4GG7A

Crystal structure of cmet in complex with novel inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
278
Chain Sequence
QAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Hepatocyte growth factor receptor
publication title Multisubstituted quinoxalines and pyrido[2,3-d]pyrimidines: Synthesis and SAR study as tyrosine kinase c-Met inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 278
sequence length 281
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gg7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gg7A01
5ANKA 1HCKA 3U8WA 2VX0A 3FSFA 5KHWA 3NYVA 1H25A 1PXPA 5AAFA 1JSUA 1MP8A 3LFCA 3OP5A 3FZTA 4LGDA 2QQ7A 2WTWA 1PXJA 4QP7A 3F5GA 3PXQA 4LYNA 5J1WA 3DB8A 3I0OA 4L3PA 4BGHA 4BTMA 1FVTA 4FT5A 5DFPA 5CSPA 3NYXA 4AT4A 3JUHA 4HPUE 2OJ9A 3VS7A 1H08A 2XYNA 2W5HA 4BFMA 2R3NA 3AGMA 4J96A 5HTBA 5F94A 4UMRA 4TPTA 3VHKA 5JSMA 3GU4A 4ZJIA 4NKSA 3MN3A 5JZNA 4IB5A 5IEYA 4U42A 4DH7A 4JS8A 4XV1A 3PLSA 4JDIA 5LMKC 2CJMA 3PJ2A 5H3QA 3MBLA 2W0JA 2XK7A 1OKVA 2ZB0A 2YCQA 3R8LA 3I60A 3SRVB 4BC6A 1CDKA 5AAEA 4APCA 5HG9A 4M8TA 4WG4A 5AR2A 2OI4X 1E1XA 3BHTA 1YKRA 5HG5A 5BVDA 3FC2A 3JS2A 3OVVA 3UP7A 5IUGA 2ZMDA 3EYGA 2C0IA 4RQVA 2UW9A 4IM0A 2XK6A 4BGQA 4RJ6A 4UALA 3ULIA 1ZYSA 2VO0A 3S4QA 2VNYA 4BTJA 3KXNA 2J4ZA 4HVIA 4BR3A 4RPVA 3UGCA 4DGMA 3EZVA 4PL3A 4O0WA 4A9YA 3R71A 2PMLX 3OXIA 3SC1A 4KAOA 4UWYA 2XMYA 4HYIA 2ZV2A 4IVDA 4ZMFA 3E87A 2QC6A 2UZNA 3IW8A 4QNYA 3AD4A 2IPXA 1SMHA 5FUTA 4IDTA 4RIWB 5I9VA 1YOJA 2WQEA 4OAVB 5HO7A 2QOHA 3RNYA 3ROYA 1XHAA 4J98A 3QGYA 3TG1A 3QWJA 2WFYA 5DR2A 4CKIA 4C4EA 4USDA 4XCUA 4AF3A 2WNTA 3FWQA 2W99B 2EB3A 4EOLA 3DV3A 4IZ7A 5CANA 4G6LA 3H0YA 3G9LX 3N9XA 4LFIA 4X2NA 1H8FA 2FUMA 2YHVA 4TYJA 2JKMA 5EYKA 4C38A 4CMUA 5DG5A 3FV8A 4F08A 3G33A 2G1TA 3QCQA 3LE6A 5HIEA 3F5PA 5JT2A 2Z7LA 1PXKA 3ENMA 4X2FA 3QKLA 2AUHA 5CVGA 4EWQA 3HV5A 4E6CA 3PJ3A 3W16A 3ZLSA 2NO3A 2W4OA 4JNWA 4XBRA 1IEPA 4QQJA 4RX8A 1PXOA 3FLQA 2JITA 4UY9A 5AWMA 2JLDA 5FBNC 3UZRA 2W1FA 2YITA 4UMQA 5M57A 4QYYA 3QFVA 3UOKA 1LEWA 3SOAA 3U87A 2JDSA 4AGCA 5AIKA 3AMBA 5I9ZA 1YWVA 2W4KA 3KMUA 3F82A 3KVWA 3LFQA 4IZYA 3GCQA 4DCAA 5DH3A 5HE2A 5J79A 2VTNA 3MJ1A 4N6ZA 3D5XA 4O6LA 3OUNB 5ANIA 4O7YA 5M44A 2F7XE 2QOQA 5H8BA 4D1SA 4OTGA 5A4TA 4Z7GA 2XIXA 1E1VA 3ZM9A 2QOOA 5TKDA 3DNEA 4CEGA 4BCOA 2BILB 5J1VA 1OZ1A 2VTQA 3BYVA 4RWKA 3PY1A 1OITA 4QMWA 3HGKA 1OI9A 3ZLYA 3ZUVA 2XBAA 4BZOA 5CF4A 5HBEA 4AA5A 2C3KA 4WSYA 3VUKA 4HVHA 1OKZA 2G2HA 2E9VA 1ZOHA 4KRDA 4M69A 4ASXA 3OTVA 1XH4A 2ZDUA 3OWPA 1FVRA 4QMXA 4BF2A 2X8DA 3F3ZA 2R2PA 2JDVA 2NPQA 3FHIA 5IISA 4ZSGA 3ZU7A 3UG1A 4E93A 3G0EA 2JDRA 3KXHA 3N51A 1T45A 1YWNA 2X9EA 1A06A 3EKKA 3E8CA 2W5AA 4L01A 3LOKA 1OL5A 4KABA 2WQBA 3NZ0A 1JSTA 5CEIA 4C4JA 4BDEA 4G2FA 4C59A 4XG8A 3RHKA 2WOUA 3QLFA 4Q9ZA 4Z16A 4ZLOA 1H1RA 2R3JA 3QQJA 3U55A 2ITNA 4ANSA 2O0UA 2GNGA 2PVRA 5EM6A 2ITTA 4QMTA 1Q3WA 2YM3A 4Q5EA 2YISA 4R7BA 4HGTA 4AS0A 5ACKA 3SX9A 3TV4A 3S00A 4PQNA 2C30A 4FK6A 5D12A 4KBKA 5HCYA 5C01A 3PSDA 4MNEA 1S9JA 5BYZA 1ERKA 3QTSA 5D41A 5I9WA 5IDNA 3FKOA 3IO7A 2X2KA 3HX4A 5E90A 5KCVA 3KULB 5IQEA 2XKEA 2X7FA 4FL2A 1DAYA 3V01A 1OL1A 5BNJA 3OCSA 5HNIX 1XH9A 3PRFA 5JGBA 4UX9A 3CTQA 4FT0A 2E9UA 4FKWA 4HCUA 2GDOA 5EI6A 4FG7A 2WIPA 2WZJA 1VZOA 2WO6A 4FI1A 2GNLA 3AC4A 1FINA 3NNXA 4FTTA 3FI4A 3JVSA 5CU3A 4JT3A 5HESA 5HI2A 1OKWA 1SVGA 5EHLA 2B9IA 3E7OA 4S30A 4E6AA 5GJFA 4G31A 4E7WA 3I7BA 3DBDA 4YHJA 2J2IB 4FZ7A 2HCKA 4QQTA 2QVSE 3FXWA 5KMLA 3TNIA 4A9SA 2XIYA 4RIYA 3NIZA 4L52A 4O7LA 1KWPA 3TM0A 4XG2A 1GIHA 1P14A 2X0GA 2XCHA 3E63A 4GSBA 4S32A 4BL1A 2X4FA 5GHVA 2PVNA 4KKGA 3PZHA 3GENA 2YDJA 4UZDA 4C3RA 4ZS4A 3QYZA 3ZC5A 4FV8A 5C8NA 5E1SA 4N4SA 5CI6A 4LUEA 3FZSA 1PRYA 4RJ3A 5F9EA 4CG9A 4IAFA 2UZEA 5DEWA 4F9BA 2I7QA 4PP9A 1KE5A 4IAYA 2CKQA 5LVMA 4KSQA 5L2TA 4U45A 4AZFA 4R3CA 4FVQA 3UO5A 4DAWA 4O7VA 1UNHA 4BCIA 3MVLA 5JKGA 4O84A 4APPA 3RPYA 3ELJA 3F5UA 3BIZA 2GQRA 3NLBA 3A8WA 3PRIA 4FEVA 3CKXA 2KTYA 5KX8A 5HZNA 4TY1A 2XH5A 2FSLX 3D94A 4Y83A 4YJVA 3ZH8A 4QYEA 5J9LA 5M07A 4EQCA 3BX5A 3LQ5A 3LPBA 3HV3A 4RFZA 5GNKA 3HMPA 2YDIA 4W9XA 4ENXA 3BV2A 1H24A 3C1XA 3BHUA 5HEZA 5IQAA 3FY0A 3O8UA 1JKTA 3D5VA 4HGLA 5HO6A 2CNVA 1GZ8A 4L7SA 1AGWA 2B52A 2HZIA 2CDZA 5HORA 5GIPE 3MY0A 2OZAB 4A07A 3DBEA 4HGEA 5EM8A 3V5WA 1G3NA 3OCTA 1PJKA 2XEYA 3F5XA 3CD8A 2J7TA 3R9NA 4ASDA 5BMMA 4DEEA 2HW7A 3NPCA 5E7RA 5ITAA 3LFFA 4GMYA 5GZAA 4G16A 3V5JA 1UNGA 3BQRA 4DEAA 3LW0A 4A9RA 4FV9A 3GUBA 4JX7A 1YXSA 4YJUA 5IUHA 5FWKK 3PVBA 4NJDA 1H1WA 1ZOEA 2AC5A 1PKGA 1MUOA 2PK9A 4RVKA 3R00A 2OG8A 2UW5A 2WELA 4FG8A 5EK7A 2OIBA 4GRBA 3TKHA 3RAIA 4E20A 1PMUA 3GU6A 3QHRA 5DVRA 5AV1A 5CAQA 5D9HA 5M4CA 2I0VA 2VTHA 2R64A 2HZ0A 4MF1A 4FICA 3D14A 5AX3A 5AM6A 4I5HA 4QYGA 3DK7A 3OEZA 2CN8A 1K3AA 2W17A 3MYGA 3VW8A 3WF5A 4DYMA 3LHJA 4NCTA 3RVGA 1BYGA 2YWVA 3HL7A 3NRMA 3T9TA 5A14A 5CENA 2WOTA 3CPBA 4YTIA 3LLAA 1Y57A 2X6EA 2X4ZA 3AC3A 2VV9A 3BE9A 2YDKA 5K3YA 3OCBA 5CF5A 5BVOA 1Q8TA 4S34A 2VWWA 3LCTA 4F9CA 1UWJA 4EC9A 4AW5A 3MDYA 4F9YA 1LEZA 3KRJA 2R3MA 3MIAA 3MV5A 5HG7A 4UN0C 2IW8A 1DM2A 2UZWE 3U51A 3IKAA 4XRJA 2XK3A 4IB0A 3PXFA 5CU6A 3FBVA 3SLSA 1M17A 2XCKA 3A60A 3BRBA 4JLCA 3ZDUA 5DA3A 1ZXEA 3OCGA 3DNDA 4FG9A 2NP8A 1Q41A 2YLEA 3BHVA 4NH1A 5EDQA 3WOWA 2B54A 4EOIA 3U4UA 4OW8A 4GG7A 2BRNA 5L6WL 4S31A 2EXCX 3HYHA 5D11A 4N70A 2F2UA 3HV4A 1SNXA 3SKCA 3TNQB 2YLFA 4CZTA 1CKJA 3A62A 5E8UA 4O2ZA 4XP3A 3ZLXA 5HQ0A 3A7GA 4EUTA 5LQFA 5LVNA 5HE0A 4EUUA 3UNZA 1UA2A 4IAZA 4V0GB 3VUHA 4GFOA 3W2QA 3FUPA 3QA0A 2F7ZE 3NUAA 2Y9QA 4QOXA 1X8BA 3F3VA 4AZEA 2XNMA 5HLWA 2UZTA 4DH8A 4O86A 2X8EA 5M4UA 3QCYA 1REJA 4ACCA 4YJPA 4O82A 2DYLA 2OXDA 2WB8A 3NNVA 4QMOA 3ZUUA 4DGNA 4OTQA 5HO8A 1I09A 5D10A 4JRNA 5J95A 2V7OA 2BMCA 5AR7A 2W9ZB 3RM6A 4CFFA 1KE9A 2R3GA 5KNJA 1IAHA 4YZBA 2WHBA 4GFMA 4CNHA 4F09A 4BHZA 3EL7A 3KF4A 3MPTA 3W55A 4L68A 4PUZA 3FLYA 3GEQA 4U80A 2QG5A 3E8DA 3P79A 3O96A 2FH9A 3QRIA 4RWJA 2XIZA 3GGFA 2YCFA 3HDNA 2GTNA 2PVYA 3B2TA 1U5QA 3QAME 3QL8A 4I93A 4U41A 1YDRE 4FIIA 4RA5A 2C5XA 2XZSA 4D0WA 4F7SA 4F9AA 3PFQA 4N0SA 4YU2A 3LCKA 3UMWA 4RVLA 5KUPA 3LFAA 4QTBA 3R9DA 2WIHA 2PUNA 4G9RA 4O96A 5IA5A 4FX3A 3R9OA 2CSNA 3O51A 2JEDA 4BDDA 1XBAA 2XVDA 4BTFA 2R7IA 3UNKA 3G9NA 3GQIA 2UUEA 4JDJA 4YZMA 3RK5A 3WE4A 2XBJA 3MPMA 3W2PA 3RGFA 2YIQA 4GIIA 2VTJA 4KINA 2B9FA 4F0GA 2J6MA 5LVPA 3VO3A 1KE6A 5FD2A 5T3QA 2X8IA 5F95A 5LCKA 5KO1A 3LXNA 2IVTA 4RT7A 3PA5A 3NNWA 3PPZA 5CTPA 1WBNA 4AXAA 4WUNA 2ONLC 2VTRA 2HY81 4ZP5A 5AA9A 4IIRA 2F49A 4JG7A 1KV2A 5DBXA 3ORXA 2W4JA 2YABA 2NRUA 4J1RA 4LQMA 4O0TA 3UYTA 3MVMA 4KRCA 3VBVA 2FB8A 2RFEA 3FLSA 3WZKA 5I4NA 2PYWA 2PY3A 3D2IA 4PNIA 1WZYA 3GB2A 4JAIA 1XBCA 1H27A 4BDCA 3FAAA 1R3CA 4FKUA 2EXMA 4G3FA 1Q4LA 2B9JA 3PXZA 4UZHA 1OGUA 3UG2A 4QMZA 4MKCA 2VTTA 3VF8A 4BCFA 3DTCA 3K5UA 2VU3A 3NW6A 2CCHA 3HRCA 3A7IA 3D7ZA 3QC9A 1R39A 1H0WA 4CT2A 4CLJA 5CQUA 3CLYA 3TTIA 4BCQA 3KREA 2ZOQA 2E9OA 3GXLA 3IGGA 2BROA 4FSYA 4F1OA 3KGAA 5IA2A 4AW1A 4QP9A 4V04A 1XKKA 4AOJA 3OTUA 5IF1A 4MQ1A 5K5XA 2VAGA 2IVUA 2XNNA 4IH8A 4CQGA 4XV2A 5DRBA 4YR8A 3KMWA 3R2YA 1ZY5A 2BR1A 4FSMA 3T3VA 4C2VA 2R3KA 5IQGA 4L45A 1OECA 3OW4A 4Y5HA 4F7JA 4EH8A 5EW9A 4AT5A 1LUFA 3BV3A 3NNUA 3VC4A 2YZAA 4X7QA 3MW1A 3A7JA 3QTRA 2I6LA 3RPOA 1H07A 3TV7A 2BDJA 1IR3A 3BLHA 3ZRKA 2YERA 2OGVA 3EWHA 2VWIA 2WMXA 3O7LD 1VYWA 1FGIA 2OFUA 3BKBA 1YXUA 4ANLA 5FG8A 4HVGA 2UVZA 2XKDA 2G2IA 4KIKB 5JK3A 2FA2A 5FXRA 2PE1A 4JQEA 2WTVA 3R1NA 4YC8A 4BCKA 4KIQA 4BRXA 4D5KA 5IQDA 5LCJA 1G8AA 2Y4IB 3NR9A 4GFGA 4HZSA 5ANDA 3R6XA 5I3OA 3OW3A 3MFUA 2Z7RA 3CP9A 4I0SA 4W8DA 3KK9A 3O8PA 1B38A 2XK4A 5FTQA 4NYEA 3UPXA 3E92A 3FZ1A 4K18A 4E8AA 4DGLC 2W1GA 1WBVA 4DH5A 1JLUE 2WMBA 3HRBA 4X6QC 3WZEA 5AFVA 2CMWA 2WTKB 3IW5A 4TN6A 2WMVA 4AGDA 3HEGA 4NWMA 1ZZ2A 3ZXTA 2HENA 4FKVA 4BWXA 3RINA 3ID6C 4XBUA 3K3IA 3IOKA 3FL5A 4IWQA 4QTEA 4J8NA 2BVAA 2VTLA 3PVGA 2JIIA 1QPDA 4F64A 3THBA 3ZZEA 3Q5ZA 3TKUA 2UW7A 3NGAA 4GIHA 3QXPA 2ZM1A 1WBPA 3ZBXA 3VW6A 3EN5A 3FMDA 3WBLA 4YSJA 4A06A 2YJRA 1OIYA 1P4OA 4O0SA 4WBOA 5LMAA 2R0IA 2J0MB 3COMA 3RAKA 1IRKA 1URCA 3P1AA 3RALA 4BB4A 3UZPA 4D4VA 4HNFA 3ORZA 4LV5A 4KUJA 4DFUA 3O8TA 2Z7QA 3GOKA 3NIEA 3PE1A 2GS6A 2X7OA 4RBLA 1XJDA 2VTPA 4PMTA 4C62A 4NK9A 4ZY6A 2QO7A 4GYGA 5CEQA 4IQ6A 3UVQA 3ZYAA 1YOLA 2WXVA 3D7TB 2QKWB 4CFNA 3KN5A 5I3RA 4O83A 4HYUA 1BI8A 5HLNA 1O6LA 5IEXA 3SDJA 5GINE 4AWIA 2GS2A 2R3HA 3IGOA 3V04A 3DU8A 3QBNA 4L46A 4RC2A 3FHRA 4R8QA 2R3OA 2VWZA 2P4IA 3UJGA 5CEKA 2JFLA 4U44A 4CFXA 5CAPA 3EFWA 2ACXA 4JIAA 1QPJA 1FPUA 4FV7A 5AV3A 5HVKA 5EQPA 1R0EA 3R02A 5C8KA 2BALA 1GAGA 2FO0A 2JKQA 3IW7A 4BI0A 3PYYA 3QQKA 4UBAA 3RK7A 3VBXA 3GNIB 3C0HA 1PW2A 2QOLA 5HE1A 3UP2A 4C02A 4EOMA 4HCTA 2HK5A 3EQFA 4O0UA 4AZSA 4ZLZA 4BZNA 2ERZE 4B7TA 4FSTA 2WTJA 4YJQA 5AP1A 4A4XA 3E7VA 3TEIA 3UQFA 4IEBA 5GIOE 3R0TA 2UZVA 3G6HA 3GU5A 2J5FA 2C5OA 3H4JA 5D1JA 2XIKA 4MWHA 2PZYA 3FQEA 3RTPA 3BYOA 5EI2A 4C61A 3OROA 4G6NA 3HMIA 1FQ1B 4IWDA 1L8TA 3OY1A 4ZY5A 1TQPA 3ZO1A 2G01A 2QURA 3MIYA 4QYFA 1YDSE 2FSOX 2OW3A 4PWNA 5A4CA 5L2IA 4F6SA 3R63A 1UVRA 1A9UA 3OT3A 2WEVA 3WZUA 4AAAA 3EN4A 3P7AA 2QCSA 4DEDA 5F4NA 3WYYA 1DI9A 5HNGA 3Q4TA 4G17A 4MD8E 3S0OA 3OF0A 3Q04A 5KBQA 4TWNA 1ZLTA 2Z02A 4Q2AA 4O0YA 4FV1A 3ZCLA 1SM2A 4DEBA 2PZ5A 2OXYA 5A4EA 4E6QA 3QTZA 3L8PA 4YLKA 4O7TA 2QG7A 3R21A 5AV0A 2O63A 4W4XA 3H9RA 4FVPA 3II5A 5DT3A 3F88A 2AC3A 5FM3A 4FKTA 5TR6A 4E73A 4DT9A 1NW1A 3FPQA 3L8XA 5J5SA 5AP5A 4EOJA 3F7ZA 2R3PA 3F7WA 4KBAA 4ZSLA 1OPJA 3W2CA 5IA3A 5LMKA 1JBPE 3V6RA 2UVYA 2BFXA 3DXPA 3OXTA 3OWKA 5CEMA 1ZY4A 3F3TA 2DWBA 3FLZA 1Y6AA 1QMZA 3LXLA 4RQKA 3LCDA 5IH5A 4P90A 3O7LB 4D4YA 2C3IB 4YJSA 3WF8A 3LFDA 2A0CX 4XG9A 4ANOA 3TI1A 4G6OA 1NY3A 5E8TA 4D58A 4GS6A 3OBGA 4L42A 1QL6A 3I6WA 5KE0A 4BCHA 3A4OX 3MFRA 4E4XA 4F99A 2F57A 4IB3A 3UIUA 4IANA 4D2TA 2UW3A 2W5BA 4BCNA 4YTCA 4O7WA 2J9MA 3LXPA 4I4FA 1RDQE 5CU0A 4JBVA 3NCGA 3RWQA 3RNIA 3OZ6A 2QHMA 2WU7A 4XP2A 4DF3A 3C4FA 4IZAA 4NM3A 5A6NA 4I6HA 5AAGA 1H00A 2WTIA 5H2UA 3VJNA 5HBHA 5CI7A 4DGGA 4O0RA 5A46A 2GTMA 4ZJVA 4FTLA 2E2BA 2YM5A 3TWJA 3I5ZA 4Y95A 2BRMA 2BHEA 4YBJA 3DFCB 4AUAA 2QOKA 2XNPA 4LM5A 4ZAUA 1M2PA 3V8WA 3P86A 1OL7A 3DLSA 3BI6A 2B53A 5DYJA 4FTAA 4IW0A 4DBXA 1Y6BA 1ZAOA 4I20A 4QP2A 5ETFA 5J7BA 4F0IA 3R8PA 1ZRZA 3AMAA 1APME 3WIGA 2R3LA 3CTJA 3S3IA 3LIJA 2E9NA 3HVCA 3A4PA 5ANOA 2FGIA 5M08A 3OC1A 3SOCA 4KB8A 4C0TA 5IPJA 2C6TA 2GNHA 3ORTA 4G3GA 2C1AA 4E6DA 2Z7SA 2P2HA 1V0OA 3BLQA 5KKRB 3DJ5A 2SRCA 4HVDA 4EJNA 3GFEA 3HMMA 3V8TA 4F65A 3CS9A 5IMXA 4A7CA 4DEIA 3NW5A 4ZTSA 3I5NA 3RPRA 3LQ3A 1AQ1A 3SRVA 4LGGA 1H1SA 3SG8A 4UV0A 4WUAA 2HIWA 4EOPA 4YJTA 4BDFA 2O64A 4YZDA 2XF0A 5I9YA 4XHKB 3V3VA 2XS0A 5HOAA 4RVTA 4L67A 3KQ7A 3VRZA 2WPAA 1WBTA 4PDSA 4LRKA 2WD1A 4OTHA 3AT4A 2BZIB 1R1WA 3PJ8A 5AA8A 4U43A 4OBOA 1M7NA 4GH2A 3QYWA 1U46A 3P9JA 5IQIA 4E4MA 2DQ7X 2REIA 3UO6A 4OTPA 1ND4A 4FE2A 4MXOA 3SW7A 4WNKA 4RIWA 4JX3A 2CGXA 1VR2A 2ZV8A 2R9SA 4C2WA 3EN6A 3VWAA 4NTSA 4UWBA 5BVFA 3MB6A 2JBPA 2XJ1A 2YAAA 4M7IA 4L3LA 5HG8A 3WIKA 2GHLA 1E9HA 5AX9A 3UBDA 5M51A 3Q9WA 3FXXA 3Q53A 4RX9A 2G9XA 4FNXA 4QMQA 4PTEA 3ZEWA 4CSVA 3AMYA 4RWIA 4KKHA 1PXNA 3P23A 3KEXA 3PXYA 1WFCA 4FT9A 5IKWA 3CTHA 4AN2A 3QTQA 3A8XA 3DA6A 4RX7A 5AR5A 3REPA 2O65A 1U5RA 2B7AA 3AD6A 2QOFA 2WMSA 2ITQA 1K2PA 1JVPP 2WMRA 1H0VA 3COIA 4WNOA 1PF8A 1PYXA 3EFKA 3QCSA 4QMPA 5AUZA 3VBWA 5CALA 2PU8A 3R83A 4KS7A 3HLLA 2VTMA 3WARA 2J51A 2C4GA 3BGPA 4IHPA 4PP7A 3EQCA 4EOSA 3QTWA 5CEOA 3VUMA 2QHNA 3PY3A 2ZJWA 2R3FA 1SZMA 4RMZA 5B0XA 1KOBA 4U3ZA 4ANBA 2ZMCA 3P4KA 3PLAE 2XA4A 1OMWA 4JQ7A 4WA9A 3CGFA 3FZOA 5DHJA 4RIOA 1W98A 4ZEGA 4EHZA 4CV8A 2Z60A 4A9TA 3W2RA 4CLIA 4PV0A 4QMVA 3C4ZA 5IQCA 4L44A 3NS9A 4Y5QA 4GUEA 4X2KA 4K0YA 4M3QA 4O2PA 3TZMA 3KCFA 4BN1A 2O5KA 3ZBFA 3DXQA 5LJJA 3D83A 5HVYA 4TYIA 3AC1A 5J9YA 4W4VA 5CVFA 1PXMA 4YZCA 5IH6A 3Q2JA 4I6BA 4C8BA 3JYAA 2BKKA 3VIDA 4EH7A 4PDYA 3FMLA 3K2LA 4KD1A 2V62A 4YZ9A 1H01A 5IA4A 4EHEA 2IZTA 1XR1A 3PA3A 4AT3A 3QC4A 2I0EA 3H10A 5C9CA 4IB1A 3GC0A 3QTUA 4WNPA 3HUBA 2H6DA 2ZV9A 4ZTNA 5J9ZA 2CLQA 4WNMA 5CAUA 4I5CA 3HZTA 4FGBA 3N4VA 3E88A 5BVKA 2JBOA 3D5UA 2YM4A 5HCZA 4YMJA 2C0OA 4BYJA 4TYEA 3PY0A 3IPHA 3QTXA 2CKOA 2HWOA 1UU9A 2OBJA 3RMFA 4R3PA 4BDIA 3V8SA 4YTFA 5AUYA 4CYJA 4W4YA 3UMXA 4M15A 4JG8A 4HYHA 3K5VA 3EQPA 2YM6A 4I5PA 4AX8A 5JMSA 4AA4A 3O71A 2W1ZA 3SV0A 4ZS0A 4NIFA 4NTTA 5K4IA 3QKMA 2EB2A 1H4LA 4FT7A 2X9FA 2CHLA 2IZSA 4U3YA 5LWMA 2JFMA 4IBMA 2HWPA 5HTIA 5JH6A 3E93A 4KS8A 3HNGA 2VO7A 4BYIA 1JKLA 4RG0A 2RG5A 2KULA 2X81A 3LQ8A 5EHYA 3VQHA 1OL2A 5CY3A 1UV5A 4BZDA 2UVXA 1KV1A 3KULA 5I9XA 4II5A 4RFMA 4U8ZA 4LI5A 4DTKA 4Y8DA 5HLPA 2QI8A 2YIYA 2BCJA 5D7AA 3UIMA 4ASEA 4DCEA 4H3QA 2ETMA 4EOQA 2J50A 4EH5A 4C4GA 2GNFA 3I1AA 2WMUA 3ORNA 4B0GA 3ZO2A 3KRLA 1TQMA 4I21A 4RJ5A 4FL1A 2IJMA 2RKUA 2ZDTA 1ZYLA 4RGJA 4EONA 5CF6A 2ITXA 1O9UA 3A2CA 4YSMA 4E4LA 3AD5A 2LAVA 3BGQA 5ANEA 3TUCA 3MWUA 3W8QA 1JQHA 3MESA 4V01A 3EH9A 2QLUA 2GU8A 4JR3A 5DR6A 1YQJA 2IW6A 3C4EA 3Q9YA 5CSVA 4R1VA 5HHWA 1YRPA 3NSZA 1REKA 3H0ZA 2CGVA 4I4EA 4NL0A 5DT0A 4CGAA 2W1HA 3PSBA 3B8QA 1ZWSA 4KKEA 3IW6A 4YO6A 3JXWA 4NM7A 3DFAA 4IFGA 2VO6A 4RRVA 1NXKA 4QPSA 4PF4A 3CQEA 4RZVA 3EFJA 2QOIA 3B2WA 4TNBA 4EBWA 2H96A 4Z55A 5IQHA 5IA0A 4X0MA 3PXRA 4FZAB 5JFVA 3R9RA 3T8OA 4ACHA 3QHWA 2UZDA 3CXWA 1PXIA 2CNQA 3TIZA 4FZFB 4O21A 3RKBA 1ZMVA 4GL9A 4FSZA 1W7HA 5JFSA 3QUEA 2GHGA 4D2WA 3TCPA 4NFMA 2YIRA 4MCVA 4U81A 3HAVA 2PMNX 1DS5A 5K5NA 4QP4A 4CD0A 3KXGA 2X7GA 4DFBA 2PZRA 3S95A 2C6EA 3MH1A 2OJFE 3TTJA 2WTDA 4FKJA 2XNBA 1XO2B 4IZ5A 3GU8A 4A4LA 3WI6A 5EKNA 4X3JA 5CT0A 2OZAA 4YLLA 3FLNC 1H26A 4CFUA 4USEA 2UV2A 3T9IA 2B0QA 3FPMA 3W33A 4YPDA 4CCBA 3KCKA 1O6YA 3BQCA 3TXOA 4DTAA 3HRFA 3QRKA 5FP6A 4QMLA 3ANRA 3GC9A 4XOYA 5M53A 4N57A 1H1QA 4FZ6A 2O2UA 4D5HA 4MVFA 3AC2A 4I92A 4DT8A 1RJBA 4U0IA 2XKFA 3ORLA 2VX1A 3L1SA 4HZRA 5KZ0A 4XRLA 5BUIA 3F6XA 4MX9A 3P5KA 3AXWA 4FKQA 4UMPA 2X6DA 1O6KA 3CY2A 4CTBA 3Q9XA 4ZY4A 3W1FA 1FVVA 4PPAA 5A3XA 4H58A 3N4UA 4FF8A 2W1DA 4C33A 3EN9A 3RZFA 3RWPA 3EIDA 3CD3A 2YIWA 1UU3A 4XG4A 4EORA 2ITWA 2R5TA 3G2FA 5C27A 3U9NA 5CNOA 1FMKA 4AU8A 1YXTA 2PPQA 2C69A 4KWPA 4B8MA 2ZAZA 3QWKA 4D4SA 4WRGA 4TWPA 3U6IA 4IE9A 1BUHA 3Q4ZA 2BTSA 4MWIA 1GOLA 4U7ZA 4EWHA 5AM7A 1B39A 3CE3A 4IAIA 4WT6A 4C36A 1V0BA 3EKNA 4IXPA 4K1BA 4X3FB 2JIUA 3MGYA 3SAYA 4GW8A 4DITA 3DB6A 4GJ2A 3AOXA 3OFMA 2XK8A 3TNWA 2QOBA 3VS3A 4E3CA 1J7UA 3AQVA 3ZRLA 3RCDA 4QP8A 1OL6A 2Q0BA 2Z2WA 4M84A 3DBQA 4MK0A 1CKIA 4C35A 2W1CA 5J5TA 4DTBA 3ZMMA 4GT4A 2VN9A 4I6QA 5EW3A 3OD6X 1GY3A 5AP7A 2R3RA 3ODZX 4G3EA 4DC2A 3DXNA 3RJCA 2A1AB 3RAWA 4CVAA 4XV9A 2GS7A 3BLRA 3GCSA 3HKOA 4M97A 4YPSA 2PVHA 5FM2A 4WIHA 2Y0AA 5FBOA 1U54A 5A4QA 4DGOA 4PY1A 5DPVA 4FK3A 5GJGA 1PY5A 1XQZA 3TKIA 2VO3A 3DQXA 3RCJA 3QQLA 5LMBA 4YBKA 3BHYA 1R0PA 4GUBA 4FEWA 5CAVA 1NVQA 3TJDA 5HKMA 3FJQE 4DEGA 5CASA 3E3BX 2YCRA 2J90A 4HNIA 3UO4A 4GG5A 5T68A 4V0GA 5CNNA 4FSUA 1VEBA 2OIDA 4YP8A 3UQGA 3VULA 2ONLA 5HVJA 4CKRA 3JVRA 3C9WA 3ZONA 5G6VA 2G15A 3CQUA 5EG3A 1ZMWA 4D0XA 4AZVA 4O81A 1M7QA 3F61A 2C3LA 2AYPA 3CJGA 3F9NA 2EVAA 3C4XA 5DT4A 4D2PA 3BWJA 3HP5A 1RQQA 4I94A 2ITZA 4H39A 4B6LA 3G0FA 3TZ8A 2V5QA 1MRVA 2BHHA 3A7HA 3QZHA 4YZNA 4AGUA 5LWNA 4QQCA 1OUYA 1S9IA 3VS2A 2J0LA 1HOWA 2DUVA 4BVUA 4JXFA 5CXZA 2JKKA 1JSVA 3DPKA 1URWA 3KF7A 4NU1A 3W18A 3C4CA 2A2AA 3DJ7A 3PA4A 4X3FC 5ANJA 2IVSA 3UTOA 4OBPA 2QONA 4U6RA 4FNYA 4Y85A 3TNHA 2V7AA 2C3JA 3FMMA 3OY3A 4IX5A 4I3ZA 4ZZOA 4AE6A 3DKGA 5BYYA 5HX6A 3MVHA 4H1MA 4MXYA 2F2CB 1WVXA 4WSQA 4BDBA 5FXSA 4MD7E 5DI1A 2YCSA 4IJ9A 4RSSA 4YUQA 5IU2A 4MQ2A 2P33A 3VUIA 3IW4A 2GQGA 2VWUA 4X2GA 4FTQA 3PPJA 3WZJA 5K0XA 2WU6A 3Q5IA 3I4BA 3BU6A 4PTCA 3VS0A 4KIOA 4H1JA 2HXQA 3NUUA 4NEUA 4TYHB 4O7SA 4DLJA 1EH4A 2W9FB 3CY3A 5AUVA 2OIQA 3HA8A 3MH2A 3KXZA 1FOTA 4KIPA 4JG6A 4U97A 3GC7A 4K9YA 1XH8A 3QUPA 2VZ6A 1YW2A 3LJ0A 5LARA 3RBWA 2PVMA 2IN6A 3OS3A 4NM0A 3DTWA 4F1TA 4YC6A 5E8WA 2VTSA 3ANQA 2R7BA 3Q60A 5FTOA 2A19B 3Q6UA 3IQ7A 3R8VA 2YN8A 3RAHA 4ZIMA 2UW4A 2QLQA 2CKPA 3R8MA 3RK9A 4F1MA 1ZZLA 4L53A 4C3PA 2JDOA 5AR4A 1FMOE 5JRSA 3U6HA 3V5PA 3F2RA 3G15A 3Q52A 3ERKA 1PXLA 5DRDA 5HICA 1QPCA 4BBMA 3D9VA 3OOGA 1Q8WA 4IMYA 2YAKA 3HDMA 2UW0A 1TQIA 4JOAA 4MXAA 4NZWB 2C6KA 2QR8A 2C6LA 1WBWA 1ZOGA 3I79A 4P7EA 3WYXA 4OTWA 4QTDA 2GNIA 3L9PA 3P78A 4FOCA 3SQQA 2RF9A 2VWXA 3CKWA 2W06A 4O22A 1JOWB 3PSCA 5CYIA 5FGKA 2J0IA 3PWYA 4M12A 3UZTA 2ZM4A 4FODA 2PUIA 3IDCA 3FSKA 2RFNA 1TVOA 3MPAA 4FTIA 1T46A 2QOCA 4PDOA 2PWLA 1BKXA 4TWOA 3C0IA 5EDPA 2BAQA 3TN8A 5K4JA 2IZUA 3DJ6A 2B1PA 3GCPA 3LJ1A 3AG9A 5FEDA 4AG8A 5L8LA 1STCE 4MH7A 3ZO3A 1YWRA 3VS4A 2HYYA 3MH3A 4YJNA 3U4WA 3POZA 3VN9A 4U40A 2YZLA 1BL6A 5F1ZA 5M09A 5HE3A 2HZ4A 3EHAA 2CGWA 2P55A 4JAJA 5CSWA 1FGKA 3M42A 4U9AA 4ZTLA 3HAMA 4U79A 2V0DA 2VGPA 3RM7A 3Q32A 3DAEA 4R6VA 3O0GA 2XNOA 2C6DA 2BFYA 4JRVA 4R5YA 4WBBB 2XJ0A 3CPCA 5IQBA 5B2KA 1R78A 3UVPA 4FV3A 4LL5A 5HD4A 2HOGA 4KIKA 2NRYA 4BIBA 1Q8YA 4I1ZA 2V22A 3Q96A 3UYSA 4RIXB 5AIRA 5KMJA 3NUNA 5BPYA 4JBPA 3P0MA 4PX6A 4E5BA 4AACA 1Q97A 3TDWA 1KSWA 4EH9A 4BY9E 3ALNA 4MBJA 4BCGA 1MQBA 4D2VA 3L9LA 3NUYA 4FIEA 3LFBA 2UZBA 3FY2A 3C4WA 4M0ZA 3VRYA 5CX9A 3MFTA 4OTFA 4CRSA 3R7IA 4RVMA 1M52A 3E8EA 1H1PA 2BIYA 5AV2A 2QU6A 4FIHA 4IVCA 5C8MA 3R22A 2BZJA 2OJGA 2Y4IC 4MXXA 3EQDA 1OM1A 1UKHA 2W96B 3QD2B 4MTAA 2JC6A 3BYMA 4GK3A 5CSXA 3DS6A 5IH4A 4GKIA 4BI2A 4MNFA 4P4CA 3U6JA 3SXRA 2HY0A 2HELA 4J53A 4PPCA 3DK6A 2C47A 4FVRA 4CT1A 2E9PA 5JFXA 1TKIA 2WTKC 2OSCA 2VNWA 3EJ1A 1L3RE 4WG3A 3BEAA 3DBCA 4NM5A 4YNEA 5DNRA 3ZLWA 4IC7A 3DKFA 1BL7A 3MVJA 3QKKA 4R3RA 4AOTA 5HU9A 2RIOA 4QP6A 2X1NA 3Q9ZA 3OBJA 2JDTA 2QO2A 5AADA 4FUXA 1SNUA 4CFVA 1I44A 4AOIA 5CAOA 4BCPA 2XNEA 3D7TA 4JDHA 5CEPA 3QRTA 3ATSA 5EHOA 4FGRA 3GCVA 4QNAA 3PPKA 2XJ2A 3FQSA 4HJOA 4NT4A 5F20A 4FTRA 2FYSA 5A6OA 4XG3A 2C5VA 4UXLA 4S33A 3ZSGA 3E3PA 4RZWA 3E8NA 1J7IA 1OKYA 4V05A 5IMEA 5BVEA 4WOVA 2YM7A 4I6FA 4PL4A 4FC0A 4MXCA 1HCLA 3QZIA 3G5DA 3ALOA 5TF9A 4QQ5A 1NT2A 3IONA 5KMKA 4MYGA 5ETAA 4ASZA 3C7QA 2PL0A 2R4BA 3MY5A 3VBQA 1IASA 4R5SA 1BI7A 4G9CA 3MSSA 3VNTA 3ORMA 4QMNA 3D0EA 2ZV7A 5C03A 4P5QA 3G51A 4GK4A 4YJOA 3F3WA 3ZSIA 3C0GA 2EUFB 3OHTA 4I41A 3G6GA 4DEHA 4OGRA 1CKPA 1NVRA 2PZIA 1JNKA 3GVUA 3NYOA 4YJRA 3LAUA 4PMPA 3OWLA 3MA3A 3LFEA 3LXKA 2WGJA 3QCXA 2WMTA 4JR7A 1Z57A 3MJ2A 5HCXA 4C3FA 2XK9A 5L8JA 4ZSEA 3M2WA 2BIKB 4ZXTA 5L2SA 3S1HA 3LM0A 3K54A 4Q5HA 4G34A 4FNWA 5IZFA 3HUCA 3EQIA 4EOKA 4YO4A 4O91A 2YM8A 1NVSA 4CV9A 2BDWA 4EOOA 4EYMA 4PMMA 5ACBC 4BDJA 3FMJA 4KNBA 3JPVA 4EK3A 5E8YA 3QRJA 1IAJA 3CIKA 3PTGA 3S2PA 4PTGA 3FLWA 4DFLA 4BICA 4NFNA 2EU9A 2Y6OA 4TL0A 4G1WA 4W9WA 3R9HA 2X2MA 4G5PA 4XEYA 3EL8A 3UOHA 4AZTA 3EYHA 3ZSHA 2P2IA 3BYUA 2BRHA 3F2NA 4FV6A 4MBLA 4XLIA 3UOJA 2OO8X 3TZ9A 1WMKA 1BX6A 5DGZA 3CC6A 4DG2E 3IDPA 4BKYA 4XP0A 4TKSA 4MHAA 4ANMA 4C34A 4IM2A 2ZYBA 2WQMA 4AP7A 3FEGA 4K33A 3L8SA 3VJOA 4Y46A 5JRQA 2XIRA 1Q24A 3DKOA 4TTHB 1CSNA 4UWCA 1YDTE 3PP1A 4XG6A 4A4OA 3B8RA 5DE2A 5IEVA 4DLIA 4QYHA 5L2WA 4QP3A 2RL5A 4R1YA 3EFLA 3LLTA 2CPKE 1YI3A 4GKHA 5L6PA 4FV2A 5ETIA 4DG3E 1U59A 2BZKB 2ZM3A 4CRLA 2F7EE 1J1CA 3QF9A 4CXAA 3O23A 2UZOA 5I9UA 3CQWA 2ERKA 4QMMA 3L8VA 3SGCA 1P4FA 5CT7A 3FE3A 5HNBA 2BRBA 4IC8A 1RW8A 4UMUA 2PSQA 4WD5A 4WHZA 3R8UA 1U4DA 4MEDA 5L8KA 3ET7A 4O6EA 4FTOA 3T3UA 4BCJA 4USFA 5CSHA 4L43A 3R01A 4ITJA 4FEQA 4RC4A 3ZFXA 5TO8A 4BDAA 3KB7A 1NA7A 2RFDA 1DAWA 3QALE 4FSQA 2UZLA 3GOPA 3SVVA 3Q4UA 1VYZA 4BDGA 4YHTA 3TACA 3MTFA 2LGCA 5HGIA 2BDFA 4AGWA 4C37A 3O50A 4CMOA 3LMGA 1W82A 2C1BA 3SD0A 3NUSA 4OR5A 1W0XC 3VBTA 4M69B 3DDQA 5L3AA 5CXHA 1H28A 3P08A 3GFWA 4QMSA 5CQWA 4UXQA 4EBVA 5BX0A 5H8GA 2I0YA 1SVEA 4TWCA 2PVJA 2NNWB 1GIIA 1J3HA 4QPMA 4BTKA 1YI4A 5CU2A 5CZIA 1OVEA 3HECA 2CLXA 3PG3A 5HIBA 3ROCA 4IAAA 3FMKA 4B8LA 3MI9A 3VAPA 4LL0A 2WQNA 2W1IA 3WF7A 2VTOA 4GU6A 1F0QA 5FEEA 4BBFA 4ERWA 4DA5A 3R7GA 4YURA 5DMZA 4EKKA 4O1PA 1A48A 4FIFA 2VX3A 4IACA 1GJOA 5CVHA 4BCMA 3UIXA 3UQCA 4LMNA 3R73A 5J7HA 5KKRC 1XH5A 2XEZA 4O0VA 4EH2A 4RWLA 3BU3A 3R1YA 4J95A 4NKAA 2BZHB 2OH4A 5KHXA 3N4TA 4EZ5A 4F7LA 3NUPA 3MFSA 3CCNA 4MNEB 3NVMB 5EQEA 4C7TA 5KMIA 3QD4A 5FRIA 2WQOA 4DFNA 2YWPA 4DN5A 4EHGA 4AN9A 4Y72A 2C6IA 4I22A 5AP3A 2VD5A 3KVXA 4F7NA 5BYLA 4DFYA 2GNJA 4R7IA 3LFSA 4YTHA 3TV6A 3PP0A 2VRXA 3NEWA 1YHWA 2BAKA 5AMNA 4O1OA 1YVJA 3R1QA 5CS6A 4LG4A 4AW0A 3FL4A 1J91A 3ZUTA 3LFNA 4HYSA 4IX4A 1CTPE 3VS6A 5EYDA 4D55A 4UYAA 5IDPA 5FXQA 4XYFA 1ZYDA 4ACGA 2UW8A 3MTLA 3R7UA 3WF9A 4AFJA 3W2OA 3KK8A 3Q6WA 4K77A 3AT2A 5CZHA 5DWRA 4RIYB 5IQFA 2CKEA 5DOSA 5I0BA 2O3PA 4JIKA 3ZS5A 4D9TA 1PMVA 3ZC6A 4RJ4A 4XOZA 3ZEPA 3R7EA 3R04A 2OFVA 4F4PA 4FYNA 4ZJJA 3KA0A 2UW6A 4TZRA 4BHNA 2GFCA 3NAXA 4ID7A 4FR4A 3FI3A 3PDTA 3D15A 3IG7A 4FMQA 1XH6A 5JN2A 3LKMA 4NIFB 4FOBA 3WILA 2XYUA 4FSRA 5CWZA 4ZZMA 3POOA 3GU7A 4TYGA 3O17A 2FSMX 3LJ2A 5AR3A 1OBDA 2W05A 3VUGA 3SG9A 2B9HA 4HW7A 2IWIA 3DZQA 4D9UA 4IFCA 4CZUA 5B7VA 4DINA 5E4HA 3F69A 2Z8CA 4FV0A 5IUIA 2QKRA 3KL8A 5AUTA 3UDBA 3LCOA 4HOKA 4EKLA 3MB7A 5TOZA 3CBLA 3GT8A 4K11A 5DR9A 4C57A 3HV7A 4NW6A 4ZZNA 4PNKA 3KU2A 1YHVA 3DY7A 5AUWA 3R7OA 4FTNA 5LVLA 2JD5A 4FTUA 3BGZA 4GVAA 4K8AA 4L7FA 3RPVA 3AT3A 4EC8A 4NJ3A 3FXZA 5E91A 2XKCA 2OH0E 3V5QA 4ZLYA 2P0CA 4DFXE 2GCDA 3FKLA 3O2MA 4I0TA 4OTRA 4X2JA 4IWPA 3R7VA 3ZZWA 4DG0E 5LVOA 4EH6A 4C4FA 5M4FA 1Q5KA 4BWPA 5A9UA 4AW2A 5DN3A 4NSTA 2C5YA 2ETRA 3R28A 4M66A 4E1ZA 4ZMEA 3ITZA 1PKDA 3H9OA 2PMOX 4UMTA 1BLXA 3TIYA 4CZYB 3ZFMA 3WF6A 4O7ZA 1B6CB 3WZDA 2J5EA 4DH1A 3GCUA 4MBIA 5EOBA 2PHKA 3KRWA 4FKLA 2XNGA 4HCVA 2QR7A 4QMYA 1OIQA 4S2ZA 1UWHA 4F70A 4O7RA 5FTGA 4EZ3A 4CCUA 4YGAA 4ZTHA 4AA0A 4GEOA 2PMIA 5JGAA 1J1BA 5EW8A 5EDRA 4BKZA 3OT8A 3ZRMA 5JEBA 3PJCA 4E5AX 3KXMA 1UU8A 4F9WA 1PMNA 1W83A 3OG7A 4JDKA 1CMKE 4M14A 1ATPE 5FEQA 3BEGA 4ANQA 2OK1A 4BIEA 2VTIA 3H30A 5E8XA 3DDPA 4IWOA 5M56A 4EL9A 3QQUA 3PWDA 2BUJA 3ENHA 4OTDA 3KC3A 4QTCA 4TW9A 4DBNA 5AEPA 3KRXA 4FZDB 4WG5A 4D2RA 5A4LA 3HP2A 2ZB1A 3BE2A 3I0QA 1M14A 4L00A 4WO5A 5LXMA 2BRGA 4GT5A 4EK5A 4FKGA 2VWBA 3CJFA 3Q4CA 4F6UA 4L8MA 3QX4A 3UPZA 4EEVA 4UB7A 3BU5A 4RLKA 3EB0A 4FUYA 3Q2MA 3FI8A 2YACA 4TXCA 2R0UA 5J87A 3DBFA 3WE8A 3GBZA 1IG1A 2CN5A 3BBTB 3FC1X 1Y91A 1YOMA 5GJDA 4C4HA 2F4JA 2WMQA 4J7BA 4XX9A 4JBQA 1ZYCA 4QO9A 3PIZA 4WRSA 2YIXA 2X2LA 4H36A 5M06A 3FYKX 2CGUA 4CQEA 4GU9A 3ETAA 4LGHA 3KRRA 5KZIA 4JL9A 2WKMA 4RJ7A 5E9EA 3IS5A 3H9FA 5JQ8A 1GZOA 4HVSA 2VGOA 1V1KA 4FIJA 3PXKA 3W10A 5EH0A 5C26A 2CNUA 1Y8YA 4FKOA 2OLCA 3PJ1A 5G1XA 3SXFA 3ATTA 4B99A 3RHXA 1Q99A 3LMIA 3DLZA 4PRJA 3ZDIA 2ITPA 3FKNA 4FT3A 3BPRA 4IVBA 4I0RA 3VS5A 1WVYA 5IG1A 1W84A 2CCIA 2HW6A 1UKIA 4PL5A 4FKIA 1Q8ZA 2RGPA 4I23A 3LVPA 1SYKA 3AGLA 2Y4PA 4KBCA 2ETKA 3W8LA 5KMOA 2VTAA 2I40A 2RFSA 2A4LA 2JKOA 4EQMA 4BI1A 1YI6A 3AC8A 4AE9A 4BDHA 2YEXA 3TZ7A 3RZBA 4FYOA 5E8ZA 4I24A 2GHMA 4O7NA 4NCTC 3M1SA 3PIYA 5FDXA 3KFAA 4JVGA 4XNEA 5K9IA 4Z9LA 2DS1A 5E8SA 1WBOA 2XM8A 5LOHA 3DQWA 5E1EA 4CG8A 2GMXA 4Y73A 2A27A 3QD3A 4GV1A 5AJQA 4CKJA 4O0XA 2IVVA 5B2MA 1U54B 2RG6A 4LOPA 3V5LA 3JY0A 3EQHA 3ODYX 2VUWA 4RC3A 3C5UA 2IG7A 1CM8A 5ETCA 3EZRA 1YXXA 4G5JA 4FKPA 3R8ZA 1XWSA 5AR8A 4BBEA 3UIBA 4RLLA 4H05A 1WVWA 4NUSA 2ITOA 3E5AA 2OU7A 5JQ5A 1V0PA 5EI8A 3V6SA 4N6YA 2QODA 2J0KA 2XP2A 2YFXA 1K9AA 3PUPA 4RA4A 4LRMA 4M67A 3SW4A 2IW9A 3FMNA 4J8MA 4EQUA 1OIRA 3IECA 2RSVA 3CSVA 2HAKA 4EH4A 5JZJA 3QXOA 4OBQA 4X21A 1Q3DA 4ALWA 2P3GX 5D7VA 3COHA 3G90X 4A9UA 3ORIA 1MQ4A 1Q61A 4KA3A 4FL3A 2EWAA 3FZPA 3LM5A 4IAKA 3NYNA 5E92A 1KUTA 2WTCA 3DKCA 4GK2A 5BVNA 1LPUA 3NMUF 5A54A 2XUUA 3CGOA 5TE0A 3LZBA 4K6ZA 3RP9A 4BKJA 4FA2A 3FYJX 4L6QA 3QZFA 3D2KA 3CEKA 3C13A 3MA6A 4FSWA 1SVHA 2OKRA 2G2FA 4OTIA 4QTAA 5DIAA 3RPSA 1VJYA 2H8HA 3A99A 3MY1A 4ONAA 4OLIA 5KMMA 1OBGA 3COKA 4X3FA 3QTIA 3W2SA 1UNLA 2IO6A 4XLVA 2I0HA 3PVUA 4XMOA 4IM3A 4ARKA 3EN7A 3BCEA 2Y6MA 3QZGA 4U5JA 3VVHA 3FMHA 2GQSA 2C6OA 4D28A 4ZOGA 3UOLA 4B9DA 3GI3A 5M55A 5EFQA 5AUXA 4P5ZA 3OUKA 2F9GA 4H3PA 3C5IA 3NWWA 1Q62A 2IZRA 4E26A 1MRUA 3QX2A 5EM5A 4UEUA 4HPTE 2BAJA 2OZOA 5GZ9A 4D1ZA 2PZPA 4KSPA 4MAOA 4ZK5A 5BUEA 1XH7A 1DI8A 4RFYA 3V5TA 2XRUA 3JY9A 4QP1A 4FKRA 2Y7JA 4Z3VA 3DT1A 1KE7A 1YXVA 3VS1A 4G3CA 4LUDA 4ALUA 2R3IA 3EOCA 2WAJA 4L9IA 1KOAA 1P5EA 2OICA 3QLGA 4FIGA 3D5WA 4IDVA 3LCSA 5AP2A 4AZWA 3EQBA 3BZ3A 3U54A 4Z7HA 4C4IA 4DHFA 4ZTRA 2ITUA 2OF4A 4LOQA 3HMNA 4EK4A 4GJ3A 5FP5A 2VWYA 3OWJA 4D4RA 4LV8A 4BGGA 5FDPA 1AD5A 3K3JA 5CF8A 5C4KA 3R2BA 1OB3A 1UU7A 3RI1A 4F0FA 1ZYJA 4EH3A 3FDNA 3DZOA 4TRLA 3TUDA 4OT5A 4D1XA 3VUDA 2XM9A 3VBYA 5TT7A 3UODA 3ACKA 1WAKA 4BWKA 1M2RA 3PZEA 4JJRA 5AP4A 2JAMA 2HZNA 3NX8A 4QD6A 4LMUA 2JIVA 4X6RA 2JAVA 3W32A 3U9CA 3OEFX 5KBRA 3L9NA 4FV4A 4DE4A 1PYEA 4ORKA 1YHSA 4OAUC 4M0YA 4ERKA 2GFSA 5HX8A 4P2KA 2C5NA 3DOGA 4W4WA 3TUBA 3OOMA 3NAYA 2C68A 4AN3A 4R78A 3ZHPC 4FKSA 5BMSA 2PVFA 1G5SA 1W8CA 3VHEA 1OUKA 3BBWA 5AP0A 2J0JA 3C51A 1JPAA 1WBSA 5ANGA 3QQHA 5EOLA 4ZSJA 4FTCA 1QPEA 3FQHA 3TT0A 4C58A 3EMGA 4QRCA 2QO9A 5HBJA 4F6WA 3PVWA 5K0KA 4PDPA 2H9VA 3A7FA 4FV5A 4TYHA 4LOOA 5EM7A 5FQDC 2ITVA 3EQGA 2O8YA 3M11A 4TT7A 3UVRA 5J8IA 4BDKA 4XH6A 4XJ0A 3NDMA 2EXEA 3QGWA 1ZMUA 3ZM4A 1JKKA 1KE8A 4M13A 3KKVA 3KN6A 1MRYA 5JGDA 2R3QA 4IADA 1GZKA 2FVDA 4NW5A 3SA0A 5T6KA 1QCFA 2I1MA 2UZUE 3F66A 2PUUA 4LRJA 4M68A 3QQGA 4UYNA 4XG7A 1GNGA 4GT3A 5DEYA 4AQCA 2OXXA 5AV4A 4IVAA 3E64A 3PE2A 3BYSA 4K2RA 3ZXZA 4Q9SA 2YJSA 4O38A 4XV3A 2PULA 3ZTXA 3HA6A 3F3UA 3KY2A 3DK3A 3QUDA 3TL8A 1GZNA 3I6UA 1G8SA 3QU0A 2PUPA 2WMAA 2XB7A 2GPHA 3QD0A 4J97A 3R30A 4JBOA 3I81A 4ALVA 4EYJA 3R1SA 3KMMA 3BWFA 3PG1A 2H34A 4FNZA 3TDVA 1F5QA 5HU3A 3IDBA 3CR0A 4ITHA 1IA9A 2QU5A 3DAJA 2ESMA 1FBNA 4G3DA 3OXZA 1F3MC 3OMVA 3ORPA 4XS2A 3TNPC 3UNJA 3P7CA 3ZOSA 4QT1A 2W7XA 3V51A 2B4SB 3DAKA 4CYIA 4E4NA 5ICPA 1LP4A 2ZVAA 4EK6A 4WKQA 1XBBA 3QA8A 3NUXA 4L3JA 5E8VA 3VF9A 4CMTA 4FTMA 4HGSA 4IX3A 4FTKA 1GIJA 2OJIA 3ACJA 3C50A 4OT6A 4YHFA 4DFZE 2PE0A 4CFMA 4H3BA 2JGZA 2BTRA 4EZ7A 4YLJA 3ZFYA 4FBXA 3UE4A 2GSFA 4BIDA 3FI2A 4PMSA 2WEIA 5I5ZA 3GQLA 5H8EA 4ENYA 1OIUA 4ITIA 4PPBA 3ZO4A 2QD9A 3L9MA 3QRUA 2C0TA 4EI4A 3P7BA 2W1EA 5HIDA 5M4IA 1JAMA 3FMEA 4J52A 4GCJA 5CLPA 4MXZA 5C1QB 5GZ8A 5EYMA 4F63A 1J7LA 3EQRA 4J99A 3HMOA 4RIXA 3BELA 3H3CA 3I7CA 3Q3BA 1PHKA 5AP6A 4FEUA 3BHHA 3VQUA 4IX6A 3QQFA 4FEXA 3TJCA 2C6MA 2V55A 2XRWA 5EQYA 4IJPA 3ORKA 4W8EA 1WCCA 2ITYA 2Y8OA 4GYIA 4ZTQA 4FTJA 3FZRA 1OPLA 3MS9A 3IK3A 4CFWA 3PIXA 1Y8GA 5KMNA 4CTCA 4OUCA 1JWHA 2Q0NA 4J71A 1BMKA 5BVWA 4ZTMA 4TNDA 4D2SA 2X39A 1Q8UA 4MF0A 3UC4A 5HD7A 2BKZA 4RJ8A 5AUUA 3JR1A 4ACDA 4EK8A 5BUJA 4ANNA 5EYCA 2QNJA 5C4LA 4MD9E 3AC5A 4QMUA 5JFWA 2OF2A 3D4QA 2B55A 4R7HA 5DLSA 4FSNA 3VUTA 4O27B 5CU4A 3F2AA 4XUFA 2OWBA 2PE2A 2YA9A 2BPMA 3GP0A 4YNOA 4EHVA 4ACMA 3GC8A 5B2LA 3DGKA 5H9BA 4ZSAA 1M2QA 1Z5MA 5IA1A 3SHEA 3IOPA 2WMWA 1ZARA 2PVKA 2Q83A 3SXSA 3DCVA 4RX5A 5L2QA 5FLFA 1RE8A 4DH3A 2OJJA 1P2AA 4YC3A 4QPAA 3UC3A 1LR4A 5HTCA 2HXLA 3HV6A 4E5WA 4EJ7A 4JQ8A 3ULZA 4AFEA 1JKSA 3NW7A 4B4LA 2PVLA 1IA8A 3LMHA 1OPKA 4GVJA 4JI9A 3R7YA 5L4QA 5EKOA 5L6OA 3NVKI 2FSTX 2PTKA 3A61A 3KXXA 1PMEA 3E62A 3NCZA 5BQ0A 1Z9XA 2VWVA 3MH0A 4I5MA 4R77A
chains in the Genus database with same CATH superfamily
5ANKA 1HCKA 3U8WA 2VX0A 3FSFA 5KHWA 3NYVA 1H25A 1PXPA 5AAFA 1JSUA 1MP8A 3LFCA 3OP5A 3FZTA 4LGDA 2QQ7A 2WTWA 1PXJA 3AKLA 4QP7A 3F5GA 3PXQA 4LYNA 5J1WA 3DB8A 3I0OA 4L3PA 4BGHA 4BTMA 1FVTA 4FT5A 5DFPA 5CSPA 3NYXA 4AT4A 3JUHA 4HPUE 2OJ9A 3VS7A 1H08A 1XMLA 2XYNA 2W5HA 4BFMA 2R3NA 3AGMA 4J96A 5HTBA 5F94A 4UMRA 4TPTA 3VHKA 5JSMA 3GU4A 4ZJIA 4NKSA 3MN3A 5JZNA 4IB5A 5IEYA 4U42A 4AXCA 4DH7A 4JS8A 4XV1A 3PLSA 4JDIA 5LMKC 2CJMA 3PJ2A 5H3QA 3MBLA 2W0JA 2XK7A 1OKVA 2ZB0A 2YCQA 3R8LA 3I60A 3SRVB 4BC6A 1ST0A 1CDKA 5AAEA 1G8KA 4APCA 5HG9A 4M8TA 4WG4A 4I6LA 5AR2A 2OI4X 1E1XA 3BHTA 1YKRA 5HG5A 5BVDA 4QDEA 3FC2A 3JS2A 3OVVA 3UP7A 5IUGA 2ZMDA 3EYGA 2C0IA 4RQVA 2UW9A 4IM0A 3TYKA 2XK6A 4BGQA 4RJ6A 4UALA 3ULIA 1ZYSA 2VO0A 3S4QA 2VNYA 4BTJA 3KXNA 2J4ZA 4HVIA 4BR3A 4RPVA 3UGCA 4DGMA 2XANA 3EZVA 4PL3A 4O0WA 4A9YA 3R71A 2PMLX 3OXIA 3SC1A 4KAOA 4UWYA 2XMYA 4HYIA 2ZV2A 4IVDA 4ZMFA 3E87A 2QC6A 2UZNA 3IW8A 4QNYA 3AD4A 2IPXA 1SMHA 5FUTA 4IDTA 4RIWB 5I9VA 1YOJA 2WQEA 4OAVB 5HO7A 2QOHA 3RNYA 3ROYA 1XHAA 4J98A 3QGYA 3TG1A 3QWJA 2WFYA 5DR2A 4CKIA 4C4EA 4USDA 4XCUA 4AF3A 2WNTA 3FWQA 2W99B 2EB3A 4EOLA 3DV3A 4IZ7A 5CANA 4G6LA 3H0YA 3G9LX 3N9XA 4LFIA 4X2NA 1H8FA 2FUMA 2YHVA 4TYJA 2JKMA 5EYKA 4C38A 4CMUA 5DG5A 3FV8A 4F08A 3G33A 2G1TA 3QCQA 3LE6A 5HIEA 3F5PA 5JT2A 2Z7LA 1PXKA 3ENMA 4X2FA 3QKLA 2AUHA 5CVGA 4EWQA 3HV5A 4E6CA 3PJ3A 3W16A 1OGYA 3ZLSA 2NO3A 2W4OA 4JNWA 4XBRA 1IEPA 4QQJA 4RX8A 1PXOA 3FLQA 2JITA 4UY9A 5AWMA 2JLDA 5FBNC 3UZRA 2W1FA 2YITA 4UMQA 5M57A 4QYYA 3QFVA 3UOKA 1LEWA 3SOAA 3U87A 2JDSA 4AGCA 5AIKA 3AMBA 5I9ZA 1YWVA 2W4KA 3KMUA 3F82A 3KVWA 3LFQA 4IZYA 3GCQA 4DCAA 5DH3A 5HE2A 5J79A 2VTNA 3MJ1A 4N6ZA 3D5XA 4O6LA 3OUNB 5ANIA 4O7YA 5M44A 2F7XE 2QOQA 5H8BA 4D1SA 4OTGA 5A4TA 4Z7GA 2XIXA 1E1VA 3ZM9A 2QOOA 5TKDA 3DNEA 4CEGA 4BCOA 2BILB 5J1VA 1OZ1A 2VTQA 3BYVA 4RWKA 3PY1A 1OITA 4QMWA 3HGKA 1OI9A 3ZLYA 3ZUVA 2XBAA 4BZOA 5CF4A 5HBEA 4AA5A 3W0PA 2C3KA 4WSYA 3VUKA 4HVHA 1OKZA 2G2HA 2E9VA 1ZOHA 4KRDA 4M69A 4ASXA 3OTVA 1XH4A 2ZDUA 3OWPA 1FVRA 4QMXA 4BF2A 2X8DA 3F3ZA 2R2PA 2JDVA 2NPQA 3FHIA 5IISA 4ZSGA 3ZU7A 3UG1A 4E93A 3G0EA 2JDRA 3KXHA 3N51A 1T45A 1YWNA 2X9EA 1A06A 3EKKA 3E8CA 2W5AA 4L01A 3LOKA 1OL5A 4KABA 2WQBA 3NZ0A 1JSTA 5CEIA 4C4JA 4BDEA 4G2FA 4C59A 4XG8A 3RHKA 2WOUA 3QLFA 4Q9ZA 4Z16A 4ZLOA 1H1RA 2R3JA 3QQJA 3U55A 2ITNA 4ANSA 2O0UA 2GNGA 2PVRA 5EM6A 2ITTA 4QMTA 1Q3WA 2YM3A 4Q5EA 2YISA 4R7BA 4HGTA 4AS0A 5ACKA 3SX9A 3TV4A 3S00A 4BJJA 4PQNA 2C30A 4FK6A 5D12A 4KBKA 5HCYA 5C01A 3PSDA 4MNEA 1S9JA 5BYZA 1ERKA 3QTSA 5D41A 5I9WA 5IDNA 3FKOA 3IO7A 2X2KA 3TMOA 3HX4A 2A98A 5E90A 5KCVA 3KULB 5IQEA 2XKEA 2X7FA 4FL2A 1DAYA 3V01A 1OL1A 5BNJA 3OCSA 5HNIX 1XH9A 3PRFA 5JGBA 4UX9A 3CTQA 4FT0A 2E9UA 4FKWA 4HCUA 2GDOA 5EI6A 4FG7A 2WIPA 2WZJA 3UDSA 1VZOA 2WO6A 4FI1A 2GNLA 3AC4A 1FINA 3NNXA 4FTTA 3FI4A 3JVSA 5CU3A 4JT3A 5HESA 5HI2A 1OKWA 1SVGA 5EHLA 2B9IA 3E7OA 4S30A 4E6AA 5GJFA 4G31A 4AXEA 4E7WA 3I7BA 3DBDA 4YHJA 2J2IB 4FZ7A 2HCKA 4QQTA 2QVSE 3FXWA 5KMLA 3TNIA 4A9SA 2XIYA 4RIYA 3NIZA 4L52A 4O7LA 1KWPA 3TM0A 4XG2A 1GIHA 1P14A 2X0GA 2XCHA 3E63A 4GSBA 4S32A 4BL1A 2X4FA 5GHVA 2PVNA 4KKGA 3PZHA 3GENA 2YDJA 4UZDA 4C3RA 4ZS4A 3QYZA 3ZC5A 4FV8A 5C8NA 5E1SA 4N4SA 5CI6A 4LUEA 3FZSA 1PRYA 4RJ3A 5F9EA 4CG9A 4IAFA 2UZEA 5DEWA 4F9BA 2I7QA 4PP9A 1KE5A 4IAYA 2CKQA 5LVMA 4KSQA 5L2TA 4U45A 4AZFA 4R3CA 4FVQA 3UO5A 4DAWA 4O7VA 1UNHA 4BCIA 3MVLA 5JKGA 4O84A 4APPA 3RPYA 3ELJA 3F5UA 3BIZA 2GQRA 3NLBA 3A8WA 3PRIA 4FEVA 3CKXA 2KTYA 5KX8A 5HZNA 4TY1A 2XH5A 2FSLX 3D94A 4Y83A 4YJVA 3ZH8A 4QYEA 5J9LA 5M07A 4EQCA 3BX5A 3LQ5A 3LPBA 3HV3A 4RFZA 5GNKA 3HMPA 2YDIA 4W9XA 4ENXA 3BV2A 1H24A 3C1XA 3BHUA 5HEZA 5IQAA 3FY0A 3O8UA 1JKTA 3D5VA 4HGLA 5HO6A 2CNVA 1GZ8A 4L7SA 1AGWA 2B52A 2HZIA 2CDZA 5HORA 5GIPE 3MY0A 2OZAB 4A07A 3DBEA 4HGEA 5EM8A 3V5WA 1G3NA 3P5JC 3OCTA 1PJKA 2XEYA 3F5XA 3CD8A 2J7TA 3R9NA 4ASDA 5BMMA 4DEEA 2HW7A 3NPCA 5E7RA 5ITAA 3LFFA 4GMYA 5GZAA 4G16A 3V5JA 4DHJA 1UNGA 3BQRA 4DEAA 3LW0A 4A9RA 4FV9A 3GUBA 4JX7A 1YXSA 4YJUA 5IUHA 5FWKK 3PVBA 4NJDA 1H1WA 1ZOEA 2AC5A 1PKGA 1MUOA 2PK9A 4RVKA 3R00A 2X0QA 2UW5A 2OG8A 2WELA 4FG8A 5EK7A 2OIBA 4GRBA 3TKHA 3RAIA 4E20A 1PMUA 3GU6A 3QHRA 5DVRA 5AV1A 5CAQA 5D9HA 5M4CA 2I0VA 2VTHA 2R64A 2HZ0A 4MF1A 4FICA 3D14A 5AX3A 5AM6A 4I5HA 4QYGA 3DK7A 3OEZA 2CN8A 1K3AA 2W17A 3MYGA 3VW8A 3WF5A 4DYMA 3LHJA 4NCTA 3RVGA 1BYGA 2YWVA 5BV3A 3HL7A 3NRMA 3T9TA 5A14A 5CENA 2WOTA 3CPBA 4YTIA 3LLAA 1Y57A 2X6EA 2X4ZA 3BL9A 3AC3A 2VV9A 3BE9A 2YDKA 5K3YA 3OCBA 5CF5A 5BVOA 1Q8TA 4S34A 2VWWA 3LCTA 4F9CA 1UWJA 4EC9A 4AW5A 3MDYA 4F9YA 1LEZA 3KRJA 3PUFC 2R3MA 3MIAA 3MV5A 5HG7A 4UN0C 2IW8A 1DM2A 2UZWE 3U51A 3IKAA 4XRJA 2XK3A 4IB0A 3PXFA 5CU6A 3FBVA 3SLSA 1M17A 2XCKA 3A60A 3BRBA 4JLCA 3ZDUA 5DA3A 1ZXEA 3OCGA 3DNDA 4FG9A 2NP8A 1Q41A 2YLEA 3BHVA 4NH1A 5EDQA 3WOWA 2B54A 4EOIA 3U4UA 4OW8A 4GG7A 2BRNA 4O4BB 5L6WL 4S31A 2EXCX 3HYHA 5D11A 4N70A 2F2UA 3HV4A 1SNXA 3SKCA 3TNQB 2YLFA 4CZTA 1CKJA 3A62A 5E8UA 4O2ZA 4XP3A 3ZLXA 5HQ0A 3A7GA 4EUTA 5LQFA 5LVNA 5HE0A 4EUUA 3UNZA 1UA2A 1W2DA 4AQKA 4IAZA 4V0GB 3VUHA 4GFOA 3W0QA 3W2QA 3FUPA 3QA0A 2F7ZE 3NUAA 2Y9QA 4QOXA 1X8BA 3F3VA 4AZEA 2XNMA 5HLWA 2UZTA 4DH8A 4O86A 2X8EA 5M4UA 3QCYA 1REJA 4ACCA 4YJPA 4O82A 2DYLA 2OXDA 2WB8A 3NNVA 4QMOA 3ZUUA 4DGNA 4OTQA 5HO8A 1I09A 4O4FA 5D10A 4JRNA 5J95A 2V7OA 2BMCA 5AR7A 2W9ZB 3RM6A 4CFFA 1KE9A 2R3GA 5KNJA 1IAHA 4YZBA 2WHBA 4GFMA 4CNHA 4F09A 4BHZA 3EL7A 3KF4A 3MPTA 3W55A 4L68A 4PUZA 3FLYA 3GEQA 4U80A 2QG5A 3E8DA 3P79A 3O96A 2FH9A 3QRIA 4RWJA 2XIZA 3GGFA 2YCFA 3HDNA 2GTNA 2PVYA 3B2TA 1U5QA 3QAME 3QL8A 4I93A 4U41A 1YDRE 4FIIA 4RA5A 2C5XA 2XZSA 4D0WA 4F7SA 4F9AA 3PFQA 4N0SA 4YU2A 3LCKA 3UMWA 4RVLA 5KUPA 3LFAA 4QTBA 3R9DA 2WIHA 2PUNA 4G9RA 4O96A 5IA5A 4FX3A 3R9OA 2CSNA 3O51A 2JEDA 4BDDA 1XBAA 2XVDA 4BTFA 3PFYA 2R7IA 3UNKA 3G9NA 3GQIA 2UUEA 4JDJA 4YZMA 3RK5A 3WE4A 1TFFA 3UDZA 2XBJA 3MPMA 3W2PA 3RGFA 2YIQA 4GIIA 2VTJA 4KINA 2B9FA 4F0GA 2J6MA 5LVPA 3VO3A 1KE6A 5FD2A 5T3QA 2X8IA 5F95A 5LCKA 5KO1A 3LXNA 2IVTA 4RT7A 3PA5A 3NNWA 3PPZA 5CTPA 1WBNA 4AXAA 4WUNA 2ONLC 2VTRA 2HY81 4ZP5A 5AA9A 4IIRA 2F49A 4JG7A 1KV2A 5DBXA 3ORXA 2W4JA 2YABA 2NRUA 4J1RA 4LQMA 4O0TA 3UYTA 3MVMA 4KRCA 3VBVA 2FB8A 2RFEA 3FLSA 3WZKA 5I4NA 1XMMA 2PYWA 2PY3A 3D2IA 4PNIA 1WZYA 3GB2A 4JAIA 1XBCA 1H27A 4BDCA 3FAAA 1R3CA 4FKUA 2EXMA 4G3FA 1Q4LA 2B9JA 3PXZA 4UZHA 1OGUA 3UG2A 4QMZA 4MKCA 2VTTA 3VF8A 4BCFA 3DTCA 3K5UA 2VU3A 3NW6A 2CCHA 3HRCA 3A7IA 3D7ZA 3QC9A 1R39A 1H0WA 4CT2A 4CLJA 5CQUA 3CLYA 3TTIA 4BCQA 3KREA 2ZOQA 2E9OA 3GXLA 3IGGA 2BROA 4FSYA 4F1OA 3KGAA 5IA2A 4AW1A 4QP9A 4V04A 1XKKA 4AOJA 3OTUA 5IF1A 4MQ1A 5K5XA 2VAGA 2IVUA 2XNNA 4IH8A 4CQGA 4XV2A 5DRBA 4YR8A 3KMWA 3R2YA 1ZY5A 2BR1A 4FSMA 3T3VA 4C2VA 2R3KA 5IQGA 4L45A 1OECA 3OW4A 4Y5HA 4F7JA 4EH8A 5EW9A 4AT5A 1LUFA 3BV3A 3NNUA 3VC4A 2YZAA 4X7QA 3BLAA 3MW1A 3A7JA 3QTRA 2I6LA 3RPOA 1H07A 3TV7A 2BDJA 1IR3A 3BLHA 3ZRKA 2YERA 2OGVA 3EWHA 2VWIA 2WMXA 3O7LD 1VYWA 1FGIA 2OFUA 3BKBA 1YXUA 4ANLA 5FG8A 4HVGA 2UVZA 2XKDA 2G2IA 4KIKB 5JK3A 2FA2A 5FXRA 2PE1A 4JQEA 2WTVA 3R1NA 4YC8A 4BCKA 4KIQA 4BRXA 4D5KA 5IQDA 5LCJA 1G8AA 2Y4IB 3NR9A 4GFGA 4HZSA 5ANDA 3R6XA 5I3OA 3OW3A 3MFUA 2Z7RA 3CP9A 4I0SA 4W8DA 3KK9A 3O8PA 1B38A 2XK4A 5FTQA 4NYEA 3UPXA 3E92A 3FZ1A 4K18A 4E8AA 4DGLC 2W1GA 1WBVA 4DH5A 1JLUE 2WMBA 3HRBA 4X6QC 3WZEA 5AFVA 2CMWA 2WTKB 3IW5A 4TN6A 2WMVA 4AGDA 3HEGA 4NWMA 1ZZ2A 3ZXTA 2HENA 4FKVA 4BWXA 3RINA 3ID6C 4XBUA 3K3IA 3IOKA 3FL5A 4IWQA 4QTEA 4J8NA 2BVAA 2VTLA 3PVGA 2JIIA 1QPDA 4F64A 3THBA 3ZZEA 3Q5ZA 3TKUA 2UW7A 3NGAA 4GIHA 3QXPA 2ZM1A 1WBPA 3ZBXA 3VW6A 3EN5A 3FMDA 3WBLA 4YSJA 4A06A 2YJRA 1OIYA 1P4OA 4O0SA 4WBOA 5LMAA 2R0IA 2J0MB 3COMA 3RAKA 1IRKA 1URCA 3P1AA 3RALA 4BB4A 3UZPA 4D4VA 4HNFA 3ORZA 4LV5A 4KUJA 4DFUA 3O8TA 2Z7QA 3GOKA 3NIEA 3PE1A 2GS6A 2X7OA 4RBLA 1XJDA 2VTPA 4PMTA 4C62A 4NK9A 4ZY6A 2QO7A 4GYGA 5CEQA 4IQ6A 3UVQA 3ZYAA 1YOLA 2WXVA 3D7TB 2QKWB 4CFNA 3KN5A 5I3RA 4O83A 4HYUA 1BI8A 5HLNA 1O6LA 5IEXA 3SDJA 5GINE 4AWIA 2GS2A 2R3HA 3IGOA 3V04A 3DU8A 3QBNA 4L46A 4RC2A 3FHRA 4R8QA 2R3OA 4FRFA 2VWZA 2P4IA 3UJGA 4AXFA 5CEKA 2JFLA 4U44A 4CFXA 5CAPA 3EFWA 2ACXA 4JIAA 1QPJA 1FPUA 4FV7A 5AV3A 5HVKA 5EQPA 1R0EA 3R02A 5C8KA 2BALA 1GAGA 2FO0A 2JKQA 3IW7A 4BI0A 3PYYA 3QQKA 4UBAA 3RK7A 3VBXA 3GNIB 3C0HA 1PW2A 2QOLA 5HE1A 3UP2A 4C02A 4EOMA 4HCTA 2HK5A 3EQFA 4O0UA 4AZSA 4ZLZA 4BZNA 2ERZE 4B7TA 4FSTA 2WTJA 4YJQA 5AP1A 4A4XA 3E7VA 3TEIA 3UQFA 4IEBA 5GIOE 3R0TA 2UZVA 3G6HA 3GU5A 2J5FA 2C5OA 3H4JA 5D1JA 2XIKA 4MWHA 2PZYA 3FQEA 3RTPA 3BYOA 5EI2A 4C61A 3OROA 4G6NA 3HMIA 1FQ1B 4IWDA 1L8TA 3OY1A 4ZY5A 1TQPA 3ZO1A 2G01A 2QURA 3MIYA 4QYFA 1YDSE 2FSOX 2OW3A 4PWNA 5A4CA 5L2IA 4F6SA 3R63A 1UVRA 1A9UA 3OT3A 2WEVA 3WZUA 4AAAA 3EN4A 3P7AA 2QCSA 4DEDA 5F4NA 3WYYA 1DI9A 5HNGA 3Q4TA 4G17A 4MD8E 3S0OA 3OF0A 3Q04A 5KBQA 4TWNA 1ZLTA 2Z02A 4Q2AA 4O0YA 4FV1A 3ZCLA 1SM2A 4DEBA 2PZ5A 2OXYA 5A4EA 4E6QA 3QTZA 3L8PA 4YLKA 4O7TA 2QG7A 3R21A 5AV0A 2O63A 4W4XA 3H9RA 4FVPA 3II5A 5DT3A 3F88A 2AC3A 5FM3A 4FKTA 5TR6A 4E73A 4DT9A 1NW1A 3FPQA 3L8XA 5J5SA 5AP5A 4EOJA 3F7ZA 2R3PA 3F7WA 4KBAA 4ZSLA 1OPJA 3W2CA 5IA3A 5LMKA 1JBPE 3V6RA 2UVYA 2BFXA 3DXPA 3OXTA 3OWKA 5CEMA 1ZY4A 3F3TA 2DWBA 3FLZA 1Y6AA 1QMZA 3LXLA 4RQKA 3LCDA 5IH5A 4P90A 3O7LB 4D4YA 2C3IB 4YJSA 3WF8A 3LFDA 2A0CX 4XG9A 4ANOA 3TI1A 4G6OA 1NY3A 5E8TA 4D58A 4GS6A 3OBGA 4L42A 1QL6A 3I6WA 5KE0A 4BCHA 3A4OX 3MFRA 4E4XA 4F99A 2F57A 4IB3A 3UIUA 4IANA 4D2TA 2UW3A 2W5BA 4BCNA 4YTCA 4O7WA 2J9MA 3LXPA 4I4FA 1RDQE 5CU0A 4JBVA 3NCGA 3RWQA 3RNIA 3OZ6A 2QHMA 2WU7A 4XP2A 4DF3A 3C4FA 4IZAA 4NM3A 5A6NA 4I6HA 5AAGA 1H00A 2WTIA 5H2UA 3VJNA 5HBHA 5CI7A 4DGGA 4O0RA 5A46A 2GTMA 4ZJVA 4FTLA 2E2BA 2YM5A 3TWJA 3I5ZA 4Y95A 2BRMA 2BHEA 4YBJA 3DFCB 4AUAA 2QOKA 2XNPA 4LM5A 4ZAUA 1M2PA 3V8WA 3P86A 1OL7A 3DLSA 3BI6A 2B53A 5DYJA 4FTAA 4IW0A 4DBXA 1Y6BA 1ZAOA 4I20A 4QP2A 5ETFA 5J7BA 4F0IA 3R8PA 1ZRZA 3AMAA 1APME 3WIGA 2R3LA 3CTJA 3S3IA 3LIJA 2E9NA 3HVCA 3A4PA 5ANOA 2FGIA 5M08A 3OC1A 3SOCA 4KB8A 4C0TA 5IPJA 2C6TA 2GNHA 3ORTA 4G3GA 2C1AA 4E6DA 2Z7SA 2P2HA 1V0OA 3BLQA 5KKRB 3DJ5A 2SRCA 4HVDA 4EJNA 3GFEA 3HMMA 3V8TA 4F65A 3CS9A 5IMXA 4A7CA 4DEIA 3NW5A 4ZTSA 3I5NA 3RPRA 3LQ3A 1AQ1A 3SRVA 4LGGA 1H1SA 3SG8A 4UV0A 4WUAA 2HIWA 4EOPA 4YJTA 4BDFA 2O64A 4YZDA 2XF0A 5I9YA 4XHKB 3V3VA 2XS0A 5HOAA 4RVTA 4L67A 3KQ7A 3VRZA 2WPAA 1WBTA 4PDSA 4LRKA 2WD1A 4QDVA 4OTHA 3AT4A 2BZIB 1R1WA 3PJ8A 5AA8A 4U43A 4OBOA 1M7NA 4GH2A 4DDGA 3QYWA 1U46A 3P9JA 5IQIA 4E4MA 2DQ7X 2REIA 3UO6A 4OTPA 1ND4A 4FE2A 4MXOA 3SW7A 4WNKA 4RIWA 4JX3A 2CGXA 1VR2A 2ZV8A 2R9SA 4C2WA 3EN6A 3VWAA 4NTSA 4UWBA 5BVFA 3MB6A 2JBPA 2XJ1A 2YAAA 4M7IA 4L3LA 5HG8A 3WIKA 2GHLA 1E9HA 5AX9A 3UBDA 5M51A 3Q9WA 3FXXA 3Q53A 4RX9A 2G9XA 4FNXA 4QMQA 4PTEA 3ZEWA 4CSVA 3AMYA 4RWIA 4KKHA 1PXNA 3P23A 3KEXA 3PXYA 1WFCA 4FT9A 5IKWA 3CTHA 4AN2A 3QTQA 3A8XA 3DA6A 4RX7A 5AR5A 3REPA 2O65A 1U5RA 2B7AA 3AD6A 2QOFA 2WMSA 2ITQA 1K2PA 1JVPP 2WMRA 1H0VA 3COIA 4WNOA 1PF8A 1PYXA 3EFKA 3QCSA 4QMPA 5AUZA 3VBWA 5CALA 2PU8A 3R83A 4KS7A 3HLLA 2VTMA 3WARA 2J51A 2C4GA 3BGPA 4IHPA 4BJJB 4PP7A 3EQCA 4EOSA 3QTWA 5CEOA 3VUMA 2QHNA 2XAMA 3PY3A 2ZJWA 2R3FA 1SZMA 4RMZA 5B0XA 1KOBA 4U3ZA 4ANBA 2ZMCA 3P4KA 3PLAE 2XA4A 1OMWA 4JQ7A 4WA9A 3CGFA 3FZOA 5DHJA 4RIOA 1W98A 4ZEGA 4EHZA 4CV8A 2Z60A 4A9TA 3W2RA 4CLIA 2XARA 4PV0A 4QMVA 3C4ZA 5IQCA 4L44A 3NS9A 4Y5QA 4GUEA 4X2KA 4K0YA 4M3QA 4O2PA 3TZMA 3KCFA 4BN1A 2O5KA 3ZBFA 3DXQA 5LJJA 3W0SA 3D83A 5HVYA 4TYIA 3AC1A 5J9YA 4W4VA 5CVFA 1PXMA 4YZCA 5IH6A 3Q2JA 4I6BA 4C8BA 3JYAA 2BKKA 3VIDA 4EH7A 4PDYA 3FMLA 3K2LA 4KD1A 2V62A 4YZ9A 1H01A 5IA4A 4EHEA 2IZTA 1XR1A 3PA3A 4AT3A 3QC4A 2I0EA 3H10A 5C9CA 4IB1A 3GC0A 3QTUA 4WNPA 3HUBA 2H6DA 2ZV9A 4ZTNA 5J9ZA 2CLQA 4WNMA 5CAUA 4I5CA 3HZTA 4FGBA 3N4VA 3E88A 5BVKA 2JBOA 3D5UA 2YM4A 5HCZA 4YMJA 2C0OA 4BYJA 4TYEA 3PY0A 3IPHA 3QTXA 2CKOA 2HWOA 1UU9A 2OBJA 3RMFA 4R3PA 4BDIA 3V8SA 4YTFA 5AUYA 4CYJA 4W4YA 3UMXA 4M15A 4JG8A 4HYHA 3AKKA 3K5VA 3EQPA 2YM6A 4I5PA 4AX8A 5JMSA 4QEBA 4AA4A 3O71A 2W1ZA 3SV0A 4ZS0A 4NIFA 4NTTA 5K4IA 3QKMA 2EB2A 1H4LA 4FT7A 2X9FA 2CHLA 2IZSA 4U3YA 5LWMA 2JFMA 4IBMA 2HWPA 5HTIA 5JH6A 3E93A 4KS8A 3HNGA 2VO7A 4BYIA 1JKLA 4RG0A 2RG5A 2KULA 2X81A 3LQ8A 5EHYA 3VQHA 1OL2A 5CY3A 1UV5A 4BZDA 2UVXA 1KV1A 3KULA 5I9XA 4II5A 4RFMA 4U8ZA 4LI5A 4DTKA 4Y8DA 5HLPA 2QI8A 2YIYA 2BCJA 5D7AA 3UIMA 4ASEA 4DCEA 4H3QA 2ETMA 4EOQA 2J50A 4EH5A 4C4GA 2GNFA 3I1AA 2WMUA 3ORNA 4B0GA 3ZO2A 3KRLA 1TQMA 4I21A 4RJ5A 4FL1A 2IJMA 2RKUA 2ZDTA 1ZYLA 4RGJA 4EONA 5CF6A 2ITXA 1O9UA 3A2CA 4YSMA 4E4LA 3AD5A 2LAVA 3BGQA 5ANEA 3TUCA 3MWUA 3W8QA 1JQHA 3MESA 4V01A 3EH9A 2QLUA 2GU8A 4JR3A 5DR6A 1YQJA 2IW6A 3C4EA 3Q9YA 5CSVA 4AAYA 4R1VA 5HHWA 1YRPA 3NSZA 1REKA 3H0ZA 2CGVA 4I4EA 4NL0A 5DT0A 4CGAA 2W1HA 3PSBA 3B8QA 1ZWSA 4KKEA 3IW6A 4YO6A 3JXWA 4NM7A 3DFAA 4IFGA 2VO6A 4RRVA 1NXKA 4QPSA 4PF4A 3CQEA 4RZVA 3EFJA 2QOIA 3B2WA 4TNBA 4EBWA 2H96A 4Z55A 5IQHA 5IA0A 4X0MA 3PXRA 4FZAB 4F78A 5JFVA 3R9RA 3T8OA 4ACHA 3QHWA 2UZDA 3CXWA 1PXIA 2CNQA 3TIZA 4FZFB 4O21A 3RKBA 1ZMVA 4GL9A 4FSZA 1W7HA 5JFSA 3QUEA 2GHGA 4D2WA 3TCPA 4NFMA 3BL7A 2YIRA 4MCVA 4U81A 3HAVA 2PMNX 1DS5A 5K5NA 4QP4A 4CD0A 3KXGA 2X7GA 4DFBA 2PZRA 3S95A 2C6EA 3MH1A 2OJFE 3TTJA 2WTDA 4FKJA 2AEGA 2XNBA 1XO2B 4IZ5A 3GU8A 4A4LA 3WI6A 5EKNA 4X3JA 5CT0A 2OZAA 4YLLA 3FLNC 1H26A 4CFUA 4USEA 2UV2A 3T9IA 2B0QA 3FPMA 3W33A 4YPDA 4CCBA 3KCKA 1O6YA 3BQCA 3TXOA 4DTAA 3HRFA 3QRKA 5FP6A 4QMLA 3ANRA 3GC9A 1VLRA 4XOYA 5M53A 4N57A 1H1QA 4FZ6A 2O2UA 4D5HA 4MVFA 3AC2A 4I92A 4DT8A 1RJBA 4U0IA 2XKFA 3ORLA 2VX1A 3L1SA 4HZRA 5KZ0A 4XRLA 5BUIA 3F6XA 4MX9A 3P5KA 3AXWA 4FKQA 4UMPA 2X6DA 1O6KA 3CY2A 4CTBA 3Q9XA 4ZY4A 3W1FA 1FVVA 4PPAA 5A3XA 4H58A 3N4UA 4FF8A 2W1DA 4C33A 3EN9A 3RZFA 3RWPA 3EIDA 3CD3A 2YIWA 1UU3A 4XG4A 4EORA 2ITWA 2R5TA 3G2FA 5C27A 3U9NA 5CNOA 1FMKA 4AU8A 1YXTA