3TXOA

Pkc eta kinase in complex with a naphthyridine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
327
structure length
317
Chain Sequence
DNFEFIRVLGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGICGTPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSLTQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLPIDEGHLPMINQDEFRNFEYVSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Protein kinase C eta type
publication title 2,6-Naphthyridines as potent and selective inhibitors of the novel protein kinase C isozymes.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 317
sequence length 327
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2011-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3txoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3txoA01
5IA4A 2B0QA 2GHGA 4HNFA 3VHKA 3S00A 2CCHA 3LQ5A 2Y0AA 3NAYA 5JKGA 1B6CB 1A06A 2UZEA 3VBQA 4BWPA 2V5QA 2W4JA 4QQCA 5IA2A 2IVTA 2R7IA 2FYSA 3V04A 4R3PA 2H34A 3NW5A 4JJRA 4O6LA 3LMIA 2QHNA 1FMOE 4ZJVA 4DH8A 3L9LA 3HLLA 3K5UA 4EOPA 3NSZA 4U5JA 4AZFA 3I7CA 1Q3WA 3DB6A 3EQIA 4I0SA 3ENMA 4NM3A 5HESA 4F70A 1K2PA 4O7WA 4CNHA 4HPUE 4RX5A 3EN5A 3IPHA 3OFMA 3CCNA 3JVSA 4QP2A 2RG5A 3DU8A 2J2IB 4JBQA 4CT1A 5BVNA 1UU3A 5AR5A 2PVYA 5IUIA 2XKFA 4FZ6A 3W16A 1I44A 5A46A 1OMWA 2UW3A 3FYKX 5HCXA 3KGAA 1TVOA 1KUTA 1J7IA 3POZA 1UU9A 4IX6A 3W8QA 3E8CA 4DBNA 3IW8A 2J0JA 3SDJA 3DBDA 4A9SA 3I60A 4K6ZA 4IB0A 4ANMA 2OF2A 2C6DA 2QR8A 2XEYA 4NEUA 2OZAB 5B7VA 2GQRA 1YHVA 1GIJA 4M12A 4CFNA 4H3BA 2PMOX 2QOFA 2P3GX 4U0IA 2ZV9A 2X8IA 1OL1A 4FTMA 1XBAA 1OKYA 3KVWA 5HG8A 4R7BA 5EM5A 3KULA 5CZHA 3CTQA 4H05A 4UV0A 5DHJA 5G6VA 3ZTXA 4XG6A 2XNMA 2YM8A 3UO6A 1H1PA 4PL4A 2G2HA 2ITVA 2G2FA 2KTYA 2XRUA 3A7JA 2YISA 3F9NA 3G33A 3LJ2A 4S31A 5AR4A 3UTOA 3VWAA 4YJRA 4APPA 4GFGA 1QMZA 3G9LX 3NCGA 5ETCA 4MXCA 4OBQA 4UY9A 1AD5A 3MY5A 4ZJJA 3SG8A 2CLQA 4LL5A 3C4CA 2BHEA 3F69A 4P2KA 4RIYB 3C7QA 3DCVA 4FG8A 5CAQA 2PULA 4XRLA 4FV7A 2PE2A 3CGFA 4O7TA 2VUWA 5F1ZA 3QRUA 4OAUC 3CKXA 4ACHA 4QQTA 3BEGA 2C5YA 3OG7A 1PMEA 4XP3A 4XUFA 2VTRA 1FMKA 1V0OA 4F6UA 4HYSA 3ZMMA 3B8QA 5L2IA 5EM6A 1Q8WA 2JIUA 4TPTA 4EHVA 4JAJA 4EEVA 3AD6A 1JOWB 2H6DA 1UU7A 4HNIA 4GK2A 4QPAA 1Q8YA 4D4VA 5CAOA 5I9VA 4FA2A 5IH4A 3PPJA 3EZRA 4R5SA 2X6DA 3ERKA 2WQBA 4KBKA 3DB8A 4D1SA 1ZYDA 3FBVA 3E3BX 2QKRA 3PPZA 3PY3A 4FUXA 4A9RA 5I3OA 4DTKA 5K5NA 2NO3A 3KN6A 2W5HA 4D5KA 4ZLOA 1NVRA 1CSNA 4EH6A 4XG4A 3TIYA 5AA9A 4IC7A 4TYIA 3O7LD 3WOWA 4F1MA 1V0PA 4HCVA 4HYIA 3PP1A 4U3YA 3LQ3A 4IVBA 4M97A 4JDIA 4NK9A 4ASDA 4KKGA 4FIGA 3EKKA 4FKWA 5GIPE 1QPDA 4TKSA 3V6SA 3D14A 3ORNA 4IWOA 4ZY4A 4C35A 2WMQA 3BX5A 3OT8A 4UXLA 5A3XA 2VTOA 4OTDA 2PZ5A 4J98A 1YWNA 2B52A 1YXVA 3U54A 1NVQA 3AMYA 4D2SA 4D2VA 4DN5A 5LMBA 2O64A 3PSBA 3QCSA 4ONAA 3HV5A 4TYEA 2VX1A 3UC3A 3W2QA 3RPYA 3ZXTA 4DFNA 5I9XA 2RG6A 4YTHA 4LQMA 4GW8A 3LZBA 4IW0A 3ZYAA 5HVJA 5HD4A 1W7HA 4DFLA 3KMMA 5BVKA 3DFAA 2ITWA 3BE2A 3CTHA 2PVJA 4X3FC 4BY9E 4YZ9A 2R3GA 2VTPA 3HMNA 3Q5ZA 3LKMA 4L43A 3EQPA 5E8TA 3IW7A 4UBAA 4O91A 4MK0A 3FMHA 3A8XA 3R2YA 4FV3A 3GQIA 4AA0A 2PHKA 4R7HA 5HI2A 4A7CA 2E9NA 4E6AA 3HL7A 2VO3A 1O6LA 3G5DA 3RAWA 3LJ0A 5BMSA 1A48A 2QG7A 2W1ZA 5DA3A 4FV4A 2C3JA 4CFMA 4BBFA 5C27A 3QA0A 4EZ7A 4I6BA 4FG9A 4NFNA 3VS3A 3ANQA 5AEPA 5EKOA 4AXAA 3IGOA 4C38A 2ETMA 4XCUA 2PUIA 3H30A 4ZSLA 2RFNA 3QBNA 3N4UA 3LFDA 1YI6A 3BPRA 3Q9XA 2VZ6A 5LMKC 4XBUA 2EB2A 2BPMA 3HYHA 4KNBA 3RWPA 2BZKB 2UVYA 4FIJA 4FVQA 4OTPA 2WTVA 2A0CX 3KULB 5AWMA 3TI1A 4K33A 5I9UA 2QOHA 3PXRA 5IEVA 1JQHA 1EH4A 2YM7A 2A19B 4RGJA 4RJ6A 5E4HA 4USEA 1JKKA 4CSVA 1W0XC 1SNUA 3WI6A 4N4SA 5DI1A 3PA4A 5EQYA 4BCOA 4UYAA 3RNYA 3NYNA 4LV8A 3D0EA 2FGIA 1XQZA 4GT5A 2C5VA 3U9NA 3FC1X 4YZCA 4D55A 4OBPA 2PZRA 3F88A 5F20A 2VNYA 3CD3A 3D83A 5A4QA 3Q60A 1P4FA 2A1AB 4X6RA 3FXZA 5HVKA 1UU8A 4FKJA 2VTIA 2VGOA 2W1DA 4DF3A 3ZCLA 4DEDA 5IQDA 4D2PA 2VX0A 4FIHA 1OPLA 3OCSA 3C0HA 5FQDC 4F7LA 1SZMA 5C26A 3HGKA 4DA5A 2ITTA 3I0OA 4EKLA 4OTHA 2DYLA 3DZOA 4Y5HA 3BHVA 2ETRA 5J7BA 3RGFA 2JBPA 3F3UA 4LGGA 4ZAUA 2IW6A 4H1MA 4MVFA 2RFDA 5H8EA 4AA4A 4BZDA 2OICA 5I9YA 3VBYA 4M14A 1ZMWA 2QOBA 4YBKA 4O2ZA 2ZV7A 4I20A 2BAKA 3JR1A 3TN8A 1XKKA 1S9JA 5HZNA 2W17A 2F7XE 4F6SA 3RMFA 2VAGA 4ENYA 2V7OA 3FI4A 1WBTA 1FBNA 2R2PA 2CNVA 2DUVA 3E64A 4YLJA 2KULA 4UN0C 4PDSA 2PSQA 3NPCA 3E3PA 4UEUA 4L53A 3G6GA 3VN9A 2PU8A 3CJFA 5LVPA 4QYEA 5DBXA 4K77A 3COIA 2WTWA 2BDJA 4KABA 3H9FA 4HYHA 2C1BA 3FMNA 4RVMA 5BPYA 2IJMA 5L6PA 4YJSA 1DAYA 4EJ7A 3ZZWA 2P33A 4FI1A 4LM5A 5KHWA 1PXPA 3HA6A 3E8DA 5CX9A 3OUKA 2O3PA 2RGPA 2XP2A 2J51A 2VTJA 4L7FA 2PE0A 3DGKA 3LFSA 3LAUA 4RIWB 1YXTA 5M09A 1PKDA 3CS9A 2OJFE 5EM8A 3R7YA 2XBAA 3DQWA 5HEZA 2BILB 5C1QB 4BDIA 2HZIA 3ODYX 2AC5A 3WZKA 3NMUF 3SGCA 2C4GA 4MNEA 4XOYA 3FKOA 1Z5MA 3MTLA 4I5PA 4YJUA 4FKVA 4KKHA 3P5KA 2R3NA 3D2KA 3PG3A 3WIKA 2Z8CA 4Y8DA 3FXXA 4YSMA 4M66A 2VTHA 3G0EA 2RFSA 4ACMA 4BCKA 4G3FA 4EYJA 4KIOA 4ANOA 2P2IA 3NUUA 3R1YA 1YDRE 2CNUA 1ZMUA 4K1BA 3FMJA 4FSQA 4CYIA 4XV1A 3LLAA 3WIGA 1XH9A 3CC6A 3IKAA 2LAVA 2XUUA 3WF6A 4I5CA 3LCSA 1M17A 2WZJA 4C59A 2X2KA 5AP0A 5CF8A 4HGLA 1BMKA 4IANA 2B9JA 4MBIA 3QC9A 3MPAA 1TKIA 4MQ1A 4QQJA 4DFUA 3LXKA 3IDPA 3VS5A 1U54A 3KRJA 1AQ1A 3FPQA 2XS0A 3BQCA 4KS7A 2CN5A 4DGOA 3HX4A 4PTEA 2ONLA 2EVAA 2WMSA 3QHWA 4KIQA 4MXYA 3BI6A 3BU5A 5FXQA 1GJOA 3PXFA 3TZMA 5HE0A 4EOOA 5I0BA 3VUMA 4DFXE 4HOKA 5E91A 2XKEA 5L4QA 2WIPA 3NVMB 2I1MA 4L8MA 4NW6A 5EM7A 1YXXA 4QMMA 3EQBA 3FLQA 4FSTA 3EJ1A 3KKVA 1SMHA 3PLAE 1R1WA 2UZBA 1OVEA 5AV4A 2BKZA 3BBTB 3RVGA 4XHKB 1H07A 4ZLZA 4O7NA 4BTJA 3WF8A 4TTHB 4FZFB 4RZWA 4ANQA 4BCMA 4F0GA 5LWNA 2XK8A 5DT0A 4H36A 3CTJA 2ZB0A 3PWYA 4NU1A 4QMQA 4A06A 4BDJA 2XK3A 2HYYA 4EOSA 4CFFA 3TZ9A 4DFBA 5AUZA 1IASA 4DITA 2YACA 2WIHA 3EFKA 4K11A 4ZS0A 5HLWA 3U6IA 4BIBA 5KUPA 4JQEA 3TKUA 2VWZA 5KZ0A 3QTIA 3KF4A 2JDTA 3NYXA 4AZVA 4AN3A 4DAWA 3O17A 4E6DA 2CHLA 2J5EA 4QYYA 5HTCA 3KMWA 3R1QA 3BYSA 2XNEA 4M3QA 5EI6A 2YIRA 4M69B 2R3PA 5E1EA 2XMYA 5LVNA 4XX9A 4NUSA 4WRSA 3ALOA 2WMTA 1H26A 2IN6A 4EH4A 1NA7A 4CMOA 3NEWA 3S0OA 4C34A 3TKIA 2QOLA 5HX6A 2X7FA 3PXQA 3FXWA 3GUBA 4I0TA 4PPBA 2GNGA 3HP5A 2OW3A 3QRJA 4I41A 4CD0A 3GC7A 3NAXA 1T46A 1PMVA 4QMLA 2WTCA 3DJ5A 3NR9A 3EFJA 3LOKA 5H8BA 1RJBA 4RIOA 4V0GB 5CANA 3LQ8A 3KRLA 3R63A 4BHZA 2GFSA 3Q4TA 3BWJA 1Y6AA 3OP5A 2W1EA 4P5QA 3ZXZA 3DK6A 4MD9E 4IJ9A 1JKSA 2REIA 3NYVA 4W8EA 3D15A 2YHVA 4RX7A 3UOKA 3WBLA 3DFCB 4TRLA 4E6CA 4MNEB 1WMKA 3ZM4A 1PMNA 4IZ7A 4X3JA 3SQQA 5GNKA 4FTLA 2G2IA 2WQOA 2YDIA 4IQ6A 4G34A 5AM6A 4EOIA 5FEEA 4AZWA 5JZNA 2WMAA 2CLXA 4GSBA 3VUGA 4FT0A 2WEIA 4OTGA 3CR0A 2YJRA 1ZOGA 5IF1A 3AOXA 5AV2A 3QHRA 1Q8UA 4L00A 4XP0A 2OIQA 1FPUA 2Y6OA 3D4QA 3TUCA 4YHJA 4F9CA 3WF5A 3D5UA 3GU7A 4XLIA 3AC5A 3MWUA 4R6VA 3KXZA 3VQHA 5IEXA 5CSWA 2UZWE 5HLPA 2QC6A 3MW1A 4KRCA 1Q4LA 2I0YA 5L2QA 3DAKA 3CEKA 5K4IA 3ID6C 4B8MA 4QMWA 3MVMA 2HY0A 1O9UA 4L42A 4E5BA 3BBWA 4WRGA 2J4ZA 2JKMA 4OTIA 4XLVA 3KCFA 3PE1A 4PV0A 4CFUA 5ANDA 5KMMA 3OWKA 4FL3A 2XIKA 5CSXA 4DLJA 4ZS4A 3QXPA 3H0ZA 4L01A 4TYGA 4Y72A 1AGWA 5HVYA 5DR2A 5AAFA 2C1AA 2C5OA 2CGVA 2XH5A 3GOPA 5DPVA 2H9VA 3RCDA 4DGLC 4I94A 3PJ2A 3GC9A 5GJFA 1SVGA 2V55A 3QQFA 4W9XA 3QKKA 1G5SA 4NJDA 4A4XA 2W0JA 4QYHA 4U81A 3LM5A 4YC8A 3OXZA 1MRYA 2Y8OA 3M1SA 3DTWA 4D2TA 3CIKA 4RJ8A 3PTGA 2J50A 5HICA 4ITHA 4J97A 5JFXA 4F08A 5J8IA 3G51A 3VF9A 2R3JA 4K2RA 5LVLA 3LW0A 2YDJA 4LOPA 3V8SA 2W96B 1WFCA 3C4FA 2Q0NA 4FT5A 3R9DA 4DT9A 2VRXA 2PWLA 5LVOA 5JQ5A 5EYMA 2J5FA 4QTDA 3V5JA 3W2SA 3K3IA 4R77A 2JLDA 4G3EA 4C8BA 5F4NA 2IVUA 3C4ZA 2Y4IC 4RVKA 3VW6A 4U42A 1H25A 4XJ0A 5HKMA 5HE2A 4PTGA 1ZLTA 2XCHA 1RDQE 1ZYLA 4X2JA 5CT0A 4BBEA 2G15A 2JAVA 4RFMA 1Q41A 1O6YA 2XIYA 2XK6A 5F95A 4USDA 1GNGA 4AT5A 2C6EA 4O96A 5EHLA 2NRUA 4MBLA 3FV8A 5CEPA 1DI8A 3RJCA 4EHGA 2PYWA 3TV4A 4RJ7A 3MFSA 5IQCA 2BAJA 4RVLA 4ZTQA 4AF3A 3NVKI 2C69A 3SVVA 2R3KA 4XP2A 4GFOA 3SKCA 3F7ZA 2YAAA 4IXPA 4Y73A 5CF6A 3ORZA 2JITA 3KY2A 2HAKA 3MYGA 3HECA 4YJTA 2BRBA 5JFSA 3MGYA 4WT6A 4JXFA 3GGFA 4UMRA 4HZSA 5HO7A 1UNGA 4I4FA 3EN7A 2P4IA 3OC1A 5LMAA 2F4JA 4X7QA 1IA9A 4F9WA 4G9RA 2ZAZA 2ZM4A 4KIKA 4EH8A 2GS7A 2GTNA 4LOQA 3PJ8A 3QUDA 4MD7E 2X7OA 3H3CA 4U43A 5HBHA 3QL8A 3SG9A 3H0YA 4WO5A 3H4JA 3UVPA 4WNKA 4YO6A 5BMMA 4EOQA 4AAAA 4AT4A 4NM0A 4AFJA 3FMLA 1SYKA 2WTDA 3P0MA 4D2WA 4DH1A 1XH7A 4C3RA 2ZVAA 3QCQA 4BDBA 3NW7A 2J0LA 3IOKA 3NLBA 5AP7A 1A9UA 2C47A 5BYZA 4BTMA 3Q53A 4JDHA 4FSWA 4RQVA 4C02A 4FNYA 3Q52A 4IVDA 4L67A 2WB8A 5E8YA 4CFVA 4WIHA 3GU5A 2QLUA 4YHTA 4F9YA 4G5PA 2WKMA 1Q8ZA 1YXUA 3EL8A 1QPJA 3NZ0A 4FTCA 4UMTA 3Q9ZA 4FK3A 2B9IA 3DKOA 4LRKA 4U44A 5HNGA 1YWVA 3RZBA 4E4XA 3MTFA 4ZJIA 2OXXA 3BRBA 1T45A 4F9AA 3ZSGA 4L68A 5ETIA 5HHWA 2X39A 2XBJA 3DOGA 5E1SA 3HUBA 3KXMA 2IZUA 3NCZA 3W55A 1R3CA 1YW2A 3IOPA 1OPJA 2EXEA 3I81A 2YM3A 4AE9A 3E87A 4DEBA 4DYMA 2GHLA 4CYJA 4YURA 1BI7A 1H4LA 2ITUA 3JS2A 2VWUA 2Z60A 4IWPA 3VBTA 3F82A 4C0TA 3K54A 4OW8A 4GK3A 3V01A 5JGBA 1FINA 4RJ3A 5DR9A 3TUDA 4BCGA 3WE8A 3OCTA 3PZHA 1CKIA 2YIYA 3QQLA 4IVAA 4PP9A 5L6OA 3QUEA 1FVRA 2HZ4A 4L46A 4LRMA 3RK7A 3H9OA 3K2LA 4JIAA 3MVLA 3QX2A 4I0RA 3VJNA 5CENA 1F0QA 4KKEA 4O21A 2CGXA 3AGMA 4Q9ZA 3BYVA 5JN2A 3SV0A 4GYIA 3E88A 4Z7HA 4RIYA 4QNYA 3MH1A 4K8AA 3MVHA 3GB2A 3TUBA 4WUNA 5M08A 3PY0A 4U6RA 4ZSGA 3TNPC 2EB3A 3VW8A 4FV5A 5AIRA 3UQCA 1KSWA 2UW7A 3ORKA 4X2GA 3OEFX 1J7UA 3OUNB 5G1XA 3P9JA 3RPVA 2IVVA 4DBXA 3DK7A 3KA0A 3ZBFA 3D9VA 2YFXA 1Q62A 2CKOA 4YNOA 4C37A 5DNRA 2XZSA 3WILA 5EYCA 3C51A 3VS1A 3W10A 1OL7A 4AN2A 3OROA 3PG1A 1ZRZA 3GQLA 5J5TA 4I3ZA 1KV2A 3QQKA 2PPQA 3DS6A 3KREA 2ACXA 3E8EA 2HELA 1Q3DA 5B2KA 3R8VA 4FKIA 3FLSA 3FPMA 4JBPA 2F57A 2W4KA 5T68A 4HW7A 4CVAA 5JZJA 2PVHA 2E2BA 2Q0BA 2ZM1A 4N70A 5CWZA 4CQGA 2BAQA 4YJVA 5AX9A 2VX3A 2YM5A 5FLFA 1UWJA 2CN8A 4GG5A 2YIWA 2CGUA 1PMUA 1R0PA 1ZZLA 1ATPE 3HVCA 5CF4A 3AGLA 4KBCA 4OAVB 4H1JA 3GCVA 4AFEA 3KMUA 3PSCA 1OBGA 4W4YA 5D7AA 2Z7SA 1GZOA 3DV3A 2IVSA 4PX6A 2XYNA 5E8ZA 4BB4A 2OI4X 4H3QA 4JX7A 3DDQA 4YC3A 3PPKA 4C61A 1U46A 2RSVA 4CKRA 2C0IA 4KSQA 5JK3A 4IEBA 4U97A 3ZFMA 4KRDA 3U6JA 2YLFA 3R8PA 3UGCA 5KX8A 3SLSA 2W1IA 1O6KA 2WMRA 3FE3A 2Z2WA 3BHUA 3EZVA 4M0ZA 1KE6A 3EYGA 4OT6A 4QMUA 3WYYA 3R9NA 3HKOA 5BVWA 1OI9A 4WBOA 2PMIA 3DJ6A 3KRWA 4HVSA 2CKEA 3ORLA 3QTQA 3NIZA 1LEWA 1ZYSA 4BTKA 5IQFA 3ZDUA 2H96A 2WAJA 1VEBA 1XH4A 3DK3A 5FTOA 3ALNA 1P14A 3GXLA 2OJ9A 5KCVA 3V51A 4D4RA 3D7TA 4A9TA 1YDSE 2PVLA 4AW5A 5A4TA 3C4XA 4I5HA 2PVRA 3NNUA 4PDOA 5AUYA 2CKQA 3DLSA 3MH3A 5I9ZA 4O84A 4K18A 3QD3A 4F6WA 2F2UA 2QOIA 2R7BA 4FSMA 4FZ7A 3OS3A 4PPAA 2X81A 4G6OA 4UWBA 5DMZA 1WBWA 4TNBA 4TWOA 4EUTA 1ERKA 1MQBA 1Y6BA 2BIKB 2O0UA 2X4FA 5EQPA 3BLRA 5KMKA 4Y95A 1R78A 3COKA 2VO0A 3QD2B 4FTOA 3R8ZA 2Y7JA 3EYHA 4M68A 5FXSA 4K0YA 4JIKA 1CMKE 4GUBA 3BGPA 4GEOA 4JG6A 2X2LA 4L44A 2V7AA 4FK6A 4L9IA 4NW5A 3BU6A 3CKWA 3REPA 4D28A 1PXOA 1PYXA 1H1WA 3FMMA 4MQ2A 4IAFA 4BCNA 3DXNA 4J96A 4GUEA 5ETFA 3D5VA 5EDRA 5C8MA 3R9OA 1RW8A 2XVDA 4QMZA 4R3CA 2I7QA 1MP8A 3QTWA 2E9UA 4G3CA 4QT1A 1J1CA 4ASXA 2XIZA 3TEIA 4C7TA 2BDFA 2I6LA 2X4ZA 3TACA 5TE0A 3NUSA 5CI7A 4FV9A 3BHYA 3GP0A 4UMUA 2WQEA 3EIDA 2P0CA 4JR7A 4RJ5A 5CEIA 3TTIA 4BDKA 3T9IA 2DWBA 2W9ZB 3IO7A 3Q4ZA 2UZLA 4QMSA 3RINA 3UIXA 3JVRA 4AX8A 2VWXA 4MKCA 1KOBA 5AM7A 3MI9A 4D4SA 1KV1A 1UWHA 3FZPA 2Y4PA 4HCUA 2QNJA 3D2IA 4EK6A 4QP7A 2GFCA 4J71A 5B0XA 4F0IA 3ZRLA 3ZOSA 3BKBA 4B99A 3EQRA 4NWMA 4HGTA 2HWOA 4IE9A 4DH5A 5HU9A 5T3QA 5J9ZA 3GI3A 3FWQA 4RMZA 5KKRC 1KE5A 4GFMA 1FVTA 4AGDA 2B53A 5AAEA 4GU6A 5BVEA 3R28A 3QA8A 2Z7RA 4C4FA 2FVDA 2WTJA 4BKJA 3GFEA 3F5XA 2PZYA 2YCSA 4WBBB 4X6QC 2C6MA 5D11A 4ARKA 5EQEA 4FT3A 3SHEA 4FKRA 4CRLA 4BL1A 4B6LA 1OUYA 4LYNA 4EC8A 3E8NA 1ND4A 5AMNA 4RIWA 2XM8A 4XS2A 3NWWA 3FLYA 1J91A 1W8CA 3SRVA 4BKYA 5IDNA 3Q9YA 2WO6A 3PRIA 5I3RA 4YGAA 2YZLA 5HIBA 2C6OA 3F2AA 4X2FA 4DTAA 4AOIA 5IQIA 4IJPA 5IUHA 3DBEA 4BRXA 4DCAA 4YTFA 4AZSA 4U9AA 2BTRA 4FKQA 4JT3A 1OPKA 3TM0A 4XOZA 3BLHA 5D41A 4YJOA 2UW8A 4GV1A 5HU3A 5JGDA 1DAWA 4QP4A 4ZY6A 3WF9A 4AGUA 2UUEA 1GY3A 5J1WA 5DEYA 2OIDA 4CXAA 4FUYA 5IU2A 3ULIA 4O2PA 4TYHB 3ZLYA 5B2LA 3OY1A 3P08A 3DAEA 4AG8A 4AOTA 3D7TB 4QTEA 2WPAA 4FNWA 3E7OA 3WARA 4R5YA 1K3AA 2XNBA 3DT1A 4JI9A 5HNIX 2UW9A 3TNHA 2OFUA 1PXKA 5IISA 3QTXA 3RP9A 3M42A 1JKTA 1VR2A 2C6TA 4YJNA 4U80A 3U4WA 2BR1A 4PP7A 3FQHA 3RPOA 4YMJA 1PXLA 3OOGA 4GL9A 4BZNA 1UKHA 5IH5A 3E5AA 2QKWB 5DH3A 2OJJA 3QRTA 4APCA 3R02A 4J95A 4BR3A 2JIVA 3H10A 4EI4A 4XV9A 1M7QA 3IW6A 5DR6A 3TJDA 3UPXA 3VC4A 4C57A 2ITNA 3UQGA 4PRJA 2YITA 4BI0A 5JT2A 4ALUA 2UZTA 3TDWA 4YZNA 5KBQA 3QD4A 5EG3A 2JDOA 3O7LB 1JAMA 4YPSA 5ANOA 1OL2A 4IM3A 5AUUA 4ERWA 4HVDA 4ZP5A 4Y46A 3A2CA 3ZM9A 2NRYA 4JX3A 4JBVA 3DLZA 2ZJWA 3ACKA 2HW6A 4U7ZA 5IUGA 3ZO4A 3BELA 3FY2A 3UOJA 2ZV2A 4ERKA 3W2OA 2VNWA 1NVSA 2WU6A 4R1YA 5AAGA 4UMPA 4R1VA 2XNGA 3TL8A 3UODA 5FRIA 4F1OA 1JWHA 4N6ZA 4RFZA 3U8WA 3MY0A 1KOAA 3O8TA 5DT4A 2R3IA 3PXKA 4M69A 1JSUA 5TR6A 4DEAA 4E93A 4EQCA 1YI3A 5KNJA 5AP5A 2P2HA 4QMVA 2YIXA 4YZBA 5AIKA 5HG5A 3ZUVA 3SA0A 3PIZA 4YP8A 2EWAA 3DNEA 4PNKA 1GAGA 3FJQE 3DZQA 3CQUA 2VO7A 4XG3A 4NM7A 4C4GA 3QYWA 3AMBA 4R78A 1H0WA 4FZDB 4CV9A 1YWRA 2VU3A 3VS6A 5AP4A 3D7ZA 4V0GA 3HUCA 2YAKA 4EYMA 3EQFA 1BL7A 3PY1A 3KN5A 3FEGA 2GNLA 4OR5A 4GVJA 2W7XA 4C3FA 5IA0A 2B1PA 4FV8A 3V8WA 2R3HA 3SRVB 2VD5A 3HAVA 4RPVA 2VTNA 2W1CA 4GMYA 1SVHA 4QP6A 4U8ZA 4BIDA 4FTAA 4WKQA 4ZTHA 5M51A 1NXKA 1Q5KA 3OBGA 3OW4A 2QQ7A 1JVPP 3HP2A 5KE0A 4IIRA 4Q9SA 5DEWA 1XH6A 2OIBA 3P79A 4KB8A 5HO6A 4GH2A 4RA4A 3WE4A 4ASEA 4MF1A 2QOQA 4I23A 4BI2A 5EI8A 5CT7A 2R3LA 4CQEA 5LCKA 5A4CA 5M07A 4EZ5A 2OGVA 3G0FA 3R7GA 4FTTA 3KVXA 5H9BA 4TZRA 3RI1A 2UZDA 4RQKA 5L8LA 3DXQA 2A2AA 5AUXA 4C2VA 3FQSA 4LUDA 5DVRA 4OLIA 5EDQA 3R83A 4J8MA 2XEZA 5M4UA 2C0TA 5IDPA 3PSDA 2R9SA 3NYOA 4EQMA 5AR7A 4XH6A 4QYGA 3UIUA 4EOLA 2IWIA 3PFQA 2OKRA 3P1AA 4TWCA 3KQ7A 4UWCA 4XG2A 3F7WA 1WAKA 4Q5HA 3QLFA 4YZMA 5KMJA 3R01A 2OO8X 2LGCA 4PQNA 3R21A 1KE9A 4HGSA 2R3FA 2WFYA 4C4IA 4FKSA 4W4VA 3OWPA 3LPBA 3PP0A 4FEXA 3R7UA 3G2FA 2B55A 4F1TA 4A9YA 3W2PA 2YA9A 2R5TA 2WU7A 3GCPA 4RVTA 2PVMA 4I93A 3OF0A 1F3MC 5AR2A 1IAHA 3U6HA 4MF0A 4E6QA 3DAJA 2YWVA 4BN1A 5DGZA 1W82A 3ZSHA 5AP3A 5J7HA 2XJ0A 5AR8A 3MFUA 1JNKA 4DTBA 4OTWA 3DY7A 3F2NA 2HOGA 2JKOA 1ZAOA 2ONLC 4QTBA 3VS4A 3R9RA 3CQWA 3OCGA 3ZEPA 4CKIA 5HTIA 2FA2A 4DCEA 3OWLA 2FSTX 5C01A 3O0GA 4X21A 4AW2A 4LOOA 1WBOA 4BDCA 4Y83A 3A61A 4XYFA 4X2KA 5L3AA 4BYJA 3P4KA 3L9MA 3BHHA 1XWSA 4UZDA 3U4UA 2ETKA 2WHBA 2QHMA 2UZVA 2OJGA 3Q04A 4HJOA 4DH7A 3DTCA 4TL0A 4JG7A 5CU2A 4K9YA 5HE1A 1M2QA 5DIAA 3V5QA 2QU6A 3N4VA 4PMTA 3RM7A 4YJPA 1NT2A 4FV2A 4BWXA 2ZYBA 2WNTA 3RCJA 1REJA 2JAMA 3JY9A 3CE3A 3O96A 3WF7A 4AP7A 4G9CA 1YOJA 4MEDA 4QTCA 3FYJX 4O81A 4JQ7A 4HVHA 2X2MA 4G31A 4AZTA 3QZFA 3FI2A 2BALA 4GG7A 4JBOA 5M57A 5DE2A 3F5UA 3F3TA 3EL7A 4FGBA 3PVUA 4QP9A 3CPCA 3VUDA 3Q6UA 5L6WL 4L52A 3VHEA 3NUAA 4EH3A 3AC1A 4H58A 3UNKA 5J1VA 1OM1A 1WBSA 3EN4A 3MPTA 3VRYA 5IQEA 2QODA 3UYSA 4F99A 4GU9A 2EUFB 4FL1A 4FZAB 4C4JA 4FF8A 2OG8A 1GZNA 3AMAA 3NIEA 4IB1A 5A4LA 3I5NA 5C8KA 3I6UA 3R71A 4DLIA 1OIRA 2PE1A 2PVFA 3EQHA 3RAKA 5M4CA 3IDBA 4MBJA 3GU8A 4FTUA 4D5HA 2UZOA 4WHZA 3CLYA 1OIQA 4TNDA 4A9UA 4V01A 1OGUA 5HBJA 4AS0A 1GIIA 4O0YA 2DQ7X 3E92A 5GHVA 5JQ8A 5CF5A 3TXOA 1QPCA 3MJ1A 4XV3A 3HV4A 2HIWA 2QOCA 3FHIA 3UP7A 4BDFA 2C3LA 3LFQA 5A4EA 1IR3A 4BC6A 1YOLA 4FIEA 4IM0A 4M8TA 2EXCX 3ZRKA 3O50A 1FGKA 2ITZA 3W2CA 2W4OA 4UWYA 3MJ2A 3HMPA 2ESMA 4HCTA 2WOTA 3E7VA 4RZVA 4ZMEA 4MWIA 4LL0A 3LJ1A 5L8KA 3ORMA 5CNNA 1U59A 3UPZA 3CJGA 3HAMA 2HW7A 3FI3A 1OIUA 3NDMA 4E5AX 3ZDIA 5CI6A 1SNXA 1JLUE 3VS7A 3DDPA 4IAZA 4RIXB 4QPSA 5ACBC 5LVMA 1FGIA 4B8LA 2ZMCA 1Q8TA 3P86A 4CV8A 1H00A 3MA6A 2R0IA 4QO9A 4BDHA 4FTIA 5M55A 3B2TA 2GU8A 2VGPA 3Q3BA 4TN6A 4D0XA 4G5JA 4KBAA 3QRIA 1OECA 5J87A 2XKDA 3JXWA 5KMNA 4M13A 3A7GA 4RWKA 3OT3A 5L2SA 3E62A 2CDZA 3FL5A 2B4SB 5L2TA 3N4TA 3HZTA 4DG2E 4G2FA 4NCTA 3SW4A 4P7EA 5DWRA 2YCQA 4GK4A 3DQXA 3V8TA 2XM9A 4BCIA 3NGAA 1ZOEA 4O83A 3FSKA 3QZHA 2YN8A 4S34A 5DFPA 5IQGA 4KUJA 3UYTA 4CRSA 3PVWA 5K4JA 5CXZA 3Q96A 3IQ7A 3TG1A 4E8AA 2UZUE 5DYJA 4BCHA 4D9TA 5CVFA 4LMUA 4XG8A 3UVRA 5AADA 5F9EA 2EXMA 3C5UA 2FSLX 5IMEA 4FKPA 4RSSA 1H27A 3Q4UA 4TY1A 5DN3A 5AV1A 4ZZOA 4ZK5A 3DA6A 3QTUA 5FM3A 5JFWA 3OEZA 1LUFA 4AUAA 5BVDA 4FE2A 5FP5A 4AQCA 1E1VA 5AFVA 3P7BA 5E8VA 1ZYJA 4IVCA 5E8WA 4A07A 4CKJA 1ZWSA 4JDKA 4BCFA 4O0VA 4GKIA 2BDWA 3U87A 4AW1A 3ROCA 3HRBA 3ZO3A 3HDNA 3KU2A 5EH0A 4CLIA 3R7EA 3PVBA 1M2PA 2WOUA 4MHAA 4EORA 3ATSA 5GJGA 3ZUTA 3W33A 5CU4A 4O6EA 3MA3A 4EK4A 1OKZA 5JEBA 1VYWA 2CSNA 5DG5A 4ZTLA 3LFFA 3W8LA 2WTKC 1H28A 3ZHPC 3M11A 4DG0E 5ACKA 4QMTA 1PXIA 3AC3A 3BEAA 4AN9A 3F2RA 4M0YA 4U79A 3HRFA 3T3VA 4YTCA 2F7EE 1Q24A 3OXTA 2O65A 3I0QA 4D9UA 4RFYA 4IAAA 4BFMA 1IAJA 2C6LA 3KRXA 4FL2A 2JEDA 5BQ0A 4CLJA 3ULZA 2VTAA 4ZEGA 1WVYA 3W32A 5GZAA 3ZUUA 2JKKA 3QF9A 2YEXA 4LFIA 4FKTA 5HIDA 2XIXA 4UB7A 1PYEA 3ZC5A 2O8YA 3R9HA 4ACCA 3LCOA 4ID7A 2XNNA 5JMSA 4FV6A 4I5MA 3A7FA 3QAME 5GZ8A 5FDXA 4E4MA 2IO6A 3RKBA 3SXRA 3ORIA 1CM8A 4O7ZA 1XO2B 2PK9A 3KXGA 2G9XA 2GS2A 2UV2A 5D12A 3R8MA 1BLXA 2CPKE 1BUHA 2J0KA 4YUQA 4EKKA 2G01A 4M67A 4ACGA 4Q2AA 4AZEA 4ANBA 1DM2A 5DOSA 3IGGA 4RG0A 4BTFA 3ZLXA 1BI8A 1W98A 1YHWA 3DKGA 3IDCA 3L8SA 5FGKA 3RK5A 4O7LA 1X8BA 3G90X 3W1FA 1B38A 1Q61A 1G3NA 4BF2A 3ZO2A 1H8FA 4W4XA 4S32A 4IB5A 4RX8A 5AP2A 4NKAA 4IDTA 4RWLA 4ZIMA 3RTPA 5EFQA 3Q32A 4I4EA 1G8AA 3AQVA 2OH4A 2ZV8A 1OUKA 2F2CB 2GSFA 3MH0A 3TCPA 4KINA 5FWKK 4IC8A 3ZLWA 2I0VA 5CY3A 1K9AA 5JH6A 4IMYA 5HNBA 3VRZA 3R7IA 3OXIA 3GC8A 5C4LA 3V5PA 3RK9A 5JSMA 1XJDA 5K3YA 1KE8A 2XNOA 2B54A 4BDDA 3QFVA 2Y4IB 2VO6A 4ZTRA 4O7VA 4Z55A 4FSZA 3C9WA 1XHAA 3WZUA 4PY1A 5IQBA 2JD5A 1OB3A 4Q5EA 2GCDA 5K5XA 5C4KA 3NUPA 3QYZA 4IFCA 2F7ZE 3MB7A 3OY3A 4JR3A 3I5ZA 3G15A 4PTCA 3FLWA 4MXZA 4BGHA 2YDKA 4MXOA 3MB6A 4EK3A 5ANEA 5H8GA 5BNJA 5JGAA 2JDSA 4TYJA 4IADA 2YCFA 3I1AA 2ZM3A 3R73A 4FEQA 5A6OA 3GFWA 3UNJA 4WNPA 3G9NA 5IG1A 5JRQA 2IPXA 3UP2A 1L8TA 2GQSA 3F3ZA 4U40A 3I7BA 1BX6A 2YJSA 3FMEA 2X6EA 3LHJA 5TKDA 3FZ1A 3G6HA 4AOJA 4DT8A 2UW0A 4FBXA 4FVRA 5AX3A 1CTPE 2ITOA 4RJ4A 1URCA 4FGRA 4ALVA 3P7CA 4DH3A 2J0IA 1PY5A 4D58A 4MYGA 3RALA 3FUPA 1LPUA 3V3VA 4TXCA 5BUEA 5CQWA 1S9IA 2QD9A 3ETAA 3FY0A 4FKGA 4II5A 3BYOA 1CDKA 5FM2A 4DFYA 1PXMA 2YWPA 4LUEA 2C6IA 3FZSA 2BZJA 3UIBA 4KAOA 4QMYA 1GZKA 4FTNA 5TOZA 4E4LA 4JQ8A 5KHXA 3MFTA 3Q6WA 4ZLYA 1QL6A 3KL8A 1CKJA 3RAIA 3MH2A 5D1JA 5IEYA 4FSNA 3V5LA 3ENHA 3ITZA 2VWYA 3Q5IA 4PWNA 4ZXTA 4J8NA 3ZRMA 3EQDA 2VTSA 3UBDA 5LJJA 4H3PA 4KA3A 2QOKA 3RPSA 3L1SA 5BYYA 5CEKA 3FC2A 5EKNA 2QOOA 1IG1A 3HMMA 2I0EA 2W1GA 3BYUA 1H01A 3RHXA 4N57A 5FTGA 4ZMFA 1Y91A 2OWBA 4FNXA 4O0SA 4RT7A 4QP3A 2RL5A 4D0WA 5CZIA 2WMXA 2XYUA 3F3WA 3E93A 3B8RA 3IK3A 3WZEA 1Z57A 4ITIA 4IDVA 4FSRA 5FXRA 3OCBA 3ORTA 3NX8A 4D4YA 5ETAA 3WZJA 4CEGA 3NUNA 3L9NA 4GCJA 3TWJA 1I09A 4OTRA 4DEIA 3C0IA 3WZDA 3TV6A 5E8UA 1W83A 3UNZA 4G17A 3ZONA 4JRNA 3QCXA 3AXWA 2W5BA 4R8QA 3TDVA 5E92A 5IH6A 2WGJA 4IH8A 3EQCA 3EFLA 3C13A 3FL4A 4ZSJA 4JRVA 4IZYA 4TYHA 4NIFB 3MS9A 2R64A 3PXZA 4MXXA 4J7BA 3U55A 1J1BA 3FZRA 3KC3A 5EYKA 3ZFYA 4ANLA 3N9XA 3Q2MA 5AP1A 3F66A 5CVGA 1KWPA 2X8DA 4OBOA 5DRDA 4EJNA 3GCSA 4O7SA 1Q99A 5J9YA 4EUUA 1PRYA 2PMLX 5DLSA 4UMQA 4WOVA 3TT0A 2X8EA 3BYMA 3TTJA 3FLNC 3DBFA 4EBVA 5M4IA 3PWDA 4FNZA 3M2WA 5FP6A 1WBNA 4H39A 5K0KA 2UW6A 3SC1A 3GU4A 2GS6A 3VUKA 3NW6A 4O27B 5CEOA 3PA5A 2PZIA 3PJCA 4IHPA 5CU0A 3Q2JA 2OSCA 4UX9A 2UVZA 1GOLA 3GEQA 3GENA 3HNGA 5HGIA 5CEQA 5K9IA 3UO5A 3U9CA 4C4EA 2PMNX 4O86A 2Z02A 5DT3A 3IS5A 3CP9A 4OUCA 4BICA 2NNWB 2W9FB 2ITYA 5KMLA 4O82A 4IWQA 5C03A 3DPKA 4ANSA 4DC2A 4IX3A 3LXPA 3RZFA 4EK8A 2WMUA 2IZRA 4B7TA 3PVGA 4J1RA 3ATTA 2C6KA 4Y5QA 3UQFA 3GC0A 2WMBA 2EU9A 3PYYA 2Y6MA 2BVAA 1ZMVA 4QRCA 4O7RA 4OGRA 5IA1A 1M2RA 2VN9A 1OKVA 4IACA 4ANNA 4Z9LA 5HG7A 4BGGA 3R7VA 5FG8A 4EOKA 4F4PA 4CG8A 3HV6A 4BHNA 3C4EA 3EQGA 3GVUA 1CKPA 3NNWA 3R8LA 4FG7A 2R4BA 4FODA 2XCKA 4IBMA 4JOAA 3ZS5A 4PMSA 1NW1A 4FEWA 1UV5A 2R3QA 2GDOA 5HQ0A 1JBPE 3S4QA 3T9TA 3S1HA 5K0XA 1PHKA 2HZNA 3RHKA 3BIZA 2O5KA 3JYAA 4AU8A 4BBMA 4QMOA 4YJQA 4YTIA 4YLLA 4LG4A 3LFAA 2O63A 4EOJA 4GIHA 2NPQA 1OL6A 1TQMA 4C62A 2BRGA 4I22A 2BRMA 5LQFA 2A27A 4BDEA 5ICPA 4XG7A 1QPEA 3PE2A 2X7GA 3QGYA 4FMQA 3GU6A 2JKQA 4BYIA 3QC4A 5EK7A 3UZPA 2WEVA 1MRVA 4C58A 5A9UA 4DEGA 4X3FA 1VJYA 4CMUA 1YHSA 3O8PA 1YRPA 4FX3A 3VQUA 2QONA 3O8UA 3I6WA 3TNWA 3VUHA 3VUTA 4DGNA 2BZIB 5CTPA 4C36A 4E3CA 1JKLA 4GRBA 1OL5A 4BVUA 1J7LA 3SXSA 4FKUA 1YOMA 3QGWA 3IECA 4I24A 2C0OA 4HVIA 3ROYA 1HCKA 1XH8A 2WTIA 3HA8A 4QP8A 4ZTMA 4O0WA 2ZOQA 2VTLA 2AYPA 2ERKA 5AV3A 4QPMA 3TIZA 3SAYA 4QQ5A 4FSUA 3PJ1A 4CTBA 3QTRA 4L45A 3IW4A 2HY81 3FMDA 3RM6A 5FD2A 4BI1A 3F5PA 3HV7A 5D7VA 5CS6A 4F7JA 2YERA 5LMKA 2IW8A 4KIPA 4HYUA 5CVHA 4WG5A 3NRMA 3ZC6A 1E1XA 4YR8A 4O7YA 5CNOA 2WMWA 2JDRA 2F9GA 2GQGA 2I40A 4MWHA 5L8JA 1UA2A 1L3RE 2VWVA 2CJMA 2OH0E 3GBZA 5E8SA 2ERZE 1R39A 2PZPA 2GTMA 3FDNA 3KEXA 2G1TA 5J9LA 4Z7GA 4GIIA 3S3IA 2J0MB 4O38A 3KXXA 2IW9A 4GKHA 4E4NA 4F09A 5TT7A 2QVSE 1VYZA 2HXQA 4X0MA 4JVGA 4S2ZA 5CEMA 3C50A 3R00A 3BWFA 5FUTA 5JRSA 2R0UA 4IM2A 1JPAA 3CY2A 5H2UA 4CZTA 4DEHA 4I6QA 1H0VA 1SVEA 3BV3A 2R3OA 3CPBA 5AUVA 1E9HA 3I79A 3ET7A 1WVWA 3POOA 4V05A 5I5ZA 1U5QA 3TZ7A 2SRCA 4YSJA 3UOLA 3IW5A 3ORXA 4DE4A 2W1HA 1ZZ2A 4CZYB 3F3VA 5LWMA 2E9PA 4PDYA 2RF9A 4EONA 5I9WA 2IZSA 2JFMA 2BFYA 4ZZMA 3KK9A 3QWKA 4CTCA 2AC3A 3EWHA 4FIFA 1Y57A 4NTTA 3D5XA 4WSQA 1WZYA 2X0GA 3KCKA 3ZLSA 1UKIA 3OWJA 4ZSAA 2YABA 4QMNA 3A7IA 4C4HA 1DI9A 4BCPA 1Y8GA 3V5WA 5KMOA 4XV2A 2BIYA 3NUXA 4EWQA 3PXYA 2C3IB 3K5VA 3FI8A 2VTMA 5IA5A 5KKRB 3EB0A 4B4LA 4PL5A 4X2NA 4GYGA 5M44A 2I0HA 4FEUA 2QG5A 4O1PA 4G6NA 2OXDA 3ZZEA 3E63A 3BE9A 2CGWA 3FMKA 4TT7A 4KD1A 3NNXA 4F7SA 4FYOA 5E7RA 1PXNA 3EHAA 3QQHA 2J9MA 3GT8A 4CT2A 2OJIA 5ANGA 4IAKA 2UW5A 3VULA 3OD6X 4F64A 5M06A 3ANRA 1J3HA 3CSVA 3LLTA 1LP4A 3RNIA 3EFWA 2YIQA 2FO0A 2PVKA 5HX8A 2V62A 3HV3A 3FKLA 5F94A 4AE6A 3SW7A 2R3MA 3QUPA 4ENXA 3VBXA 3MFRA 5A14A 5LXMA 4X3FB 4IX4A 4W8DA 4GS6A 4S30A 3LFCA 4LGHA 4GJ3A 4W9WA 5D9HA 2AUHA 3L8VA 1YKRA 2JGZA 4FC0A 4G3DA 1VZOA 4NTSA 2OU7A 4FSYA 3UIMA 2NP8A 1R0EA 3DBQA 3BU3A 3L8XA 3Q9WA 4GT4A 3R8UA 4DGGA 3UG2A 3SD0A 2W05A 5LCJA 2GNHA 4W4WA 5E90A 4EHZA 4AW0A 4DEEA 3MIYA 1H24A 1SM2A 3RBWA 3DBCA 3AC8A 5JFVA 4PMMA 4EH2A 3QXOA 5M53A 3ACJA 4DFZE 3PDTA 3WYXA 4CCUA 3MY1A 4DGMA 3OOMA 2UW4A 3QKMA 4KSPA 3MDYA 3ZU7A 4BZOA 1BL6A 4N0SA 5HTBA 4LV5A 5M4FA 4NYEA 1YXSA 5C8NA 4RC4A 4GT3A 4I1ZA 1XBBA 4M84A 2OFVA 4E7WA 2YZAA 5KMIA 4IZ5A 4YO4A 4UYNA 4PPCA 3ZBXA 1Q97A 2HWPA 5CAVA 5IMXA 4BWKA 1ZY4A 4JL9A 5M56A 1V0BA 4G3GA 4NL0A 4LGDA 2BRNA 3BQRA 1PXJA 4WNMA 1H1QA 4EH9A 4F9BA 5FEQA 3CXWA 4NKSA 3C1XA 1M14A 3EKNA 5C9CA 4QMPA 3S2PA 2B7AA 4I21A 3AC4A 2WMVA 4Z3VA 2E9OA 2CKPA 2XB7A 5H3QA 3O71A 2W5AA 1V1KA 3VAPA 3OBJA 4RIXA 2FUMA 1WBPA 2F49A 5CAPA 5KBRA 2BKKA 1UNHA 3MSSA 4USFA 4JG8A 2Y9QA 3BGQA 4A4OA 5EOBA 1YVJA 1ZARA 3CY3A 3A60A 3AT2A 4WA9A 3LFEA 1WVXA 3SXFA 5CASA 4WSYA 4AA5A 5T6KA 2Q83A 4J52A 2C30A 4B9DA 1ZY5A 4IAIA 3FQEA 4JDJA 1MUOA 4ZOGA 2JC6A 3AT3A 2P55A 4DINA 2XK9A 5AA8A 5HOAA 4P90A 1IA8A 4BCJA 1MQ4A 3I4BA 2ZB1A 4GVAA 4RC3A 3LE6A 3SOAA 4ALWA 4RA5A 4D1XA 4FKOA 1OITA 3QALE 3HMOA 3AG9A 1GZ8A 3R2BA 1LR4A 5HCYA 3R7OA 4I6HA 4IB3A 3A4PA 4DG3E 5HCZA 4F7NA 3FLZA 2XJ1A 2FH9A 5AV0A 1B39A 2ZDUA 5E8XA 3PA3A 5LOHA 2XK7A 1UVRA 2QO7A 2R3RA 4JLCA 4MH7A 3UMXA 2FB8A 4MCVA 4F65A 1TQIA 4PNIA 3BHTA 4YNEA 2OK1A 4C3PA 4L6QA 4KWPA 3LVPA 4CZUA 2FSMX 4YPDA 3OMVA 4BDGA 2J7TA 3EH9A 4QP1A 4NZWB 3MV5A 2B9FA 3R0TA 2GNIA 2QI8A 4MD8E 1H1RA 3GOKA 5FTQA 2BHHA 5TF9A 3MVJA 4UXQA 2HK5A 3MESA 4CG9A 3OHTA 5AJQA 3ORPA 3QCYA 3R1NA 1M52A 4L3JA 2PUNA 3C4WA 5J5SA 3JUHA 2YM6A 4QMXA 3NS9A 4Z16A 2UVXA 3C0GA 4CCBA 5I4NA 5IQAA 2IZTA 4AGWA 5KZIA 3VNTA 3CBLA 4XEYA 3OZ6A 3PUPA 4JNWA 5GZ9A 3TNIA 3UG1A 5BX0A 2GNJA 4FT7A 1REKA 5HLNA 4MAOA 3KXHA 3PJ3A 4OT5A 3PZEA 3A62A 4EQUA 3QQJA 5D10A 2VV9A 4MNFA 3CD8A 1WCCA 2GHMA 4YC6A 5ANJA 1Z9XA 5HIEA 2Z7LA 3THBA 2OBJA 2HENA 3UMWA 5KO1A 4HZRA 3MIAA 4M7IA 4IFGA 5EYDA 4EHEA 1F5QA 4R3RA 5HORA 2ZDTA 3L8PA 4QD6A 2WQNA 3QZIA 2YCRA 4EL9A 4XRJA 3W2RA 3R30A 4ZSEA 2XA4A 3VJOA 1U5RA 2OLCA 2HXLA 3LXNA 3BZ3A 3R6XA 4FVPA 4HGEA 3RWQA 4FT9A 4EZ3A 1HCLA 5FBNC 3LCKA 2C3KA 4I92A 4B0GA 2CMWA 3LFNA 2BCJA 3DKFA 4FYNA 5CU6A 2CNQA 5CYIA 3UDBA 3FZTA 3P7AA 4RLLA 2C5NA 3TKHA 1H08A 3TNQB 4JAIA 5ITAA 5GIOE 4O0UA 4EK5A 3VBVA 1STCE 1OZ1A 1OBDA 2JIIA 3NNVA 2V22A 4J53A 2BRHA 1G8SA 1WBVA 2RKUA 4OTQA 2C68A 5AUWA 1U54B 4FV0A 1APME 3R04A 4O0TA 3HDMA 4O1OA 4FKLA 5CSPA 1QCFA 2BMCA 4BKZA 4FTKA 3K3JA 5HBEA 2QO2A 4ACDA 4C2WA 1XR1A 2J90A 4L3LA 5DRBA 2X9FA 4FICA 3DNDA 5E9EA 2YM4A 5FBOA 1H1SA 3OTVA 3V6RA 4BIEA 4UALA 4EH7A 5CLPA 3QRKA 4XBRA 3PLSA 3P23A 5HE3A 3UZTA 4A4LA 2X1NA 4E26A 3COHA 2PUPA 4FEVA 4NT4A 3UE4A 2QURA 5FEDA 4LI5A 1P4OA 2DS1A 3GNIB 2XRWA 4UZHA 5BUIA 2QO9A 5EW8A 2PVNA 4HPTE 4M15A 4PDPA 3FZOA 1KE7A 5CQUA 1ZOHA 5AUTA 3KK8A 1MRUA 1M7NA 3PIYA 3II5A 3EMGA 3T8OA 4BCQA 2CCIA 2XNPA 3FSFA 2BROA 4MXAA 4QOXA 4AWIA 4RX9A 4NCTC 1PJKA 4LMNA 3AT4A 4S33A 2PTKA 3MBLA 2WELA 3AC2A 3UZRA 4PL3A 1FOTA 1Y8YA 1W84A 3F5GA 4G16A 2X9EA 4WG3A 4CFWA 4YZDA 3A4OX 3L9PA 3GCUA 2PY3A 4XMOA 4V04A 2W1FA 4QNAA 1HOWA 2W06A 3KFAA 3OW3A 3ZFXA 4EOMA 4D1ZA 1TQPA 2QLQA 2VWWA 4EC9A 5BVFA 3LMHA 2ITPA 3DXPA 4IZAA 2GMXA 2RIOA 4JS8A 2O2UA 3CGOA 4LRJA 4FOCA 2JFLA 4EBWA 5TO8A 5GINE 3UVQA 3SX9A 4E5WA 5IKWA 4GJ2A 4R7IA 3LIJA 4PMPA 2RFEA 4E1ZA 2XF0A 1PF8A 2OXYA 5L2WA 3AD5A 2ITQA 3HRCA 3R1SA 4FIIA 5EHYA 5EOLA 3A99A 5HO8A 3VUIA 3FKNA 4OTFA 5EHOA 1ZXEA 4RC2A 3KB7A 1RE8A 5ANKA 4BGQA 4CGAA 2WD1A 4TWPA 4NJ3A 5B2MA 4NSTA 3LMGA 4P4CA 1LEZA 3T3UA 1P5EA 2JDVA 3QX4A 1DS5A 3CQEA 2BFXA 1BYGA 5J95A 5AP6A 2H8HA 2GPHA 4WG4A 1IRKA 2B9HA 3JY0A 2E9VA 2GNFA 1GIHA 4IX5A 1YI4A 2HZ0A 3PIXA 1NY3A 2OF4A 3F6XA 4FV1A 4BDAA 4ZZNA 1PW2A 1IEPA 3LM0A 3TV7A 2HCKA 3MPMA 1XBCA 4WUAA 4FTJA 4KS8A 1FVVA 4TW9A 5CALA 3TZ8A 3O51A 3LCTA 1RQQA 4NIFA 2W99B 4XG9A 5EW3A 2WXVA 1OKWA 2VTTA 1URWA 4CMTA 4DHFA 4C33A 2XJ2A 3O23A 3H9RA 3QQGA 3EOCA 4F63A 5BVOA 2BZHB 4NH1A 4G6LA 4RLKA 1OIYA 2VWBA 4EH5A 3ZH8A 3HMIA 3PRFA 3KRRA 5AR3A 4F0FA 4FR4A 4ZY5A 5BYLA 1JSTA 1JSVA 4WD5A 4I6FA 3ZSIA 2QR7A 3IG7A 4TWNA 1FQ1B 5HG9A 3BV2A 3AD4A 4L3PA 4NM5A 1YDTE 2YLEA 3GCQA 4RRVA 2Z7QA 5CSHA 5EDPA 3B2WA 2UZNA 4O0XA 1P2AA 4FOBA 3U51A 4AACA 4ZTSA 5J79A 2PUUA 4WNOA 3IONA 4J99A 4U41A 4NFMA 2A4LA 4PF4A 4Y85A 4E20A 5IZFA 3MN3A 4G1WA 3N51A 4ITJA 4U3ZA 3QD0A 4ZTNA 5FDPA 4YBJA 1ZYCA 2OZAA 2ITXA 3COMA 3QZGA 5IPJA 1U4DA 3D5WA 4N6YA 4ASZA 5EI2A 2C5XA 3VF8A 4IAYA 4EWHA 3KXNA 5LARA 4XNEA 4MX9A 4YLKA 3TJCA 2XIRA 3OTUA 4PUZA 4AT3A 1PKGA 3UC4A 2QU5A 4YU2A 4RWIA 2BTSA 3S95A 3VS2A 4FTQA 5CU3A 3LFBA 1XH5A 3VO3A 4AGCA 3QTZA 2ZMDA 3R22A 3QWJA 3LXLA 2BUJA 4QYFA 3LCDA 5CXHA 2PL0A 2WQMA 2WTKB 5CSVA 3QU0A 3RPRA 3A8WA 3O2MA 3HEGA 1BKXA 3DJ7A 4ORKA 1YQJA 3UJGA 2J6MA 3VIDA 3ZEWA 3VBWA 4RWJA 4MTAA 4FTRA 5GJDA 3BLQA 5HD7A 5IA3A 3QKLA 3VS0A 3ZO1A 4E73A 3VVHA 4L7SA 4P5ZA 2V0DA 3A7HA 3DKCA 5CAUA 3QTSA 4U45A 4QTAA 2QCSA 3SOCA 3OVVA 4RBLA 3RAHA 3W18A 3F61A 5BUJA 5ANIA 1UNLA 4CFXA 4D2RA 3D94A 3NUYA 3Q4CA 5A6NA 3V5TA 3FAAA 2OZOA 3FHRA 4O22A 2XK4A 3JPVA 3BCEA 2VWIA 4KIKB 2IG7A 2XKCA 3ODZX 2FSOX 3P78A 4IWDA 3KF7A 4O0RA 3C5IA 4HVGA 2VTQA 4YHFA 3QQUA 3QLGA 3UOHA 3UO4A 5A54A 3BGZA 2JBOA 3EN6A 3ELJA 5EW9A 5IQHA 3EN9A
chains in the Genus database with same CATH superfamily
5IA4A 2B0QA 2GHGA 4HNFA 3VHKA 3S00A 2CCHA 3LQ5A 5BV3A 2Y0AA 3NAYA 5JKGA 1B6CB 1A06A 2UZEA 3VBQA 4BWPA 2V5QA 2W4JA 4QQCA 5IA2A 2IVTA 2R7IA 2FYSA 3V04A 4R3PA 2H34A 3NW5A 4JJRA 4O6LA 3LMIA 2QHNA 1FMOE 4ZJVA 4DH8A 3L9LA 2XAMA 3HLLA 3K5UA 4EOPA 3NSZA 4U5JA 4AZFA 3I7CA 1Q3WA 3DB6A 3EQIA 4I0SA 3ENMA 4NM3A 5HESA 4F70A 1K2PA 4O7WA 3UDZA 4CNHA 4HPUE 4RX5A 3EN5A 3IPHA 3OFMA 3CCNA 3JVSA 4QP2A 2RG5A 3DU8A 2J2IB 4JBQA 4CT1A 5BVNA 1UU3A 5AR5A 2PVYA 5IUIA 2XKFA 4FZ6A 3W16A 1I44A 5A46A 1OMWA 2UW3A 3FYKX 5HCXA 3KGAA 1TVOA 1KUTA 1J7IA 3POZA 1UU9A 4IX6A 3W8QA 3E8CA 4DBNA 3IW8A 2J0JA 3SDJA 3DBDA 4A9SA 3I60A 4K6ZA 4IB0A 4ANMA 2OF2A 2C6DA 2QR8A 2XEYA 4NEUA 2OZAB 5B7VA 2GQRA 1YHVA 1GIJA 4M12A 4CFNA 4H3BA 2PMOX 2QOFA 2P3GX 4U0IA 2ZV9A 2X8IA 1OL1A 4FTMA 1XBAA 1OKYA 3KVWA 5HG8A 4R7BA 5EM5A 3KULA 5CZHA 3CTQA 4H05A 4UV0A 4O4CA 5DHJA 5G6VA 3ZTXA 4LV7A 4XG6A 2XNMA 2YM8A 3UO6A 1H1PA 4PL4A 2G2HA 2ITVA 2G2FA 2KTYA 2XRUA 3A7JA 2YISA 3F9NA 3G33A 3LJ2A 4S31A 5AR4A 3UTOA 3VWAA 4YJRA 4APPA 4GFGA 1QMZA 3G9LX 3NCGA 5ETCA 4MXCA 4OBQA 4UY9A 1AD5A 3MY5A 4ZJJA 3SG8A 2CLQA 4LL5A 3C4CA 2BHEA 3F69A 4P2KA 4RIYB 3C7QA 3DCVA 4FG8A 5CAQA 2PULA 4XRLA 4FV7A 2PE2A 3CGFA 4O7TA 2VUWA 5F1ZA 1W2FA 3QRUA 4OAUC 3CKXA 4ACHA 4QQTA 3BEGA 2C5YA 3OG7A 1PMEA 4XP3A 4XUFA 2VTRA 1FMKA 1V0OA 4F6UA 4HYSA 3ZMMA 3B8QA 5L2IA 5EM6A 1Q8WA 2JIUA 4TPTA 4EHVA 4JAJA 4EEVA 3AD6A 1JOWB 2H6DA 1UU7A 4HNIA 4GK2A 4QPAA 1Q8YA 4D4VA 5CAOA 5I9VA 4FA2A 5IH4A 3PPJA 3EZRA 4R5SA 2X6DA 3ERKA 2WQBA 4KBKA 3DB8A 4D1SA 1ZYDA 3FBVA 3E3BX 2QKRA 3PPZA 3PY3A 4FUXA 4A9RA 5I3OA 4DTKA 5K5NA 2NO3A 3KN6A 2W5HA 4D5KA 4ZLOA 1NVRA 1CSNA 4EH6A 4XG4A 3TIYA 5AA9A 4IC7A 4TYIA 3O7LD 3WOWA 4F1MA 1V0PA 4HCVA 4HYIA 3PP1A 4U3YA 2X0OA 3LQ3A 4IVBA 4M97A 4JDIA 4NK9A 4ASDA 4KKGA 4FIGA 3EKKA 4FKWA 5GIPE 1QPDA 4TKSA 3V6SA 3D14A 3ORNA 4IWOA 4ZY4A 4C35A 2WMQA 3BX5A 3OT8A 4UXLA 5A3XA 2VTOA 4OTDA 2PZ5A 4J98A 1YWNA 2B52A 1YXVA 3U54A 1NVQA 3AMYA 4D2SA 4D2VA 4DN5A 5LMBA 2O64A 3PSBA 3QCSA 4ONAA 3HV5A 4TYEA 2VX1A 3UC3A 3W2QA 3RPYA 3ZXTA 4DFNA 5I9XA 2RG6A 4YTHA 4LQMA 4GW8A 3LZBA 4IW0A 3ZYAA 5HVJA 5HD4A 1W7HA 4DFLA 3KMMA 5BVKA 3DFAA 2ITWA 3BE2A 3CTHA 2PVJA 4X3FC 3W0MA 4BY9E 4YZ9A 2R3GA 2VTPA 3HMNA 3Q5ZA 3LKMA 4L43A 3EQPA 5E8TA 3IW7A 4UBAA 4O91A 4MK0A 3FMHA 3A8XA 3R2YA 4FV3A 3GQIA 4AA0A 2PHKA 4R7HA 5HI2A 4A7CA 2E9NA 4E6AA 3HL7A 1XMMA 2VO3A 1O6LA 3G5DA 3RAWA 3LJ0A 5BMSA 1A48A 2QG7A 2W1ZA 5DA3A 4FV4A 2C3JA 4CFMA 4BBFA 5C27A 3QA0A 4EZ7A 4AXDA 4I6BA 4FG9A 4NFNA 3VS3A 3ANQA 5AEPA 5EKOA 4AXAA 3IGOA 4C38A 2ETMA 4XCUA 2PUIA 3H30A 4ZSLA 2RFNA 3QBNA 3N4UA 3LFDA 1YI6A 3BPRA 3Q9XA 2VZ6A 5LMKC 4XBUA 2EB2A 2BPMA 3HYHA 4KNBA 3RWPA 2BZKB 2UVYA 4FIJA 4FVQA 4OTPA 2WTVA 2A0CX 3KULB 5AWMA 3TI1A 4K33A 5I9UA 2QOHA 3PXRA 5IEVA 1JQHA 1EH4A 2YM7A 2A19B 4RGJA 4RJ6A 5E4HA 4USEA 1JKKA 4CSVA 1W0XC 1SNUA 3WI6A 4N4SA 5DI1A 3PA4A 5EQYA 4BCOA 4UYAA 3RNYA 3NYNA 4LV8A 3D0EA 2FGIA 1XQZA 4GT5A 2C5VA 3U9NA 3FC1X 4YZCA 4D55A 4OBPA 2PZRA 3F88A 5F20A 2VNYA 3CD3A 3D83A 5A4QA 3Q60A 1P4FA 2A1AB 4X6RA 3FXZA 5HVKA 1UU8A 4FKJA 2VTIA 2VGOA 2W1DA 4DF3A 3ZCLA 1G8JA 4DEDA 5IQDA 4D2PA 2VX0A 4FIHA 1OPLA 3OCSA 3C0HA 5FQDC 4F7LA 1SZMA 5C26A 3HGKA 4DA5A 2ITTA 3I0OA 4EKLA 4OTHA 2DYLA 3DZOA 4Y5HA 3BHVA 2ETRA 5J7BA 3RGFA 2JBPA 3F3UA 4LGGA 4ZAUA 2IW6A 4H1MA 4MVFA 2RFDA 5H8EA 4AA4A 4BZDA 2OICA 5I9YA 3VBYA 4M14A 1ZMWA 2QOBA 4YBKA 4O2ZA 2ZV7A 4I20A 2BAKA 3JR1A 3TN8A 1XKKA 1S9JA 5HZNA 2W17A 2F7XE 4F6SA 3RMFA 2VAGA 4ENYA 2V7OA 3FI4A 1WBTA 1FBNA 2R2PA 2CNVA 2DUVA 3E64A 4YLJA 2KULA 4UN0C 4PDSA 2PSQA 3NPCA 3E3PA 4UEUA 4L53A 3G6GA 3VN9A 2PU8A 3CJFA 5LVPA 4QYEA 5DBXA 4K77A 3COIA 2WTWA 2BDJA 4KABA 3H9FA 4HYHA 2C1BA 3FMNA 4RVMA 5BPYA 2IJMA 5L6PA 4YJSA 1DAYA 4EJ7A 3ZZWA 2P33A 4FI1A 4LM5A 5KHWA 1PXPA 3HA6A 3E8DA 5CX9A 3OUKA 2O3PA 2RGPA 2XP2A 2J51A 2VTJA 4L7FA 2PE0A 3DGKA 3LFSA 3LAUA 4RIWB 1YXTA 5M09A 1PKDA 2OJFE 3CS9A 5EM8A 3R7YA 2XBAA 3DQWA 5HEZA 2BILB 5C1QB 4BDIA 2HZIA 3ODYX 2AC5A 3WZKA 3NMUF 3SGCA 2C4GA 4MNEA 4XOYA 3FKOA 1Z5MA 3MTLA 4I5PA 4YJUA 4FKVA 4KKHA 3P5KA 2R3NA 3D2KA 3PG3A 3WIKA 2Z8CA 4Y8DA 3FXXA 4YSMA 4M66A 2VTHA 3G0EA 2RFSA 4ACMA 4BCKA 4G3FA 4EYJA 4KIOA 4ANOA 2P2IA 3NUUA 3R1YA 1YDRE 2CNUA 3VONA 1ZMUA 4K1BA 3FMJA 4FSQA 4CYIA 4XV1A 3LLAA 3WIGA 1XH9A 3CC6A 3IKAA 2LAVA 2XUUA 3WF6A 4I5CA 3LCSA 1M17A 2WZJA 4C59A 2X2KA 5AP0A 5CF8A 4HGLA 1BMKA 4IANA 2B9JA 4MBIA 3QC9A 3MPAA 1TKIA 4MQ1A 4QQJA 4DFUA 3LXKA 3IDPA 3VS5A 1U54A 3KRJA 1AQ1A 3FPQA 2XS0A 3BQCA 4KS7A 2CN5A 4DGOA 3HX4A 4PTEA 2ONLA 2EVAA 2WMSA 3QHWA 4KIQA 4MXYA 3BI6A 3BU5A 5FXQA 3AKJA 3O5AA 1GJOA 3PXFA 3TZMA 5HE0A 4EOOA 5I0BA 3VUMA 4DFXE 4HOKA 5E91A 2XKEA 5L4QA 2WIPA 3NVMB 2I1MA 4L8MA 4NW6A 5EM7A 1YXXA 4QMMA 3EQBA 3FLQA 4FSTA 3EJ1A 3KKVA 1SMHA 3PLAE 1R1WA 2UZBA 1OVEA 5AV4A 2BKZA 3BBTB 3RVGA 4XHKB 1H07A 4ZLZA 4O7NA 4BTJA 3WF8A 4TTHB 4FZFB 4RZWA 4ANQA 4BCMA 4F0GA 5LWNA 2XK8A 5DT0A 4H36A 3CTJA 2ZB0A 3PWYA 4NU1A 4QMQA 4A06A 4BDJA 2XK3A 2HYYA 4EOSA 4CFFA 3TZ9A 4DFBA 5AUZA 1IASA 4DITA 2YACA 2WIHA 3EFKA 4K11A 4ZS0A 5HLWA 3U6IA 4BIBA 5KUPA 4JQEA 3TKUA 2VWZA 5KZ0A 3QTIA 3KF4A 2JDTA 3NYXA 4AZVA 4AN3A 4DAWA 3O17A 4E6DA 1XMLA 2CHLA 2J5EA 4QYYA 5HTCA 3KMWA 3R1QA 3BYSA 2XNEA 4M3QA 5EI6A 2YIRA 4M69B 2R3PA 5E1EA 2XMYA 5LVNA 4XX9A 4NUSA 4WRSA 3ALOA 2WMTA 1H26A 2IN6A 4EH4A 1NA7A 4CMOA 3NEWA 3S0OA 4C34A 3TKIA 2QOLA 5HX6A 2X7FA 3PXQA 3FXWA 3GUBA 4I0TA 4PPBA 2GNGA 3HP5A 2OW3A 3QRJA 4I41A 4CD0A 3GC7A 3NAXA 1T46A 1PMVA 4QMLA 2WTCA 3DJ5A 3NR9A 3EFJA 3LOKA 5H8BA 1RJBA 4RIOA 4V0GB 5CANA 3LQ8A 3KRLA 3R63A 4BHZA 2GFSA 3Q4TA 3BWJA 1Y6AA 3OP5A 2W1EA 4P5QA 4AQKA 3ZXZA 3DK6A 4MD9E 4IJ9A 1JKSA 2REIA 3NYVA 4W8EA 3D15A 2YHVA 4RX7A 3UOKA 3WBLA 3DFCB 4TRLA 4E6CA 4MNEB 1WMKA 3ZM4A 1PMNA 4IZ7A 4X3JA 3SQQA 5GNKA 4FTLA 2G2IA 2WQOA 2YDIA 4IQ6A 4G34A 5AM6A 4EOIA 5FEEA 4AZWA 5JZNA 2WMAA 2CLXA 4GSBA 3VUGA 4FT0A 2WEIA 4OTGA 3CR0A 2YJRA 1ZOGA 5IF1A 3AOXA 5AV2A 3QHRA 1Q8UA 4L00A 4XP0A 2OIQA 1FPUA 2Y6OA 3D4QA 3TUCA 4YHJA 4F9CA 3WF5A 3D5UA 3GU7A 4XLIA 3AC5A 3MWUA 4R6VA 3KXZA 3VQHA 5IEXA 5CSWA 2UZWE 5HLPA 2QC6A 3MW1A 4KRCA 1Q4LA 2I0YA 5L2QA 3DAKA 3CEKA 5K4IA 3ID6C 4B8MA 2AQXA 4QMWA 3MVMA 2HY0A 1O9UA 4L42A 4E5BA 3BBWA 4WRGA 2J4ZA 2JKMA 4OTIA 4XLVA 3KCFA 3PE1A 4PV0A 4CFUA 5ANDA 5KMMA 3OWKA 4FL3A 2XIKA 5CSXA 4DLJA 4ZS4A 3QXPA 3H0ZA 4L01A 4TYGA 4Y72A 1AGWA 5HVYA 5DR2A 5AAFA 2C1AA 2C5OA 2CGVA 2XH5A 3GOPA 5DPVA 2H9VA 3RCDA 4DGLC 4I94A 3PJ2A 3GC9A 5GJFA 1SVGA 2V55A 3QQFA 4W9XA 3QKKA 1G5SA 4NJDA 4A4XA 2W0JA 4QYHA 4U81A 3LM5A 4YC8A 3OXZA 1MRYA 2Y8OA 3M1SA 3DTWA 4D2TA 3CIKA 4RJ8A 3PTGA 2J50A 5HICA 4ITHA 4J97A 5JFXA 4F08A 5J8IA 3G51A 3VF9A 2R3JA 4K2RA 5LVLA 3LW0A 2YDJA 4LOPA 3V8SA 2W96B 1WFCA 3C4FA 2Q0NA 4FT5A 3R9DA 4DT9A 2VRXA 2PWLA 5LVOA 5JQ5A 5EYMA 2J5FA 4QTDA 3V5JA 3W2SA 3K3IA 4R77A 2JLDA 4G3EA 4C8BA 5F4NA 2IVUA 3C4ZA 2Y4IC 4RVKA 3VW6A 4U42A 1H25A 4XJ0A 5HKMA 5HE2A 4PTGA 1ZLTA 2XCHA 1RDQE 1ZYLA 4X2JA 5CT0A 4BBEA 2G15A 4MUQA 2JAVA 4RFMA 1Q41A 1O6YA 2XIYA 2XK6A 5F95A 4USDA 1GNGA 4AT5A 2C6EA 4O96A 5EHLA 2NRUA 4MBLA 3FV8A 5CEPA 1DI8A 3RJCA 4EHGA 2PYWA 3TV4A 4RJ7A 3MFSA 5IQCA 2BAJA 4RVLA 4ZTQA 4AF3A 3NVKI 2C69A 3SVVA 2R3KA 4XP2A 4GFOA 3SKCA 3F7ZA 2YAAA 4IXPA 4Y73A 5CF6A 3ORZA 2JITA 3KY2A 2HAKA 3MYGA 3HECA 4YJTA 2BRBA 5JFSA 3MGYA 4WT6A 4JXFA 3GGFA 4UMRA 4HZSA 5HO7A 1UNGA 4I4FA 3EN7A 2P4IA 3OC1A 5LMAA 2F4JA 4X7QA 1IA9A 4F9WA 4G9RA 2ZAZA 2ZM4A 4KIKA 4EH8A 2GS7A 2GTNA 4LOQA 3PJ8A 3QUDA 4MD7E 2X7OA 3H3CA 4U43A 5HBHA 3QL8A 3SG9A 3H0YA 4WO5A 3H4JA 3UVPA 4WNKA 4YO6A 5BMMA 4EOQA 4AAAA 4AT4A 4NM0A 4AFJA 3FMLA 1SYKA 2WTDA 3P0MA 4D2WA 4DH1A 1XH7A 4C3RA 3W0NA 2ZVAA 3QCQA 4BDBA 3NW7A 2J0LA 3IOKA 3NLBA 5AP7A 1A9UA 2C47A 5BYZA 4BTMA 3Q53A 4JDHA 4FSWA 4RQVA 4O4FA 4C02A 4FNYA 3Q52A 4IVDA 4L67A 2WB8A 5E8YA 4CFVA 4WIHA 3GU5A 2QLUA 4YHTA 4F9YA 4G5PA 2WKMA 1Q8ZA 1YXUA 3EL8A 1QPJA 3NZ0A 4FTCA 4UMTA 3Q9ZA 4FK3A 2B9IA 3DKOA 4LRKA 4U44A 5HNGA 1YWVA 3RZBA 4E4XA 3MTFA 4ZJIA 2OXXA 3BRBA 1T45A 4F9AA 3ZSGA 4L68A 5ETIA 5HHWA 2X39A 2XBJA 3DOGA 5E1SA 3HUBA 3KXMA 2IZUA 3NCZA 3W55A 1R3CA 1YW2A 3IOPA 1OPJA 2EXEA 3I81A 2YM3A 4AE9A 3E87A 4DEBA 4DYMA 2GHLA 4CYJA 4YURA 1BI7A 1H4LA 2ITUA 3JS2A 2VWUA 2Z60A 4IWPA 3VBTA 3F82A 4C0TA 3K54A 4OW8A 4GK3A 3V01A 5JGBA 1FINA 4RJ3A 5DR9A 3TUDA 4BCGA 3WE8A 3OCTA 3PZHA 1CKIA 2YIYA 3QQLA 4IVAA 4PP9A 5L6OA 3QUEA 4DHZA 1FVRA 2HZ4A 4L46A 4LRMA 3RK7A 3H9OA 3K2LA 1TFFA 4JIAA 3MVLA 3QX2A 4I0RA 3VJNA 5CENA 1F0QA 4KKEA 4O21A 2CGXA 3AGMA 4Q9ZA 3BYVA 5JN2A 3SV0A 4GYIA 3E88A 4Z7HA 4RIYA 4QNYA 3MH1A 4K8AA 3MVHA 3GB2A 3TUBA 4WUNA 5M08A 3PY0A 4U6RA 4ZSGA 3TNPC 2EB3A 3VW8A 4FV5A 5AIRA 3UQCA 1KSWA 2UW7A 3ORKA 4X2GA 3OEFX 1J7UA 3OUNB 5G1XA 3P9JA 3RPVA 2IVVA 4DBXA 3DK7A 3KA0A 3ZBFA 3D9VA 2YFXA 1Q62A 2CKOA 4YNOA 4C37A 5DNRA 2XZSA 3WILA 5EYCA 3C51A 3VS1A 3W10A 1OL7A 4AN2A 3OROA 3PG1A 1ZRZA 3GQLA 5J5TA 4I3ZA 1KV2A 3QQKA 2PPQA 3DS6A 3KREA 2ACXA 3E8EA 2HELA 1Q3DA 5B2KA 3R8VA 4FKIA 3FLSA 3FPMA 4JBPA 2F57A 2W4KA 5T68A 4HW7A 4CVAA 5JZJA 2PVHA 2E2BA 2Q0BA 2ZM1A 4N70A 5CWZA 4CQGA 2BAQA 4YJVA 5AX9A 2VX3A 2YM5A 5FLFA 1UWJA 2CN8A 4GG5A 2YIWA 2CGUA 1PMUA 1R0PA 1ZZLA 1ATPE 3HVCA 5CF4A 3AGLA 4KBCA 4OAVB 4H1JA 3GCVA 4AFEA 3KMUA 3PSCA 1OBGA 4W4YA 5D7AA 2Z7SA 1GZOA 3DV3A 2IVSA 4PX6A 3KIOC 2XYNA 5E8ZA 4BB4A 2OI4X 4H3QA 4JX7A 3DDQA 4YC3A 1W2CA 3PPKA 4C61A 1U46A 2RSVA 4CKRA 2C0IA 4KSQA 5JK3A 4IEBA 4FRFA 4U97A 3ZFMA 4KRDA 3U6JA 2YLFA 3R8PA 3UGCA 5KX8A 3SLSA 2W1IA 1O6KA 2WMRA 3FE3A 2Z2WA 3BHUA 3EZVA 4M0ZA 1KE6A 3EYGA 4OT6A 4QMUA 1VLRA 3WYYA 3R9NA 3HKOA 5BVWA 1OI9A 4WBOA 2PMIA 3DJ6A 3KRWA 4HVSA 2CKEA 3ORLA 3QTQA 3NIZA 1LEWA 1ZYSA 4BTKA 5IQFA 3ZDUA 2H96A 2WAJA 1VEBA 1XH4A 3DK3A 5FTOA 3ALNA 1P14A 3GXLA 2OJ9A 5KCVA 3V51A 4D4RA 3D7TA 4A9TA 1YDSE 2PVLA 4AW5A 5A4TA 3C4XA 4I5HA 2PVRA 3NNUA 4PDOA 5AUYA 2CKQA 3DLSA 3MH3A 5I9ZA 4O84A 4K18A 3QD3A 4F6WA 2F2UA 2QOIA 2R7BA 4FSMA 4FZ7A 3OS3A 4PPAA 2X81A 4G6OA 4UWBA 5DMZA 1WBWA 4TNBA 4TWOA 4EUTA 1ERKA 1MQBA 1Y6BA 2BIKB 2O0UA 2X4FA 5EQPA 3BLRA 5KMKA 4Y95A 1R78A 3COKA 2VO0A 3QD2B 4FTOA 3R8ZA 2Y7JA 3EYHA 4M68A 5FXSA 4K0YA 4JIKA 1CMKE 4GUBA 3BGPA 4GEOA 4JG6A 2X2LA 4L44A 2V7AA 4FK6A 4L9IA 4NW5A 3BU6A 3CKWA 3REPA 4D28A 1PXOA 1PYXA 1H1WA 3FMMA 4MQ2A 4IAFA 4BCNA 3DXNA 4J96A 4GUEA 5ETFA 3D5VA 5EDRA 5C8MA 3R9OA 1RW8A 2XVDA 4QMZA 4R3CA 2I7QA 4AAYA 1MP8A 3QTWA 2E9UA 4G3CA 4QT1A 1J1CA 4ASXA 2XIZA 3TEIA 4C7TA 2BDFA 2I6LA 2X4ZA 3TACA 5TE0A 3NUSA 5CI7A 4FV9A 3BHYA 3GP0A 4UMUA 2WQEA 3EIDA 2P0CA 4JR7A 4RJ5A 5CEIA 3TTIA 4BDKA 3T9IA 4AXCA 2DWBA 2W9ZB 3IO7A 3Q4ZA 2UZLA 4QMSA 3RINA 3UIXA 3JVRA 4AX8A 2VWXA 4MKCA 1KOBA 5AM7A 3MI9A 4D4SA 1KV1A 1UWHA 3FZPA 2Y4PA 4HCUA 2QNJA 3D2IA 4EK6A 4QP7A 2GFCA 4J71A 5B0XA 4F0IA 3ZRLA 3ZOSA 3BKBA 4B99A 3EQRA 4NWMA 4HGTA 2HWOA 4IE9A 4DH5A 5HU9A 5T3QA 5J9ZA 3GI3A 3FWQA 4RMZA 3NFGB 5KKRC 1KE5A 4GFMA 1FVTA 4AGDA 2B53A 5AAEA 4GU6A 5BVEA 3R28A 3QA8A 2Z7RA 4C4FA 2FVDA 2WTJA 4BKJA 3GFEA 3F5XA 2PZYA 2YCSA 4WBBB 4X6QC 2C6MA 5D11A 4ARKA 5EQEA 4FT3A 3SHEA 4FKRA 4CRLA 4BL1A 4B6LA 1OUYA 4LYNA 4EC8A 3E8NA 1ND4A 5AMNA 4RIWA 2XM8A 4XS2A 3NWWA 3FLYA 1J91A 1W8CA 3SRVA 4BKYA 5IDNA 3Q9YA 2WO6A 3PRIA 5I3RA 4YGAA 2YZLA 5HIBA 2C6OA 3F2AA 4X2FA 4DTAA 4AOIA 5IQIA 4IJPA 5IUHA 3DBEA 4BRXA 4DCAA 4YTFA 4AZSA 4U9AA 2BTRA 4FKQA 4JT3A 1OPKA 2IEWA 4XOZA 3TM0A 3BLHA 5D41A 4YJOA 2UW8A 4GV1A 5HU3A 5JGDA 1DAWA 4QP4A 4ZY6A 3WF9A 4AGUA 2UUEA 1GY3A 5J1WA 5DEYA 2OIDA 4CXAA 4FUYA 5IU2A 3ULIA 4O2PA 4TYHB 3ZLYA 5B2LA 3OY1A 3P08A 3DAEA 4AG8A 4AOTA 3D7TB 4QTEA 2WPAA 4FNWA 3E7OA 3WARA 4R5YA 1K3AA 2XNBA 3DT1A 4JI9A 5HNIX 4O4DA 2UW9A 3TNHA 2OFUA 1PXKA 5IISA 3W0QA 3QTXA 3RP9A 3M42A 1JKTA 1VR2A 2C6TA 4YJNA 4U80A 3U4WA 2BR1A 4PP7A 3FQHA 3RPOA 4YMJA 1PXLA 3OOGA 3AKLA 4GL9A 4BZNA 1UKHA 5IH5A 3E5AA 2QKWB 5DH3A 2OJJA 3QRTA 4APCA 3R02A 4J95A 2NYAA 4BR3A 2JIVA 3H10A 4EI4A 4XV9A 1M7QA 3BLAA 3IW6A 5DR6A 3TJDA 3UPXA 3VC4A 4C57A 2ITNA 3UQGA 4PRJA 2YITA 4BI0A 5JT2A 4ALUA 2UZTA 3TDWA 4YZNA 5KBQA 3QD4A 5EG3A 2JDOA 3O7LB 1JAMA 4YPSA 5ANOA 1OL2A 4IM3A 5AUUA 4ERWA 4HVDA 4ZP5A 4Y46A 3A2CA 3ZM9A 2NRYA 4JX3A 4JBVA 3DLZA 2ZJWA 3ACKA 2HW6A 4U7ZA 5IUGA 3ZO4A 3BELA 3FY2A 3UOJA 2ZV2A 4ERKA 3W2OA 2VNWA 1NVSA 2WU6A 4R1YA 5AAGA 4UMPA 4R1VA 2XNGA 3TL8A 3UODA 5FRIA 4F1OA 1JWHA 4N6ZA 4RFZA 3U8WA 3MY0A 1KOAA 3O8TA 5DT4A 2R3IA 3PXKA 4M69A 1JSUA 5TR6A 4DEAA 4E93A 4EQCA 1YI3A 5KNJA 5AP5A 2P2HA 4QMVA 2YIXA 4YZBA 5AIKA 5HG5A 3ZUVA 3SA0A 3PIZA 4YP8A 2EWAA 3DNEA 4PNKA 1GAGA 3FJQE 3DZQA 3CQUA 2VO7A 4XG3A 4NM7A 4C4GA 3QYWA 3AMBA 4R78A 1H0WA 4FZDB 4CV9A 1YWRA 2VU3A 3VS6A 5AP4A 3D7ZA 4V0GA 3HUCA 2YAKA 4EYMA 3EQFA 1BL7A 3PY1A 3KN5A 3FEGA 2GNLA 4OR5A 4GVJA 2W7XA 4C3FA 5IA0A 2B1PA 4FV8A 3V8WA 2R3HA 1OGYA 3SRVB 2VD5A 3HAVA 4RPVA 2VTNA 2W1CA 4GMYA 1SVHA 4QP6A 4U8ZA 4BIDA 4FTAA 4WKQA 4ZTHA 5M51A 1NXKA 1Q5KA 3OBGA 3OW4A 2QQ7A 1JVPP 3HP2A 5KE0A 4IIRA 3W0RA 4Q9SA 5DEWA 1XH6A 2OIBA 3P79A 4KB8A 5HO6A 4GH2A 4RA4A 3WE4A 4ASEA 4MF1A 2QOQA 4I23A 4BI2A 5EI8A 5CT7A 2R3LA 4CQEA 5LCKA 5A4CA 5M07A 4EZ5A 2OGVA 3G0FA 3R7GA 4FTTA 3KVXA 5H9BA 4TZRA 3RI1A 2UZDA 4RQKA 5L8LA 3DXQA 2A2AA 5AUXA 4C2VA 3FQSA 4LUDA 5DVRA 4OLIA 5EDQA 3R83A 4J8MA 2XEZA 5M4UA 2C0TA 5IDPA 3PSDA 2R9SA 3NYOA 4EQMA 5AR7A 4XH6A 4QYGA 3UIUA 4EOLA 2IWIA 3PFQA 2OKRA 3P1AA 4TWCA 3KQ7A 4UWCA 4XG2A 3F7WA 1WAKA 4Q5HA 3QLFA 4YZMA 5KMJA 4QDEA 3R01A 2OO8X 2LGCA 4PQNA 3R21A 1KE9A 4HGSA 2R3FA 2WFYA 4C4IA 4FKSA 4W4VA 3OWPA 3LPBA 3PP0A 4FEXA 3R7UA 3G2FA 2B55A 4F1TA 4A9YA 3W2PA 2YA9A 2R5TA 2WU7A 3GCPA 4RVTA 2PVMA 4I93A 3OF0A 1F3MC 5AR2A 1IAHA 3U6HA 4MF0A 4E6QA 3DAJA 2YWVA 4BN1A 5DGZA 1W82A 3ZSHA 5AP3A 5J7HA 2XJ0A 5AR8A 3MFUA 1JNKA 4DTBA 4OTWA 3DY7A 3F2NA 2HOGA 2JKOA 1ZAOA 2ONLC 4QTBA 3VS4A 3R9RA 3CQWA 3OCGA 3ZEPA 4CKIA 5HTIA 2FA2A 4DCEA 3OWLA 2FSTX 5C01A 3O0GA 4X21A 4AW2A 4LOOA 1WBOA 4BDCA 4Y83A 3A61A 4XYFA 4X2KA 5L3AA 4BYJA 3P4KA 3L9MA 3BHHA 1XWSA 4UZDA