4GG7A

Crystal structure of cmet in complex with novel inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
278
Chain Sequence
b'QAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hepatocyte growth factor receptor
publication title Multisubstituted quinoxalines and pyrido[2,3-d]pyrimidines: Synthesis and SAR study as tyrosine kinase c-Met inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 278
sequence length 281
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gg7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gg7A01
5GJGA 2OLCA 4I92A 3EJ1A 4M7IA 5AR5A 4IB5A 4Q5HA 4O27B 4JRVA 2XYNA 4CT2A 4UX9A 1ZYSA 4GL9A 4Y5HA 4PF4A 3U55A 3PLSA 4TZRA 3OC1A 2ITTA 3ZRKA 4HGTA 1WZYA 4XHKB 2QQ7A 4O0XA 3FMEA 4CRLA 1P4FA 1PHKA 5TOZA 2XRWA 3ET7A 5DR2A 5HHWA 1U5RA 3BBWA 5IQCA 2YCSA 1OECA 2PE0A 2Z7RA 2FGIA 3B8RA 3PVWA 1YXUA 3QALE 3QLFA 5HKMA 2NNWB 2I0VA 1Q61A 2YAKA 3I5NA 3TTJA 3LMGA 4XJ0A 2QOBA 4KRDA 5CZIA 4W4YA 2A2AA 4NM7A 5HD7A 3LHJA 1PKGA 4U79A 2CNUA 4IM3A 5ANDA 4XNEA 2AUHA 4JQ7A 4R3CA 4S34A 2JKMA 2YIRA 3VS3A 4RBLA 2R3JA 3HMOA 2QOQA 2IW9A 3C0IA 2UZEA 1JOWB 4MBLA 1FQ1B 1YRPA 2ERKA 2QO2A 1DAYA 3O71A 4AU8A 1PKDA 3E8CA 4AW1A 1K9AA 5D7AA 4ALWA 3RNYA 2Z7SA 4IWPA 4C4EA 4E4LA 4RIWB 2HY81 3K54A 3NAXA 4FKQA 4FV3A 4O96A 3WOWA 4BCJA 4MTAA 4BFMA 4EC8A 2ETMA 1CTPE 4RZVA 2R3RA 3NX8A 4QMOA 3W33A 4DTKA 1GZ8A 2BR1A 3KCKA 1BX6A 2UZUE 5KMIA 4F7SA 4EQMA 5A3XA 3QZHA 3DBEA 2BIKB 4J52A 2YLEA 5BVEA 3D15A 1XBCA 1MUOA 2XCHA 4JBOA 4LV5A 3NZ0A 3IW6A 3ORTA 3T9TA 4XLVA 5K5XA 5HX8A 2JFLA 4GJ3A 3G0EA 3EZVA 4PQNA 2VTHA 3H9FA 3WYXA 3ORPA 3G90X 4E6CA 4YUQA 3CIKA 5CXZA 2UZBA 5DMZA 4ZS4A 3MV5A 5HCYA 5AAFA 4ZZOA 2ZV2A 3REPA 5L2TA 3FI3A 2C0OA 3FMDA 3NCGA 4JR3A 4R6VA 4IHPA 3FMHA 5BYYA 1ZY5A 3I0QA 4GSBA 2PZRA 2JIVA 4DEBA 3FAAA 2YITA 5HOAA 4F6UA 1MRVA 4O91A 2XNEA 5GZ9A 3RPOA 4BN1A 4FZFB 3BHHA 3ZRMA 2FYSA 3IDCA 4QYGA 3U87A 2QOFA 3WBLA 4DFUA 4FT9A 3LCTA 4FTJA 4X2KA 2XMYA 5JGBA 4O7YA 2CGUA 4LMNA 3KULA 4WRSA 5EOLA 3SXFA 4LGDA 1IRKA 4OTGA 4F0FA 3DQWA 4CXAA 2F7EE 5CANA 3RPRA 4APCA 4B8LA 5HD4A 4CYJA 3RVGA 5EYCA 3UVPA 5AMNA 3Q53A 2O5KA 2XJ1A 2V7AA 3SQQA 3BEAA 2B53A 1OIUA 5AM7A 5AA8A 1GOLA 3F5PA 3E7OA 3PP1A 4V01A 3PXFA 3UQGA 2PULA 5IUGA 3CR0A 2C3IB 3T3UA 3PTGA 5CEQA 2OIQA 4ASDA 3MY5A 4PNKA 3DK7A 4BBMA 4BRXA 4L3LA 4FV4A 4ZXTA 2ZVAA 4OT5A 4WD5A 5I9UA 4FSYA 4A4OA 1B38A 1UWHA 1W8CA 1JKKA 4L7SA 4YSJA 4DE4A 2BFYA 4IADA 5DGZA 4UMUA 3QUDA 4YMJA 3GQLA 3PZHA 3KEXA 5AIKA 3TN8A 5AUWA 2XS0A 2X8DA 4ZJIA 1V1KA 2XIXA 4D2PA 2GNJA 4AN9A 4O7WA 4W9WA 1W98A 4KBCA 3VHEA 2HY0A 3R9HA 3BGZA 4Y83A 5H9BA 4J71A 3FYJX 4DN5A 4E26A 3CS9A 4FTCA 4TYEA 5LWMA 1OUKA 3FI4A 3RHXA 4Z7HA 4IJPA 4UXLA 3IOKA 3KL8A 5TF9A 3KF4A 5ITAA 3A7GA 3Q5ZA 3UNZA 1FVTA 5HLNA 3DTCA 3PIXA 2QU6A 4FKVA 2QOKA 3PXRA 1FINA 4ZJVA 4YBJA 2C68A 5CALA 2AC3A 3KXNA 3BV3A 3MTFA 4E1ZA 2OJJA 4AGDA 2Y4IC 2GNHA 4XG8A 3PA5A 3HRFA 3ZDUA 5M09A 4FTMA 4Y73A 4IAZA 4QYFA 3O7LB 4IAFA 4A06A 3HMIA 2DS1A 3HDNA 1XWSA 3KXGA 3EQDA 3R7VA 4E6AA 3NWWA 4Q9ZA 1WVYA 2HXQA 2XK4A 4N6ZA 2B55A 4UMPA 2QLQA 3G5DA 3FQEA 5DFPA 3R1QA 1UU9A 2QOLA 2X6EA 3HP5A 5CEPA 2QD9A 2WMBA 3UIUA 3WI6A 3UPZA 3NVKI 3FKLA 2J0JA 3I0OA 4FTAA 4YNEA 3DB6A 4QTBA 2J6MA 5AJQA 4EOSA 3BLHA 5FDPA 2VUWA 4U81A 1Q24A 3H10A 4RG0A 4BYJA 4UN0C 4F08A 3F2AA 4GK3A 4L46A 5IEYA 4H39A 3ANQA 3RMFA 4MD7E 4BTMA 4CFWA 3UYTA 1M52A 4RIYA 2A27A 3TTIA 3VUHA 3L9MA 4U44A 3SG9A 5J1WA 4E4XA 4BGQA 2BRBA 4CLJA 2YWVA 4MBJA 5GIPE 2WHBA 5JRSA 3LLTA 3R2BA 4I6QA 3OXZA 4J97A 4YJOA 3LAUA 3MSSA 1WVXA 1GIIA 3F5XA 4EYJA 4EK6A 3GCPA 4H1JA 5CNNA 2PHKA 2OXXA 5KMOA 3VUMA 3ATSA 3TM0A 1V0OA 1H08A 4BCGA 3LZBA 5EHLA 3KMMA 5AAGA 2JIUA 2JDTA 4C34A 3NNXA 4R7HA 2FUMA 2IZUA 1JSUA 2CKQA 3VRYA 4R7BA 1UA2A 5CVHA 4KRCA 2KULA 4FTOA 4PL3A 5CF4A 4K0YA 5J9LA 2W1DA 5DIAA 4EK5A 3D7ZA 3L9PA 5HE3A 3WYYA 2GNIA 2X9EA 2X9FA 5CU0A 4M12A 3B8QA 2OG8A 3ERKA 3MB7A 4EI4A 4F9CA 3U9NA 2XNGA 4IX3A 2CGWA 4J8MA 3II5A 3FMJA 3B2TA 4IC8A 2CNQA 1UV5A 3PYYA 4J96A 5CAQA 3O23A 4JRNA 1YDRE 4UZHA 2VO3A 2PZIA 1FMOE 3ANRA 1PMNA 4I4FA 4JX3A 3VWAA 1M2QA 3RALA 5I5ZA 5KHXA 3LE6A 3RGFA 4X2GA 1AQ1A 4X2NA 1P14A 3GOPA 3QQUA 3UIXA 3GENA 3VS0A 4A4LA 3MTLA 1NVQA 1DI8A 2NP8A 3O8PA 4WBOA 5HESA 5HG5A 3WZUA 3A7HA 2QG7A 3EH9A 4FSWA 5AP3A 4R77A 3GU8A 2VTLA 4ZTLA 3V8TA 4DH5A 1J91A 4DGLC 3EFJA 4CMTA 4CG9A 2ITWA 1Q5KA 3VF9A 3E3BX 2PY3A 2UZDA 2XJ0A 4R7IA 3TJCA 2RGPA 4IXPA 1Z5MA 4BIEA 5J79A 3R8ZA 2CNVA 3LFBA 2ITYA 4KBKA 3ZRLA 4GKHA 4FSNA 4QRCA 4CG8A 4FKRA 4GIHA 3AC4A 2XIYA 2O2UA 4LRJA 1YXTA 3KVWA 2CMWA 1OMWA 3HKOA 3O96A 4FT7A 3LFDA 5C4KA 4TWOA 4HPUE 4JOAA 3VS4A 3I79A 4AZTA 2ZM4A 5ANIA 2LAVA 4JT3A 3CQUA 4IDTA 3D2IA 4FZAB 4NTTA 2J5FA 2QHMA 3POZA 3C51A 4ASEA 3MPTA 3LXLA 5FRIA 2XNBA 4BKZA 3QQJA 4ZY6A 5CF8A 5AAEA 2WOUA 1YHVA 3IK3A 3ENHA 3DKGA 4HNIA 3KULB 4BI2A 2F9GA 4YO4A 4KIQA 4ZLOA 3OEZA 5CAPA 4OAVB 2PVRA 2R64A 3SLSA 4QMPA 1H28A 3C1XA 3QGYA 4HYUA 4NL0A 1H24A 3IW8A 2ITOA 2JLDA 3QD3A 4U7ZA 5FXQA 1PMVA 5KKRC 1U4DA 4L6QA 3R7IA 4C2VA 3TWJA 3U54A 1SNXA 1UKHA 2PUNA 1WBVA 3Q52A 1OIYA 4MK0A 4U43A 4YZCA 5IH5A 3E88A 1QL6A 3DA6A 3ROCA 4GH2A 3ZBFA 2RSVA 1TQIA 4EWHA 1HOWA 1DM2A 2Q0NA 1IA9A 5IQHA 3AC1A 2GMXA 4L3JA 3LFSA 5ANJA 4NKSA 4BVUA 3K5VA 2CCHA 2VNYA 4EHZA 5KCVA 2CKOA 1WMKA 2WTJA 2OW3A 3P5KA 4OTIA 4XV1A 4XX9A 2QOCA 4CFNA 2WQEA 2YN8A 4JXFA 4AZVA 5KNJA 2W1FA 5J5SA 3FXWA 5JN2A 3ZO3A 3KMWA 3FBVA 3MA6A 3TACA 1P4OA 4NCTC 4QMVA 1JVPP 1WBNA 4WSYA 3KN5A 2CKEA 4H3QA 4W8DA 3RPYA 4JDKA 1YOMA 3OW4A 3MVMA 4JNWA 3CTJA 4YLKA 3KRWA 3LMHA 4D4SA 1IASA 3KKVA 3KXXA 5DI1A 4QQTA 4L45A 2I6LA 4QTDA 5TR6A 4M84A 5E8ZA 3KREA 1PMEA 3PIYA 4GFMA 4AG8A 4C2WA 4JG6A 3ZC6A 5BMSA 3SG8A 4DHFA 3BU3A 4O82A 2IO6A 4DEAA 1Q41A 3QQLA 3ZO1A 2ITNA 3ACKA 4EOMA 4ALVA 5CZHA 3Q6WA 2X2MA 5IUHA 3VHKA 3F6XA 4PMTA 5AFVA 2RF9A 2UW9A 4W8EA 1LEZA 4AOJA 2PVNA 3O8TA 4FTTA 2GHGA 1B39A 4QMZA 2E9OA 3MH1A 4GJ2A 5ETFA 3UMXA 5L2IA 2JAMA 3R2YA 4IIRA 5HGIA 2PZ5A 3RKBA 4M0ZA 5EKOA 3FSKA 2RKUA 5M55A 4BCMA 4D2TA 3DZQA 1YW2A 4F0IA 2VN9A 4UYAA 1FVRA 4DBNA 4HNFA 2YDJA 2IG7A 4XP3A 4NT4A 2GQGA 2SRCA 4ALUA 3Q2JA 2P3GX 4FI1A 2F7ZE 4PTCA 3BLQA 3ZBXA 5HE1A 5HG9A 4IAIA 5AP5A 2PVJA 3DLSA 2QONA 3DB8A 3GU4A 4FVRA 4YLLA 3DGKA 3QXOA 4C0TA 4IX5A 3MB6A 4NWMA 5F20A 4FEVA 4L44A 2JD5A 3Q2MA 4KAOA 4B99A 3VIDA 4KIKA 2B9JA 4RIYB 2G2FA 3GCQA 4XEYA 4WG4A 2YERA 5E9EA 2XK8A 3L8XA 1A06A 2UUEA 3DZOA 2GSFA 3FI2A 5HBEA 3Q6UA 4ASZA 5E4HA 3QFVA 4FF8A 3VJOA 4RFZA 3DXPA 2E9UA 2FB8A 4YZNA 2OIDA 1NY3A 1KOBA 2X4ZA 3MH3A 2XM9A 2FSOX 4TWCA 3DY7A 4X21A 4EC9A 4ZTSA 2FH9A 4ANNA 4C61A 1Z57A 4QMSA 3L9NA 4V04A 4QMNA 2UVZA 1ZRZA 2DUVA 3AMYA 4A07A 1QCFA 3QKLA 5EM7A 4EL9A 5TT7A 3F3WA 5HVYA 3CJGA 4QQCA 5F4NA 3SV0A 2VTNA 5M51A 1QPCA 4FTQA 5FBOA 1YWVA 3HV4A 3IDPA 2YIQA 3SXRA 3VS1A 4C4JA 4YTFA 4DITA 3U8WA 2NPQA 2C47A 4W4XA 3FLNC 5AIRA 2R2PA 4ZZMA 2B54A 3EQCA 4UMTA 4AGWA 1XBBA 2GU8A 4AE9A 1JKLA 2WEIA 2XK9A 2XKDA 3G51A 4PX6A 3RCDA 4JQEA 4LRMA 3OXIA 4NCTA 3PVGA 2PZPA 4UYNA 3W10A 2ITUA 4FKLA 4IM0A 4WT6A 4X2FA 5CT7A 3C9WA 5FWKK 3R9OA 3UQCA 5BYLA 1OI9A 3LCOA 1PXOA 3QAME 3ETAA 2G2IA 3ZUTA 3CD3A 4WOVA 2ZB0A 3VNTA 3OXTA 2PK9A 5JEBA 4FBXA 5ICPA 4YTHA 1IA8A 4IVBA 4NW6A 3V01A 3CQEA 4CSVA 2YCRA 2Z7QA 4BTJA 2O65A 3C4FA 3C0HA 3VS5A 3VULA 4EH8A 3DLZA 3GBZA 3BPRA 4GCJA 3DAEA 4IAAA 4DFXE 3UJGA 2J4ZA 1TQMA 2JAVA 4JJRA 4I0SA 5HU9A 3HV3A 3LCDA 2PVFA 4BTKA 4IZYA 4BKYA 2UW6A 5FTOA 3KGAA 1QPDA 3QHRA 1XHAA 3LJ0A 3F2NA 3HMNA 2VTTA 5EKNA 1H01A 4RIXA 4C37A 3AMBA 3MFTA 3O50A 5J9YA 2X4FA 1OL7A 3M1SA 3OUKA 3AQVA 4QD6A 2QHNA 3BELA 4MKCA 1G8SA 4NU1A 4RSSA 5T6KA 4AAAA 3FXXA 4CV9A 3MA3A 2BZHB 4G3CA 5ANKA 5DT3A 3TL8A 3VAPA 4O7ZA 5CLPA 2GDOA 4ONAA 5LMAA 3MVHA 3V3VA 2JKOA 3WE4A 4ENXA 5C4LA 4QMUA 2O8YA 4MXYA 3RM7A 3RZBA 3S4QA 5IF1A 1LUFA 2ONLC 2ZV7A 4GT4A 3ORKA 2WU7A 1FVVA 1URCA 3D9VA 3EYHA 4PRJA 3S1HA 4YJTA 2YZAA 3COIA 3VC4A 2BVAA 3A60A 1RW8A 2OI4X 3QTRA 2PE1A 4PDSA 4XV9A 3QQKA 4YP8A 3Q9YA 3IECA 3UG2A 4AW5A 2WEVA 1WBSA 5BYZA 4FTNA 3IPHA 3HRBA 4NM0A 4OTWA 2BZJA 4FIIA 2IJMA 5E8YA 4LG4A 4R1VA 4ZSGA 3JY0A 3JS2A 5E8SA 3C50A 4FODA 3HZTA 5IH4A 4YPSA 4C3RA 2VO6A 1JKSA 3GU7A 3LCKA 1LR4A 4XP2A 2YM5A 4RLKA 5IA5A 4BDEA 1WFCA 1ZYLA 2BRHA 5FEEA 4WNPA 5A4QA 3R04A 4I5PA 3EKNA 2GNFA 3ORZA 3G0FA 3AC2A 3LFFA 3UNJA 2GS2A 4FG9A 4BHNA 2CGXA 4F9AA 3I7BA 4XS2A 2YLFA 3QKKA 3W2PA 4YZDA 4MBIA 3WIGA 4D9UA 4O81A 1M7QA 1PW2A 2W5HA 5HO7A 3QF9A 3EN9A 4QMMA 2YM4A 2X81A 3VUKA 1PJKA 3BHTA 3E64A 3CXWA 1YHWA 4UBAA 3UODA 4ZY4A 2WMUA 2VX1A 2JDRA 3DPKA 4CNHA 1YI6A 3HGKA 3RHKA 3UNKA 3PWYA 1H25A 2B52A 4OTPA 4EH7A 3S0OA 4U41A 2BKKA 4HCVA 2C1AA 3PSBA 4FKTA 4AA0A 2QC6A 5H2UA 3ZLWA 3F9NA 3ZONA 2IZRA 1JSVA 2ZDUA 4S33A 4IWDA 4JAIA 4H3BA 3MBLA 4IZ7A 4FMQA 3NW7A 2H9VA 5HI2A 3EWHA 4OBPA 4DT9A 4D2RA 4BCKA 5GZAA 2C5OA 1R78A 4ZOGA 3UOKA 4G34A 4G6NA 4CMOA 4KINA 5D9HA 4HVHA 4Z3VA 5HX6A 3W32A 4XRJA 4U0IA 5M08A 1PXPA 3OP5A 1CKJA 4FUXA 4Q2AA 2G2HA 3TIYA 3HEGA 4GVJA 1SMHA 3PY0A 3QC9A 2C3LA 5L2SA 4TYJA 3CGFA 4QQJA 2J51A 3LW0A 4ANBA 4LUDA 5GJDA 5HEZA 2VX0A 2PUUA 4I1ZA 4RJ5A 2WPAA 3L9LA 3Q9WA 4G1WA 4KKGA 1GIHA 4C4HA 4W9XA 4XCUA 1WAKA 5JQ8A 3R83A 1GNGA 3MJ1A 5BVWA 4Y8DA 3LIJA 4HGEA 4DG2E 3P86A 3PJ8A 5EYMA 2OGVA 2HCKA 3PRFA 2VWBA 2ONLA 5AR4A 3EZRA 3NUYA 5IA2A 2UW3A 4G3DA 4WG5A 5J9ZA 5HZNA 2R0UA 3DS6A 4UZDA 4NSTA 4DGGA 4X3JA 3SC1A 2C30A 4M67A 3VBYA 5IISA 3UP7A 5G6VA 1S9IA 4YLJA 3UZPA 5JFWA 4FYOA 3MESA 3R8UA 2OIBA 4JDHA 4LM5A 1Q3WA 2WOTA 4CCBA 2OJFE 2IVTA 5FXSA 5BX0A 2B9FA 3FQHA 1KE5A 1OL5A 2BMCA 2QCSA 4H1MA 3VBXA 5EH0A 1R3CA 5FQDC 1R0EA 4NW5A 3UZRA 2HXLA 4OAUC 2ZYBA 1UNGA 4AOIA 5FD2A 5JQ5A 5EQEA 4MNFA 2UZNA 3WF8A 2J0MB 1MRYA 2VWYA 2C4GA 3E92A 2X6DA 4CVAA 4J8NA 3R7YA 5DT0A 5CAOA 1WBOA 2WMSA 1U54B 3ROYA 4X3FC 3DT1A 4M13A 3CPBA 1R0PA 2ZOQA 3E93A 2VWUA 4JVGA 4O38A 4ZJJA 3V6RA 4FR4A 2AYPA 4ITJA 5KBRA 1PRYA 4P90A 2GTNA 5HG7A 3IG7A 2HZIA 3JUHA 4AZSA 4YJPA 2IPXA 3F5UA 5I9VA 1Z9XA 2UW8A 3UG1A 4IANA 4RWJA 3TT0A 4BDCA 4EOKA 3R21A 2EWAA 4QPAA 2J9MA 4IM2A 4RJ3A 3IONA 4CFFA 5AR8A 1PXNA 3QZIA 3D5VA 5J8IA 4KBAA 3R1SA 2QG5A 3S95A 3WARA 4K6ZA 4FV8A 4D5HA 2W7XA 3LXNA 3P7BA 1PXKA 4FL3A 5AP2A 1PY5A 4P7EA 5JGAA 1M14A 4L67A 4ZMEA 3LQ8A 4Q5EA 4GFOA 3M11A 2YACA 3R73A 1SZMA 3CPCA 4I20A 4WNKA 4D1XA 5CEOA 1WBWA 4EOJA 2BAJA 2P33A 5AV4A 1CDKA 1Y57A 4ANMA 5DWRA 4KD1A 3DNEA 4XUFA 1XO2B 4BKJA 3SAYA 3QD4A 4HYHA 4JBPA 5T3QA 4I41A 5CU2A 4APPA 3I1AA 4PDPA 3FLQA 4E6QA 1REJA 5BUJA 3BEGA 3OZ6A 1FGIA 4ERKA 2XF0A 3FLYA 1BL6A 2EXEA 4M14A 4EJNA 3C7QA 1Y6BA 3F61A 3UGCA 3C0GA 1OVEA 3ACJA 1SVEA 2HWOA 1XH8A 1ZY4A 3RI1A 4EUTA 3T8OA 3HUCA 4WBBB 3NS9A 2B9IA 3HLLA 5C8MA 3WZJA 4IFGA 2OK1A 3AGLA 2PMOX 2V22A 3ZC5A 5L8KA 3R01A 4IE9A 3K3JA 4RA5A 4LYNA 2CN8A 2PMNX 2PSQA 4RGJA 2VGOA 1XH4A 3E7VA 3BHUA 3FPMA 1ZOEA 3BHVA 2WTKB 4IQ6A 4X6QC 3BGPA 2BAKA 5CTPA 4IAKA 3BE9A 3WZDA 4EOLA 1SM2A 3TNHA 4A9YA 2J0IA 2PYWA 2XK6A 3V5JA 2ZJWA 4F7NA 2P0CA 2W4KA 3IW4A 4ANQA 4M97A 2C6MA 3EKKA 4IVAA 4RFYA 2OFUA 4I21A 5AP1A 2YM7A 3SXSA 1YI4A 4NTSA 2YISA 4FZ7A 3EOCA 2BDJA 2UZOA 4GMYA 4HZRA 3KY2A 3R63A 1ZYCA 2B4SB 3QXPA 4XG4A 3ZMMA 5FUTA 5CY3A 2PU8A 4NH1A 3TV7A 4ANSA 4BZOA 3N9XA 2R7BA 1LEWA 3I7CA 3BWFA 2XKFA 5EYKA 3L1SA 4X3FA 3NYNA 4XV3A 4JDJA 2CHLA 1IAJA 3D0EA 2ITZA 2JFMA 3P1AA 4GU9A 2IZSA 4DC2A 5I3OA 2HZNA 1HCLA 2PVMA 1U59A 2BIYA 3MFSA 2R3NA 1GZKA 2C6TA 2HIWA 2ZV8A 3IDBA 5KZ0A 2GS7A 3KRLA 3ZSIA 4CCUA 2Y4PA 2B0QA 1I44A 4N57A 4GS6A 3SHEA 3QRIA 5BNJA 4UMRA 3KXZA 2DWBA 3HMPA 2QURA 4FT3A 3QCXA 1DAWA 4DFLA 4GK2A 5FGKA 1Q8WA 2EB2A 4BCOA 4W4VA 3QTWA 5LCJA 2WMXA 2VWIA 1REKA 4M3QA 4H05A 3ZCLA 1GZOA 1VZOA 3ZLYA 5AUTA 4XRLA 4X2JA 4QTEA 4XG7A 2PE2A 4ZEGA 3OY3A 4ZMFA 1XR1A 1T45A 1QPEA 1GZNA 2WGJA 3HA8A 4G16A 4JBVA 4B9DA 2VTMA 3COHA 3NNWA 2O3PA 4YPDA 5DH3A 5HIBA 4B0GA 2WTVA 3T3VA 1DS5A 2P55A 2XNMA 1R1WA 1PXIA 2I0EA 1BI7A 1MP8A 2C1BA 2JKKA 2VRXA 3FYKX 3H4JA 5EI2A 3A2CA 2J0KA 5IA4A 3QWJA 4RWLA 3MFRA 4CGAA 3VS6A 4FTKA 2OSCA 3Q4ZA 4RX8A 3BYSA 4PWNA 3W2CA 1Y8YA 3A4OX 4LRKA 4R5YA 5K4JA 5K3YA 5BVNA 4O0SA 3RPSA 3TDWA 5BPYA 1F5QA 2G01A 3PXKA 3DJ7A 4K11A 5G1XA 5J5TA 3OBJA 4UEUA 3SGCA 1YHSA 4E73A 3QCSA 4OBOA 4ZK5A 3VBQA 3HAMA 2GS6A 3O2MA 1H4LA 3PXZA 4WKQA 2G1TA 4F7JA 4BDKA 3GXLA 4O1OA 4YHTA 2BRMA 4AF3A 4LL0A 4TYHA 3QTSA 1Y8GA 3JPVA 1KV1A 2VTOA 4TNBA 4DEIA 3VS2A 3LFAA 4OT6A 3R7GA 5CENA 4Q9SA 4WUNA 3TNQB 4I6FA 4BY9E 4BL1A 5ETCA 3WF5A 3OCSA 4WNOA 5E8TA 5EI8A 3WF9A 2C5XA 2EXCX 3BWJA 3VW8A 4E4NA 4NYEA 4LUEA 3GUBA 2C3JA 4QPMA 3TKUA 4G31A 3F7WA 3D7TA 3NYOA 4WIHA 3ZS5A 4EH6A 4EZ5A 4BBEA 4K77A 4J98A 2VWWA 5CSWA 2BRNA 1JSTA 4AFJA 3G2FA 4CEGA 1O6KA 4CD0A 5DLSA 4RLLA 2X39A 2ITQA 5TE0A 2W96B 2YIYA 2O63A 2YM6A 3BLRA 4QO9A 2CSNA 5I0BA 3R7EA 2XRUA 4XBRA 5GNKA 4WO5A 2FSLX 1JAMA 2RFDA 3QTUA 2YIWA 4ZTNA 4NFMA 3MFUA 3NDMA 4YJUA 4GEOA 1PXLA 3SOCA 4UMQA 2XP2A 3TZMA 4D0XA 3ALNA 3AT3A 1E9HA 2Z60A 3PJCA 2H34A 2OF4A 1YXXA 4TY1A 3QRUA 4U5JA 4BYIA 3KRXA 5CAVA 4CFVA 3FMNA 4XG9A 2YDKA 3DOGA 4KNBA 4C8BA 3LMIA 2UW5A 3DFAA 3JY9A 2ETKA 5HCXA 4MXZA 4RWKA 2IVVA 3T9IA 4O83A 5DVRA 1ZYDA 4MWHA 5AR2A 4MEDA 1JWHA 2V62A 2ZDTA 3NUSA 3PPJA 4G9CA 4TYIA 3UIMA 4U42A 3ZXZA 5LOHA 3GC8A 3RPVA 3RAWA 4C58A 3EFLA 3P0MA 4GFGA 4M8TA 1NVSA 2YEXA 4GRBA 4RX5A 5JT2A 2OFVA 2R3LA 1KUTA 5F94A 4U9AA 3Q4UA 3GQIA 4S32A 1OBDA 3R30A 5HQ0A 4L53A 1GIJA 2R7IA 4QOXA 3OHTA 3ZLXA 1F3MC 4LI5A 2WMTA 3PVUA 4HOKA 3UOLA 3ZH8A 4LV8A 4QTCA 3IW7A 1H07A 2YJSA 2VTQA 3QTIA 2CLXA 5AV2A 1OUYA 3ZM9A 5DNRA 4EH4A 5LVOA 1G5SA 4L01A 1BKXA 5A9UA 5C8NA 2ZM3A 4YURA 4ZTQA 3F88A 3PZEA 4NM3A 2UV2A 2WQMA 2HZ0A 5AA9A 3PE2A 4OLIA 3AT4A 1H0WA 4EZ3A 5A4LA 4O0TA 4O86A 3VBWA 2WNTA 3AD5A 4IH8A 4R5SA 1YQJA 3EQIA 3FXZA 4FZ6A 4FGRA 5HO8A 3RNIA 4F64A 3KRRA 2Y0AA 4RX9A 4XOYA 2W4JA 2C6KA 3LFCA 4PY1A 4ZTHA 3OOMA 5HO6A 2OXYA 4EONA 3V8SA 4JIKA 2YM3A 4LOOA 1BUHA 1OL1A 3O7LD 4QP4A 4PPBA 3V8WA 5A54A 2CKPA 5L6WL 3HV7A 4YZMA 1ZMWA 1GJOA 4AQCA 2PVHA 2X8IA 3I4BA 3I6UA 3QZFA 3R71A 4CQEA 3GFWA 4FZDB 4PUZA 3GCSA 3TIZA 3QYZA 4OTQA 5KMMA 4BIBA 3VBTA 2DQ7X 4B7TA 1H26A 3FJQE 4BCIA 2YWPA 4MYGA 5IKWA 3BU6A 3Q60A 2CN5A 4RVMA 3WILA 4ENYA 1NA7A 2RFNA 4LGHA 5HNBA 2OJGA 3EQBA 4E6DA 5CSPA 4DGMA 1OIRA 3DBDA 4RJ4A 2C6OA 4C4IA 4EQUA 3NSZA 3ORMA 2BROA 4TTHB 4DGNA 1M2RA 3PY3A 5I4NA 3CCNA 3QRTA 4F99A 4ZZNA 3PJ2A 4X3FB 4AGCA 5IEVA 2XCKA 4USDA 4TXCA 4ZY5A 2ZAZA 5GINE 3VN9A 4GT5A 4GW8A 2YM8A 1JBPE 1RE8A 2XNPA 1OKYA 4BDIA 4FEUA 3QZGA 3E8EA 2XBAA 2H8HA 5D41A 3IQ7A 2I0YA 4IX6A 2WMVA 4F1MA 4U3YA 5I3RA 3HECA 5KUPA 2ZMCA 3HMMA 1X8BA 4WRGA 3U4UA 1YDSE 4QMWA 4ACGA 1H1PA 3TCPA 4OGRA 1CSNA 4IWOA 5HU3A 1VR2A 3FKNA 3V6SA 4BC6A 2Z02A 4RC4A 2C0TA 5E8WA 2IVUA 4TT7A 4MAOA 5EDQA 2X2LA 1MQ4A 4F9BA 4BCNA 5LJJA 4R1YA 4R78A 1APME 5GIOE 3MDYA 4O0WA 5FDXA 1UNLA 1ZMUA 3KC3A 3KRJA 4EBVA 3HV5A 3DKOA 1R39A 2BFXA 1YI3A 3GI3A 1Q8UA 1VJYA 5KMNA 5FXRA 3NCZA 4Y72A 3B2WA 5DEWA 3CY3A 2PZYA 4U6RA 4CLIA 2CDZA 3CC6A 3KB7A 5AUUA 2G15A 4MXOA 3ZM4A 4JLCA 5CYIA 4BZDA 1W84A 2E9PA 2ZV9A 5A14A 3MI9A 4L3PA 4QYEA 5L2WA 4NUSA 2R3PA 3SW7A 4D28A 1RDQE 4HYSA 2H96A 2XIZA 3V5QA 2ZB1A 2C5YA 4YJQA 4DH8A 3Q4TA 3JXWA 3QC4A 2RFEA 4IJ9A 4JI9A 3VUDA 3R8PA 3U9CA 2I7QA 2WO6A 2ERZE 5AEPA 4FIEA 4OBQA 3GT8A 3FC2A 3A8WA 5L2QA 4AACA 3LFEA 2YAAA 4O7VA 3AGMA 3H30A 4JQ8A 5J1VA 4EKLA 4XH6A 2HZ4A 4JL9A 3R9NA 5I9YA 3PG1A 3DBFA 5DR6A 3I81A 1UU3A 3BU5A 2X2KA 4F9WA 5IQGA 3RZFA 4RJ7A 4WHZA 2BDWA 2PUPA 3OTUA 1ZLTA 4MXXA 2C6LA 4EOQA 4DINA 3OWLA 4X6RA 5AUYA 5DEYA 1WCCA 4TYHB 3D5XA 2QR8A 4FVPA 4K33A 4Z7GA 4FL1A 3COMA 3Q4CA 5AV3A 3UC3A 4EORA 2VTIA 2Z7LA 3QBNA 3DBQA 3QA8A 4O22A 4NK9A 4YJNA 4BI0A 4EH9A 5J7BA 3HAVA 1H27A 2WIHA 3BYVA 3SW4A 3CLYA 5IG1A 5KO1A 1OKVA 3RAHA 5DPVA 1ZOGA 5BVDA 5HLPA 2W1IA 4FEXA 3PP0A 1W0XC 3OCBA 4E7WA 1ATPE 3ZFYA 3R8MA 3D7TB 3NPCA 3H9OA 4GVAA 5HIDA 5FP5A 2I40A 2R3FA 4KIPA 2XK3A 3KN6A 4GUBA 4CKRA 4UV0A 2JGZA 3NEWA 3R00A 3PA3A 3UE4A 4KABA 3LFNA 5EFQA 4AT3A 3U4WA 4F6SA 4PTGA 2OZAA 3F82A 1STCE 3CE3A 3NUUA 3P4KA 5BVKA 3IKAA 3OBGA 2BZIB 3E87A 4I5MA 2BHHA 2JEDA 3QX4A 4RT7A 3MH2A 2YFXA 5DRBA 2B1PA 3ZYAA 3ODYX 4D4RA 5LVNA 4Y85A 1KSWA 5AX9A 5HTIA 4MVFA 4FUYA 4TWPA 4O0YA 2QKWB 3GC0A 1EH4A 3GC9A 4FSTA 4N4SA 4QNYA 5CXHA 2XEYA 1T46A 3BYMA 3NUPA 4BDHA 4FE2A 5C26A 3D5UA 4IEBA 5CAUA 3P79A 2Y4IB 3QYWA 3MS9A 4QYYA 4DYMA 2WQBA 4JS8A 3R9DA 2R3IA 2HYYA 2GHMA 5HVJA 4EH2A 5LMKC 4ZP5A 2C6EA 3GCVA 4PDYA 2JBOA 5CF6A 2R3GA 2RL5A 4H36A 4GUEA 1OPJA 5DYJA 3KXHA 2XYUA 1BL7A 1YOLA 1F0QA 2C6IA 4I93A 3EB0A 3R7OA 5A4CA 5L8LA 4IX4A 4DEDA 5A4TA 1M2PA 4PL5A 5CASA 4YGAA 4QP9A 3SKCA 4HJOA 4YR8A 2WFYA 3F69A 4FKUA 4FNYA 3A7FA 3UTOA 4USEA 4U40A 1H1WA 3EN6A 3P9JA 4RA4A 5BUIA 4DGOA 4A9UA 2NO3A 2QU5A 4F9YA 4FIFA 3ZXTA 2R3OA 3G9NA 3QCQA 3NR9A 3ORNA 5GHVA 1NT2A 4GT3A 2UZTA 3MW1A 3WZEA 4E3CA 3Q9XA 3EN7A 1VYWA 5CVGA 4BCHA 3A7IA 4G3GA 4K9YA 5HVKA 1GAGA 2IZTA 1CKIA 1MQBA 4RC3A 4WA9A 4FV9A 5F9EA 3P7AA 4GG7A 4N70A 4OTFA 4U3ZA 4DTAA 1J7IA 2XBJA 4RMZA 2BRGA 2W1CA 4CFXA 4E5BA 5M4CA 3UC4A 2EB3A 2QI8A 4RZWA 1W82A 5CEIA 4CT1A 3ULZA 1H0VA 3QQGA 4BWXA 1BI8A 3ZHPC 1H1QA 1HCKA 3K2LA 4IBMA 5IUIA 2GTMA 3A8XA 4JAJA 2F2CB 4EOOA 4H58A 4YC6A 2YIXA 1AGWA 2A1AB 4FV0A 4GIIA 5LMBA 3OROA 3FPQA 1W83A 3GU6A 3OWPA 4HPTE 4HCTA 5FP6A 4BZNA 2W5BA 4ACHA 3KCFA 5EHYA 3SOAA 2ITVA 2VWXA 2W1EA 3FLZA 4DEEA 2VAGA 3IO7A 5FM2A 5A6NA 4FL2A 5AUXA 3G33A 5LXMA 3Q32A 3SX9A 3N4TA 4O7LA 3KMUA 4USFA 5EOBA 2VO7A 4LOQA 4C02A 4UB7A 2CGVA 4D4YA 5HTBA 5D1JA 3BYUA 2JIIA 4ACDA 1H1RA 5CEKA 3S00A 4DCEA 2BAQA 4N0SA 3LCSA 4DEGA 5C01A 3TNIA 3QRKA 2P2IA 5CQUA 4CKIA 3NNVA 4AA5A 4CZUA 2Q83A 2QOOA 5FEQA 2X0GA 5J7HA 4EHVA 3ODZX 1J7LA 3PY1A 5KBQA 5M4IA 4J7BA 4BR3A 5ANGA 2LGCA 3G6HA 3QLGA 4RQVA 2BTSA 1PMUA 3FHRA 3QQHA 5KX8A 3DK3A 5CU6A 1V0PA 4I5CA 3FWQA 2XJ2A 5JZNA 5LMKA 5CU4A 5F1ZA 4J95A 2FA2A 4G5JA 3WE8A 5KHWA 3PPKA 3RCJA 3OT3A 5M44A 3ZFXA 3LM0A 4HYIA 1CKPA 4B8MA 3A7JA 5AV1A 2W1ZA 3CTQA 5FBNC 1OKZA 2PVLA 4QNAA 4I23A 4L00A 4FA2A 3HA6A 4PPCA 5J87A 4ZSJA 4KUJA 2VTSA 5KMLA 3ALOA 3R8LA 5LVPA 1J1CA 3FV8A 4MF0A 2QVSE 3RWPA 4BDGA 5EG3A 3BRBA 3ORXA 5IDPA 2P4IA 4EH3A 4S2ZA 3RBWA 3TZ7A 1YVJA 2YHVA 4F1TA 3ZZEA 4TN6A 5DHJA 3ZLSA 3D83A 4C4GA 3KA0A 3OOGA 4I5HA 3POOA 4MQ2A 2VO0A 5E91A 3QA0A 5BUEA 3DXNA 5EW3A 3UIBA 2XZSA 2NRUA 1DI9A 3CTHA 4AZWA 4G17A 4C59A 3RK5A 4F7LA 3QKMA 2FSMX 3FZOA 1JNKA 3COKA 4AA4A 3BBTB 2ZMDA 1JKTA 3R22A 3PJ3A 2QLUA 2VNWA 3D2KA 5ACBC 2A19B 5M4UA 3MJ2A 3HP2A 4G2FA 4IVCA 5E7RA 3LFQA 4DH7A 3TZ9A 3A61A 4KIKB 4TPTA 5FTQA 4PTEA 3WF7A 2GCDA 5CU3A 4GU6A 4XG3A 3LQ3A 2VTAA 5JMSA 3EL8A 5DE2A 3VUTA 3DAKA 4NKAA 3EYGA 4Z16A 4YTIA 4EYMA 2J0LA 1U5QA 4MD9E 2A0CX 3PRIA 5KKRB 3UDBA 4MD8E 2V5QA 4F70A 3V5PA 2UW4A 5L3AA 3Q5IA 2XEZA 3CQWA 3QTQA 4KIOA 2X8EA 4O0VA 1I09A 4FICA 4FKPA 4FOBA 5EYDA 4D5KA 1UWJA 4FNZA 4PP7A 3BGQA 3FUPA 5LQFA 4ZTRA 4RRVA 3VRZA 3NLBA 5DA3A 3MYGA 5B2KA 3VW6A 2OBJA 4YZBA 3ZZWA 4MHAA 2WB8A 3DJ6A 5K5NA 5CI7A 5CSVA 3HX4A 2I1MA 3TG1A 5C03A 4O84A 1XBAA 4NFNA 4ZIMA 4OR5A 5ANOA 4AW2A 5IU2A 2R5TA 1ZZLA 3OD6X 3P78A 4FKWA 4MCVA 4AX8A 5I9ZA 4FK6A 1KV2A 2OJIA 5C1QB 2C3KA 2OH4A 1ZZ2A 4P5ZA 2OZAB 3V04A 4ANOA 3OF0A 5JFVA 3MWUA 2W9ZB 4O6EA 5KZIA 3ZSHA 3OMVA 2R3KA 4QMTA 4D1SA 4EKKA 2PUIA 4PPAA 4FIHA 2W0JA 4O21A 4RJ6A 3LXPA 2WMQA 5CX9A 4ACCA 3FY0A 3U6IA 3KXMA 4XG2A 5LVLA 4RC2A 1TVOA 3LLAA 1K2PA 4ZSLA 3RINA 5C27A 4IFCA 2EXMA 2W5AA 4C62A 2WMAA 5EM6A 4BGHA 3AMAA 3UBDA 2RG5A 2OKRA 3RTPA 3ZDIA 4F6WA 2Y9QA 4R8QA 2YZLA 2ETRA 3C4WA 1E1XA 3RP9A 3EQHA 3ZTXA 4RIXB 1FGKA 2YA9A 4PL4A 1YKRA 4FNXA 1YWNA 4FNWA 1BYGA 1L8TA 5HBJA 2W17A 1Q8TA 5EQPA 3H0ZA 3S2PA 1ZXEA 3CBLA 1OIQA 4O0UA 4TNDA 3W2QA 3DCVA 3NUXA 2WTIA 3R0TA 4I3ZA 3EQFA 3D4QA 1JQHA 1L3RE 5HE0A 5CNOA 2PVKA 4LMUA 2DYLA 3RAKA 3DDQA 3BX5A 3CKWA 2W1HA 3MY1A 3OWKA 5C8KA 4NIFA 4DFBA 4ACMA 3MPMA 4YNOA 4ERWA 1ND4A 1G3NA 1Y6AA 3GVUA 3EFWA 4LOPA 4FV5A 1J3HA 4U45A 3DKFA 5B2MA 3TDVA 2VTJA 2O0UA 3PJ1A 4O2ZA 4DAWA 5HTCA 1IG1A 4ZLZA 4QP2A 1KE6A 2XVDA 4UWCA 5AV0A 4FG7A 1YWRA 2CPKE 5F95A 4CFUA 2UW0A 2Y8OA 3AC3A 2PWLA 4AOTA 2KTYA 5IMXA 5IQAA 4DFNA 3P7CA 4K2RA 2UVYA 3TKHA 4BDFA 3NMUF 3OS3A 3LM5A 3QUEA 4K8AA 3CSVA 2PMIA 2WIPA 2JKQA 3FHIA 4J1RA 2QOHA 3G6GA 4M69A 5AUVA 2BDFA 1WBTA 4GYIA 2R3MA 4D2VA 4E93A 2YDIA 4PP9A 4C4FA 5M56A 4QMYA 5KMKA 1IR3A 3SRVA 2BHEA 3W18A 4G9RA 2XKCA 2RIOA 4C57A 3OFMA 5K0XA 4O7SA 4BBFA 4RVKA 4D4VA 3DU8A 2EU9A 3W55A 4CFMA 5M53A 5AX3A 3FE3A 4FSMA 3FEGA 5HORA 2CJMA 3NW6A 4RWIA 4FV7A 3P08A 4XYFA 4EJ7A 3GFEA 4JG8A 2ITPA 4YC8A 4I24A 1G8AA 4MNEA 1XQZA 2C69A 2WXVA 3PXQA 4ITHA 4L7FA 4UALA 5L4QA 1YOJA 3UOJA 4EHGA 2QKRA 4FKJA 3DDPA 4DG3E 3C4XA 2QR7A 4R3PA 3NRMA 3PSCA 4EK8A 4FTLA 4XMOA 2UW7A 4AS0A 2WD1A 4IZAA 4L43A 5IA1A 4AP7A 3N51A 5AUZA 5E92A 1PXJA 2F2UA 4IMYA 2B7AA 2JDOA 4CYIA 5D12A 2HWPA 4HVDA 4PMMA 3Q04A 2IVSA 1BLXA 3A4PA 4O1PA 3GGFA 3QCYA 3DQXA 3F5GA 5ACKA 3ZOSA 4UXQA 3RJCA 2Z8CA 2RFSA 1OB3A 3CKXA 3O17A 3ZUUA 3W2SA 3NW5A 2JC6A 2YABA 3Q3BA 2OO8X 2FVDA 3FZ1A 3OTVA 4FT0A 3IOPA 4IWQA 4QP8A 4CKJA 4XG6A 1XH7A 2FSTX 3QD0A 5TKDA 4LL5A 2P2HA 5DG5A 5LCKA 3DV3A 3O51A 4YBKA 4JG7A 4TYGA 4OUCA 4DEHA 4F4PA 3QTXA 4QP6A 2GQSA 3VF8A 5LWNA 4ITIA 4E8AA 4A7CA 5CF5A 4YJSA 4EZ7A 1Q4LA 1Q8ZA 2RG6A 3GU5A 4E4MA 3LXKA 1PF8A 2OICA 2BKZA 4FK3A 4FSQA 2C5VA 4FTIA 4LQMA 4W4WA 4A9RA 4B4LA 4D0WA 3U6JA 2WU6A 4QP1A 4L42A 4CZYB 1LPUA 2J5EA 5AWMA 5H8EA 5IQBA 4F09A 1K3AA 1H1SA 3BHYA 1O9UA 2XM8A 3OT8A 2ITXA 3SVVA 4YZ9A 2BTRA 1QPJA 2BALA 2G9XA 4MH7A 3ATTA 4GV1A 4AT5A 3MY0A 2R4BA 3NVMB 2Y7JA 5AR7A 4E5WA 4DCAA 2REIA 1KE7A 4FTRA 5ETAA 3W8QA 3MPAA 3SDJA 4BGGA 4EEVA 3FI8A 5E90A 3UPXA 4D55A 2IW8A 2E9NA 4YHJA 5KMJA 3PPZA 3PE1A 4ASXA 4IW0A 3E8NA 5I9XA 2QNJA 3NUAA 4FTUA 3VS7A 2VWZA 2ESMA 2WTDA 3V51A 4GKIA 3VUGA 3AG9A 4G3FA 4RFMA 1A48A 2GFSA 3AC8A 1IAHA 4JBQA 5LVMA 4BCFA 3LJ1A 2HW7A 3UO6A 5E8XA 2V7OA 3QX2A 4K1BA 4QMXA 1S9JA 5JK3A 4O0RA 4PDOA 4KKHA 3C4CA 2ZM1A 4I0RA 5JFXA 3M2WA 1AD5A 2GHLA 1XH6A 3A62A 3DTWA 3OVVA 2F57A 1NVRA 2XNOA 4ORKA 3OWJA 5M4FA 3GB2A 1J1BA 1M17A 1SVGA 4FIGA 4JR7A 4U80A 1XJDA 3NUNA 4KSQA 4RVLA 2YCFA 1GY3A 3PDTA 4FKGA 5IEXA 1A9UA 4Y46A 3NYXA 3HL7A 4CQGA 5EI6A 5JZJA 4H3PA 3WIKA 2OF2A 5EDPA 2J50A 2PMLX 4XOZA 3TV6A 4TWNA 1Q99A 4WG3A 3VQUA 1OBGA 4O7TA 5E8VA 1KE9A 3FMMA 5AP7A 3KVXA 2GNGA 3ORIA 2I0HA 4MQ1A 4O2PA 2R3HA 3H0YA 4BTFA 3KFAA 1ZMVA 5D7VA 4DLJA 2F7XE 2OXDA 3W1FA 2YCQA 4AZFA 2GPHA 3VJNA 2HENA 2VTRA 3CD8A 3F7ZA 4G5PA 4FEWA 3D14A 2JBPA 4DLIA 5FTGA 4OW8A 3ELJA 4OTRA 1XH9A 2A4LA 3OUNB 5HE2A 3V5WA 1CMKE 1MRUA 5CSHA 5CSXA 3TXOA 5DRDA 4JX7A 3RM6A 1QMZA 5EW9A 3M42A 5L6OA 3GCUA 2OJ9A 2XH5A 4EK4A 3UO5A 3BCEA 3N4UA 3R02A 4BIDA 5H8GA 3BQRA 4JIAA 1UKIA 4R3RA 2W05A 4O7NA 3WZKA 2FO0A 5E1EA 3PIZA 2XIRA 3CJFA 3U6HA 1U46A 4IACA 5HICA 3CP9A 2BUJA 4P2KA 1E1VA 2X7FA 4NJDA 5D10A 4HCUA 2VV9A 2Z2WA 3TUBA 5M07A 3MVLA 2V0DA 3EFKA 2WQNA 3CY2A 3K3IA 3ZFMA 3UYSA 3DJ5A 3FY2A 3H3CA 4IVDA 3TKIA 4HW7A 4ZSAA 2V55A 3PA4A 3BKBA 1JLUE 3EHAA 3VO3A 3ZO4A 4E5AX 3PWDA 5JRQA 1TQPA 5IQDA 1PXMA 4EH5A 4NIFB 1P5EA 3FKOA 4FEQA 5IPJA 2XNNA 3TUCA 2R3QA 5EM5A 1P2AA 4FIJA 4C38A 1JPAA 4XLIA 4P4CA 3TV4A 5DR9A 1TKIA 3FLSA 3LQ5A 3EMGA 4GK4A 3I5ZA 3U51A 1OL6A 4IB3A 4EOIA 5FLFA 4MF1A 4RX7A 4YC3A 4LFIA 3UVQA 5E8UA 1FBNA 3HNGA 3R7UA 2BPMA 5C9CA 4N6YA 2WTWA 4RVTA 1YDTE 3R9RA 3F3ZA 4DH3A 4I6HA 3L8SA 4O6LA 4C36A 4IAYA 4TKSA 3ZUVA 4M69B 4HGLA 2VTPA 5L6PA 4FKOA 3QGWA 2QOIA 4PMPA 4Z9LA 1VYZA 2WMRA 3KK8A 4KWPA 3FLWA 4KS7A 3GOKA 5AP4A 2W06A 3DKCA 3SRVB 4PMSA 1XH5A 5AR3A 4O7RA 4XP0A 4M0YA 3F3VA 2F49A 4PV0A 4PNIA 4BICA 3MVJA 2WQOA 2R0IA 4G6OA 4YU2A 4I4EA 1J7UA 5B2LA 5T68A 3ID6C 5IDNA 4I0TA 5EHOA 3FMLA 4AW0A 4CMUA 4ZAUA 4BF2A 5B7VA 4NJ3A 4HVIA 2PTKA 3ENMA 4FT5A 3ZO2A 4MNEB 3RWQA 3AD4A 3LPBA 3QL8A 4V0GA 3BYOA 3R6XA 1WBPA 4RIOA 2C5NA 3GEQA 1VEBA 4ID7A 3CEKA 4RJ8A 3EL7A 5HCZA 4BB4A 1UU8A 4IB0A 3IGOA 1OM1A 4I22A 3KF7A 3DXQA 4QYHA 3LJ2A 3JVRA 3L8VA 3TNWA 4AN3A 4D58A 3IS5A 3VUIA 3R28A 4J53A 4EBWA 3EN4A 2WKMA 2W1GA 3FZSA 4AFEA 3PSDA 5BMMA 4F63A 4AUAA 5E1SA 4A9TA 3FZTA 4QQ5A 3EIDA 2VD5A 2CCIA 4P5QA 2JDVA 3W16A 5JFSA 1M7NA 3MIYA 3HVCA 4B6LA 3E5AA 3C5IA 1RQQA 4FX3A 4QP3A 4C7TA 3GP0A 4MWIA 4YJVA 2Y6OA 1V0BA 5I9WA 1ZAOA 2IN6A 4U8ZA 2HAKA 1Q97A 4L68A 5FM3A 3E63A 3THBA 4XV2A 2WTKC 4M15A 1ZYJA 1FMKA 2VZ6A 2VGPA 2XIKA 1UVRA 3DK6A 4S30A 5CQWA 3UP2A 3JR1A 4FSUA 2NRYA 3TJDA 2JDSA 4F1OA 5A46A 4DA5A 5K0KA 2WMWA 4MXAA 3TZ8A 5JGDA 2JITA 5FEDA 4D1ZA 1NXKA 4DG0E 4FOCA 1BMKA 2UZVA 3HV6A 3CGOA 5EK7A 3RK9A 3MGYA 2WELA 1FOTA 4DBXA 1KOAA 1OKWA 4AE6A 3HUBA 3GNIB 1XKKA 3ULIA 1UU7A 4FG8A 3QTZA 4II5A 4YSMA 3SA0A 3TUDA 3FSFA 5IQEA 2X1NA 1U54A 4ZLYA 5A6OA 2VU3A 2XKEA 3TEIA 4S31A 5AP0A 4WSQA 5AM6A 3EQRA 4YO6A 1FPUA 1KWPA 1OGUA 1PYXA 5BVFA 2J7TA 5IH6A 3G9LX 3AT2A 3PLAE 4RIWA 3FL5A 3JYAA 2E2BA 4QTAA 3QD2B 4FKIA 3A99A 4HVSA 4BCPA 1PYEA 2OH0E 4C35A 5IQFA 3OEFX 5HBHA 4AGUA 5DOSA 2QODA 4EWQA 3TI1A 5GJFA 3FZRA 2C0IA 4QMQA 3NIEA 3D5WA 2YJRA 4I94A 1ZWSA 2QO9A 4A4XA 4EUUA 1URWA 2UVXA 3NIZA 4AXAA 4L9IA 4K18A 5JH6A 3HRCA 2UZWE 3BQCA 2WTCA 5HG8A 1ZARA 4X0MA 5IA0A 4IZ5A 3O0GA 4BDBA 5EM8A 5IMEA 3FDNA 3C13A 3D94A 4DFZE 4G6LA 4QT1A 4I6BA 4OTDA 2PPQA 2PVYA 4EHEA 4M68A 4A9SA 3QQFA 4U97A 4BDAA 5M57A 5D11A 2C6DA 1OPLA 2IWIA 4Y5QA 4KSPA 5DT4A 2VX3A 3DBCA 5IQIA 4EOPA 4L8MA 2PL0A 2QO7A 3PVBA 4TL0A 4FSRA 1CM8A 2J2IB 3C5UA 3FQSA 3KU2A 3QUPA 3EN5A 5DN3A 3W2OA 3MN3A 2ACXA 4AZEA 5LARA 3DFCB 4CTCA 4QPSA 5K9IA 3AOXA 3OCTA 3QRJA 2Q0BA 3ZSGA 5IA3A 3UQFA 5HNGA 2HK5A 4Y95A 3LKMA 3P23A 3QWKA 3BI6A 4NM5A 5M06A 3E8DA 1W7HA 3PFQA 2XB7A 3UO4A 4FV6A 3I60A 4E20A 1YXVA 3O8UA 4FKSA 3FC1X 5TO8A 4CV8A 2WAJA 5H3QA 3TNPC 3N4VA 3VBVA 4FV1A 1O6LA 3C4ZA 3F3UA 4MX9A 3BZ3A 3LVPA 3H9RA 2OWBA 5HNIX 2HELA 5H8BA 5EQYA 5ANEA 3MIAA 4TW9A 4HVGA 1OPKA 1OL2A 1RJBA 3NAYA 4KS8A 4WNMA 3GC7A 3WF6A 5GZ8A 5KE0A 3VVHA 3F2RA 1YXSA 3QU0A 2W4OA 3HYHA 3R1YA 4GYGA 2R9SA 1Q3DA 3I6WA 3OG7A 4OTHA 3E3PA 1KE8A 3BE2A 3QHWA 4HGSA 4IC7A 4UWBA 5L8JA 4ARKA 1OITA 3RK7A 4DTBA 5CEMA 3NNUA 4WUAA 3R8VA 3V5TA 4YJRA 4C33A 3PUPA 3ZEWA 2F4JA 2H6DA 4AT4A 4QMLA 4LGGA 4FSZA 4BCQA 3BV2A 3JVSA 3LOKA 4QP7A 3IGGA 4BDJA 2X7OA 3IW5A 5K4IA 3PXYA 3W8LA 4BWPA 4D2SA 3F3TA 3F66A 4Z55A 1SNUA 2EVAA 5B0XA 2HW6A 4NZWB 1H00A 1WVWA 3E62A 1SYKA 2W9FB 3FL4A 4G3EA 5CS6A 2BILB 2EUFB 2UZLA 4DH1A 5CWZA 2BZKB 4GG5A 3V5LA 3OY1A 4BWKA 5J95A 3K5UA 5DBXA 3C4EA 4BHZA 5IZFA 3L8PA 4CTBA 2IW6A 4V05A 3AC5A 5JKGA 5FG8A 4J99A 1OZ1A 3W2RA 3ITZA 3R1NA 4FGBA 2XA4A 4C3FA 4DT8A 3DAJA 3HDMA 3Q96A 4ANLA 3AXWA 4KB8A 4CRSA 4ZTMA 1IEPA 1ZOHA 2GNLA 5BVOA 5HIEA 4RQKA 4AWIA 1UNHA 4FV2A 4L52A 2Y6MA 3AD6A 4RPVA 1NW1A 3G15A 4F0GA 2WZJA 5BQ0A 2AC5A 3ORLA 4YHFA 2O64A 4FYNA 3EQGA 4D9TA 1H8FA 3EQPA 3FZPA 4FVQA 3NYVA 3ZEPA 2CLQA 2GFCA 3KQ7A 3NGAA 2OU7A 2X7GA 3UOHA 4HZSA 4CZTA 1LP4A 2GQRA 4V0GB 4ZSEA 5A4EA 5JSMA 1B6CB 2BCJA 4UWYA 3ZU7A 4AN2A 2HOGA 4TRLA 3VQHA 4DF3A 1Y91A 4JDIA 3BIZA 3MH0A 4BI1A 4X7QA 4ZS0A 1SVHA 4MXCA 5CVFA 3UMWA 3S3IA 2XUUA 3DNDA 5HLWA 5EW8A 5EDRA 2XK7A 3OW3A 3SD0A 2VWVA 1ERKA 3FMKA 4KKEA 4NEUA 5AADA 4BDDA 4D2WA 4IDVA 4EK3A 2E9VA 4DFYA 5ETIA 5CI6A 4IB1A 2J90A 3PG3A 4F65A 1Q62A 2OZOA 3KK9A 3RAIA 4M66A 4FC0A 5AP6A 3UVRA 2B9HA 1O6YA 4XBUA 3UZTA 2W99B 4KA3A 5CT0A 3Q9ZA 4EQCA 4YTCA 1Q8YA 3OCGA 4UY9A 4C3PA
chains in the Genus database with same CATH superfamily
5GJGA 2OLCA 4I92A 3EJ1A 4M7IA 5AR5A 4IB5A 4Q5HA 4O27B 4JRVA 2XYNA 4CT2A 4UX9A 1ZYSA 4GL9A 4Y5HA 4PF4A 3U55A 3PLSA 4TZRA 3OC1A 2ITTA 3ZRKA 4HGTA 1WZYA 4XHKB 2QQ7A 4O0XA 3FMEA 4CRLA 1P4FA 1PHKA 5TOZA 2XRWA 3ET7A 5DR2A 5HHWA 1U5RA 3BBWA 5IQCA 2YCSA 1OECA 2PE0A 2Z7RA 2FGIA 3B8RA 3PVWA 1YXUA 3QALE 3QLFA 5HKMA 2NNWB 2I0VA 1Q61A 2YAKA 3I5NA 3TTJA 3LMGA 4XJ0A 2QOBA 4KRDA 5CZIA 4W4YA 2A2AA 4NM7A 5HD7A 3LHJA 1PKGA 4U79A 2CNUA 4IM3A 5ANDA 4XNEA 2AUHA 4JQ7A 4R3CA 4S34A 2JKMA 2YIRA 3VS3A 4AXFA 4RBLA 2R3JA 3HMOA 2QOQA 2IW9A 3C0IA 2UZEA 1JOWB 4MBLA 1FQ1B 1YRPA 2ERKA 2QO2A 1DAYA 3O71A 4AU8A 1PKDA 3E8CA 4AW1A 1K9AA 5D7AA 4ALWA 3RNYA 2Z7SA 4IWPA 4C4EA 4E4LA 4RIWB 2HY81 3K54A 3NAXA 4FKQA 4FV3A 4O96A 3WOWA 4BCJA 4MTAA 4BFMA 4EC8A 2ETMA 1CTPE 4RZVA 2R3RA 3NX8A 4QMOA 3W33A 4DTKA 3P5JC 1GZ8A 2BR1A 3KCKA 1BX6A 2UZUE 5KMIA 4F7SA 4EQMA 5A3XA 3QZHA 3DBEA 2BIKB 4J52A 2YLEA 5BVEA 3D15A 1XBCA 1MUOA 2XCHA 4JBOA 4LV5A 3NZ0A 3IW6A 3ORTA 3T9TA 4XLVA 5K5XA 5HX8A 2JFLA 4GJ3A 3G0EA 3EZVA 4PQNA 2VTHA 3H9FA 3WYXA 3ORPA 3G90X 4E6CA 4YUQA 3CIKA 5CXZA 2UZBA 5DMZA 4ZS4A 3MV5A 5HCYA 5AAFA 4ZZOA 2ZV2A 3REPA 5L2TA 3FI3A 2C0OA 3FMDA 3NCGA 4JR3A 4R6VA 4IHPA 3FMHA 5BYYA 1ZY5A 3I0QA 4GSBA 2PZRA 2JIVA 4DEBA 3FAAA 2YITA 5HOAA 4F6UA 1MRVA 4O91A 2XNEA 5GZ9A 3RPOA 4BN1A 4FZFB 3BHHA 3ZRMA 2FYSA 3IDCA 4QYGA 3U87A 2QOFA 3WBLA 4DFUA 4FT9A 3LCTA 4FTJA 4X2KA 2XMYA 5JGBA 4O7YA 2CGUA 4LMNA 3KULA 4WRSA 5EOLA 3SXFA 4LGDA 1IRKA 4OTGA 4F0FA 3DQWA 4CXAA 2F7EE 5CANA 3RPRA 4APCA 4B8LA 5HD4A 4CYJA 3RVGA 5EYCA 3UVPA 5AMNA 3Q53A 2O5KA 2XJ1A 2V7AA 3SQQA 3BEAA 2B53A 1OIUA 5AM7A 5AA8A 1GOLA 3F5PA 3E7OA 3PP1A 4V01A 3PXFA 3UQGA 2PULA 5IUGA 3CR0A 2C3IB 3T3UA 3PTGA 5CEQA 2OIQA 4ASDA 3MY5A 4PNKA 3DK7A 4BBMA 4BRXA 4L3LA 4FV4A 4ZXTA 2ZVAA 4OT5A 4WD5A 5I9UA 4FSYA 4A4OA 1B38A 1UWHA 1W8CA 1JKKA 4L7SA 4YSJA 4DE4A 2BFYA 4IADA 5DGZA 4UMUA 3QUDA 4YMJA 3BLAA 3GQLA 3PZHA 3KEXA 5AIKA 3TN8A 5AUWA 2XS0A 2X8DA 4ZJIA 1V1KA 2XIXA 4D2PA 2GNJA 4AN9A 4O7WA 4W9WA 1W98A 4KBCA 3VHEA 2HY0A 3R9HA 3BGZA 4Y83A 5H9BA 4J71A 3FYJX 4DN5A 4E26A 3CS9A 4FTCA 4TYEA 5LWMA 1OUKA 3FI4A 3W0MA 3RHXA 4Z7HA 4IJPA 4UXLA 3IOKA 3KL8A 5TF9A 3KF4A 5ITAA 3A7GA 3Q5ZA 3UNZA 1FVTA 5HLNA 3DTCA 3PIXA 2QU6A 4FKVA 2QOKA 3PXRA 1FINA 4ZJVA 3TMOA 4YBJA 2C68A 5CALA 2AC3A 3KXNA 3BV3A 3MTFA 4DDIA 4E1ZA 2OJJA 4AGDA 2Y4IC 2GNHA 4XG8A 3PA5A 3HRFA 3ZDUA 5M09A 4FTMA 4Y73A 3AKLA 4IAZA 4QYFA 3O7LB 4IAFA 4A06A 3HMIA 2DS1A 3HDNA 1XWSA 3KXGA 3EQDA 3R7VA 4E6AA 3NWWA 4Q9ZA 1WVYA 2HXQA 2XK4A 4N6ZA 2B55A 4UMPA 2QLQA 3G5DA 3FQEA 5DFPA 3R1QA 1UU9A 2QOLA 2X6EA 3HP5A 5CEPA 2QD9A 2WMBA 3UIUA 3WI6A 3UPZA 3NVKI 3FKLA 2J0JA 3I0OA 4FTAA 4YNEA 3DB6A 4QTBA 2J6MA 5AJQA 4EOSA 3BLHA 5FDPA 2VUWA 4U81A 1Q24A 3H10A 4RG0A 4BYJA 4UN0C 4F08A 3F2AA 4GK3A 4L46A 5IEYA 4H39A 3ANQA 3RMFA 4MD7E 4BTMA 4CFWA 3UYTA 1M52A 4RIYA 2A27A 3TTIA 3VUHA 3L9MA 4U44A 3SG9A 5J1WA 4E4XA 4BGQA 2BRBA 4CLJA 2YWVA 3W0OA 4MBJA 5GIPE 2WHBA 5JRSA 3LLTA 3R2BA 4I6QA 3OXZA 4J97A 4YJOA 3LAUA 3MSSA 1WVXA 1GIIA 3F5XA 4EYJA 4EK6A 3GCPA 4H1JA 5CNNA 2PHKA 2OXXA 5KMOA 3VUMA 3ATSA 3TM0A 1V0OA 1H08A 4BCGA 3LZBA 5EHLA 3KMMA 3W0QA 2NYAA 5AAGA 2JIUA 2JDTA 4C34A 3NNXA 4R7HA 2FUMA 2IZUA 1JSUA 2CKQA 3VRYA 4R7BA 1UA2A 5CVHA 4KRCA 2KULA 4FTOA 4PL3A 4O4BB 5CF4A 4K0YA 5J9LA 2W1DA 5DIAA 4EK5A 3D7ZA 4QDEA 3L9PA 5HE3A 3WYYA 2GNIA 2X9EA 2X9FA 5CU0A 4AXCA 4M12A 3B8QA 2OG8A 3ERKA 3MB7A 4EI4A 4F9CA 3U9NA 3UDSA 2XNGA 4IX3A 2CGWA 4J8MA 3II5A 3FMJA 3B2TA 4IC8A 2CNQA 1UV5A 3PYYA 4J96A 5CAQA 3O23A 4JRNA 1YDRE 4UZHA 2VO3A 2PZIA 4BJJA 1FMOE 3ANRA 1PMNA 4I4FA 4JX3A 3VWAA 1M2QA 3RALA 5I5ZA 5KHXA 3LE6A 3RGFA 4X2GA 1AQ1A 4X2NA 1P14A 3GOPA 3QQUA 3UIXA 3GENA 3VS0A 3BL7A 4A4LA 3MTLA 1NVQA 1DI8A 2NP8A 3O8PA 4WBOA 5HESA 5HG5A 3WZUA 3A7HA 2QG7A 3EH9A 4FSWA 5AP3A 4R77A 3GU8A 2VTLA 2XAOA 4ZTLA 3V8TA 4DH5A 1J91A 4DGLC 3EFJA 4CMTA 4CG9A 2ITWA 1Q5KA 3VF9A 3E3BX 2PY3A 2UZDA 2XJ0A 3KIOC 4R7IA 3TJCA 2RGPA 4IXPA 1Z5MA 4BIEA 5J79A 3R8ZA 2CNVA 3LFBA 2ITYA 4KBKA 3ZRLA 4GKHA 4FSNA 4QRCA 4CG8A 4FKRA 4GIHA 3AC4A 2XIYA 2O2UA 4LRJA 1YXTA 3KVWA 2CMWA 1OMWA 3HKOA 3O96A 4FT7A 3LFDA 5C4KA 4TWOA 4HPUE 4JOAA 3VS4A 3I79A 4AZTA 2ZM4A 5ANIA 2LAVA 4JT3A 3CQUA 4IDTA 3D2IA 4FZAB 4NTTA 2J5FA 2QHMA 3POZA 3C51A 4ASEA 3MPTA 3LXLA 5FRIA 2XNBA 4BKZA 3QQJA 4ZY6A 5CF8A 5AAEA 2WOUA 1YHVA 3IK3A 3ENHA 3DKGA 4HNIA 3KULB 4BI2A 2F9GA 4YO4A 4KIQA 4ZLOA 3OEZA 5CAPA 3NFFB 4OAVB 2PVRA 2R64A 3SLSA 4QMPA 1H28A 3C1XA 3QGYA 4HYUA 4NL0A 1H24A 3IW8A 2ITOA 2JLDA 3QD3A 4U7ZA 5FXQA 1PMVA 5KKRC 1U4DA 4L6QA 3R7IA 4C2VA 3TWJA 3U54A 1SNXA 1UKHA 2PUNA 1WBVA 3Q52A 1OIYA 4MK0A 4U43A 4YZCA 5IH5A 3E88A 1QL6A 3DA6A 3ROCA 4GH2A 3ZBFA 2RSVA 1TQIA 4EWHA 1HOWA 1DM2A 2Q0NA 1IA9A 5IQHA 3AC1A 2GMXA 4L3JA 3LFSA 5ANJA 4NKSA 4BVUA 3K5VA 2CCHA 2VNYA 4EHZA 5KCVA 2CKOA 1WMKA 2WTJA 2OW3A 3P5KA 4OTIA 4XV1A 4XX9A 2QOCA 4CFNA 2WQEA 2YN8A 4JXFA 4AZVA 5KNJA 2W1FA 5J5SA 3FXWA 5JN2A 3ZO3A 3KMWA 3FBVA 3MA6A 3TACA 1P4OA 4NCTC 4QMVA 1JVPP 1WBNA 4WSYA 3KN5A 2CKEA 4H3QA 4W8DA 3RPYA 3UDTA 4JDKA 1YOMA 3OW4A 3MVMA 4JNWA 3CTJA 4YLKA 3KRWA 3LMHA 4D4SA 1IASA 3KKVA 3KXXA 5DI1A 4QQTA 4L45A 2I6LA 4QTDA 5TR6A 4M84A 5E8ZA 3KREA 1PMEA 3PIYA 4GFMA 4AG8A 4C2WA 4JG6A 3ZC6A 5BMSA 3SG8A 4DHFA 3BU3A 4O82A 2IO6A 4DEAA 1Q41A 3QQLA 3ZO1A 2ITNA 3ACKA 4EOMA 4ALVA 5CZHA 3Q6WA 2X2MA 5IUHA 3VHKA 3F6XA 4PMTA 5AFVA 2RF9A 2UW9A 4W8EA 1LEZA 3O5AA 4AOJA 2PVNA 3O8TA 4FTTA 2GHGA 1B39A 4QMZA 2E9OA 3MH1A 4GJ2A 5ETFA 3UMXA 5L2IA 2JAMA 3R2YA 4IIRA 5HGIA 2PZ5A 3RKBA 4M0ZA 5EKOA 3FSKA 2RKUA 5M55A 4BCMA 4D2TA 3DZQA 1YW2A 4F0IA 2VN9A 4UYAA 1FVRA 4DBNA 4HNFA 2YDJA 2IG7A 4XP3A 4NT4A 2GQGA 2SRCA 4ALUA 3Q2JA 2P3GX 4FI1A 2F7ZE 4PTCA 3BLQA 3ZBXA 5HE1A 5HG9A 4IAIA 5AP5A 2PVJA 3DLSA 2QONA 3DB8A 3GU4A 4FVRA 4YLLA 3DGKA 3QXOA 3ML1A 4C0TA 4IX5A 3MB6A 4NWMA 5F20A 4FEVA 4L44A 2JD5A 3Q2MA 4KAOA 4B99A 3VIDA 4KIKA 2B9JA 4RIYB 2G2FA 3GCQA 4XEYA 4WG4A 2YERA 5E9EA 2XK8A 3L8XA 1A06A 2UUEA 3DZOA 2GSFA 3FI2A 5HBEA 3Q6UA 4ASZA 5E4HA 3QFVA 4FF8A 3VJOA 4RFZA 3DXPA 2E9UA 2FB8A 4YZNA 2OIDA 1NY3A 1KOBA 2X4ZA 3MH3A 3AKJA 2XM9A 2FSOX 4TWCA 3DY7A 4X21A 4EC9A 4ZTSA 2FH9A 4ANNA 4C61A 1Z57A 4QMSA 3L9NA 4V04A 4QMNA 2UVZA 1ZRZA 2DUVA 3AMYA 4A07A 1QCFA 3QKLA 5EM7A 4EL9A 5TT7A 3F3WA 5HVYA 3CJGA 4QQCA 5F4NA 3SV0A 2VTNA 5M51A 1QPCA 4FTQA 5FBOA 1YWVA 3HV4A 3IDPA 2YIQA 3SXRA 3VS1A 4C4JA 4YTFA 4DITA 3U8WA 2NPQA 2C47A 4W4XA 3FLNC 5AIRA 2R2PA 4ZZMA 2B54A 3EQCA 4UMTA 4AGWA 1XBBA 2GU8A 4AE9A 1JKLA 2WEIA 2XK9A 2XKDA 3G51A 4PX6A 3RCDA 4JQEA 4LRMA 3OXIA 4NCTA 3PVGA 2PZPA 4UYNA 3W10A 2ITUA 4FKLA 4IM0A 4WT6A 4X2FA 5CT7A 3C9WA 5FWKK 3R9OA 3UQCA 5BYLA 1OI9A 3LCOA 1PXOA 3QAME 3ETAA 2G2IA 3ZUTA 3CD3A 4WOVA 2ZB0A 3VNTA 4BJJB 3OXTA 2PK9A 5JEBA 4FBXA 5ICPA 4YTHA 1IA8A 4IVBA 4NW6A 3V01A 3CQEA 4CSVA 2YCRA 2Z7QA 4BTJA 2O65A 3C4FA 3C0HA 3VS5A 3VULA 4EH8A 3DLZA 3GBZA 3BPRA 4GCJA 3DAEA 4IAAA 4DFXE 3UJGA 2J4ZA 1TQMA 2JAVA 4JJRA 4I0SA 5HU9A 3HV3A 3LCDA 2PVFA 4BTKA 4IZYA 4BKYA 2UW6A 5FTOA 3KGAA 1QPDA 3QHRA 1XHAA 3LJ0A 3F2NA 3HMNA 2VTTA 5EKNA 1H01A 4RIXA 4C37A 3AMBA 3MFTA 3O50A 5J9YA 2X4FA 1OL7A 3M1SA 3OUKA 3AQVA 4QD6A 2QHNA 3BELA 4MKCA 1G8SA 4NU1A 4RSSA 5T6KA 4AAAA 3FXXA 4CV9A 3MA3A 2BZHB 4G3CA 5ANKA 5DT3A 3TL8A 3VAPA 4O7ZA 5CLPA 2GDOA 4ONAA 5LMAA 3MVHA 3V3VA 2JKOA 3WE4A 4ENXA 5C4LA 4QMUA 2O8YA 4MXYA 3RM7A 3RZBA 3S4QA 5IF1A 1LUFA 2ONLC 2ZV7A 4GT4A 3ORKA 2WU7A 1FVVA 1URCA 3D9VA 3EYHA 4PRJA 3S1HA 4YJTA 4AXEA 2YZAA 3COIA 3VC4A 2BVAA 3A60A 1RW8A 2OI4X 3QTRA 2PE1A 4PDSA 4XV9A 3QQKA 4YP8A 3Q9YA 3IECA 3UG2A 4AW5A 2WEVA 1WBSA 5BYZA 4FTNA 3IPHA 3HRBA 4NM0A 4OTWA 2BZJA 4FIIA 2IJMA 5E8YA 4LG4A 4R1VA 4ZSGA 3W0RA 3JY0A 3JS2A 5E8SA 3C50A 4FODA 3HZTA 5IH4A 4YPSA 4C3RA 2VO6A 1JKSA 3GU7A 3LCKA 1LR4A 4XP2A 2YM5A 4RLKA 5IA5A 4BDEA 1WFCA 1ZYLA 2BRHA 5FEEA 4WNPA 5A4QA 3R04A 4I5PA 3EKNA 2GNFA 3ORZA 3G0FA 3AC2A 3LFFA 3UNJA 2GS2A 4FG9A 4BHNA 2CGXA 4F9AA 3I7BA 4XS2A 2YLFA 3QKKA 3W2PA 4YZDA 4MBIA 3WIGA 4D9UA 4O81A 1M7QA 1PW2A 2W5HA 5HO7A 1ST0A 3QF9A 3EN9A 4QMMA 2YM4A 2X81A 3VUKA 1PJKA 3BHTA 3E64A 3CXWA 1YHWA 4UBAA 3UODA 4ZY4A 2WMUA 2VX1A 2JDRA 4I6LA 3DPKA 4CNHA 1YI6A 3HGKA 3RHKA 3UNKA 3PWYA 1H25A 2B52A 4OTPA 4EH7A 3S0OA 4U41A 2BKKA 4HCVA 2C1AA 3PSBA 4FKTA 4AA0A 2QC6A 5H2UA 3ZLWA 3F9NA 3ZONA 2IZRA 1JSVA 2ZDUA 4S33A 4IWDA 4JAIA 4H3BA 3MBLA 4IZ7A 4FMQA 3NW7A 2H9VA 1W2CA 3EWHA 4OBPA 5HI2A 4DT9A 4D2RA 4BCKA 5GZAA 2C5OA 1R78A 4ZOGA 3UOKA 4G34A 4G6NA 4CMOA 4KINA 5D9HA 4HVHA 4Z3VA 5HX6A 3W32A 4XRJA 4U0IA 5M08A 1PXPA 3OP5A 1CKJA 4O4DA 4FUXA 4Q2AA 2G2HA 3TIYA 3HEGA 4GVJA 1SMHA 3PY0A 3QC9A 2C3LA 5L2SA 4TYJA 3CGFA 4QQJA 2J51A 3LW0A 4ANBA 4LUDA 5GJDA 5HEZA 2VX0A 2PUUA 4I1ZA 4RJ5A 2WPAA 3L9LA 3Q9WA 4G1WA 4KKGA 1GIHA 4C4HA 4W9XA 4XCUA 1WAKA 5JQ8A 3R83A 1GNGA 3MJ1A 5BVWA 4Y8DA 3LIJA 4HGEA 4DG2E 3P86A 3PJ8A 5EYMA 2OGVA 2HCKA 3PRFA 2VWBA 2ONLA 5AR4A 3EZRA 3NUYA 5IA2A 2UW3A 4G3DA 4WG5A 5J9ZA 5HZNA 2R0UA 3DS6A 4UZDA 4NSTA 4DGGA 4X3JA 3SC1A 2C30A 4M67A 3VBYA 5IISA 3UP7A 5G6VA 1S9IA 4YLJA 3UZPA 5JFWA 4FYOA 3MESA 3R8UA 2OIBA 4JDHA 4LM5A 1Q3WA 2WOTA 4CCBA 1W2FA 2OJFE 2IVTA 5FXSA 5BX0A 2B9FA 3FQHA 1KE5A 1OL5A 2BMCA 2QCSA 4H1MA 3VBXA 5EH0A 1R3CA 5FQDC 1R0EA 4NW5A 3UZRA 2HXLA 4OAUC 2ZYBA 1UNGA 4AOIA 5FD2A 5JQ5A 5EQEA 4MNFA 2UZNA 3WF8A 2J0MB 1MRYA 2VWYA 2C4GA 3E92A 2X6DA 4CVAA 4J8NA 3R7YA 5DT0A 5CAOA 1WBOA 2WMSA 1U54B 3ROYA 4X3FC 3DT1A 4M13A 3CPBA 1R0PA 2ZOQA 3E93A 2VWUA 4JVGA 4O38A 4ZJJA 3V6RA 4FR4A 2AYPA 4ITJA 5KBRA 1PRYA 4P90A 2GTNA 5HG7A 3IG7A 2HZIA 3JUHA 4AZSA 4YJPA 2IPXA 3F5UA 5I9VA 1Z9XA 2UW8A 3UG1A 4IANA 4RWJA 3TT0A 4BDCA 4EOKA 3R21A 2EWAA 4QPAA 2J9MA 4IM2A 4RJ3A 3IONA 4CFFA 5AR8A 1PXNA 3QZIA 3D5VA 5J8IA 4KBAA 3R1SA 2QG5A 3S95A 3WARA 4K6ZA 4FV8A 4D5HA 2W7XA 3LXNA 3P7BA 1PXKA 4FL3A 5AP2A 1PY5A 4P7EA 5JGAA 1M14A 4L67A 4ZMEA 3LQ8A 4Q5EA 4GFOA 3M11A 2YACA 3R73A 1SZMA 3CPCA 4I20A 4WNKA 4D1XA 5CEOA 1WBWA 4EOJA 2BAJA 2P33A 5AV4A 1CDKA 1Y57A 4ANMA 5DWRA 4KD1A 3DNEA 4XUFA 1XO2B 4BKJA 3SAYA 3QD4A 4HYHA 4JBPA 5T3QA 4I41A 5CU2A 4APPA 3I1AA 4PDPA 3FLQA 4E6QA 1REJA 5BUJA 3BEGA 3OZ6A 1FGIA 4ERKA 2XF0A 3FLYA 1BL6A 2EXEA 4M14A 4EJNA 3C7QA 4JMQA 1Y6BA 3F61A 3UGCA 3C0GA 1OVEA 3ACJA 1SVEA 2HWOA 1XH8A 1ZY4A 3RI1A 4EUTA 3T8OA 3HUCA 4WBBB 3NS9A 2B9IA 3HLLA 5C8MA 3WZJA 4IFGA 2OK1A 3AGLA 2PMOX 2V22A 3ZC5A 5L8KA 3R01A 4IE9A 3K3JA 4RA5A 4LYNA 2CN8A 2PMNX 2PSQA 4RGJA 2VGOA 1XH4A 3E7VA 3BHUA 3FPMA 1ZOEA 3BHVA 2WTKB 4IQ6A 4X6QC 3BGPA 2BAKA 5CTPA 4IAKA 3BE9A 3WZDA 4EOLA 1SM2A 3TNHA 4A9YA 2J0IA 2PYWA 2XK6A 3V5JA 2ZJWA 4F7NA 2P0CA 2W4KA 3IW4A 4ANQA 4M97A 2C6MA 3EKKA 4IVAA 4RFYA 2OFUA 4I21A 5AP1A 2YM7A 3SXSA 1YI4A 4NTSA 2YISA 4FZ7A 3EOCA 2BDJA 2UZOA 4GMYA 4HZRA 3KY2A 3R63A 1ZYCA 2B4SB 3QXPA 4XG4A 3ZMMA 5FUTA 5CY3A 2PU8A 4NH1A 3TV7A 4ANSA 4BZOA 3N9XA 2R7BA 1LEWA 3I7CA 3BWFA 2XKFA 5EYKA 3L1SA 4X3FA 3NYNA 4XV3A 4JDJA 2CHLA 1IAJA 3D0EA 2ITZA 2JFMA 3P1AA 4GU9A 2IZSA 4DC2A 5I3OA 2HZNA 1HCLA 2PVMA 1U59A 2AQXA 2BIYA 3MFSA 2R3NA 1GZKA 2C6TA 2HIWA 2ZV8A 3IDBA 5KZ0A 2GS7A 3KRLA 3ZSIA 4CCUA 2Y4PA 2B0QA 1I44A 4N57A 4GS6A 3SHEA 3QRIA 5BNJA 4UMRA 3KXZA 2DWBA 3HMPA 2QURA 4FT3A 3QCXA 1DAWA 4DFLA 4GK2A 5FGKA 1Q8WA 2EB2A 4BCOA 5BV3A 4W4VA 3QTWA 5LCJA 2WMXA 2VWIA 1REKA 4M3QA 4H05A 3ZCLA 1GZOA 1VZOA 3ZLYA 5AUTA 4XRLA 4X2JA 4QTEA 4XG7A 2PE2A 4ZEGA 3OY3A 4ZMFA 1XR1A 1T45A 1QPEA 1GZNA 2WGJA 3HA8A 4G16A 4JBVA 4B9DA 2VTMA 3COHA 3NNWA 2O3PA 4YPDA 5DH3A 5HIBA 4B0GA 3PFYA 2WTVA 3T3VA 1DS5A 2P55A 2XNMA 1R1WA 1PXIA 2I0EA 1BI7A 1MP8A 2C1BA 2JKKA 2VRXA 3FYKX 3H4JA 5EI2A 3A2CA 2J0KA 5IA4A 3QWJA 4RWLA 3MFRA 4CGAA 3VS6A 4FTKA 2OSCA 3Q4ZA 4RX8A 3BYSA 4PWNA 3W2CA 1Y8YA 3A4OX 4LRKA 4R5YA 5K4JA 5K3YA 5BVNA 4O0SA 3RPSA 3TDWA 5BPYA 1F5QA 2G01A 3PXKA 3DJ7A 4K11A 5G1XA 5J5TA 4MUQA 3OBJA 4UEUA 3SGCA 1W2DA 1YHSA 4E73A 3QCSA 4OBOA 4ZK5A 3VBQA 3HAMA 2GS6A 3O2MA 1H4LA 3PXZA 4WKQA 2G1TA 4F7JA 4BDKA 3GXLA 4O1OA 4YHTA 2BRMA 4AF3A 4LL0A 4TYHA 3QTSA 1Y8GA 3JPVA 1KV1A 2VTOA 4TNBA 4DEIA 3VS2A 3LFAA 4LDTA 4OT6A 3R7GA 5CENA 4Q9SA 4WUNA 3TNQB 4I6FA 4BY9E 4BL1A 5ETCA 3W0SA 3WF5A 3OCSA 4WNOA 5E8TA 5EI8A 3WF9A 2C5XA 2EXCX 3BWJA 3VW8A 3W0NA 4E4NA 4NYEA 4LUEA 3GUBA 2C3JA 4QPMA 3TKUA 4G31A 3F7WA 3D7TA 3NYOA 4WIHA 3ZS5A 4EH6A 4EZ5A 4BBEA 4K77A 4J98A 2VWWA 5CSWA 2BRNA 1JSTA 4AFJA 3G2FA 4CEGA 1O6KA 4CD0A 5DLSA 4RLLA 2X39A 2ITQA 5TE0A 2W96B 2YIYA 2O63A 2YM6A 3BLRA 4QO9A 2CSNA 5I0BA 3R7EA 2XRUA 4XBRA 5GNKA 4WO5A 2FSLX 1JAMA 2RFDA 3QTUA 2YIWA 4ZTNA 4NFMA 3MFUA 3NDMA 4YJUA 4GEOA 1TFFA 1PXLA 3SOCA 4UMQA 2XP2A 3TZMA 4D0XA 3ALNA 3AT3A 1E9HA 2Z60A 3PJCA 2H34A 2OF4A 1YXXA 4TY1A 3QRUA 4U5JA 4BYIA 3KRXA 5CAVA 4CFVA 3FMNA 4XG9A 2YDKA 3DOGA 4KNBA 4C8BA 3LMIA 2UW5A 1VLRA 3DFAA 3JY9A 2ETKA 5HCXA 1XMMA 4MXZA 4RWKA 2IVVA 3T9IA 4O83A 5DVRA 1ZYDA 4MWHA 5AR2A 4MEDA 1JWHA 2V62A 2ZDTA 3NUSA 3PPJA 4G9CA 4TYIA 3UIMA 4U42A 3ZXZA 5LOHA 3GC8A 3RPVA 3RAWA 4C58A 3EFLA 3P0MA 4GFGA 4M8TA 1NVSA 2YEXA 4GRBA 4RX5A 5JT2A 2OFVA 2R3LA 1KUTA 5F94A 4U9AA 3Q4UA 3GQIA 4S32A 1OBDA 3R30A 5HQ0A 4L53A 1GIJA 2R7IA 4QOXA 3OHTA 3ZLXA 1F3MC 4LI5A 2WMTA 3PVUA 4HOKA 3UOLA 3ZH8A 4LV8A 4QTCA 3IW7A 1H07A 2YJSA 2VTQA 3QTIA 2CLXA 5AV2A 1OUYA 3ZM9A 5DNRA 4EH4A 5LVOA 1G5SA 4L01A 1BKXA 5A9UA 5C8NA 2ZM3A 4YURA 4ZTQA 3F88A 3PZEA 4NM3A 2UV2A 2WQMA 2X0OA 2HZ0A 5AA9A 3PE2A 4OLIA 3AT4A 1H0WA 4EZ3A 5A4LA 4O0TA 4O86A 3VBWA 2WNTA 3AD5A 4IH8A 4R5SA 1YQJA 3EQIA 2XALA 3FXZA 4FZ6A 4FGRA 5HO8A 3RNIA 4F64A 3KRRA 2Y0AA 4RX9A 4XOYA 2W4JA 2C6KA 3LFCA 4PY1A 4ZTHA 3OOMA 5HO6A 2OXYA 4EONA 3V8SA 4JIKA 2AEGA 2YM3A 4O4EA 4LOOA 1BUHA 1OL1A 3O7LD 4QP4A 4PPBA 3V8WA 5A54A 2CKPA 5L6WL 3HV7A 4YZMA 1ZMWA 1GJOA 4AQCA 2PVHA 2X8IA 3I4BA 3I6UA 3QZFA 3R71A 4CQEA 3GFWA 4FZDB 4PUZA 3GCSA 3TIZA 3QYZA 4OTQA 5KMMA 4BIBA 3VBTA 2DQ7X 4B7TA 1H26A 3FJQE 4BCIA 2YWPA 4MYGA 5IKWA 3BU6A 3Q60A 2CN5A 4RVMA 3WILA 4ENYA 1NA7A 2RFNA 4LGHA 5HNBA 2OJGA 3EQBA 4E6DA 5CSPA 4DGMA 1OIRA 3DBDA