4YJSA

The kinase domain of human spleen tyrosine (syk) in complex with gtc000226
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
269
structure length
257
Chain Sequence
YLDRKLLTLEDKELGTVKKGYYQMKKVVKTVAVKILALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Discovery of GSK143, a highly potent, selective and orally efficacious spleen tyrosine kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 257
sequence length 269
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yjsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yjsA01
5JEBA 2PK9A 4K6ZA 2XNPA 3UG2A 3HKOA 3V6SA 2AC5A 4GMYA 1JKTA 4RIWA 4ZXTA 5TT7A 2VO7A 1R39A 4ERKA 3NYXA 3EJ1A 3AMYA 3HUCA 4EK5A 2A4LA 2FB8A 4QP8A 4RWIA 3R8VA 5AAFA 1NVSA 3SRVA 3VS7A 4D4YA 1FPUA 5BVOA 4X2NA 3FL4A 3CQWA 3MBLA 4OT5A 5EI8A 3SOAA 5HLWA 2BDWA 1ZMVA 4MKCA 4IXPA 1H01A 4YJSA 2XNGA 3P79A 4TYHB 4DC2A 3AG9A 3CJGA 3QQUA 5KMKA 3MPTA 1URWA 2YDJA 3R2YA 2UZBA 3R73A 2VRXA 1FBNA 3FBVA 5HU3A 2JIIA 2QOKA 2Y4IC 5CAUA 4DFLA 4MD8E 4QYYA 2C0TA 1FGKA 2YZAA 5DI1A 1OKYA 2WOUA 3CGOA 1RJBA 2W1CA 2YCQA 4BGQA 4DBNA 2C6TA 2PE0A 3UOLA 5L8LA 4FKUA 3AC1A 4WSYA 4DA5A 3NYNA 2BRBA 3NDMA 4H3BA 4M84A 4DH3A 4E1ZA 1YWVA 4BFMA 4DEGA 2W5AA 5FXRA 4JRVA 2XRWA 5IDNA 4O7WA 5JQ5A 4AA0A 3KB7A 3MPMA 3KA0A 3FWQA 1E1XA 5E8XA 1J7LA 2ETKA 1O6YA 4G5JA 1H1QA 4X0MA 5CU4A 4YHJA 4ZSLA 3FV8A 4ANLA 2I40A 3Q9ZA 4MTAA 2J0MB 3P7BA 4IWOA 2QR7A 3OT8A 4EH4A 3KN5A 4YZNA 4BI1A 3GI3A 4RIXB 4RT7A 3TTIA 2R3IA 3BV2A 1PRYA 4C4GA 2CLXA 4L3LA 4FKLA 4IB3A 3PXZA 3ZZWA 2ERZE 3PVGA 4TWCA 1OZ1A 5IPJA 3VWAA 5FEDA 2GS6A 3ANRA 5DIAA 4Y83A 2VWYA 5CZIA 4JXFA 3R1YA 1PHKA 3ZXTA 5FTQA 4HVSA 4II5A 2YM3A 3F7ZA 3CY3A 5CU2A 2B52A 3VW6A 4H58A 4D2SA 1IR3A 2XCKA 5HKMA 4CCBA 2IVSA 2GTNA 5GZ9A 5DRBA 5IISA 2OWBA 3BEGA 5ANKA 5KUPA 3FZOA 3TIYA 2PE2A 2ZV9A 5IZFA 1W8CA 2C3IB 4RQVA 2UZVA 5KBQA 4A4XA 3C4FA 4ZS0A 4GK4A 4FT0A 2JAMA 3ZRLA 1YVJA 3V04A 5HTBA 4C0TA 5IA4A 1APME 4PDOA 3KXHA 4M3QA 3HL7A 4E73A 3ERKA 3ZTXA 3I6UA 3RAHA 3F9NA 1OECA 5GIPE 5J7HA 4UMTA 1CKJA 4NZWB 4LGHA 4Y5HA 2PVYA 3FQHA 2XK7A 4U81A 5HLPA 2X4FA 3EWHA 5F94A 5EOBA 2C5OA 5DE2A 4G9CA 4E20A 5C1QB 4FL3A 1J1CA 4BDIA 2PULA 3CCNA 5GINE 3S0OA 3MTFA 3OWKA 2EB2A 1H1PA 4KWPA 4MXZA 4MXYA 5F1ZA 1XWSA 4F1TA 4ZTHA 4F7NA 4N0SA 4QTDA 5EG3A 1OKVA 3OUNB 4HGSA 2JDSA 1YKRA 5IQBA 2W5HA 3GCQA 3BHTA 2B9FA 3ODYX 2QO9A 4YUQA 1UWJA 4FOCA 2XIZA 3FMKA 4I6HA 4MD7E 5BUJA 4NCTC 4XCUA 4R3CA 1H24A 4D1ZA 4ZLOA 4IEBA 5BVNA 5LMKA 3R6XA 3GOPA 3LAUA 1PMEA 3I81A 2IVTA 4WNOA 4CLIA 4PDYA 4WSQA 4BZNA 4F65A 1Q97A 2UZTA 1XHAA 3HP5A 3P23A 5LWMA 3UQCA 1K3AA 3DPKA 2WTCA 4XG3A 2G2HA 3NS9A 3NW7A 1YI4A 4IACA 5AP2A 4AACA 2NRUA 2UW6A 2ZMDA 3R22A 4DITA 3G15A 5EDPA 3HV5A 3TT0A 3H30A 4CFXA 2PY3A 4FV3A 3CE3A 4O27B 4EQCA 4XOZA 3W2PA 3L1SA 5A4QA 3KRXA 3O2MA 4NYEA 3TDVA 5CVGA 4EK3A 2C3LA 3PZEA 3S1HA 2JD5A 5CALA 5DT4A 4RPVA 3PE1A 3BELA 4O0VA 3DOGA 4KIKB 2UZLA 5D41A 3OMVA 4YSMA 3ZS5A 2BILB 4IBMA 4JAIA 4DLJA 3PA3A 1PXIA 4FT3A 4DE4A 4ZSJA 2ETRA 3CJFA 3COMA 2YJSA 2JBPA 3ZH8A 3DFCB 4PPAA 3JY0A 3L9MA 3KXMA 3O8TA 3QRJA 4XV1A 4XS2A 3SW7A 2CJMA 2OIQA 5JSMA 3MV5A 4EYMA 2OU7A 2W96B 2BRNA 3KL8A 1UWHA 3SHEA 5DT3A 4A4OA 5EQEA 5TE0A 4M14A 4J8MA 3POZA 2XBAA 4YLJA 4KRDA 1O6KA 2VTMA 2WIHA 1GIJA 3DBDA 3LXNA 3ORPA 4ACCA 2PMOX 3R63A 5IEYA 4FSMA 4ZMFA 3MB6A 4APCA 2LGCA 5IMEA 4MF1A 2W9FB 2RFSA 3VC4A 4A4LA 4FC0A 4BCPA 3OG7A 2O8YA 2UZWE 3AT3A 4PMTA 3EYHA 3ODZX 1DI9A 4BCIA 5J9ZA 2YM4A 1MRYA 2W1FA 1PXPA 3U4UA 4IB1A 4PNIA 4L3JA 2VNYA 3NUSA 5EKNA 2QR8A 3SLSA 4GG7A 2X39A 4J1RA 3TZ9A 2NP8A 4X2JA 3NVMB 1M2PA 3NUPA 2UZNA 1OI9A 3GVUA 4AZVA 1W82A 3E8NA 3S2PA 4Z9LA 5JQ8A 1B6CB 2X7GA 4C3FA 4L8MA 4I22A 2ERKA 2Z7QA 3Q04A 1H1RA 1M14A 2VU3A 2YACA 4HYUA 3TNQB 3B2TA 5CF5A 4JBVA 2R5TA 2W4JA 3DY7A 3HV7A 4M68A 3UZPA 3AD5A 4A9TA 4Y95A 5ETIA 3D7TA 2YZLA 3VVHA 2R3GA 3HA8A 5IQAA 4JLCA 3FXXA 4BB4A 5IQCA 3HLLA 5F4NA 2JFMA 1G3NA 4Z7HA 1QPDA 2GFCA 4WUAA 4DFZE 3K54A 4UBAA 2P2IA 3ALNA 3RAWA 4FNWA 3FLNC 2XKCA 1WBPA 4J99A 5EW8A 5FGKA 5C27A 3CGFA 4K0YA 5E4HA 3U51A 2PUPA 3PXYA 4N4SA 4EQMA 2W1ZA 2G15A 2VO3A 4FF8A 4C2WA 4Y5QA 4FKVA 5KZ0A 3V5PA 5HVYA 3DNDA 3O51A 1PXNA 4ANNA 5AUWA 3QZGA 4NH1A 1FQ1B 4JQ7A 4O0SA 2YCSA 4RVKA 5CTPA 3FKLA 2BAKA 2GMXA 5H3QA 4O84A 3ENMA 4RSSA 4Y8DA 2AYPA 5AWMA 3VS2A 4K33A 5IQDA 2XM8A 1YXXA 4P7EA 5LVPA 4YHFA 4I24A 4FV0A 3PXQA 4Y85A 3PPZA 2REIA 5HD7A 5CENA 5KBRA 5L4QA 4WG3A 4QQ5A 4F7JA 5CEPA 3Q6UA 4GKHA 2PU8A 3WF8A 3C13A 1OKWA 4FZAB 4CFUA 5FTGA 2C6LA 5CF6A 2WIPA 4YSJA 5CAQA 4L3PA 1GZNA 3KRJA 1QMZA 2XA4A 2UW4A 4R7IA 3ZONA 5CXHA 3VUGA 1ZYSA 3QAME 5IH5A 4DG0E 3F2AA 5DR9A 5EK7A 3E7OA 4OUCA 4NSTA 5D10A 2ITNA 4MK0A 4QQJA 2VTNA 3TNPC 4KUJA 5HX8A 1RW8A 2YFXA 3ANQA 4XG4A 5HG7A 4DT9A 3BLQA 3WF9A 2WTDA 3GGFA 4HW7A 3JR1A 2QNJA 4PUZA 4FIJA 1H25A 3ELJA 3NAXA 4IZYA 2DUVA 4M0ZA 4W8DA 2O2UA 3U87A 4TZRA 4F7SA 3G9NA 4AOJA 2W7XA 1OGUA 3QYWA 3POOA 2XMYA 2Q0BA 4E4XA 3DCVA 2VUWA 2UW3A 1FOTA 3CD3A 5HVKA 1YHSA 2VAGA 4H1JA 4NFNA 3I5NA 4F6WA 4A07A 1JSVA 1Y91A 2XP2A 4LMNA 4B99A 2R7BA 1MUOA 2W1HA 3DQWA 3DQXA 4HGEA 3MN3A 4MCVA 2I1MA 4YZ9A 2Y0AA 2WMWA 3FI2A 5BVFA 2BUJA 1YDSE 4AT3A 3RPYA 5AUZA 1OMWA 4HVGA 2V5QA 5DHJA 4GIIA 2HY81 4QMYA 1BX6A 4E4NA 5IA1A 2XIXA 3KFAA 4WT6A 5BX0A 4YPDA 3O7LD 5KNJA 2OJIA 5CYIA 1WCCA 1J7UA 1JKSA 2QD9A 4F63A 4C4JA 5J5TA 3L9NA 4IAFA 4FV7A 3LLAA 3F3ZA 2JDVA 3KU2A 5EYDA 3KEXA 5HIDA 1P14A 3UO6A 3EN7A 4N6YA 2C3JA 3SX9A 3IGOA 2ESMA 2QVSE 2ZYBA 3Q60A 3ENHA 4X21A 3E3BX 1DS5A 4BDAA 4FNZA 3CSVA 3GCSA 1PMVA 5A3XA 3HYHA 2WMBA 5AX9A 5LMKC 2G1TA 2OIDA 3UOJA 4AT5A 3OW3A 4GH2A 3DXPA 4HCTA 2WMRA 2IZTA 4NL0A 3A7IA 4U7ZA 3PVUA 3NPCA 5HNIX 5EKOA 4JOAA 4ALVA 5B7VA 3EFJA 5GJDA 4C4IA 3NIEA 5J5SA 3VS1A 5M55A 2C5XA 3SAYA 2J5EA 4ONAA 3B8QA 4FL2A 4FE2A 3OY1A 4FZFB 5HVJA 1XH9A 2ZM3A 5KMOA 4JT3A 4FV1A 2YM6A 5JGDA 2I0EA 3C4XA 2IN6A 4FKRA 4EOSA 3THBA 3E63A 5LMBA 3NUAA 1XO2B 4RJ7A 1RE8A 4KD1A 3ORKA 3LOKA 4A9RA 4HZSA 4O7LA 3U6HA 3UPXA 2EU9A 1U5QA 2C6EA 2HW6A 3R9OA 3L8SA 5M07A 4FNYA 5M44A 4JIAA 3CLYA 3G6GA 4J71A 4CVAA 2Q0NA 3HAVA 5IG1A 2X2MA 4HCUA 5GNKA 4GSBA 4DEHA 5CAVA 2FVDA 5A54A 5BYYA 4JRNA 3GC0A 4Q9SA 3W33A 2W1EA 4G6LA 1PMNA 2O3PA 2XVDA 3DAJA 4IX3A 4UZHA 2JIVA 3AC5A 3QA8A 3IDBA 4IX6A 5CEQA 5HBEA 5I9VA 1H8FA 3FQEA 3E62A 2OW3A 4MBJA 3VUIA 5IA0A 1S9IA 2Y9QA 5IMXA 4I3ZA 2ZVAA 5IKWA 1BYGA 2C1AA 4JQEA 2CN8A 3P08A 3SXFA 4Z3VA 4BY9E 4FBXA 2X8IA 4BDCA 3QLFA 4RA4A 3PSCA 4MNEA 4QMWA 3JUHA 1ND4A 2E2BA 2YERA 3UIUA 4DGMA 3Q2JA 3H0YA 3W16A 4EHZA 2BKZA 3GNIB 2YITA 3EN6A 5EHOA 4F09A 5IUHA 2AC3A 3KKVA 3G2FA 5M4IA 3HV6A 4YJRA 1Z57A 3ZEWA 4F99A 3RM6A 1SVGA 4NJDA 4DGGA 5A4EA 4F9CA 3R0TA 5H9BA 2VTIA 3BU5A 3FEGA 4FZDB 5AUXA 4ORKA 4CFMA 2QOHA 3EHAA 4FEWA 5CI6A 3R8PA 2BTRA 2B1PA 4TYJA 5CQWA 5AR4A 4XG8A 4AE9A 4BHNA 5J79A 2C1BA 3QCYA 4I21A 4DH1A 2C0IA 1GY3A 3ULIA 3LQ8A 2Y4IB 3GU8A 3N4TA 3LZBA 4YJTA 4WHZA 4FV2A 4YZBA 2BHEA 1VJYA 4L9IA 4UWYA 4R1YA 2XYNA 3VS4A 5F9EA 5I9XA 4C8BA 1GOLA 3R00A 4FI1A 3LW0A 5KZIA 3W8QA 4YC3A 3R28A 3WZEA 4BYIA 4DFNA 2P55A 3QQFA 1Y57A 4BIEA 4AZSA 2EXMA 4J96A 4M66A 4D5HA 4WNPA 4GVAA 5CASA 3U54A 3UJGA 4FKSA 3NNWA 2Z8CA 1IA9A 4ITIA 1U54A 3N9XA 3UYSA 5CI7A 4BR3A 3O50A 3PIZA 4E6AA 4V0GA 2QO7A 3REPA 4NEUA 3PJ2A 4OW8A 2UW8A 3NLBA 3IDCA 5E91A 4EOPA 4ENYA 2O64A 1V0BA 3Q4UA 2PL0A 2W0JA 3R01A 4RLKA 4BKZA 5L2SA 2C30A 1XH5A 3FI4A 4E26A 5LQFA 3NZ0A 2YLEA 1KE9A 1ZMWA 3G0EA 1Y6BA 2YN8A 2Z60A 4TL0A 3IO7A 4JDHA 5A4TA 2VO0A 2YJRA 5DVRA 1DAYA 2QCSA 3R1SA 1YI6A 2YIWA 1BUHA 4MXXA 4V05A 4MX9A 5JFSA 3AXWA 2YDIA 3EZRA 3ORTA 4J53A 2PE1A 2DWBA 3NCZA 1PY5A 4E8AA 5DBXA 2A19B 1WVYA 1SZMA 4FYNA 4G31A 3NAYA 4MBIA 4JG7A 3U6JA 3P78A 4AW1A 2WMQA 4CZYB 1ZY5A 4FGRA 4RA5A 4I1ZA 3W55A 1IEPA 4UMUA 3FSFA 5ITAA 4RX9A 4X2FA 1H0WA 2OXXA 3RCDA 2OSCA 5BYLA 2XNEA 4HVDA 2WMXA 4OTWA 4Q2AA 5F20A 3LXKA 3PPKA 3WILA 4AXAA 4FKQA 4ZTSA 2XKFA 3EN9A 4XRLA 4OAUC 1SNXA 3AMBA 4O6LA 4H36A 3LQ5A 4AP7A 1PMUA 4EHEA 3MJ2A 4JI9A 3II5A 3QD3A 4UB7A 3UMWA 4FK6A 4NK9A 1DI8A 5HICA 3TZ8A 1VYWA 3MFTA 4K2RA 4CG9A 5DEWA 4TKSA 2DS1A 5AUYA 4BDJA 3BGQA 3MDYA 5BVKA 3GUBA 2WXVA 2PVHA 4FA2A 3DTWA 3JS2A 3DNEA 3KRLA 4W4WA 4FG9A 4O86A 3C9WA 5CANA 4JAJA 1IASA 3DFAA 2UW7A 3Q96A 3UZRA 4QPMA 2BMCA 4XMOA 2G01A 3GEQA 4EH9A 3EYGA 4CYJA 2P33A 1R0PA 4Q5HA 4R1VA 2NO3A 4O0RA 4G17A 3TN8A 4FEVA 3PRFA 3QALE 3GBZA 2A0CX 4JX7A 5I3OA 2V0DA 3F69A 2JBOA 2YCFA 3LFAA 3PIXA 5FP5A 4JS8A 3H0ZA 3MB7A 2J7TA 5AP1A 4ASEA 4XNEA 5M56A 4GCJA 3CKWA 1IAHA 4AGCA 3NEWA 2XNBA 2YAKA 5EHYA 3D4QA 5A6NA 3AC2A 3VO3A 4M69B 5AUUA 3VNTA 4AW2A 4FT7A 4D55A 3E7VA 5E8WA 4FG7A 4M8TA 3VF8A 4UALA 4AAAA 2B9IA 3ZBXA 5E8ZA 3A7JA 1GZ8A 3EFWA 2ITWA 3D0EA 3TL8A 4EONA 3KXNA 3MS9A 1ZARA 3W2QA 4O82A 4HNFA 4FK3A 2F7EE 4YPSA 2QI8A 4MVFA 4K9YA 5HG8A 4O0UA 4BI2A 2W99B 3SXSA 2R3HA 4C02A 4CG8A 2QKRA 2W5BA 3G51A 4FKTA 4USFA 1YOLA 2R0UA 4DGLC 5FLFA 3BCEA 2R4BA 2PVKA 3EIDA 5JGAA 3I60A 3R7EA 5HE2A 4LRKA 3VULA 4IAKA 5CZHA 3ET7A 3D5UA 3HMNA 3NCGA 4YJPA 2HCKA 3UBDA 2UW9A 4ZTNA 2C6KA 5JZJA 4OTPA 5AP0A 3FYKX 4TTHB 3BWJA 4AS0A 4CSVA 3IKAA 4AQCA 3EH9A 3Q6WA 3PZHA 2GHMA 2WTKC 1V0OA 2PVRA 5HBJA 4EH2A 3S3IA 4TT7A 2X9EA 4NKSA 2HENA 4QMMA 2QOBA 3NRMA 1XH8A 4GJ2A 2O65A 3ROYA 4DFYA 4E93A 3SGCA 3TV4A 3VUDA 3HUBA 1JSTA 4GUBA 5BUIA 3FHIA 3WBLA 4O7VA 2QU5A 3CTQA 3P1AA 5CSVA 5L2IA 3UZTA 4BWXA 1YDTE 4P90A 3Q4TA 4E7WA 2C68A 4TWOA 3NR9A 2PMIA 2YCRA 4WBBB 4ZP5A 3C1XA 3F3TA 3BHUA 3OTUA 3QCSA 4EJNA 1Q8WA 2J0LA 4IFCA 1UA2A 3TNWA 4KKGA 4FTJA 4S2ZA 4YO4A 3IG7A 4U0IA 3LMGA 2R3NA 3Q4CA 4A7CA 2BTSA 3NW5A 4L52A 5A14A 2ETMA 3Q5IA 3UE4A 3UVPA 4CYIA 5KMMA 1PW2A 3W1FA 2OG8A 1K9AA 3FL5A 3UGCA 4M67A 2F2CB 4N70A 3ORZA 1B38A 4TYHA 1R78A 2FGIA 2VWIA 4ZTLA 3HAMA 4XP2A 2BALA 1ZMUA 5IQIA 4MXAA 4EC9A 4ZZNA 4F7LA 2UZEA 4GEOA 1OPLA 2QOFA 4U97A 2X7OA 5D7VA 4PTGA 5KX8A 4JBQA 3UIBA 3HVCA 3HP2A 4RIWB 3R71A 2CKPA 1PYXA 5FBOA 3FXWA 4QMNA 4I6BA 2IVVA 2QLQA 4E3CA 3SRVB 2WTJA 3NW6A 3ZUUA 4YTCA 4YO6A 1LP4A 3QRUA 1UNLA 4QMZA 5K0XA 4P2KA 3K2LA 2VTJA 1CM8A 2PWLA 2QODA 3BYUA 3K3JA 5AUTA 3EKNA 3V6RA 2XYUA 2FSMX 3ORMA 4G9RA 3R7VA 4CXAA 1OPJA 5DN3A 4KBKA 4QP4A 3OWPA 2Y8OA 3F82A 5FD2A 1YDRE 2OJJA 4D2TA 4OTGA 5C8KA 1Q61A 3UPZA 3ZFXA 1I09A 3OF0A 4R3PA 1ZAOA 3IGGA 2JKKA 4IM2A 2CGUA 3E64A 3TV6A 1W98A 4LUDA 4PMSA 3V3VA 4BTKA 1Q24A 4BN1A 3BGPA 4EKKA 4XG6A 2BZHB 5BMMA 4U79A 3OXZA 3D5WA 4EWHA 3KGAA 3OEZA 4QYFA 4EBWA 1XH4A 4ENXA 4EOOA 3UC3A 4AA4A 2Z7RA 4FV6A 1NVQA 4FMQA 3C7QA 3ORNA 1JAMA 1OVEA 4U42A 3CBLA 1UNHA 4RJ3A 1WFCA 4LOPA 3TKUA 3JPVA 4CFNA 3QTRA 2FSOX 4I94A 3GT8A 3MVLA 3N51A 5E8YA 4F0FA 2CPKE 4QMUA 3RKBA 3W2RA 4D4SA 4C4EA 3GCUA 2Z02A 2VWBA 3AC3A 5HZNA 2HXQA 2YWPA 2W05A 3FMLA 3HRCA 4RWLA 3RVGA 5L6OA 4FIHA 2ITOA 3F3VA 5DPVA 1KV1A 3C4EA 3WZDA 4MEDA 3LCKA 4ZJVA 3ZUTA 5H8GA 2QHMA 3NMUF 2RKUA 4DLIA 3BWFA 2XNMA 1PYEA 2J2IB 3OOGA 4DGOA 4IX5A 2J4ZA 1YI3A 2IPXA 2RG5A 4KKHA 4MH7A 4ASXA 4EZ5A 3P9JA 4IWQA 4FT9A 4DEDA 1U46A 3H9FA 4QMLA 4ZZOA 2BZJA 1OM1A 3QRTA 4J7BA 3IW6A 4LFIA 2CN5A 4I6FA 5AP6A 5AX3A 1KWPA 3C0GA 4KSQA 5GZ8A 3C4ZA 2G2FA 3LE6A 2WZJA 3D5XA 4DFBA 3MI9A 4F64A 5GZAA 4U8ZA 3QGWA 5CEKA 4OTQA 4R7BA 1BKXA 3COHA 4ACGA 1NY3A 3AGLA 3LFNA 1Q4LA 4FT5A 3MVHA 5HO6A 4L44A 3MJ1A 2F57A 4QTCA 5LVOA 1VZOA 3T9TA 3FHRA 3LJ0A 4GW8A 2PVFA 5DYJA 2XIYA 4ZK5A 5KKRC 2WELA 5AUVA 2KTYA 3L8XA 2WAJA 2ZM4A 3OCBA 5EI6A 1P2AA 3BYOA 3LCTA 4BF2A 4EOJA 3MFSA 5K4JA 1ZOGA 3KRRA 2Z7LA 1AD5A 1I44A 2EXEA 3R9DA 3UMXA 4BCGA 3ORXA 3N4UA 1YOJA 1H28A 4QMOA 4DTAA 4WBOA 4RIYA 3MYGA 5ANGA 1QPEA 2YA9A 4CD0A 4H05A 5IUIA 3FPMA 5DH3A 5CXZA 4IZ5A 4QMQA 3WZKA 3DDPA 4UWBA 5E8VA 4D0XA 1RDQE 1TVOA 4O22A 4IDTA 3RPVA 5C4KA 1YOMA 3ALOA 4H39A 5AAEA 3BEAA 3DJ5A 4O21A 3VUMA 1KE5A 2P4IA 4ANQA 4DEAA 4YTFA 1Q99A 5M57A 5BMSA 3BRBA 5TKDA 4AN3A 2PZYA 3ID6C 5K9IA 4KAOA 2GQGA 1LPUA 5AM7A 3F5XA 2HXLA 2ZOQA 2B7AA 3NIZA 4EK4A 4FTKA 1REJA 3RAIA 2GNFA 2ITUA 4IIRA 2R3KA 3COKA 4CT1A 3KXXA 4NM7A 1L8TA 3EQBA 3FLZA 5GIOE 5EM8A 2V7AA 3KN6A 5CSHA 3CPBA 4E5BA 5HBHA 3CIKA 2HIWA 2YIRA 3HA6A 5J8IA 3OXIA 3C4WA 2RG6A 3OEFX 3QKLA 5E7RA 2BIYA 2XZSA 3QYZA 4LRMA 5HEZA 1NT2A 1OKZA 4IAYA 3ZEPA 2ZB0A 3FY0A 3QTSA 5C4LA 5CVFA 4XBRA 2FA2A 1ZOHA 4WOVA 4YJOA 5ANIA 3QC4A 2YIYA 3BHHA 2UW0A 5CF8A 3SVVA 4JG8A 1WVXA 3LLTA 3QUPA 3G5DA 4MBLA 4R5YA 5FXSA 1L3RE 3NGAA 5IQGA 4DEBA 1HOWA 2PSQA 4QQTA 4F4PA 4R78A 1KE6A 2G9XA 5DNRA 5IDPA 3GCVA 4FKJA 2CGWA 4IDVA 3VUTA 2IJMA 2PMLX 3FMNA 1OIQA 4RC3A 3SV0A 4P5QA 2UVZA 4FSTA 5D12A 2BFYA 3EB0A 4C4FA 5KMJA 3Q4ZA 4YJUA 2OF2A 2VX3A 1OL5A 3G90X 2CCIA 3HMIA 3TZMA 5IH4A 4PDSA 5HGIA 4IZAA 5A6OA 3AT4A 3EL8A 3QX4A 4FVRA 2IW6A 4R6VA 3DU8A 3P0MA 3QTQA 4X6QC 5M09A 2CGVA 5I9UA 2XNNA 5DG5A 3AC4A 1QPCA 2W9ZB 3BBTB 3MH1A 2CNQA 4TYEA 4PTEA 2XJ2A 4OTRA 5CT0A 1G8SA 1ZYCA 2E9VA 4FVPA 5FRIA 3F61A 2VO6A 5E8SA 4XG7A 4B8LA 3FZ1A 4H1MA 2GNHA 3TUCA 4UXQA 3UNJA 3ATTA 3BGZA 3OZ6A 1DAWA 5HO8A 2JDOA 2YISA 3QXOA 2ZJWA 3UP7A 3WI6A 5JKGA 1MP8A 2FYSA 4Z7GA 4W8EA 5HCXA 5IQEA 4O91A 4JBPA 2QKWB 4EEVA 3PVWA 4ASZA 1OUKA 4HZRA 2PZIA 2B9JA 2ITZA 2B54A 5ETFA 1VR2A 2A1AB 3EQDA 3I4BA 4GT4A 3R7IA 3WYXA 4ANSA 4O6EA 4DFUA 2W17A 3KK8A 4G5PA 5EM6A 4AT4A 4I0SA 1Y8YA 3EQPA 4CFWA 2XH5A 3MY1A 5IEVA 2W1IA 3PTGA 2J50A 4CV9A 1M7NA 3LJ1A 3O17A 3ACKA 2BROA 4C58A 1WBTA 2A2AA 3UVRA 4XBUA 3GQLA 4A9SA 3D5VA 2OK1A 1XKKA 1ZZ2A 2BR1A 1GJOA 4KBCA 4QO9A 3OWLA 3R1QA 5J7BA 3DBEA 3PJ8A 4U44A 4NM5A 3WOWA 4QTEA 4CGAA 1PJKA 3ZLSA 4A9UA 2WNTA 3HEGA 2PZ5A 2QHNA 4OBOA 4YMJA 2WQOA 3BYMA 4IQ6A 5CT7A 1PKGA 2ACXA 3L8VA 3MSSA 4QNAA 1REKA 3PJ3A 4B8MA 1YWNA 4U3YA 1KOAA 2CKQA 1W83A 3R02A 5L8KA 3ORIA 4IVDA 5I9WA 4BZOA 4FX3A 5EFQA 4IJ9A 5B2KA 3Q53A 1Q3DA 3VJOA 3QQKA 4KBAA 3VBVA 5L2TA 2BZIB 3PLSA 3PXKA 4O2ZA 1J91A 1YXSA 3IOKA 5AADA 5AFVA 4IB0A 5TR6A 1JQHA 2F49A 2FO0A 4I20A 4TW9A 4BBFA 2CNUA 1UV5A 3GENA 4NIFA 1NXKA 4UY9A 3LFSA 5E9EA 3OROA 4JG6A 5HO7A 4FKGA 4BTFA 2YIQA 2IZUA 3E8EA 3BE9A 3NWWA 4G3FA 3R83A 2WQNA 4V04A 5L3AA 3ATSA 4L67A 4O83A 2OZOA 4DYMA 4DG3E 4D9UA 4L01A 1GNGA 3FKNA 4HNIA 4G1WA 5FG8A 1WBNA 3DAEA 2WTIA 4LRJA 3VF9A 5HCZA 3FSKA 4BZDA 5KHWA 3QTXA 1HCLA 3UYTA 4QP9A 1O6LA 5AP4A 4QTBA 5GHVA 4JBOA 2R3QA 4BI0A 4ZIMA 1OB3A 4OAVB 3HMPA 2OXDA 3F6XA 5LVMA 1IA8A 4I5MA 4JVGA 4YR8A 4U9AA 5E1SA 5L6WL 5IA5A 3HV3A 4ZMEA 4FIEA 5AP3A 5FBNC 3VBXA 2C47A 2J0JA 4XV3A 5HHWA 4U3ZA 4OLIA 2YM5A 1A06A 2C6MA 1XBCA 3QQHA 1M52A 2V62A 3VRYA 3CC6A 4YC8A 4M15A 2WMUA 3QX2A 1B39A 5JRSA 4EQUA 2JITA 3OT3A 2AUHA 4EH3A 3F5GA 4FVQA 4ALWA 3RP9A 2ONLA 4RVTA 4X3FA 3C5UA 3ZFMA 4HVIA 4PQNA 2EB3A 2GFSA 3E93A 5ANEA 2PMNX 3ZZEA 3HV4A 3FJQE 3CEKA 3FDNA 4IZ7A 5IQFA 3UP2A 3DBCA 4X2GA 4MXCA 5BNJA 3EKKA 1Q8YA 4FIGA 3A7FA 4IWPA 3N4VA 4DG2E 4UZDA 4B0GA 4QP2A 4I4EA 3R8LA 3O71A 2OI4X 1YHVA 2CGXA 2PVNA 1PXOA 2ITPA 4X2KA 5J1WA 4O7YA 3AD4A 4EOIA 2Y6OA 2V55A 4GT5A 2CHLA 5CSXA 4QYHA 1WBVA 4FTOA 4BICA 3TNHA 5E1EA 1XBAA 4W4YA 4QP7A 3U8WA 4USEA 4PDPA 2Y7JA 3Q52A 1ZWSA 3KVXA 3R1NA 5HG9A 5BVWA 1BMKA 4EHVA 2HZ4A 5LCKA 2JEDA 4O0XA 3OHTA 4F6UA 1KE8A 4WIHA 3EQCA 4GJ3A 4LM5A 3W18A 5ACBC 4L53A 4BDDA 4F0GA 1E1VA 4C33A 4D5KA 5FDPA 1UU7A 3HMOA 3MY5A 4AG8A 4EI4A 3Q32A 1JNKA 2JKMA 3A61A 3G9LX 4L7FA 4BTJA 1FMOE 2VTPA 2WB8A 5TO8A 4XJ0A 4IVCA 1SVHA 3NUXA 1WBSA 3MIAA 2XM9A 4LV5A 3NNUA 4I92A 4FEQA 5FEQA 2BRGA 1OL7A 5AV1A 4GVJA 4OT6A 4QP3A 4AOTA 4DH8A 5LCJA 3VJNA 3NYOA 4X7QA 4AW5A 1TQIA 2WTKB 4AGWA 4ZY6A 4CMTA 2CMWA 4ZOGA 4IVAA 4L43A 2ITYA 5D7AA 5CVHA 2CDZA 3KXGA 3PY0A 3NSZA 4LI5A 4G2FA 3FLSA 2H96A 4PMPA 2WTVA 3OVVA 4O38A 4BCJA 1GAGA 2R9SA 4PL5A 4E4LA 3RCJA 4YLKA 4XP3A 4FZ7A 4HVHA 1PXJA 2HAKA 4GFGA 4GKIA 3DV3A 4UXLA 5HU9A 4BCQA 4RIOA 3M11A 3QWKA 4IAZA 2PHKA 3PWDA 1MQ4A 2WO6A 3FC2A 1LEWA 4YC6A 5HOAA 5HX6A 5FDXA 2GPHA 2OH4A 2GHLA 2WQBA 5DGZA 2ITXA 3ZSIA 3R9NA 4LMUA 3ZOSA 2BAJA 1YQJA 4FSQA 5C01A 3PSBA 4QP6A 4S31A 4YNOA 5T3QA 4O7ZA 1OL2A 5CX9A 4WNKA 4XG9A 4D4RA 4CMUA 3NX8A 1OIRA 4XLVA 4DCAA 4MNEB 4QMVA 2I7QA 4AZEA 3KCFA 2B4SB 1WVWA 2PZRA 4HJOA 1IRKA 1WAKA 1P4OA 2BFXA 2VNWA 2QURA 4AZFA 5HTCA 5AA8A 3FC1X 4BBMA 3EQHA 4D2VA 4ARKA 5C8NA 4FYOA 3OWJA 3A62A 4KB8A 5JFVA 3SDJA 3TG1A 3QTIA 4ZY5A 3VRZA 2YAAA 2VZ6A 5DWRA 4C34A 3RZFA 3QCQA 3TKHA 2QLUA 4YBKA 2FUMA 2VV9A 2VWWA 2BAQA 2UZOA 4HPTE 5EYMA 4IE9A 4IC7A 1ZXEA 2WU7A 3GQIA 3FZPA 2VTHA 5BVEA 2XF0A 4AE6A 2O0UA 4RVLA 4FG8A 5B2LA 1GIIA 1JOWB 4FEXA 2JAVA 2QOLA 1Q3WA 5B0XA 4BCFA 4J98A 4U80A 4OGRA 4I5CA 4EJ7A 2E9PA 1PF8A 5ANDA 1X8BA 5HIBA 4HOKA 1ERKA 4TNBA 3V8TA 3RAKA 5JMSA 4RFZA 3U9CA 3CTHA 4EH7A 3ROCA 3RWPA 4FNXA 2R2PA 4DFXE 1SNUA 4C7TA 2JC6A 3NNXA 4WO5A 2XK6A 1U54B 4N57A 3EMGA 5ANJA 3BIZA 4S33A 3ZO4A 4F1MA 3KRWA 1CSNA 4S30A 5K0KA 3RGFA 2LAVA 3BLHA 4E6QA 3FUPA 2UZUE 5CU3A 2C4GA 4ZAUA 5CF4A 3OS3A 3PY1A 5IF1A 3LIJA 2JDRA 4FTLA 2R3RA 2GSFA 4ERWA 4O0YA 2HZNA 4UYAA 3KF4A 2I6LA 4NTSA 4M0YA 2OZAA 4FV8A 4PRJA 4CKRA 3T8OA 3LFEA 4C61A 3C5IA 1URCA 2XS0A 4GS6A 4JR7A 2CNVA 3KULB 4CQGA 4EOKA 5LARA 2GU8A 2E9UA 2W4KA 3EFLA 2PVMA 4APPA 1UKHA 2ZDTA 5IQHA 2FSLX 5J95A 4PP7A 3VHEA 2KULA 4BIBA 5LJJA 1OBGA 2I0YA 3DXQA 3RK5A 3MFUA 4NU1A 1J3HA 2CKEA 4NUSA 2BHHA 4FTCA 4S32A 2ZV8A 3D9VA 3I6WA 4D2RA 1BL7A 3BQCA 4G3GA 3LCSA 4C3RA 4WUNA 4DINA 5L2WA 3CKXA 4O2PA 4BGGA 1OL1A 3GCPA 3RI1A 3ZDIA 2OJ9A 4B6LA 2GS7A 3FY2A 1R1WA 2XKDA 1UU8A 3I7CA 4H3QA 2VTRA 4MQ1A 3FE3A 4CZUA 4EYJA 2EXCX 3Q9WA 3WF5A 4X3JA 4BDKA 3ZXZA 3QQJA 2ZM1A 2FSTX 5I3RA 4W4VA 3LFBA 5KO1A 1GZKA 4LOOA 2HELA 3V8WA 3IPHA 3CXWA 3BKBA 3EQGA 3KC3A 4GK3A 3BU6A 5ETAA 3C0HA 4RX5A 5JRQA 2F9GA 1A48A 4LG4A 5KKRB 1LR4A 2VTAA 3BYVA 4LQMA 4MQ2A 5AIKA 4IX4A 4RQKA 3WE4A 3QF9A 5L6PA 5EHLA 4ANBA 3RINA 2ITVA 1AGWA 2YABA 3DK3A 4GFOA 4Y73A 3V8SA 4B9DA 5I9ZA 2ONLC 4X3FC 5C9CA 4FTRA 3IDPA 2H34A 2UW5A 2Z2WA 4GIHA 4IAAA 4RMZA 5DT0A 4C4HA 4XG2A 1UU3A 3GU7A 1J1BA 2XB7A 4MF0A 4EKLA 3AOXA 1SVEA 2QOOA 3LXPA 4E6DA 5D1JA 1BI7A 1U5RA 4YJNA 4JIKA 2PUIA 4QPSA 3DZOA 4WKQA 4J8NA 1GZOA 2BRHA 2JLDA 1OIUA 3C50A 4UMPA 2UV2A 4RX8A 3RPSA 3HNGA 1YW2A 3SQQA 4FSRA 4G6OA 5AP7A 2VWUA 1WBWA 3LFDA 3KREA 3KVWA 2XK4A 1YXTA 1MRUA 4KIOA 4WRSA 3HECA 5AA9A 5M51A 1OUYA 2X1NA 4FTMA 4BGHA 4OTHA 2C5NA 1MRVA 1BI8A 1W0XC 3TWJA 1NW1A 2R3PA 4AN9A 4CFVA 1U59A 2HWOA 3PSDA 3MA3A 4BDHA 2UVXA 3DTCA 3HX4A 2W4OA 1FINA 3RM7A 4JDKA 1H07A 2SRCA 4R3RA 4KRCA 4I5PA 5I4NA 1H08A 4QYGA 2I0HA 4XV9A 2BZKB 3PRIA 4F9YA 4QP1A 3TZ7A 1XR1A 3L9PA 4GT3A 4ZSEA 4BC6A 3PIYA 5H8BA 1JBPE 5CNOA 3TJDA 4QNYA 2W06A 2GCDA 1H00A 4EUTA 3ZLXA 5LOHA 4G3EA 3Q3BA 4KNBA 4YZMA 4ZY4A 3DKOA 3T9IA 4C57A 1OPKA 4GG5A 2J0KA 5H2UA 2B9HA 5C8MA 3WF6A 4DGNA 3NUYA 1XQZA 2I0VA 3ULZA 2X8EA 1V1KA 4ITHA 4OTDA 5EM5A 3FXZA 5DR2A 3R7GA 5EOLA 3EOCA 1H0VA 4C2VA 4IW0A 2JDTA 4AW0A 4YURA 4P5ZA 2GHGA 4CKIA 1ZY4A 4O0TA 5AR8A 3ZLWA 1IAJA 2ZV7A 3R7YA 4AN2A 4CV8A 1ZYJA 3RTPA 2BDJA 4D28A 5AR5A 5DLSA 4NJ3A 1JKLA 3VIDA 5M06A 4D0WA 3FMHA 1M7QA 2J6MA 4FR4A 4GFMA 3V5TA 5CSPA 2B53A 5IU2A 3SG9A 4PV0A 3ZC6A 2ZB1A 4XP0A 1V0PA 5KHXA 1IG1A 5CWZA 2EWAA 2OJGA 4DTKA 4L7SA 4ZLZA 3DGKA 5ICPA 4Q5EA 3QHRA 3C4CA 4ANMA 4YZCA 4MHAA 2F2UA 2XKEA 3SC1A 4RZWA 5HCYA 3LCDA 2OH0E 3QD0A 3AD6A 3DXNA 4U43A 4GK2A 2R3FA 1YWRA 2XEZA 3GFEA 4U41A 5J9LA 3QQLA 2VN9A 3C51A 2QONA 2WMAA 2PUNA 3A99A 4RLLA 4D58A 3NVKI 2IW9A 4R7HA 3JXWA 3RNYA 5HQ0A 5LWNA 3DJ6A 4PY1A 4RIXA 3QWJA 3UIMA 1OBDA 3F7WA 2IVUA 3HGKA 3QTZA 4IFGA 4MAOA 3R8MA 5HIEA 1KE7A 2GNLA 4O1OA 4O1PA 3OBGA 4EZ3A 5LVNA 4AZWA 5CAOA 4FSNA 4O7NA 3CP9A 4TWPA 2WHBA 4O7RA 3OCTA 3W10A 3P7AA 2C6DA 5J87A 5AAGA 1KV2A 4EOMA 4EH8A 2X4ZA 4PPBA 2Y6MA 3AQVA 3E5AA 4QQCA 1G5SA 2GNGA 5AEPA 4Y46A 5C03A 3MH2A 2X2KA 3I7BA 3KMMA 2BCJA 4ITJA 3BX5A 2R64A 3A8XA 2XIKA 5HE3A 5FWKK 3PXFA 4HYSA 4PX6A 3D94A 3LHJA 2PVJA 3NUNA 2P3GX 4KABA 3B2WA 3E3PA 3UTOA 2HZ0A 3HZTA 4O81A 1YRPA 3ZUVA 1Z9XA 3QRKA 4CEGA 5E8UA 2HOGA 4QPAA 2J5FA 4ZSGA 1JVPP 4K18A 4ID7A 3LM5A 4RJ4A 5AR2A 3WIGA 4FKWA 5ETCA 3A7GA 2H8HA 2DYLA 2XUUA 2X6DA 3L8PA 3DK7A 5BPYA 2RF9A 3IECA 1F3MC 3UQGA 1BL6A 3BV3A 4AF3A 4WRGA 2GDOA 3W32A 3PA4A 3QA0A 2WKMA 4I4FA 3FMMA 4I6QA 5HE1A 3AT2A 4ASDA 1P4FA 3H9RA 5EW3A 4I23A 3OY3A 3UC4A 3CR0A 3DK6A 5AR3A 4BYJA 3BPRA 2ITTA 4AX8A 3F3WA 4F9BA 3CY2A 3BBWA 3P86A 4NM3A 3QHWA 3I1AA 3V5QA 4AGUA 3FZRA 1KUTA 4RJ5A 3RJCA 3AGMA 4NT4A 3DZQA 2QC6A 1T46A 3QQGA 3U55A 5LVLA 3F5PA 4G16A 3WZUA 5KCVA 1CKPA 4EORA 4L68A 4R5SA 5TF9A 2WEVA 2BKKA 3IK3A 4IM3A 4JNWA 3EFKA 3I79A 3I0QA 1ZOEA 5IA3A 4DH5A 4BBEA 3QZIA 3TDWA 4DCEA 3UNZA 3RZBA 4FTTA 2VWZA 5FTOA 1Q5KA 3PE2A 3GC9A 3ZCLA 3QKKA 4EK8A 3RHKA 4E5AX 3WARA 3F3UA 3TTJA 5G1XA 3ZLYA 1JKKA 4LV8A 4E6CA 5HESA 3VS0A 3VW8A 4DBXA 3M42A 4F08A 3MIYA 3OTVA 3MY0A 4YJVA 5I0BA 5C26A 2X81A 4KIKA 4D1SA 3PP1A 3S95A 5M4FA 3VHKA 3DS6A 4PF4A 4GU6A 4YHTA 4ZTMA 1Q8ZA 1TQMA 3MVJA 5A4LA 4RG0A 3E87A 2GQRA 4K1BA 4ZJIA 3GU5A 4V01A 4YNEA 1G8AA 4LUEA 3NNVA 3VQHA 4RIYB 4DEIA 4FV9A 4KS8A 3HRBA 3DB6A 4ALUA 4NW6A 4RZVA 3TCPA 3A4OX 4JJRA 2OIBA 4JL9A 3OC1A 4NKAA 1FVTA 3DBFA 2WTWA 2VTOA 4RJ8A 3FAAA 4U45A 3UODA 3PLAE 4TWNA 3FMJA 2BVAA 2XRUA 2QO2A 2VGOA 3LPBA 5EDRA 2IW8A 4UEUA 3RK9A 2XK9A 5BQ0A 4YGAA 1E9HA 1M2RA 4ZEGA 4M97A 3VS3A 2YWVA 1Q8TA 3F2NA 4PL4A 4J95A 4JQ8A 2XNOA 3U9NA 4NM0A 3ZDUA 1P5EA 3E8DA 4EK6A 3F5UA 5AJQA 1H1SA 4ZTRA 3LFCA 4UX9A 4EWQA 3NUUA 4A9YA 4FEUA 5L8JA 1BLXA 3DBQA 2PUUA 3G0FA 4I5HA 4L46A 3FLQA 5FM3A 2J0IA 3KK9A 4G3CA 1H1WA 5CQUA 5L2QA 1RQQA 3OCGA 4L00A 2XBJA 2GQSA 1CKIA 4C62A 2WOTA 4BCKA 3FZTA 3JYAA 4QMPA 5J1VA 4O7TA 3E8CA 3IW4A 4GU9A 2YM7A 2R3MA 1CDKA 2P2HA 2JKOA 1QCFA 4LGGA 3O96A 3UQFA 1R3CA 2YIXA 4BVUA 2HZIA 1VEBA 1ZLTA 4NFMA 5TOZA 1CMKE 3R9HA 4EL9A 5J9YA 1T45A 3RHXA 2O63A 3UVQA 3S00A 1AQ1A 3DKGA 3I5ZA 3BHVA 3TV7A 4AOIA 2C0OA 3PXRA 5HI2A 3DKFA 4F6SA 1ATPE 3DLSA 3ZBFA 3MTLA 4ANOA 4CCUA 4TNDA 2YEXA 4U5JA 3QLGA 4I0TA 3FPQA 3TUBA 3ZO2A 4FTAA 1A9UA 3PG3A 4BWKA 5FXQA 1LUFA 3R7OA 4ACDA 4D9TA 1JSUA 3QTWA 5IA2A 5JN2A 3UG1A 3UIXA 2A27A 3R04A 4Z16A 2OXYA 1M17A 2R3OA 2IO6A 1LEZA 1TQPA 1H26A 4XEYA 2OF4A 5GJGA 3D7TB 2QU6A 4EZ7A 3O7LB 4UMQA 3QRIA 4FICA 4DH7A 3PVBA 4P4CA 1W84A 2VX1A 3TM0A 3OUKA 3DA6A 3DKCA 4XX9A 3M2WA 4LOQA 3VS6A 2Z7SA 4PL3A 3R8UA 1QL6A 4M7IA 2OKRA 2C5VA 2WMTA 2OO8X 1SM2A 3QD2B 2YM8A 4DN5A 2J51A 3DB8A 5HNBA 4NWMA 1H27A 1W7HA 2WQMA 2OFVA 2RFNA 4KS7A 1Z5MA 3QTUA 3WE8A 4EBVA 4TN6A 4F1OA 2JGZA 4FUYA 3SG8A 5I9YA 2C5YA 3FZSA 4HYHA 3AMAA 4QOXA 2OGVA 4MYGA 4WD5A 3ETAA 1EH4A 3TUDA 2Y4PA 1HCKA 5EH0A 5LMAA 3OCSA 3OXTA 3MVMA 3PA5A 3PY3A 5AV2A 2PTKA 2F7XE 4OTFA 4B4LA 2QQ7A 3CQUA 4FKPA 3GU4A 3DLZA 4QYEA 4W9XA 5CEOA 3O8PA 4FL1A 2X0GA 4R8QA 4KA3A 4C36A 1OITA 2XIRA 3A8WA 4GV1A 2J90A 5CEMA 4M13A 4YBJA 4BCNA 4CTBA 1R0EA 2O5KA 3GP0A 4WG5A 4J52A 2VGPA 4IH8A 3U4WA 3FMEA 3VUHA 5AIRA 4LL5A 2OICA 4IADA 1F0QA 2IZRA 3CD8A 5FEEA 2HWPA 3LXLA 3FLYA 4ZTQA 3RMFA 2XK8A 2V22A 4BKYA 1MQBA 2OJFE 3MESA 2GNIA 5CEIA 1PKDA 4PNKA 3VBYA 1OIYA 4N6ZA 4K8AA 4D1XA 3PPJA 1XH6A 4ZSAA 3BZ3A 3H4JA 3QFVA 4LYNA 3FI8A 4O7SA 3MH3A 3SKCA 5D9HA 3D2KA 4I0RA 2UUEA 4IJPA 3QUEA 4XV2A 4NIFB 3B8RA 5DA3A 3P5KA 1H4LA 2HK5A 2X6EA 5AR7A 3D15A 3U6IA 3ZFYA 4YZDA 4F9WA 5JFWA 3HDMA 4ACHA 4WA9A 4L45A 5EQYA 4HPUE 5AV3A 1PXMA 4G3DA 2VX0A 3BYSA 4G34A 4HCVA 4IM0A 4Z55A 5EQPA 2OLCA 4FOBA 5DMZA 4JR3A 3PP0A 4GYGA 1JWHA 1NA7A 4OBQA 4DAWA 1YHWA 3ZRKA 5K5XA 3R21A 4MNFA 2BIKB 3QKMA 2V7OA 4XLIA 4W9WA 2WGJA 5EDQA 3D83A 4AFJA 4FTNA 1ZZLA 1OL6A 5EW9A 4CRLA 3BI6A 4PP9A 4OTIA 1VYZA 3ACJA 4H3PA 3T3VA 4B7TA 2X7FA 3E88A 2PPQA 4BWPA 2EVAA 3GC8A 3MFRA 2F4JA 3OP5A 4EH5A 5JH6A 2B55A 2RL5A 5EM7A 4AWIA 2IG7A 2F7ZE 4FGBA 1WMKA 4Q9ZA 4JX3A 4EC8A 4UMRA 2VWXA 5ACKA 1TKIA 4X3FB 4OR5A 4DT8A 1GIHA 4FSUA 4BL1A 4R77A 2EUFB 2X8DA 3UOHA 4X6RA 4TXCA 3TJCA 2G2IA 2R3LA 4QTAA 3F2RA 2E9NA 1SYKA 4K11A 5A9UA 4GUEA 4FSWA 4BCMA 5D11A 3ORLA 4RGJA 4CZTA 2WFYA 3Q9YA 3RWQA 3TEIA 3QZHA 4DTBA 3RALA 5CLPA 3GOKA 3I0OA 3IOPA 4GYIA 4MWHA 2QOIA 2W1GA 3FYJX 3BHYA 4BHZA 3PJCA 4KIQA 4BTMA 4MXOA 1Y6AA 2R0IA 3V5WA 4C38A 5IH6A 1UKIA 2IZSA 4JDIA 4TY1A 4M12A 5E8TA 2Q83A 4D2WA 3EL7A 2ZAZA 3HMMA 3F88A 4U6RA 2XK3A 3BU3A 1PXKA 2BPMA 4HGTA 1JLUE 3ZYAA 4USDA 3KMUA 5KMLA 3LMHA 4FIFA 1Q8UA 2HY0A 4I93A 3CPCA 5A46A 3EQRA 4BRXA 4FKIA 1WBOA 2RIOA 2ITQA 4IAIA 2QOQA 2VD5A 4FIIA 3SA0A 3EN5A 3MW1A 3M1SA 4UWCA 5H8EA 5JFXA 3P4KA 2RGPA 4CNHA 2RFEA 3OFMA 3OW4A 3PFQA 2C3KA 4G6NA 3BLRA 3R8ZA 1ZYLA 3GFWA 3BQRA 4RWJA 3EQFA 3RNIA 4KINA 3CS9A 3PDTA 4C37A 4CRSA 3EZVA 3GU6A 1STCE 3Q9XA 5T68A 1F5QA 4RFMA 5IUGA 5K3YA 2WMSA 2JKQA 3K3IA 3JY9A 5CU6A 2CSNA 5CY3A 3LJ2A 4YLLA 2ZDUA 3BE2A 5HLNA 1SMHA 5K5NA 1UNGA 3COIA 3IW8A 2W1DA 3AC8A 3PG1A 3MPAA 5JT2A 3V01A 2RFDA 4YTIA 2VTLA 4QMSA 3SOCA 3QZFA 3V5LA 1FGIA 2XEYA 4D4VA 4DHFA 5M53A 1WZYA 3UNKA 1DM2A 2QG5A 3JVSA 4GL9A 2HYYA 2ZV2A 4IMYA 3VBTA 1XBBA 4KKEA 3UDBA 4FTQA 5A4CA 3O23A 3OD6X 4KSPA 3ZSGA 4CMOA 5CU0A 5KMIA 3ZMMA 3GB2A 2IWIA 2UVYA 3LFFA 3VUKA 4FV5A 4FTIA 3IS5A 2H9VA 3IW7A 2XJ1A 3FMDA 4FV4A 3EQIA 5CAPA 5JK3A 3R9RA 3H3CA 3E92A 3QGYA 3ZC5A 3C0IA 4YU2A 3A2CA 4QD6A 4XRJA 2B0QA 3H9OA 3VN9A 2YLFA 4IC8A 4RFYA 1Q62A 4TYGA 3OBJA 2JFLA 3FKOA 3NYVA 4FZ6A 4IWDA 4GRBA 2YHVA 3F66A 3QXPA 1J7IA 1FVRA 2C69A 3KQ7A 4C59A 4EHGA 2J9MA 4FSZA 4TYIA 4S34A 4XH6A 4F9AA 4XOYA 4PWNA 2GTMA 4L42A 5T6KA 4PMMA 3ZRMA 2E9OA 3WF7A 3ZU7A 1Q41A 2PZPA 5HE0A 4IB5A 3G33A 3RBWA 4CTCA 5HORA 4UN0C 3VQUA 3DDQA 4ZLYA 3VBQA 4RRVA 3H10A 5FP6A 2BRMA 2XJ0A 4V0GB 4ZS4A 3S4QA 3WZJA 3LCOA 4FUXA 5EI2A 2PVLA 3R2BA 4JDJA 5CSWA 2X9FA 4AZTA 2VWVA 4TRLA 3T3UA 5LXMA 3RPRA 5DOSA 4DEEA 4RVMA 5BUEA 1ZRZA 4AA5A 3CQEA 4F0IA 2NRYA 4O96A 5FUTA 4EOLA 4FSYA 4BDGA 2WQEA 4QMTA 2WMVA 4U40A 1UU9A 3KULA 4MD9E 2HW7A 5M08A 3P7CA 2UZDA 4EOQA 4CKJA 3MH0A 3QL8A 2VTSA 4CQEA 2JIUA 4NTTA 3WYYA 3Q2MA 5M4CA 4LGDA 1XH7A 2VTQA 3IONA 3SD0A 5ANOA 5DFPA 3K5VA 3GXLA 3LMIA 3LM0A 3D2IA 3ZSHA 2CLQA 2GNJA 4L6QA 2OZAB 3KF7A 2XCHA 4ACMA 3MGYA 2C6IA 4HGLA 3QCXA 5DR6A 3TACA 2QG7A 3A7HA 4Y72A 3W2CA 2X2LA 4IVBA 4F70A 3K5UA 3O8UA 4RX7A 4W4XA 4LL0A 2R3JA 3FQSA 4QRCA 4XUFA 5JZNA 5I5ZA 4RJ6A 5KMNA 4RBLA 4D2PA 3PYYA 3LKMA 2NNWB 1KOBA 4RC2A 4E4MA 3RK7A 5CNNA 5BYZA 2FH9A 3ZHPC 3L9LA 2RSVA 3QU0A 4A06A 5AV0A 1KSWA 4K77A 5EYCA 3MA6A 1YXVA 4I41A 2NPQA 4NW5A 4BCHA 4CLJA 5DRDA 1YXUA 4NCTA 5FM2A 3TXOA 5E90A 3WIKA 5E92A 3LQ3A 4QMXA 5AMNA 4CT2A 4XHKB 3ZO3A 5HNGA 5CS6A 3ZM9A 3KY2A 3IQ7A 1O9UA 2DQ7X 3D7ZA 4M69A 4UYNA 5F95A 3ITZA 3QC9A 3PWYA 3O0GA 3VAPA 3D14A 4RC4A 5HD4A 4C3PA 4YTHA 2P0CA 1PXLA 3LVPA 4IANA 3DT1A 4MWIA 4UV0A 4AU8A 5HTIA 2CKOA 5AM6A 3KCKA 4PTCA 3LFQA 2R7IA 1NVRA 5DEYA 2VTTA 3R30A 4E5WA 4TPTA 3ZM4A 2YDKA 3IW5A 3CTJA 5B2MA 3TNIA 4HYIA 3SW4A 5KE0A 3UOKA 3ZO1A 4PPCA 4BCOA 2OFUA 4WG4A 5IEXA 4OBPA 5AV4A 3A4PA 3UO4A 5HG5A 4DF3A 3KXZA 1UVRA 2OBJA 1CTPE 1XJDA 4RWKA 4XYFA 3SXRA 4YJQA 4BDBA 1K2PA 2ZMCA 3GC7A 5EYKA 4CFFA 3VS5A 3W2OA 1S9JA 2QOCA 4IHPA 2WU6A 3R7UA 2C6OA 3TI1A 1FVVA 2BDFA 4AUAA 4YP8A 4AFEA 3PUPA 5M4UA 3RPOA 3VBWA 4O0WA 3QBNA 3PJ1A 3DJ7A 5G6VA 1QPJA 4FTUA 4FKOA 3EN4A 3DAKA 3V51A 3TIZA 4FODA 2PYWA 5AP5A 4BIDA 3G6HA 4C35A 1M2QA 4J97A 5FQDC 3KMWA 4KIPA 3QUDA 3HRFA 2CCHA 4ZJJA 2WEIA 1ZYDA 4QT1A 2GS2A 3OOMA 1Y8GA 3V5JA 2H6DA 4WNMA 3TKIA 4AGDA 4BDFA 5BVDA 3UO5A 3A60A 3HDNA 4BDEA 3FLWA 3JVRA 1U4DA 3Q5ZA 4BKJA 3QD4A 1FMKA 1JPAA 3W8LA 3W2SA 4EUUA 5JGBA 5K4IA 3MWUA 4ZZMA 4EH6A 2WPAA 3FI3A 5GJFA 2WD1A
chains in the Genus database with same CATH superfamily
5JEBA 2PK9A 4K6ZA 2XNPA 3UG2A 3HKOA 3V6SA 3UDTA 2AC5A 4GMYA 1JKTA 4RIWA 4ZXTA 5TT7A 2VO7A 1R39A 4ERKA 3NYXA 3EJ1A 3AMYA 3HUCA 4EK5A 2A4LA 2FB8A 4QP8A 4RWIA 3R8VA 5AAFA 1NVSA 3SRVA 3VS7A 4D4YA 1FPUA 5BVOA 4X2NA 3FL4A 3CQWA 3MBLA 4OT5A 5EI8A 3SOAA 5HLWA 2BDWA 1ZMVA 4MKCA 4IXPA 1H01A 4YJSA 2XNGA 3P79A 4TYHB 4DC2A 3AG9A 3CJGA 3QQUA 5KMKA 3MPTA 1URWA 2YDJA 3R2YA 2UZBA 3R73A 2VRXA 1FBNA 3FBVA 5HU3A 2JIIA 2QOKA 2Y4IC 5CAUA 4DFLA 4MD8E 4QYYA 2C0TA 1FGKA 2YZAA 5DI1A 1OKYA 2WOUA 3CGOA 1RJBA 2W1CA 2YCQA 4BGQA 4DBNA 2C6TA 2PE0A 3UOLA 5L8LA 4FKUA 3AC1A 4WSYA 4DA5A 3NYNA 2BRBA 3NDMA 4H3BA 4M84A 4DH3A 4E1ZA 1YWVA 4BFMA 4AXCA 4DEGA 2W5AA 5FXRA 4JRVA 2XRWA 5IDNA 4O7WA 5JQ5A 4AA0A 3KB7A 3MPMA 3KA0A 3FWQA 1E1XA 5E8XA 1J7LA 2ETKA 1O6YA 4G5JA 1H1QA 4X0MA 5CU4A 4YHJA 4ZSLA 3FV8A 3BLAA 4ANLA 2I40A 3Q9ZA 4MTAA 2J0MB 3P7BA 4IWOA 2QR7A 3OT8A 4AXEA 4EH4A 3KN5A 4YZNA 4BI1A 3GI3A 4RIXB 4RT7A 3TTIA 2R3IA 3BV2A 1PRYA 4C4GA 2CLXA 4L3LA 4FKLA 4IB3A 3PXZA 1W2FA 3ZZWA 2ERZE 3PVGA 4TWCA 1OZ1A 5IPJA 3VWAA 5FEDA 3W0SA 2GS6A 3ANRA 5DIAA 4Y83A 2VWYA 5CZIA 4JXFA 3R1YA 1PHKA 2AQXA 3ZXTA 5FTQA 4HVSA 4II5A 2YM3A 3F7ZA 3CY3A 5CU2A 2B52A 3PFYA 3VW6A 4H58A 4D2SA 1IR3A 2XCKA 5HKMA 4CCBA 2IVSA 2GTNA 5GZ9A 5DRBA 5IISA 2OWBA 3BEGA 5ANKA 5KUPA 3FZOA 3TIYA 2PE2A 2ZV9A 5IZFA 1W8CA 2C3IB 4RQVA 2UZVA 1W2CA 5KBQA 4A4XA 3C4FA 4ZS0A 4GK4A 4FT0A 2JAMA 3ZRLA 1YVJA 3V04A 5HTBA 4C0TA 5IA4A 1APME 4PDOA 3KXHA 4M3QA 3HL7A 4E73A 3ERKA 3ZTXA 3I6UA 3RAHA 3F9NA 1OECA 5GIPE 5J7HA 4UMTA 1CKJA 4NZWB 4LGHA 4Y5HA 2PVYA 3FQHA 2XK7A 4U81A 5HLPA 2X4FA 3EWHA 5F94A 5EOBA 2C5OA 5DE2A 4G9CA 4E20A 5C1QB 4FL3A 1J1CA 4BDIA 2PULA 3CCNA 5GINE 3S0OA 3MTFA 3OWKA 2EB2A 1H1PA 4KWPA 4MXZA 4MXYA 5F1ZA 1XWSA 4F1TA 4ZTHA 4F7NA 4N0SA 4QTDA 5EG3A 1OKVA 3OUNB 4HGSA 2JDSA 1YKRA 5IQBA 2W5HA 3GCQA 3BHTA 2B9FA 3ODYX 2QO9A 4YUQA 1UWJA 4FOCA 2XIZA 3FMKA 4I6HA 4MD7E 5BUJA 4NCTC 4XCUA 4R3CA 1H24A 4D1ZA 4ZLOA 4IEBA 5BVNA 5LMKA 3R6XA 3GOPA 3LAUA 1PMEA 3I81A 2IVTA 4WNOA 4CLIA 4PDYA 4WSQA 4BZNA 4F65A 1Q97A 2UZTA 1XHAA 3HP5A 3P23A 5LWMA 3UQCA 1K3AA 3DPKA 2WTCA 4XG3A 2G2HA 3NS9A 3NW7A 1YI4A 4IACA 5AP2A 4AACA 2NRUA 2UW6A 2ZMDA 3R22A 4DITA 3G15A 5EDPA 3HV5A 3TT0A 3H30A 4CFXA 2PY3A 4FV3A 3CE3A 4O27B 4EQCA 4XOZA 3W2PA 3L1SA 5A4QA 3KRXA 3O2MA 4NYEA 3TDVA 5CVGA 4EK3A 2C3LA 3PZEA 3S1HA 2JD5A 5CALA 5DT4A 4RPVA 3PE1A 3BELA 4O0VA 3DOGA 4KIKB 2UZLA 5D41A 3OMVA 4YSMA 3ZS5A 2BILB 4IBMA 4JAIA 4DLJA 3PA3A 1PXIA 4FT3A 4DE4A 4ZSJA 2ETRA 3CJFA 3COMA 2YJSA 1ST4A 2JBPA 3ZH8A 3DFCB 4PPAA 3JY0A 3L9MA 3KXMA 3O8TA 3QRJA 4XV1A 4XS2A 3SW7A 3NFGB 2CJMA 2OIQA 5JSMA 3W0MA 3MV5A 4EYMA 2OU7A 2W96B 2BRNA 3KL8A 1UWHA 3SHEA 5DT3A 4A4OA 5EQEA 5TE0A 4M14A 4J8MA 3POZA 2XBAA 4YLJA 4KRDA 1O6KA 2VTMA 2WIHA 1GIJA 3DBDA 3LXNA 3ORPA 4ACCA 2PMOX 3R63A 5IEYA 4FSMA 4ZMFA 3MB6A 4APCA 2LGCA 5IMEA 4MF1A 2W9FB 2RFSA 3VC4A 4A4LA 4FC0A 4BCPA 3OG7A 2O8YA 4O4CA 2UZWE 3AT3A 4PMTA 3EYHA 3ODZX 1DI9A 4BCIA 5J9ZA 2YM4A 1MRYA 2W1FA 1PXPA 3U4UA 4IB1A 4PNIA 4L3JA 2VNYA 3NUSA 5EKNA 2QR8A 3SLSA 4GG7A 2X39A 4J1RA 3TZ9A 2NP8A 4X2JA 3NVMB 1M2PA 2ZFYA 3NUPA 2UZNA 1OI9A 3GVUA 4AZVA 1W82A 3E8NA 3S2PA 4Z9LA 5JQ8A 1B6CB 2X7GA 4C3FA 4L8MA 4I22A 2ERKA 2Z7QA 3Q04A 1H1RA 1M14A 2VU3A 2YACA 4HYUA 3TNQB 3B2TA 5CF5A 4JBVA 2R5TA 2W4JA 3DY7A 3HV7A 4M68A 3UZPA 3AD5A 4A9TA 4Y95A 5ETIA 3D7TA 2YZLA 3VVHA 2R3GA 3HA8A 5IQAA 4JLCA 3FXXA 4BB4A 5IQCA 3HLLA 5F4NA 2JFMA 1G3NA 4Z7HA 1QPDA 2GFCA 4WUAA 4DFZE 2XANA 3K54A 4UBAA 2P2IA 3ALNA 3RAWA 4FNWA 3FLNC 2XKCA 1WBPA 4J99A 5EW8A 5FGKA 5C27A 3CGFA 4K0YA 5E4HA 3U51A 2PUPA 3PXYA 4N4SA 4EQMA 2W1ZA 2G15A 2VO3A 4FF8A 4C2WA 4Y5QA 4FKVA 5KZ0A 3V5PA 5HVYA 3DNDA 3O51A 1PXNA 4ANNA 5AUWA 3QZGA 4NH1A 1FQ1B 4JQ7A 4O0SA 2YCSA 4RVKA 5CTPA 3FKLA 2BAKA 2GMXA 5H3QA 4O84A 3ENMA 4RSSA 4Y8DA 2AYPA 5AWMA 3VS2A 4DHZA 4K33A 5IQDA 2XM8A 1YXXA 4P7EA 5LVPA 4YHFA 4I24A 4FV0A 3PXQA 4Y85A 3PPZA 2REIA 5HD7A 5CENA 5KBRA 5L4QA 4WG3A 4QQ5A 4F7JA 5CEPA 3Q6UA 4GKHA 2PU8A 3WF8A 3C13A 1OKWA 4FZAB 4CFUA 5FTGA 2C6LA 5CF6A 2WIPA 4YSJA 5CAQA 4L3PA 1GZNA 3KRJA 1QMZA 2XA4A 2UW4A 4R7IA 3ZONA 5CXHA 3VUGA 1ZYSA 3QAME 5IH5A 4DG0E 1TFFA 3F2AA 5DR9A 5EK7A 3E7OA 4OUCA 4NSTA 5D10A 2ITNA 4MK0A 4QQJA 2VTNA 3TNPC 4KUJA 5HX8A 1RW8A 2YFXA 3ANQA 4XG4A 5HG7A 4DT9A 3BLQA 3WF9A 2WTDA 3GGFA 4HW7A 3JR1A 2QNJA 4PUZA 4FIJA 1H25A 3ELJA 3NAXA 4IZYA 2DUVA 4M0ZA 4W8DA 2O2UA 3U87A 4TZRA 4F7SA 3G9NA 4AOJA 2W7XA 1OGUA 3QYWA 3POOA 2XMYA 2Q0BA 4E4XA 3DCVA 2VUWA 2UW3A 1FOTA 3CD3A 5HVKA 1YHSA 2VAGA 4H1JA 4NFNA 3I5NA 4F6WA 4A07A 1JSVA 1Y91A 2XP2A 4LMNA 4B99A 2R7BA 1MUOA 2W1HA 3DQWA 3DQXA 4HGEA 3MN3A 4MCVA 2I1MA 4YZ9A 3UDZA 2Y0AA 2WMWA 3FI2A 5BVFA 2BUJA 1YDSE 4AT3A 3RPYA 5AUZA 1OMWA 4HVGA 2V5QA 5DHJA 4GIIA 2HY81 4QMYA 1BX6A 4E4NA 5IA1A 2XIXA 3KFAA 4WT6A 5BX0A 4YPDA 3O7LD 5KNJA 2OJIA 5CYIA 1WCCA 1J7UA 1JKSA 2QD9A 4F63A 4C4JA 5J5TA 3L9NA 4IAFA 4FV7A 3LLAA 3UDSA 3F3ZA 2JDVA 3KU2A 5EYDA 3KEXA 5HIDA 1P14A 3UO6A 3EN7A 4N6YA 2C3JA 3SX9A 3IGOA 2ESMA 2QVSE 2ZYBA 3Q60A 3ENHA 4X21A 1W2DA 3E3BX 1DS5A 4BDAA 1TZDA 4FNZA 3CSVA 3GCSA 1PMVA 5A3XA 3HYHA 2WMBA 5AX9A 5LMKC 2G1TA 2OIDA 3UOJA 4AT5A 3OW3A 4GH2A 3DXPA 4HCTA 2WMRA 2IZTA 4NL0A 3A7IA 4U7ZA 3PVUA 3NPCA 5HNIX 5EKOA 4JOAA 4ALVA 5B7VA 3EFJA 5GJDA 4C4IA 3NIEA 5J5SA 3VS1A 5M55A 2C5XA 3SAYA 2J5EA 4ONAA 3B8QA 4FL2A 4FE2A 3OY1A 4FZFB 5HVJA 1XH9A 2ZM3A 5KMOA 4JT3A 4I6LA 4FV1A 2YM6A 5JGDA 2I0EA 3C4XA 2IN6A 4FKRA 4EOSA 3THBA 3E63A 5LMBA 3NUAA 1XO2B 4RJ7A 1RE8A 4KD1A 3ORKA 3LOKA 4A9RA 4HZSA 4O7LA 3U6HA 3UPXA 2EU9A 1U5QA 2C6EA 2HW6A 3R9OA 3L8SA 5M07A 4FNYA 5M44A 4JIAA 3CLYA 3G6GA 4J71A 4CVAA 2Q0NA 3HAVA 5IG1A 2X2MA 4HCUA 5GNKA 4DHJA 4GSBA 4DEHA 5CAVA 2FVDA 5A54A 5BYYA 4JRNA 3GC0A 4Q9SA 3W33A 2W1EA 4G6LA 1PMNA 2O3PA 2XVDA 3DAJA 4IX3A 4UZHA 2JIVA 3AC5A 3QA8A 3IDBA 4IX6A 5CEQA 5HBEA 5I9VA 1H8FA 3FQEA 3E62A 2OW3A 4MBJA 3VUIA 5IA0A 1S9IA 2Y9QA 5IMXA 4I3ZA 2ZVAA 5IKWA 1BYGA 2C1AA 4JQEA 2CN8A 3P08A 3SXFA 4Z3VA 4BY9E 4FBXA 2X8IA 4BDCA 3QLFA 4RA4A 3PSCA 4MNEA 4QMWA 3JUHA 1ND4A 2XALA 2E2BA 2YERA 3UIUA 4DGMA 3Q2JA 3H0YA 3W16A 4EHZA 2BKZA 3GNIB 2YITA 3EN6A 5EHOA 4F09A 5IUHA 2AC3A 3KKVA 3G2FA 5M4IA 3HV6A 4YJRA 1Z57A 3ZEWA 4F99A 3RM6A 1SVGA 4NJDA 4DGGA 5A4EA 4F9CA 3R0TA 5H9BA 2VTIA 3BU5A 3FEGA 4FZDB 5AUXA 4ORKA 4CFMA 2QOHA 3EHAA 4FEWA 5CI6A 3R8PA 2BTRA 2B1PA 4TYJA 5CQWA 5AR4A 4XG8A 4AE9A 4BHNA 5J79A 2C1BA 3QCYA 4I21A 4DH1A 2C0IA 1GY3A 3ULIA 3LQ8A 2Y4IB 3GU8A 3N4TA 3LZBA 4YJTA 4WHZA 4FV2A 4YZBA 2BHEA 1VJYA 4L9IA 4UWYA 4R1YA 2XYNA 3VS4A 5F9EA 5I9XA 4C8BA 1GOLA 3R00A 4FI1A 3LW0A 5KZIA 3W8QA 4YC3A 3R28A 3WZEA 4BYIA 4DFNA 2P55A 3QQFA 1Y57A 4BIEA 4AZSA 2EXMA 4AQKA 4J96A 4M66A 4D5HA 4WNPA 4GVAA 5CASA 3U54A 2X0OA 4FKSA 3NNWA 2Z8CA 3UJGA 1IA9A 4ITIA 1U54A 3N9XA 3UYSA 5CI7A 4BR3A 3O50A 3PIZA 4E6AA 4V0GA 2QO7A 3REPA 4NEUA 3PJ2A 4OW8A 2UW8A 3NLBA 3IDCA 5E91A 4EOPA 4ENYA 2O64A 1V0BA 3Q4UA 2PL0A 2W0JA 3R01A 4RLKA 4BKZA 5L2SA 2C30A 1XH5A 3FI4A 4E26A 5LQFA 4LDTA 3NZ0A 2YLEA 1KE9A 1ZMWA 3G0EA 1Y6BA 2YN8A 2Z60A 4TL0A 3IO7A 4JDHA 5A4TA 2VO0A 2YJRA 5DVRA 1DAYA 2QCSA 3R1SA 1YI6A 2YIWA 1BUHA 4MXXA 4V05A 4MX9A 5JFSA 3AXWA 2YDIA 3EZRA 3ORTA 4J53A 2PE1A 2DWBA 3NCZA 1PY5A 4E8AA 5DBXA 2A19B 1WVYA 1SZMA 4FYNA 4G31A 3NAYA 4MBIA 4JG7A 3U6JA 3P78A 4AW1A 2WMQA 4CZYB 1ZY5A 4FGRA 4RA5A 4I1ZA 3W55A 1IEPA 4UMUA 3FSFA 5ITAA 4RX9A 4X2FA 1H0WA 2OXXA 3RCDA 2OSCA 5BYLA 2XNEA 4HVDA 2WMXA 4OTWA 4Q2AA 5F20A 3LXKA 3PPKA 3WILA 4AXAA 4FKQA 4ZTSA 2XKFA 3EN9A 4XRLA 4OAUC 1SNXA 3AMBA 4O6LA 4H36A 3LQ5A 4AP7A 1PMUA 4EHEA 1XMLA 3MJ2A 4JI9A 3II5A 3QD3A 4UB7A 3UMWA 4FK6A 4NK9A 1DI8A 5HICA 3TZ8A 1VYWA 3MFTA 4K2RA 4CG9A 5DEWA 4TKSA 2DS1A 5AUYA 4BDJA 4QDVA 3BGQA 3MDYA 5BVKA 3GUBA 2WXVA 2PVHA 4FA2A 4AAYA 3DTWA 3JS2A 3DNEA 3KRLA 4W4WA 4FG9A 4O86A 3C9WA 5CANA 4JAJA 1IASA 3DFAA 2UW7A 3Q96A 3UZRA 4QPMA 2BMCA 4XMOA 2G01A 3GEQA 4EH9A 3EYGA 4CYJA 2P33A 1R0PA 4Q5HA 4R1VA 2NO3A 4O0RA 4G17A 3TN8A 4FEVA 3PRFA 3QALE 3GBZA 2A0CX 4JX7A 5I3OA 2V0DA 3F69A 2JBOA 2YCFA 3LFAA 3PIXA 5FP5A 4JS8A 2AEGA 3H0ZA 3MB7A 2J7TA 5AP1A 4ASEA 4XNEA 5M56A 1XMMA 4GCJA 3CKWA 1IAHA 4AGCA 3NEWA 2XNBA 2YAKA 5EHYA 3D4QA 5A6NA 3AC2A 3VO3A 4M69B 5AUUA 3VNTA 4AW2A 4FT7A 4D55A 3E7VA 5E8WA 4FG7A 4M8TA 3VF8A 4UALA 4AAAA 2B9IA 3ZBXA 5E8ZA 3A7JA 1GZ8A 3EFWA 2ITWA 3D0EA 3TL8A 4EONA 3KXNA 3MS9A 1ZARA 3W2QA 4O82A 4HNFA 4FK3A 2F7EE 4YPSA 2QI8A 4MVFA 4K9YA 5HG8A 4O0UA 4BI2A 2W99B 3SXSA 2R3HA 3BL7A 4C02A 4CG8A 2QKRA 2W5BA 3G51A 4FKTA 4USFA 1YOLA 2R0UA 4DGLC 5FLFA 3BCEA 2R4BA 2PVKA 3EIDA 5JGAA 3I60A 3R7EA 5HE2A 4LRKA 3VULA 4IAKA 5CZHA 3ET7A 3D5UA 3HMNA 3NCGA 4YJPA 2HCKA 3UBDA 2UW9A 4ZTNA 2C6KA 5JZJA 4OTPA 5AP0A 3FYKX 4TTHB 3BWJA 4AS0A 4CSVA 3IKAA 4AQCA 3EH9A 3Q6WA 3PZHA 2GHMA 2WTKC 1V0OA 2PVRA 5HBJA 4EH2A 3S3IA 4TT7A 2X9EA 4NKSA 2HENA 4QMMA 2QOBA 3NRMA 1XH8A 4GJ2A 2O65A 3ROYA 4DFYA 4E93A 3SGCA 3TV4A 3VUDA 3HUBA 1JSTA 4GUBA 5BUIA 4QEBA 3FHIA 3WBLA 2NYAA 4O7VA 2QU5A 3CTQA 3P1AA 5CSVA 5L2IA 3UZTA 4BWXA 1YDTE 4FRFA 4P90A 3Q4TA 4E7WA 2C68A 4TWOA 3NR9A 2PMIA 2YCRA 4WBBB 4ZP5A 3C1XA 3F3TA 3BHUA 3OTUA 3QCSA 4EJNA 1Q8WA 2J0LA 4IFCA 1UA2A 3TNWA 4KKGA 4FTJA 4S2ZA 4YO4A 3IG7A 4U0IA 3LMGA 2R3NA 3Q4CA 4A7CA 2BTSA 3NW5A 4L52A 5A14A 2ETMA 3Q5IA 3UE4A 3UVPA 4CYIA 5KMMA 1PW2A 3W1FA 2OG8A 1K9AA 3FL5A 3UGCA 4M67A 2F2CB 4N70A 3ORZA 1B38A 4TYHA 1R78A 2FGIA 2VWIA 4ZTLA 3HAMA 4XP2A 2BALA 1ZMUA 5IQIA 4MXAA 4EC9A 4ZZNA 4F7LA 2UZEA 4GEOA 1OPLA 2QOFA 4U97A 2X7OA 5D7VA 4PTGA 5KX8A 4JBQA 3UIBA 3HVCA 3HP2A 4RIWB 3R71A 2CKPA 1PYXA 5FBOA 3FXWA 4QMNA 4I6BA 2IVVA 2QLQA 4E3CA 3SRVB 2WTJA 3NW6A 3ZUUA 4YTCA 4YO6A 1LP4A 3QRUA 1UNLA 4QMZA 5K0XA 4P2KA 3K2LA 2VTJA 1CM8A 2PWLA 2QODA 3BYUA 3K3JA 5AUTA 3EKNA 3V6RA 4MUQA 2XYUA 2FSMX 3ORMA 4G9RA 3TMOA 3R7VA 4CXAA 1OPJA 5DN3A 4KBKA 4QP4A 3OWPA 2Y8OA 3F82A 5FD2A 1YDRE 2OJJA 4D2TA 4OTGA 5C8KA 1Q61A 3UPZA 3ZFXA 1I09A 3OF0A 4R3PA 1ZAOA 3IGGA 2JKKA 4IM2A 2CGUA 3E64A 3TV6A 1W98A 4LUDA 4PMSA 3V3VA 4BTKA 1Q24A 4BN1A 3BGPA 4EKKA 4XG6A 2BZHB 3W0RA 5BMMA 4U79A 3OXZA 3D5WA 4EWHA 3KGAA 3OEZA 4QYFA 4EBWA 1XH4A 4ENXA 4EOOA 3UC3A 4AA4A 2Z7RA 4FV6A 1NVQA 4FMQA 3C7QA 3ORNA 1JAMA 1OVEA 4U42A 3CBLA 1UNHA 4RJ3A 1WFCA 4LOPA 3TKUA 3JPVA 4CFNA 3QTRA 2FSOX 4I94A 3GT8A 3MVLA 3N51A 5E8YA 4F0FA 2CPKE 4QMUA 3RKBA 3W2RA 4D4SA 4C4EA 3GCUA 2Z02A 2VWBA 3AC3A 5HZNA 2HXQA 2YWPA 2W05A 3FMLA 3HRCA 4RWLA 3RVGA 5L6OA 4FIHA 2ITOA 3F3VA 5DPVA 1KV1A 3C4EA 3WZDA 4MEDA 3LCKA 4ZJVA 3ZUTA 5H8GA 2QHMA 3NMUF 2RKUA 4DLIA 3BWFA 2XNMA 1PYEA 2J2IB 3OOGA 4DGOA 4IX5A 2J4ZA 1YI3A 2IPXA 2RG5A 4KKHA 4MH7A 4ASXA 4EZ5A 3P9JA 4IWQA 4FT9A 4DEDA 1U46A 3H9FA 4QMLA 4ZZOA 2BZJA 1OM1A 3QRTA 4J7BA 3IW6A 4LFIA 2CN5A 4I6FA 5AP6A 5AX3A 1KWPA 3C0GA 4KSQA 5GZ8A 3C4ZA 2G2FA 3LE6A 2WZJA 3D5XA 4DFBA 3MI9A 4F64A 5GZAA 4U8ZA 3QGWA 5CEKA 4OTQA 4R7BA 1BKXA 3COHA 4ACGA 1NY3A 3AGLA 3LFNA 1Q4LA 4FT5A 3MVHA 5HO6A 4L44A 3MJ1A 2F57A 4QTCA 5LVOA 1VZOA 3T9TA 3FHRA 3LJ0A 4GW8A 2PVFA 5DYJA 2XIYA 4ZK5A 5KKRC 2WELA 5AUVA 2KTYA 3L8XA 2WAJA 2ZM4A 3OCBA 5EI6A 1P2AA 3BYOA 3LCTA 4BF2A 4EOJA 3MFSA 4DHIB 5K4JA 1ZOGA 3KRRA 2Z7LA 1AD5A 1I44A 2EXEA 3R9DA 3UMXA 4BCGA 3ORXA 3N4UA 1YOJA 1H28A 4QMOA 2XAOA 4WBOA 4DTAA 4RIYA 3MYGA 5ANGA 1QPEA 2YA9A 4CD0A 4H05A 5IUIA 3FPMA 5DH3A 5CXZA 4IZ5A 4QMQA 3AKJA 3WZKA 3DDPA 4UWBA 5E8VA 4D0XA 1RDQE 1TVOA 4O22A 4IDTA 3RPVA 5C4KA 1YOMA 3ALOA 4H39A 5AAEA 3BEAA 3DJ5A 4O21A 3VUMA 1KE5A 2P4IA 4ANQA 4DEAA 4YTFA 1Q99A 5M57A 3TYKA 5BMSA 3BRBA 5TKDA 4AN3A 2PZYA 3ID6C 5K9IA 4KAOA 2GQGA 1LPUA 5AM7A 3F5XA 2HXLA 2ZOQA 2B7AA 3NIZA 4EK4A 4FTKA 1REJA 3RAIA 2GNFA 2ITUA 4IIRA 2R3KA 3COKA 4CT1A 3KXXA 4NM7A 1L8TA 3EQBA 3FLZA 5GIOE 5EM8A 2V7AA 3KN6A 5CSHA 3CPBA 4E5BA 5HBHA 3CIKA 2HIWA 2YIRA 3HA6A 2A98A 3OXIA 3C4WA 5J8IA 2RG6A 3OEFX 3QKLA 4BJJB 5E7RA 2BIYA 2XZSA 3QYZA 4LRMA 5HEZA 1NT2A 1OKZA 4IAYA 3ZEPA 2ZB0A 3FY0A 3QTSA 5C4LA 5CVFA 4XBRA 2FA2A 1ZOHA 4WOVA 4YJOA 5ANIA 3QC4A 2YIYA 3BHHA 2UW0A 5CF8A 3SVVA 4JG8A 1WVXA 3LLTA 3QUPA 3G5DA 4MBLA 4R5YA 5FXSA 1L3RE 3NGAA 5IQGA 4DEBA 1HOWA 2PSQA 4QQTA 4F4PA 4R78A 1KE6A 2G9XA 5DNRA 5IDPA 3GCVA 4FKJA 2CGWA 4IDVA 3VUTA 2IJMA 2PMLX 3FMNA 1OIQA 4RC3A 3SV0A 3W0QA 4P5QA 2UVZA 4FSTA 5D12A 2BFYA 3EB0A 4C4FA 5KMJA 3Q4ZA 4YJUA 2OF2A 2VX3A 1OL5A 3G90X 2CCIA 3HMIA 3TZMA 5IH4A 4PDSA 5HGIA 4IZAA 5A6OA 3AT4A 3EL8A 3QX4A 4FVRA 2IW6A 4R6VA 3DU8A 3P0MA 3QTQA 4X6QC 5M09A 2CGVA 5I9UA 2XNNA 5DG5A 3AC4A 1QPCA 2W9ZB 3BBTB 3MH1A 2CNQA 4TYEA 4PTEA 2XJ2A 4OTRA 5CT0A 1G8SA 1ZYCA 2E9VA 4FVPA 5FRIA 3F61A 2VO6A 5E8SA 4XG7A 4B8LA 3FZ1A 4H1MA 2GNHA 3TUCA 4JMQA 4UXQA 3UNJA 3ATTA 3BGZA 3OZ6A 1DAWA 5HO8A 2JDOA 2YISA 3QXOA 2ZJWA 3UP7A 3WI6A 5JKGA 1MP8A 2FYSA 4Z7GA 4W8EA 5HCXA 5IQEA 4O91A 4JBPA 2QKWB 4EEVA 3PVWA 4ASZA 1OUKA 4HZRA 2PZIA 2B9JA 2ITZA 2B54A 5ETFA 1VR2A 2A1AB 3EQDA 3I4BA 4GT4A 3R7IA 3WYXA 4ANSA 4O6EA 4DFUA 2W17A 3KK8A 4G5PA 5EM6A 4AT4A 4I0SA 1Y8YA 3EQPA 4CFWA 2XH5A 3MY1A 5IEVA 2W1IA 3PTGA 2J50A 4CV9A 1M7NA 3LJ1A 3O17A 3ACKA 2BROA 4C58A 1WBTA 2A2AA 3UVRA 4XBUA 3GQLA 4A9SA 3D5VA 2OK1A 1XKKA 1ZZ2A 2BR1A 1GJOA 4KBCA 4QO9A 3OWLA 3R1QA 5J7BA 2XAMA 3DBEA 3PJ8A 4U44A 4NM5A 3WOWA 4QTEA 4CGAA 1PJKA 3ZLSA 4A9UA 1OGYA 2WNTA 3HEGA 2PZ5A 2QHNA 4OBOA 4YMJA 2WQOA 3BYMA 4IQ6A 5CT7A 1PKGA 2ACXA 3L8VA 3MSSA 4QNAA 1REKA 3PJ3A 4B8MA 1YWNA 4U3YA 1KOAA 2CKQA 1W83A 2IF8A 3R02A 5L8KA 3ORIA 4IVDA 5I9WA 4BZOA 4FX3A 5EFQA 4IJ9A 5B2KA 3Q53A 1Q3DA 3VJOA 3QQKA 4KBAA 3VBVA 5L2TA 2BZIB 3PLSA 3PXKA 4O2ZA 1J91A 1YXSA 3IOKA 5AADA 5AFVA 4IB0A 5TR6A 1JQHA 2F49A 2FO0A 4I20A 4TW9A 4BBFA 2CNUA 4AXDA 1UV5A 3GENA 4NIFA 1NXKA 4UY9A 3LFSA 5E9EA 3OROA 4JG6A 5HO7A 4FKGA 4BTFA 2YIQA 2IZUA 3E8EA 3BE9A 3NWWA 4G3FA 3R83A 2WQNA 4V04A 5L3AA 3ATSA 4L67A 4O83A 2OZOA 4DYMA 4DG3E 4D9UA 4L01A 1GNGA 3FKNA 4HNIA 4G1WA 5FG8A 1WBNA 3DAEA 2WTIA 4LRJA 3VF9A 5HCZA 3FSKA 4BZDA 5KHWA 3VONA 3QTXA 1HCLA 3UYTA 4QP9A 1O6LA 5AP4A 4QTBA 5GHVA 4JBOA 2R3QA 4BI0A