLWA 2XNNA 3MH2A 1Q3WA 4C7TA 5DH3A 2VGOA 1SNUA 4KS8A 4ANNA 5J9ZA 1O6LA 4A4OA 3FZSA 3R04A 3HV3A 3SQQA 2RFEA 5AIKA 4KKHA 3LVPA 3ZLXA 3K5VA 3ZRKA