4GG7A

Crystal structure of cmet in complex with novel inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
278
Chain Sequence
QAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multisubstituted quinoxalines and pyrido[2,3-d]pyrimidines: Synthesis and SAR study as tyrosine kinase c-Met inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Hepatocyte growth factor receptor
total genus 89
structure length 278
sequence length 281
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gg7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gg7A01
3LFAA 5FEDA 2E9VA 4YO6A 2UW6A 5BVOA 4BYJA 2YCSA 3QC9A 1FMKA 3KCKA 3AMAA 1XH9A 2A0CX 2W99B 2Y4IC 3P86A 4AE6A 3O8UA 4A9RA 4X2JA 5L2WA 3A8XA 3MJ1A 4EK3A 2Z2WA 3MA6A 4EL9A 1XH6A 1TQMA 2X39A 5CS6A 3TNIA 2JDOA 1ATPE 2X7OA 3KF4A 5HIDA 1Q8YA 2ERKA 2WTCA 3KVWA 5BVWA 4GFOA 4FEVA 5JRQA 3LZBA 3A8WA 4ZXTA 5JQ5A 5HE0A 1IR3A 1WBTA 4CTBA 4CZYB 3QCSA 4Y5QA 5DYJA 2F2CB 4BKZA 3PPZA 3FMDA 2I40A 2VTHA 4FIIA 4FIGA 2Y7JA 4I3ZA 1O6YA 4CEGA 3G33A 1GJOA 5AM6A 2W1CA 3GU8A 3AT3A 3HRBA 4WD5A 4YLKA 2YLFA 3AMYA 3OROA 4EYJA 2OJFE 4MYGA 4J8NA 4I93A 4E4LA 1UWHA 1CKIA 3VQUA 4QQJA 2DWBA 2CDZA 3NNUA 4FSUA 2WKMA 4F9WA 5BMSA 5CVHA 3DLSA 2XS0A 4CG9A 3VAPA 5CU0A 4RJ8A 3BHHA 3NNXA 1PXPA 4YBKA 3CEKA 5M55A 4U8ZA 4GG5A 3MN3A 4IDTA 2JITA 3FQSA 3UP7A 4M8TA 1KOBA 5AP1A 4G3CA 4EKLA 4HYHA 5HVKA 3FY0A 3HZTA 3FPQA 2QI8A 3VUDA 4CMOA 3FC1X 3H9RA 2UVZA 3UIBA 3WF8A 2PUPA 5GJDA 4H3QA 4LRKA 5HE2A 3PVUA 1J91A 4RX8A 1OGUA 2O63A 4O7RA 3PP0A 5ETFA 1OM1A 3QUPA 1Y57A 4MF1A 5EYDA 2WTKC 1ZY4A 1IAHA 4L53A 3IG7A 4BDIA 3BQCA 3G51A 3UG1A 5CY3A 2XB7A 3ZLSA 1M52A 4DAWA 3G9NA 4XHKB 4CLIA 2QOIA 3HEGA 4X6QC 1MP8A 3MPMA 4BN1A 4X0MA 4IX3A 4F64A 3R28A 5E8ZA 2UUEA 3R02A 3SAYA 4LGDA 4FKOA 5HZNA 3GCVA 5CSXA 4LYNA 4DFXE 4EJNA 2VTAA 4R3PA 4JQEA 3ZO3A 4JDKA 4ZLOA 4TYJA 3DKFA 2VWWA 3BRBA 5CNNA 4H3PA 5HE3A 4BCQA 2ZJWA 5AUTA 5DLSA 4J53A 2HW7A 2PYWA 3WZDA 2WMXA 2XK9A 3V5WA 3LKMA 3P08A 2KTYA 1DM2A 2WU6A 3VRYA 1NVQA 3PVBA 3E8NA 4TWOA 3R9RA 3ALNA 4ZIMA 5AP0A 5ETCA 3QTRA 5IA2A 4QPMA 3BYMA 3CY3A 3Q2JA 3IDBA 4FV9A 2FUMA 4DEHA 3FMMA 4Q5HA 3ZSGA 3QTZA 1OL6A 3B2TA 3FL5A 3PJ2A 3EOCA 5EI8A 4F1MA 2QURA 3NIEA 5JKGA 3F2RA 3JR1A 1JSVA 3HMMA 1SMHA 5J5TA 2GTNA 2W5HA 3O0GA 4M14A 3HMNA 4EQMA 5C8NA 2VTIA 4LMUA 2BRMA 3CLYA 2YDKA 3MPAA 2YN8A 3D94A 1W83A 4PF4A 4FT9A 5KMMA 4IC8A 3EQGA 4O7VA 2LAVA 5HD7A 5KKRC 4I0RA 3FZPA 3DAEA 3GNIB 5AX3A 3BHUA 3GUBA 4B9DA 5L6OA 2FA2A 2O0UA 1SYKA 4QNAA 1X8BA 1ZOEA 3EFJA 2UVXA 5FTQA 3OG7A 2CHLA 4DH3A 1ZYLA 4QP3A 5CEQA 1KWPA 2VX3A 4YC3A 3GU6A 3QQFA 4LM5A 3P78A 3QTWA 1YI4A 5HIEA 2A4LA 5D7AA 5EFQA 2DQ7X 4YC8A 2PMNX 4QMZA 2HWPA 3P79A 4JAIA 4QYFA 4AN3A 5M51A 1YXXA 3Q6WA 5CYIA 4HW7A 4D28A 1B6CB 1S9IA 4FUYA 4J52A 4FV5A 2BR1A 3ZFXA 5ANJA 3Q4TA 4S32A 4R78A 4XG3A 2B4SB 4ALVA 4FEUA 5IH4A 1JSUA 1TVOA 2ITUA 3Q4ZA 1V0PA 3C4FA 3FQEA 5KO1A 3FSKA 2WEIA 3DLZA 3QRJA 4PTGA 4R7IA 4O81A 3ZEWA 5DEYA 3FSFA 2Z02A 3U55A 4YPDA 4O0VA 4BCMA 4FKJA 1Q41A 2RF9A 4PPBA 4F63A 3R73A 3QA8A 3D7ZA 4CFMA 2B52A 3H30A 3L8PA 3Q4CA 4DFUA 2A19B 2ZDUA 4ZMFA 5DT4A 3BELA 4BCGA 3BBWA 3I0QA 3F2AA 1OUKA 4LGHA 4V01A 2OJJA 3GU4A 1WBWA 3D0EA 2W1IA 4L43A 4GT4A 2PMIA 3ZSHA 2IWIA 4A4OA 2UW0A 4J71A 3CJGA 3FMLA 3FL4A 4C3RA 3TDWA 4E6AA 4F9CA 3OY3A 4HVGA 1OBDA 1PMEA 3F3WA 4FV0A 2F7EE 2O8YA 3EN7A 5LMKC 3TN8A 4R1YA 4A9SA 3R7VA 2I0YA 5FEQA 4YTFA 2HAKA 3E7OA 2JBOA 3TKIA 3ZO1A 1KOAA 3L9NA 5CENA 4AXAA 4DGOA 2O2UA 2GSFA 2BAQA 5L2QA 1UV5A 3FC2A 2RFSA 3GU7A 3BHTA 1BMKA 4HYIA 5AIKA 2R3LA 5CNOA 4ZS0A 3ZLWA 3GI3A 4BDKA 1H07A 1PYXA 2UZVA 2Y6OA 3OCGA 3CGOA 1LPUA 2OSCA 2QODA 2R3GA 4NW5A 2XH5A 4X21A 3ENMA 4ZY4A 4X3JA 3QC4A 4QT1A 4KIKB 3W8LA 4DFNA 4HCVA 4UYNA 2PPQA 3DK6A 2YEXA 3W8QA 1XBCA 4KB8A 4DN5A 4F6UA 3BV3A 4GMYA 5AUXA 3K5VA 3PY0A 1CMKE 3TM0A 3Q6UA 4L44A 3TCPA 4JR7A 4Y46A 3NCGA 5DNRA 4CSVA 3ZUTA 3BE9A 1Y6AA 4GU6A 3ET7A 1RDQE 2FB8A 1FVVA 4D4YA 4JBQA 3Q4UA 4IAYA 2HELA 2AC5A 2YWPA 2PVRA 5C1QB 4BDEA 2ACXA 4BICA 3PXQA 4YMJA 2WMWA 2V55A 3GC8A 4FSWA 5C4KA 3LQ5A 3HP5A 4ZSLA 3EYHA 5A4EA 4OTIA 3F5UA 3UQGA 4O2ZA 5CSHA 3UJGA 3FKLA 2XUUA 3OXZA 1OB3A 5B7VA 3IS5A 3ZLXA 4U3ZA 1REKA 2RG5A 5HCZA 1ZYCA 2Y9QA 3M1SA 5HG8A 3UZTA 4FYOA 4NFNA 2OZOA 4JRVA 2JFMA 1AGWA 5D7VA 3HV5A 3P9JA 4HGTA 4JR3A 5J8IA 5IF1A 4ANLA 2QOKA 4DC2A 4U79A 4AU8A 3KMUA 2VTTA 2VGPA 2HWOA 5BUJA 4MWIA 4IACA 3KC3A 3F5PA 4EEVA 4B7TA 4JDJA 1VR2A 4R3CA 4CCUA 1LEZA 2IPXA 4QTBA 2ZV9A 5GINE 2YFXA 4C61A 3OTVA 2ETMA 1I44A 3O17A 3SHEA 3MV5A 1WBNA 3PXZA 3ZS5A 4D4SA 5M4IA 2YWVA 3LQ3A 3HX4A 1LP4A 2E9UA 1MQ4A 2YIQA 3IECA 4QP7A 3ZSIA 3SW4A 4K11A 3QGYA 3I4BA 3G6HA 3L8SA 2JAMA 1PYEA 1Q61A 2YITA 2QO9A 4XS2A 3UOLA 2PU8A 3KKVA 4O21A 5EW9A 3VUMA 2PMLX 2P3GX 2YM8A 2EB2A 3PIYA 5M06A 3OD6X 3V5JA 4E6DA 3SGCA 2GU8A 4L9IA 4GJ2A 3GQIA 3F7WA 3NPCA 1VJYA 4BFMA 4QOXA 2YDIA 3TZMA 2X4FA 3W2CA 4YJOA 4BDGA 5J87A 4I6BA 1WBPA 2F7ZE 5DA3A 4GFMA 3GQLA 2XIYA 1OITA 2WZJA 3BPRA 2AUHA 2OBJA 3O96A 5FEEA 5T3QA 4JQ8A 3ODYX 3QF9A 4UALA 2XNGA 4DGMA 5HICA 4WIHA 2IVSA 3Q52A 3FMEA 2O3PA 4KAOA 5C01A 5L3AA 2F2UA 2QOQA 1UKIA 3DTCA 5TF9A 4DGLC 3RWQA 1QMZA 4NIFB 1ZZ2A 5L6WL 3NUXA 4OBPA 4OLIA 2R3IA 2WU7A 5A4TA 5CEPA 2W4JA 5EG3A 4ZJIA 3FKOA 2XK6A 3QUDA 3V6SA 5M44A 3IGGA 5F1ZA 5HI2A 2A1AB 3VBTA 3VJNA 3V3VA 4RJ4A 3TZ8A 3SX9A 1JNKA 4LUEA 4L45A 3SC1A 4GVJA 4ENYA 5A46A 3R8MA 4A9YA 3VS2A 4F7SA 2J0MB 3N4VA 4XRLA 3GXLA 3QD4A 3R6XA 4M3QA 3BIZA 1JPAA 2GDOA 1BL7A 5IISA 3A60A 4AT5A 3VS7A 2V22A 2X2MA 4EOMA 5E92A 4JAJA 3EKKA 3R1NA 3JYAA 5DPVA 2GHLA 3TI1A 3WBLA 3DKGA 3HV6A 4G5JA 4IFGA 4KBKA 4QD6A 2VO3A 4C34A 1JLUE 4MQ1A 2VWVA 2XK8A 4P90A 3IONA 3KL8A 3VVHA 4YHJA 4CFFA 4UMPA 4WNPA 2XMYA 1TQIA 3F3TA 2QC6A 2HXQA 3ZHPC 1WAKA 2VTNA 3P23A 2EB3A 4PV0A 4U7ZA 4PMPA 4MD7E 3EQHA 3P1AA 5HG7A 3VW8A 5FBOA 2C3IB 4DH5A 3ACJA 3RK7A 4RVKA 4JBPA 1Q4LA 5HESA 3QGWA 3LLAA 3CTHA 2Q0NA 3QTUA 4IX5A 4QMTA 4JVGA 2JDTA 4F6SA 1OECA 4QMLA 3NIZA 4YJUA 3M11A 4H39A 1IG1A 5CF8A 5L6PA 4TN6A 3CKXA 4FT5A 4JS8A 4RVTA 5ITAA 2XEZA 3DNEA 3SRVA 4U44A 3W2SA 1QPCA 3UNZA 1PY5A 4QTAA 3AC5A 2J51A 3PXFA 2G1TA 4BWKA 4O0SA 3FDNA 4HYUA 3DKCA 4N0SA 4D58A 2Z7RA 1QL6A 3EMGA 2C0OA 3UNKA 4DFLA 3T9TA 4NW6A 4FTAA 3CD3A 4FIFA 3OEZA 3RCJA 4APCA 5FM2A 4JX7A 5D11A 3AGLA 3I81A 3PZHA 5KHXA 5E8YA 4YR8A 2PVMA 4JIKA 4I5HA 2QLQA 3HDMA 4NIFA 5F95A 3QZHA 3COIA 4USFA 5M53A 2GFCA 2V7OA 3R8UA 2RKUA 3CCNA 2QNJA 4MNEB 3C0HA 2C6MA 4NYEA 3FMJA 4FZFB 3WE4A 3TG1A 4QTCA 2G9XA 3FYKX 2G2IA 3MH3A 5F9EA 1H1SA 4DTBA 1KV1A 2GS6A 2QOCA 2X7GA 3QQLA 4XP2A 4DTKA 5CU2A 1Z9XA 4F9BA 4GG7A 3FMKA 3QCYA 4RIXA 4J97A 4Y72A 5AJQA 3QLFA 3TZ9A 2HW6A 4QP2A 5A4LA 2R7BA 2ETKA 2FVDA 3UOJA 2BZJA 2WMQA 4GFGA 3FI4A 3LW0A 5A3XA 4AACA 5IA0A 4AE9A 3FZRA 3G9LX 2WIHA 3PE2A 4X2GA 3ZDIA 4F0FA 2PWLA 5B2MA 3UQFA 3LCKA 2PUNA 5FQDC 4M84A 4BKYA 5C9CA 2JIIA 4BCPA 4NJDA 4GV1A 4EH7A 2QOBA 5CEIA 3MPTA 4Y85A 4MD9E 3VS6A 2QHNA 2PSQA 4TYHA 5E8XA 3ZTXA 5KCVA 1R39A 2VTLA 3BYOA 1XH8A 4BB4A 4FNWA 1ZMVA 3D2KA 3QLGA 4D0WA 4KS7A 4EONA 2YJRA 2UZNA 2XKEA 3A99A 1K3AA 2ZV7A 1PJKA 3KY2A 5AUVA 3LMHA 1OIUA 4DINA 4HGEA 3PXYA 3DS6A 2V62A 4B4LA 4UY9A 4XV3A 4YJNA 5AUZA 3DTWA 3MW1A 4L7FA 3VF8A 2QU5A 1BLXA 3D4QA 3A7HA 2WMBA 4G34A 4F09A 5K0XA 3NUUA 3ZCLA 5FRIA 3QTSA 1WVWA 3LFCA 4XG2A 3FZSA 2JLDA 3H9OA 1ZYDA 3ULIA 1PKDA 3KGAA 4RX7A 1NXKA 4IAZA 2QKWB 3MY5A 3V5PA 3TNHA 5AEPA 3BBTB 3WF6A 2OH0E 4BBFA 4BDHA 1M17A 2X4ZA 4FTIA 3UYSA 3GENA 3OT3A 4V0GA 5CF5A 1R1WA 4C4JA 5EHLA 4AW2A 5IA3A 2CGWA 3JY9A 4RC4A 1U54B 4MNEA 4DTAA 5IQFA 3FKNA 2YISA 2XK3A 3VULA 3ULZA 3R1SA 4FV3A 2BHEA 5GJFA 4U80A 4K33A 2OWBA 3EIDA 4MCVA 4EORA 3ZOSA 2GTMA 5JGAA 3C51A 4E5AX 3QX4A 4XG6A 3LXLA 2XBAA 3VS3A 4C37A 4EQUA 4PDYA 3UMXA 1H01A 4YSMA 4ANSA 4FKSA 1VZOA 4EHZA 2B54A 4IJ9A 3GBZA 4R8QA 5C27A 1XQZA 5EOBA 5FXSA 1YOJA 5CAQA 3LQ8A 3IW7A 3UO6A 3P4KA 4ASEA 4G9RA 1A06A 2VV9A 2YABA 3K2LA 3U87A 5CF4A 5E90A 2B9FA 4LOPA 1NA7A 1U4DA 4O38A 4DE4A 1BI8A 2XK4A 5LJJA 2BFXA 5CEOA 2ZM4A 5IH5A 3S00A 2O64A 2JD5A 1BYGA 1Q97A 4QMUA 3V5QA 4A7CA 4L3PA 1ZYSA 3FJQE 4TYEA 4LL0A 3F5XA 3QBNA 5JFVA 3N4TA 4BTKA 1SVHA 1Y8YA 3FI2A 3FMHA 4FZ7A 2R4BA 5GZ9A 4MNFA 4BZOA 3U6JA 3QALE 1OKVA 3E88A 4BY9E 3PRIA 5CEKA 4ERWA 5DRBA 2RFDA 3ZXZA 2XM8A 4XP3A 3I1AA 3RNYA 2WMRA 5EDRA 4O7WA 3FXXA 4MH7A 2OI4X 3E62A 5ANEA 2XNMA 3WIGA 1H24A 5GNKA 3R8ZA 5CWZA 4BCHA 2WNTA 5FXRA 4FR4A 5BPYA 2CNVA 4H1MA 4GKIA 4R5SA 1Q3DA 3BCEA 2C0TA 5T6KA 1OI9A 4RWJA 3KULA 3W10A 4CQEA 3TT0A 4F65A 3HRFA 3V6RA 4XG9A 2ERZE 1V1KA 4CFXA 2XNNA 2YAAA 5I9ZA 3ALOA 4FSZA 2FSOX 3LMIA 3CQWA 5AIRA 4UMUA 3HUCA 4IVAA 5EKOA 5CI6A 4L46A 3ZUUA 4IB0A 5HO8A 3PG3A 2W0JA 4EOPA 3WIKA 3ZEPA 3GFWA 4BI2A 5EW8A 4C62A 2VAGA 3IPHA 1OIQA 3NEWA 3DT1A 2X81A 2IO6A 4R1VA 3NW5A 1YXVA 3VUHA 4D4RA 4EZ3A 4EYMA 5KMIA 4FGRA 3GOPA 3MGYA 2BDJA 5HCXA 2YZLA 4ITHA 1XWSA 5BYYA 5LARA 3CBLA 1B38A 2RFNA 3QYWA 3RNIA 4FA2A 5A9UA 3UPZA 3RPYA 5LVNA 1E1XA 3MFSA 1H0WA 3K54A 1OL2A 3D5UA 3QX2A 2X7FA 3QUEA 5DGZA 5AX9A 5JMSA 5H2UA 4UN0C 4EI4A 5CAVA 4AZSA 1F3MC 4UMRA 5FM3A 5AV2A 1CDKA 5EH0A 4TWPA 3KN5A 3OF0A 2ZB0A 4MBLA 3TUDA 2WEVA 1UU7A 2VWXA 4HGLA 1A48A 4WKQA 2UW8A 5M57A 4IXPA 2GFSA 5FTOA 2UZTA 2C4GA 1BX6A 3C0GA 2PVYA 3DK7A 3LFFA 4M0ZA 2X0GA 3OZ6A 3IW6A 3EN9A 4BKJA 3BWFA 4FSRA 4CRLA 4D2RA 2J7TA 3IW8A 1GIHA 4LV8A 3LMGA 4C35A 4F08A 2WFYA 3MFUA 1TKIA 4E4XA 1U54A 2BZHB 4DH7A 5HX6A 4AGCA 5FBNC 4IZYA 4BGHA 5GJGA 1IRKA 4OGRA 4EH2A 4BHNA 4FKGA 3RAWA 1V0OA 5B2LA 3KQ7A 1LUFA 4LRJA 5J9YA 2OICA 2UW4A 3NVKI 4BBEA 4IC7A 4Z7GA 4MK0A 4USDA 4FTRA 3OMVA 3MWUA 5K9IA 1OL5A 3QQUA 5I3OA 4LGGA 3S95A 3ZC5A 1DI9A 4OT5A 4Z16A 3QZFA 2R3JA 3IK3A 4AFEA 5EK7A 4ASXA 4JLCA 4UMTA 2QO2A 4AP7A 1OBGA 1Q8ZA 3C7QA 4LV5A 3RHKA 3RCDA 1YVJA 3LJ2A 4AX8A 5JQ8A 3PIZA 3PY3A 4ASDA 4USEA 1FQ1B 4HOKA 4UEUA 4XNEA 4C2WA 2GS2A 3KCFA 3BE2A 2RG6A 3GEQA 4HNIA 3U9CA 4YZBA 2ITPA 5ANGA 3ID6C 2NRYA 3UP2A 2ZYBA 4ENXA 4EUTA 2XF0A 1U59A 3P0MA 4J7BA 4EJ7A 5FDPA 1O9UA 4I94A 3C5IA 2ITWA 2QU6A 3QXOA 1YXUA 1ZWSA 3G90X 4IX6A 3WYYA 3RZFA 3LJ1A 4KIQA 4FUXA 3TL8A 5EOLA 4D1XA 2CNUA 4J98A 4XUFA 4DEBA 3KMWA 4JG6A 4GIIA 2G2FA 3CE3A 5HVYA 4GL9A 1LEWA 4X2NA 3TZ7A 3JUHA 4FL1A 3BX5A 3LLTA 4OUCA 4RG0A 4ANOA 4C3PA 1Q62A 2VTMA 3R7GA 3VS5A 2C47A 5A4CA 4M69A 1L8TA 5EM6A 5FG8A 3ZO2A 4WNKA 4EWHA 3TV6A 3DBFA 2VWYA 3O50A 1RJBA 3LFEA 4IB5A 5TO8A 3BLQA 2F9GA 4DGNA 3KXGA 3PWYA 4N6YA 5FLFA 1YDSE 4P5ZA 4I0SA 4E7WA 1URWA 2BROA 2OJIA 4L00A 4O1PA 4WOVA 5IA4A 4W4VA 3PJ1A 3QQJA 5AR7A 4XG7A 4YNEA 4O1OA 4PTCA 5HG9A 5KMLA 2QR7A 4FF8A 1GIJA 5IUIA 4ANBA 4QMMA 4TYHB 5E9EA 3WF7A 4LRMA 4QMPA 4G3DA 4H3BA 3PJ3A 3ROYA 5AUYA 5CANA 4FV8A 4L8MA 4CTCA 3BYSA 3E92A 1I09A 1MRVA 2GNFA 4YGAA 4I5MA 5E7RA 1OKWA 4YTCA 2YLEA 4E93A 2ZDTA 4DFBA 4E20A 4TNDA 3GGFA 3TEIA 2XIXA 4WA9A 3DGKA 1O6KA 2GQGA 4K6ZA 4KIKA 5CX9A 3QHRA 4EOKA 4O7ZA 5IMEA 1XH7A 4IAAA 2Q0BA 4G5PA 4JNWA 4IWPA 4F9YA 5HNIX 4C02A 5HD4A 3FPMA 3UO5A 3Q9XA 2I0HA 4QYEA 3UZPA 4O91A 1HCKA 4AAAA 2P55A 1YW2A 3H0ZA 3ODZX 1UWJA 4I5CA 4JXFA 3R7OA 4FTNA 4D2WA 4AWIA 4F70A 3DBQA 1FBNA 4PP7A 4ITJA 1P4OA 4FGBA 4MHAA 3UIUA 1YRPA 5HCYA 1J7IA 1R78A 2A27A 2BVAA 3ELJA 5AP4A 3AD5A 2OXYA 5EM7A 2C68A 3ZM4A 5JFXA 3NUYA 4KRCA 2VN9A 1JBPE 4ANNA 2FSLX 4DBNA 5EDQA 3GCSA 2YA9A 1G8SA 4KBAA 5LMBA 3HMIA 5A6OA 4CNHA 2R3HA 4QP9A 3KRJA 3MVLA 1NT2A 3EJ1A 4QP8A 5IUHA 2OW3A 4X6RA 2J5FA 3SOCA 4ASZA 4BTFA 3KRLA 4OBOA 2X9FA 4UMQA 2E9PA 2XYUA 4FTOA 5AAEA 2BUJA 1OIRA 3FLWA 4I41A 4W4YA 2IVUA 5AR5A 2BTSA 4BI0A 5BUEA 1HCLA 1DI8A 5DIAA 2W9ZB 3FWQA 1F5QA 4FTCA 2Z60A 4EOQA 4DLIA 3UYTA 3ZU7A 4NCTA 4QP1A 4U6RA 5FP5A 4EH8A 4DG2E 2C5OA 3SLSA 1MUOA 4WRGA 3V01A 1ZOHA 3N51A 3R22A 4GS6A 4TYGA 3LVPA 5FDXA 5G1XA 5TKDA 3TNQB 3TNWA 4I92A 4RA4A 4RA5A 5CEMA 2PULA 3RZBA 4XV9A 2H9VA 3OWPA 3B8QA 1SM2A 4ZSGA 3RMFA 4TPTA 3PE1A 3WZEA 5HO7A 1BKXA 5IU2A 3KB7A 2NPQA 2VO0A 4JT3A 3E8DA 2WELA 4EQCA 4E6CA 5JZJA 2ITYA 1UNHA 2W06A 4M13A 3ATSA 2BRGA 2ITOA 2CGXA 4ARKA 1WFCA 1ZAOA 1K2PA 3KRWA 4OBQA 2LGCA 4A07A 5EM8A 2ZV2A 2OIBA 4AQCA 4CKRA 3BWJA 2WO6A 5ANIA 4O7YA 4QMWA 3ORMA 3CIKA 2YM6A 3SRVB 3UOHA 2YM3A 4RC2A 2JGZA 3RI1A 2E9NA 2YJSA 1J1CA 2VNWA 3SXRA 2IJMA 4BWXA 4D5HA 4DLJA 2VTOA 2WD1A 2OG8A 1ZZLA 4ZZNA 1EH4A 5HEZA 4RX9A 4GEOA 5EDPA 4I22A 4AZWA 1PXLA 4MBIA 5CTPA 2XBJA 2XIKA 4KSPA 5M07A 1ZXEA 3CR0A 4FG8A 3R04A 2QD9A 2XP2A 3P5KA 4LI5A 3VBQA 3EFLA 3WF9A 1GOLA 4GRBA 2JDSA 3BGZA 3Q2MA 3Q04A 4I6QA 2BILB 3SG8A 4EHVA 3QU0A 4C2VA 3QRIA 2UW9A 4EHGA 3KRRA 5M4CA 2HK5A 4QMQA 4AOJA 3CKWA 5EW3A 1MRUA 5D1JA 5E8WA 1H1RA 5HBEA 4QMYA 1SNXA 5AP6A 3JS2A 4MEDA 2EXEA 3HNGA 3PXRA 4RIXB 3RWPA 2XKDA 4EOIA 3FI3A 5KMKA 3VC4A 5CZIA 4QPSA 4X7QA 4Y95A 5CU6A 5BUIA 2VTSA 2C6OA 4IE9A 1PW2A 2IW9A 4BC6A 4BBMA 5BMMA 4RWLA 2PE0A 4FK6A 3F5GA 2YHVA 3EH9A 4AUAA 3UVRA 3NLBA 4ONAA 1W84A 1VYWA 2X1NA 3WZJA 5IZFA 5AP3A 4GCJA 4BYIA 3TUCA 3BU3A 2CKQA 4L01A 4ZK5A 3G0EA 5AAFA 4EHEA 4RSSA 2J0KA 5HIBA 2UVYA 2CGUA 4I24A 4QYHA 2WQBA 2ITXA 3QL8A 4IWOA 3EL7A 2P4IA 3A61A 5ANOA 3VUGA 3ORIA 5IQAA 5IG1A 3H9FA 5BYZA 4C0TA 4PNKA 3Q32A 5CAUA 2OGVA 3E8CA 2Y0AA 4RRVA 4BDDA 4EK6A 4C4IA 2OU7A 3OCSA 5AM7A 4YLJA 3VRZA 4F1OA 2HENA 4FTLA 4J95A 4UYAA 4F4PA 4QMNA 1H25A 4YZCA 4KNBA 3A2CA 3QCXA 3OT8A 3GVUA 4JIAA 4FNYA 4M66A 4O27B 1IAJA 2J0JA 4WT6A 4O86A 5E8TA 2WTWA 1FVRA 1H27A 3W32A 3LXNA 4RZWA 3CGFA 5J9LA 5DT3A 4Q2AA 3UVQA 3WOWA 4EK4A 2F49A 1P2AA 4LMNA 5I9VA 2UZUE 1YWNA 3FLQA 2QLUA 4R7BA 3RHXA 3FAAA 4IJPA 3DAJA 3GC0A 5HLPA 4M7IA 2UZEA 3JXWA 3PSCA 3FLSA 2V0DA 1KE6A 2R3FA 2P0CA 4MBJA 4BCIA 2YM7A 1STCE 2Y4PA 4AOIA 3AC3A 1F0QA 1Q24A 4LFIA 4UV0A 5CT7A 3RJCA 3TV7A 4ACDA 3AT4A 4F6WA 3CTJA 4NSTA 4NUSA 4RFMA 3MYGA 3CJFA 3Q5ZA 4IDVA 5DR6A 3VBWA 3HV7A 2R3OA 2H34A 1VEBA 1OMWA 2BRBA 3AC4A 3FZTA 3GC7A 3I7BA 3R21A 4FSMA 4C4EA 5I3RA 3N4UA 4QP6A 3KREA 4F1TA 1OL1A 1UU8A 4ZTLA 4ITIA 4FTUA 4IZ5A 4QPAA 4NEUA 5DI1A 4CRSA 1H0VA 2XIZA 3UO4A 2PTKA 5KHWA 4FEXA 5EQPA 3P7BA 3DV3A 5L8JA 4IEBA 3RM7A 3M42A 3ORLA 3PPKA 1M2QA 3E7VA 4Y5HA 4NTSA 2ZV8A 4O7LA 4M69B 2W5AA 4IAFA 1UNGA 3MVHA 5DOSA 3R83A 4DT8A 1IASA 2VNYA 4CT1A 1NW1A 4RFYA 2CJMA 5EYCA 3LE6A 2F7XE 5KE0A 3ZFYA 5HNGA 3WZKA 2C5NA 3W16A 3GOKA 3V8SA 3DFAA 4YLLA 4QYYA 5DR9A 3VS4A 5LVPA 2RSVA 2CN5A 2WHBA 4FNZA 3MDYA 4WBOA 4CMUA 1OL7A 3IW4A 5IA1A 2XZSA 3O7LB 2W17A 3NYXA 2ZAZA 3ZLYA 3KXXA 4G17A 5D41A 3FZOA 3OBJA 4ZY6A 2C3LA 3CY2A 4QYGA 4O0YA 4L6QA 5CVGA 4D55A 4ZSEA 2PY3A 4WG4A 1SVEA 4CV9A 2OXXA 2XEYA 4DEGA 3O7LD 3BKBA 4FV4A 4QMVA 3PY1A 4B0GA 5AADA 1WBVA 4MQ2A 1RW8A 2B9JA 5HU3A 4HGSA 4IM0A 3QTIA 4FNXA 2BKZA 1V0BA 4QP4A 3I5NA 2W1FA 3MB6A 4A06A 2C1BA 1Z5MA 3EFWA 3OHTA 3TTJA 3U4UA 4P4CA 4FV7A 3OEFX 3MIAA 5IQIA 1Q8TA 3R7UA 5KBQA 4BRXA 4N70A 4FKIA 4HVHA 4WNMA 3ZFMA 4XEYA 4ALWA 3OUNB 2UZOA 4WSQA 2CSNA 2PMOX 2VZ6A 4OW8A 3HAVA 3ORKA 4U5JA 3Q3BA 3ATTA 2XYNA 2YIXA 4FVRA 3NUNA 4EC8A 1KE7A 5KMNA 2XRUA 3RK5A 1WMKA 3COHA 4B8MA 1NY3A 3MJ2A 3BLHA 2JDVA 2I0VA 3F82A 4JQ7A 4PQNA 4F0IA 2R2PA 5ANDA 2XIRA 1VYZA 2P2HA 3A62A 3FBVA 1JWHA 3DBEA 4TYIA 1FGKA 1JOWB 3D9VA 3I5ZA 2RGPA 5KZIA 5GZ8A 2CKOA 3EB0A 4NM5A 5CSWA 2JIUA 3F3VA 2ZMCA 4ZTSA 3F6XA 4MTAA 5FGKA 2FO0A 3NWWA 5BQ0A 1WBOA 4DYMA 3WYXA 5FTGA 1JKSA 3OCTA 4BTMA 5DHJA 3SXFA 4S33A 5HBJA 3KA0A 2B9IA 5M4UA 3EQPA 5LMKA 1U46A 3ZXTA 4II5A 4IVCA 4D9TA 3NS9A 1YI3A 4NFMA 3QRUA 4PY1A 5L8KA 4NKSA 2SRCA 4I4EA 1P5EA 2WB8A 2CNQA 3ANRA 3IGOA 4W9XA 3QKMA 5T68A 2J5EA 4MXCA 3CSVA 4IAIA 4D9UA 4O6EA 4YBJA 2C6EA 4RFZA 2XJ2A 5CT0A 2CLXA 1GZKA 3PSDA 1JKKA 2ZB1A 3TJDA 2GNGA 2WMAA 5JEBA 4QRCA 1GY3A 2H6DA 2X8EA 5CALA 5BYLA 1FPUA 5CSPA 3R9HA 4E73A 3NDMA 3QKLA 1XBBA 3R9NA 4G6OA 4IX4A 4MWHA 3T3UA 3CXWA 4FKTA 3PXKA 4BDAA 3GU5A 3VF9A 4J96A 2ONLA 3UC3A 5ACBC 4QTEA 4R3RA 3RBWA 2QG7A 4DEEA 2PE1A 4DCEA 2PVJA 1WBSA 3R0TA 1QPEA 1YKRA 2JBPA 5H8GA 4UXQA 4CFWA 1PMUA 5ICPA 3V8TA 4GJ3A 2V5QA 4BTJA 1FOTA 4X3FA 2W4KA 2XA4A 2OJGA 4YU2A 1XR1A 5CF6A 2W1DA 2WTKB 4AW5A 2BFYA 5CU3A 4FKUA 2P33A 2B55A 3U8WA 5CU4A 3W33A 1M2RA 2C5YA 5E4HA 3DPKA 3DBDA 3DU8A 2EVAA 1HOWA 3A7GA 4MXXA 3OP5A 4FK3A 3UE4A 1U5QA 2PVKA 2R3PA 4RIYA 5DT0A 4KSQA 2O65A 3PVGA 2W1GA 3QTQA 3VIDA 3VHEA 4BDJA 3NGAA 3VO3A 5GHVA 1H28A 2PVHA 4BWPA 2QONA 2R9SA 2CKPA 4F7NA 2HY81 3LCTA 5AA8A 3DJ7A 2X9EA 2JFLA 1XO2B 4NWMA 4M15A 4GVAA 3RPVA 3MSSA 4I21A 1ND4A 5IQHA 3LXPA 4D1ZA 2EWAA 3C4ZA 2BAKA 4G2FA 4J8MA 4MXAA 4PNIA 1KE8A 4ZSJA 4CZTA 3FV8A 3VS1A 3I60A 2CCIA 3CQUA 2C5XA 4A4XA 4JG8A 3QTXA 3UDBA 3UVPA 4B99A 4C4FA 1DS5A 2QOLA 4FV6A 4L68A 2PE2A 4MD8E 2IZUA 5AP2A 4C7TA 2XNEA 4GIHA 4YJPA 5C8KA 4FC0A 5AMNA 2VU3A 3NMUF 2OF4A 1CSNA 1S9JA 4RVMA 5L8LA 2WMUA 4HPUE 5KZ0A 5I9YA 4S34A 4GH2A 4OAUC 1PXJA 2CPKE 3ORXA 3TUBA 4CMTA 2BALA 4UWBA 4DG0E 3PTGA 4DITA 1XHAA 4FEQA 5EHYA 2R7IA 3SQQA 1FGIA 3KU2A 3PA5A 4EH4A 3FUPA 4OAVB 4MAOA 3SG9A 2IW8A 3RVGA 3COKA 2PUUA 4ZTRA 2X2LA 3QAME 5JFSA 3W1FA 2XVDA 2Y4IB 2ITQA 3LFNA 1ZRZA 4NL0A 1PXNA 4YZDA 3RALA 1IA8A 4AZEA 4RIOA 1BUHA 3R01A 4FT0A 2OO8X 2QO7A 1UU9A 3I79A 2YCQA 4MF0A 2C30A 3O8TA 3S0OA 4BR3A 2DS1A 5C4LA 5K3YA 5M4FA 3UPXA 1T45A 4NCTC 1T46A 4F7LA 5C26A 2VWBA 3A7JA 4O0UA 4RZVA 3PDTA 1Z57A 4AT3A 3SW7A 2UZDA 3MY0A 5GIOE 5FP6A 3A4PA 3SOAA 3AQVA 4ZP5A 5JRSA 4UZHA 5HOAA 4C4GA 4I23A 4EH3A 4G1WA 4FZ6A 4PMMA 3KXHA 3OOGA 3VS0A 4WBBB 4E8AA 5LQFA 4XBUA 4PL4A 4RJ7A 1SNUA 1IEPA 4RC3A 5L4QA 3ZUVA 1APME 3FYJX 4L3JA 4JL9A 2QG5A 3VBVA 4CQGA 3REPA 3QA0A 4D2TA 3QZGA 3O51A 4FOBA 4KD1A 3UG2A 4MXZA 5H8EA 4Z9LA 3QRTA 4JDHA 5J1VA 2PZPA 5K5XA 3I6WA 2UW3A 3FLYA 1AQ1A 2WTJA 1H1WA 3LHJA 4FSYA 4YJTA 4RBLA 4OTDA 2OKRA 4JX3A 3IKAA 3HKOA 5K4JA 4H05A 3PUPA 3BZ3A 1M2PA 4FV1A 4DA5A 2OLCA 3ORZA 4OTHA 4F9AA 3PVWA 2YACA 3PWDA 2ZM3A 5C03A 5CAPA 2VTQA 4KBCA 1JSTA 3EQBA 3F7ZA 3OBGA 4BDFA 4IHPA 3V8WA 4QQCA 4JDIA 2GHMA 4YNOA 4NM7A 1Q8UA 4A9TA 4RIWA 1Q99A 2BDWA 2Y8OA 2J2IB 2YCRA 4YJQA 2BMCA 3QD2B 3GCUA 3UIXA 5CZHA 3ACKA 4G16A 3S2PA 3AD6A 3R1QA 2PL0A 2HZ0A 3NZ0A 2R3QA 2PZYA 2AC3A 4CYIA 4IM2A 2X8DA 5E8SA 4RT7A 2WQEA 4I6FA 3VBYA 3QWJA 2BRNA 2WAJA 4LG4A 3I6UA 3ZH8A 1ERKA 4HNFA 4NT4A 4UZDA 5IQBA 5HX8A 4IB1A 3RGFA 2AYPA 5LWMA 3OXIA 5E1SA 4HPTE 4RJ3A 5E91A 5IKWA 3TWJA 4OTQA 4AZFA 3LCSA 1ZLTA 5L2IA 3C5UA 3MFTA 4IFCA 5LMAA 2H8HA 4EZ7A 3OTUA 3TKHA 2X6DA 3UOKA 1OIYA 2YAKA 4XBRA 4D4VA 2YZAA 3WE8A 4PDSA 4MX9A 3GP0A 2R0IA 4ZTHA 2GMXA 3UTOA 3LCOA 3AG9A 4HVDA 4B6LA 4JBVA 5KUPA 3E87A 3O2MA 2JAVA 4AGUA 2ZOQA 5DG5A 4K8AA 3WZUA 3NNWA 3D15A 4K77A 2FYSA 3EWHA 4EUUA 2VTPA 5CAOA 3D5VA 4N4SA 4RJ6A 5CI7A 2OZAA 4RX5A 1U5RA 3R8LA 5ANKA 2GNHA 4GT5A 5F94A 3Q60A 4WRSA 5CSVA 4LL5A 2WQNA 3EQCA 3HGKA 4YP8A 5HE1A 4I4FA 4E26A 1YHWA 2CMWA 4FZAB 1E9HA 4AGWA 3LCDA 2VX1A 4BDCA 3DJ6A 1G3NA 3E3BX 3UNJA 4FIJA 3D2IA 4CYJA 4RLKA 4ZLZA 4QNYA 3C0IA 3Q9ZA 3VQHA 5CXZA 3E3PA 4Z7HA 5DMZA 2V7AA 3HMPA 2HIWA 4FZDB 4U42A 1UNLA 5KNJA 4NU1A 2EU9A 3HUBA 3U6IA 4O7NA 1E1VA 3IO7A 3NX8A 4QO9A 4CG8A 3HLLA 2JKOA 4BIBA 3MH0A 5HTIA 3OW4A 3HECA 2W1ZA 1WVXA 3QHWA 2BRHA 4FI1A 4WG3A 3LAUA 2VWUA 4M67A 4CZUA 4DH1A 3AT2A 3IOPA 3UGCA 1FINA 2IZTA 3EZRA 3FHRA 3T9IA 2C1AA 2GNLA 5LVOA 4AS0A 2ONLC 2YDJA 4O96A 4UWYA 3II5A 5HO6A 4C8BA 3NVMB 2XJ0A 2J6MA 3BEAA 4BGQA 2KULA 2XM9A 3VUTA 4IZAA 4PWNA 1MQBA 4L7SA 5J9ZA 2FH9A 3I7CA 1UU3A 4I5PA 4CKIA 4L67A 4D2SA 3DK3A 5HVJA 2P2IA 5IUGA 4JG7A 3R00A 5M56A 4AF3A 3MH2A 4FTMA 4CT2A 2W7XA 2XJ1A 4S2ZA 2UZLA 5IEXA 3IDPA 5LCJA 5EI2A 2UZBA 2ZM1A 3D5XA 3E93A 2XNOA 3G5DA 3GB2A 2PUIA 3DB8A 5FWKK 2WXVA 4JI9A 2F57A 3DAKA 1YXSA 2NP8A 3L9LA 4FVQA 4G3GA 4I0TA 3WI6A 4QMOA 4IBMA 2OFVA 2YM5A 2Z7SA 4G31A 4RQKA 3TIZA 5EYKA 4AA4A 3PLSA 1OZ1A 3IOKA 3ZC6A 3DXPA 3SV0A 4HVSA 4X3FB 3ROCA 4BCFA 4EH9A 4HCUA 4FKQA 3ZONA 3TJCA 3GCQA 3H10A 5AP7A 2VUWA 3GT8A 4KABA 1PXOA 2NO3A 4XCUA 4YHFA 3RINA 4EOOA 4OT6A 4TY1A 4G3FA 4E1ZA 3CD8A 2WQMA 3AC2A 3A4OX 3EN6A 3L8XA 1XJDA 3OC1A 3OUKA 4U81A 4APPA 4YURA 1Y8GA 5JK3A 3PIXA 4ACGA 4ZTNA 4ACCA 4BGGA 3EQFA 3H0YA 4AW0A 2I6LA 4WUAA 4FOCA 4PTEA 1YHSA 4UXLA 5B0XA 2UW7A 4E4NA 5FUTA 5IA5A 4L52A 4PPCA 3VUKA 3A7IA 5DR2A 3KULB 4H1JA 1J3HA 5KMOA 4W8EA 3TIYA 4DFZE 5K4IA 2GQRA 5E8VA 4JJRA 5TT7A 2GPHA 4ZEGA 2GCDA 5HNBA 5C8MA 3FMNA 3LM5A 5D12A 2YERA 4FV2A 3ZZEA 2PZ5A 1QPDA 2PZIA 3DZQA 4BIEA 4CVAA 3LXKA 1OKZA 2W1EA 4FSQA 3B8RA 4C36A 4CD0A 4KWPA 4N6ZA 4DEIA 5DRDA 1OPKA 3IW5A 4FG7A 5LXMA 1H4LA 3S4QA 3VNTA 4YTHA 2OJ9A 3E63A 3QRKA 4R7HA 5HORA 5I5ZA 3PA4A 3BYVA 5IEVA 3W2QA 2VO6A 4IMYA 4M68A 4KKGA 2BZIB 2VD5A 3OW3A 4CFVA 2GNIA 5BX0A 4YJSA 1YWRA 4Y8DA 5KBRA 3MH1A 5JSMA 3RPSA 3TKUA 1KSWA 4FKRA 3MTFA 5EQYA 3U54A 3D5WA 5G6VA 1YOLA 3ITZA 1XKKA 1NVRA 3EQDA 4U3YA 1URCA 4PP9A 4YPSA 1OUYA 4DGGA 3HL7A 5I9UA 4D5KA 3OWKA 1KE5A 4Y83A 5AWMA 3LPBA 4CV8A 4BCJA 3MS9A 3EYGA 4A9UA 2WOTA 1B39A 5J95A 5TOZA 3JPVA 1PRYA 3QFVA 1GZ8A 2ESMA 2DYLA 3PA3A 3Q96A 5IQDA 5J79A 4E5BA 4O82A 4PL3A 4TZRA 3MY1A 4WNOA 4ALUA 4FKLA 4BCKA 4FTKA 1H00A 4NKAA 4X2KA 1OPJA 2R3RA 5CVFA 5DVRA 5F20A 3P7CA 3FLNC 1G8AA 5J1WA 2B7AA 3AGMA 4JRNA 5TE0A 2OK1A 4IVBA 3KRXA 5IEYA 5JFWA 4E6QA 5HGIA 2X8IA 2G01A 4M0YA 2IVTA 5B2KA 3LM0A 4FKVA 5HTCA 3GC9A 3NYOA 4KINA 3KFAA 4F0GA 4GSBA 5IMXA 3CPCA 2C5VA 1W0XC 2WMVA 2ITTA 3RAIA 3U9NA 3CC6A 4EBVA 4CKJA 5ETIA 2VRXA 4DEAA 3TTIA 1OVEA 3OXTA 2R64A 3FQHA 2HZNA 1Q5KA 4XRJA 2HZ4A 2X6EA 3ZMMA 4D2PA 3IQ7A 1M14A 3AD4A 2OIDA 2PVFA 2Z7QA 4BL1A 1WZYA 4YSJA 3FY2A 5A54A 2O5KA 3K3IA 5J5SA 3PP1A 4AOTA 4I20A 3R2BA 4RPVA 5GIPE 4FKWA 5DWRA 4R6VA 1PXKA 2QQ7A 2C6TA 1Q8WA 2REIA 4D1SA 3CP9A 2W5BA 3ZRKA 3NR9A 3W2OA 1ZARA 4ORKA 2PZRA 4U9AA 3BGQA 1M7QA 4XLIA 1H08A 1SVGA 3QKKA 3VWAA 3EN5A 4BF2A 1JAMA 4ANMA 4QQ5A 3HRCA 5DBXA 4UWCA 3ZDUA 3AC1A 2RIOA 5BVNA 1PHKA 3Q9YA 2HZIA 3R9DA 4V04A 4BCNA 2VGOA 4U41A 2IZRA 4C38A 3R7IA 1XH4A 2IZSA 2JKKA 4WG5A 4YJRA 3T3VA 3ENHA 1YDTE 2YM4A 1PXMA 2W05A 3A7FA 3HA6A 3LFQA 3PFQA 4XH6A 5AR3A 5IDPA 5K5NA 3NUPA 1R0EA 1LR4A 4FX3A 4EH5A 4Q9ZA 4O7SA 4DF3A 3HAMA 2J90A 3KXMA 3QZIA 3U51A 1M7NA 3F3ZA 4BHZA 4GKHA 5D9HA 4C58A 5J7BA 3PRFA 2VWZA 3PPJA 2G15A 3EN4A 2XKCA 1W7HA 4V05A 4FTTA 3UC4A 3L1SA 4U0IA 1ZMUA 3OS3A 5M08A 1DAYA 4B8LA 3DBCA 3QCQA 2WOUA 5HU9A 2R0UA 4K0YA 3B2WA 5A6NA 3ANQA 3UIMA 4TTHB 2VX0A 4AZVA 4EK5A 1GNGA 1PF8A 3QQGA 5IQCA 2OZAB 5H9BA 2JKQA 2OXDA 2YIRA 3MA3A 4Q5EA 5DE2A 4U40A 5KMJA 4AZTA 2HXLA 3RM6A 3KK8A 4M12A 4UBAA 2J9MA 2EXCX 2QVSE 4HJOA 2IG7A 4JBOA 3S3IA 4XOZA 2RFEA 4FIEA 1H1PA 1P14A 3DZOA 3RKBA 4RLLA 1ZYJA 3O71A 2XNPA 3F69A 4TWNA 3NAYA 4ACMA 4HZRA 4DH8A 3BU6A 5EYMA 2GS7A 4YO4A 5L2SA 3CPBA 4IADA 4O0TA 4TKSA 4AN2A 3MFRA 4C4HA 4BCOA 3PSBA 3DJ5A 3JY0A 5CLPA 4FE2A 4GUBA 2BDFA 4U45A 4WSYA 5ETAA 5AR4A 3NW6A 2E2BA 4AN9A 4BI1A 1K9AA 4PRJA 4FYNA 4GW8A 3QQHA 4K18A 3QWKA 5AV1A 1BL6A 3I0OA 5HKMA 5J7HA 1H1QA 3ERKA 2YIWA 1RQQA 1Y6BA 4GYGA 3C1XA 4H36A 4IW0A 2W96B 2QOFA 1J1BA 3KN6A 2WTVA 3EL8A 1NVSA 3DQXA 4IB3A 5DEWA 5HHWA 4ZSAA 4FVPA 4E5WA 2PVNA 2XKFA 4GT3A 3W18A 2BKKA 2FSTX 3KMMA 4ZS4A 5BVDA 2QCSA 4C33A 2HCKA 5AUUA 4HZSA 3RAKA 3HYHA 4GUEA 4RQVA 4FL3A 2BZKB 2GHGA 3RP9A 3F2NA 4J99A 4KIOA 3VHKA 2EXMA 3ORPA 3W2PA 4O84A 4DBXA 4EZ5A 2PHKA 3ZZWA 4R5YA 4ZJVA 4AA0A 4DCAA 1J7UA 2R3KA 3D14A 2FGIA 4O0XA 4AGDA 2XNBA 3V04A 3POOA 3NUAA 1XBAA 3C4EA 2JEDA 3NW7A 4AW1A 2B0QA 1UA2A 1J7LA 4IZ7A 2WPAA 4TW9A 5I0BA 5IQEA 1H8FA 3F66A 3BHYA 4F99A 2A2AA 4OTWA 4RWKA 5H3QA 4EOJA 2EUFB 4QMXA 1Y91A 4TXCA 5IPJA 1MRYA 3VBXA 5TR6A 3NYVA 2BAJA 3CQEA 4RVLA 1YXTA 1L3RE 2WMTA 4GK2A 4C57A 5HTBA 3EFKA 1UVRA 3F61A 4KIPA 3TACA 4XV2A 3LOKA 3NAXA 1DAWA 5AUWA 3D7TB 4TWCA 5CQWA 4PMSA 3R9OA 2UV2A 4EK8A 5A4QA 4S31A 4EKKA 4R77A 2IVVA 3SD0A 4ZOGA 5IQGA 3BQRA 3BV2A 3HVCA 3UBDA 1GIIA 4O6LA 1YWVA 3ORNA 4G3EA 4J1RA 2E9OA 2XCHA 4ZZOA 4U43A 4KUJA 3EHAA 4LOOA 2WIPA 3DQWA 3KXNA 4AT4A 3G0FA 1XH5A 3OCBA 3NSZA 5IH6A 3SA0A 2X2KA 4Y73A 4IAKA 4FIHA 4ZTQA 1CTPE 2C69A 3D83A 4PDOA 3AMBA 2CKEA 2JDRA 2Y6MA 4FKPA 4YC6A 5CASA 2XK7A 3SXSA 5GZAA 3PJCA 1ZOGA 2WTDA 3L8VA 4FT3A 3W2RA 3Q9WA 3G15A 3COMA 4G6LA 4PL5A 3R2YA 5LCKA 2VTRA 3DXQA 4GK4A 3SKCA 3DDPA 4I1ZA 4IWDA 4RJ5A 5EI6A 3FI8A 2WGJA 3QD3A 5BVKA 3SVVA 5ACKA 2B53A 1UKHA 3PJ8A 1CKPA 3C4WA 3HMOA 4XX9A 4MXOA 5K0KA 2ZVAA 3MB7A 3U6HA 3MESA 4G6NA 5LVLA 4FTJA 3BLRA 5I4NA 4TL0A 4NH1A 3LJ0A 3BI6A 1Q3WA 5AV4A 5DH3A 2DUVA 3MBLA 4FT7A 3MTLA 4GK3A 3AC8A 2HY0A 3BHVA 4NTTA 3BU5A 3ORTA 4KA3A 4NK9A 4LQMA 4P2KA 1YOMA 4O22A 3FE3A 3R63A 4IM3A 3S1HA 1H26A 2Z8CA 4NM0A 1WCCA 5DFPA 4PPAA 4DT9A 2OFUA 2JC6A 2Z7LA 4WUNA 5I9XA 5JT2A 2QOHA 2J50A 1AD5A 2W9FB 1YHVA 3P7AA 3OWLA 2ITVA 4FTQA 4YZ9A 4XLVA 2QOOA 5CQUA 4P7EA 5AR8A 5LVMA 2CLQA 1QPJA 1O6LA 2RL5A 3MIYA 5AP5A 3K5UA 3EZVA 3FHIA 5FXQA 3PLAE 2W1HA 1PMVA 2G2HA 1PXIA 2QKRA 3F3UA 3OVVA 4TRLA 3SDJA 2R3MA 3IDCA 3ZRLA 4EC9A 1W82A 1OKYA 3D7TA 3HDNA 4BVUA 5HG5A 2YCFA 2C3JA 3DCVA 5JZNA 2QR8A 3RPRA 3E64A 3WF5A 4O83A 3C9WA 5AAGA 4FODA 4IANA 4ZTMA 4XYFA 3K3JA 4W9WA 2WMSA 5JGBA 3LFBA 3DFCB 4OTGA 4XOYA 2BIYA 3VUIA 4EWQA 3HA8A 4OR5A 2JKMA 4W4XA 4BZNA 2BTRA 4G9CA 2WQOA 4P5QA 4KKHA 4Z55A 4YZNA 3DOGA 4PX6A 2B1PA 3VN9A 4EOLA 2C3KA 2GNJA 2W4OA 2B9HA 4YHTA 1R3CA 3ZRMA 3KF7A 3PG1A 3NRMA 5IDNA 2ITZA 4F7JA 3PZEA 3E5AA 5HBHA 3O8PA 3OWJA 3QQKA 4D0XA 5LOHA 4UB7A 5E8UA 3TXOA 1JKTA 3F9NA 2PVLA 2VO7A 3OFMA 5AV3A 4K2RA 3BYUA 3HV3A 4K9YA 4XG8A 3R7YA 3RK9A 3E8EA 5EM5A 3G6GA 1BI7A 4OTFA 5F4NA 5AV0A 3ZBFA 3H3CA 3CS9A 3NYNA 4HYSA 1PKGA 4Q9SA 4ZJJA 3VW6A 4ACHA 4V0GB 3LFDA 1R0PA 5KKRB 1W98A 3FEGA 2VWIA 4EBWA 5JGDA 2H96A 4XMOA 3EKNA 4X2FA 3G2FA 5BNJA 4KRDA 2XCKA 2WTIA 4CFNA 4RGJA 5EKNA 5AFVA 1IA9A 1FMOE 1CM8A 1G5SA 2CCHA 4MXYA 2HYYA 3N9XA 4C59A 4N57A 3ZM9A 3C4XA 3KEXA 3UQCA 1PMNA 3HV4A 1OPLA 1CKJA 3POZA 3PYYA 4WHZA 4O7TA 2OIQA 2BHHA 5H8BA 4H58A 1REJA 3TNPC 5JN2A 4RIYB 4FEWA 2F4JA 3QXPA 1JKLA 2NNWB 4RWIA 4O0RA 5CXHA 5KX8A 3MVJA 2R3NA 2I0EA 2QHMA 2JIVA 5L2TA 1JVPP 4IWQA 3R7EA 3EQRA 2CGVA 3FLZA 4GYIA 4IIRA 4W8DA 3U4WA 3R8PA 4E4MA 1FVTA 2XRWA 3RPOA 3THBA 1RE8A 4W4WA 4BDBA 3MVMA 3TDVA 3WILA 3T8OA 2C6LA 4ERKA 3DXNA 3R8VA 5E1EA 4A4LA 4QTDA 2ITNA 4KKEA 1A9UA 3C4CA 4FICA 4JOAA 3C13A 2Q83A 4D2VA 4XP0A 4YJVA 3TV4A 1GZOA 5BVFA 1TQPA 1JQHA 4MKCA 4QMSA 2I1MA 3W55A 3KK9A 4U97A 2UW5A 2ZMDA 4OTRA 5A14A 3EQIA 5HQ0A 2ETRA 2BPMA 4IVDA 4FSTA 4TNBA 3KXZA 4IQ6A 5I9WA 3JVRA 3RAHA 2J0LA 4LOQA 4NM3A 4ZLYA 3DNDA 1QCFA 4L3LA 4AG8A 4LUDA 1YQJA 1YDRE 3CTQA 4RMZA 3V51A 5D10A 3F88A 5AR2A 4CXAA 2BCJA 3BEGA 4E3CA 5LWNA 3KVXA 3ZO4A 2HOGA 4GU9A 4C3FA 4ANQA 4O2PA 5HLNA 3BGPA 3GFEA 4ZY5A 3L9MA 3ETAA 3JVSA 4EH6A 3DA6A 1SZMA 4FL2A 1GZNA 2FSMX 4CFUA 3FZ1A 3R71A 3NNVA 3DY7A 2NRUA 3OY1A 5EHOA 5DN3A 2OF2A 2UZWE 3AOXA 4PMTA 3V5LA 4L42A 3C50A 4ZMEA 3VJOA 2CN8A 4AFJA 3NUSA 3R1YA 4YUQA 2R5TA 5AA9A 1KUTA 4M97A 4OTPA 3LFSA 3UMWA 2IN6A 4EOSA 4FBXA 4PDPA 3L9PA 2C6KA 4RIWB 5EQEA 2C6DA 2C6IA 4FSNA 2OH4A 2YIYA 5BVEA 3UZRA 5HLWA 3R30A 4KS8A 1ZY5A 4YTIA 1KV2A 3RTPA 4ZZMA 2I7QA 3UODA 3ZBXA 4BIDA 5M09A 4Z3VA 4WO5A 4UX9A 1YI6A 4ZAUA 3NCZA 3DDQA 4FG9A 4YZMA 4DG3E 2BIKB 1WVYA 4DEDA 3AXWA 4XG4A 4HVIA 1P4FA 5FD2A 2GQSA 4CCBA 4O0WA 3DKOA 2VTJA 3ZYAA 3MI9A 4QQTA 5JH6A 2C0IA 4TT7A 4S30A 3HP2A 3QYZA 3Q53A 1KE9A 4CLJA 3M2WA 3H4JA 4BZDA 3OOMA 4DFYA 2J4ZA 4HCTA 4MVFA 4PUZA 3WARA 3O23A 3FXZA 4CGAA 4XV1A 3FXWA 4DHFA 4NZWB 4XJ0A 4NJ3A 3GCPA 4I6HA 1W8CA 4K1BA 2IW6A 4FMQA 3V5TA 1GAGA 4AA5A 4IH8A 2PK9A 3Q5IA 3LIJA 4ID7A 1ZMWA 3QD0A 4X3FC 3DB6A 2J0IA
chains in the Genus database with same CATH superfamily
3LFAA 5FEDA 2E9VA 4YO6A 2UW6A 5BVOA 4BYJA 2YCSA 3QC9A 1FMKA 3KCKA 3AMAA 1XH9A 2A0CX 2W99B 2Y4IC 3P86A 4AE6A 3O8UA 4A9RA 4X2JA 5L2WA 3A8XA 3MJ1A 4EK3A 2Z2WA 3MA6A 4EL9A 1XH6A 1TQMA 2X39A 5CS6A 3TNIA 2JDOA 1ATPE 2X7OA 3KF4A 5HIDA 1Q8YA 2ERKA 2WTCA 3KVWA 5BVWA 4GFOA 4FEVA 5JRQA 3LZBA 3A8WA 4ZXTA 5JQ5A 5HE0A 1IR3A 1WBTA 4CTBA 4CZYB 3QCSA 4Y5QA 5DYJA 2F2CB 4BKZA 3PPZA 3FMDA 2I40A 2VTHA 4FIIA 4FIGA 2Y7JA 4I3ZA 1O6YA 4CEGA 3G33A 1GJOA 5AM6A 2W1CA 3GU8A 3AT3A 3HRBA 4WD5A 4YLKA 2YLFA 3AMYA 3OROA 4EYJA 2OJFE 2X0PA 4J8NA 4MYGA 4I93A 4E4LA 1UWHA 2XANA 1CKIA 3VQUA 4QQJA 2DWBA 2CDZA 3NNUA 4FSUA 2WKMA 4F9WA 5BMSA 5CVHA 3DLSA 2XS0A 4CG9A 3VAPA 5CU0A 4RJ8A 3BHHA 3NNXA 1PXPA 4YBKA 3CEKA 5M55A 4U8ZA 4GG5A 3MN3A 4IDTA 2JITA 3FQSA 3UP7A 4M8TA 1KOBA 5AP1A 4G3CA 4EKLA 4HYHA 5HVKA 3FY0A 3KIOC 3HZTA 3FPQA 2QI8A 3VUDA 4CMOA 3FC1X 3H9RA 2UVZA 4AXDA 3UIBA 3WF8A 2PUPA 5GJDA 4H3QA 4LRKA 5HE2A 3PVUA 1J91A 4RX8A 1OGUA 2O63A 4O7RA 3PP0A 5ETFA 1OM1A 3QUPA 1Y57A 4MF1A 5EYDA 2WTKC 1ZY4A 1IAHA 4L53A 3IG7A 4BDIA 3BQCA 3G51A 3UG1A 5CY3A 2XB7A 3ZLSA 1M52A 4DAWA 3ML1A 3G9NA 4XHKB 4CLIA 2QOIA 3HEGA 4X6QC 1MP8A 3MPMA 4BN1A 4X0MA 4IX3A 4F64A 3R28A 5E8ZA 2UUEA 3R02A 3SAYA 4LGDA 4FKOA 5HZNA 3GCVA 5CSXA 4LYNA 4DFXE 4EJNA 2VTAA 4R3PA 4JQEA 3ZO3A 4JDKA 4ZLOA 4TYJA 3DKFA 2VWWA 3BRBA 5CNNA 4H3PA 5HE3A 4BCQA 2ZJWA 5AUTA 5DLSA 4J53A 2HW7A 2PYWA 3WZDA 2WMXA 2XK9A 4O4EA 3V5WA 3LKMA 3P08A 2KTYA 1DM2A 2WU6A 3VRYA 1NVQA 3PVBA 2AQXA 3E8NA 4TWOA 3R9RA 3ALNA 4ZIMA 5AP0A 5ETCA 3QTRA 5IA2A 4QPMA 3BYMA 3CY3A 3Q2JA 3IDBA 4FV9A 2FUMA 4DEHA 3FMMA 4Q5HA 3ZSGA 3QTZA 1OL6A 3B2TA 3FL5A 3PJ2A 3EOCA 5EI8A 4F1MA 2QURA 3NIEA 5JKGA 3F2RA 3JR1A 1JSVA 3HMMA 1SMHA 5J5TA 2GTNA 2W5HA 3O0GA 4M14A 3HMNA 4EQMA 5C8NA 2VTIA 1VLRA 4LMUA 2BRMA 3CLYA 2YDKA 3MPAA 2YN8A 3D94A 1W83A 3PUFC 4PF4A 4FT9A 5KMMA 4IC8A 3EQGA 4O7VA 3W0PA 2LAVA 5HD7A 5KKRC 4I0RA 3FZPA 3DAEA 3GNIB 5AX3A 1OGYA 3BHUA 3GUBA 4B9DA 5L6OA 2FA2A 2O0UA 1SYKA 4QNAA 1X8BA 1ZOEA 3EFJA 2UVXA 5FTQA 3OG7A 2CHLA 4DH3A 1ZYLA 4QP3A 5CEQA 1KWPA 2VX3A 4YC3A 3GU6A 3QQFA 4LM5A 3P78A 3QTWA 4O4FA 1YI4A 5HIEA 2A4LA 5D7AA 5EFQA 2DQ7X 4YC8A 2PMNX 4QMZA 2HWPA 3P79A 4JAIA 4QYFA 4AN3A 5M51A 1YXXA 3Q6WA 5CYIA 4HW7A 4D28A 1B6CB 1S9IA 4FUYA 4J52A 4FV5A 2BR1A 3ZFXA 5ANJA 3Q4TA 4S32A 4R78A 4XG3A 2B4SB 4ALVA 4FEUA 5IH4A 1JSUA 1TVOA 2ITUA 3Q4ZA 1V0PA 3C4FA 3FQEA 5KO1A 3FSKA 2WEIA 3DLZA 3QRJA 4PTGA 4R7IA 4O81A 3ZEWA 5DEYA 3FSFA 2Z02A 3U55A 4YPDA 4O0VA 4BCMA 4FKJA 1Q41A 2RF9A 4PPBA 4F63A 3R73A 3QA8A 3D7ZA 4CFMA 2B52A 3H30A 3L8PA 3Q4CA 4DFUA 2A19B 2ZDUA 4ZMFA 5DT4A 3BELA 4BCGA 3BBWA 3I0QA 3F2AA 1OUKA 4LGHA 4V01A 2OJJA 3GU4A 1WBWA 3D0EA 2W1IA 4L43A 4GT4A 2PMIA 3ZSHA 2IWIA 4A4OA 2UW0A 4J71A 3CJGA 3FMLA 3FL4A 4C3RA 3TDWA 4E6AA 4F9CA 3OY3A 3VONA 4HVGA 1OBDA 1PMEA 3F3WA 4FV0A 2F7EE 2O8YA 3EN7A 5LMKC 3TN8A 4R1YA 4A9SA 3R7VA 2I0YA 5FEQA 4YTFA 2HAKA 3E7OA 2JBOA 3TKIA 3ZO1A 1KOAA 3L9NA 5CENA 4AXAA 4DGOA 2O2UA 2GSFA 2BAQA 5L2QA 1UV5A 3FC2A 2RFSA 3GU7A 3BHTA 1BMKA 4HYIA 5AIKA 2R3LA 5CNOA 4ZS0A 3ZLWA 3GI3A 4BDKA 1H07A 1PYXA 2UZVA 2Y6OA 3OCGA 3CGOA 1LPUA 2OSCA 2QODA 2R3GA 4NW5A 2XH5A 4X21A 3ENMA 4ZY4A 4X3JA 3QC4A 4QT1A 4KIKB 3W8LA 4DFNA 4HCVA 4UYNA 2PPQA 3DK6A 2YEXA 3W8QA 1XBCA 4KB8A 4DN5A 4F6UA 3BV3A 4GMYA 5AUXA 3K5VA 3PY0A 1CMKE 3TM0A 3Q6UA 4L44A 3TCPA 4JR7A 4Y46A 3NCGA 5DNRA 4CSVA 3ZUTA 3BE9A 1Y6AA 4GU6A 3ET7A 1RDQE 2FB8A 1FVVA 4D4YA 4JBQA 3Q4UA 4IAYA 2HELA 2AC5A 2YWPA 2PVRA 5C1QB 4BDEA 2ACXA 4BICA 3PXQA 4YMJA 2WMWA 2V55A 3GC8A 4FSWA 5C4KA 3LQ5A 3HP5A 4ZSLA 3EYHA 5A4EA 4OTIA 3F5UA 3UQGA 4O2ZA 5CSHA 3UJGA 3FKLA 2XUUA 3OXZA 1OB3A 5B7VA 3IS5A 3ZLXA 4U3ZA 1REKA 2RG5A 5HCZA 1ZYCA 2Y9QA 3M1SA 5HG8A 3UZTA 4FYOA 4NFNA 2OZOA 4JRVA 2JFMA 1AGWA 5D7VA 3HV5A 3P9JA 4HGTA 4JR3A 5J8IA 2X0OA 4ANLA 2QOKA 4DC2A 4U79A 4AU8A 3KMUA 2VTTA 2VGPA 2HWOA 5BUJA 4MWIA 4IACA 3KC3A 3F5PA 4EEVA 4B7TA 4JDJA 1VR2A 4R3CA 4CCUA 1LEZA 2IPXA 4QTBA 2ZV9A 5GINE 2YFXA 4C61A 3OTVA 2ETMA 1I44A 3O17A 4F78A 3SHEA 3MV5A 1WBNA 3PXZA 3ZS5A 4D4SA 5M4IA 2YWVA 3LQ3A 3HX4A 1LP4A 2E9UA 1MQ4A 2YIQA 3IECA 4QP7A 3ZSIA 3SW4A 4K11A 3QGYA 3I4BA 3G6HA 3L8SA 2JAMA 1PYEA 1Q61A 2YITA 2QO9A 4XS2A 3UOLA 2PU8A 3KKVA 4O21A 5EW9A 3VUMA 2PMLX 2P3GX 2YM8A 2EB2A 3PIYA 5M06A 3OD6X 3V5JA 4E6DA 3SGCA 2GU8A 4L9IA 1TZDA 4GJ2A 3GQIA 3F7WA 3NPCA 1VJYA 4BFMA 4QOXA 2YDIA 3TZMA 2X4FA 3W2CA 4YJOA 4BDGA 5J87A 4I6BA 1WBPA 2F7ZE 4BJJB 5DA3A 4GFMA 3GQLA 2XIYA 1OITA 2WZJA 3BPRA 2AUHA 2OBJA 3O96A 5FEEA 5T3QA 4JQ8A 3ODYX 3QF9A 4UALA 2XNGA 4DGMA 5HICA 4WIHA 2IVSA 3Q52A 3FMEA 2O3PA 4KAOA 5C01A 5L3AA 2F2UA 2QOQA 1UKIA 3DTCA 5TF9A 4DGLC 3RWQA 1QMZA 4NIFB 1ZZ2A 5L6WL 3NUXA 4OBPA 4OLIA 2R3IA 2WU7A 5A4TA 5CEPA 2W4JA 5EG3A 4ZJIA 3FKOA 2XK6A 3QUDA 3V6SA 5M44A 3IGGA 5F1ZA 5HI2A 2A1AB 3VBTA 3VJNA 4I6LA 3V3VA 4RJ4A 3TZ8A 3SX9A 4DHZA 1JNKA 4LUEA 4L45A 3SC1A 4GVJA 4DHIB 4ENYA 5A46A 3R8MA 4A9YA 3VS2A 4F7SA 2J0MB 3N4VA 4XRLA 3GXLA 3QD4A 3R6XA 4M3QA 4FJVA 3BIZA 1JPAA 2GDOA 1BL7A 5IISA 3A60A 4AT5A 3VS7A 2V22A 2X2MA 4EOMA 5E92A 4JAJA 3EKKA 3R1NA 3JYAA 5DPVA 2GHLA 3TI1A 3WBLA 3DKGA 3HV6A 4G5JA 4IFGA 4KBKA 4QD6A 2VO3A 4MUQA 4C34A 1JLUE 4BJJA 4MQ1A 2VWVA 2XK8A 4P90A 3IONA 3KL8A 3VVHA 4YHJA 4CFFA 4UMPA 4QEBA 4WNPA 2XMYA 1TQIA 3F3TA 2QC6A 2HXQA 3ZHPC 1WAKA 2VTNA 3P23A 2EB3A 4PV0A 4U7ZA 4PMPA 4MD7E 3EQHA 3P1AA 5HG7A 3VW8A 5FBOA 2C3IB 4DH5A 3ACJA 3RK7A 4RVKA 4JBPA 1Q4LA 5HESA 3QGWA 3LLAA 3CTHA 2Q0NA 3QTUA 4IX5A 4QMTA 4JVGA 2JDTA 4F6SA 1OECA 4QMLA 3NIZA 4YJUA 3M11A 4H39A 1IG1A 5CF8A 5L6PA 4TN6A 3CKXA 4FT5A 2NYAA 4JS8A 4RVTA 5ITAA 2XEZA 3DNEA 3SRVA 4U44A 3W2SA 1QPCA 3UNZA 1PY5A 4QTAA 3AC5A 2J51A 3PXFA 2G1TA 4BWKA 4O0SA 3FDNA 4HYUA 3DKCA 4N0SA 4D58A 2Z7RA 1QL6A 3EMGA 2C0OA 3UNKA 4DFLA 3T9TA 4NW6A 4FTAA 3CD3A 4FIFA 3OEZA 3RCJA 4APCA 5FM2A 4JX7A 5D11A 3AGLA 3I81A 3PZHA 5KHXA 5E8YA 4YR8A 2PVMA 4JIKA 4I5HA 2QLQA 3HDMA 4NIFA 5F95A 3QZHA 3COIA 4USFA 5M53A 2GFCA 2V7OA 4JMQA 3R8UA 2RKUA 3CCNA 2QNJA 4MNEB 3C0HA 2C6MA 4NYEA 3FMJA 4FZFB 3WE4A 3TG1A 4QTCA 2G9XA 3FYKX 2G2IA 3MH3A 5F9EA 1H1SA 4DTBA 1KV1A 2GS6A 2QOCA 2X7GA 3QQLA 4XP2A 4DTKA 5CU2A 1Z9XA 4F9BA 4GG7A 3FMKA 3QCYA 4RIXA 4J97A 4Y72A 5AJQA 4DDGA 3QLFA 3TZ9A 2HW6A 4QP2A 5A4LA 2R7BA 2ETKA 2FVDA 3UOJA 2BZJA 2WMQA 4GFGA 3FI4A 3LW0A 5A3XA 3O5AA 4AACA 5IA0A 4AE9A 3FZRA 3G9LX 2WIHA 3PE2A 4X2GA 3ZDIA 4F0FA 2PWLA 5B2MA 3UQFA 3LCKA 2PUNA 5FQDC 4M84A 4BKYA 5C9CA 2JIIA 4BCPA 4NJDA 4GV1A 4EH7A 2QOBA 5CEIA 3MPTA 4Y85A 4MD9E 3VS6A 2QHNA 2PSQA 4TYHA 5E8XA 3ZTXA 5KCVA 1R39A 2VTLA 3BYOA 1XH8A 4BB4A 4FNWA 1ZMVA 3D2KA 3QLGA 4D0WA 4KS7A 4EONA 2YJRA 2UZNA 2XKEA 3A99A 1K3AA 2ZV7A 1PJKA 3KY2A 5AUVA 3LMHA 1OIUA 4DINA 4HGEA 3PXYA 3DS6A 2V62A 4B4LA 4UY9A 4XV3A 4YJNA 5AUZA 3DTWA 3MW1A 4L7FA 3VF8A 2QU5A 1BLXA 3D4QA 3A7HA 2WMBA 4G34A 4F09A 5K0XA 3NUUA 3ZCLA 5FRIA 3QTSA 1WVWA 3LFCA 4XG2A 3FZSA 2JLDA 3H9OA 1ZYDA 3ULIA 1PKDA 3KGAA 4RX7A 1NXKA 4IAZA 2QKWB 3MY5A 3V5PA 3TNHA 5AEPA 3BBTB 3WF6A 2OH0E 4BBFA 4BDHA 1M17A 2X4ZA 4FTIA 3UYSA 3GENA 3OT3A 4V0GA 5CF5A 1R1WA 4C4JA 5EHLA 4AW2A 5IA3A 2CGWA 3JY9A 4RC4A 1U54B 4MNEA 4DTAA 5IQFA 3FKNA 2YISA 2XK3A 3VULA 3ULZA 3R1SA 4FV3A 2BHEA 5GJFA 4U80A 4K33A 2OWBA 3EIDA 4MCVA 4EORA 3ZOSA 2GTMA 5JGAA 4DHJA 3C51A 4E5AX 3QX4A 4XG6A 3LXLA 2XBAA 3VS3A 4C37A 4EQUA 4PDYA 3UMXA 1H01A 4YSMA 4ANSA 4FKSA 1VZOA 4EHZA 2B54A 4IJ9A 3GBZA 4R8QA 5C27A 1XQZA 5EOBA 5FXSA 1YOJA 5CAQA 3LQ8A 3IW7A 3UO6A 3P4KA 4ASEA 4G9RA 1A06A 2VV9A 2YABA 3K2LA 3U87A 5CF4A 5E90A 2B9FA 4LOPA 1NA7A 1U4DA 4O38A 4DE4A 1BI8A 2XK4A 5LJJA 2BFXA 5CEOA 1W2DA 2ZM4A 5IH5A 1G8KA 3S00A 2O64A 2JD5A 1BYGA 1Q97A 4QMUA 3V5QA 4A7CA 4L3PA 1ZYSA 3FJQE 4TYEA 4LL0A 3F5XA 3QBNA 5JFVA 3N4TA 4BTKA 1SVHA 1Y8YA 3FI2A 3FMHA 4FZ7A 5IF1A 2R4BA 5GZ9A 4MNFA 4BZOA 3U6JA 3QALE 1OKVA 3E88A 4BY9E 3PRIA 5CEKA 4ERWA 5DRBA 2RFDA 3ZXZA 2XM8A 4XP3A 3I1AA 3RNYA 2WMRA 5EDRA 4O7WA 3FXXA 4MH7A 2OI4X 3E62A 5ANEA 2XNMA 3WIGA 1H24A 5GNKA 3R8ZA 5CWZA 4BCHA 2WNTA 5FXRA 4FR4A 5BPYA 2CNVA 4H1MA 4GKIA 4R5SA 1Q3DA 3BCEA 2C0TA 5T6KA 1OI9A 4RWJA 3KULA 3W10A 4CQEA 3TT0A 4F65A 3HRFA 3V6RA 4XG9A 2ERZE 1V1KA 4CFXA 2XNNA 2YAAA 5I9ZA 3ALOA 4FSZA 2FSOX 3LMIA 3CQWA 5AIRA 4UMUA 3HUCA 4IVAA 5EKOA 5CI6A 4L46A 3ZUUA 4IB0A 5HO8A 3PG3A 4FRFA 2W0JA 4EOPA 3WIKA 3ZEPA 3GFWA 4BI2A 5EW8A 4C62A 2VAGA 3IPHA 1OIQA 3NEWA 3DT1A 2X81A 2IO6A 4R1VA 3NW5A 1YXVA 3VUHA 4D4RA 4EZ3A 4EYMA 5KMIA 4FGRA 3GOPA 3MGYA 2BDJA 5HCXA 2YZLA 4ITHA 1XWSA 5BYYA 5LARA 3CBLA 1B38A 2RFNA 3QYWA 3RNIA 4FA2A 5A9UA 3UPZA 3RPYA 5LVNA 1E1XA 3MFSA 1H0WA 3K54A 1OL2A 3D5UA 3QX2A 2X7FA 3QUEA 5DGZA 5AX9A 5JMSA 5H2UA 4UN0C 4EI4A 5CAVA 4AZSA 1F3MC 4UMRA 5FM3A 5AV2A 1CDKA 5EH0A 4TWPA 3KN5A 3OF0A 2ZB0A 4MBLA 3TUDA 2WEVA 1UU7A 2VWXA 4HGLA 1A48A 4WKQA 2UW8A 5M57A 4IXPA 2GFSA 5FTOA 2UZTA 2C4GA 1BX6A 3C0GA 2PVYA 3DK7A 3LFFA 4M0ZA 2X0GA 3OZ6A 3IW6A 3EN9A 4BKJA 3BWFA 4FSRA 4CRLA 4D2RA 2J7TA 3IW8A 1GIHA 4LV8A 3LMGA 4C35A 4F08A 2WFYA 3MFUA 1TKIA 4E4XA 1U54A 2BZHB 4DH7A 5HX6A 4AXCA 4AGCA 5FBNC 4IZYA 4BGHA 5GJGA 1IRKA 4OGRA 4EH2A 4BHNA 4FKGA 3RAWA 1V0OA 5B2LA 3KQ7A 1LUFA 4LRJA 5J9YA 2OICA 2UW4A 3NVKI 4BBEA 4IC7A 4Z7GA 4MK0A 4USDA 4FTRA 3OMVA 3MWUA 5K9IA 1OL5A 3QQUA 5I3OA 4LGGA 3S95A 3ZC5A 1DI9A 4OT5A 4Z16A 3QZFA 2R3JA 3IK3A 4AFEA 5EK7A 4ASXA 4JLCA 4UMTA 2QO2A 4AP7A 1OBGA 1Q8ZA 3C7QA 3PFYA 4LV5A 4AXEA 3RHKA 3RCDA 1YVJA 3LJ2A 4AX8A 5JQ8A 3PIZA 3PY3A 4ASDA 4USEA 1FQ1B 4HOKA 4UEUA 4XNEA 4C2WA 2GS2A 3KCFA 3BE2A 2RG6A 3GEQA 4HNIA 3U9CA 4YZBA 2ITPA 5ANGA 3ID6C 2NRYA 4O4BB 3UP2A 2ZYBA 4ENXA 4EUTA 2XF0A 1U59A 3P0MA 4J7BA 4EJ7A 5FDPA 1O9UA 4I94A 3C5IA 2ITWA 2QU6A 3QXOA 1YXUA 1ZWSA 3G90X 4IX6A 3WYYA 3RZFA 3LJ1A 4KIQA 4FUXA 3TL8A 5EOLA 4D1XA 2CNUA 4J98A 4XUFA 4DEBA 3KMWA 4JG6A 4GIIA 2G2FA 3CE3A 5HVYA 4GL9A 1LEWA 4X2NA 3TZ7A 3JUHA 4FL1A 3BX5A 3LLTA 4OUCA 4RG0A 4ANOA 4C3PA 1Q62A 2VTMA 3R7GA 3VS5A 2C47A 5A4CA 4M69A 1L8TA 5EM6A 5FG8A 3ZO2A 4WNKA 4EWHA 3TV6A 3DBFA 2VWYA 3O50A 1RJBA 3LFEA 4IB5A 5TO8A 3BLQA 2F9GA 4DGNA 3KXGA 3PWYA 4N6YA 5FLFA 1YDSE 4P5ZA 4I0SA 4E7WA 1URWA 2BROA 2OJIA 4L00A 4O1PA 4WOVA 5IA4A 4W4VA 3PJ1A 3QQJA 5AR7A 4XG7A 4YNEA 4O1OA 4PTCA 5HG9A 5KMLA 2QR7A 4FF8A 1GIJA 5IUIA 4ANBA 4QMMA 4TYHB 5E9EA 3WF7A 4LRMA 4QMPA 4G3DA 4H3BA 3PJ3A 3ROYA 5AUYA 5CANA 4FV8A 4L8MA 4CTCA 3BYSA 3E92A 1I09A 1MRVA 2GNFA 4YGAA 4I5MA 5E7RA 1OKWA 4YTCA 2YLEA 4E93A 2ZDTA 4DFBA 4E20A 4TNDA 3GGFA 3TEIA 2XIXA 4WA9A 3DGKA 1O6KA 2GQGA 4K6ZA 4KIKA 5CX9A 3QHRA 4EOKA 4O7ZA 5IMEA 1XH7A 4IAAA 3W0NA 2Q0BA 4G5PA 4JNWA 4IWPA 4F9YA 5HNIX 4C02A 5HD4A 3FPMA 3UO5A 3Q9XA 2I0HA 4QYEA 3UZPA 4O91A 1HCKA 4AAAA 2P55A 1YW2A 3H0ZA 3ODZX 1UWJA 4I5CA 4JXFA 3R7OA 4FTNA 4D2WA 4AWIA 4F70A 3DBQA 1FBNA 4PP7A 4ITJA 1P4OA 4FGBA 4MHAA 3UIUA 1YRPA 5HCYA 1J7IA 1R78A 2A27A 2BVAA 3ELJA 5AP4A 3AD5A 2OXYA 5EM7A 2C68A 3ZM4A 5JFXA 3NUYA 4KRCA 2VN9A 1JBPE 4ANNA 2FSLX 4DBNA 5EDQA 3GCSA 2YA9A 1G8SA 4KBAA 5LMBA 3HMIA 5A6OA 4CNHA 2R3HA 4QP9A 3KRJA 3MVLA 1NT2A 3EJ1A 4QP8A 5IUHA 2OW3A 4X6RA 2J5FA 3SOCA 4ASZA 4BTFA 3KRLA 4OBOA 2X9FA 4UMQA 2E9PA 2XYUA 4FTOA 5AAEA 2BUJA 1OIRA 3FLWA 4I41A 4W4YA 2IVUA 5AR5A 2BTSA 4BI0A 5BUEA 1HCLA 1DI8A 5DIAA 2W9ZB 3FWQA 1F5QA 4FTCA 2Z60A 4EOQA 3AKKA 4DLIA 3UYTA 3ZU7A 4NCTA 4QP1A 4U6RA 5FP5A 4EH8A 4DG2E 2C5OA 3SLSA 1MUOA 4WRGA 3V01A 1ZOHA 3N51A 3R22A 4GS6A 4TYGA 3LVPA 5FDXA 5G1XA 5TKDA 3TNQB 3TNWA 4I92A 4RA4A 4RA5A 5CEMA 2PULA 3RZBA 4XV9A 2H9VA 3OWPA 3B8QA 1SM2A 4ZSGA 3RMFA 4TPTA 3PE1A 3WZEA 5HO7A 1BKXA 5IU2A 3KB7A 2NPQA 2VO0A 4JT3A 3E8DA 2WELA 4EQCA 4E6CA 5JZJA 2A98A 2ITYA 1UNHA 2W06A 4M13A 3ATSA 2BRGA 2ITOA 2CGXA 4ARKA 1WFCA 1ZAOA 1K2PA 3KRWA 4OBQA 4QDVA 2LGCA 4A07A 5EM8A 2ZV2A 2OIBA 4AQCA 4CKRA 3BWJA 2WO6A 5ANIA 4O7YA 4QMWA 3ORMA 3CIKA 2YM6A 3SRVB 3UOHA 2YM3A 4RC2A 2JGZA 3RI1A 2E9NA 2YJSA 1J1CA 2VNWA 3SXRA 2IJMA 4BWXA 4D5HA 4DLJA 2VTOA 2WD1A 2OG8A 1ZZLA 4ZZNA 1EH4A 5HEZA 4RX9A 4GEOA 5EDPA 4I22A 4AZWA 1PXLA 4MBIA 5CTPA 2XBJA 2XIKA 4KSPA 5M07A 1ZXEA 3CR0A 4FG8A 3R04A 2QD9A 2XP2A 3P5KA 4LI5A 3VBQA 3EFLA 3WF9A 1GOLA 4GRBA 2JDSA 3BGZA 3Q2MA 3Q04A 4I6QA 2BILB 3SG8A 4EHVA 3QU0A 4C2VA 3QRIA 2UW9A 4EHGA 3KRRA 5M4CA 2HK5A 4QMQA 4AOJA 3CKWA 5EW3A 1MRUA 5D1JA 5E8WA 1H1RA 5HBEA 4QMYA 3W0MA 1SNXA 5AP6A 3JS2A 4MEDA 2EXEA 3HNGA 3PXRA 4RIXB 3RWPA 2XKDA 4EOIA 3FI3A 5KMKA 3VC4A 5CZIA 4QPSA 4X7QA 4Y95A 5CU6A 5BUIA 2VTSA 1G8JA 2C6OA 4IE9A 1PW2A 2IW9A 4BC6A 4BBMA 5BMMA 4RWLA 2PE0A 4FK6A 3F5GA 2YHVA 3EH9A 4AUAA 3UVRA 3NLBA 4ONAA 1W84A 1VYWA 2X1NA 3WZJA 5IZFA 5AP3A 4GCJA 4BYIA 3TUCA 3BU3A 2CKQA 4L01A 4ZK5A 3G0EA 5AAFA 4EHEA 4RSSA 2J0KA 5HIBA 2UVYA 2CGUA 4I24A 4QYHA 2WQBA 2ITXA 3QL8A 4IWOA 3EL7A 2P4IA 3A61A 5ANOA 3VUGA 3ORIA 5IQAA 5IG1A 3H9FA 5BYZA 4C0TA 4PNKA 3Q32A 5CAUA 2OGVA 3E8CA 2Y0AA 4RRVA 4BDDA 4EK6A 4C4IA 2OU7A 3OCSA 5AM7A 4YLJA 3VRZA 4F1OA 2HENA 4FTLA 4J95A 4UYAA 4F4PA 4QMNA 1H25A 4YZCA 4KNBA 1ST4A 3A2CA 3QCXA 3OT8A 3GVUA 4JIAA 4FNYA 4M66A 4O27B 1IAJA 2AEGA 2J0JA 4WT6A 4O86A 5E8TA 2WTWA 1FVRA 1H27A 3W32A 3LXNA 4RZWA 3CGFA 5J9LA 5DT3A 4Q2AA 3UVQA 3WOWA 4EK4A 2F49A 1P2AA 4LMNA 5I9VA 2UZUE 1YWNA 3FLQA 2QLUA 4R7BA 3RHXA 3FAAA 4IJPA 3DAJA 3GC0A 5HLPA 4M7IA 2UZEA 3JXWA 3PSCA 3FLSA 2V0DA 1KE6A 2R3FA 2P0CA 4MBJA 4BCIA 2YM7A 1STCE 2Y4PA 4AOIA 3AC3A 1F0QA 1Q24A 4LFIA 4UV0A 5CT7A 3RJCA 3TV7A 4ACDA 3AT4A 4F6WA 3CTJA 4NSTA 4NUSA 4RFMA 3MYGA 3CJFA 3Q5ZA 4IDVA 5DR6A 3VBWA 3HV7A 2R3OA 2H34A 4AQKA 1VEBA 1OMWA 2BRBA 3AC4A 3FZTA 3GC7A 3I7BA 3R21A 4FSMA 4C4EA 5I3RA 3N4UA 4QP6A 3KREA 4F1TA 1OL1A 1UU8A 4ZTLA 4ITIA 4FTUA 4IZ5A 4QPAA 4NEUA 5DI1A 4CRSA 1H0VA 2XIZA 3UO4A 2PTKA 5KHWA 4FEXA 5EQPA 3P7BA 3DV3A 5L8JA 4IEBA 3RM7A 3M42A 3ORLA 3PPKA 1M2QA 3E7VA 4Y5HA 4NTSA 2ZV8A 4O7LA 4M69B 2W5AA 4IAFA 1UNGA 3MVHA 5DOSA 3R83A 4DT8A 1IASA 2VNYA 4CT1A 1NW1A 4RFYA 2CJMA 5EYCA 3LE6A 2F7XE 5KE0A 3ZFYA 5HNGA 3WZKA 2C5NA 3W16A 3GOKA 3V8SA 3DFAA 4YLLA 4QYYA 5DR9A 3VS4A 5LVPA 2RSVA 2CN5A 2WHBA