1O9UA

Glycogen synthase kinase 3 beta complexed with axin peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
350
structure length
349
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPATVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFAFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase substrate
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Structural Basis for Recruitment of Glycogen Synthase Kinase 3Beta to the Axin-Apc Scaffold Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 349
sequence length 350
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1o9uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1o9uA01
2OXXA 5HBJA 4K6ZA 5FDXA 5LCKA 3SXRA 5HD4A 2J0JA 3C4EA 5J9ZA 2P0CA 4TW9A 2R3JA 4MVFA 1I44A 1TQIA 5HTIA 4CLIA 2YM6A 1YQJA 4ZSEA 4I4FA 2I0EA 1M2RA 4L42A 4XG7A 4DEEA 3MY1A 2I40A 4JT3A 3ORPA 4FEVA 1DAYA 3IDPA 3QTXA 4FKTA 3AXWA 3ZBXA 3EN5A 3ROCA 3VUTA 1CKJA 3DQWA 2CCIA 2G2FA 4DH1A 4Z7HA 4EOQA 5DMZA 4FV2A 2Y9QA 3Q9ZA 4E3CA 4B7TA 1XBBA 3UDBA 3EQPA 3Q9YA 1EH4A 2JD5A 5L6OA 4MF0A 2QONA 1XH5A 3KN5A 3LJ2A 3WF5A 5JKGA 4AZWA 5G6VA 3ZC6A 4IC8A 3U6JA 2B55A 1IASA 4CZYB 3H0ZA 4QMUA 5T68A 3R02A 3R8PA 4KIQA 3GC0A 2W9FB 3F7ZA 4BVUA 3NNUA 3V6RA 1FOTA 4FEUA 1GOLA 3NPCA 4LOPA 4HW7A 4QTEA 1M52A 2ERKA 3EQFA 3ORNA 5D12A 3DBEA 4RJ6A 4AN2A 4C33A 4ZEGA 2X2LA 4ORKA 2I0YA 4I4EA 4TY1A 4X3FB 4EL9A 3QUDA 4WA9A 4YJRA 5M4IA 3S3IA 4BDFA 3B8RA 3TDVA 4WRSA 2O0UA 3IPHA 3QC9A 4DG2E 5AP3A 3LCTA 3DBCA 3KXNA 4OTDA 3AC2A 5HX6A 2PE1A 3MJ1A 4V04A 5KMLA 4Y5QA 2R0UA 4RFZA 5J87A 5ETIA 5CEMA 4QP4A 5I9UA 1YWVA 2P33A 1OIQA 1V0OA 1FINA 3ZS5A 2J51A 3LFQA 5IG1A 3R7VA 1JPAA 3RCDA 2QLUA 4BKZA 4YO4A 1ZZ2A 4BDIA 3ZBFA 3MY0A 3ZC5A 2PMOX 2GNLA 4V0GB 4YLLA 4BDAA 5JRQA 4EOMA 2NRYA 3BBWA 3EFLA 3G0EA 4QMVA 3TEIA 4BDJA 4ENXA 5JFXA 5JFWA 4OTWA 4IIRA 3NS9A 3QCQA 2IZSA 4HGTA 5ANJA 2CLXA 2WB8A 5H3QA 3NVKI 4XRLA 3KA0A 4D55A 3QZFA 3BGPA 1YHWA 3BV2A 4FTCA 1JSVA 2IVSA 1BYGA 1PYEA 4GU9A 3L8PA 3GXLA 3EFWA 4G3CA 4UZDA 4EHVA 4IWOA 4FTTA 5AUVA 3F3TA 3TNQB 3SDJA 2F7EE 3R2BA 4JDIA 2BKZA 1FGIA 2XNPA 3FMEA 5I3RA 1MRVA 2YIXA 4F0GA 5EQEA 5AEPA 5M4UA 2OXYA 5L4QA 4PTCA 3Q5ZA 4RBLA 3F2AA 4YLJA 5CSWA 3TG1A 4APPA 3JR1A 5AUXA 4KSQA 4X3FC 3O8TA 3QLGA 3MW1A 4HGLA 2BDJA 4H1JA 5IQIA 3ACJA 4FKOA 4YC6A 4XRJA 3R9DA 2UZLA 1YW2A 5IQAA 4D5KA 3SOAA 2A1AB 4PWNA 2CHLA 2VD5A 2BZIB 2WOUA 2J4ZA 4FT7A 4KRCA 4P5QA 4AOTA 2P55A 4RVMA 5EM6A 3WF6A 4YSJA 2R3OA 2XUUA 3I5ZA 3QRKA 4RX8A 4W9XA 3QXPA 3RINA 3OCGA 4FKJA 2J9MA 2X0GA 2XRUA 1PYXA 2CCHA 3OXTA 4ITHA 4N0SA 2W05A 3G6HA 5KE0A 3WBLA 1R78A 1PMEA 4YC3A 4OTHA 3D5WA 3MJ2A 4M7IA 4Y8DA 5L2QA 3R73A 3JUHA 5JEBA 1HCLA 1MP8A 4FTAA 1O6KA 4O96A 2VZ6A 4W4YA 2B53A 2O5KA 3QC4A 5F95A 2GNGA 4X2NA 2V7OA 4I41A 4EJNA 5AR3A 3SV0A 3LMHA 3ORMA 4I1ZA 3IGGA 3OROA 2BIYA 4EYMA 5IDPA 2JDSA 5BYZA 5K0KA 5KMIA 3MESA 1NT2A 5BVDA 2VRXA 4CTBA 4CLJA 3LQ3A 4DHFA 3HA8A 4YTCA 3LLAA 2XEZA 1BKXA 3NIEA 4IX5A 3CCNA 2OH0E 2PVRA 3RHKA 3R30A 4U5JA 4KKHA 3AQVA 3O96A 2XVDA 4FSNA 5TKDA 5CYIA 4CXAA 4E5BA 1KV2A 4GKHA 4AZVA 3QX4A 3C13A 4ASEA 3GB2A 2WOTA 5CENA 4IB3A 4FNYA 3GU5A 3VUMA 4IDTA 3GFWA 3IONA 3BYUA 3HUBA 3NEWA 4IM2A 2QKRA 3ZXZA 3FSFA 4G1WA 4WBOA 1XJDA 4MTAA 1OPJA 4AA5A 4TYGA 4QPMA 3CLYA 5JZNA 1Y6BA 4QMQA 3BLRA 4BZOA 4PQNA 3MIYA 3QAME 4XCUA 4FEXA 4ZTHA 2HXLA 2UV2A 3Q04A 1RQQA 4U42A 2PYWA 3OCSA 1YI6A 3PWDA 3FAAA 4CZTA 4IVBA 4F9YA 4YBJA 5CU4A 1NW1A 3MVHA 5DFPA 3VWAA 4WBBB 3WF9A 4YZNA 4F64A 3NUAA 4O7VA 4FUXA 4IZYA 5HO8A 1XH6A 5DIAA 5E8VA 4RIWB 3MSSA 4R8QA 3CR0A 2W1EA 3VUHA 4FMQA 3W2QA 4ERWA 4F1OA 3UO5A 2KULA 1Q24A 1W7HA 3NX8A 5CNOA 2C0IA 4X2GA 3ZMMA 1TQPA 4CFVA 2X8IA 4DFXE 4EK5A 3KK9A 4JRVA 4RIYB 5CU0A 5HIDA 3A99A 3VBWA 4WNKA 3KU2A 4XBRA 1Q4LA 4OBQA 5EM8A 3W2OA 4AGDA 1GZ8A 3KQ7A 1YXXA 4HNIA 4LFIA 4U8ZA 4EC9A 4GK2A 4N4SA 4UXLA 3TZMA 4H3BA 4U6RA 3DJ5A 5JH6A 4D9UA 5EI2A 1MRYA 4QYYA 5CVGA 4YHJA 3U87A 4APCA 4EOIA 3P1AA 4FTLA 4J96A 2J0LA 3A7JA 4KWPA 3FC2A 3G0FA 3FKNA 4IXPA 5DHJA 2OW3A 3FZSA 5GZ9A 2R3MA 5M06A 5L8KA 1O9UA 3I7CA 1E1XA 2JBPA 4FTKA 5A4TA 2ETKA 4GV1A 4AT5A 4M8TA 3MH1A 3DTWA 2R0IA 3FLWA 3C50A 3G5DA 3DU8A 4GIIA 4YJSA 4DEIA 2A27A 5I9YA 4IVCA 5LMKC 1YHVA 3ZO3A 3TWJA 1YWNA 5FXSA 2QD9A 4QYFA 4Q9ZA 1FGKA 4F08A 4P7EA 4RVTA 5FD2A 4P90A 4FNZA 4O27B 2C6LA 2OZOA 3EQIA 1NVRA 4FIGA 4JBVA 2C3LA 4QQTA 5HNIX 2BZKB 3MPTA 4FOBA 1LUFA 3FMNA 3KVXA 4D4VA 5KBQA 4C62A 3EFKA 2JDRA 4IDVA 4RJ8A 4KB8A 4EQUA 1GZKA 1SNUA 2QVSE 3IW6A 3KB7A 3LVPA 4MBIA 4OTPA 3VS5A 5KCVA 1ZWSA 3PDTA 2YA9A 5DT0A 4BDGA 1ZYJA 5CEIA 3PSBA 5K4IA 4OT6A 4F1TA 4GRBA 4KBCA 4AW2A 2GU8A 4FNWA 4FV7A 4FG9A 3AGLA 5FRIA 4IJ9A 3VBYA 3PG3A 3TNIA 2C6KA 5A4CA 4FEQA 4BDDA 1V0BA 3UG2A 2V62A 3RNYA 4LL0A 4Y5HA 2R3RA 2IJMA 4RG0A 3Q32A 4GFOA 3R22A 3CIKA 3V01A 4FTUA 1OITA 2W96B 3DJ7A 3KFAA 2XRWA 3B2TA 4MQ2A 3QTUA 3U9CA 5TOZA 3DAEA 4A9TA 5HU9A 4OTGA 4F09A 2F4JA 1JKKA 5L8LA 3FHRA 3KN6A 5FTGA 3PZEA 1ZLTA 4CT2A 2KTYA 3QYWA 1G3NA 2C5NA 2J6MA 4FSMA 4MHAA 4XLVA 4QMTA 4TNBA 4DINA 2W7XA 4IC7A 5EW8A 4CRSA 3UNZA 2E9NA 2YIWA 3U4UA 2YCSA 2PTKA 3KVWA 1GAGA 2JFLA 4J71A 3VHKA 3E8NA 5EM7A 4EONA 2VGOA 2A4LA 2C69A 3OW3A 3ZRLA 4GJ2A 1FPUA 4C8BA 4G17A 5CU2A 5BYYA 2ZJWA 3IW4A 2VAGA 4BFMA 3QZIA 4K18A 4CTCA 3DOGA 5FM2A 3K3JA 1MQBA 2BIKB 4NFMA 4RLKA 5M56A 1G8SA 3UOHA 1R1WA 1H27A 4JDHA 3COHA 4O1PA 3BHVA 3EMGA 5GIPE 2RF9A 2PE2A 5M07A 2QU6A 4D5HA 4E1ZA 3HV7A 5M4FA 1IR3A 1SNXA 2VX0A 1LEZA 4USDA 2Y6OA 1VR2A 3Q4TA 5HBHA 1U59A 3DK7A 4QP3A 4ERKA 5AV3A 4WUAA 5E8XA 2Z7RA 2OZAB 2OIBA 4FSYA 1UNHA 3LKMA 2OF4A 4H3PA 4BYJA 4TWOA 1UVRA 4L7FA 4USFA 1UNLA 2Y4IB 3EQBA 5FXRA 4BDCA 4EH4A 4EH3A 4AOJA 3MDYA 3VBXA 4E4MA 5FM3A 1Q8UA 3ORZA 1OL5A 3UP7A 3Q60A 3P5KA 4CRLA 4E4LA 4ZMFA 2J7TA 3KF4A 2WZJA 4EWHA 4S30A 3P7AA 3WZDA 4ZJIA 2WTJA 5IH6A 4FGBA 2R3NA 4G6NA 4AP7A 3R9RA 3TXOA 3LFNA 3D94A 4L6QA 4RIOA 4AGUA 5IEVA 4FVRA 4NZWB 1SM2A 4RRVA 3S00A 5HEZA 3DB8A 4QP1A 1FVVA 2BRGA 2W1IA 3PY3A 4R6VA 1GIJA 3QFVA 2PSQA 3FZTA 2XK8A 3F66A 5LCJA 2YJRA 1KE6A 2CGXA 5LVLA 4R7HA 2X7OA 3KL8A 3C0GA 3H0YA 5AUYA 4BI0A 2V5QA 3D7ZA 2B9IA 1NVSA 2UZBA 2VTJA 4ZLZA 3R00A 3KXMA 3QD2B 5JFVA 3SVVA 3FI8A 1REJA 2WTWA 3I60A 4X6RA 1Z9XA 3OTUA 2VWYA 4O0VA 5JFSA 2PHKA 4MXXA 4YPDA 1H25A 4FG8A 5EW9A 3KC3A 4G3DA 4EHEA 5EG3A 5KNJA 4DH5A 4R5YA 5AV0A 2OICA 3K5UA 3A8XA 3RAWA 1XBCA 5AP2A 3RNIA 2OWBA 2W5HA 4EUUA 4UBAA 4XNEA 3AG9A 4HZSA 5IA5A 3PJ3A 4UEUA 4JS8A 3TV7A 2Y4IC 4BF2A 3FJQE 3PLAE 3O0GA 3PVBA 4QTDA 5IQCA 4K77A 4YP8A 3F5UA 5HNBA 2GS7A 4BI2A 3CD8A 1QPDA 2J5EA 1FQ1B 2B1PA 2OXDA 3QUPA 1OUYA 4MWHA 3PTGA 4LYNA 1NA7A 4XG9A 5CALA 5HLWA 3D83A 3RWQA 5AA8A 3QKLA 5HE0A 4B4LA 2XIZA 3Q52A 5GJDA 4ITJA 4BCKA 1SYKA 2GQGA 3VS4A 4ZSAA 1WBPA 5K5NA 4EWQA 4QMPA 3GUBA 4X3FA 3IQ7A 4GSBA 1ZRZA 2BTSA 5ETFA 3UIBA 2NP8A 3GGFA 1F5QA 3VUIA 4C4FA 2W1ZA 3QZHA 2EU9A 2ITTA 5GINE 3RPVA 3CTJA 3DAKA 4L68A 4II5A 3UTOA 2WMSA 4R1YA 4NTSA 3V5JA 3KF7A 4W9WA 3VC4A 1SZMA 5IUIA 4D2VA 4IW0A 4LL5A 3WILA 3AT2A 2WTCA 2XH5A 4F99A 4FODA 3GCUA 4U97A 3TN8A 5ANDA 5M57A 2YITA 2QC6A 4BRXA 2VTHA 4PY1A 3TTJA 3UIXA 4IH8A 2YERA 2PULA 4WG3A 5ICPA 3P4KA 4LI5A 4ZZMA 5LQFA 3ZXTA 2IZUA 3VS6A 4BZDA 2BAKA 1PXPA 2JC6A 4YHFA 2WMTA 4M97A 2XF0A 4V0GA 2X7GA 2OIDA 3HEGA 3EQHA 1E1VA 1NXKA 3EHAA 5A9UA 4EH2A 5BQ0A 1ZMUA 4QMZA 3LFCA 3B2WA 2Q0BA 3VS7A 3G6GA 3ZEWA 3ZEPA 3FL5A 3VUDA 4H05A 3T9TA 4BHZA 2WU7A 3K54A 4YNOA 5IKWA 3LLTA 4L45A 3T3UA 3UBDA 3BE9A 3H10A 4DEBA 3U6HA 4WHZA 2QG5A 2XIYA 4NEUA 4JR7A 3D5XA 1ZZLA 2GFSA 4WSYA 4H58A 1XHAA 2PUIA 4PF4A 2Y7JA 1FMOE 3JVRA 3NYXA 3E92A 4X2FA 5L8JA 3W2RA 4HVIA 5DNRA 4RIXB 4G2FA 4PDPA 5ANEA 2WTIA 2IWIA 4DCEA 4QYHA 2RG6A 4GU6A 2QKWB 4IVAA 3T3VA 4BDBA 4A9UA 1APME 4YJOA 4YURA 2OJJA 3UMXA 4YJNA 4IE9A 4FEWA 1JKLA 3U51A 3NWWA 4O86A 4TRLA 4U9AA 4B8MA 4ONAA 3BEGA 4A7CA 4J7BA 2ZV8A 1Q97A 4AF3A 2QR8A 3NYOA 4LV8A 3ZH8A 4AE9A 2OJFE 5HU3A 5CF6A 3DK6A 2OLCA 4CFUA 2ZMDA 4U80A 5CF4A 4O0UA 5M53A 2VNWA 3QWJA 3PXQA 4TYJA 3FI3A 2Z8CA 2O8YA 2RG5A 3ANQA 5ETCA 1XH7A 5AAGA 4AZTA 1GIIA 2Z7SA 5K3YA 4RA5A 2W1FA 3C5IA 5HD7A 1JKSA 4IB5A 4DTKA 3ORIA 4WUNA 5CASA 2JLDA 3FPQA 5ITAA 4O7YA 4DCAA 2C5XA 3TNPC 4D2WA 2O2UA 1I09A 5DR2A 5CAOA 4C7TA 4DLIA 2DS1A 5LMBA 5AUUA 2OSCA 3M11A 3RAHA 1IG1A 5EDQA 3R9OA 4NM3A 5IQDA 2C5VA 2VO7A 4XP2A 2YM4A 4L7SA 4MAOA 5G1XA 4UX9A 4O38A 4BWPA 5DN3A 4L52A 5JSMA 4NTTA 4O81A 4QMLA 4ACGA 4EZ5A 4P4CA 4ZJJA 4YR8A 3ET7A 3PFQA 4BIBA 2GNIA 3U4WA 1UU9A 2G01A 2R3LA 2OJ9A 3EZVA 2ITXA 2XK7A 3MTLA 4FSQA 4FVQA 1Q41A 4K1BA 4IVDA 4LRJA 4MXCA 1PKGA 3W2PA 4AT4A 5B2KA 3FE3A 3ZFXA 4ASXA 2OFVA 2IW6A 3VVHA 5A6OA 2HELA 4C36A 3KRXA 4GUEA 3C51A 4HOKA 4MXOA 4UWYA 3UZPA 2X2KA 3MIAA 5F1ZA 3I6UA 4DGGA 4R3RA 3UC3A 5K5XA 3RJCA 5HKMA 2OO8X 3I6WA 1UKHA 5LMKA 4PNIA 4IM3A 4S33A 5FTQA 3VJNA 2BKKA 4GCJA 2VN9A 4X7QA 4EYJA 2AYPA 4GKIA 1XWSA 3HUCA 1RW8A 2CGWA 3HRFA 3FZPA 4U3YA 4JOAA 4D1ZA 4OAVB 2UW7A 2H34A 3HRBA 4CFXA 3OFMA 4M0YA 4BKYA 2B0QA 3QWKA 3OXIA 4FT0A 1IRKA 1J3HA 1LP4A 4F7NA 4J98A 1SVHA 4C61A 5J79A 3DB6A 4KUJA 2G9XA 4XS2A 2PMIA 3BYSA 4GVAA 4YJQA 5DH3A 1WBSA 3SC1A 4BKJA 5CXZA 3DV3A 5CI6A 1WVXA 2YLEA 4JIAA 3K3IA 4FK6A 4QPSA 4RIWA 3W1FA 4ANNA 4J97A 3PRIA 3BYOA 4MQ1A 3GP0A 1ZY5A 3NCZA 3DZQA 3FMMA 2R3IA 3MPMA 3DK3A 4LUDA 4ZMEA 2DYLA 4RIYA 3MFRA 3DAJA 3R21A 4EH8A 3QGWA 1HCKA 4MEDA 3ZO4A 5HZNA 5HG7A 3E8CA 2VO3A 3AMAA 4L8MA 3IS5A 1W84A 3TJCA 5J5SA 4C3PA 3I4BA 4FKWA 3R9HA 1IAJA 2IG7A 4HVSA 2J0IA 5ANGA 3RVGA 3BWJA 4YUQA 3VJOA 1PXJA 3CKXA 4DITA 1ZYLA 4FSUA 3R7IA 4BGQA 2WQNA 3FBVA 3VBTA 4AW1A 3IW7A 4Z16A 1QCFA 4U43A 3GCSA 2V0DA 5C03A 3NUUA 2RFEA 3DLZA 4OBOA 5D41A 3SQQA 2R3HA 4Q5HA 4TYEA 3H30A 5LARA 2GQRA 2LAVA 5LVNA 2O3PA 3VS2A 5I4NA 3ORXA 4IM0A 3ZSHA 3GEQA 3LW0A 3L1SA 1B38A 3FV8A 2PMNX 3UZTA 4H3QA 5FWKK 3ZLYA 1U54B 5CEOA 1PY5A 4LQMA 3LMGA 1TKIA 3OCBA 5DBXA 3V5PA 1XH4A 2XCHA 2FYSA 5E92A 3TACA 1ERKA 5HTBA 2CLQA 3MBLA 5LVOA 2WMUA 4FTNA 4ARKA 3EB0A 3NDMA 2ZV9A 4UV0A 4DT8A 2HZ0A 5IDNA 2WO6A 5EHLA 4AU8A 4C58A 2WMRA 3Q96A 4ZXTA 4BWXA 4DFYA 4AOIA 2XBAA 4HPUE 4PL5A 4QQCA 4EK4A 3HGKA 4EOKA 1J7UA 5JRSA 1OL1A 4U7ZA 4IAYA 2CPKE 2UW9A 4WKQA 2WNTA 3ZRMA 5LVPA 4O7SA 4UMTA 5I9XA 5M44A 4BICA 4ALWA 3PJ2A 2B9HA 4YO6A 5BVKA 3OVVA 2JKQA 2ETMA 4O21A 4ZTQA 3TTIA 3NVMB 3FWQA 2R7IA 4A06A 4S31A 4TT7A 4HVDA 3F9NA 5FGKA 1K2PA 4O0RA 4YTHA 3UMWA 1DAWA 4KIKA 5EM5A 5ACKA 3F3WA 4ACDA 4IAFA 2BHEA 3A4OX 3F5PA 2DQ7X 2WU6A 3D9VA 3M2WA 4F65A 3VS1A 3IW8A 4ZTMA 4DE4A 3ZDIA 2C5OA 4FV3A 2VTLA 3UC4A 4D9TA 2QOOA 3SLSA 5HHWA 1G8AA 4EOJA 4JL9A 4I5CA 4LGHA 5CQWA 3VRZA 2PVLA 3GC9A 3TJDA 4ZAUA 5L3AA 1TQMA 3AC1A 3R7UA 4FV5A 2WQMA 1PMUA 1OI9A 3IW5A 5EYDA 3O23A 3E93A 1PKDA 4BY9E 4X2KA 2YEXA 5C26A 4DBXA 3KCFA 3TKHA 1VJYA 4QP8A 2UW3A 1OPLA 4FIFA 2BDWA 5D9HA 2PVKA 2UW8A 4J95A 5M08A 3HKOA 4J52A 5HBEA 4B0GA 4FTQA 4TYHA 5HTCA 1M14A 5I3OA 4I22A 2WD1A 4IX3A 4I0RA 5CQUA 1R0EA 4MBLA 4EKKA 4D2SA 4WSQA 1UU7A 4BN1A 1G5SA 3QHRA 4MXAA 3KMUA 3ENMA 3A2CA 4C0TA 2JAMA 3O7LD 5IUGA 2OZAA 3CEKA 3GENA 3KKVA 4FVPA 2PK9A 1UKIA 2GSFA 4DG0E 4PTEA 3MB7A 3CGOA 3BBTB 5CTPA 2FSLX 4KRDA 5AP7A 2XKCA 2ONLA 3EOCA 4I5HA 3QRUA 1O6YA 3QHWA 4BCIA 4DYMA 5GJGA 3DXNA 4ANMA 2BCJA 4UWBA 5HCYA 1CTPE 1H0WA 4FV8A 4XG3A 2YABA 3HECA 1CKIA 2C1AA 3R01A 3C0IA 1PXMA 3G90X 2GPHA 3T8OA 1GJOA 4EOOA 4FZDB 3COKA 3WE4A 4IX4A 2F7ZE 2PVMA 3JY0A 1YXUA 4OTRA 2ITYA 4X2JA 3GU6A 4QTCA 4CQEA 4CG9A 1T46A 4WRGA 2FSTX 2ITOA 3A8WA 3VUKA 2CKQA 3OT8A 4CFMA 4JJRA 4QQJA 1DI8A 3KY2A 2P3GX 2B4SB 3QRTA 3PLSA 1KOAA 4HYUA 4UALA 1GZNA 5L2SA 3SW4A 5J9LA 2BR1A 3POZA 5BMMA 1MQ4A 3MY5A 2HZIA 2PWLA 3OUKA 5C8MA 4F4PA 1AGWA 5CZHA 5DT4A 2OKRA 5IZFA 3DFAA 5KBRA 4FZ7A 4BTMA 3FY2A 2AC3A 3Q4CA 5DLSA 4IAKA 3V3VA 4EK3A 4NK9A 4MD8E 4FTIA 2GMXA 3HMPA 4H36A 5EOLA 4S2ZA 4HYIA 4JLCA 5HI2A 5A14A 5HG8A 2XS0A 4FT3A 4NWMA 4BCMA 3CPBA 3ETAA 3NUNA 4AA4A 5T6KA 3QTSA 3PRFA 5HLNA 2YWVA 3VULA 2J0MB 4UMUA 4BI1A 1NY3A 4PP9A 5CANA 1Y8YA 2Z02A 4ZY6A 4AT3A 3CQEA 3DDQA 3CTQA 1JWHA 4X0MA 3ZUVA 3GFEA 1ND4A 2PVYA 4FT5A 2VTRA 3GQLA 3RKBA 3P79A 3EN7A 4GH2A 4TYIA 3GOPA 2EXCX 4AZEA 4GG5A 4DF3A 3AC4A 3RPYA 3HDMA 2Y6MA 2XNBA 3LJ1A 5CY3A 3TIZA 4IFGA 3JVSA 5B2LA 3ZUTA 4C2WA 3MVMA 1WZYA 3R1YA 2ZB1A 3HRCA 2WEVA 3C4ZA 3BLQA 3FLQA 3MFSA 4F9AA 4CG8A 2XKEA 2VUWA 2W4OA 2WKMA 3ORLA 4O0WA 2R64A 4AA0A 1CDKA 2FO0A 4FNXA 3NUSA 4EH9A 2PL0A 3LPBA 4FKQA 4GUBA 4I6BA 4FV9A 3SW7A 2GHMA 2O63A 4JG7A 3R7EA 3II5A 3JY9A 4AFEA 2CNUA 4CFWA 4NYEA 1H1PA 2UW0A 4C4HA 4FOCA 3DGKA 2VV9A 3OD6X 5DE2A 5TT7A 4ITIA 3KXZA 2I0VA 3ALOA 2WMQA 4ZP5A 4F70A 4DFUA 3DBQA 2PVNA 5AAEA 1UV5A 4PPCA 3BI6A 3E63A 5L6WL 2HW6A 2X2MA 4D2PA 1Q61A 5JGDA 2ZMCA 4N70A 4CYIA 2EVAA 4O0SA 4GL9A 5CI7A 5A4QA 3VN9A 1LPUA 1URCA 1OKVA 4G9RA 1U4DA 4O0XA 1J1CA 3LXKA 4QTAA 3AMBA 4YZCA 2BILB 5L6PA 1Q99A 4QD6A 5CLPA 5E90A 4NJ3A 3SX9A 3LAUA 4FZFB 5HIEA 2EXMA 5DRBA 2CNQA 3NCGA 3H9OA 5CSXA 4G31A 4FKIA 4C4EA 4XJ0A 2QO2A 5AUTA 2CNVA 4FGRA 3HVCA 2YAKA 5FQDC 5GNKA 3LCSA 3QRIA 1ZAOA 4RIXA 5FEEA 4TWCA 3GC7A 3FQSA 4N6ZA 3FXWA 4MXYA 3Q5IA 3C4FA 3KK8A 1XKKA 1YI3A 4I93A 4NJDA 4NW5A 2HZNA 5EDPA 4B9DA 1IEPA 2ZAZA 4L67A 5D11A 3QCXA 1Q5KA 2HYYA 4ZTLA 2X8EA 3HNGA 4IANA 3D4QA 3LFAA 2VO0A 5FLFA 5AV4A 3S0OA 4G5JA 3PJ1A 4DEDA 3W10A 3BEAA 2WAJA 5IMXA 4FC0A 4L44A 1OKZA 1PXIA 4YZ9A 4YMJA 2RFDA 3BCEA 4QP2A 1OVEA 5E8SA 1YXSA 2VTNA 3OOGA 1P14A 2BDFA 1BL6A 1GZOA 2WIHA 4PL3A 1JKTA 2GS2A 3EJ1A 4UZHA 5CS6A 3FMJA 3WZKA 5JQ8A 2C0TA 3QLFA 3IOKA 3TDWA 4ZS0A 5HG9A 3K2LA 2GQSA 4BCQA 3PVGA 2C5YA 2GS6A 4QMYA 3JXWA 1R3CA 1ZOGA 1M7NA 5T3QA 2X7FA 4KBAA 4D1XA 2I6LA 4TPTA 4RQKA 4UYAA 4DFZE 4F1MA 2BRHA 4Z3VA 1KOBA 1DI9A 4ZSGA 4RWLA 5I9VA 2AUHA 4FR4A 3BZ3A 2QHMA 3RGFA 1Q8YA 5A54A 4P2KA 5BX0A 4GS6A 3PWYA 3U6IA 2ITPA 5EHYA 3DDPA 3I1AA 2R7BA 1ZARA 3G15A 4QYEA 4KIKB 2JKOA 4QRCA 4ASDA 4C38A 4BBFA 1YDSE 2F2CB 3K5VA 3WF8A 5CT0A 5HLPA 3N4VA 4L43A 1IA8A 2YJSA 2B9JA 1RE8A 4B6LA 4R3PA 3VW8A 2J2IB 3REPA 3D7TB 2E9VA 5IISA 2JITA 4I6HA 4I94A 4RFYA 3RCJA 1AQ1A 1XR1A 3FZRA 3BKBA 3IGOA 3LFFA 3NAXA 4BCOA 5BNJA 1WCCA 5FBNC 2PZRA 4F6UA 3QYZA 4BCJA 2YZLA 2BMCA 3W2CA 1FVRA 5HIBA 3R8UA 2HZ4A 3UIMA 4TTHB 4AN9A 4RSSA 2XEYA 5CAQA 5EQYA 3RPRA 3BWFA 5BVOA 5AX3A 2C6DA 4OBPA 2BFXA 2RFSA 2YM7A 4O6LA 4TYHB 4JX7A 1OPKA 3MI9A 4HCUA 3A7IA 5AMNA 4ASZA 5EW3A 3GOKA 2VWBA 4RZWA 4E6CA 2BRMA 4RA4A 4JVGA 2Z7LA 4CYJA 3FQHA 3KXGA 1ZYDA 4TZRA 2OG8A 3JYAA 3PVUA 4BR3A 2ESMA 4RC4A 5J8IA 4TXCA 5EI8A 5HCZA 3N9XA 4XG2A 2UZNA 1ZMWA 2ITQA 3E8DA 3EL7A 4RX9A 3TUBA 4M68A 2ZDUA 5H2UA 5AIRA 2G15A 2JKKA 3Q4UA 5BUJA 2B9FA 2EXEA 2V7AA 4FSWA 2ITUA 2HOGA 3TCPA 3FKOA 3L9PA 1Z5MA 3LFDA 5C01A 3ZZWA 1BLXA 2ITVA 4M0ZA 4B8LA 2WTKC 3GQIA 4NSTA 4E26A 2X9FA 3UP2A 4I24A 1P2AA 4C02A 2ACXA 1S9IA 1QPJA 3QKMA 3FXZA 3OUNB 1PXLA 4UMPA 3S1HA 3DXPA 1UWHA 2QOBA 2BROA 2PVHA 2UVYA 5DR9A 2Y8OA 3OS3A 3GU8A 5CU6A 4R77A 4LV5A 5IQFA 4C35A 2CGVA 2W0JA 3FMHA 4U3ZA 1J7IA 4QMSA 4QP9A 2E2BA 2F49A 2J90A 3IECA 2R4BA 3H4JA 1CM8A 3ELJA 3QTZA 4L9IA 5DR6A 2WMBA 2QOQA 1H8FA 4Y73A 5D7VA 5IA2A 4TL0A 4A9YA 4YC8A 4AACA 5M55A 1WBNA 4Y83A 2JIIA 4C4JA 4FICA 2H8HA 3I0QA 3R1NA 4O91A 2X1NA 2GCDA 1UWJA 3O8UA 4GVJA 4J99A 1YOLA 2PVJA 1ZY4A 1B6CB 4O83A 1KE5A 3LQ5A 5DEYA 3L9LA 1U54A 4PX6A 2J0KA 2X4ZA 4E4XA 4JDJA 1PRYA 5DGZA 5E1SA 2VWIA 5EKNA 2XNMA 3LFEA 2ITNA 5IF1A 4PMTA 4ANQA 4QQ5A 2UZVA 3BPRA 4U79A 5J7BA 4HJOA 4FI1A 5JQ5A 3IO7A 2XBJA 1BUHA 1RDQE 2W4JA 4MYGA 2WIPA 2WHBA 1W8CA 1P5EA 4CKRA 4U44A 2R3QA 3PE1A 3WYXA 1WVYA 2HY0A 2XB7A 3FXXA 3R6XA 2AC5A 4O1OA 4AX8A 4LOQA 2BRNA 3LZBA 3FYJX 4FE2A 2YCFA 3KULB 1SVGA 5TE0A 3LQ8A 1PHKA 3DNEA 4KIPA 1XO2B 2JDVA 4LG4A 2JIUA 5BVNA 2YIQA 3G2FA 3RK7A 1MRUA 4GW8A 3F5XA 3MFTA 4TNDA 4O2PA 3DBDA 2G2HA 1BL7A 4LM5A 4RJ4A 1JVPP 2ERZE 3M1SA 3QZGA 2J50A 3DTCA 3OP5A 4M67A 4QNYA 1REKA 2JKMA 4RMZA 4JAIA 1OIRA 2NNWB 2Y0AA 1O6LA 2F9GA 2IN6A 3I7BA 3P08A 5DPVA 3W18A 5ANKA 3MVJA 4DA5A 3ENHA 4JQ8A 3UPZA 4M15A 3CQWA 4C2VA 3CE3A 4M69B 3E7VA 4FYNA 1U5QA 3PZHA 1XBAA 4HYSA 4UYNA 3V04A 4BCHA 3RK5A 4F6WA 4I0TA 3QQHA 2C4GA 2WTVA 1PF8A 4LRMA 4BIDA 5A6NA 4JQEA 4IZ7A 5AJQA 5A3XA 2WMAA 3KRLA 2A2AA 1M2QA 3PG1A 1OZ1A 1WVWA 1XH9A 2UVZA 4OUCA 4AGWA 3NNWA 3BU5A 1KUTA 2QOIA 5L2TA 4F0IA 2Q83A 4O2ZA 2QQ7A 5I0BA 5LJJA 3FZ1A 3V51A 3VS0A 5IH4A 4ANBA 5IA0A 5JGBA 4UWCA 3CGFA 3L8XA 3MPAA 3LCDA 3NSZA 4M3QA 4ZTSA 4DFLA 2VTQA 3TNHA 4O7NA 1JSTA 3AC8A 4BIEA 2WQEA 3O71A 3OWKA 3ZDUA 4OR5A 5D7AA 1WFCA 2E9UA 1H1WA 3FLSA 4IB1A 4RT7A 3QX2A 4IACA 3QGYA 4NUSA 4O7ZA 2QOFA 2YM8A 1H26A 2REIA 4G3EA 4A4OA 1H00A 2VGPA 3MN3A 3LMIA 1YOMA 1CSNA 4FKSA 5C27A 3VRYA 4GFMA 3EKKA 3OEZA 3UZRA 4RVLA 4CV8A 2SRCA 4PMSA 3G33A 3ZRKA 4MBJA 2GDOA 1KE7A 5HESA 1GIHA 2W1CA 4HGEA 5B0XA 2XK3A 3HMNA 3DKOA 2WXVA 2JAVA 1UU3A 5J9YA 4IAAA 4AQCA 4EKLA 1JNKA 5EI6A 2PMLX 3W55A 1V0PA 2ZV7A 3R8LA 4AUAA 4CV9A 3UNKA 2YDJA 4LGDA 4WOVA 5KMNA 2QCSA 4CD0A 2OBJA 4FKUA 3R8MA 2HWPA 4V05A 2VWXA 3UOLA 3WARA 3CPCA 1Q3WA 3MH3A 1OMWA 3Q3BA 5AP0A 2QU5A 4I92A 4IMYA 2OGVA 1HOWA 1PMNA 2HWOA 3EQGA 4KS7A 3RMFA 2PVFA 4C59A 1WAKA 2R3GA 2XM8A 2H96A 5M4CA 4Z55A 3ZCLA 3TKUA 4DEHA 3NW7A 4FZ6A 3KREA 5JGAA 5AR5A 5HG5A 4FSTA 4FV1A 1J7LA 5KMJA 3QA0A 5EKOA 4JXFA 4RX7A 4AXAA 4BBEA 1U46A 4YZMA 3OTVA 4C34A 3NUPA 5E1EA 3R04A 3V5QA 3D2KA 5EOBA 4CNHA 2CN8A 3AD5A 5HQ0A 3ULZA 2UW5A 4JBQA 2VTAA 3HMMA 3OEFX 5JMSA 3R1QA 4WO5A 5FP6A 2H9VA 3N4UA 3QTWA 3BRBA 5DRDA 4HZRA 5BYLA 4ANSA 3C5UA 3LM0A 2B7AA 1H0VA 4ACHA 4F9WA 3HA6A 5BVEA 4O82A 1XQZA 3QD4A 3FLYA 4A07A 3M42A 3QL8A 2YDKA 4S32A 2QODA 1YRPA 3BHUA 3EH9A 1JOWB 3LOKA 2XNNA 4KA3A 3FY0A 3ODZX 1H4LA 2XKFA 1PXOA 4FF8A 4FV6A 4FKPA 4FSRA 3UE4A 3ZLSA 1YDTE 1OL7A 5B7VA 4OLIA 4X21A 4YGAA 2XCKA 2YM5A 3HP2A 4U45A 3C4XA 5DYJA 4RWKA 3TV6A 4IB0A 3UODA 3KEXA 2GTMA 3Q53A 2VWZA 3D5UA 3R71A 4KABA 4M84A 4YNEA 2BZJA 4BZNA 4O6EA 4XOZA 4DEGA 4MD9E 4I20A 4RWJA 4E5AX 2YIRA 2XJ0A 3LCOA 4MK0A 4R3CA 2IW8A 3RTPA 2QI8A 4NL0A 4USEA 2QOLA 2OIQA 4E5WA 1OKWA 3Q9XA 1H08A 4EHZA 1GNGA 4CMUA 5F94A 5LMAA 4XV3A 3QD3A 2ZM1A 5TF9A 4E7WA 2XJ2A 4G9CA 4ZS4A 1Y91A 3UIUA 4ZLOA 2B52A 3EYGA 5KMMA 5KUPA 1E9HA 3ZFMA 4G16A 4CFNA 4PDYA 2VU3A 2JDTA 3U8WA 5IA3A 3ID6C 3BU6A 3R63A 3HAMA 3W16A 4CT1A 3GU4A 1MUOA 5HE1A 3DT1A 2OJIA 2UZUE 3KXXA 3LJ0A 3OY3A 4DLJA 4EQMA 1H28A 4GT3A 2XKDA 2X4FA 2O64A 3UVQA 4D28A 4QMNA 2P4IA 2PUNA 4G3GA 5DT3A 1OGUA 4MF1A 4YSMA 4EJ7A 4UMRA 3CC6A 3IK3A 3L8VA 2XNOA 3E87A 4NKSA 3O51A 3PSDA 4U40A 5ACBC 4EH7A 2ZB0A 3A60A 2WELA 4IFCA 4O0TA 5H8EA 1FVTA 4XV9A 5EDRA 3SRVB 5K9IA 3S4QA 4XG8A 4QP7A 2YM3A 4DG3E 3QBNA 4RWIA 3WYYA 3Q6UA 2C6EA 4BWKA 3ZSIA 3R9NA 4X3JA 3MFUA 3CJFA 2DWBA 3MTFA 2UZOA 3OY1A 2YCQA 2CSNA 4IZ5A 2F57A 3AT3A 4KAOA 1LEWA 1IA9A 3TL8A 3DJ6A 2BPMA 3SXFA 5DEWA 4YPSA 4LGGA 3ZTXA 2UVXA 3PA3A 2LGCA 4XG6A 5CNNA 3U9NA 5M51A 4QYGA 2XK6A 2XYNA 4M13A 3BELA 1J1BA 4KINA 2ZOQA 4AW5A 2VNYA 4IAZA 4NM7A 3AC5A 4HGSA 5CAUA 3OOMA 4K11A 4FL3A 4GIHA 3H9FA 3C4WA 5A4EA 5EYMA 2J5FA 4ID7A 3QA8A 3N4TA 2R9SA 3W32A 3ALNA 3W2SA 4QOXA 5CF5A 5ANOA 5IEXA 2C3KA 3FQEA 3EWHA 3VIDA 3PY1A 3JS2A 4CFFA 5KKRB 1YHSA 4I6QA 4WNPA 5CT7A 3R83A 4I0SA 4PDSA 3VAPA 2PZPA 1W83A 4C4GA 3UQCA 3ODYX 4Y85A 5AIKA 4MX9A 3O50A 3MA6A 5CVHA 4AW0A 4BCGA 3L9NA 4H39A 2BUJA 2CN5A 5AM7A 3SG8A 3D7TA 1A06A 2XYUA 1UU8A 3NIZA 4OW8A 2E9OA 2XM9A 3RI1A 2IO6A 4PMPA 4ZY4A 5J1VA 4FIEA 1ZYSA 4JRNA 1FMKA 3QKKA 2C6IA 3EL8A 4XG4A 2GFCA 4R1VA 2W1GA 1RJBA 2PE0A 3PYYA 1M2PA 5DWRA 5CEKA 5FDPA 5L2WA 1KE9A 3AT4A 1DS5A 3R1SA 4B99A 5HGIA 5JK3A 3E64A 3GCPA 5CVFA 5LXMA 3ZLXA 4RVKA 4K33A 5D10A 2WGJA 4DGNA 3QU0A 3U55A 4E6QA 5CU3A 3AMYA 4RFMA 3NYVA 4BCFA 1SVEA 4KIOA 3OMVA 4LRKA 5F4NA 3R8VA 2Z60A 3PP0A 4MD7E 4IJPA 2BVAA 3PIZA 4G5PA 4QMMA 4I6FA 3TKIA 3WZUA 3CKWA 2QO7A 2VX3A 4O7RA 4XP3A 3OC1A 4G6LA 4S34A 4MCVA 3BQCA 4D4YA 2C0OA 5CF8A 3HX4A 3QQJA 4YJUA 4FK3A 4NFNA 4Z9LA 5IH5A 2XIKA 3KGAA 1A48A 4C37A 2CGUA 2CKEA 5BUEA 1T45A 2FVDA 3F3UA 3LHJA 2C3JA 2RKUA 4BL1A 3IOPA 2C3IB 2YIYA 2BALA 2XNEA 3C4CA 3DA6A 3ZONA 5TO8A 2JGZA 3ORKA 4ALUA 5KHXA 4R5SA 2VTPA 1QPEA 5C4LA 3E88A 3WE8A 3PXKA 4J8NA 4UMQA 4W8EA 5KHWA 4GJ3A 5B2MA 3NNVA 2HAKA 2W17A 3DBFA 3H9RA 3EN9A 5AP5A 5AADA 5KKRC 2RIOA 1YXVA 2B54A 1CKPA 2NPQA 2C6TA 3QRJA 3MVLA 4G34A 3GCQA 5FEDA 2RFNA 3POOA 4YJTA 3R7YA 2HXQA 3WOWA 1PMVA 4ACMA 3LFBA 4AE6A 2G2IA 3F88A 5AR4A 3A61A 2YHVA 4FSZA 4HVGA 3SOCA 2BAQA 2X39A 3V5LA 3HAVA 4IAIA 4FL2A 1JLUE 3OT3A 3UYTA 4EC8A 4UY9A 4F7SA 2ETRA 3PA5A 2PPQA 3TUDA 2DUVA 5GJFA 2WEIA 2OH4A 3VF9A 4D0XA 4OAUC 2VTOA 3G9NA 3IDCA 4MNEB 4PTGA 2CKOA 4CGAA 2YZAA 3QQGA 3VBVA 5KMOA 3RZFA 4TWPA 1R0PA 3ZOSA 4IWDA 4Q2AA 4IX6A 2QOKA 3NMUF 5ETAA 1JAMA 1OUKA 5CEQA 3CP9A 5C8NA 3QTQA 4TKSA 4K2RA 2HY81 4ZIMA 4I5MA 5CEPA 4ZY5A 1FBNA 4L00A 5AM6A 4EI4A 2R2PA 5IQHA 4Y72A 1BI8A 2G1TA 3FSKA 3NUXA 5AP1A 3UGCA 2X8DA 1ZYCA 2WTDA 2XA4A 1Q8TA 3ZU7A 4CEGA 4E6DA 1H01A 5AUWA 2WFYA 4NM0A 2GNFA 2WMXA 4DTAA 4F7JA 3ANRA 3ZUUA 3EZRA 3R2YA 3KULA 3GU7A 4D1SA 3NUYA 1Q3DA 1GY3A 2CKPA 5DA3A 2W5AA 5HOAA 3OBJA 4TN6A 3NYNA 5AUZA 1DM2A 4QO9A 2FA2A 2IVVA 1LR4A 4XH6A 4CCUA 3QTRA 1YOJA 3HLLA 3HV5A 4HYHA 2HK5A 2XK9A 3MV5A 4F63A 1WMKA 4FUYA 4V01A 4BDKA 3HV3A 4NIFA 2NRUA 4DFBA 3D5VA 4ZJVA 5EFQA 5CSVA 3L9MA 4IEBA 3UNJA 4DEAA 3GT8A 1V1KA 3PPZA 3AC3A 3HL7A 5KZIA 4GT4A 2BAJA 3A7HA 3OF0A 2H6DA 4JAJA 4MXZA 5F20A 2W06A 2C6MA 4NT4A 5GZ8A 3B8QA 3BGZA 4EBWA 4QT1A 4L3JA 4M69A 4DAWA 2VX1A 4BTFA 5LVMA 2RGPA 3PXFA 4JX3A 5HORA 2QLQA 5EYKA 2HCKA 4BGGA 4BYIA 5HE2A 3SHEA 4PV0A 3GCVA 5KZ0A 2P2IA 4NH1A 1WBWA 3RHXA 2PUUA 3I81A 4FT9A 3A62A 4FKVA 4FX3A 3F82A 3R8ZA 2P2HA 4F0FA 4O7LA 3NNXA 2WPAA 4IHPA 4GK4A 1XH8A 1A9UA 3OG7A 4EHGA 4EBVA 2XIRA 2YACA 5CZIA 4RJ5A 4JG8A 4RJ7A 4DT9A 3FMDA 4ENYA 2ZVAA 4C57A 3NGAA 3RAIA 2XMYA 2F2UA 3S2PA 4XP0A 3N51A 4TWNA 3O8PA 4Q5EA 5AV1A 4C3FA 3I0OA 2F7XE 4C4IA 2ITZA 3DZOA 4JR3A 1IAHA 2GHLA 4DH3A 3TI1A 4AG8A 3OWPA 3TIYA 3C9WA 2OU7A 5H8BA 3GNIB 1Q62A 3CSVA 5H8GA 4D4RA 1OBGA 4E4NA 3WZJA 3ACKA 1YI4A 4CQGA 5J1WA 4IBMA 3ZO1A 3D15A 4R7IA 3FI4A 4K8AA 4FIHA 5E91A 3Q2JA 4NCTC 2I7QA 5IU2A 3DNDA 2IPXA 4LUEA 2W1DA 3E5AA 3P23A 4DFNA 1B39A 2A0CX 4W4WA 5DOSA 2I1MA 4WG4A 2QOHA 4DGLC 3VBQA 4M12A 1OB3A 4RGJA 5AR2A 3HV4A 2BRBA 5HCXA 4IQ6A 4DGMA 1M7QA 5CAVA 2O65A 1ZOHA 2XIXA 3HP5A 5AV2A 4FTOA 3I5NA 3FZOA 3C1XA 4OGRA 3BE2A 4OTFA 3FHIA 4AS0A 2JDOA 2C30A 1UNGA 4ALVA 3CJGA 4IWQA 1W82A 1QPCA 4R7BA 2PZYA 3UO4A 1KWPA 2WTKB 3QD0A 3KMWA 4RC2A 3LFSA 3ZYAA 2Q0NA 2OI4X 4CKJA 2QR7A 1WBOA 2VWWA 2XZSA 5IQBA 2C47A 4L3LA 4Y46A 3ZM4A 1H1SA 3BHTA 1PXKA 5AAFA 2X6DA 4XEYA 4D58A 4BDEA 3ZHPC 3BIZA 3R0TA 3DXQA 4N6YA 2ZM4A 3R7GA 4L3PA 4UXQA 5GHVA 4OTQA 4BDHA 4WNOA 4CSVA 4PPAA 4Z7GA 2QNJA 3RZBA 4GT5A 4CVAA 4MKCA 2OJGA 3EQDA 3A7GA 2QHNA 4KKEA 3THBA 4O84A 3D2IA 3TNWA 4GEOA 1BI7A 4HPTE 2HENA 5IUHA 3BHHA 3ATTA 4NKAA 4FTRA 4EUTA 2PZIA 2YISA 2V22A 3P7CA 5E9EA 3L8SA 4JBPA 3ZZEA 2R3PA 3WI6A 1Y6AA 2YN8A 4EQCA 3ZSGA 1Q8WA 5EQPA 3QUEA 4PUZA 4HCTA 4WT6A 3QQFA 4YU2A 3BYVA 2PU8A 2X81A 2XP2A 3VW6A 5LOHA 4FIIA 3DPKA 5HO7A 2FH9A 4ZTRA 4U41A 4WD5A 5CX9A 3EYHA 3UG1A 5I9WA 3LIJA 2UZTA 3E62A 4JIKA 3RM7A 5AFVA 2W99B 3F3ZA 3DKCA 3VS3A 1TVOA 3HYHA 4M14A 4PPBA 1VYZA 4R78A 2A19B 1J91A 5AR8A 3PPKA 3W8QA 4AZFA 4AAAA 2R3FA 3H3CA 4GFGA 3QQKA 4XOYA 3FPMA 4PNKA 3V5TA 4PL4A 4AGCA 3QCYA 3LXLA 5BVFA 2R5TA 4W4VA 3W33A 4KBKA 1QL6A 4G3FA 2W5BA 4A9RA 1P4OA 5EYCA 4BBMA 3FDNA 4E93A 2UZEA 1H1QA 4ZK5A 2C68A 2FSMX 3HV6A 4HCVA 1U5RA 5HVJA 2Z2WA 4FTMA 4AWIA 5AA9A 1OM1A 4DH8A 3RAKA 3QTIA 4BGHA 3HMOA 5FTOA 3DQXA 4FV0A 5DG5A 3KRWA 1ATPE 3AOXA 3MB6A 3BV3A 2NO3A 3UO6A 3HZTA 3F7WA 4K0YA 3RBWA 3COMA 5I5ZA 4EH5A 3RM6A 2OFUA 4FTJA 4ZZOA 2RL5A 3NW6A 5HVKA 4O7WA 5BMSA 4L46A 2CJMA 5EH0A 3TZ7A 2C1BA 2PZ5A 4D2TA 3D14A 4JDKA 3ATSA 1H1RA 2FGIA 1OL6A 1QMZA 3SXSA 3CY3A 4F7LA 3FYKX 3LXNA 3T9IA 2WMWA 4E6AA 3BX5A 3E3BX 4HVHA 1JSUA 4YTFA 3UQFA 3FLNC 3SRVA 3P7BA 1M17A 4I23A 4ZLYA 3F69A 3UVPA 3UVRA 3RWPA 3VHEA 4Y95A 5AWMA 4QP6A 4FYOA 3VO3A 1Y57A 3E7OA 2OF2A 5CXHA 3WF7A 5K0XA 3MWUA 3QF9A 5FEQA 4XUFA 4QTBA 5JT2A 3PJCA 3OWLA 2IW9A 1KV1A 3DLSA 3RALA 5AX9A 3CXWA 5AP4A 3TT0A 2XK4A 5KX8A 1Q8ZA 5FG8A 4LMUA 4AN3A 5CSPA 3DFCB 5J5TA 3CS9A 4OT5A 1PXNA 5BPYA 4A9SA 5CSHA 5E8UA 3SKCA 3QCSA 2EUFB 4ZSLA 2ITWA 4AFJA 3DCVA 2CMWA 4WIHA 3BHYA 4RX5A 3CBLA 3F61A 4FIJA 3Q4ZA 4IADA 4X6QC 5IMEA 2IVUA 2W9ZB 3NZ0A 3WIKA 3MA3A 3QQLA 4F6SA 4I3ZA 4CMTA 2GHGA 4JG6A 4KD1A 3NAYA 3VQHA 2W4KA 3FUPA 4MWIA 4ZTNA 4K9YA 5FP5A 3SD0A 3VQUA 1URWA 3F2RA 3MYGA 3E3PA 3UOJA 4NIFB 3ITZA 3WIGA 5C4KA 2ONLC 2JFMA 1CMKE 3OZ6A 4GYIA 3W8LA 4C3RA 2ZDTA 3FEGA 3ZM9A 3D0EA 3ORTA 2UZWE 1VZOA 4FKLA 4FKRA 4W8DA 4EEVA 3FL4A 1ZMVA 4PMMA 5HVYA 4Q9SA 2UW6A 1R39A 3A7FA 3COIA 2IZTA 2IZRA 3TZ9A 5KMKA 5LWNA 4ZOGA 3CQUA 3Q9WA 4RZVA 5E7RA 5AP6A 3BLHA 5C8KA 5IPJA 2QO9A 3CD3A 4OTIA 1PJKA 4EZ3A 2WQBA 4FBXA 2WMVA 3P9JA 4ANLA 5ANIA 4LMNA 3FMLA 3HMIA 5CWZA 3KMMA 2V55A 4XMOA 3RK9A 1PW2A 4KSPA 2YLFA 1K9AA 2R3KA 1OECA 3E8EA 4M66A 5HNGA 4J53A 5BUIA 4FZAB 4GK3A 2YDIA 2ZYBA 3OWJA 4D2RA 3RPSA 2QG7A 3ERKA 5I9ZA 4EOPA 2GNJA 2CDZA 3I79A 3P78A 4RLLA 1SMHA 2YAAA 4QMOA 5K4JA 3F6XA 3EQCA 1X8BA 5JZJA 5IQEA 3V5WA 1BX6A 5HO6A 3FMKA 5HICA 3O17A 3RP9A 2X9EA 1F3MC 2QURA 2VO6A 3BU3A 3DKFA 3BYMA 3SAYA 3QQUA 3UOKA 4BC6A 3C0HA 2HW7A 3TZ8A 3GC8A 5E8YA 2PUPA 2X6EA 3ZO2A 5EHOA 4GYGA 2YFXA 4DN5A 4MH7A 2Z7QA 1YVJA 2OK1A 3G51A 3PXZA 2VTIA 2WQOA 4J1RA 2W1HA 3OXZA 1L8TA 1OL2A 3CTHA 4F9BA 5A46A 2YWPA 4YTIA 4MNFA 1WBTA 5IQGA 3P0MA 2VWUA 2VTMA 2XNGA 2Y4PA 4I5PA 4O22A 3U54A 5E8ZA 3PUPA 3F5GA 4LOOA 2BZHB 2E9PA 3EFJA 4WG5A 5EK7A 5C9CA 4NM5A 3PP1A 5C1QB 3SGCA 4BTJA 3KRRA 1OBDA 3F3VA 1OIUA 3EN6A 4L01A 5LWMA 2XJ1A 4MNEA 3WZEA 1BMKA 3Q6WA 4YZBA 3GBZA 4EOSA 3PXYA 5J7HA 4DTBA 4H1MA 1K3AA 5GZAA 3OCTA 1S9JA 3QALE 4PDOA 3G9LX 3O7LB 3HDNA 3F2NA 2JIVA 5H9BA 5L2IA 4AZSA 3S95A 1OKYA 1YKRA 5E4HA 4HNFA 3ROYA 3ZFYA 2UUEA 4IWPA 4XLIA 2UW4A 3LM5A 3V8WA 2ZV2A 4RQVA 1UA2A 4BB4A 4O7TA 1KSWA 4F9CA 2GTNA 4FA2A 4N57A 4JI9A 3R28A 3PXRA 5FXQA 4JNWA 3TV4A 2IVTA 3TUCA 5DI1A 3MGYA 2HIWA 1W98A 4JBOA 3PJ8A 5CAPA 2VTSA 2VWVA 4ZZNA 4XBUA 1ZXEA 3IDBA 3DS6A 4A4LA 4RPVA 3DY7A 4NU1A 4FKGA 4L53A 3PPJA 4E8AA 3OHTA 3C7QA 3GVUA 3O2MA 3PIYA 3UPXA 3PSCA 3KXHA 5D1JA 5IEYA 3QXOA 3NR9A 3UQGA 3PE2A 1P4FA 4WNMA 4NCTA 4KKGA 4XHKB 1L3RE 4I21A 5DVRA 4FV4A 4E73A 1ZOEA 2GNHA 2RSVA 3A4PA 4CZUA 5JN2A 3EN4A 3VF8A 3DKGA 1KE8A 2BFYA 3BGQA 3V8TA 4PRJA 3MS9A 3PY0A 3R7OA 4XX9A 3SA0A 4KNBA 3OBGA 4DBNA 4YZDA 4J8MA 1YDRE 3LXPA 2QOCA 1WBVA 3JPVA 3CY2A 3LE6A 4EOLA 5GIOE 4UN0C 4RC3A 4YBKA 2UZDA 3FI2A 3NRMA 4W4XA 3FC1X 4BTKA 4QMXA 2EWAA 4ACCA 3PA4A 4YJPA 1F0QA 4U0IA 3AGMA 3Q2MA 4GMYA 5E8TA 1W0XC 4EZ7A 2I0HA 1Y8GA 3RPOA 5E8WA 1JQHA 3P86A 3UYSA 3MH2A 3BQRA 1VYWA 4IZAA 4RJ3A 4EK6A 4QNAA 5HX8A 1NVQA 4QPAA 4XV2A 3V6SA 2FB8A 2EB3A 4G6OA 3KCKA 5FBOA 1H07A 3ULIA 3EIDA 3IKAA 3AD6A 1JBPE 1VEBA 2BHHA 4QMWA 5J95A 1AD5A 4NW6A 3PVWA 4GG7A 3V8SA 4DC2A 4BCNA 5KO1A 1Z57A 4O0YA 4UB7A 3VUGA 1YXTA 3UJGA 3LCKA 3SG9A 4PP7A 3NLBA 4U81A 5BVWA 3AD4A 4JQ7A 2BTRA 4YJVA 2EB2A 3VNTA 2VTTA 3FLZA 5IA4A 4A4XA 4EH6A 4FL1A 1H24A 3MH0A 4P5ZA 5M09A 4DGOA 5HE3A 5F9EA 2JBOA 3NW5A 2FSOX 3GI3A 5AR7A 4CCBA 4XV1A 3ZLWA 4YLKA 4D0WA 5IA1A 4FG7A 5FUTA 3TM0A 4ZSJA 4CKIA 4E20A 5A4LA 3EKNA 4BCPA 4KS8A 4D4SA 3OW4A 2C6OA 3KRJA 2YCRA 2PY3A 3EQRA 3IG7A 1YWRA 4DH7A 4EK8A 1OIYA 4YHTA 2JEDA 5TR6A 3PIXA 4BHNA 2ZM3A 4XYFA 4CMOA 4EORA 3FKLA 4ANOA 2FUMA 1STCE
chains in the Genus database with same CATH superfamily
2OXXA 5HBJA 4K6ZA 5FDXA 5LCKA 3SXRA 5HD4A 1ST0A 2J0JA 3C4EA 5J9ZA 2P0CA 4TW9A 2R3JA 4MVFA 1I44A 1TQIA 5HTIA 4CLIA 2YM6A 1G8KA 1YQJA 4ZSEA 4I4FA 2I0EA 1M2RA 4L42A 4XG7A 4DEEA 3MY1A 2I40A 4JT3A 3ORPA 4FEVA 1DAYA 3IDPA 3QTXA 4FKTA 3AXWA 3ZBXA 3EN5A 3ROCA 3VUTA 1CKJA 1G8JA 3DQWA 2CCIA 2G2FA 4DH1A 4Z7HA 4EOQA 5DMZA 4FV2A 2Y9QA 3Q9ZA 4E3CA 4B7TA 1XBBA 3UDBA 3EQPA 3Q9YA 1EH4A 2JD5A 5L6OA 4MF0A 2QONA 1XH5A 3KN5A 3LJ2A 3WF5A 5JKGA 3BLAA 4AZWA 5G6VA 3ZC6A 4IC8A 3U6JA 2B55A 1IASA 4CZYB 3H0ZA 4QMUA 5T68A 3R02A 3R8PA 4KIQA 3PUFC 3GC0A 2W9FB 3F7ZA 4BVUA 3NNUA 3V6RA 1FOTA 4FEUA 1GOLA 3NPCA 4LOPA 4HW7A 4QTEA 1M52A 2ERKA 3EQFA 3ORNA 5D12A 3DBEA 4RJ6A 4AN2A 4C33A 4ZEGA 2X2LA 4ORKA 2I0YA 4I4EA 4TY1A 4X3FB 4EL9A 3QUDA 4WA9A 4YJRA 5M4IA 3S3IA 4BDFA 3VONA 3B8RA 3TDVA 4WRSA 2O0UA 3IPHA 3QC9A 4DG2E 5AP3A 3LCTA 3DBCA 3KXNA 4OTDA 3AC2A 5HX6A 2PE1A 3MJ1A 4V04A 5KMLA 4Y5QA 2R0UA 4RFZA 5J87A 5ETIA 5CEMA 4QP4A 5I9UA 1YWVA 2P33A 1OIQA 1V0OA 2XARA 1FINA 3ZS5A 2J51A 3LFQA 5IG1A 4LV7A 3R7VA 1JPAA 3RCDA 2QLUA 4BKZA 4YO4A 1ZZ2A 4BDIA 3ZBFA 3MY0A 3ZC5A 2PMOX 2GNLA 4V0GB 4YLLA 4BDAA 5JRQA 1W2FA 4EOMA 2NRYA 3BBWA 3EFLA 3G0EA 4QMVA 3TEIA 4BDJA 4ENXA 5JFXA 5JFWA 4OTWA 4IIRA 3NS9A 3QCQA 2IZSA 4HGTA 4AXCA 5ANJA 2CLXA 2WB8A 5H3QA 3NVKI 4XRLA 3KA0A 4D55A 3QZFA 3BGPA 1YHWA 3BV2A 4FTCA 1JSVA 2IVSA 1BYGA 1PYEA 4GU9A 2XALA 3L8PA 3GXLA 3EFWA 4G3CA 4UZDA 4EHVA 4IWOA 4FTTA 5AUVA 3F3TA 3TNQB 3SDJA 2F7EE 3R2BA 4JDIA 2BKZA 1FGIA 2XNPA 3FMEA 5I3RA 1MRVA 2YIXA 4F0GA 5EQEA 5AEPA 1TFFA 5M4UA 2OXYA 5L4QA 4PTCA 3Q5ZA 4RBLA 3F2AA 4YLJA 5CSWA 3TG1A 4APPA 3JR1A 5AUXA 4KSQA 4X3FC 3O8TA 3QLGA 3MW1A 4HGLA 2BDJA 4H1JA 5IQIA 3ACJA 4FKOA 4YC6A 4XRJA 3R9DA 2UZLA 1YW2A 5IQAA 4D5KA 3SOAA 2A1AB 4PWNA 2CHLA 2VD5A 3AKKA 2BZIB 2WOUA 2J4ZA 4FT7A 4KRCA 4P5QA 4AOTA 2P55A 4RVMA 5EM6A 3WF6A 4YSJA 2R3OA 2XUUA 3I5ZA 3QRKA 4RX8A 4W9XA 3QXPA 3RINA 3OCGA 4FKJA 2J9MA 2X0GA 2XRUA 1PYXA 2CCHA 3OXTA 4ITHA 4N0SA 2W05A 3G6HA 5KE0A 3WBLA 1R78A 1PMEA 3UDTA 4YC3A 4OTHA 3D5WA 3MJ2A 4M7IA 4Y8DA 5L2QA 3R73A 3JUHA 5JEBA 1HCLA 1MP8A 4FTAA 1O6KA 4O96A 2VZ6A 4W4YA 2B53A 2O5KA 3QC4A 5F95A 2GNGA 4X2NA 2V7OA 4I41A 4EJNA 5AR3A 3SV0A 3LMHA 3ORMA 4I1ZA 3IGGA 3OROA 2BIYA 4EYMA 5IDPA 2JDSA 5BYZA 5K0KA 5KMIA 3MESA 1NT2A 5BVDA 2VRXA 4CTBA 4CLJA 3LQ3A 4DHFA 3HA8A 4YTCA 3LLAA 2XEZA 1BKXA 3NIEA 4IX5A 3CCNA 2OH0E 2PVRA 3RHKA 3R30A 4U5JA 4KKHA 3AQVA 3O96A 2XVDA 4FSNA 5TKDA 5CYIA 4CXAA 4E5BA 1KV2A 4GKHA 4MUQA 4AZVA 3QX4A 3C13A 4ASEA 3GB2A 2WOTA 5CENA 4DHIB 4IB3A 4FNYA 3GU5A 3VUMA 4IDTA 3GFWA 3IONA 3BYUA 3HUBA 3NEWA 4IM2A 2QKRA 3ZXZA 3FSFA 4G1WA 4WBOA 1XJDA 4MTAA 1OPJA 4AA5A 4TYGA 4QPMA 3CLYA 5JZNA 1Y6BA 4QMQA 3BLRA 4BZOA 4PQNA 3MIYA 3QAME 4XCUA 4FEXA 4ZTHA 2HXLA 2UV2A 3Q04A 1RQQA 4U42A 2PYWA 3OCSA 1YI6A 3PWDA 3FAAA 4CZTA 4IVBA 4F9YA 4YBJA 5CU4A 1NW1A 3MVHA 5DFPA 3VWAA 4WBBB 3WF9A 4YZNA 4F64A 3NUAA 4O7VA 4FUXA 4IZYA 5HO8A 1XH6A 5DIAA 5E8VA 4RIWB 3MSSA 4R8QA 3CR0A 2W1EA 3VUHA 4FMQA 3W2QA 4ERWA 4F1OA 3UO5A 2KULA 1Q24A 1W7HA 3NX8A 5CNOA 2C0IA 4X2GA 3ZMMA 1TQPA 4CFVA 2X8IA 4DFXE 4EK5A 3KK9A 4JRVA 4RIYB 5CU0A 5HIDA 3A99A 3VBWA 4WNKA 3KU2A 4XBRA 1Q4LA 4OBQA 5EM8A 3W2OA 4AGDA 1GZ8A 3KQ7A 1YXXA 4HNIA 4LFIA 4U8ZA 4EC9A 4GK2A 4N4SA 4UXLA 3TZMA 4H3BA 4U6RA 3DJ5A 5JH6A 4D9UA 5EI2A 1MRYA 4QYYA 5CVGA 4YHJA 3U87A 4APCA 4EOIA 3P1AA 4FTLA 4J96A 2J0LA 3A7JA 4KWPA 3FC2A 3G0FA 3FKNA 4IXPA 5DHJA 2OW3A 3FZSA 5GZ9A 2R3MA 1OGYA 5L8KA 1O9UA 5M06A 3I7CA 1E1XA 2JBPA 4FTKA 5A4TA 2ETKA 4GV1A 4AT5A 4M8TA 3MH1A 3DTWA 2R0IA 3FLWA 3C50A 3G5DA 3DU8A 4GIIA 4YJSA 4DEIA 2A27A 5I9YA 4IVCA 5LMKC 1YHVA 3ZO3A 3TWJA 1YWNA 5FXSA 2QD9A 4QYFA 4Q9ZA 1FGKA 4F08A 4P7EA 4RVTA 5FD2A 4P90A 4FNZA 4O27B 2C6LA 2OZOA 3EQIA 1NVRA 4FIGA 4JBVA 2C3LA 4QQTA 5HNIX 2BZKB 3MPTA 4FOBA 1LUFA 3FMNA 3KVXA 4D4VA 5KBQA 4C62A 3EFKA 2JDRA 4IDVA 4RJ8A 4KB8A 4EQUA 1GZKA 1SNUA 2QVSE 3IW6A 3KB7A 3LVPA 4MBIA 4OTPA 3VS5A 5KCVA 1ZWSA 3PDTA 2YA9A 5DT0A 4BDGA 1ZYJA 5CEIA 3PSBA 5K4IA 4OT6A 4F1TA 4GRBA 4KBCA 4AW2A 2GU8A 4FNWA 4FV7A 4FG9A 3AGLA 5FRIA 4IJ9A 3VBYA 3PG3A 3TNIA 2C6KA 5A4CA 4FEQA 4BDDA 1V0BA 3UG2A 2V62A 3RNYA 4LL0A 4Y5HA 2R3RA 2IJMA 4RG0A 3Q32A 4GFOA 3R22A 3CIKA 3V01A 4FTUA 1OITA 2W96B 3DJ7A 3KFAA 2XRWA 3B2TA 4MQ2A 3QTUA 3U9CA 4O4CA 5TOZA 3DAEA 4A9TA 5HU9A 4OTGA 4F09A 2F4JA 1JKKA 5L8LA 3FHRA 3KN6A 5FTGA 3PZEA 1ZLTA 4CT2A 2KTYA 3QYWA 1G3NA 2C5NA 2J6MA 4FSMA 4MHAA 4XLVA 4QMTA 4TNBA 4DINA 2W7XA 4IC7A 5EW8A 4CRSA 3UNZA 2E9NA 2YIWA 3U4UA 2YCSA 2PTKA 3KVWA 1GAGA 2JFLA 4J71A 3VHKA 3E8NA 5EM7A 4EONA 2VGOA 2A4LA 2C69A 3OW3A 3ZRLA 4GJ2A 1FPUA 4C8BA 4G17A 5CU2A 4AQKA 5BYYA 2ZJWA 3IW4A 2VAGA 4BFMA 3QZIA 4K18A 4CTCA 3DOGA 5FM2A 3K3JA 1MQBA 2BIKB 4NFMA 4RLKA 5M56A 1G8SA 3UOHA 1R1WA 1H27A 4JDHA 3COHA 4O1PA 3BHVA 3EMGA 5GIPE 2RF9A 2PE2A 5M07A 2QU6A 4D5HA 4E1ZA 3HV7A 5M4FA 1IR3A 1SNXA 2VX0A 1LEZA 4USDA 2Y6OA 1VR2A 3Q4TA 5HBHA 1U59A 3DK7A 4QP3A 4ERKA 5AV3A 4WUAA 5E8XA 2Z7RA 2OZAB 2OIBA 4FSYA 1UNHA 3LKMA 2OF4A 4H3PA 4BYJA 4TWOA 1UVRA 4L7FA 4USFA 1UNLA 2Y4IB 3EQBA 5FXRA 4BDCA 4EH4A 4EH3A 4AOJA 3MDYA 3VBXA 4E4MA 5FM3A 1Q8UA 3ORZA 1OL5A 3UP7A 3Q60A 3P5KA 4CRLA 4E4LA 4ZMFA 2J7TA 3KF4A 2WZJA 4EWHA 4S30A 3P7AA 3WZDA 4ZJIA 2WTJA 5IH6A 4FRFA 1XMMA 4FGBA 2R3NA 4G6NA 4AP7A 3R9RA 3TXOA 3LFNA 3D94A 4L6QA 4RIOA 4AGUA 5IEVA 4FVRA 4NZWB 1SM2A 4RRVA 3S00A 4QDEA 5HEZA 3DB8A 4QP1A 1FVVA 2BRGA 2W1IA 3PY3A 4R6VA 1GIJA 3QFVA 2PSQA 3FZTA 3NFFB 2XK8A 3F66A 5LCJA 2YJRA 1KE6A 2CGXA 5LVLA 4R7HA 2X7OA 3KL8A 3C0GA 3H0YA 5AUYA 4BI0A 2V5QA 3D7ZA 2B9IA 1NVSA 2UZBA 2VTJA 4ZLZA 3R00A 3KXMA 3QD2B 5JFVA 3SVVA 3FI8A 1REJA 2WTWA 3I60A 4X6RA 1Z9XA 3OTUA 2VWYA 4O0VA 5JFSA 2PHKA 4MXXA 4JMQA 4YPDA 1H25A 4FG8A 5EW9A 3KC3A 4G3DA 4EHEA 5EG3A 5KNJA 4DH5A 4R5YA 5AV0A 2OICA 3K5UA 3A8XA 3RAWA 1XBCA 5AP2A 3RNIA 2OWBA 2W5HA 4EUUA 4DDGA 4UBAA 4XNEA 3AG9A 4HZSA 5IA5A 3PJ3A 4UEUA 4JS8A 3TV7A 2Y4IC 4BF2A 3FJQE 3PLAE 3O0GA 3PVBA 4QTDA 5IQCA 4K77A 4YP8A 3F5UA 5HNBA 2GS7A 4BI2A 3CD8A 1QPDA 2J5EA 1FQ1B 2B1PA 2OXDA 3QUPA 1OUYA 4MWHA 3PTGA 4LYNA 1NA7A 4XG9A 5CALA 5HLWA 3D83A 3RWQA 5AA8A 3QKLA 5HE0A 4B4LA 2XIZA 3Q52A 5GJDA 4ITJA 4BCKA 1SYKA 2GQGA 3VS4A 4ZSAA 1WBPA 5K5NA 4EWQA 4QMPA 3GUBA 4X3FA 3IQ7A 4GSBA 1ZRZA 2BTSA 5ETFA 3UIBA 2NP8A 3GGFA 1F5QA 3VUIA 4C4FA 2W1ZA 3QZHA 2EU9A 2ITTA 5GINE 3RPVA 3CTJA 3DAKA 4L68A 4II5A 3UTOA 2WMSA 4R1YA 4NTSA 3V5JA 3KF7A 4W9WA 3VC4A 1SZMA 5IUIA 4D2VA 4IW0A 4LL5A 3WILA 3AT2A 2WTCA 2XH5A 4F99A 4FODA 3GCUA 4U97A 3AKLA 3TN8A 5ANDA 5M57A 2YITA 2QC6A 4BRXA 2VTHA 4PY1A 3TTJA 3UIXA 4IH8A 2YERA 2PULA 4WG3A 5ICPA 3P4KA 4LI5A 4ZZMA 5LQFA 3ZXTA 2IZUA 3VS6A 4BZDA 2BAKA 1PXPA 2JC6A 4YHFA 2WMTA 4M97A 2XF0A 4V0GA 2X7GA 2OIDA 3HEGA 3EQHA 1E1VA 1NXKA 3EHAA 5A9UA 4EH2A 5BQ0A 1ZMUA 4QMZA 3LFCA 3B2WA 2Q0BA 3VS7A 3G6GA 3ZEWA 3ZEPA 3FL5A 3VUDA 4H05A 3T9TA 4BHZA 2WU7A 3K54A 4YNOA 5IKWA 3LLTA 4L45A 3T3UA 3UBDA 3BE9A 3H10A 4DEBA 3U6HA 4WHZA 2QG5A 2XIYA 4NEUA 4JR7A 3D5XA 1ZZLA 2GFSA 4WSYA 4H58A 1XHAA 2PUIA 4PF4A 2Y7JA 1FMOE 3JVRA 3NYXA 3E92A 4X2FA 5L8JA 3W2RA 4HVIA 5DNRA 4RIXB 4G2FA 4PDPA 5ANEA 2WTIA 2IWIA 4DCEA 4QYHA 2RG6A 4GU6A 2QKWB 4IVAA 3T3VA 4BDBA 4A9UA 1APME 4YJOA 4YURA 2OJJA 3UMXA 4YJNA 4IE9A 4FEWA 1JKLA 3U51A 3NWWA 4O86A 4TRLA 4U9AA 4B8MA 4ONAA 3BEGA 4A7CA 4J7BA 2ZV8A 1Q97A 4AF3A 2QR8A 3NYOA 4LV8A 3ZH8A 4AE9A 2OJFE 5HU3A 5CF6A 3DK6A 2OLCA 4CFUA 2ZMDA 4U80A 5CF4A 4O0UA 5M53A 2VNWA 3QWJA 3PXQA 4TYJA 3FI3A 2Z8CA 2IF8A 2O8YA 2RG5A 3ANQA 5ETCA 1XH7A 5AAGA 4AZTA 1GIIA 2Z7SA 5K3YA 4RA5A 2W1FA 3C5IA 5HD7A 1JKSA 4IB5A 4DTKA 3ORIA 4WUNA 5CASA 2JLDA 3FPQA 5ITAA 4O7YA 4DCAA 2C5XA 3TNPC 4D2WA 2O2UA 1I09A 5DR2A 5CAOA 4C7TA 4DLIA 2DS1A 5LMBA 5AUUA 2OSCA 3M11A 3RAHA 1IG1A 5EDQA 3R9OA 4NM3A 5IQDA 2C5VA 2VO7A 4XP2A 2YM4A 4L7SA 4MAOA 5G1XA 4UX9A 4O38A 4BWPA 5DN3A 4L52A 5JSMA 4NTTA 4O81A 4QMLA 4ACGA 4EZ5A 4P4CA 4ZJJA 4YR8A 3ET7A 3PFQA 4BIBA 2GNIA 3UDSA 3U4WA 1UU9A 2G01A 2R3LA 2OJ9A 3EZVA 2ITXA 2XK7A 3MTLA 4FSQA 4FVQA 1Q41A 4K1BA 4IVDA 4LRJA 4MXCA 1PKGA 3W2PA 4AT4A 4I6LA 5B2KA 3FE3A 3ZFXA 4ASXA 2OFVA 2IW6A 3VVHA 5A6OA 2HELA 4C36A 3KRXA 4GUEA 3C51A 4HOKA 4MXOA 4UWYA 3UZPA 2X2KA 3MIAA 5F1ZA 3I6UA 4DGGA 4R3RA 3UC3A 5K5XA 3RJCA 5HKMA 2OO8X 3I6WA 1UKHA 5LMKA 4PNIA 4IM3A 4S33A 5FTQA 3VJNA 2BKKA 4GCJA 2VN9A 4X7QA 4EYJA 2AYPA 4GKIA 1XWSA 3HUCA 1RW8A 2CGWA 3HRFA 3FZPA 4U3YA 4JOAA 4D1ZA 4OAVB 2UW7A 2H34A 3HRBA 4CFXA 3OFMA 4M0YA 4BKYA 2B0QA 3QWKA 3OXIA 4FT0A 1IRKA 1J3HA 1LP4A 4F7NA 4J98A 1SVHA 4C61A 5J79A 3DB6A 4KUJA 2G9XA 4XS2A 2PMIA 3BYSA 4GVAA 4YJQA 5DH3A 1WBSA 3SC1A 4BKJA 5CXZA 3DV3A 5CI6A 1WVXA 2YLEA 4JIAA 3K3IA 4FK6A 4QPSA 4RIWA 3W0NA 3W1FA 4ANNA 4J97A 3PRIA 3BYOA 4MQ1A 3GP0A 1ZY5A 3NCZA 3DZQA 3FMMA 2R3IA 3MPMA 3DK3A 4LUDA 4ZMEA 2DYLA 4RIYA 3MFRA 3DAJA 3R21A 4EH8A 3QGWA 1HCKA 4MEDA 3ZO4A 5HZNA 5HG7A 3E8CA 2VO3A 3AMAA 4L8MA 3IS5A 1W84A 3TJCA 5J5SA 4C3PA 2XAMA 3I4BA 4FKWA 3R9HA 1IAJA 2IG7A 4HVSA 2J0IA 5ANGA 3RVGA 3BWJA 4YUQA 3VJOA 1PXJA 4DHJA 3CKXA 4DITA 1ZYLA 4FSUA 3R7IA 4BGQA 2WQNA 3FBVA 3VBTA 4AW1A 3IW7A 4Z16A 1QCFA 4U43A 3GCSA 2V0DA 5C03A 3NUUA 2RFEA 3DLZA 4OBOA 5D41A 3SQQA 2R3HA 4Q5HA 4TYEA 3H30A 5LARA 2GQRA 2LAVA 5LVNA 2O3PA 3VS2A 5I4NA 3ORXA 4IM0A 3ZSHA 3GEQA 3LW0A 3L1SA 1B38A 3FV8A 2PMNX 3UZTA 4H3QA 5FWKK 3ZLYA 1U54B 5CEOA 1PY5A 4LQMA 3LMGA 1TKIA 3OCBA 5DBXA 3V5PA 1XH4A 2XCHA 2FYSA 5E92A 3TACA 1ERKA 5HTBA 2CLQA 3MBLA 5LVOA 2WMUA 4FTNA 4ARKA 3EB0A 3NDMA 2ZV9A 4UV0A 4DT8A 2HZ0A 5IDNA 2WO6A 5EHLA 4AU8A 4C58A 2WMRA 3Q96A 4ZXTA 4BWXA 4DFYA 4AOIA 2XBAA 4HPUE 4PL5A 4QQCA 4EK4A 3HGKA 4EOKA 1J7UA 5JRSA 1OL1A 4U7ZA 4IAYA 2CPKE 2UW9A 4WKQA 2WNTA 3ZRMA 5LVPA 4O7SA 4UMTA 5I9XA 5M44A 4BICA 4ALWA 3PJ2A 2B9HA 4YO6A 5BVKA 3OVVA 2JKQA 2ETMA 4O21A 4ZTQA 3TTIA 3NVMB 3FWQA 2R7IA 4A06A 4S31A 4TT7A 4HVDA 3F9NA 5FGKA 1K2PA 4O0RA 4YTHA 3UMWA 1DAWA 4KIKA 5EM5A 5ACKA 3F3WA 4ACDA 4IAFA 2BHEA 3A4OX 3F5PA 2DQ7X 2WU6A 3D9VA 3M2WA 4F65A 3VS1A 3IW8A 4ZTMA 4DE4A 3ZDIA 2C5OA 4FV3A 2VTLA 3UC4A 4D9TA 2QOOA 3SLSA 5HHWA 1G8AA 4EOJA 4JL9A 4I5CA 4LGHA 5CQWA 3VRZA 2PVLA 3GC9A 3TJDA 4ZAUA 5L3AA 1TQMA 3AC1A 3R7UA 4FV5A 2WQMA 1PMUA 1OI9A 3IW5A 5EYDA 3O23A 3E93A 1PKDA 4BY9E 4X2KA 2YEXA 5C26A 4DBXA 3KCFA 3TKHA 1VJYA 2AQXA 2UW3A 1OPLA 4QP8A 4FIFA 2BDWA 5D9HA 2PVKA 2UW8A 4J95A 5M08A 3HKOA 4J52A 5HBEA 4B0GA 4FTQA 4TYHA 5HTCA 1M14A 5I3OA 4I22A 2WD1A 4IX3A 4I0RA 5CQUA 1R0EA 4MBLA 4EKKA 4D2SA 4WSQA 1UU7A 4BN1A 1G5SA 3QHRA 4MXAA 3KMUA 3ENMA 3A2CA 4C0TA 2JAMA 3O7LD 5IUGA 2OZAA 3W0QA 3CEKA 3GENA 3KKVA 4FVPA 2PK9A 1UKIA 2GSFA 4DG0E 4PTEA 3MB7A 3CGOA 3BBTB 5CTPA 2FSLX 4KRDA 5AP7A 2XKCA 2ONLA 3EOCA 4I5HA 3QRUA 1O6YA 3QHWA 4BCIA 4DYMA 5GJGA 3DXNA 4ANMA 2BCJA 4UWBA 5HCYA 1CTPE 1H0WA 4FV8A 4XG3A 2YABA 3HECA 1CKIA 2C1AA 3R01A 3C0IA 1PXMA 3G90X 2GPHA 3T8OA 1GJOA 4EOOA 4FZDB 3COKA 3WE4A 4IX4A 2F7ZE 2PVMA 3JY0A 1YXUA 4OTRA 2ITYA 4X2JA 3GU6A 4QTCA 4CQEA 4CG9A 1T46A 4WRGA 2FSTX 2ITOA 3A8WA 3VUKA 2CKQA 3OT8A 4CFMA 3W0RA 4JJRA 4QQJA 1DI8A 3KY2A 2P3GX 2B4SB 3QRTA 3PLSA 1KOAA 4HYUA 4UALA 1GZNA 5L2SA 3SW4A 1W2CA 5J9LA 2BR1A 3POZA 5BMMA 1MQ4A 3MY5A 2HZIA 2PWLA 3OUKA 5C8MA 4F4PA 1AGWA 5CZHA 5DT4A 2OKRA 5IZFA 3BL9A 3DFAA 5KBRA 4FZ7A 4BTMA 3FY2A 2AC3A 3Q4CA 5DLSA 4IAKA 3V3VA 4EK3A 4NK9A 4MD8E 3W0SA 4FTIA 2GMXA 3HMPA 4H36A 5EOLA 4S2ZA 4HYIA 4JLCA 5HI2A 5A14A 5HG8A 2XS0A 4FT3A 4NWMA 4BCMA 3CPBA 3ETAA 3NUNA 4AA4A 5T6KA 3QTSA 3PRFA 5HLNA 2YWVA 3VULA 2J0MB 4UMUA 4BI1A 1NY3A 4O4BB 4PP9A 1Y8YA 5CANA 2Z02A 4ZY6A 4AT3A 3CQEA 3DDQA 3CTQA 1JWHA 4X0MA 3ZUVA 3GFEA 1ND4A 2PVYA 4FT5A 2VTRA 3GQLA 3RKBA 3P79A 3EN7A 4GH2A 4TYIA 3GOPA 2EXCX 4AZEA 4GG5A 4DF3A 3AC4A 4O4DA 3HDMA 2Y6MA 2XNBA 3RPYA 3LJ1A 5CY3A 3TIZA 4IFGA 3JVSA 5B2LA 3ZUTA 4C2WA 3MVMA 1WZYA 3R1YA 2ZB1A 3HRCA 2WEVA 3C4ZA 3BLQA 3FLQA 3MFSA 4F9AA 4CG8A 2XKEA 2VUWA 2W4OA 2WKMA 3ORLA 4O0WA 2R64A 4AA0A 1CDKA 2FO0A 4FNXA 3NUSA 4EH9A 2PL0A 3LPBA 4FKQA 4GUBA 4I6BA 4FV9A 3SW7A 2GHMA 2O63A 4JG7A 3R7EA 3II5A 3JY9A 4AFEA 2CNUA 4CFWA 4NYEA 1H1PA 2UW0A 4C4HA 4FOCA 3DGKA 2VV9A 3OD6X 5DE2A 5TT7A 2XANA 4ITIA 3KXZA 2I0VA 3ALOA 2WMQA 4ZP5A 4F70A 4DFUA 3DBQA 2PVNA 5AAEA 1UV5A 4PPCA 3BI6A 3ML1A 3E63A 5L6WL 2HW6A 2X2MA 4D2PA 1Q61A 5JGDA 2ZMCA 4N70A 4CYIA 2EVAA 4O0SA 4GL9A 5CI7A 5A4QA 3VN9A 1LPUA 5BV3A 1URCA 1OKVA 4G9RA 1U4DA 4O0XA 1J1CA 3LXKA 4QTAA 3AMBA 4YZCA 2BILB 5L6PA 1Q99A 4QD6A 5CLPA 5E90A 4NJ3A 3SX9A 3LAUA 4FZFB 5HIEA 2EXMA 5DRBA 2CNQA 3NCGA 3H9OA 5CSXA 4G31A 4FKIA 4C4EA 4XJ0A 2QO2A 5AUTA 2CNVA 4FGRA 3HVCA 2YAKA 5FQDC 5GNKA 3LCSA 3QRIA 1ZAOA 4RIXA 5FEEA 4TWCA 3GC7A 3FQSA 4N6ZA 3FXWA 4MXYA 3Q5IA 3C4FA 3KK8A 1XKKA 1YI3A 4I93A 4NJDA 4NW5A 2HZNA 5EDPA 4B9DA 1IEPA 2ZAZA 4L67A 5D11A 3QCXA 1Q5KA 2HYYA 4ZTLA 2X8EA 3HNGA 4IANA 3D4QA 3LFAA 2VO0A 5FLFA 5AV4A 3S0OA 4G5JA 3PJ1A 4DEDA 3W10A 3BEAA 2WAJA 5IMXA 4FC0A 4L44A 1OKZA 1PXIA 4YZ9A 4YMJA 2RFDA 3BCEA 4QP2A 1OVEA 5E8SA 1YXSA 2VTNA 3OOGA 1P14A 2BDFA 1BL6A 1GZOA 2WIHA 4PL3A 1JKTA 2GS2A 3EJ1A 4UZHA 5CS6A 3FMJA 3WZKA 5JQ8A 2C0TA 3QLFA 3IOKA 3TDWA 4ZS0A 5HG9A 3K2LA 2GQSA 4BCQA 3PVGA 2C5YA 2GS6A 4QMYA 3JXWA 1R3CA 1ZOGA 1M7NA 5T3QA 4QDVA 2X7FA 4KBAA 4D1XA 2I6LA 4TPTA 4RQKA 4UYAA 4DFZE 4F1MA 2BRHA 4Z3VA 1KOBA 1DI9A 4ZSGA 4RWLA 5I9VA 2AUHA 3W0PA 4FR4A 3BZ3A 2QHMA 3RGFA 1Q8YA 5A54A 4P2KA 5BX0A 4GS6A 3PWYA 3U6IA 2ITPA 5EHYA 3DDPA 3I1AA 2R7BA 1ZARA 3G15A 4QYEA 4KIKB 2JKOA 4QRCA 4ASDA 4C38A 4BBFA 1YDSE 2F2CB 3K5VA 3WF8A 5CT0A 5HLPA 3N4VA 4L43A 1IA8A 2YJSA 2B9JA 1RE8A 4B6LA 4R3PA 3VW8A 2J2IB 3REPA 3D7TB 2E9VA 5IISA 2JITA 4I6HA 4I94A 4RFYA 3RCJA 1AQ1A 1XR1A 3FZRA 3BKBA 3IGOA 3LFFA 3NAXA 4BCOA 5BNJA 1WCCA 5FBNC 2PZRA 4F6UA 3QYZA 4BCJA 2YZLA 2BMCA 3W2CA 1FVRA 5HIBA 3R8UA 2HZ4A 3UIMA 4TTHB 4AN9A 4RSSA 2XEYA 5CAQA 5EQYA 3RPRA 3BWFA 5BVOA 5AX3A 2C6DA 4OBPA 2BFXA 2RFSA 2YM7A 4O6LA 4TYHB 4JX7A 1OPKA 3MI9A