4GG7A

Crystal structure of cmet in complex with novel inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
278
Chain Sequence
QAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hepatocyte growth factor receptor
publication title Multisubstituted quinoxalines and pyrido[2,3-d]pyrimidines: Synthesis and SAR study as tyrosine kinase c-Met inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 278
sequence length 281
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gg7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gg7A01
5EH0A 4HNFA 5EYCA 4F7NA 4FTQA 4GH2A 4YTIA 3DZOA 2OSCA 3BE9A 4IADA 3UVRA 1VZOA 3I5ZA 5BMSA 4XRJA 4FV0A 3CQEA 4AZTA 4RJ5A 4XMOA 4CYJA 1PMEA 4Q2AA 4CV8A 3OY1A 4OW8A 4HNIA 4BFMA 4BYJA 4IIRA 5A9UA 3HAMA 3FMJA 2QU6A 4X7QA 4XHKB 2WMSA 1GJOA 3BHTA 5EDQA 3EN9A 4QMLA 2X4ZA 4KS8A 5D1JA 5M44A 3KREA 2HW7A 3CEKA 3R22A 4N6YA 4R3RA 3TKUA 3VAPA 3QZHA 3QTSA 4X2NA 1Q8TA 3DPKA 2DWBA 1QPCA 2WMBA 3DAEA 4H3QA 4FGBA 4NSTA 1ZYDA 4JAJA 4GV1A 1PXJA 2UW4A 4OTWA 3LFEA 5CAUA 2OKRA 4TY1A 2GNGA 2JDRA 3I7CA 2VO0A 4LFIA 2ZM1A 3VHEA 5A4CA 3PFQA 1CKJA 3FL4A 3KF4A 5D12A 4C4FA 4RJ8A 5JQ5A 2GHGA 3AC2A 3QTIA 4FUXA 4FIJA 4E6CA 5HI2A 3I79A 3G6GA 2XM9A 4FV5A 4Y5HA 3LPBA 3H3CA 5EM7A 3WILA 3FXXA 3ORNA 2X2MA 2JKQA 3QRJA 4EQUA 4EWQA 3O50A 3BIZA 4Z9LA 4RVLA 2W4JA 5BVDA 3OT8A 4MD8E 4FTTA 2UVZA 4WSYA 4QYFA 2X81A 5ETIA 3IW5A 2P33A 2WMQA 2PULA 2YISA 2J50A 2UV2A 4ALWA 4CNHA 4EBWA 4FEQA 3HV7A 3AD5A 3CJFA 4D58A 2GHLA 2B55A 3G15A 2XJ0A 3Q53A 3SAYA 4BZNA 4E5BA 2HW6A 4AG8A 2PSQA 4BDBA 4N57A 3RZBA 4EOIA 2W1FA 4BIBA 2OK1A 4U80A 2VX3A 4HPTE 1IA9A 5CAOA 5EQEA 2J0JA 2NRUA 3EB0A 3QC4A 4Y8DA 5CVGA 4I6QA 5HVKA 3UYSA 4LYNA 3I81A 3LVPA 4X21A 4F7SA 4Y46A 4AGWA 4LGGA 4TKSA 3DQXA 4G9RA 5ANGA 4FK3A 4MK0A 3MJ1A 4YU2A 1J7LA 2PU8A 3UOKA 3F2RA 4I6HA 4BCPA 3E62A 4CMOA 5F9EA 4B9DA 5FTGA 3PE1A 3RNYA 3ZSHA 4DAWA 4TNDA 4YPSA 3PY3A 4LRMA 4TTHB 4BKYA 3IOPA 2VO3A 3CR0A 3W33A 2QLUA 3QD0A 1E1XA 1OI9A 4TWCA 1M7QA 4JG8A 3GC0A 3KXZA 3MVJA 3VUKA 5IQCA 5HESA 4A07A 4ASEA 1PMVA 3HP5A 4PL5A 1CDKA 3FI8A 2JEDA 4O0YA 5J9YA 3UOJA 1NT2A 3MSSA 1ZYLA 4NK9A 4TYEA 3DFCB 3GOPA 3OXZA 4QMUA 1LR4A 4L42A 2R3FA 3NYNA 3GCPA 3MBLA 3RINA 3ZUTA 4D0WA 2FSLX 2RFSA 3GGFA 3QTUA 5ETAA 1CKPA 1PYEA 3F3UA 3V8WA 2UZLA 4O22A 2CKQA 4IZYA 3N51A 3POOA 3QHWA 2Y6MA 4MQ2A 5DH3A 3G9NA 5CXHA 4UEUA 2C6IA 5EYDA 5C9CA 4B8LA 3KK9A 5CANA 4O7ZA 2QOKA 3O2MA 2W99B 3NUSA 2R64A 4HCUA 2HIWA 2V7OA 4OTQA 4D9UA 4FNXA 5DMZA 2PMOX 4EHEA 3MFUA 2ZDTA 3NCGA 3ZC5A 2JDTA 4FV2A 3WE4A 4U44A 4BDJA 4QOXA 4X0MA 5BVNA 3HZTA 1OUYA 2OF2A 4DG3E 5FEQA 4OTHA 4R1YA 3PSDA 3NAXA 3BU3A 4O91A 2R3LA 2XNMA 5DFPA 4AFJA 3QWJA 3BYVA 3KRWA 3HV6A 4ACGA 4K11A 2BAJA 3FLWA 3SVVA 4FOBA 5C8KA 3NRMA 3OY3A 4ASZA 2OJFE 3DAJA 3R8MA 1ZYJA 3BRBA 2ONLC 1YWVA 3CP9A 4I92A 1VEBA 5KHXA 3SXRA 3KRRA 1WVXA 3OXTA 5DE2A 4D9TA 3NIZA 1YHWA 2PTKA 3VUMA 4IB1A 3VUHA 2QNJA 2VAGA 3IDPA 3A4PA 4NIFB 1URCA 1ZOEA 4G17A 2W1EA 1H24A 1G8SA 3QXOA 2OIQA 5I3OA 5JRQA 3ITZA 3E3PA 4QMQA 5DRBA 3K54A 3TXOA 4ZLYA 4PMPA 3C5IA 3ZM9A 1PXOA 3R8LA 4RX5A 4R77A 1URWA 3QRKA 3COMA 4FKLA 4DH7A 2WO6A 3OWKA 2PVLA 3DGKA 2V55A 2WB8A 4OR5A 2WIPA 1M14A 2HK5A 3MH1A 3OOGA 3LXNA 3ORTA 4J53A 4O2ZA 4R5YA 4DGOA 1REJA 4M84A 3CCNA 4CMUA 4IVAA 4M13A 3QRTA 4MH7A 4P5ZA 2QOOA 2W9ZB 2J5EA 3DCVA 4IJ9A 1XKKA 2XEZA 5LWMA 2GNJA 3EKNA 4UBAA 3ZTXA 3WF7A 1E1VA 2C69A 4PTEA 3R30A 1BKXA 3E93A 5HNIX 5M06A 5IUHA 4GIIA 1SZMA 3GFWA 4G3GA 3C0IA 3U9CA 2VO6A 4FKVA 4O7TA 4O27B 4C61A 4ZLZA 4YJPA 2EXMA 3N9XA 1JQHA 2GNIA 3FKLA 2P55A 3OROA 3ORIA 4GJ2A 3VW8A 3A7JA 4L7FA 4E1ZA 5L6OA 3KK8A 4D1XA 3VS3A 4LV5A 2UW7A 2QCSA 3LFCA 3QTZA 4I6FA 3FI3A 3HEGA 1YHVA 3GUBA 2R3NA 3OOMA 1GIIA 5L3AA 4HW7A 3CE3A 3F5UA 3MGYA 5JMSA 3EQHA 4U41A 3W2SA 4F9CA 4FYOA 4EOMA 5A4TA 1GOLA 2XBJA 4RC4A 4U7ZA 5DIAA 1O6YA 2PMLX 4FL1A 4M15A 4W4YA 3W8LA 2ZAZA 5TOZA 5CVHA 2CGUA 2OIDA 2ERZE 5AJQA 4CRSA 3SRVB 4C2VA 1L3RE 5HLWA 3AOXA 4JXFA 2IW8A 3DK6A 4QNAA 3VJOA 4CZTA 5JFSA 5KNJA 1KE5A 3W2QA 4EK3A 2XNBA 2VGOA 2X9FA 4P2KA 4U79A 3RBWA 3F5PA 3C5UA 5IQDA 4YJQA 3PZEA 4ZK5A 3R9NA 3R9OA 4OTIA 4DLIA 3EWHA 5IH5A 1Q41A 4JQ8A 4DCEA 5AP4A 1ZWSA 2EB2A 4U40A 5AV2A 4FTNA 4MBJA 5L2SA 4AE6A 4ZIMA 2OLCA 3OT3A 3V5PA 3VS0A 4C4EA 4YJNA 1JKKA 1R39A 2X8DA 3D9VA 4IM0A 3ZH8A 5IA2A 2AYPA 2A27A 2EXCX 2PL0A 4GK3A 3L8XA 3MN3A 2RG6A 4FV6A 2VTNA 3HMNA 4MTAA 4WT6A 3DBCA 5JSMA 5I9VA 5IQBA 2Z60A 3A62A 4ACMA 2P3GX 3ZHPC 4BBEA 3VUGA 3LKMA 3AD6A 4HCTA 4OT5A 2B9HA 4FZ6A 3TCPA 3U9NA 5CEOA 3UOHA 4IX5A 1SVGA 4IM2A 4BCQA 5CF4A 3RTPA 3F88A 2BIKB 3PYYA 3L9LA 3R2YA 2VTSA 3R04A 5LQFA 3R8PA 2GTMA 4E93A 2HCKA 2IN6A 2IW6A 3B8QA 2PK9A 3FLYA 4DH5A 4XG9A 5HOAA 4BL1A 5IKWA 2JIUA 3FY0A 3PG1A 2XNGA 2QOFA 3NUPA 3ROCA 5L8LA 3LFNA 3ANQA 2BILB 3NZ0A 4YC3A 4CFWA 1OBGA 2YZAA 4UWYA 3Q60A 4UXLA 1H1WA 4M67A 4M69A 2HWOA 5HCZA 2G2FA 1WFCA 4QP9A 4V04A 3KULB 4QTDA 3SOAA 3QCYA 3MY5A 2QG7A 4HJOA 5AIRA 4BCKA 1BX6A 2VTOA 3OCBA 5AP0A 4MXYA 5BVEA 2C5YA 3DJ6A 4XP2A 4C2WA 4FV7A 4F65A 3UQCA 4E6AA 1WVYA 2B0QA 2VTTA 3MH0A 3PLSA 2V7AA 4ENYA 5IMXA 3P79A 4JQ7A 1H07A 4ANOA 2GS2A 4ZMEA 5IF1A 2J0LA 4AOTA 3VVHA 3PRIA 4JR7A 4BCJA 4I4EA 2R9SA 5JEBA 5CU0A 2PYWA 4AXAA 4IAFA 4XNEA 1KUTA 4RFZA 5HE3A 4FGRA 4EH8A 4MXCA 1STCE 2ZB1A 3LOKA 3QD2B 3Q04A 5L6WL 1UVRA 3NGAA 2G9XA 3GP0A 4HPUE 4XBRA 2B1PA 1JVPP 4GCJA 4FV8A 3FMHA 1ZXEA 3PXQA 4Z3VA 2IG7A 3PSCA 4YBKA 3MB6A 5EI2A 3QXPA 4W9WA 3RKBA 4EKLA 3MYGA 3Q5ZA 3ZFXA 4YJSA 3KA0A 4ERKA 5M4IA 3RAHA 1S9IA 2PUIA 3QQLA 4D4YA 3BU6A 3NNVA 4IWOA 3R0TA 3R7EA 4F7JA 3RPYA 2F7XE 4ZMFA 1YDSE 4YZCA 2XM8A 4QQ5A 1XH9A 2QKRA 3DBQA 3F69A 4EC9A 4BIDA 2I7QA 1PXPA 2XRUA 4G9CA 4D2SA 1I09A 4QMYA 4QMVA 4XOYA 2W1HA 3QZFA 1BMKA 2I0EA 5J79A 5LVPA 2IPXA 4Q5HA 3OW4A 3D94A 5AR8A 3HDMA 3QQJA 4EHVA 3W10A 2BVAA 2DUVA 5CAVA 5EHLA 4FUYA 4JL9A 3AMAA 2VNWA 3Q9ZA 3VBQA 2FUMA 5TT7A 2VTAA 4ZY5A 5BUIA 1IAHA 1DM2A 1M17A 3F6XA 5EOBA 4I23A 4YHJA 4O1OA 3CBLA 2I0HA 1VR2A 4RIWB 3N4TA 4USEA 5JGBA 3WF8A 4FIHA 4Q5EA 3HECA 3Q32A 1ZY5A 3R28A 3L1SA 3C4WA 3BE2A 3P4KA 1W8CA 4FTUA 4JRNA 4PDSA 3CY2A 4CGAA 3AC1A 1FVVA 3FLNC 5HHWA 5I4NA 4QYHA 4K6ZA 4NT4A 3ATTA 4O84A 3DY7A 3LLTA 4G3DA 5JGDA 4DFZE 5KUPA 2PVRA 3NYOA 5AP2A 5E9EA 5CU4A 4KSPA 3LMIA 3FMDA 3NIEA 3MJ2A 5HTIA 1J3HA 2O63A 2WQMA 4PRJA 4MWHA 3G33A 4X6QC 3ZXTA 5J1VA 4BB4A 4BCHA 3SXFA 3U4UA 4D28A 1XBAA 3LXLA 4L3LA 5HLNA 3JXWA 2PUPA 2OJ9A 2WFYA 3RJCA 4CKIA 4FTCA 1G5SA 4IVCA 4OT6A 4WSQA 4AZVA 3U6JA 2FYSA 3FPQA 2BPMA 2Y4IC 3NNUA 4DEIA 5AAGA 3GI3A 3TG1A 4CCUA 1A48A 4ZS4A 3PDTA 2R3QA 4DCAA 2OJIA 3ZONA 4DITA 4FE2A 4E8AA 4EORA 2GCDA 3W2CA 4L67A 5E8XA 4AS0A 2F7ZE 3PXRA 4FL2A 3KXXA 1Q8UA 3KCFA 3DB6A 4GG7A 1JNKA 3ZLSA 4FEXA 5CVFA 1Q4LA 4TWPA 4NIFA 5D7VA 2A19B 3MS9A 2ETRA 3SOCA 4FEVA 3M42A 4XV2A 4F63A 3GC7A 4PMTA 2QOCA 4F1MA 4G1WA 1W0XC 3IW7A 3DKGA 3R9DA 2R7IA 5J8IA 1HCKA 3DBDA 3U87A 2JKKA 4MNFA 4BWKA 3R2BA 3OWJA 3PP1A 5C03A 2LAVA 3OBGA 3V01A 3VBWA 1CMKE 2VTHA 5B7VA 5A3XA 5D10A 2P2IA 3KXGA 5EW8A 4APPA 1OZ1A 4EQCA 2W1CA 1U4DA 4GUBA 3QCXA 4NFMA 4ARKA 4X2GA 5K3YA 3MV5A 2EUFB 4QTCA 4MXAA 4UYNA 3SV0A 4C33A 5L2WA 2BCJA 4O0SA 4RX7A 3FY2A 4RVMA 1Q8WA 3HL7A 2YM7A 1YWRA 1P2AA 1QPDA 2RSVA 3A8XA 3ENMA 4F09A 5DG5A 3IGGA 3QTWA 2XH5A 4CT2A 2YN8A 2YZLA 2OXDA 4O7VA 3ELJA 3NUAA 3CJGA 1IG1A 1XQZA 2X8IA 3GQLA 2C5NA 5J7BA 2PY3A 1YOLA 2BKZA 5F1ZA 3QGWA 3SG9A 1RQQA 5CT0A 5ITAA 4O7YA 4IX3A 5HTBA 1FGIA 3EN5A 3TIYA 4M97A 3VN9A 3E8NA 4NZWB 3GU8A 5CX9A 4WKQA 2YM4A 4J7BA 1OKWA 5AFVA 2YABA 3MTFA 3RAWA 4EWHA 5J9LA 3NCZA 2FB8A 5CF5A 4MX9A 2JC6A 4RA5A 4O83A 4Z7GA 1PY5A 5DN3A 3D4QA 4O0VA 4BZDA 5BNJA 3NNXA 4L46A 3FBVA 3ANRA 3QTRA 4E7WA 3RAKA 4C4HA 3REPA 2H8HA 1UA2A 4RIOA 5LCKA 3VF9A 4EH6A 4CV9A 2O64A 2H96A 2QVSE 1ZMVA 3A8WA 3SRVA 3QFVA 3SLSA 4DN5A 2RFEA 5EKNA 2BZKB 4KBAA 4GKHA 4LUEA 3TUBA 2XMYA 4FSRA 4RJ7A 1IASA 5DI1A 4CFUA 3WZEA 5L4QA 2O65A 4JR3A 5EKOA 5KKRC 1H0WA 3TEIA 2BHHA 5GNKA 3AC4A 2GS6A 4ZS0A 2WQEA 3CQWA 5B0XA 3VHKA 2OI4X 5LMBA 1SNXA 3C7QA 3GU7A 4O0RA 3SQQA 3HV4A 1Y57A 4QPMA 4CQGA 4G5JA 3QQHA 4L68A 4W8DA 2WD1A 4E4XA 2HWPA 2YJSA 4BRXA 2VTPA 3O96A 4EYJA 2JFLA 4GVAA 2CKPA 5AEPA 5JRSA 2IJMA 2FO0A 1PW2A 3D2KA 2PVNA 4RVTA 3DBEA 1YXXA 2V5QA 3FZ1A 4O2PA 5ANIA 4HVSA 4MYGA 4PP9A 4MWIA 3LXPA 1IRKA 3KVWA 4ANMA 5CF6A 3A7FA 4IAAA 2CGVA 4KWPA 4BYIA 3S95A 2XA4A 4O6LA 2XYNA 5L8JA 1OPJA 5IDPA 1YXVA 2WMXA 2C6MA 5HBHA 2VWWA 5FP5A 5HX6A 1XO2B 2FSMX 3O0GA 3PVWA 3QCSA 4U5JA 4V0GB 5CSHA 3V5LA 1FVRA 1PKGA 4ZSLA 1FOTA 1UNGA 3RMFA 2PZIA 3ZSIA 4J8MA 3Q6UA 3DXNA 3KULA 4FF8A 3D5VA 5CSVA 3BYSA 1Q8ZA 2W7XA 2R0IA 4CXAA 2CNVA 4E6DA 1YW2A 5EM8A 2PZRA 3FXZA 4X3FC 2BZIB 3GU5A 3E3BX 5T3QA 4A9YA 4ANLA 1WBWA 3UMWA 3VBVA 3T3UA 5HG9A 4G16A 2J90A 4G6LA 4HGEA 2Z7QA 3COKA 5I9XA 2WELA 5AUYA 3GB2A 1NVRA 3EMGA 4I20A 5BVFA 3PP0A 5M56A 5CXZA 2YLFA 3R8UA 3HRFA 2C3IB 3RI1A 3RVGA 4AZFA 2O8YA 3G2FA 4HOKA 1E9HA 3RZFA 4M68A 3LFBA 5CEMA 2FGIA 2V0DA 4EOJA 4AW2A 4XJ0A 4JOAA 3CY3A 1PHKA 3R01A 2J0MB 4L9IA 4TYJA 4GJ3A 3Q52A 3VS6A 3P5KA 3PA5A 4J52A 1OUKA 1WBTA 2ITTA 4FKUA 4O0TA 5FGKA 5FXSA 2B9IA 2GQGA 3EFWA 4FKPA 5D41A 4EKKA 5FDPA 3QGYA 3NVMB 4YPDA 4DFYA 4DLJA 2OFVA 2NP8A 4IDTA 4QRCA 4W4XA 4DTBA 4MVFA 2GNHA 4WBBB 3OD6X 2R4BA 3BI6A 1CKIA 2V62A 4PV0A 4FBXA 4HVGA 3EHAA 3TTJA 5JFWA 3E87A 3U54A 4X6RA 4XUFA 4DF3A 2C4GA 4E5AX 4CMTA 4KIOA 1K2PA 4KAOA 3DKFA 5A4LA 1XH7A 4JX7A 2X6EA 1OIUA 2QD9A 2GFCA 2HZIA 2X0GA 3QRIA 3MIAA 4I3ZA 5DNRA 3DKCA 4KIPA 4DGMA 2UZTA 1DAYA 2VWVA 3BLHA 4D5HA 3PWDA 3SGCA 3BEAA 4IAIA 4LL0A 4F08A 2YM5A 4C58A 2UW3A 4YHFA 3VIDA 3QTXA 1DAWA 4M7IA 4O38A 3BLRA 3LAUA 2CPKE 4PMMA 4PTCA 3ZRKA 4M0YA 3D7TA 2J4ZA 2ZDUA 5FXQA 4F9YA 2ZV2A 1UKHA 5DR2A 5E92A 1KE7A 5EDRA 4BCNA 1ATPE 2EB3A 4PY1A 2KTYA 2BDJA 4EUUA 3IECA 3M2WA 5C4LA 4BTKA 3UDBA 2W0JA 4ZTHA 3F3VA 3P9JA 3MFRA 4RJ4A 4ZTMA 4K77A 5DA3A 1UNLA 3L8SA 3ZXZA 1KWPA 3QLFA 4FT7A 4LL5A 2XK8A 2WU7A 3MB7A 3MW1A 4EK5A 5L6PA 4NH1A 3RAIA 2CCIA 1OM1A 2X6DA 3R00A 3W2OA 4BDFA 2WPAA 5J95A 3QWKA 3UNZA 1Z5MA 1JBPE 4ORKA 3R1NA 3QKKA 5KHWA 3BLQA 3AGMA 3FMLA 4BCIA 4UMTA 5KMJA 2H6DA 5TO8A 5CSXA 4DTAA 1YQJA 2XS0A 2F2CB 3F3TA 2PZ5A 2HXQA 2Z2WA 3W18A 2WMVA 4ANQA 3NDMA 4EJNA 2XNNA 4C4GA 3P1AA 5IDNA 3OXIA 2G15A 2Y9QA 1YDTE 3BGQA 2CLXA 1JLUE 2XZSA 3S4QA 1T46A 4QP6A 3P7BA 4O0XA 5FQDC 5LMKA 2XK9A 2VWIA 3LW0A 1YKRA 4ERWA 5HG7A 4XEYA 3UBDA 3T3VA 1VYZA 4RMZA 2YLEA 4BZOA 2UW9A 3E5AA 4BCFA 1OB3A 4YTFA 4JBQA 3D5WA 1H0VA 5CI6A 4E3CA 3P7AA 4A06A 2NO3A 3RCDA 2CNUA 1NXKA 2IZUA 4YC6A 4F7LA 4ZTQA 4ENXA 1YWNA 3II5A 5FG8A 3VO3A 4PUZA 2YITA 3I6WA 5KE0A 3TL8A 4JIKA 5EI8A 3U6IA 1SM2A 3BGZA 1M52A 4H36A 4S30A 2QO7A 2X2KA 3EN7A 5IH4A 5E8VA 2QKWB 3VC4A 2ITUA 2J2IB 4DH8A 4YLJA 3UO5A 3NMUF 4H3PA 2BIYA 1SVEA 1WBSA 3FKOA 3FMNA 4TYHB 5DOSA 5TE0A 1M2QA 2ITOA 3WZJA 4ACDA 3BELA 4EJ7A 4U45A 1JAMA 5F20A 3EQDA 4X2JA 4FG8A 3FLQA 4OAVB 3LM5A 4M12A 1U59A 1Q97A 2ZM4A 5EHOA 3GXLA 5IH6A 4EHGA 2XUUA 1ZARA 2X9EA 3TUCA 5AAFA 4NCTC 4Y85A 4Y83A 4ZZMA 4APCA 4DA5A 3QA8A 4YNOA 4S33A 4AT5A 4QQCA 2BTRA 4TRLA 1REKA 4XH6A 2JDSA 4XLVA 3RNIA 3KXMA 3GU4A 3Q2MA 3EN6A 3Q4CA 4IDVA 2BDWA 4LRKA 5KMLA 3VUTA 4F1OA 2WMAA 1YI3A 4LUDA 4CEGA 2UZBA 4QPAA 3KEXA 3AQVA 1GZOA 2W1DA 4ZLOA 1L8TA 2QLQA 3FZTA 2WNTA 3Q9WA 1YI6A 5LARA 2X4FA 4FVRA 2A4LA 5BQ0A 3OUKA 1YXUA 4FTMA 5LOHA 2WTKC 3LMHA 2F49A 4W4VA 4NFNA 5FWKK 5A46A 1JOWB 1QCFA 4I6BA 3G90X 4XV3A 2PE1A 2QQ7A 4ZY6A 3JVSA 4NM7A 4C4IA 4JS8A 3A61A 1B39A 2XF0A 3G0FA 3NYVA 5DWRA 5AAEA 4O21A 4MHAA 3E8DA 1PMUA 4AGDA 3OS3A 4FV4A 1BL6A 3TI1A 4C8BA 3G0EA 3GFEA 3KMWA 3SDJA 4QD6A 3RK9A 3DK7A 3UP2A 1XBBA 4ZJJA 4BI2A 4F64A 4Z7HA 4EH5A 1OPLA 5JFVA 5CASA 5K5NA 3ZFMA 1MQ4A 1M7NA 5HBJA 1KV1A 4ID7A 3ZO3A 3C0GA 3QZGA 4AT3A 2PUNA 3HUCA 2R3PA 4YSJA 2Y6OA 2IO6A 4GL9A 3RM6A 2OW3A 2YDKA 3AG9A 3K2LA 4IHPA 4C37A 4F1TA 4O7RA 3DB8A 3KVXA 1ZYSA 4H3BA 4TW9A 4X2KA 5HNGA 3VBXA 3ZRMA 4DG2E 4GK2A 4U6RA 1XBCA 5A14A 4V0GA 2FSOX 3JS2A 4OLIA 4RWLA 5ETFA 5EW3A 2C0TA 3EL8A 5ICPA 5J9ZA 3W32A 2WU6A 4MBIA 4U97A 3TZ8A 3ZBFA 1YHSA 4KIQA 5J7HA 3RPSA 3QQUA 5L2IA 2BRMA 4RX8A 5IA1A 3QQFA 3UMXA 5A6NA 5KMNA 1FMKA 3NNWA 3A7GA 4JDJA 3U8WA 3NYXA 1RJBA 3C0HA 4PDPA 1H1SA 5KMOA 5HLPA 2YDIA 3UQFA 3ORPA 3P78A 3UNJA 2YWPA 3FI2A 3EYGA 3IOKA 3FZOA 2ERKA 2OU7A 3VQUA 4LGDA 3C4ZA 4O7SA 2VTIA 2JITA 2PZYA 3HMIA 4FT9A 4RG0A 3UZRA 2W17A 2PVMA 2QOHA 4PPBA 4YLKA 5I9WA 3OBJA 5FUTA 4L00A 3LFQA 4WNMA 4KRDA 4MNEB 5AR7A 1YRPA 2PUUA 3IW4A 3KC3A 4EK8A 3Q96A 4ZSJA 2Z7RA 4IX6A 3LFAA 4D4VA 4QMXA 4F6SA 3PJ3A 1OECA 5EG3A 4DEEA 3TNPC 2VD5A 1NW1A 3NPCA 3FQSA 3O71A 3TM0A 3GC9A 5AA8A 4ZAUA 3EKKA 4IAKA 2JAVA 4BGGA 4OUCA 2QOLA 4ONAA 1WBNA 1GNGA 5A54A 3PXKA 2ITYA 4FZ7A 2YIWA 2W1ZA 1AGWA 1VYWA 4NWMA 4IMYA 1B38A 4BDHA 4G2FA 5CSWA 1QPJA 4IB3A 3ACKA 3VBYA 1LEZA 5IA0A 3ATSA 4PNIA 4R78A 2UW0A 4AA0A 3O51A 2H34A 3VJNA 3QKLA 4NM3A 2R3OA 4BBMA 2CGWA 2WMTA 2WKMA 2QODA 1NA7A 2GSFA 4NTSA 1ZOGA 5IQEA 3FAAA 4A7CA 3QX4A 2WTJA 5CT7A 4WRSA 4FR4A 4AZSA 3FUPA 2OG8A 2YIQA 4GSBA 5C8MA 1UWHA 2C1AA 2C6KA 4R5SA 4NW5A 4ANNA 3HMPA 4GT4A 5ACBC 3KGAA 2UUEA 2Z02A 3SD0A 1AD5A 4Y5QA 4YZBA 4FKGA 5K9IA 3DOGA 2ITXA 2CNQA 3FI4A 5TF9A 5DR6A 3WZKA 2B7AA 1J1BA 3PY0A 3LE6A 5BMMA 4BTFA 4WNOA 4C36A 3MI9A 4P5QA 4BICA 2YIXA 3KF7A 4FSWA 3BHYA 2OIBA 4LI5A 2W4OA 1O9UA 1K3AA 1PXKA 4XOZA 3QLGA 3CLYA 4I22A 5E8TA 4ITIA 2I40A 2PHKA 3F61A 1DI8A 3ZDUA 5B2LA 3O17A 3OHTA 5E91A 1QL6A 4YJOA 3SG8A 3DBFA 3FMMA 3EQCA 1R0EA 3ZEWA 4EZ3A 1YDRE 3C4XA 4NJ3A 3UIBA 4UV0A 4BKJA 4EOOA 2J6MA 3UPXA 1OMWA 3UO4A 2R3JA 3ZM4A 4I21A 3CTHA 3HDNA 3LQ5A 5BPYA 2WXVA 5IEVA 4DT9A 1F0QA 1JPAA 3H9FA 3R21A 1OPKA 5E8SA 1H00A 1NVQA 4AFEA 2E9NA 3P08A 2RL5A 3CXWA 1H1QA 2OICA 4JRVA 3VS1A 2YDJA 3EZRA 5CZHA 3ZO2A 4R3PA 1ZYCA 4PL4A 2H9VA 5AV1A 4BI0A 3D5XA 2XJ1A 3MY1A 2PMNX 4ZSAA 1OL2A 4E5WA 2GFSA 3A7HA 3D14A 3PIYA 4U0IA 2VWZA 4F6UA 2ZMCA 3KN5A 5KMMA 4N0SA 3IPHA 1X8BA 5EI6A 1W82A 3G6HA 3TTIA 2IVUA 3ORKA 2PVYA 3PSBA 5DEYA 4EZ7A 2I0VA 5JZNA 2HENA 4C4JA 4C7TA 1HOWA 4X2FA 1RW8A 4GK4A 3THBA 3S0OA 4MCVA 3UQGA 1H4LA 5FEDA 3W2RA 2BZHB 2UZEA 3QZIA 3R1YA 4F0FA 3RM7A 5IQHA 3Q4TA 4FKJA 4ZSEA 3VRZA 1U54B 4WUNA 4ASXA 3CQUA 4XLIA 3QKMA 1KE8A 5K4IA 2BFXA 2FSTX 4QPSA 5F4NA 5FM3A 5CEPA 2ITZA 4U9AA 5HICA 2GNLA 4TYHA 3ID6C 1VJYA 3BPRA 3DAKA 3GVUA 1CSNA 4RX9A 2HZ4A 4PNKA 5H9BA 4DBNA 3FPMA 4ASDA 3QTQA 2VTMA 5I9YA 1ZRZA 2DS1A 3MA6A 4DG0E 4R1VA 2JKMA 3W1FA 3ZCLA 2WTKB 5CQWA 4D5KA 3DS6A 3R8VA 4FIFA 1KE6A 5KBQA 4L6QA 4YTHA 4NUSA 5EFQA 4QQTA 4NL0A 2Q0BA 4L43A 4MXXA 3BGPA 4QTEA 3VW6A 4BWXA 5J5SA 3ULZA 4AW0A 3C51A 2C0IA 4I0TA 2OWBA 4LG4A 4R8QA 5HIBA 4B8MA 5JKGA 2YERA 2UZOA 4RVKA 5IMEA 2WTVA 3OWLA 1ZOHA 5EM5A 4KBKA 3WIGA 3DT1A 4BDIA 1J7UA 3BBTB 1OL5A 5HE2A 3SHEA 3ZZEA 4LOPA 4TXCA 4QQJA 2FA2A 1PXNA 3BEGA 3I6UA 1GZNA 2NRYA 1U5QA 5JGAA 2R0UA 4YURA 2YAKA 1ZAOA 2R3RA 4QMPA 2VV9A 2ACXA 5F94A 5CU6A 1UV5A 3C9WA 5HBEA 4RRVA 2BZJA 4LQMA 3UGCA 4M8TA 3WZUA 4J1RA 3ORXA 1GY3A 4IH8A 4JDKA 4UB7A 4FG9A 4N6ZA 2PPQA 3CTQA 3K3IA 2WTCA 5AR4A 1RDQE 2JDOA 4YZMA 2XB7A 4AU8A 4G3FA 1KSWA 4FZDB 4PTGA 2VGPA 4L53A 4DH3A 2CDZA 5M4CA 3KMMA 4K18A 4U3YA 3KXHA 2F57A 4RFYA 1O6KA 2GNFA 2VNYA 4IB5A 3ZU7A 3PRFA 4B7TA 4MF1A 3P7CA 2W1GA 3TV7A 5GJDA 1WZYA 4IANA 3VULA 3I7BA 4CZYB 1TQMA 5KBRA 3TDWA 1LP4A 2ITVA 1Q5KA 4KABA 4AQCA 4FL3A 3EZVA 1OIQA 4R6VA 3GC8A 4X3JA 1JWHA 2WMUA 4QTAA 1Y6AA 3ZLXA 3K5UA 3LCTA 1Q61A 2UZVA 3H4JA 5CYIA 4OAUC 3OWPA 4UYAA 5J1WA 3LCSA 4F9WA 4I94A 4WD5A 2B54A 3ET7A 4HGSA 4I93A 3TJDA 4BC6A 4AP7A 4CCBA 3M1SA 4FIEA 1EH4A 1BI7A 4MD7E 3EOCA 4NKSA 4ZTNA 3KKVA 3WE8A 2AUHA 4BDKA 3CKXA 4BDDA 4DINA 1WBVA 4FSMA 2B4SB 5HIEA 3R83A 4A9UA 5IUGA 3RK5A 4XG7A 1MUOA 4FX3A 3MVHA 3PE2A 4L45A 3H9OA 4DTKA 4ZZNA 3D7ZA 2OXXA 5HTCA 5M53A 4B99A 3OF0A 4O82A 4J97A 1Z9XA 2C5VA 3F5XA 4FMQA 4LMNA 5LVOA 4FICA 4GIHA 4WBOA 1KE9A 3NS9A 5IISA 3L9NA 5EQPA 4RZVA 3N4UA 3QUPA 4IWDA 5DEWA 4MNEA 5C27A 2R3HA 3FJQE 3PY1A 4TT7A 4ZTSA 2XNEA 4S31A 3V5QA 3MH2A 2PWLA 2PVHA 2CLQA 5E8UA 4F9BA 5BYYA 3LFFA 3KB7A 5FBNC 3UE4A 4IVDA 3QF9A 3JPVA 2B52A 3R71A 4JDHA 4U3ZA 3RWPA 4AN9A 2OJGA 3NAYA 1LUFA 3U6HA 1W7HA 1WMKA 2WQOA 3O8TA 3OEFX 3WARA 3SW7A 3VBTA 3F7WA 5IPJA 3OCTA 2JAMA 4WA9A 3F2NA 4S34A 3LIJA 3OG7A 5CS6A 5JQ8A 2R3KA 4K33A 1XH5A 4D4RA 4HYSA 1TQPA 3M11A 4MAOA 4HYUA 1QMZA 4BY9E 4I4FA 5DVRA 3DZQA 3TN8A 3NR9A 4L52A 2P4IA 3EQIA 3F9NA 2EU9A 1SMHA 3A7IA 4UXQA 2KULA 1XWSA 2W05A 5DT0A 3BWJA 3LFSA 1APME 2PMIA 4WHZA 3V51A 5AUUA 3P0MA 1W98A 4YO4A 4ZSGA 1WBPA 5B2MA 4BVUA 4L01A 2W4KA 3E92A 2F2UA 4FTLA 5HORA 3S2PA 2QHMA 2UZDA 1ZLTA 3ZBXA 4FKTA 4AW5A 1WBOA 4AZEA 2BRNA 2YCSA 2G2HA 3O8PA 1Y91A 4FSZA 3C13A 3RK7A 2QHNA 4I24A 3H0YA 3OCSA 5HKMA 3A2CA 3G5DA 3KFAA 1OKVA 1P5EA 5AUXA 5AV3A 2R3MA 2XCHA 4M14A 4AAAA 4BGHA 3QRUA 3SA0A 4C57A 4WG5A 4MF0A 4MEDA 3BHUA 2FH9A 4J96A 5LJJA 5LXMA 3MWUA 4EQMA 4EYMA 5EHYA 4DFBA 5IA4A 3FL5A 3K5VA 2QR7A 3MDYA 4NTTA 5GZ9A 2ITPA 3QD4A 4EOKA 2HAKA 3ZEPA 2DQ7X 4Q9ZA 5GIOE 1OKYA 4I0SA 2W96B 4JJRA 2F4JA 4HYIA 4DFXE 4F0IA 1ZZLA 3DLZA 3G9LX 3BQCA 4H39A 2P0CA 5CTPA 3DV3A 4D1ZA 4ITHA 2CHLA 1HCLA 4FVPA 3IK3A 2I0YA 1U46A 4K1BA 3ALNA 4OBQA 3RP9A 4BTMA 3R7IA 2VX1A 3TIZA 4IJPA 4TNBA 5H8GA 5HG8A 3RPRA 3BYOA 4KKEA 4BGQA 4F6WA 5IU2A 3VUDA 4FVQA 4IZAA 3E7VA 1IEPA 1O6LA 2BHEA 4CD0A 3LM0A 4FKOA 5ANEA 4GT5A 4BHNA 4YTCA 5L2TA 1BLXA 3CGFA 5C4KA 2AC5A 2QOBA 2UZWE 4I5CA 2C0OA 3BQRA 4WUAA 3W8QA 1H01A 2QU5A 3CGOA 4YZ9A 2W5BA 3EL7A 3H30A 4XRLA 5FDXA 5JH6A 3LHJA 5DLSA 5IEXA 2GQSA 4II5A 5I3RA 2PVJA 2VRXA 3U51A 4A4XA 3L8PA 3BYUA 3TNWA 3EH9A 4E6QA 3R7GA 3EFKA 5I9ZA 4BF2A 1U54A 4PDYA 2GS7A 2DYLA 4U42A 4IB0A 4XG3A 4AE9A 4EC8A 5HU9A 3IG7A 3JR1A 3KXNA 3TNQB 3WBLA 2WOUA 3E88A 5EOLA 5KCVA 4G31A 5IUIA 2R7BA 3MFSA 3KCKA 2HYYA 4LV8A 4FSUA 3VUIA 5E7RA 2ZMDA 5D7AA 4IFCA 2XKEA 3HP2A 3MESA 4GT3A 3GCSA 1ERKA 4JNWA 2ITQA 4KD1A 2Y8OA 2YCQA 1P14A 5IG1A 1BUHA 3O23A 4RA4A 4TZRA 3ERKA 3NX8A 1F3MC 4MQ1A 3RHXA 1TVOA 4QMZA 5CEQA 3F82A 3QBNA 4IC8A 3I0OA 3OCGA 3DTWA 1XH8A 3H0ZA 3HYHA 4FTJA 4RLKA 5DPVA 4CLJA 4XP0A 3AC5A 3O7LB 4G3EA 2C3KA 3ODYX 2UW5A 2XVDA 5HGIA 3I60A 4FNWA 4E4MA 1JKTA 1J7IA 4I41A 5I0BA 2CGXA 5BVWA 1ZMWA 2A1AB 5A4QA 2Q83A 2X7OA 3IQ7A 2WQBA 1JSVA 3QX2A 4RIWA 4UY9A 3R7VA 3VF8A 2CCHA 2ZV9A 4A9RA 3QCQA 5E1SA 4KRCA 1OIYA 2R5TA 3GCQA 4FT0A 3D15A 3FHRA 3UIUA 4O6EA 5ACKA 2X39A 1ND4A 1YXSA 3IW6A 5IQFA 3NUNA 4FV1A 2ZVAA 1UU8A 4XV9A 3MY0A 3FZPA 3FLSA 2Y4IB 4BDEA 1PXIA 5CF8A 2Z8CA 2OZOA 4J99A 5CWZA 1F5QA 4CSVA 3EYHA 3BCEA 3OEZA 1MRYA 4DEDA 1AQ1A 1PF8A 4GU9A 4CFFA 3IDBA 2ONLA 4DFLA 4DHFA 3E8EA 5HD4A 3S3IA 4RQKA 3TJCA 2ETKA 4D2TA 4YLLA 4D2RA 3ORZA 4WNPA 3OZ6A 4LOQA 4BDAA 4USFA 4WG4A 1LEWA 1V1KA 2BRBA 2VTLA 1NVSA 4QYEA 4AGUA 3CC6A 1H08A 2ZOQA 1Q62A 1Q8YA 2GPHA 2WEVA 4U8ZA 4PPAA 2UW8A 3LFDA 4ALVA 4PQNA 4GMYA 4FTIA 4W4WA 5DGZA 4CTBA 2WTIA 4WNKA 2C5OA 5BX0A 1PXLA 4J71A 1FMOE 4BN1A 3HMOA 1IR3A 4AZWA 3GEQA 1H28A 2E2BA 4FKSA 2R3GA 4TYIA 4C38A 4QMSA 3MPAA 2WMWA 4GRBA 4RQVA 3N4VA 2JIIA 4C3FA 5AADA 5FBOA 5AP7A 1DI9A 2X7GA 4QO9A 4XG4A 4AUAA 2G2IA 4GG5A 5CNOA 4IAZA 3DJ5A 3BZ3A 4RIYB 3IW8A 2E9PA 3I4BA 3NW5A 4IX4A 4K2RA 3PJ2A 4QMMA 3ZS5A 5AV4A 4UWCA 2YIYA 3HA6A 4DH1A 5AR5A 1RE8A 5HIDA 3R7UA 3CSVA 1ZMUA 5BUJA 3ORMA 2XIZA 3QD3A 1Q3DA 4QNYA 4DEHA 3L9PA 4GS6A 5K4JA 1B6CB 2RFDA 4OTPA 4FEWA 2QOQA 4M69B 2Y7JA 3EQRA 3MIYA 4XG2A 4YJVA 5D9HA 5EYKA 3GOKA 2C5XA 2PZPA 3AMYA 3CS9A 4FT3A 1PKDA 2J51A 3QQKA 4FZAB 2WQNA 4HGTA 4KS7A 4QYGA 4OBOA 4QP4A 3IO7A 4B0GA 3V6SA 1MRVA 3AC8A 2HOGA 3RWQA 3WYYA 4O7NA 4TWOA 5HD7A 3FQHA 1Q24A 3QA0A 1GIJA 1G3NA 2VWXA 3KY2A 4FV9A 4PF4A 5E8ZA 3S1HA 2XNOA 2I6LA 4JVGA 1SYKA 2J5FA 3BHVA 2F9GA 3PLAE 3LXKA 5IQIA 4FTAA 3COHA 1KOAA 5HE1A 3OUNB 2GU8A 3ALOA 3TZ9A 1OL6A 2ETMA 4F0GA 4RSSA 1YOJA 3ODZX 3LQ8A 4FZFB 1SVHA 4YGAA 4KIKB 1OVEA 2C6OA 5AUZA 2HZ0A 4A9TA 5BYZA 2VU3A 5LVLA 1MRUA 5IEYA 1JSTA 3UODA 4PPCA 3E64A 4PMSA 5KKRB 2P2HA 4O1PA 3FC2A 3V5WA 5DT4A 4KSQA 5AM7A 1OL1A 3LCDA 4NYEA 3ZLYA 3DNDA 3KMUA 4EONA 1R1WA 4AA5A 4YZNA 4G5PA 3DFAA 3UIXA 3DXQA 4I5MA 3L9MA 2XCKA 3W16A 4JI9A 3HVCA 4QT1A 2NPQA 5KZ0A 1WCCA 4UX9A 2BDFA 4CG9A 4EH9A 4EL9A 4O0WA 5GZAA 4Z16A 5IA5A 4L44A 1XJDA 3HGKA 4IBMA 1TQIA 4BWPA 3UZPA 2XK4A 3QYWA 4KB8A 4IC7A 5HE0A 4JBPA 3GCUA 4IAYA 5AMNA 4PP7A 3TV6A 3RPOA 2YWVA 3EN4A 2CN8A 3SX9A 2WAJA 2BALA 3UNKA 4F4PA 2VUWA 4Y73A 4RPVA 4JX3A 3DA6A 4BDCA 5AUVA 3R7YA 3PVBA 3DU8A 3Q2JA 2JFMA 4EK6A 5CEIA 4ANBA 2YA9A 3UG2A 4EH2A 4DEGA 3PIXA 5HU3A 5GHVA 3EQFA 2IZSA 3I1AA 5AA9A 3ZUVA 3C50A 3V3VA 3AT4A 2BAKA 2C6EA 5BYLA 2HY81 5LVMA 3FZSA 3PPZA 5HCYA 1GZKA 4X3FB 4AOJA 2G01A 4W9XA 3FEGA 4AOIA 4E4NA 4XP3A 4ALUA 4OGRA 4N4SA 4MD9E 4BCMA 1UU7A 4U43A 1SNUA 2C30A 3R1QA 3VS4A 4BI1A 5L8KA 3HKOA 5CI7A 3TDVA 3RCJA 1W84A 3KL8A 4DYMA 3OVVA 4K9YA 4E73A 3VNTA 3Q9XA 2JD5A 1WAKA 5CY3A 5ANJA 5AR3A 3V5TA 4CFVA 4JAIA 2C6TA 4WIHA 1OKZA 4RJ3A 2GMXA 4RWKA 5AR2A 1OIRA 2C1BA 3AT2A 4J98A 3FKNA 5TKDA 4Z55A 3QC9A 5HQ0A 5H8EA 3E63A 4RLLA 3BV2A 5E4HA 4G3CA 3B8RA 3S00A 4M66A 5E8WA 5HG5A 5F95A 2CSNA 4LRJA 4ZJIA 3KN6A 4FKIA 2OBJA 5EDPA 5M55A 4HVHA 5KMKA 5FTQA 4XG6A 3ZOSA 2CJMA 1OL7A 4K0YA 4I0RA 5EYMA 5KX8A 4DBXA 1YI4A 5FXRA 3ETAA 4FI1A 4G6OA 4FNYA 3BWFA 3FWQA 3FSKA 3LMGA 5CALA 3PJ1A 3HUBA 2ITNA 2BROA 4LGHA 2YACA 3QAME 1I44A 2PVKA 5M4FA 5EK7A 3UPZA 2NNWB 4A9SA 5GZ8A 3BHHA 4N70A 4GYGA 2QC6A 1S9JA 4E4LA 3CPBA 3LJ1A 5LMKC 2XIXA 3PJCA 4ITJA 1H8FA 1P4FA 2YM8A 2WTDA 3FXWA 3R9RA 4D0XA 3H10A 4GFMA 3PIZA 3UTOA 3ZSGA 5K0KA 3QU0A 3UOLA 4ZP5A 4JQEA 4QMOA 3G51A 3BYMA 3DK3A 4JBOA 3L8VA 3EQPA 4GYIA 2W9FB 3T8OA 4HYHA 4C35A 3AXWA 3I0QA 4CTCA 2BMCA 2O2UA 2OH4A 3ZRLA 2C68A 2QURA 4D55A 2J9MA 1H1PA 2XRWA 1Z57A 4ZOGA 1XHAA 5GJFA 3V8SA 4BCGA 4JG6A 2QOIA 4RGJA 1XH6A 3JYAA 4QYYA 4O96A 4IXPA 4YP8A 1QPEA 4E26A 5BUEA 1PYXA 1TKIA 4HGLA 4O86A 3BBWA 4IEBA 2W5AA 3E7OA 3TNIA 4FEUA 2BUJA 3SC1A 4CFNA 3K3JA 4R7HA 5A6OA 4BKZA 2X8EA 3PUPA 4R3CA 4ANSA 5C8NA 1MP8A 3E8CA 5KZIA 2BKKA 2JBOA 2XP2A 3O7LD 4YUQA 2EWAA 4TYGA 2VWUA 3MPTA 4TWNA 2HELA 3Q3BA 4GW8A 3A99A 2Z7SA 5J87A 3QQGA 4YJRA 4NM0A 3DDQA 3ZFYA 1WVWA 3FC1X 1Y6BA 1Q3WA 2X7FA 3IKAA 3R1SA 4FK6A 4KBCA 2JBPA 4KKHA 4A4LA 5AX9A 2GQRA 3EJ1A 3BU5A 4UZDA 1PXMA 2E9VA 3SW4A 1BL7A 2BRGA 2C47A 3WOWA 4NW6A 4LMUA 4EOQA 4E20A 2XBAA 3B2TA 3PWYA 1V0OA 3KQ7A 5KMIA 5DBXA 1OITA 3DQWA 5AUTA 1BYGA 2UW6A 4FSQA 5A4EA 5HX8A 4R7BA 4FSNA 3ZUUA 3UIMA 5ANOA 4CVAA 3TUDA 3TV4A 2ESMA 4YHTA 4S2ZA 3ZO1A 4UWBA 2XIKA 4G6NA 3C1XA 2XIRA 1OGUA 5G6VA 3NSZA 4WRGA 5CAQA 4CRLA 4NKAA 3QALE 4TN6A 2W06A 3GQIA 4RIYA 5D11A 2B53A 3ZYAA 2ZJWA 4C59A 4IE9A 4FSTA 4BR3A 1XR1A 2XNPA 3BKBA 4USDA 5CU2A 3PVGA 2OXYA 4F70A 1NY3A 2GDOA 2OZAB 5TR6A 5E1EA 2XK7A 4LOOA 4PWNA 1A9UA 3D0EA 5HO7A 2VO7A 4AF3A 3HMMA 4KNBA 4IVBA 3C4CA 3DJ7A 1FBNA 1G8AA 2YM3A 3FE3A 4NJDA 3Q9YA 5B2KA 4CG8A 1J91A 3RALA 3TKIA 3LJ0A 4FODA 2YM6A 3Q4UA 4B4LA 2XKCA 2PVFA 2SRCA 3V5JA 3VQHA 2VWYA 5JK3A 2O3PA 4DEAA 3HRBA 5CNNA 1GIHA 1V0BA 4ZJVA 2QO2A 3CTJA 2XKFA 4BTJA 1ZY4A 3TKHA 4KIKA 5T68A 3QYZA 4C02A 4JBVA 4C62A 2XKDA 4EH7A 4DGNA 4M3QA 4IW0A 4AN3A 2OO8X 3NUXA 5I5ZA 4HZSA 3H9RA 4RC3A 4BDGA 4DGGA 3ORLA 3SKCA 2W1IA 3PA3A 4I5PA 3LCKA 4RFMA 4QP7A 4GFGA 5CAPA 1PJKA 3DTCA 2WEIA 1P4OA 4IZ7A 4C3PA 4YR8A 3TZMA 5GIPE 2RKUA 3KU2A 2E9OA 2XK6A 3DLSA 4I5HA 3UC4A 3AD4A 3ZLWA 5K5XA 4IZ5A 4S32A 3ROYA 5FD2A 4HVIA 4FIGA 5ANKA 3KRLA 2O5KA 2XIYA 4QP8A 3WYXA 2G1TA 5H2UA 4JG7A 4ZZOA 1CM8A 3OMVA 3DKOA 2WTWA 3C4EA 3FMKA 3ZC6A 1OBDA 5AP1A 4AWIA 4HCVA 4CQEA 4GVJA 4YSMA 1H26A 3EFJA 3PPKA 2A0CX 1FVTA 1ZZ2A 3ENHA 4R7IA 4DGLC 3BX5A 2BR1A 1A06A 2REIA 3D5UA 3OC1A 1BI8A 3AT3A 2CKOA 4O7WA 2ZYBA 4J95A 3EIDA 3MTLA 4G34A 4RIXB 3NEWA 2QONA 3T9TA 3VS2A 4YO6A 4DC2A 4QMNA 4XCUA 3R7OA 4B6LA 2PE2A 3GU6A 4GFOA 1J1CA 3V6RA 1FINA 4WG3A 4OTGA 1FQ1B 5AM6A 4HZRA 2RIOA 4UMPA 4XG8A 3D7TB 4L8MA 1UU3A 4KA3A 4QP3A 5JZJA 3DNEA 4L3JA 2ITWA 4AT4A 5C26A 3UZTA 2WOTA 1UNHA 2OGVA 2WHBA 4OTFA 4UMRA 3DXPA 4BCOA 5FRIA 1Y8YA 2UZNA 3F2AA 2RGPA 2XJ2A 3HRCA 4IM3A 5AIKA 3UJGA 3PJ8A 4X3FA 4ACCA 1MQBA 4BBFA 4ZXTA 5JN2A 3NLBA 3WF5A 3EFLA 4EK4A 5GINE 4IWPA 4RC2A 2UZUE 5H3QA 5AX3A 4F99A 2CN5A 3KRJA 2HZNA 1H25A 3IONA 3QUDA 4UMQA 5T6KA 3U4WA 2B9FA 3EQBA 3EQGA 3V8TA 5JFXA 3JVRA 4P90A 4IQ6A 3RPVA 3LQ3A 3R73A 4RWIA 3MH3A 2GTNA 4K8AA 1R3CA 2OJJA 3NW7A 5AP5A 4RWJA 1KV2A 2VN9A 5LWNA 4IWQA 3W55A 1Q99A 3HV3A 3Q5IA 2JGZA 3PVUA 3QHRA 4RT7A 4GKIA 3ZO4A 4ZEGA 4DT8A 3LCOA 3F3WA 2ZB0A 4V05A 3ZMMA 3HNGA 3CPCA 4EBVA 2FVDA 2YCFA 3FSFA 3WF9A 4NEUA 4FSYA 4NU1A 5FM2A 2LGCA 4KKGA 4Y95A 4YNEA 5GJGA 2BTSA 3FLZA 4YJUA 2WZJA 3FZRA 1UU9A 2YJRA 4ZTRA 4WO5A 4D2WA 1Y8GA 1YVJA 2CKEA 1FGKA 3ULIA 3TZ7A 3HAVA 3PTGA 3BV3A 1LPUA 2IVTA 5M51A 3WIKA 4GU6A 1KOBA 2XK3A 5DHJA 4TPTA 5L2QA 5KO1A 4RJ6A 3AC3A 4W8EA 2ZM3A 4OTRA 4FTKA 3HA8A 4J8NA 3FDNA 5C01A 5DYJA 2Y0AA 4FOCA 2Y4PA 3PA4A 5IA3A 3MFTA 4MBLA 4QMWA 3JUHA 1CTPE 4TL0A 4FNZA 3FHIA 4EEVA 2C3JA 5BVOA 4AW1A 5H8BA 4AA4A 4CKRA 5LCJA 2OFUA 4D4SA 2I1MA 4OTDA 3WF6A 2OF4A 3LJ2A 3TNHA 4BHZA 2V22A 4AX8A 2IW9A 3U55A 2YIRA 3AMBA 2VTRA 3WI6A 2O0UA 2UVXA 2WIHA 4O0UA 4KINA 5HCXA 3OP5A 3R6XA 4FTOA 4EUTA 2Z7LA 1DS5A 5I9UA 4Y72A 4C3RA 1YOMA 4H05A 3HV5A 3VRYA 4XBUA 5HO8A 4XS2A 4DE4A 3NVKI 3F7ZA 4GEOA 4YMJA 3FV8A 3IGOA 4QP1A 2RF9A 3FYJX 3COIA 4UN0C 2JIVA 3C4FA 4AACA 1PMNA 2IVVA 3VS5A 3UP7A 2RG5A 4GUEA 5JT2A 2QO9A 4AN2A 4EZ5A 3MVLA 2EVAA 2IVSA 4QTBA 2BAQA 2J0KA 4ZTLA 4O81A 3HX4A 3FMEA 3IDCA 4YBJA 3UC3A 4FTRA 3SXSA 5LMAA 5ETCA 4EH3A 3ZZWA 3P86A 5BVKA 3V04A 2WMRA 2A2AA 3UO6A 4UMUA 5HNBA 5EM6A 5K0XA 1FPUA 1GAGA 1JKLA 3RHKA 4H1MA 4JIAA 4ACHA 3CKWA 5C1QB 3MVMA 2IZRA 3MPMA 3OTVA 4M0ZA 4KUJA 3HLLA 3JY9A 5IQAA 5M09A 4QP2A 5E8YA 4FIIA 3KRXA 4XYFA 1T45A 4NM5A 5AP3A 5CENA 1W83A 3RGFA 2XYUA 3GBZA 5M07A 1GZ8A 4CYIA 4EOLA 4QMTA 2BRHA 2RFNA 4RZWA 3F5GA 3OFMA 4PX6A 1K9AA 3GENA 5E90A 3GNIB 3VWAA 4MXOA 4C34A 5CEKA 1PRYA 4O7LA 4A4OA 2VTJA 3QUEA 4FA2A 5HZNA 5HVYA 4XV1A 3PPJA 2PE0A 2Q0NA 3OTUA 2XEYA 4DFNA 2C6DA 2YCRA 2HY0A 3NWWA 5ANDA 3NW6A 2VX0A 5CU3A 1UWJA 2YHVA 4L3PA 3DDPA 3CD3A 2VZ6A 4I1ZA 4P4CA 4UZHA 5CQUA 4CT1A 1UKIA 3OW3A 1M2PA 3A4OX 3CD8A 4MKCA 2OZAA 4BIEA 2W5HA 4NCTA 5AWMA 4CZUA 2WGJA 4D2VA 2QI8A 4HVDA 3MA3A 4CLIA 4YZDA 3CIKA 3UVPA 5J5TA 2F7EE 2X2LA 5HEZA 4EH4A 4FC0A 4JDIA 2YAAA 1JSUA 3WZDA 2VWBA 1JKSA 2JDVA 3UYTA 3VS7A 3F66A 3FQEA 4FKRA 2BFYA 3PXYA 1H27A 4U81A 4JLCA 5AP6A 5EW9A 3UVQA 4EOSA 5M4UA 3PXFA 2VTQA 2E9UA 4DEBA 4AGCA 3PZHA 4IFGA 5IQGA 2X1NA 4YC8A 1U5RA 2AC3A 3TACA 4EHZA 3NUYA 3O8UA 3R63A 5CZIA 5CSPA 4L7SA 3R9HA 5G1XA 2JKOA 4CKJA 3D83A 5HO6A 3PXZA 3GCVA 4FKWA 4XX9A 3ZDIA 4PDOA 4DFUA 4H58A 4IACA 3JY0A 4PL3A 1H1RA 5AUWA 5FEEA 2GHMA 3LLAA 4WOVA 3UG1A 4Q9SA 3P23A 2J7TA 1R0PA 2QG5A 5IZFA 3PG3A 3ACJA 2QR8A 2EXEA 5HVJA 2IZTA 2HXLA 3AGLA 2R2PA 4OBPA 5DRDA 4C0TA 4CFMA 2R3IA 4D2PA 4EI4A 5M57A 3TWJA 2YFXA 4YJTA 4JT3A 3I5NA 2CMWA 5EQYA 3R8ZA 4FYNA 5LVNA 1M2RA 3Q4ZA 2JLDA 1IA8A 2OH0E 3IS5A 5DR9A 5CLPA 3TT0A 5FP6A 4MXZA 3T9IA 2ZV7A 5DT3A 4FKQA 4LM5A 4RBLA 4FG7A 1IAJA 3FYKX 5FLFA 2UVYA 3Q6WA 1R78A 4V01A 2YEXA 3W2PA 4CFXA 2B9JA 2J0IA 4FT5A 4EOPA 3GT8A 5AV0A 1V0PA 3D2IA 3F3ZA 3POZA 2C3LA 2C6LA 3QL8A 4FV3A 1XH4A 1YXTA 3LZBA 4UALA 2ZV8A 4RIXA 3B2WA 3NUUA 4H1JA 4F9AA 4D1SA 4P7EA 5M08A 2IWIA 3A60A 4ZY4A 5FTOA 3R02A
chains in the Genus database with same CATH superfamily
5EH0A 4HNFA 5EYCA 4F7NA 4FTQA 4GH2A 4YTIA 3DZOA 2OSCA 3BE9A 4IADA 3UVRA 1VZOA 3I5ZA 5BMSA 4XRJA 4FV0A 3CQEA 4AZTA 4RJ5A 4XMOA 4CYJA 1PMEA 4Q2AA 4CV8A 3OY1A 4OW8A 4HNIA 4BFMA 4BYJA 4IIRA 3UDSA 5A9UA 3HAMA 3FMJA 2QU6A 4X7QA 4XHKB 2WMSA 1GJOA 3BHTA 5EDQA 3EN9A 4QMLA 2X4ZA 4KS8A 5D1JA 5M44A 3KREA 2HW7A 3CEKA 3R22A 4N6YA 4R3RA 3TKUA 3VAPA 3QZHA 3QTSA 4X2NA 1Q8TA 3DPKA 3BLAA 2DWBA 1QPCA 2WMBA 3DAEA 4H3QA 4FGBA 4NSTA 1ZYDA 4JAJA 4GV1A 1PXJA 2UW4A 4OTWA 3LFEA 5CAUA 2OKRA 4TY1A 2GNGA 2JDRA 3I7CA 2VO0A 4LFIA 2ZM1A 3VHEA 5A4CA 3PFQA 1CKJA 3FL4A 3KF4A 5D12A 4C4FA 4RJ8A 5JQ5A 2GHGA 3AC2A 3QTIA 4FUXA 4FIJA 4E6CA 5HI2A 3I79A 3G6GA 2XM9A 4FV5A 4Y5HA 3LPBA 3H3CA 5EM7A 3WILA 3FXXA 3ORNA 2X2MA 2JKQA 3QRJA 4EQUA 4EWQA 3O50A 3BIZA 3W0OA 4Z9LA 4RVLA 2W4JA 5BVDA 3OT8A 4MD8E 4FTTA 2UVZA 4WSYA 4QYFA 2X81A 5ETIA 3IW5A 2P33A 2WMQA 2PULA 2YISA 2J50A 2UV2A 4ALWA 4CNHA 4EBWA 4FEQA 3HV7A 3AD5A 3CJFA 4D58A 2GHLA 2B55A 3G15A 2XJ0A 3Q53A 3SAYA 4BZNA 4E5BA 2HW6A 4AG8A 2PSQA 4BDBA 4N57A 3RZBA 4O4EA 4EOIA 2W1FA 4BIBA 2OK1A 4U80A 2VX3A 4HPTE 1IA9A 5CAOA 5EQEA 2J0JA 2NRUA 3EB0A 3QC4A 4Y8DA 5CVGA 4I6QA 5HVKA 3UYSA 4LYNA 3I81A 3LVPA 4X21A 4F7SA 4Y46A 4AGWA 4LGGA 4TKSA 3DQXA 4G9RA 5ANGA 4FK3A 4MK0A 3MJ1A 4YU2A 1J7LA 2PU8A 3UOKA 3F2RA 4I6HA 4BCPA 3E62A 4CMOA 5F9EA 4B9DA 5FTGA 3PE1A 3RNYA 3ZSHA 4DAWA 4TNDA 4YPSA 3PY3A 4LRMA 4TTHB 4BKYA 3IOPA 2VO3A 3CR0A 3W33A 2QLUA 3QD0A 1E1XA 1OI9A 4TWCA 1M7QA 4JG8A 4LV7A 3GC0A 3KXZA 3MVJA 3VUKA 5IQCA 5HESA 4A07A 4ASEA 1PMVA 3HP5A 4PL5A 1CDKA 3FI8A 2JEDA 4O0YA 5J9YA 3UOJA 1NT2A 3MSSA 1ZYLA 4NK9A 4TYEA 3DFCB 3GOPA 3OXZA 4QMUA 1LR4A 4L42A 2R3FA 3NYNA 3GCPA 3MBLA 3RINA 3ZUTA 4D0WA 2FSLX 2RFSA 3GGFA 3QTUA 5ETAA 1CKPA 1PYEA 3F3UA 3V8WA 2UZLA 4O22A 2CKQA 4IZYA 3N51A 3POOA 3QHWA 2Y6MA 4MQ2A 5DH3A 3G9NA 5CXHA 4UEUA 2C6IA 5EYDA 5C9CA 4B8LA 3KK9A 5CANA 4O7ZA 2QOKA 3O2MA 2W99B 3NUSA 2R64A 4HCUA 2HIWA 2V7OA 4OTQA 4D9UA 4FNXA 5DMZA 2PMOX 4EHEA 3MFUA 2ZDTA 3NCGA 3ZC5A 2JDTA 4FV2A 3WE4A 4U44A 4BDJA 4QOXA 4X0MA 5BVNA 3HZTA 1OUYA 2OF2A 4DG3E 5FEQA 4OTHA 4R1YA 3PSDA 2IEWA 3NAXA 3BU3A 4O91A 2R3LA 2XNMA 5DFPA 4AFJA 3QWJA 3BYVA 3KRWA 3HV6A 4ACGA 4K11A 2BAJA 3FLWA 3SVVA 4FOBA 5C8KA 3NRMA 3OY3A 4ASZA 2OJFE 3DAJA 3R8MA 1ZYJA 3BRBA 2ONLC 1YWVA 3CP9A 4AXDA 4I92A 1VEBA 5KHXA 3SXRA 3KRRA 1WVXA 3OXTA 5DE2A 4D9TA 3NIZA 1YHWA 2PTKA 3VUMA 4IB1A 3VUHA 2QNJA 2VAGA 3IDPA 4AAYA 3A4PA 4NIFB 1URCA 3P5JC 1ZOEA 4G17A 2W1EA 1H24A 1G8SA 3QXOA 2OIQA 5I3OA 5JRQA 3ITZA 3E3PA 4QMQA 5DRBA 3K54A 3TXOA 4ZLYA 4PMPA 3C5IA 3ZM9A 1PXOA 3R8LA 4RX5A 4R77A 1URWA 3QRKA 3COMA 4FKLA 4DH7A 2WO6A 3OWKA 2PVLA 3DGKA 2V55A 2WB8A 4OR5A 2WIPA 1M14A 2HK5A 3MH1A 3OOGA 3LXNA 3ORTA 4J53A 4O2ZA 4R5YA 4DGOA 1REJA 4M84A 3CCNA 4CMUA 4IVAA 4M13A 3QRTA 4MH7A 4P5ZA 2QOOA 2W9ZB 2J5EA 3DCVA 4IJ9A 1XKKA 2XEZA 5LWMA 2GNJA 3EKNA 4UBAA 3ZTXA 3WF7A 1E1VA 2C69A 4PTEA 3R30A 1BKXA 3E93A 5HNIX 5M06A 5IUHA 4GIIA 1SZMA 3GFWA 4G3GA 3C0IA 3U9CA 2VO6A 4FKVA 4O7TA 4O27B 4C61A 4ZLZA 4YJPA 2EXMA 3N9XA 1JQHA 2GNIA 3FKLA 2P55A 3OROA 3ORIA 4GJ2A 3VW8A 3A7JA 4L7FA 4E1ZA 5L6OA 3KK8A 4D1XA 3VS3A 4LV5A 2UW7A 2QCSA 3LFCA 3QTZA 4QEBA 4I6FA 3FI3A 3HEGA 1YHVA 3GUBA 2R3NA 4I6LA 3OOMA 1GIIA 5L3AA 4HW7A 3CE3A 3F5UA 3MGYA 5JMSA 3EQHA 4U41A 3W2SA 4F9CA 4FYOA 4EOMA 5A4TA 4DDGA 1GOLA 2XBJA 4RC4A 4U7ZA 5DIAA 1O6YA 2PMLX 4FL1A 4M15A 4W4YA 3W8LA 2ZAZA 5TOZA 3NFGB 5CVHA 2CGUA 2OIDA 2ERZE 4DHZA 5AJQA 4CRSA 3SRVB 4C2VA 1L3RE 5HLWA 3AOXA 4JXFA 2IW8A 3DK6A 4QNAA 3VJOA 4CZTA 5JFSA 5KNJA 1KE5A 3W2QA 4EK3A 2XNBA 2VGOA 2X9FA 4P2KA 4U79A 3RBWA 3F5PA 3C5UA 5IQDA 4YJQA 3PZEA 4ZK5A 3R9NA 3R9OA 4OTIA 4DLIA 3EWHA 5IH5A 1Q41A 4JQ8A 4DCEA 5AP4A 1ZWSA 2EB2A 4U40A 5AV2A 4FTNA 4MBJA 5L2SA 4AE6A 4ZIMA 2OLCA 3OT3A 3V5PA 3VS0A 4C4EA 4YJNA 1JKKA 1R39A 2X8DA 3D9VA 4IM0A 3ZH8A 5IA2A 2AYPA 2A27A 2EXCX 2PL0A 4GK3A 3L8XA 3MN3A 2RG6A 4FV6A 2VTNA 3HMNA 4MTAA 4WT6A 3DBCA 5JSMA 5I9VA 5IQBA 2Z60A 3A62A 4ACMA 2P3GX 3ZHPC 4BBEA 3VUGA 3LKMA 3AD6A 4HCTA 4OT5A 2B9HA 4FZ6A 3TCPA 3U9NA 5CEOA 3UOHA 4IX5A 1SVGA 4IM2A 4BCQA 5CF4A 3RTPA 3F88A 2BIKB 3PYYA 3L9LA 3R2YA 2VTSA 3R04A 5LQFA 3R8PA 2GTMA 4E93A 2HCKA 2IN6A 2IW6A 3B8QA 2PK9A 3FLYA 4DH5A 4XG9A 5HOAA 4BL1A 5IKWA 4JMQA 2JIUA 3FY0A 3PG1A 2XNGA 2QOFA 3NUPA 3ROCA 5L8LA 3LFNA 3ANQA 2BILB 3NZ0A 4YC3A 4CFWA 1OBGA 2YZAA 4UWYA 3Q60A 4UXLA 1H1WA 4M67A 4M69A 2HWOA 5HCZA 2G2FA 1WFCA 4QP9A 4V04A 3KULB 4QTDA 3SOAA 3QCYA 3MY5A 2QG7A 4HJOA 5AIRA 4BCKA 1BX6A 2VTOA 3OCBA 5AP0A 4MXYA 5BVEA 2C5YA 3DJ6A 4XP2A 4C2WA 4FV7A 4F65A 3UQCA 4E6AA 1WVYA 2B0QA 2VTTA 3MH0A 3PLSA 2V7AA 4ENYA 5IMXA 3P79A 4JQ7A 1H07A 4ANOA 2GS2A 4ZMEA 5IF1A 2J0LA 4AOTA 3VVHA 3PRIA 4JR7A 4BCJA 4I4EA 2R9SA 5JEBA 5CU0A 2PYWA 4AXAA 4IAFA 4XNEA 1KUTA 4RFZA 5HE3A 4FGRA 4EH8A 4MXCA 1STCE 2ZB1A 3LOKA 3QD2B 3Q04A 5L6WL 1UVRA 3NGAA 2G9XA 3GP0A 4HPUE 4XBRA 2B1PA 1JVPP 4GCJA 4FV8A 3FMHA 1ZXEA 3PXQA 4Z3VA 2IG7A 3PSCA 4YBKA 3MB6A 5EI2A 3QXPA 4W9WA 3RKBA 4EKLA 3MYGA 3Q5ZA 3ZFXA 4YJSA 3KA0A 4ERKA 5M4IA 3RAHA 1S9IA 2PUIA 3QQLA 4D4YA 3BU6A 3NNVA 4IWOA 3R0TA 3R7EA 4F7JA 3RPYA 2F7XE 4ZMFA 1YDSE 4YZCA 2XM8A 4QQ5A 1XMLA 1XH9A 2QKRA 3DBQA 3F69A 4EC9A 4BIDA 2I7QA 1PXPA 2XRUA 4G9CA 4O4BB 1I09A 4D2SA 4QMYA 4QMVA 4XOYA 2W1HA 3QZFA 1BMKA 2I0EA 5J79A 5LVPA 2IPXA 4Q5HA 3OW4A 3D94A 5AR8A 3HDMA 3QQJA 4EHVA 3W10A 2BVAA 2DUVA 5CAVA 5EHLA 4FUYA 4JL9A 3AMAA 2VNWA 3Q9ZA 3VBQA 2FUMA 5TT7A 2VTAA 4ZY5A 5BUIA 1IAHA 1DM2A 1M17A 3F6XA 5EOBA 4I23A 4YHJA 4O1OA 3CBLA 2I0HA 1VR2A 4RIWB 3N4TA 4USEA 5JGBA 3WF8A 4FIHA 4Q5EA 3HECA 3Q32A 1ZY5A 3R28A 3L1SA 3C4WA 3BE2A 3P4KA 1W8CA 4FTUA 4JRNA 4PDSA 3CY2A 4CGAA 3AC1A 1FVVA 3FLNC 5HHWA 5I4NA 4QYHA 3W0MA 4K6ZA 4NT4A 3ATTA 4O84A 3DY7A 3LLTA 4G3DA 5JGDA 4DFZE 5KUPA 2PVRA 3NYOA 5AP2A 5E9EA 5CU4A 4KSPA 3LMIA 3FMDA 3NIEA 3MJ2A 5HTIA 1J3HA 2O63A 2WQMA 4PRJA 4MWHA 3G33A 4X6QC 3ZXTA 5J1VA 4BB4A 4BCHA 3SXFA 3U4UA 4D28A 1XBAA 3LXLA 4L3LA 5HLNA 3JXWA 2PUPA 2OJ9A 2WFYA 3RJCA 4CKIA 4FTCA 1G5SA 4IVCA 4OT6A 4WSQA 4AZVA 3U6JA 2FYSA 4FJVA 3FPQA 2BPMA 2Y4IC 3NNUA 4DEIA 5AAGA 4AXEA 3GI3A 3TG1A 4CCUA 1A48A 4ZS4A 3PDTA 2R3QA 4DCAA 2OJIA 3ZONA 4DITA 4FE2A 4E8AA 4EORA 2GCDA 3W2CA 4L67A 5E8XA 4AS0A 2F7ZE 3PXRA 4FL2A 3KXXA 1Q8UA 3KCFA 3DB6A 4GG7A 1ST0A 1JNKA 3ZLSA 4FEXA 5CVFA 1Q4LA 4TWPA 4NIFA 5D7VA 2A19B 3MS9A 2ETRA 3SOCA 4FEVA 3M42A 4XV2A 4F63A 3GC7A 4PMTA 2QOCA 4F1MA 4G1WA 1W0XC 3IW7A 3DKGA 3R9DA 2R7IA 5J8IA 1HCKA 3DBDA 3U87A 2JKKA 4MNFA 4BWKA 3R2BA 3OWJA 3PP1A 5C03A 2LAVA 3OBGA 3V01A 3VBWA 1CMKE 2VTHA 5B7VA 5A3XA 5D10A 2P2IA 3KXGA 5EW8A 4APPA 1OZ1A 4EQCA 2W1CA 1U4DA 4GUBA 3QCXA 4NFMA 4ARKA 4X2GA 5K3YA 3MV5A 2EUFB 4QTCA 4MXAA 4UYNA 3SV0A 4C33A 5L2WA 2BCJA 4O0SA 4RX7A 3FY2A 4RVMA 1Q8WA 3HL7A 2YM7A 1YWRA 1P2AA 1QPDA 2RSVA 3A8XA 3ENMA 4F09A 5DG5A 3IGGA 3QTWA 2XH5A 4CT2A 2YN8A 2YZLA 2OXDA 4O7VA 3ELJA 3NUAA 3CJGA 1IG1A 1XQZA 2X8IA 3GQLA 2C5NA 5J7BA 2PY3A 1YOLA 2BKZA 5F1ZA 3QGWA 1W2CA 1RQQA 3SG9A 5CT0A 5ITAA 4O7YA 4IX3A 5HTBA 1FGIA 3EN5A 3TIYA 3W0NA 4M97A 3VN9A 3E8NA 4NZWB 3GU8A 5CX9A 4WKQA 2YM4A 4J7BA 1OKWA 5AFVA 2YABA 3MTFA 3RAWA 3NFFB 4EWHA 5J9LA 3NCZA 2FB8A 5CF5A 4MX9A 2JC6A 4RA5A 4O83A 4Z7GA 1PY5A 5DN3A 3D4QA 4O0VA 4BZDA 5BNJA 3NNXA 4L46A 3FBVA 3ANRA 3QTRA 4E7WA 3RAKA 4C4HA 3REPA 2H8HA 1UA2A 4RIOA 5LCKA 3VF9A 4EH6A 4CV9A 2O64A 2H96A 2QVSE 1ZMVA 3A8WA 3SRVA 3QFVA 3SLSA 4DN5A 2RFEA 5EKNA 2BZKB 4KBAA 4GKHA 4LUEA 3TUBA 2XMYA 4FSRA 3W0RA 4RJ7A 1IASA 5DI1A 4CFUA 3WZEA 5L4QA 2O65A 4JR3A 5EKOA 5KKRC 1H0WA 3TEIA 2BHHA 5GNKA 3AC4A 2GS6A 4ZS0A 2WQEA 3CQWA 5B0XA 3VHKA 2OI4X 5LMBA 1SNXA 3C7QA 3GU7A 4O0RA 3SQQA 3HV4A 1Y57A 4QPMA 4CQGA 4G5JA 3QQHA 4L68A 4W8DA 2WD1A 4E4XA 2HWPA 2YJSA 4BRXA 2VTPA 3O96A 4EYJA 3AKLA 2JFLA 4GVAA 2CKPA 5AEPA 5JRSA 2IJMA 2FO0A 1PW2A 3D2KA 2PVNA 4RVTA 3DBEA 1YXXA 2V5QA 3FZ1A 4O2PA 5ANIA 4HVSA 4MYGA 4PP9A 4MWIA 3LXPA 1IRKA 3KVWA 4ANMA 5CF6A 3A7FA 4IAAA 2CGVA 4KWPA 4BYIA 3S95A 2XA4A 4O6LA 2XYNA 5L8JA 1OPJA 5IDPA 1YXVA 2WMXA 2C6MA 5HBHA 3AKJA 2VWWA 5FP5A 5HX6A 1XO2B 2FSMX 3O0GA 3PVWA 3QCSA 4U5JA 4V0GB 5CSHA 3V5LA 1FVRA 1PKGA 4ZSLA 1FOTA 1UNGA 3RMFA 2PZIA 3ZSIA 4J8MA 3Q6UA 3DXNA 3KULA 4FF8A 3D5VA 5CSVA 3BYSA 1Q8ZA 2W7XA 2R0IA 4CXAA 2CNVA 4E6DA 1YW2A 5EM8A 2PZRA 3FXZA 4X3FC 2BZIB 3GU5A 3E3BX 4FRFA 5T3QA 4A9YA 4ANLA 2XALA 1WBWA 3UMWA 3VBVA 3T3UA 5HG9A 4G16A 2J90A 4G6LA 4HGEA 2Z7QA 3COKA 5I9XA 2WELA 5AUYA 3GB2A 1NVRA 3EMGA 4I20A 5BVFA 3PP0A 5M56A 5CXZA 2YLFA 3R8UA 3HRFA 2C3IB 3RI1A 3RVGA 4AZFA 2O8YA 3G2FA 4HOKA 1E9HA 3RZFA 4M68A 3LFBA 5CEMA 2FGIA 2V0DA 4EOJA 3VONA 4AW2A 4XJ0A 4JOAA 3CY3A 1PHKA 3R01A 2J0MB 4L9IA 4TYJA 4GJ3A 3Q52A 3VS6A 3P5KA 3PA5A 4J52A 1OUKA 1WBTA 2ITTA 4FKUA 4O0TA 5FGKA 5FXSA 2B9IA 2GQGA 3EFWA 4FKPA 5D41A 4EKKA 5FDPA 3W0QA 3QGYA 3NVMB 4YPDA 4DFYA 4DLJA 2OFVA 2NP8A 4IDTA 4QRCA 4W4XA 4DTBA 4MVFA 2GNHA 4WBBB 3OD6X 2R4BA 3BI6A 1CKIA 2V62A 4PV0A 4FBXA 2AEGA 4HVGA 3EHAA 3TTJA 5JFWA 3E87A 3U54A 4X6RA 4XUFA 4DF3A 2C4GA 4E5AX 4CMTA 4KIOA 1K2PA 4KAOA 3DKFA 5A4LA 1XH7A 4JX7A 2X6EA 1OIUA 2QD9A 2GFCA 2HZIA 2X0GA 3QRIA 3MIAA 4I3ZA 5DNRA 3DKCA 4KIPA 4DGMA 2UZTA 1DAYA 2VWVA 3BLHA 4D5HA 3PWDA 3SGCA 3BEAA 4IAIA 4LL0A 4F08A 2YM5A 4C58A 2UW3A 4YHFA 3VIDA 3QTXA 1DAWA 4M7IA 4O38A 3BLRA 3LAUA 2CPKE 4PMMA 4PTCA 3ZRKA 4M0YA 3D7TA 2J4ZA 2ZDUA 5FXQA 4F9YA 2ZV2A 1UKHA 5DR2A 5E92A 1KE7A 5EDRA 4BCNA 1ATPE 2EB3A 4PY1A 2KTYA 2BDJA 4EUUA 3IECA 3M2WA 5C4LA 4BTKA 3UDBA 2W0JA 4ZTHA 3F3VA 3P9JA 3MFRA 4RJ4A 4ZTMA 4K77A 5DA3A 1UNLA 3L8SA 3ZXZA 1KWPA 3QLFA 4FT7A 4LL5A 2XK8A 2WU7A 3MB7A 3MW1A 4EK5A 5L6PA 4NH1A 3RAIA 2CCIA 1OM1A 2X6DA 3R00A 3W2OA 4BDFA 2WPAA 5J95A 3QWKA 3UNZA 1Z5MA 1JBPE 4ORKA 3R1NA 3QKKA 5KHWA 3BLQA 3AGMA 3FMLA 4BCIA 4UMTA 5KMJA 3PUFC 2H6DA 5TO8A 5CSXA 4DTAA 1YQJA 2XS0A 2F2CB 3F3TA 2PZ5A 2HXQA 2Z2WA 3W18A 2WMVA 4ANQA 3NDMA 4EJNA 2XNNA 4C4GA 3P1AA 5IDNA 3OXIA 2G15A 2Y9QA 1YDTE 3BGQA 2CLXA 1JLUE 2XZSA 3S4QA 1T46A 4QP6A 3P7BA 4O0XA 5FQDC 5LMKA 2XK9A 2VWIA 3LW0A 1YKRA 4ERWA 5HG7A 4XEYA 3UBDA 3T3VA 1VYZA 4DHJA 4RMZA 2YLEA 4BZOA 2UW9A 3E5AA 4BCFA 1OB3A 4YTFA 4JBQA 3D5WA 1H0VA 5CI6A 4E3CA 3P7AA 4A06A 2NO3A 3RCDA 2CNUA 1NXKA 2IZUA 4YC6A 4F7LA 4ZTQA 4ENXA 1YWNA 3II5A 5FG8A 3VO3A 4PUZA 2YITA 3I6WA 5KE0A 3TL8A 4JIKA 5EI8A 3U6IA 1SM2A 3BGZA 1M52A 4H36A 4S30A 2QO7A 2X2KA 3EN7A 5IH4A 5E8VA 2QKWB 3VC4A 2ITUA 2J2IB 4DH8A 4YLJA 3UO5A 3NMUF 4H3PA 2BIYA 1SVEA 1WBSA 3FKOA 3FMNA 4TYHB 5DOSA 5TE0A 1M2QA 2ITOA 3WZJA 4ACDA 3BELA 4EJ7A 4U45A 1JAMA 5F20A 3EQDA 4X2JA 4FG8A 3FLQA 4OAVB 3LM5A 4M12A 1U59A 1Q97A 2ZM4A 5EHOA 3GXLA 5IH6A 4EHGA 2XUUA 1ZARA 2X9EA 3TUCA 5AAFA 4NCTC 4Y85A 4Y83A 4ZZMA 4APCA 4DA5A 3QA8A 4YNOA 4S33A 4AT5A 4QQCA 2BTRA 4TRLA 1REKA 4XH6A 2JDSA 4XLVA 3RNIA 3KXMA 3GU4A 3Q2MA 3EN6A 3Q4CA 4IDVA 2BDWA 4LRKA 5KMLA 3VUTA 4F1OA 2WMAA 1YI3A 4LUDA 4CEGA 2UZBA 4QPAA 3KEXA 3AQVA 1GZOA 2W1DA 4ZLOA 1L8TA 2QLQA 3FZTA 2WNTA 3Q9WA 1YI6A 5LARA 2X4FA 4FVRA 2A4LA 5BQ0A 3OUKA 1YXUA 4FTMA 5LOHA 2WTKC 3LMHA 2F49A 4W4VA 2A98A 4NFNA 5FWKK 5A46A 1JOWB 1QCFA 4I6BA 3G90X 4XV3A 2PE1A 2QQ7A 4ZY6A 3JVSA 3PFYA 4NM7A 4C4IA 4JS8A 3A61A 1B39A 2XF0A 3G0FA 3NYVA 5DWRA 5AAEA 1OGYA 4O21A 4MHAA 3E8DA 1PMUA 4AGDA 3OS3A 4FV4A 1BL6A 3TI1A 4C8BA 3G0EA 3GFEA 3KMWA 3SDJA 4QD6A 3RK9A 3DK7A 3UP2A 1XBBA 4ZJJA 4BI2A 4F64A 4Z7HA 4EH5A 1OPLA 5JFVA 5CASA 5K5NA 3ZFMA 1MQ4A 1M7NA 5HBJA 1KV1A 4ID7A 3ZO3A 3C0GA 3QZGA 4AT3A 2PUNA 3HUCA 2R3PA 4YSJA 2Y6OA 2IO6A 4GL9A 3RM6A 2OW3A 2YDKA 3AG9A 3K2LA 4IHPA 4C37A 4F1TA 4O7RA 3DB8A 3KVXA 1ZYSA 4H3BA 4TW9A 4X2KA 5HNGA 3VBXA 3ZRMA 4DG2E 4GK2A 4U6RA 1XBCA 5A14A 4V0GA 2FSOX 3JS2A 4OLIA 4RWLA 5ETFA 5EW3A 2C0TA 3EL8A 5ICPA 5J9ZA 3W32A 2WU6A 4MBIA 4U97A 3TZ8A 3ZBFA 1YHSA 4KIQA 5J7HA 3RPSA 3QQUA 5L2IA 2BRMA 4RX8A 5IA1A 3QQFA 3UMXA 5A6NA 5KMNA 1FMKA 3NNWA 3A7GA 4JDJA 3U8WA 3NYXA 1RJBA 3C0HA 4PDPA 1H1SA 5KMOA 5HLPA 2YDIA 3UQFA 3ORPA 3P78A 3UNJA 4QDEA 2YWPA 3FI2A 3EYGA 3IOKA 3FZOA 2ERKA 2OU7A 3VQUA 4LGDA 3C4ZA 4O7SA 2VTIA 2JITA 2PZYA 3HMIA 4FT9A 4RG0A 3UZRA 1TZDA 2W17A 2PVMA 2QOHA 4PPBA 4YLKA 5I9WA 3OBJA 5FUTA 4L00A 3LFQA 4WNMA 4KRDA 4MNEB 5AR7A 1YRPA 2PUUA 3IW4A 3KC3A 4EK8A 3Q96A 4ZSJA 2Z7RA 4IX6A 3LFAA 4D4VA 4QMXA 4F6SA 3PJ3A 4AXCA 1OECA 5EG3A 4DEEA 3TNPC 2VD5A 1NW1A 3NPCA 3FQSA 3O71A 3TM0A 3GC9A 5AA8A 4ZAUA 3EKKA 4IAKA 2JAVA 4BGGA 4OUCA 2QOLA 4ONAA 1WBNA 1GNGA 5A54A 3PXKA 2ITYA 4FZ7A 2YIWA 2W1ZA 1AGWA 1VYWA 4NWMA 2XARA 4IMYA 1B38A 4BDHA 4G2FA 5CSWA 1QPJA 4IB3A 3ACKA 3VBYA 1LEZA 5IA0A 3ATSA 4PNIA 4R78A 2UW0A 4AA0A 3O51A 2H34A 3VJNA 3QKLA 4NM3A 2R3OA 4BBMA 2CGWA 2WMTA 2WKMA 2QODA 1NA7A 2GSFA 4NTSA 1ZOGA 5IQEA 3FAAA 4A7CA 3QX4A 2WTJA 5CT7A 4WRSA 4FR4A 4AZSA 3FUPA 2OG8A 2YIQA 4GSBA 5C8MA 1UWHA 2C1AA 2C6KA 4R5SA 4NW5A 4ANNA 3HMPA 4GT4A 5ACBC 3KGAA 2UUEA 2Z02A 3SD0A 1AD5A 4Y5QA 1VLRA 2X0PA 4YZBA 4FKGA 5K9IA 3DOGA 2ITXA 2CNQA 3FI4A 5TF9A 5DR6A 3WZKA 2B7AA 1J1BA 3PY0A 3LE6A 5BMMA 4BTFA 4WNOA 4C36A 3MI9A 4P5QA 4BICA 2YIXA 3KF7A 4FSWA 3BHYA 2OIBA 4LI5A 2W4OA 1O9UA 1K3AA 1PXKA 4XOZA 3QLGA 3CLYA 4I22A 5E8TA 4ITIA 2I40A 2PHKA 3F61A 1DI8A 3ZDUA 5B2LA 3O17A 3OHTA 5E91A 1QL6A 4YJOA 3SG8A 3DBFA 3FMMA 3EQCA 1R0EA 3ZEWA 4EZ3A 1YDRE 3C4XA 4NJ3A 3UIBA 4UV0A 4BKJA 4EOOA 2J6MA 3UPXA 1OMWA 3UO4A 2R3JA 3ZM4A 4I21A 3CTHA 3HDNA 3LQ5A 5BPYA 2WXVA 5IEVA 4DT9A 1F0QA 1JPAA 3H9FA 3R21A 1OPKA 5E8SA 1H00A 1NVQA 4AFEA 2E9NA 3P08A 2RL5A 3CXWA 1H1QA 2OICA 4JRVA 3VS1A 2YDJA 3EZRA 5CZHA 3ZO2A 4R3PA 1ZYCA 4PL4A 2H9VA 5AV1A 4BI0A 3D5XA 2XJ1A 3MY1A 2PMNX 4ZSAA 1OL2A 4E5WA 2GFSA 3A7HA 3D14A 3PIYA 4U0IA 2VWZA 4F6UA 2ZMCA 3KN5A 5KMMA 4N0SA 3IPHA 1X8BA 5EI6A 1W82A 3G6HA 3TTIA 2IVUA 3ORKA 2PVYA 3PSBA 5DEYA 4EZ7A 2I0VA 5JZNA 2HENA 4C4JA 4C7TA 1HOWA 2XAOA 4X2FA 1RW8A 4GK4A 3THBA 3S0OA 4MCVA 3UQGA 1H4LA 5FEDA 3W2RA 2BZHB 2UZEA 3QZIA 3R1YA 4F0FA 3W0PA 3RM7A 5IQHA 3Q4TA 4FKJA 4ZSEA 3VRZA 1U54B 4WUNA 4ASXA 3CQUA 4XLIA 3QKMA 1KE8A 5K4IA 2BFXA 2FSTX 4QPSA 5F4NA 5FM3A